data_1DGH
# 
_entry.id   1DGH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DGH         
RCSB  RCSB010065   
WWPDB D_1000010065 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1DGB . unspecified 
PDB 1DGF . unspecified 
PDB 1DGG . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DGH 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Putnam, C.D.' 1 
'Arvai, A.S.'  2 
'Bourne, Y.'   3 
'Tainer, J.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            296 
_citation.page_first                295 
_citation.page_last                 309 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10656833 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1999.3458 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Putnam, C.D.' 1 
primary 'Arvai, A.S.'  2 
primary 'Bourne, Y.'   3 
primary 'Tainer, J.A.' 4 
# 
_cell.entry_id           1DGH 
_cell.length_a           84.028 
_cell.length_b           140.639 
_cell.length_c           231.346 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DGH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROTEIN (CATALASE)'                                        56713.438 2    1.11.1.6 ? ? ? 
2 polymer     nat 'PROTEIN (CATALASE)'                                        56794.492 2    1.11.1.6 ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                           616.487   4    ?        ? ? ? 
4 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421   2    ?        ? ? ? 
5 water       nat water                                                       18.015    1469 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
;
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
;
A,C ? 
2 'polypeptide(L)' no yes 
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVV(3AH)AKGA
GAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPI
LFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTD
QGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLN
RNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQG
GAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAV
KNFTEVHPDYGSHIQALLDKYN
;
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   ASP n 
1 4   PRO n 
1 5   ALA n 
1 6   SER n 
1 7   ASP n 
1 8   GLN n 
1 9   MET n 
1 10  GLN n 
1 11  HIS n 
1 12  TRP n 
1 13  LYS n 
1 14  GLU n 
1 15  GLN n 
1 16  ARG n 
1 17  ALA n 
1 18  ALA n 
1 19  GLN n 
1 20  LYS n 
1 21  ALA n 
1 22  ASP n 
1 23  VAL n 
1 24  LEU n 
1 25  THR n 
1 26  THR n 
1 27  GLY n 
1 28  ALA n 
1 29  GLY n 
1 30  ASN n 
1 31  PRO n 
1 32  VAL n 
1 33  GLY n 
1 34  ASP n 
1 35  LYS n 
1 36  LEU n 
1 37  ASN n 
1 38  VAL n 
1 39  ILE n 
1 40  THR n 
1 41  VAL n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  GLY n 
1 46  PRO n 
1 47  LEU n 
1 48  LEU n 
1 49  VAL n 
1 50  GLN n 
1 51  ASP n 
1 52  VAL n 
1 53  VAL n 
1 54  PHE n 
1 55  THR n 
1 56  ASP n 
1 57  GLU n 
1 58  MET n 
1 59  ALA n 
1 60  HIS n 
1 61  PHE n 
1 62  ASP n 
1 63  ARG n 
1 64  GLU n 
1 65  ARG n 
1 66  ILE n 
1 67  PRO n 
1 68  GLU n 
1 69  ARG n 
1 70  VAL n 
1 71  VAL n 
1 72  HIS n 
1 73  ALA n 
1 74  LYS n 
1 75  GLY n 
1 76  ALA n 
1 77  GLY n 
1 78  ALA n 
1 79  PHE n 
1 80  GLY n 
1 81  TYR n 
1 82  PHE n 
1 83  GLU n 
1 84  VAL n 
1 85  THR n 
1 86  HIS n 
1 87  ASP n 
1 88  ILE n 
1 89  THR n 
1 90  LYS n 
1 91  TYR n 
1 92  SER n 
1 93  LYS n 
1 94  ALA n 
1 95  LYS n 
1 96  VAL n 
1 97  PHE n 
1 98  GLU n 
1 99  HIS n 
1 100 ILE n 
1 101 GLY n 
1 102 LYS n 
1 103 LYS n 
1 104 THR n 
1 105 PRO n 
1 106 ILE n 
1 107 ALA n 
1 108 VAL n 
1 109 ARG n 
1 110 PHE n 
1 111 SER n 
1 112 THR n 
1 113 VAL n 
1 114 ALA n 
1 115 GLY n 
1 116 GLU n 
1 117 SER n 
1 118 GLY n 
1 119 SER n 
1 120 ALA n 
1 121 ASP n 
1 122 THR n 
1 123 VAL n 
1 124 ARG n 
1 125 ASP n 
1 126 PRO n 
1 127 ARG n 
1 128 GLY n 
1 129 PHE n 
1 130 ALA n 
1 131 VAL n 
1 132 LYS n 
1 133 PHE n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 ASP n 
1 138 GLY n 
1 139 ASN n 
1 140 TRP n 
1 141 ASP n 
1 142 LEU n 
1 143 VAL n 
1 144 GLY n 
1 145 ASN n 
1 146 ASN n 
1 147 THR n 
1 148 PRO n 
1 149 ILE n 
1 150 PHE n 
1 151 PHE n 
1 152 ILE n 
1 153 ARG n 
1 154 ASP n 
1 155 PRO n 
1 156 ILE n 
1 157 LEU n 
1 158 PHE n 
1 159 PRO n 
1 160 SER n 
1 161 PHE n 
1 162 ILE n 
1 163 HIS n 
1 164 SER n 
1 165 GLN n 
1 166 LYS n 
1 167 ARG n 
1 168 ASN n 
1 169 PRO n 
1 170 GLN n 
1 171 THR n 
1 172 HIS n 
1 173 LEU n 
1 174 LYS n 
1 175 ASP n 
1 176 PRO n 
1 177 ASP n 
1 178 MET n 
1 179 VAL n 
1 180 TRP n 
1 181 ASP n 
1 182 PHE n 
1 183 TRP n 
1 184 SER n 
1 185 LEU n 
1 186 ARG n 
1 187 PRO n 
1 188 GLU n 
1 189 SER n 
1 190 LEU n 
1 191 HIS n 
1 192 GLN n 
1 193 VAL n 
1 194 SER n 
1 195 PHE n 
1 196 LEU n 
1 197 PHE n 
1 198 SER n 
1 199 ASP n 
1 200 ARG n 
1 201 GLY n 
1 202 ILE n 
1 203 PRO n 
1 204 ASP n 
1 205 GLY n 
1 206 HIS n 
1 207 ARG n 
1 208 HIS n 
1 209 MET n 
1 210 ASN n 
1 211 GLY n 
1 212 TYR n 
1 213 GLY n 
1 214 SER n 
1 215 HIS n 
1 216 THR n 
1 217 PHE n 
1 218 LYS n 
1 219 LEU n 
1 220 VAL n 
1 221 ASN n 
1 222 ALA n 
1 223 ASN n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 VAL n 
1 228 TYR n 
1 229 CYS n 
1 230 LYS n 
1 231 PHE n 
1 232 HIS n 
1 233 TYR n 
1 234 LYS n 
1 235 THR n 
1 236 ASP n 
1 237 GLN n 
1 238 GLY n 
1 239 ILE n 
1 240 LYS n 
1 241 ASN n 
1 242 LEU n 
1 243 SER n 
1 244 VAL n 
1 245 GLU n 
1 246 ASP n 
1 247 ALA n 
1 248 ALA n 
1 249 ARG n 
1 250 LEU n 
1 251 SER n 
1 252 GLN n 
1 253 GLU n 
1 254 ASP n 
1 255 PRO n 
1 256 ASP n 
1 257 TYR n 
1 258 GLY n 
1 259 ILE n 
1 260 ARG n 
1 261 ASP n 
1 262 LEU n 
1 263 PHE n 
1 264 ASN n 
1 265 ALA n 
1 266 ILE n 
1 267 ALA n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 TYR n 
1 272 PRO n 
1 273 SER n 
1 274 TRP n 
1 275 THR n 
1 276 PHE n 
1 277 TYR n 
1 278 ILE n 
1 279 GLN n 
1 280 VAL n 
1 281 MET n 
1 282 THR n 
1 283 PHE n 
1 284 ASN n 
1 285 GLN n 
1 286 ALA n 
1 287 GLU n 
1 288 THR n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ASN n 
1 293 PRO n 
1 294 PHE n 
1 295 ASP n 
1 296 LEU n 
1 297 THR n 
1 298 LYS n 
1 299 VAL n 
1 300 TRP n 
1 301 PRO n 
1 302 HIS n 
1 303 LYS n 
1 304 ASP n 
1 305 TYR n 
1 306 PRO n 
1 307 LEU n 
1 308 ILE n 
1 309 PRO n 
1 310 VAL n 
1 311 GLY n 
1 312 LYS n 
1 313 LEU n 
1 314 VAL n 
1 315 LEU n 
1 316 ASN n 
1 317 ARG n 
1 318 ASN n 
1 319 PRO n 
1 320 VAL n 
1 321 ASN n 
1 322 TYR n 
1 323 PHE n 
1 324 ALA n 
1 325 GLU n 
1 326 VAL n 
1 327 GLU n 
1 328 GLN n 
1 329 ILE n 
1 330 ALA n 
1 331 PHE n 
1 332 ASP n 
1 333 PRO n 
1 334 SER n 
1 335 ASN n 
1 336 MET n 
1 337 PRO n 
1 338 PRO n 
1 339 GLY n 
1 340 ILE n 
1 341 GLU n 
1 342 ALA n 
1 343 SER n 
1 344 PRO n 
1 345 ASP n 
1 346 LYS n 
1 347 MET n 
1 348 LEU n 
1 349 GLN n 
1 350 GLY n 
1 351 ARG n 
1 352 LEU n 
1 353 PHE n 
1 354 ALA n 
1 355 TYR n 
1 356 PRO n 
1 357 ASP n 
1 358 THR n 
1 359 HIS n 
1 360 ARG n 
1 361 HIS n 
1 362 ARG n 
1 363 LEU n 
1 364 GLY n 
1 365 PRO n 
1 366 ASN n 
1 367 TYR n 
1 368 LEU n 
1 369 HIS n 
1 370 ILE n 
1 371 PRO n 
1 372 VAL n 
1 373 ASN n 
1 374 CYS n 
1 375 PRO n 
1 376 TYR n 
1 377 ARG n 
1 378 ALA n 
1 379 ARG n 
1 380 VAL n 
1 381 ALA n 
1 382 ASN n 
1 383 TYR n 
1 384 GLN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 PRO n 
1 389 MET n 
1 390 CYS n 
1 391 MET n 
1 392 GLN n 
1 393 ASP n 
1 394 ASN n 
1 395 GLN n 
1 396 GLY n 
1 397 GLY n 
1 398 ALA n 
1 399 PRO n 
1 400 ASN n 
1 401 TYR n 
1 402 TYR n 
1 403 PRO n 
1 404 ASN n 
1 405 SER n 
1 406 PHE n 
1 407 GLY n 
1 408 ALA n 
1 409 PRO n 
1 410 GLU n 
1 411 GLN n 
1 412 GLN n 
1 413 PRO n 
1 414 SER n 
1 415 ALA n 
1 416 LEU n 
1 417 GLU n 
1 418 HIS n 
1 419 SER n 
1 420 ILE n 
1 421 GLN n 
1 422 TYR n 
1 423 SER n 
1 424 GLY n 
1 425 GLU n 
1 426 VAL n 
1 427 ARG n 
1 428 ARG n 
1 429 PHE n 
1 430 ASN n 
1 431 THR n 
1 432 ALA n 
1 433 ASN n 
1 434 ASP n 
1 435 ASP n 
1 436 ASN n 
1 437 VAL n 
1 438 THR n 
1 439 GLN n 
1 440 VAL n 
1 441 ARG n 
1 442 ALA n 
1 443 PHE n 
1 444 TYR n 
1 445 VAL n 
1 446 ASN n 
1 447 VAL n 
1 448 LEU n 
1 449 ASN n 
1 450 GLU n 
1 451 GLU n 
1 452 GLN n 
1 453 ARG n 
1 454 LYS n 
1 455 ARG n 
1 456 LEU n 
1 457 CYS n 
1 458 GLU n 
1 459 ASN n 
1 460 ILE n 
1 461 ALA n 
1 462 GLY n 
1 463 HIS n 
1 464 LEU n 
1 465 LYS n 
1 466 ASP n 
1 467 ALA n 
1 468 GLN n 
1 469 ILE n 
1 470 PHE n 
1 471 ILE n 
1 472 GLN n 
1 473 LYS n 
1 474 LYS n 
1 475 ALA n 
1 476 VAL n 
1 477 LYS n 
1 478 ASN n 
1 479 PHE n 
1 480 THR n 
1 481 GLU n 
1 482 VAL n 
1 483 HIS n 
1 484 PRO n 
1 485 ASP n 
1 486 TYR n 
1 487 GLY n 
1 488 SER n 
1 489 HIS n 
1 490 ILE n 
1 491 GLN n 
1 492 ALA n 
1 493 LEU n 
1 494 LEU n 
1 495 ASP n 
1 496 LYS n 
1 497 TYR n 
1 498 ASN n 
2 1   SER n 
2 2   ARG n 
2 3   ASP n 
2 4   PRO n 
2 5   ALA n 
2 6   SER n 
2 7   ASP n 
2 8   GLN n 
2 9   MET n 
2 10  GLN n 
2 11  HIS n 
2 12  TRP n 
2 13  LYS n 
2 14  GLU n 
2 15  GLN n 
2 16  ARG n 
2 17  ALA n 
2 18  ALA n 
2 19  GLN n 
2 20  LYS n 
2 21  ALA n 
2 22  ASP n 
2 23  VAL n 
2 24  LEU n 
2 25  THR n 
2 26  THR n 
2 27  GLY n 
2 28  ALA n 
2 29  GLY n 
2 30  ASN n 
2 31  PRO n 
2 32  VAL n 
2 33  GLY n 
2 34  ASP n 
2 35  LYS n 
2 36  LEU n 
2 37  ASN n 
2 38  VAL n 
2 39  ILE n 
2 40  THR n 
2 41  VAL n 
2 42  GLY n 
2 43  PRO n 
2 44  ARG n 
2 45  GLY n 
2 46  PRO n 
2 47  LEU n 
2 48  LEU n 
2 49  VAL n 
2 50  GLN n 
2 51  ASP n 
2 52  VAL n 
2 53  VAL n 
2 54  PHE n 
2 55  THR n 
2 56  ASP n 
2 57  GLU n 
2 58  MET n 
2 59  ALA n 
2 60  HIS n 
2 61  PHE n 
2 62  ASP n 
2 63  ARG n 
2 64  GLU n 
2 65  ARG n 
2 66  ILE n 
2 67  PRO n 
2 68  GLU n 
2 69  ARG n 
2 70  VAL n 
2 71  VAL n 
2 72  3AH n 
2 73  ALA n 
2 74  LYS n 
2 75  GLY n 
2 76  ALA n 
2 77  GLY n 
2 78  ALA n 
2 79  PHE n 
2 80  GLY n 
2 81  TYR n 
2 82  PHE n 
2 83  GLU n 
2 84  VAL n 
2 85  THR n 
2 86  HIS n 
2 87  ASP n 
2 88  ILE n 
2 89  THR n 
2 90  LYS n 
2 91  TYR n 
2 92  SER n 
2 93  LYS n 
2 94  ALA n 
2 95  LYS n 
2 96  VAL n 
2 97  PHE n 
2 98  GLU n 
2 99  HIS n 
2 100 ILE n 
2 101 GLY n 
2 102 LYS n 
2 103 LYS n 
2 104 THR n 
2 105 PRO n 
2 106 ILE n 
2 107 ALA n 
2 108 VAL n 
2 109 ARG n 
2 110 PHE n 
2 111 SER n 
2 112 THR n 
2 113 VAL n 
2 114 ALA n 
2 115 GLY n 
2 116 GLU n 
2 117 SER n 
2 118 GLY n 
2 119 SER n 
2 120 ALA n 
2 121 ASP n 
2 122 THR n 
2 123 VAL n 
2 124 ARG n 
2 125 ASP n 
2 126 PRO n 
2 127 ARG n 
2 128 GLY n 
2 129 PHE n 
2 130 ALA n 
2 131 VAL n 
2 132 LYS n 
2 133 PHE n 
2 134 TYR n 
2 135 THR n 
2 136 GLU n 
2 137 ASP n 
2 138 GLY n 
2 139 ASN n 
2 140 TRP n 
2 141 ASP n 
2 142 LEU n 
2 143 VAL n 
2 144 GLY n 
2 145 ASN n 
2 146 ASN n 
2 147 THR n 
2 148 PRO n 
2 149 ILE n 
2 150 PHE n 
2 151 PHE n 
2 152 ILE n 
2 153 ARG n 
2 154 ASP n 
2 155 PRO n 
2 156 ILE n 
2 157 LEU n 
2 158 PHE n 
2 159 PRO n 
2 160 SER n 
2 161 PHE n 
2 162 ILE n 
2 163 HIS n 
2 164 SER n 
2 165 GLN n 
2 166 LYS n 
2 167 ARG n 
2 168 ASN n 
2 169 PRO n 
2 170 GLN n 
2 171 THR n 
2 172 HIS n 
2 173 LEU n 
2 174 LYS n 
2 175 ASP n 
2 176 PRO n 
2 177 ASP n 
2 178 MET n 
2 179 VAL n 
2 180 TRP n 
2 181 ASP n 
2 182 PHE n 
2 183 TRP n 
2 184 SER n 
2 185 LEU n 
2 186 ARG n 
2 187 PRO n 
2 188 GLU n 
2 189 SER n 
2 190 LEU n 
2 191 HIS n 
2 192 GLN n 
2 193 VAL n 
2 194 SER n 
2 195 PHE n 
2 196 LEU n 
2 197 PHE n 
2 198 SER n 
2 199 ASP n 
2 200 ARG n 
2 201 GLY n 
2 202 ILE n 
2 203 PRO n 
2 204 ASP n 
2 205 GLY n 
2 206 HIS n 
2 207 ARG n 
2 208 HIS n 
2 209 MET n 
2 210 ASN n 
2 211 GLY n 
2 212 TYR n 
2 213 GLY n 
2 214 SER n 
2 215 HIS n 
2 216 THR n 
2 217 PHE n 
2 218 LYS n 
2 219 LEU n 
2 220 VAL n 
2 221 ASN n 
2 222 ALA n 
2 223 ASN n 
2 224 GLY n 
2 225 GLU n 
2 226 ALA n 
2 227 VAL n 
2 228 TYR n 
2 229 CYS n 
2 230 LYS n 
2 231 PHE n 
2 232 HIS n 
2 233 TYR n 
2 234 LYS n 
2 235 THR n 
2 236 ASP n 
2 237 GLN n 
2 238 GLY n 
2 239 ILE n 
2 240 LYS n 
2 241 ASN n 
2 242 LEU n 
2 243 SER n 
2 244 VAL n 
2 245 GLU n 
2 246 ASP n 
2 247 ALA n 
2 248 ALA n 
2 249 ARG n 
2 250 LEU n 
2 251 SER n 
2 252 GLN n 
2 253 GLU n 
2 254 ASP n 
2 255 PRO n 
2 256 ASP n 
2 257 TYR n 
2 258 GLY n 
2 259 ILE n 
2 260 ARG n 
2 261 ASP n 
2 262 LEU n 
2 263 PHE n 
2 264 ASN n 
2 265 ALA n 
2 266 ILE n 
2 267 ALA n 
2 268 THR n 
2 269 GLY n 
2 270 LYS n 
2 271 TYR n 
2 272 PRO n 
2 273 SER n 
2 274 TRP n 
2 275 THR n 
2 276 PHE n 
2 277 TYR n 
2 278 ILE n 
2 279 GLN n 
2 280 VAL n 
2 281 MET n 
2 282 THR n 
2 283 PHE n 
2 284 ASN n 
2 285 GLN n 
2 286 ALA n 
2 287 GLU n 
2 288 THR n 
2 289 PHE n 
2 290 PRO n 
2 291 PHE n 
2 292 ASN n 
2 293 PRO n 
2 294 PHE n 
2 295 ASP n 
2 296 LEU n 
2 297 THR n 
2 298 LYS n 
2 299 VAL n 
2 300 TRP n 
2 301 PRO n 
2 302 HIS n 
2 303 LYS n 
2 304 ASP n 
2 305 TYR n 
2 306 PRO n 
2 307 LEU n 
2 308 ILE n 
2 309 PRO n 
2 310 VAL n 
2 311 GLY n 
2 312 LYS n 
2 313 LEU n 
2 314 VAL n 
2 315 LEU n 
2 316 ASN n 
2 317 ARG n 
2 318 ASN n 
2 319 PRO n 
2 320 VAL n 
2 321 ASN n 
2 322 TYR n 
2 323 PHE n 
2 324 ALA n 
2 325 GLU n 
2 326 VAL n 
2 327 GLU n 
2 328 GLN n 
2 329 ILE n 
2 330 ALA n 
2 331 PHE n 
2 332 ASP n 
2 333 PRO n 
2 334 SER n 
2 335 ASN n 
2 336 MET n 
2 337 PRO n 
2 338 PRO n 
2 339 GLY n 
2 340 ILE n 
2 341 GLU n 
2 342 ALA n 
2 343 SER n 
2 344 PRO n 
2 345 ASP n 
2 346 LYS n 
2 347 MET n 
2 348 LEU n 
2 349 GLN n 
2 350 GLY n 
2 351 ARG n 
2 352 LEU n 
2 353 PHE n 
2 354 ALA n 
2 355 TYR n 
2 356 PRO n 
2 357 ASP n 
2 358 THR n 
2 359 HIS n 
2 360 ARG n 
2 361 HIS n 
2 362 ARG n 
2 363 LEU n 
2 364 GLY n 
2 365 PRO n 
2 366 ASN n 
2 367 TYR n 
2 368 LEU n 
2 369 HIS n 
2 370 ILE n 
2 371 PRO n 
2 372 VAL n 
2 373 ASN n 
2 374 CYS n 
2 375 PRO n 
2 376 TYR n 
2 377 ARG n 
2 378 ALA n 
2 379 ARG n 
2 380 VAL n 
2 381 ALA n 
2 382 ASN n 
2 383 TYR n 
2 384 GLN n 
2 385 ARG n 
2 386 ASP n 
2 387 GLY n 
2 388 PRO n 
2 389 MET n 
2 390 CYS n 
2 391 MET n 
2 392 GLN n 
2 393 ASP n 
2 394 ASN n 
2 395 GLN n 
2 396 GLY n 
2 397 GLY n 
2 398 ALA n 
2 399 PRO n 
2 400 ASN n 
2 401 TYR n 
2 402 TYR n 
2 403 PRO n 
2 404 ASN n 
2 405 SER n 
2 406 PHE n 
2 407 GLY n 
2 408 ALA n 
2 409 PRO n 
2 410 GLU n 
2 411 GLN n 
2 412 GLN n 
2 413 PRO n 
2 414 SER n 
2 415 ALA n 
2 416 LEU n 
2 417 GLU n 
2 418 HIS n 
2 419 SER n 
2 420 ILE n 
2 421 GLN n 
2 422 TYR n 
2 423 SER n 
2 424 GLY n 
2 425 GLU n 
2 426 VAL n 
2 427 ARG n 
2 428 ARG n 
2 429 PHE n 
2 430 ASN n 
2 431 THR n 
2 432 ALA n 
2 433 ASN n 
2 434 ASP n 
2 435 ASP n 
2 436 ASN n 
2 437 VAL n 
2 438 THR n 
2 439 GLN n 
2 440 VAL n 
2 441 ARG n 
2 442 ALA n 
2 443 PHE n 
2 444 TYR n 
2 445 VAL n 
2 446 ASN n 
2 447 VAL n 
2 448 LEU n 
2 449 ASN n 
2 450 GLU n 
2 451 GLU n 
2 452 GLN n 
2 453 ARG n 
2 454 LYS n 
2 455 ARG n 
2 456 LEU n 
2 457 CYS n 
2 458 GLU n 
2 459 ASN n 
2 460 ILE n 
2 461 ALA n 
2 462 GLY n 
2 463 HIS n 
2 464 LEU n 
2 465 LYS n 
2 466 ASP n 
2 467 ALA n 
2 468 GLN n 
2 469 ILE n 
2 470 PHE n 
2 471 ILE n 
2 472 GLN n 
2 473 LYS n 
2 474 LYS n 
2 475 ALA n 
2 476 VAL n 
2 477 LYS n 
2 478 ASN n 
2 479 PHE n 
2 480 THR n 
2 481 GLU n 
2 482 VAL n 
2 483 HIS n 
2 484 PRO n 
2 485 ASP n 
2 486 TYR n 
2 487 GLY n 
2 488 SER n 
2 489 HIS n 
2 490 ILE n 
2 491 GLN n 
2 492 ALA n 
2 493 LEU n 
2 494 LEU n 
2 495 ASP n 
2 496 LYS n 
2 497 TYR n 
2 498 ASN n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTE ? ? ? 
2 1 sample ? ? human 'Homo sapiens' 9606 Homo ? ? ? ? ? ? ? ? ? ? ? ? ERYTHROCYTE ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CATA_HUMAN P04040 1 3 ? ? 
2 UNP CATA_HUMAN P04040 2 3 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DGH A 1 ? 498 ? P04040 3 ? 500 ? 4 501 
2 2 1DGH B 1 ? 498 ? P04040 3 ? 500 ? 4 501 
3 1 1DGH C 1 ? 498 ? P04040 3 ? 500 ? 4 501 
4 2 1DGH D 1 ? 498 ? P04040 3 ? 500 ? 4 501 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1DGH 3AH B 72 ? UNP P04040 HIS 75 'MODIFIED RESIDUE' 75 1 
4 1DGH 3AH D 72 ? UNP P04040 HIS 75 'MODIFIED RESIDUE' 75 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3AH 'L-peptide linking' n '[HISTIDIN-1-YL-4H-[1,2,4]TRIAZOL-5-YL]-AMINE'              ?    'C8 H11 N7 O2'      237.219 
ALA 'L-peptide linking' y ALANINE                                                     ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                    ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ?    'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                    ?    'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                   ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                     ?    'C2 H5 N O2'        75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                           HEME 'C34 H32 Fe N4 O4'  616.487 
HIS 'L-peptide linking' y HISTIDINE                                                   ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                       ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                  ?    'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                      ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                  ?    'C5 H11 N O2 S'     149.211 
NDP non-polymer         . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ?    'C21 H30 N7 O17 P3' 745.421 
PHE 'L-peptide linking' y PHENYLALANINE                                               ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                     ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                      ?    'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                   ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ?    'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                      ?    'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1DGH 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.01 
_exptl_crystal.density_percent_sol   59.12 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'6.5 - 8.0% PEG4000, PROTEIN AT 40 MG/ML IN 50MM TRISCL, PH 8.0, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-03-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DGH 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   173373 
_reflns.number_all                   173373 
_reflns.percent_possible_obs         93.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0470000 
_reflns.pdbx_netI_over_sigmaI        17.3 
_reflns.B_iso_Wilson_estimate        7.925 
_reflns.pdbx_redundancy              2.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   92.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1560000 
_reflns_shell.meanI_over_sigI_obs    5.200 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1DGH 
_refine.ls_number_reflns_obs                     173196 
_refine.ls_number_reflns_all                     173196 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1770000 
_refine.ls_R_factor_all                          0.1770000 
_refine.ls_R_factor_R_work                       0.1730000 
_refine.ls_R_factor_R_free                       0.2100000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  17324 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               39.79 
_refine.aniso_B[1][1]                            -1.0300 
_refine.aniso_B[2][2]                            2.4071 
_refine.aniso_B[3][3]                            -1.3771 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'BOND ANGLES AND LENGTHS TO THE HEME IRON FROM BOTH THE TYR358 LIGAND AND THE HEME NITROGENS WERE UNCONSTRAINED' 
_refine.pdbx_starting_model                      1DGF 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM, 10%' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16078 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         268 
_refine_hist.number_atoms_solvent             1469 
_refine_hist.number_atoms_total               17815 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d     0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg  1.3   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it  0.305 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it 0.569 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it  0.757 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it 0.505 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1DGH 
_struct.title                     'HUMAN ERYTHROCYTE CATALASE 3-AMINO-1,2,4-TRIAZOLE COMPLEX' 
_struct.pdbx_descriptor           'CATALASE (E.C.1.11.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DGH 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'CATALASE, HEME, NADPH, HYDROGEN PEROXIDE, 3-AMINO-1, 2, 4-TRIAZOLE, INHIBITOR, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 3 ? 
K N N 5 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 7   ? ARG A 16  ? ASP A 10  ARG A 19  1 ? 10 
HELX_P HELX_P2  2  ASP A 51  ? ASP A 62  ? ASP A 54  ASP A 65  1 ? 12 
HELX_P HELX_P3  3  ALA A 94  ? GLU A 98  ? ALA A 97  GLU A 101 5 ? 5  
HELX_P HELX_P4  4  ASP A 154 ? ILE A 156 ? ASP A 157 ILE A 159 5 ? 3  
HELX_P HELX_P5  5  LEU A 157 ? LYS A 166 ? LEU A 160 LYS A 169 1 ? 10 
HELX_P HELX_P6  6  ASP A 175 ? ARG A 186 ? ASP A 178 ARG A 189 1 ? 12 
HELX_P HELX_P7  7  SER A 189 ? PHE A 197 ? SER A 192 PHE A 200 1 ? 9  
HELX_P HELX_P8  8  SER A 198 ? ILE A 202 ? SER A 201 ILE A 205 5 ? 5  
HELX_P HELX_P9  9  SER A 243 ? ASP A 254 ? SER A 246 ASP A 257 1 ? 12 
HELX_P HELX_P10 10 ASP A 256 ? THR A 268 ? ASP A 259 THR A 271 1 ? 13 
HELX_P HELX_P11 11 THR A 282 ? PHE A 289 ? THR A 285 PHE A 292 1 ? 8  
HELX_P HELX_P12 12 ASN A 321 ? VAL A 326 ? ASN A 324 VAL A 329 1 ? 6  
HELX_P HELX_P13 13 ASP A 345 ? LEU A 363 ? ASP A 348 LEU A 366 1 ? 19 
HELX_P HELX_P14 14 ASN A 366 ? ILE A 370 ? ASN A 369 ILE A 373 5 ? 5  
HELX_P HELX_P15 15 ILE A 370 ? CYS A 374 ? ILE A 373 CYS A 377 5 ? 5  
HELX_P HELX_P16 16 GLN A 412 ? LEU A 416 ? GLN A 415 LEU A 419 5 ? 5  
HELX_P HELX_P17 17 VAL A 437 ? ASN A 446 ? VAL A 440 ASN A 449 1 ? 10 
HELX_P HELX_P18 18 ASN A 449 ? LYS A 465 ? ASN A 452 LYS A 468 1 ? 17 
HELX_P HELX_P19 19 GLN A 468 ? HIS A 483 ? GLN A 471 HIS A 486 1 ? 16 
HELX_P HELX_P20 20 HIS A 483 ? ASN A 498 ? HIS A 486 ASN A 501 1 ? 16 
HELX_P HELX_P21 21 ASP B 7   ? GLN B 15  ? ASP B 10  GLN B 18  1 ? 9  
HELX_P HELX_P22 22 ASP B 51  ? ASP B 62  ? ASP B 54  ASP B 65  1 ? 12 
HELX_P HELX_P23 23 ALA B 94  ? GLU B 98  ? ALA B 97  GLU B 101 5 ? 5  
HELX_P HELX_P24 24 ASP B 154 ? ILE B 156 ? ASP B 157 ILE B 159 5 ? 3  
HELX_P HELX_P25 25 LEU B 157 ? LYS B 166 ? LEU B 160 LYS B 169 1 ? 10 
HELX_P HELX_P26 26 ASP B 175 ? ARG B 186 ? ASP B 178 ARG B 189 1 ? 12 
HELX_P HELX_P27 27 SER B 189 ? PHE B 197 ? SER B 192 PHE B 200 1 ? 9  
HELX_P HELX_P28 28 SER B 198 ? ILE B 202 ? SER B 201 ILE B 205 5 ? 5  
HELX_P HELX_P29 29 SER B 243 ? ASP B 254 ? SER B 246 ASP B 257 1 ? 12 
HELX_P HELX_P30 30 ASP B 256 ? THR B 268 ? ASP B 259 THR B 271 1 ? 13 
HELX_P HELX_P31 31 THR B 282 ? PHE B 289 ? THR B 285 PHE B 292 1 ? 8  
HELX_P HELX_P32 32 ASN B 321 ? VAL B 326 ? ASN B 324 VAL B 329 1 ? 6  
HELX_P HELX_P33 33 ASP B 345 ? LEU B 363 ? ASP B 348 LEU B 366 1 ? 19 
HELX_P HELX_P34 34 ASN B 366 ? ILE B 370 ? ASN B 369 ILE B 373 5 ? 5  
HELX_P HELX_P35 35 ILE B 370 ? CYS B 374 ? ILE B 373 CYS B 377 5 ? 5  
HELX_P HELX_P36 36 GLN B 412 ? LEU B 416 ? GLN B 415 LEU B 419 5 ? 5  
HELX_P HELX_P37 37 VAL B 437 ? ASN B 446 ? VAL B 440 ASN B 449 1 ? 10 
HELX_P HELX_P38 38 ASN B 449 ? LYS B 465 ? ASN B 452 LYS B 468 1 ? 17 
HELX_P HELX_P39 39 GLN B 468 ? HIS B 483 ? GLN B 471 HIS B 486 1 ? 16 
HELX_P HELX_P40 40 HIS B 483 ? ASN B 498 ? HIS B 486 ASN B 501 1 ? 16 
HELX_P HELX_P41 41 ASP C 7   ? ARG C 16  ? ASP C 10  ARG C 19  1 ? 10 
HELX_P HELX_P42 42 ASP C 51  ? ASP C 62  ? ASP C 54  ASP C 65  1 ? 12 
HELX_P HELX_P43 43 ALA C 94  ? GLU C 98  ? ALA C 97  GLU C 101 5 ? 5  
HELX_P HELX_P44 44 ASP C 154 ? ILE C 156 ? ASP C 157 ILE C 159 5 ? 3  
HELX_P HELX_P45 45 LEU C 157 ? LYS C 166 ? LEU C 160 LYS C 169 1 ? 10 
HELX_P HELX_P46 46 ASP C 175 ? ARG C 186 ? ASP C 178 ARG C 189 1 ? 12 
HELX_P HELX_P47 47 SER C 189 ? PHE C 197 ? SER C 192 PHE C 200 1 ? 9  
HELX_P HELX_P48 48 SER C 198 ? ILE C 202 ? SER C 201 ILE C 205 5 ? 5  
HELX_P HELX_P49 49 SER C 243 ? ASP C 254 ? SER C 246 ASP C 257 1 ? 12 
HELX_P HELX_P50 50 ASP C 256 ? THR C 268 ? ASP C 259 THR C 271 1 ? 13 
HELX_P HELX_P51 51 THR C 282 ? PHE C 289 ? THR C 285 PHE C 292 1 ? 8  
HELX_P HELX_P52 52 ASN C 321 ? VAL C 326 ? ASN C 324 VAL C 329 1 ? 6  
HELX_P HELX_P53 53 ASP C 345 ? LEU C 363 ? ASP C 348 LEU C 366 1 ? 19 
HELX_P HELX_P54 54 ASN C 366 ? ILE C 370 ? ASN C 369 ILE C 373 5 ? 5  
HELX_P HELX_P55 55 GLN C 412 ? LEU C 416 ? GLN C 415 LEU C 419 5 ? 5  
HELX_P HELX_P56 56 VAL C 437 ? VAL C 447 ? VAL C 440 VAL C 450 1 ? 11 
HELX_P HELX_P57 57 ASN C 449 ? LYS C 465 ? ASN C 452 LYS C 468 1 ? 17 
HELX_P HELX_P58 58 GLN C 468 ? HIS C 483 ? GLN C 471 HIS C 486 1 ? 16 
HELX_P HELX_P59 59 HIS C 483 ? ASN C 498 ? HIS C 486 ASN C 501 1 ? 16 
HELX_P HELX_P60 60 ASP D 7   ? GLN D 15  ? ASP D 10  GLN D 18  1 ? 9  
HELX_P HELX_P61 61 ASP D 51  ? ARG D 63  ? ASP D 54  ARG D 66  1 ? 13 
HELX_P HELX_P62 62 ALA D 94  ? GLU D 98  ? ALA D 97  GLU D 101 5 ? 5  
HELX_P HELX_P63 63 ASP D 154 ? ILE D 156 ? ASP D 157 ILE D 159 5 ? 3  
HELX_P HELX_P64 64 LEU D 157 ? LYS D 166 ? LEU D 160 LYS D 169 1 ? 10 
HELX_P HELX_P65 65 ASP D 175 ? ARG D 186 ? ASP D 178 ARG D 189 1 ? 12 
HELX_P HELX_P66 66 SER D 189 ? PHE D 197 ? SER D 192 PHE D 200 1 ? 9  
HELX_P HELX_P67 67 SER D 198 ? ILE D 202 ? SER D 201 ILE D 205 5 ? 5  
HELX_P HELX_P68 68 SER D 243 ? ASP D 254 ? SER D 246 ASP D 257 1 ? 12 
HELX_P HELX_P69 69 ASP D 256 ? THR D 268 ? ASP D 259 THR D 271 1 ? 13 
HELX_P HELX_P70 70 THR D 282 ? PHE D 289 ? THR D 285 PHE D 292 1 ? 8  
HELX_P HELX_P71 71 ASN D 321 ? VAL D 326 ? ASN D 324 VAL D 329 1 ? 6  
HELX_P HELX_P72 72 ASP D 345 ? LEU D 363 ? ASP D 348 LEU D 366 1 ? 19 
HELX_P HELX_P73 73 ASN D 366 ? ILE D 370 ? ASN D 369 ILE D 373 5 ? 5  
HELX_P HELX_P74 74 ILE D 370 ? CYS D 374 ? ILE D 373 CYS D 377 5 ? 5  
HELX_P HELX_P75 75 GLN D 412 ? LEU D 416 ? GLN D 415 LEU D 419 5 ? 5  
HELX_P HELX_P76 76 VAL D 437 ? ASN D 446 ? VAL D 440 ASN D 449 1 ? 10 
HELX_P HELX_P77 77 ASN D 449 ? LYS D 465 ? ASN D 452 LYS D 468 1 ? 17 
HELX_P HELX_P78 78 GLN D 468 ? HIS D 483 ? GLN D 471 HIS D 486 1 ? 16 
HELX_P HELX_P79 79 HIS D 483 ? ASN D 498 ? HIS D 486 ASN D 501 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A TYR 355 OH ? ? ? 1_555 E HEM .  FE ? ? A TYR 358 A HEM 2000 1_555 ? ? ? ? ? ? ? 1.837 ? 
metalc2 metalc ? ? B TYR 355 OH ? ? ? 1_555 G HEM .  FE ? ? B TYR 358 B HEM 2001 1_555 ? ? ? ? ? ? ? 1.894 ? 
metalc3 metalc ? ? C TYR 355 OH ? ? ? 1_555 H HEM .  FE ? ? C TYR 358 C HEM 2002 1_555 ? ? ? ? ? ? ? 1.861 ? 
metalc4 metalc ? ? D TYR 355 OH ? ? ? 1_555 J HEM .  FE ? ? D TYR 358 D HEM 2003 1_555 ? ? ? ? ? ? ? 1.886 ? 
covale1 covale ? ? B VAL 71  C  ? ? ? 1_555 B 3AH 72 N  ? ? B VAL 74  B 3AH 75   1_555 ? ? ? ? ? ? ? 1.335 ? 
covale2 covale ? ? B 3AH 72  C  ? ? ? 1_555 B ALA 73 N  ? ? B 3AH 75  B ALA 76   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale3 covale ? ? D VAL 71  C  ? ? ? 1_555 D 3AH 72 N  ? ? D VAL 74  D 3AH 75   1_555 ? ? ? ? ? ? ? 1.336 ? 
covale4 covale ? ? D 3AH 72  C  ? ? ? 1_555 D ALA 73 N  ? ? D 3AH 75  D ALA 76   1_555 ? ? ? ? ? ? ? 1.324 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 402 A . ? TYR 405 A PRO 403 A ? PRO 406 A 1 0.08  
2 TYR 402 B . ? TYR 405 B PRO 403 B ? PRO 406 B 1 0.01  
3 TYR 402 C . ? TYR 405 C PRO 403 C ? PRO 406 C 1 0.06  
4 TYR 402 D . ? TYR 405 D PRO 403 D ? PRO 406 D 1 -0.20 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 4  ? 
D ? 11 ? 
E ? 3  ? 
F ? 11 ? 
G ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
D 3  4  ? anti-parallel 
D 4  5  ? anti-parallel 
D 5  6  ? anti-parallel 
D 6  7  ? anti-parallel 
D 7  8  ? anti-parallel 
D 8  9  ? anti-parallel 
D 9  10 ? anti-parallel 
D 10 11 ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? anti-parallel 
F 7  8  ? anti-parallel 
F 8  9  ? anti-parallel 
F 9  10 ? anti-parallel 
F 10 11 ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 39  ? VAL A 41  ? ILE A 42  VAL A 44  
A 2  GLU C 425 ? ARG C 428 ? GLU C 428 ARG C 431 
A 3  ILE B 420 ? GLN B 421 ? ILE B 423 GLN B 424 
B 1  ILE A 340 ? GLU A 341 ? ILE A 343 GLU A 344 
B 2  PHE A 217 ? VAL A 220 ? PHE A 220 VAL A 223 
B 3  ALA A 226 ? THR A 235 ? ALA A 229 THR A 238 
B 4  SER A 273 ? MET A 281 ? SER A 276 MET A 284 
B 5  ILE A 308 ? ARG A 317 ? ILE A 311 ARG A 320 
B 6  GLY A 75  ? VAL A 84  ? GLY A 78  VAL A 87  
B 7  LYS A 103 ? SER A 111 ? LYS A 106 SER A 114 
B 8  GLY A 128 ? THR A 135 ? GLY A 131 THR A 138 
B 9  GLY A 138 ? ASN A 145 ? GLY A 141 ASN A 148 
B 10 GLY A 211 ? TYR A 212 ? GLY A 214 TYR A 215 
B 11 ALA A 226 ? THR A 235 ? ALA A 229 THR A 238 
C 1  ILE C 39  ? VAL C 41  ? ILE C 42  VAL C 44  
C 2  GLN A 421 ? ARG A 428 ? GLN A 424 ARG A 431 
C 3  GLN D 421 ? ARG D 428 ? GLN D 424 ARG D 431 
C 4  ILE B 39  ? VAL B 41  ? ILE B 42  VAL B 44  
D 1  ILE B 340 ? ALA B 342 ? ILE B 343 ALA B 345 
D 2  PHE B 217 ? VAL B 220 ? PHE B 220 VAL B 223 
D 3  ALA B 226 ? THR B 235 ? ALA B 229 THR B 238 
D 4  SER B 273 ? MET B 281 ? SER B 276 MET B 284 
D 5  ILE B 308 ? ARG B 317 ? ILE B 311 ARG B 320 
D 6  GLY B 75  ? VAL B 84  ? GLY B 78  VAL B 87  
D 7  LYS B 103 ? SER B 111 ? LYS B 106 SER B 114 
D 8  GLY B 128 ? THR B 135 ? GLY B 131 THR B 138 
D 9  GLY B 138 ? ASN B 145 ? GLY B 141 ASN B 148 
D 10 GLY B 211 ? TYR B 212 ? GLY B 214 TYR B 215 
D 11 ALA B 226 ? THR B 235 ? ALA B 229 THR B 238 
E 1  ILE C 420 ? GLN C 421 ? ILE C 423 GLN C 424 
E 2  GLU B 425 ? ARG B 428 ? GLU B 428 ARG B 431 
E 3  ILE D 39  ? VAL D 41  ? ILE D 42  VAL D 44  
F 1  ILE C 340 ? ALA C 342 ? ILE C 343 ALA C 345 
F 2  PHE C 217 ? VAL C 220 ? PHE C 220 VAL C 223 
F 3  ALA C 226 ? THR C 235 ? ALA C 229 THR C 238 
F 4  SER C 273 ? MET C 281 ? SER C 276 MET C 284 
F 5  ILE C 308 ? ARG C 317 ? ILE C 311 ARG C 320 
F 6  GLY C 75  ? VAL C 84  ? GLY C 78  VAL C 87  
F 7  LYS C 103 ? SER C 111 ? LYS C 106 SER C 114 
F 8  GLY C 128 ? THR C 135 ? GLY C 131 THR C 138 
F 9  GLY C 138 ? ASN C 145 ? GLY C 141 ASN C 148 
F 10 GLY C 211 ? TYR C 212 ? GLY C 214 TYR C 215 
F 11 ALA C 226 ? THR C 235 ? ALA C 229 THR C 238 
G 1  ILE D 340 ? GLU D 341 ? ILE D 343 GLU D 344 
G 2  PHE D 217 ? VAL D 220 ? PHE D 220 VAL D 223 
G 3  ALA D 226 ? THR D 235 ? ALA D 229 THR D 238 
G 4  SER D 273 ? MET D 281 ? SER D 276 MET D 284 
G 5  ILE D 308 ? ARG D 317 ? ILE D 311 ARG D 320 
G 6  GLY D 75  ? VAL D 84  ? GLY D 78  VAL D 87  
G 7  LYS D 103 ? SER D 111 ? LYS D 106 SER D 114 
G 8  GLY D 128 ? THR D 135 ? GLY D 131 THR D 138 
G 9  GLY D 138 ? ASN D 145 ? GLY D 141 ASN D 148 
G 10 GLY D 211 ? TYR D 212 ? GLY D 214 TYR D 215 
G 11 ALA D 226 ? THR D 235 ? ALA D 229 THR D 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 40  ? N THR A 43  O ARG C 427 ? O ARG C 430 
A 2  3  N VAL C 426 ? N VAL C 429 O ILE B 420 ? O ILE B 423 
B 1  2  N GLU A 341 ? N GLU A 344 O LYS A 218 ? O LYS A 221 
B 2  3  N LEU A 219 ? N LEU A 222 O VAL A 227 ? O VAL A 230 
B 3  4  O LYS A 234 ? O LYS A 237 N THR A 275 ? N THR A 278 
B 4  5  O ILE A 278 ? O ILE A 281 N ILE A 308 ? N ILE A 311 
B 5  6  O ARG A 317 ? O ARG A 320 N PHE A 79  ? N PHE A 82  
B 6  7  O PHE A 82  ? O PHE A 85  N THR A 104 ? N THR A 107 
B 7  8  O SER A 111 ? O SER A 114 N GLY A 128 ? N GLY A 131 
B 8  9  O THR A 135 ? O THR A 138 N GLY A 138 ? N GLY A 141 
B 9  10 O ASN A 145 ? O ASN A 148 N TYR A 212 ? N TYR A 215 
B 10 11 O GLY A 211 ? O GLY A 214 N TYR A 233 ? N TYR A 236 
C 1  2  N THR C 40  ? N THR C 43  O ARG A 427 ? O ARG A 430 
C 2  3  N GLY A 424 ? N GLY A 427 O TYR D 422 ? O TYR D 425 
C 3  4  O ARG D 427 ? O ARG D 430 N THR B 40  ? N THR B 43  
D 1  2  O GLU B 341 ? O GLU B 344 N LYS B 218 ? N LYS B 221 
D 2  3  N LEU B 219 ? N LEU B 222 O VAL B 227 ? O VAL B 230 
D 3  4  O LYS B 234 ? O LYS B 237 N THR B 275 ? N THR B 278 
D 4  5  O ILE B 278 ? O ILE B 281 N ILE B 308 ? N ILE B 311 
D 5  6  O ARG B 317 ? O ARG B 320 N PHE B 79  ? N PHE B 82  
D 6  7  N PHE B 82  ? N PHE B 85  O THR B 104 ? O THR B 107 
D 7  8  O SER B 111 ? O SER B 114 N GLY B 128 ? N GLY B 131 
D 8  9  O THR B 135 ? O THR B 138 N GLY B 138 ? N GLY B 141 
D 9  10 O ASN B 145 ? O ASN B 148 N TYR B 212 ? N TYR B 215 
D 10 11 O GLY B 211 ? O GLY B 214 N TYR B 233 ? N TYR B 236 
E 1  2  O ILE C 420 ? O ILE C 423 N VAL B 426 ? N VAL B 429 
E 2  3  O ARG B 427 ? O ARG B 430 N THR D 40  ? N THR D 43  
F 1  2  N GLU C 341 ? N GLU C 344 O LYS C 218 ? O LYS C 221 
F 2  3  N LEU C 219 ? N LEU C 222 O VAL C 227 ? O VAL C 230 
F 3  4  O LYS C 234 ? O LYS C 237 N THR C 275 ? N THR C 278 
F 4  5  O ILE C 278 ? O ILE C 281 N ILE C 308 ? N ILE C 311 
F 5  6  O ARG C 317 ? O ARG C 320 N PHE C 79  ? N PHE C 82  
F 6  7  O PHE C 82  ? O PHE C 85  N THR C 104 ? N THR C 107 
F 7  8  O SER C 111 ? O SER C 114 N GLY C 128 ? N GLY C 131 
F 8  9  O THR C 135 ? O THR C 138 N GLY C 138 ? N GLY C 141 
F 9  10 O ASN C 145 ? O ASN C 148 N TYR C 212 ? N TYR C 215 
F 10 11 O GLY C 211 ? O GLY C 214 N TYR C 233 ? N TYR C 236 
G 1  2  N GLU D 341 ? N GLU D 344 O LYS D 218 ? O LYS D 221 
G 2  3  N LEU D 219 ? N LEU D 222 O VAL D 227 ? O VAL D 230 
G 3  4  O LYS D 234 ? O LYS D 237 N THR D 275 ? N THR D 278 
G 4  5  O ILE D 278 ? O ILE D 281 N ILE D 308 ? N ILE D 311 
G 5  6  O ARG D 317 ? O ARG D 320 N PHE D 79  ? N PHE D 82  
G 6  7  N PHE D 82  ? N PHE D 85  O THR D 104 ? O THR D 107 
G 7  8  O SER D 111 ? O SER D 114 N GLY D 128 ? N GLY D 131 
G 8  9  O THR D 135 ? O THR D 138 N GLY D 138 ? N GLY D 141 
G 9  10 O ASN D 145 ? O ASN D 148 N TYR D 212 ? N TYR D 215 
G 10 11 O GLY D 211 ? O GLY D 214 N TYR D 233 ? N TYR D 236 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM A 2000' 
AC2 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE NDP A 3000' 
AC3 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE HEM B 2001' 
AC4 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE HEM C 2002' 
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE NDP C 3001' 
AC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE HEM D 2003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 23 ARG A 69  ? ARG A 72   . ? 1_555 ? 
2   AC1 23 VAL A 70  ? VAL A 73   . ? 1_555 ? 
3   AC1 23 VAL A 71  ? VAL A 74   . ? 1_555 ? 
4   AC1 23 HIS A 72  ? HIS A 75   . ? 1_555 ? 
5   AC1 23 ARG A 109 ? ARG A 112  . ? 1_555 ? 
6   AC1 23 GLY A 128 ? GLY A 131  . ? 1_555 ? 
7   AC1 23 VAL A 143 ? VAL A 146  . ? 1_555 ? 
8   AC1 23 GLY A 144 ? GLY A 147  . ? 1_555 ? 
9   AC1 23 ASN A 145 ? ASN A 148  . ? 1_555 ? 
10  AC1 23 PHE A 158 ? PHE A 161  . ? 1_555 ? 
11  AC1 23 GLY A 213 ? GLY A 216  . ? 1_555 ? 
12  AC1 23 SER A 214 ? SER A 217  . ? 1_555 ? 
13  AC1 23 PHE A 331 ? PHE A 334  . ? 1_555 ? 
14  AC1 23 MET A 347 ? MET A 350  . ? 1_555 ? 
15  AC1 23 ARG A 351 ? ARG A 354  . ? 1_555 ? 
16  AC1 23 TYR A 355 ? TYR A 358  . ? 1_555 ? 
17  AC1 23 THR A 358 ? THR A 361  . ? 1_555 ? 
18  AC1 23 HIS A 359 ? HIS A 362  . ? 1_555 ? 
19  AC1 23 ARG A 362 ? ARG A 365  . ? 1_555 ? 
20  AC1 23 HOH K .   ? HOH A 3143 . ? 1_555 ? 
21  AC1 23 HOH K .   ? HOH A 3155 . ? 1_555 ? 
22  AC1 23 HOH K .   ? HOH A 3186 . ? 1_555 ? 
23  AC1 23 MET C 58  ? MET C 61   . ? 1_555 ? 
24  AC2 20 HIS A 191 ? HIS A 194  . ? 1_555 ? 
25  AC2 20 PHE A 195 ? PHE A 198  . ? 1_555 ? 
26  AC2 20 SER A 198 ? SER A 201  . ? 1_555 ? 
27  AC2 20 ARG A 200 ? ARG A 203  . ? 1_555 ? 
28  AC2 20 ASN A 210 ? ASN A 213  . ? 1_555 ? 
29  AC2 20 HIS A 232 ? HIS A 235  . ? 1_555 ? 
30  AC2 20 LYS A 234 ? LYS A 237  . ? 1_555 ? 
31  AC2 20 VAL A 299 ? VAL A 302  . ? 1_555 ? 
32  AC2 20 TRP A 300 ? TRP A 303  . ? 1_555 ? 
33  AC2 20 PRO A 301 ? PRO A 304  . ? 1_555 ? 
34  AC2 20 HIS A 302 ? HIS A 305  . ? 1_555 ? 
35  AC2 20 GLN A 439 ? GLN A 442  . ? 1_555 ? 
36  AC2 20 PHE A 443 ? PHE A 446  . ? 1_555 ? 
37  AC2 20 VAL A 447 ? VAL A 450  . ? 1_555 ? 
38  AC2 20 HOH K .   ? HOH A 3028 . ? 1_555 ? 
39  AC2 20 HOH K .   ? HOH A 3211 . ? 1_555 ? 
40  AC2 20 HOH K .   ? HOH A 3259 . ? 1_555 ? 
41  AC2 20 HOH K .   ? HOH A 3327 . ? 1_555 ? 
42  AC2 20 HOH K .   ? HOH A 3369 . ? 1_555 ? 
43  AC2 20 HOH K .   ? HOH A 3373 . ? 1_555 ? 
44  AC3 25 ARG B 69  ? ARG B 72   . ? 1_555 ? 
45  AC3 25 VAL B 70  ? VAL B 73   . ? 1_555 ? 
46  AC3 25 VAL B 71  ? VAL B 74   . ? 1_555 ? 
47  AC3 25 3AH B 72  ? 3AH B 75   . ? 1_555 ? 
48  AC3 25 ARG B 109 ? ARG B 112  . ? 1_555 ? 
49  AC3 25 GLY B 128 ? GLY B 131  . ? 1_555 ? 
50  AC3 25 VAL B 143 ? VAL B 146  . ? 1_555 ? 
51  AC3 25 GLY B 144 ? GLY B 147  . ? 1_555 ? 
52  AC3 25 ASN B 145 ? ASN B 148  . ? 1_555 ? 
53  AC3 25 PRO B 155 ? PRO B 158  . ? 1_555 ? 
54  AC3 25 PHE B 158 ? PHE B 161  . ? 1_555 ? 
55  AC3 25 GLY B 213 ? GLY B 216  . ? 1_555 ? 
56  AC3 25 SER B 214 ? SER B 217  . ? 1_555 ? 
57  AC3 25 LEU B 296 ? LEU B 299  . ? 1_555 ? 
58  AC3 25 PHE B 331 ? PHE B 334  . ? 1_555 ? 
59  AC3 25 MET B 347 ? MET B 350  . ? 1_555 ? 
60  AC3 25 ARG B 351 ? ARG B 354  . ? 1_555 ? 
61  AC3 25 TYR B 355 ? TYR B 358  . ? 1_555 ? 
62  AC3 25 THR B 358 ? THR B 361  . ? 1_555 ? 
63  AC3 25 HIS B 359 ? HIS B 362  . ? 1_555 ? 
64  AC3 25 ARG B 362 ? ARG B 365  . ? 1_555 ? 
65  AC3 25 HOH L .   ? HOH B 2049 . ? 1_555 ? 
66  AC3 25 HOH L .   ? HOH B 2060 . ? 1_555 ? 
67  AC3 25 HOH L .   ? HOH B 2236 . ? 1_555 ? 
68  AC3 25 MET D 58  ? MET D 61   . ? 1_555 ? 
69  AC4 26 MET A 58  ? MET A 61   . ? 1_555 ? 
70  AC4 26 ASP A 62  ? ASP A 65   . ? 1_555 ? 
71  AC4 26 ARG C 69  ? ARG C 72   . ? 1_555 ? 
72  AC4 26 VAL C 70  ? VAL C 73   . ? 1_555 ? 
73  AC4 26 VAL C 71  ? VAL C 74   . ? 1_555 ? 
74  AC4 26 HIS C 72  ? HIS C 75   . ? 1_555 ? 
75  AC4 26 ARG C 109 ? ARG C 112  . ? 1_555 ? 
76  AC4 26 GLY C 128 ? GLY C 131  . ? 1_555 ? 
77  AC4 26 VAL C 143 ? VAL C 146  . ? 1_555 ? 
78  AC4 26 GLY C 144 ? GLY C 147  . ? 1_555 ? 
79  AC4 26 ASN C 145 ? ASN C 148  . ? 1_555 ? 
80  AC4 26 PRO C 155 ? PRO C 158  . ? 1_555 ? 
81  AC4 26 PHE C 158 ? PHE C 161  . ? 1_555 ? 
82  AC4 26 GLY C 213 ? GLY C 216  . ? 1_555 ? 
83  AC4 26 SER C 214 ? SER C 217  . ? 1_555 ? 
84  AC4 26 LEU C 296 ? LEU C 299  . ? 1_555 ? 
85  AC4 26 PHE C 331 ? PHE C 334  . ? 1_555 ? 
86  AC4 26 MET C 347 ? MET C 350  . ? 1_555 ? 
87  AC4 26 ARG C 351 ? ARG C 354  . ? 1_555 ? 
88  AC4 26 TYR C 355 ? TYR C 358  . ? 1_555 ? 
89  AC4 26 THR C 358 ? THR C 361  . ? 1_555 ? 
90  AC4 26 HIS C 359 ? HIS C 362  . ? 1_555 ? 
91  AC4 26 ARG C 362 ? ARG C 365  . ? 1_555 ? 
92  AC4 26 HOH M .   ? HOH C 3058 . ? 1_555 ? 
93  AC4 26 HOH M .   ? HOH C 3059 . ? 1_555 ? 
94  AC4 26 HOH M .   ? HOH C 3141 . ? 1_555 ? 
95  AC5 19 HIS C 191 ? HIS C 194  . ? 1_555 ? 
96  AC5 19 PHE C 195 ? PHE C 198  . ? 1_555 ? 
97  AC5 19 SER C 198 ? SER C 201  . ? 1_555 ? 
98  AC5 19 ARG C 200 ? ARG C 203  . ? 1_555 ? 
99  AC5 19 ASN C 210 ? ASN C 213  . ? 1_555 ? 
100 AC5 19 HIS C 232 ? HIS C 235  . ? 1_555 ? 
101 AC5 19 LYS C 234 ? LYS C 237  . ? 1_555 ? 
102 AC5 19 ILE C 239 ? ILE C 242  . ? 1_555 ? 
103 AC5 19 TRP C 300 ? TRP C 303  . ? 1_555 ? 
104 AC5 19 PRO C 301 ? PRO C 304  . ? 1_555 ? 
105 AC5 19 HIS C 302 ? HIS C 305  . ? 1_555 ? 
106 AC5 19 GLN C 439 ? GLN C 442  . ? 1_555 ? 
107 AC5 19 PHE C 443 ? PHE C 446  . ? 1_555 ? 
108 AC5 19 VAL C 447 ? VAL C 450  . ? 1_555 ? 
109 AC5 19 HOH M .   ? HOH C 3158 . ? 1_555 ? 
110 AC5 19 HOH M .   ? HOH C 3177 . ? 1_555 ? 
111 AC5 19 HOH M .   ? HOH C 3201 . ? 1_555 ? 
112 AC5 19 HOH M .   ? HOH C 3251 . ? 1_555 ? 
113 AC5 19 HOH M .   ? HOH C 3368 . ? 1_555 ? 
114 AC6 23 ASP B 62  ? ASP B 65   . ? 1_555 ? 
115 AC6 23 ARG D 69  ? ARG D 72   . ? 1_555 ? 
116 AC6 23 VAL D 70  ? VAL D 73   . ? 1_555 ? 
117 AC6 23 VAL D 71  ? VAL D 74   . ? 1_555 ? 
118 AC6 23 3AH D 72  ? 3AH D 75   . ? 1_555 ? 
119 AC6 23 ARG D 109 ? ARG D 112  . ? 1_555 ? 
120 AC6 23 GLY D 128 ? GLY D 131  . ? 1_555 ? 
121 AC6 23 VAL D 143 ? VAL D 146  . ? 1_555 ? 
122 AC6 23 GLY D 144 ? GLY D 147  . ? 1_555 ? 
123 AC6 23 ASN D 145 ? ASN D 148  . ? 1_555 ? 
124 AC6 23 PHE D 158 ? PHE D 161  . ? 1_555 ? 
125 AC6 23 GLY D 213 ? GLY D 216  . ? 1_555 ? 
126 AC6 23 SER D 214 ? SER D 217  . ? 1_555 ? 
127 AC6 23 PHE D 331 ? PHE D 334  . ? 1_555 ? 
128 AC6 23 MET D 347 ? MET D 350  . ? 1_555 ? 
129 AC6 23 ARG D 351 ? ARG D 354  . ? 1_555 ? 
130 AC6 23 TYR D 355 ? TYR D 358  . ? 1_555 ? 
131 AC6 23 THR D 358 ? THR D 361  . ? 1_555 ? 
132 AC6 23 HIS D 359 ? HIS D 362  . ? 1_555 ? 
133 AC6 23 ARG D 362 ? ARG D 365  . ? 1_555 ? 
134 AC6 23 HOH N .   ? HOH D 2025 . ? 1_555 ? 
135 AC6 23 HOH N .   ? HOH D 2047 . ? 1_555 ? 
136 AC6 23 HOH N .   ? HOH D 2138 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DGH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DGH 
_atom_sites.fract_transf_matrix[1][1]   0.011901 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007110 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004323 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ARG A 1 2   ? -3.862  25.669  77.238  1.00 46.47 ? 5    ARG A N   1 
ATOM   2     C  CA  . ARG A 1 2   ? -2.402  25.698  76.904  1.00 46.35 ? 5    ARG A CA  1 
ATOM   3     C  C   . ARG A 1 2   ? -2.012  27.064  76.354  1.00 46.44 ? 5    ARG A C   1 
ATOM   4     O  O   . ARG A 1 2   ? -2.880  27.911  76.094  1.00 46.57 ? 5    ARG A O   1 
ATOM   5     C  CB  . ARG A 1 2   ? -2.069  24.634  75.851  1.00 46.01 ? 5    ARG A CB  1 
ATOM   6     C  CG  . ARG A 1 2   ? -2.536  23.231  76.197  1.00 45.53 ? 5    ARG A CG  1 
ATOM   7     C  CD  . ARG A 1 2   ? -2.083  22.201  75.165  1.00 45.14 ? 5    ARG A CD  1 
ATOM   8     N  NE  . ARG A 1 2   ? -2.599  22.470  73.825  1.00 44.81 ? 5    ARG A NE  1 
ATOM   9     C  CZ  . ARG A 1 2   ? -2.540  21.609  72.811  1.00 44.61 ? 5    ARG A CZ  1 
ATOM   10    N  NH1 . ARG A 1 2   ? -1.989  20.414  72.977  1.00 44.45 ? 5    ARG A NH1 1 
ATOM   11    N  NH2 . ARG A 1 2   ? -3.026  21.947  71.623  1.00 44.48 ? 5    ARG A NH2 1 
ATOM   12    N  N   . ASP A 1 3   ? -0.707  27.275  76.167  1.00 46.41 ? 6    ASP A N   1 
ATOM   13    C  CA  . ASP A 1 3   ? -0.209  28.539  75.625  1.00 46.09 ? 6    ASP A CA  1 
ATOM   14    C  C   . ASP A 1 3   ? -0.636  28.670  74.164  1.00 45.62 ? 6    ASP A C   1 
ATOM   15    O  O   . ASP A 1 3   ? -0.890  27.670  73.489  1.00 45.62 ? 6    ASP A O   1 
ATOM   16    C  CB  . ASP A 1 3   ? 1.320   28.637  75.755  1.00 46.69 ? 6    ASP A CB  1 
ATOM   17    C  CG  . ASP A 1 3   ? 2.057   27.538  74.992  1.00 47.37 ? 6    ASP A CG  1 
ATOM   18    O  OD1 . ASP A 1 3   ? 1.529   26.408  74.913  1.00 48.01 ? 6    ASP A OD1 1 
ATOM   19    O  OD2 . ASP A 1 3   ? 3.180   27.793  74.494  1.00 47.58 ? 6    ASP A OD2 1 
ATOM   20    N  N   . PRO A 1 4   ? -0.779  29.909  73.676  1.00 45.11 ? 7    PRO A N   1 
ATOM   21    C  CA  . PRO A 1 4   ? -1.184  30.152  72.291  1.00 44.71 ? 7    PRO A CA  1 
ATOM   22    C  C   . PRO A 1 4   ? -0.362  29.390  71.251  1.00 44.27 ? 7    PRO A C   1 
ATOM   23    O  O   . PRO A 1 4   ? -0.913  28.894  70.270  1.00 44.10 ? 7    PRO A O   1 
ATOM   24    C  CB  . PRO A 1 4   ? -1.014  31.664  72.157  1.00 44.82 ? 7    PRO A CB  1 
ATOM   25    C  CG  . PRO A 1 4   ? -1.419  32.145  73.504  1.00 44.78 ? 7    PRO A CG  1 
ATOM   26    C  CD  . PRO A 1 4   ? -0.689  31.180  74.418  1.00 45.01 ? 7    PRO A CD  1 
ATOM   27    N  N   . ALA A 1 5   ? 0.943   29.267  71.484  1.00 43.83 ? 8    ALA A N   1 
ATOM   28    C  CA  . ALA A 1 5   ? 1.823   28.570  70.552  1.00 43.44 ? 8    ALA A CA  1 
ATOM   29    C  C   . ALA A 1 5   ? 1.382   27.134  70.284  1.00 43.25 ? 8    ALA A C   1 
ATOM   30    O  O   . ALA A 1 5   ? 1.295   26.706  69.129  1.00 43.24 ? 8    ALA A O   1 
ATOM   31    C  CB  . ALA A 1 5   ? 3.255   28.593  71.062  1.00 43.33 ? 8    ALA A CB  1 
ATOM   32    N  N   . SER A 1 6   ? 1.069   26.407  71.350  1.00 42.90 ? 9    SER A N   1 
ATOM   33    C  CA  . SER A 1 6   ? 0.646   25.018  71.237  1.00 42.52 ? 9    SER A CA  1 
ATOM   34    C  C   . SER A 1 6   ? -0.673  24.834  70.530  1.00 42.11 ? 9    SER A C   1 
ATOM   35    O  O   . SER A 1 6   ? -0.881  23.824  69.870  1.00 42.15 ? 9    SER A O   1 
ATOM   36    C  CB  . SER A 1 6   ? 0.556   24.390  72.616  1.00 42.70 ? 9    SER A CB  1 
ATOM   37    O  OG  . SER A 1 6   ? 1.817   24.431  73.247  1.00 43.29 ? 9    SER A OG  1 
ATOM   38    N  N   . ASP A 1 7   ? -1.569  25.802  70.681  1.00 41.87 ? 10   ASP A N   1 
ATOM   39    C  CA  . ASP A 1 7   ? -2.886  25.728  70.058  1.00 41.69 ? 10   ASP A CA  1 
ATOM   40    C  C   . ASP A 1 7   ? -2.945  26.292  68.643  1.00 41.42 ? 10   ASP A C   1 
ATOM   41    O  O   . ASP A 1 7   ? -4.028  26.594  68.133  1.00 41.35 ? 10   ASP A O   1 
ATOM   42    C  CB  . ASP A 1 7   ? -3.913  26.427  70.941  1.00 41.95 ? 10   ASP A CB  1 
ATOM   43    C  CG  . ASP A 1 7   ? -4.066  25.759  72.289  1.00 42.31 ? 10   ASP A CG  1 
ATOM   44    O  OD1 . ASP A 1 7   ? -3.838  24.535  72.384  1.00 42.57 ? 10   ASP A OD1 1 
ATOM   45    O  OD2 . ASP A 1 7   ? -4.417  26.456  73.262  1.00 42.67 ? 10   ASP A OD2 1 
ATOM   46    N  N   . GLN A 1 8   ? -1.786  26.395  68.002  1.00 40.95 ? 11   GLN A N   1 
ATOM   47    C  CA  . GLN A 1 8   ? -1.701  26.923  66.653  1.00 40.62 ? 11   GLN A CA  1 
ATOM   48    C  C   . GLN A 1 8   ? -2.681  26.241  65.700  1.00 40.72 ? 11   GLN A C   1 
ATOM   49    O  O   . GLN A 1 8   ? -3.573  26.897  65.164  1.00 40.54 ? 11   GLN A O   1 
ATOM   50    C  CB  . GLN A 1 8   ? -0.263  26.804  66.143  1.00 40.30 ? 11   GLN A CB  1 
ATOM   51    C  CG  . GLN A 1 8   ? 0.032   27.556  64.848  1.00 39.85 ? 11   GLN A CG  1 
ATOM   52    C  CD  . GLN A 1 8   ? -0.505  26.856  63.617  1.00 39.73 ? 11   GLN A CD  1 
ATOM   53    O  OE1 . GLN A 1 8   ? -0.507  25.625  63.543  1.00 39.67 ? 11   GLN A OE1 1 
ATOM   54    N  NE2 . GLN A 1 8   ? -0.966  27.633  62.644  1.00 39.37 ? 11   GLN A NE2 1 
ATOM   55    N  N   . MET A 1 9   ? -2.537  24.929  65.506  1.00 40.85 ? 12   MET A N   1 
ATOM   56    C  CA  . MET A 1 9   ? -3.418  24.191  64.602  1.00 41.06 ? 12   MET A CA  1 
ATOM   57    C  C   . MET A 1 9   ? -4.887  24.264  64.998  1.00 41.42 ? 12   MET A C   1 
ATOM   58    O  O   . MET A 1 9   ? -5.755  24.458  64.144  1.00 41.57 ? 12   MET A O   1 
ATOM   59    C  CB  . MET A 1 9   ? -2.994  22.729  64.484  1.00 40.79 ? 12   MET A CB  1 
ATOM   60    C  CG  . MET A 1 9   ? -1.664  22.517  63.790  1.00 40.67 ? 12   MET A CG  1 
ATOM   61    S  SD  . MET A 1 9   ? -1.450  20.808  63.232  1.00 40.78 ? 12   MET A SD  1 
ATOM   62    C  CE  . MET A 1 9   ? -1.502  19.941  64.781  1.00 40.46 ? 12   MET A CE  1 
ATOM   63    N  N   . GLN A 1 10  ? -5.168  24.104  66.288  1.00 41.76 ? 13   GLN A N   1 
ATOM   64    C  CA  . GLN A 1 10  ? -6.544  24.168  66.774  1.00 42.16 ? 13   GLN A CA  1 
ATOM   65    C  C   . GLN A 1 10  ? -7.194  25.495  66.368  1.00 42.51 ? 13   GLN A C   1 
ATOM   66    O  O   . GLN A 1 10  ? -8.274  25.508  65.779  1.00 42.42 ? 13   GLN A O   1 
ATOM   67    C  CB  . GLN A 1 10  ? -6.589  23.994  68.295  1.00 42.05 ? 13   GLN A CB  1 
ATOM   68    C  CG  . GLN A 1 10  ? -7.995  23.965  68.887  1.00 42.22 ? 13   GLN A CG  1 
ATOM   69    C  CD  . GLN A 1 10  ? -8.839  22.804  68.375  1.00 42.39 ? 13   GLN A CD  1 
ATOM   70    O  OE1 . GLN A 1 10  ? -8.329  21.716  68.117  1.00 42.34 ? 13   GLN A OE1 1 
ATOM   71    N  NE2 . GLN A 1 10  ? -10.143 23.033  68.238  1.00 42.49 ? 13   GLN A NE2 1 
ATOM   72    N  N   . HIS A 1 11  ? -6.515  26.607  66.637  1.00 42.76 ? 14   HIS A N   1 
ATOM   73    C  CA  . HIS A 1 11  ? -7.051  27.909  66.275  1.00 43.12 ? 14   HIS A CA  1 
ATOM   74    C  C   . HIS A 1 11  ? -7.275  28.027  64.784  1.00 43.06 ? 14   HIS A C   1 
ATOM   75    O  O   . HIS A 1 11  ? -8.256  28.620  64.349  1.00 43.01 ? 14   HIS A O   1 
ATOM   76    C  CB  . HIS A 1 11  ? -6.124  29.015  66.751  1.00 43.56 ? 14   HIS A CB  1 
ATOM   77    C  CG  . HIS A 1 11  ? -6.084  29.149  68.235  1.00 44.23 ? 14   HIS A CG  1 
ATOM   78    N  ND1 . HIS A 1 11  ? -5.159  29.932  68.890  1.00 44.59 ? 14   HIS A ND1 1 
ATOM   79    C  CD2 . HIS A 1 11  ? -6.855  28.588  69.197  1.00 44.43 ? 14   HIS A CD2 1 
ATOM   80    C  CE1 . HIS A 1 11  ? -5.360  29.845  70.194  1.00 44.78 ? 14   HIS A CE1 1 
ATOM   81    N  NE2 . HIS A 1 11  ? -6.383  29.036  70.406  1.00 44.74 ? 14   HIS A NE2 1 
ATOM   82    N  N   . TRP A 1 12  ? -6.370  27.448  64.005  1.00 43.12 ? 15   TRP A N   1 
ATOM   83    C  CA  . TRP A 1 12  ? -6.478  27.485  62.556  1.00 43.28 ? 15   TRP A CA  1 
ATOM   84    C  C   . TRP A 1 12  ? -7.746  26.761  62.139  1.00 43.86 ? 15   TRP A C   1 
ATOM   85    O  O   . TRP A 1 12  ? -8.503  27.246  61.304  1.00 43.69 ? 15   TRP A O   1 
ATOM   86    C  CB  . TRP A 1 12  ? -5.264  26.821  61.918  1.00 42.58 ? 15   TRP A CB  1 
ATOM   87    C  CG  . TRP A 1 12  ? -5.201  27.007  60.442  1.00 42.08 ? 15   TRP A CG  1 
ATOM   88    C  CD1 . TRP A 1 12  ? -4.567  28.011  59.770  1.00 41.87 ? 15   TRP A CD1 1 
ATOM   89    C  CD2 . TRP A 1 12  ? -5.800  26.170  59.441  1.00 41.85 ? 15   TRP A CD2 1 
ATOM   90    N  NE1 . TRP A 1 12  ? -4.731  27.855  58.415  1.00 41.78 ? 15   TRP A NE1 1 
ATOM   91    C  CE2 . TRP A 1 12  ? -5.485  26.733  58.184  1.00 41.80 ? 15   TRP A CE2 1 
ATOM   92    C  CE3 . TRP A 1 12  ? -6.571  24.999  59.483  1.00 41.57 ? 15   TRP A CE3 1 
ATOM   93    C  CZ2 . TRP A 1 12  ? -5.913  26.165  56.976  1.00 41.59 ? 15   TRP A CZ2 1 
ATOM   94    C  CZ3 . TRP A 1 12  ? -6.996  24.432  58.280  1.00 41.41 ? 15   TRP A CZ3 1 
ATOM   95    C  CH2 . TRP A 1 12  ? -6.664  25.017  57.047  1.00 41.34 ? 15   TRP A CH2 1 
ATOM   96    N  N   . LYS A 1 13  ? -7.974  25.598  62.740  1.00 44.70 ? 16   LYS A N   1 
ATOM   97    C  CA  . LYS A 1 13  ? -9.156  24.799  62.447  1.00 45.73 ? 16   LYS A CA  1 
ATOM   98    C  C   . LYS A 1 13  ? -10.418 25.591  62.766  1.00 46.70 ? 16   LYS A C   1 
ATOM   99    O  O   . LYS A 1 13  ? -11.342 25.675  61.950  1.00 46.68 ? 16   LYS A O   1 
ATOM   100   C  CB  . LYS A 1 13  ? -9.142  23.519  63.280  1.00 45.39 ? 16   LYS A CB  1 
ATOM   101   C  CG  . LYS A 1 13  ? -10.352 22.636  63.056  1.00 45.17 ? 16   LYS A CG  1 
ATOM   102   C  CD  . LYS A 1 13  ? -10.326 21.435  63.969  1.00 45.03 ? 16   LYS A CD  1 
ATOM   103   C  CE  . LYS A 1 13  ? -11.451 20.476  63.638  1.00 44.94 ? 16   LYS A CE  1 
ATOM   104   N  NZ  . LYS A 1 13  ? -11.338 19.247  64.460  1.00 45.05 ? 16   LYS A NZ  1 
ATOM   105   N  N   . GLU A 1 14  ? -10.427 26.189  63.957  1.00 47.98 ? 17   GLU A N   1 
ATOM   106   C  CA  . GLU A 1 14  ? -11.552 26.980  64.443  1.00 49.17 ? 17   GLU A CA  1 
ATOM   107   C  C   . GLU A 1 14  ? -11.881 28.192  63.587  1.00 50.18 ? 17   GLU A C   1 
ATOM   108   O  O   . GLU A 1 14  ? -13.053 28.478  63.367  1.00 50.20 ? 17   GLU A O   1 
ATOM   109   C  CB  . GLU A 1 14  ? -11.311 27.400  65.892  1.00 48.96 ? 17   GLU A CB  1 
ATOM   110   C  CG  . GLU A 1 14  ? -11.372 26.239  66.868  1.00 48.80 ? 17   GLU A CG  1 
ATOM   111   C  CD  . GLU A 1 14  ? -10.874 26.597  68.251  1.00 48.86 ? 17   GLU A CD  1 
ATOM   112   O  OE1 . GLU A 1 14  ? -10.378 27.727  68.452  1.00 48.88 ? 17   GLU A OE1 1 
ATOM   113   O  OE2 . GLU A 1 14  ? -10.968 25.736  69.147  1.00 48.89 ? 17   GLU A OE2 1 
ATOM   114   N  N   . GLN A 1 15  ? -10.862 28.891  63.087  1.00 51.47 ? 18   GLN A N   1 
ATOM   115   C  CA  . GLN A 1 15  ? -11.100 30.068  62.253  1.00 52.93 ? 18   GLN A CA  1 
ATOM   116   C  C   . GLN A 1 15  ? -11.846 29.652  60.990  1.00 53.58 ? 18   GLN A C   1 
ATOM   117   O  O   . GLN A 1 15  ? -12.470 30.479  60.325  1.00 53.75 ? 18   GLN A O   1 
ATOM   118   C  CB  . GLN A 1 15  ? -9.787  30.783  61.889  1.00 53.53 ? 18   GLN A CB  1 
ATOM   119   C  CG  . GLN A 1 15  ? -8.957  30.076  60.808  1.00 54.80 ? 18   GLN A CG  1 
ATOM   120   C  CD  . GLN A 1 15  ? -7.622  30.766  60.495  1.00 55.32 ? 18   GLN A CD  1 
ATOM   121   O  OE1 . GLN A 1 15  ? -7.120  31.587  61.278  1.00 55.46 ? 18   GLN A OE1 1 
ATOM   122   N  NE2 . GLN A 1 15  ? -7.037  30.417  59.347  1.00 55.49 ? 18   GLN A NE2 1 
ATOM   123   N  N   . ARG A 1 16  ? -11.780 28.364  60.670  1.00 54.41 ? 19   ARG A N   1 
ATOM   124   C  CA  . ARG A 1 16  ? -12.460 27.816  59.501  1.00 55.30 ? 19   ARG A CA  1 
ATOM   125   C  C   . ARG A 1 16  ? -13.667 26.990  59.947  1.00 55.73 ? 19   ARG A C   1 
ATOM   126   O  O   . ARG A 1 16  ? -13.841 25.846  59.523  1.00 55.95 ? 19   ARG A O   1 
ATOM   127   C  CB  . ARG A 1 16  ? -11.493 26.946  58.701  1.00 55.54 ? 19   ARG A CB  1 
ATOM   128   C  CG  . ARG A 1 16  ? -10.350 27.715  58.078  1.00 56.01 ? 19   ARG A CG  1 
ATOM   129   C  CD  . ARG A 1 16  ? -9.497  26.808  57.216  1.00 56.70 ? 19   ARG A CD  1 
ATOM   130   N  NE  . ARG A 1 16  ? -10.260 26.101  56.179  1.00 57.31 ? 19   ARG A NE  1 
ATOM   131   C  CZ  . ARG A 1 16  ? -10.212 26.386  54.877  1.00 57.51 ? 19   ARG A CZ  1 
ATOM   132   N  NH1 . ARG A 1 16  ? -9.439  27.374  54.430  1.00 57.46 ? 19   ARG A NH1 1 
ATOM   133   N  NH2 . ARG A 1 16  ? -10.917 25.659  54.013  1.00 57.58 ? 19   ARG A NH2 1 
ATOM   134   N  N   . ALA A 1 17  ? -14.500 27.585  60.798  1.00 56.17 ? 20   ALA A N   1 
ATOM   135   C  CA  . ALA A 1 17  ? -15.694 26.926  61.339  1.00 56.52 ? 20   ALA A CA  1 
ATOM   136   C  C   . ALA A 1 17  ? -16.624 26.347  60.268  1.00 56.65 ? 20   ALA A C   1 
ATOM   137   O  O   . ALA A 1 17  ? -16.677 25.125  60.073  1.00 56.54 ? 20   ALA A O   1 
ATOM   138   C  CB  . ALA A 1 17  ? -16.465 27.899  62.246  1.00 56.66 ? 20   ALA A CB  1 
ATOM   139   N  N   . ALA A 1 18  ? -17.390 27.226  59.622  1.00 56.72 ? 21   ALA A N   1 
ATOM   140   C  CA  . ALA A 1 18  ? -18.315 26.828  58.562  1.00 56.74 ? 21   ALA A CA  1 
ATOM   141   C  C   . ALA A 1 18  ? -17.571 27.064  57.259  1.00 56.61 ? 21   ALA A C   1 
ATOM   142   O  O   . ALA A 1 18  ? -17.844 28.025  56.535  1.00 56.99 ? 21   ALA A O   1 
ATOM   143   C  CB  . ALA A 1 18  ? -19.586 27.684  58.620  1.00 56.87 ? 21   ALA A CB  1 
ATOM   144   N  N   . GLN A 1 19  ? -16.642 26.170  56.945  1.00 56.25 ? 22   GLN A N   1 
ATOM   145   C  CA  . GLN A 1 19  ? -15.844 26.354  55.753  1.00 55.80 ? 22   GLN A CA  1 
ATOM   146   C  C   . GLN A 1 19  ? -15.849 25.229  54.730  1.00 55.24 ? 22   GLN A C   1 
ATOM   147   O  O   . GLN A 1 19  ? -16.246 25.451  53.577  1.00 55.57 ? 22   GLN A O   1 
ATOM   148   C  CB  . GLN A 1 19  ? -14.406 26.643  56.160  1.00 56.27 ? 22   GLN A CB  1 
ATOM   149   C  CG  . GLN A 1 19  ? -13.596 27.348  55.100  1.00 56.81 ? 22   GLN A CG  1 
ATOM   150   C  CD  . GLN A 1 19  ? -13.620 28.844  55.270  1.00 57.21 ? 22   GLN A CD  1 
ATOM   151   O  OE1 . GLN A 1 19  ? -13.775 29.359  56.386  1.00 57.53 ? 22   GLN A OE1 1 
ATOM   152   N  NE2 . GLN A 1 19  ? -13.451 29.560  54.166  1.00 57.59 ? 22   GLN A NE2 1 
ATOM   153   N  N   . LYS A 1 20  ? -15.403 24.041  55.151  1.00 54.05 ? 23   LYS A N   1 
ATOM   154   C  CA  . LYS A 1 20  ? -15.267 22.866  54.276  1.00 52.90 ? 23   LYS A CA  1 
ATOM   155   C  C   . LYS A 1 20  ? -13.864 22.947  53.653  1.00 51.89 ? 23   LYS A C   1 
ATOM   156   O  O   . LYS A 1 20  ? -13.477 23.972  53.087  1.00 51.75 ? 23   LYS A O   1 
ATOM   157   C  CB  . LYS A 1 20  ? -16.370 22.812  53.199  1.00 53.00 ? 23   LYS A CB  1 
ATOM   158   C  CG  . LYS A 1 20  ? -15.997 22.091  51.917  1.00 53.21 ? 23   LYS A CG  1 
ATOM   159   C  CD  . LYS A 1 20  ? -16.667 20.736  51.789  1.00 53.54 ? 23   LYS A CD  1 
ATOM   160   C  CE  . LYS A 1 20  ? -16.361 20.122  50.418  1.00 53.86 ? 23   LYS A CE  1 
ATOM   161   N  NZ  . LYS A 1 20  ? -17.082 18.832  50.160  1.00 53.86 ? 23   LYS A NZ  1 
ATOM   162   N  N   . ALA A 1 21  ? -13.094 21.874  53.808  1.00 50.70 ? 24   ALA A N   1 
ATOM   163   C  CA  . ALA A 1 21  ? -11.721 21.799  53.315  1.00 49.37 ? 24   ALA A CA  1 
ATOM   164   C  C   . ALA A 1 21  ? -11.540 22.011  51.822  1.00 48.46 ? 24   ALA A C   1 
ATOM   165   O  O   . ALA A 1 21  ? -12.438 21.738  51.021  1.00 48.29 ? 24   ALA A O   1 
ATOM   166   C  CB  . ALA A 1 21  ? -11.094 20.474  53.721  1.00 49.28 ? 24   ALA A CB  1 
ATOM   167   N  N   . ASP A 1 22  ? -10.363 22.513  51.463  1.00 47.35 ? 25   ASP A N   1 
ATOM   168   C  CA  . ASP A 1 22  ? -10.017 22.743  50.070  1.00 46.23 ? 25   ASP A CA  1 
ATOM   169   C  C   . ASP A 1 22  ? -9.694  21.404  49.433  1.00 45.45 ? 25   ASP A C   1 
ATOM   170   O  O   . ASP A 1 22  ? -9.402  20.425  50.117  1.00 45.27 ? 25   ASP A O   1 
ATOM   171   C  CB  . ASP A 1 22  ? -8.792  23.655  49.955  1.00 46.35 ? 25   ASP A CB  1 
ATOM   172   C  CG  . ASP A 1 22  ? -9.082  25.080  50.370  1.00 46.44 ? 25   ASP A CG  1 
ATOM   173   O  OD1 . ASP A 1 22  ? -8.325  25.636  51.192  1.00 46.70 ? 25   ASP A OD1 1 
ATOM   174   O  OD2 . ASP A 1 22  ? -10.065 25.652  49.867  1.00 46.68 ? 25   ASP A OD2 1 
ATOM   175   N  N   . VAL A 1 23  ? -9.786  21.355  48.114  1.00 44.53 ? 26   VAL A N   1 
ATOM   176   C  CA  . VAL A 1 23  ? -9.471  20.138  47.391  1.00 43.49 ? 26   VAL A CA  1 
ATOM   177   C  C   . VAL A 1 23  ? -7.946  20.047  47.284  1.00 43.00 ? 26   VAL A C   1 
ATOM   178   O  O   . VAL A 1 23  ? -7.283  21.003  46.878  1.00 42.97 ? 26   VAL A O   1 
ATOM   179   C  CB  . VAL A 1 23  ? -10.107 20.144  45.972  1.00 43.32 ? 26   VAL A CB  1 
ATOM   180   C  CG1 . VAL A 1 23  ? -9.671  18.927  45.186  1.00 42.96 ? 26   VAL A CG1 1 
ATOM   181   C  CG2 . VAL A 1 23  ? -11.617 20.186  46.076  1.00 42.90 ? 26   VAL A CG2 1 
ATOM   182   N  N   . LEU A 1 24  ? -7.397  18.920  47.716  1.00 42.12 ? 27   LEU A N   1 
ATOM   183   C  CA  . LEU A 1 24  ? -5.964  18.673  47.658  1.00 41.25 ? 27   LEU A CA  1 
ATOM   184   C  C   . LEU A 1 24  ? -5.545  18.581  46.193  1.00 40.95 ? 27   LEU A C   1 
ATOM   185   O  O   . LEU A 1 24  ? -6.118  17.806  45.426  1.00 40.70 ? 27   LEU A O   1 
ATOM   186   C  CB  . LEU A 1 24  ? -5.667  17.365  48.385  1.00 41.09 ? 27   LEU A CB  1 
ATOM   187   C  CG  . LEU A 1 24  ? -4.281  16.738  48.430  1.00 40.83 ? 27   LEU A CG  1 
ATOM   188   C  CD1 . LEU A 1 24  ? -3.228  17.745  48.811  1.00 40.85 ? 27   LEU A CD1 1 
ATOM   189   C  CD2 . LEU A 1 24  ? -4.331  15.621  49.441  1.00 40.77 ? 27   LEU A CD2 1 
ATOM   190   N  N   . THR A 1 25  ? -4.550  19.377  45.805  1.00 40.48 ? 28   THR A N   1 
ATOM   191   C  CA  . THR A 1 25  ? -4.075  19.394  44.422  1.00 39.96 ? 28   THR A CA  1 
ATOM   192   C  C   . THR A 1 25  ? -2.569  19.194  44.290  1.00 39.68 ? 28   THR A C   1 
ATOM   193   O  O   . THR A 1 25  ? -1.843  19.166  45.282  1.00 39.59 ? 28   THR A O   1 
ATOM   194   C  CB  . THR A 1 25  ? -4.391  20.747  43.730  1.00 40.11 ? 28   THR A CB  1 
ATOM   195   O  OG1 . THR A 1 25  ? -3.617  21.785  44.342  1.00 40.01 ? 28   THR A OG1 1 
ATOM   196   C  CG2 . THR A 1 25  ? -5.865  21.101  43.840  1.00 40.01 ? 28   THR A CG2 1 
ATOM   197   N  N   . THR A 1 26  ? -2.115  19.039  43.049  1.00 39.36 ? 29   THR A N   1 
ATOM   198   C  CA  . THR A 1 26  ? -0.692  18.905  42.751  1.00 38.91 ? 29   THR A CA  1 
ATOM   199   C  C   . THR A 1 26  ? -0.192  20.349  42.656  1.00 38.85 ? 29   THR A C   1 
ATOM   200   O  O   . THR A 1 26  ? -0.990  21.283  42.754  1.00 38.78 ? 29   THR A O   1 
ATOM   201   C  CB  . THR A 1 26  ? -0.453  18.221  41.389  1.00 38.69 ? 29   THR A CB  1 
ATOM   202   O  OG1 . THR A 1 26  ? -0.937  19.062  40.337  1.00 38.25 ? 29   THR A OG1 1 
ATOM   203   C  CG2 . THR A 1 26  ? -1.169  16.896  41.322  1.00 38.49 ? 29   THR A CG2 1 
ATOM   204   N  N   . GLY A 1 27  ? 1.109   20.544  42.466  1.00 38.61 ? 30   GLY A N   1 
ATOM   205   C  CA  . GLY A 1 27  ? 1.632   21.895  42.351  1.00 38.40 ? 30   GLY A CA  1 
ATOM   206   C  C   . GLY A 1 27  ? 0.998   22.661  41.199  1.00 38.34 ? 30   GLY A C   1 
ATOM   207   O  O   . GLY A 1 27  ? 0.825   23.875  41.277  1.00 38.29 ? 30   GLY A O   1 
ATOM   208   N  N   . ALA A 1 28  ? 0.625   21.948  40.140  1.00 38.56 ? 31   ALA A N   1 
ATOM   209   C  CA  . ALA A 1 28  ? 0.010   22.554  38.958  1.00 38.27 ? 31   ALA A CA  1 
ATOM   210   C  C   . ALA A 1 28  ? -1.500  22.752  39.070  1.00 38.47 ? 31   ALA A C   1 
ATOM   211   O  O   . ALA A 1 28  ? -2.161  23.063  38.080  1.00 38.46 ? 31   ALA A O   1 
ATOM   212   C  CB  . ALA A 1 28  ? 0.334   21.738  37.726  1.00 38.29 ? 31   ALA A CB  1 
ATOM   213   N  N   . GLY A 1 29  ? -2.046  22.547  40.266  1.00 38.72 ? 32   GLY A N   1 
ATOM   214   C  CA  . GLY A 1 29  ? -3.471  22.737  40.489  1.00 38.94 ? 32   GLY A CA  1 
ATOM   215   C  C   . GLY A 1 29  ? -4.415  21.605  40.125  1.00 39.03 ? 32   GLY A C   1 
ATOM   216   O  O   . GLY A 1 29  ? -5.633  21.767  40.209  1.00 39.00 ? 32   GLY A O   1 
ATOM   217   N  N   . ASN A 1 30  ? -3.869  20.460  39.728  1.00 39.35 ? 33   ASN A N   1 
ATOM   218   C  CA  . ASN A 1 30  ? -4.688  19.311  39.355  1.00 39.44 ? 33   ASN A CA  1 
ATOM   219   C  C   . ASN A 1 30  ? -5.172  18.593  40.607  1.00 39.50 ? 33   ASN A C   1 
ATOM   220   O  O   . ASN A 1 30  ? -4.380  18.282  41.495  1.00 39.39 ? 33   ASN A O   1 
ATOM   221   C  CB  . ASN A 1 30  ? -3.885  18.341  38.484  1.00 39.80 ? 33   ASN A CB  1 
ATOM   222   C  CG  . ASN A 1 30  ? -3.177  19.035  37.330  1.00 40.20 ? 33   ASN A CG  1 
ATOM   223   O  OD1 . ASN A 1 30  ? -2.002  18.781  37.061  1.00 40.48 ? 33   ASN A OD1 1 
ATOM   224   N  ND2 . ASN A 1 30  ? -3.887  19.924  36.650  1.00 40.50 ? 33   ASN A ND2 1 
ATOM   225   N  N   . PRO A 1 31  ? -6.491  18.352  40.709  1.00 39.53 ? 34   PRO A N   1 
ATOM   226   C  CA  . PRO A 1 31  ? -7.108  17.668  41.852  1.00 39.55 ? 34   PRO A CA  1 
ATOM   227   C  C   . PRO A 1 31  ? -6.482  16.288  42.090  1.00 39.62 ? 34   PRO A C   1 
ATOM   228   O  O   . PRO A 1 31  ? -6.130  15.590  41.136  1.00 39.59 ? 34   PRO A O   1 
ATOM   229   C  CB  . PRO A 1 31  ? -8.565  17.540  41.408  1.00 39.58 ? 34   PRO A CB  1 
ATOM   230   C  CG  . PRO A 1 31  ? -8.768  18.752  40.572  1.00 39.51 ? 34   PRO A CG  1 
ATOM   231   C  CD  . PRO A 1 31  ? -7.518  18.767  39.737  1.00 39.57 ? 34   PRO A CD  1 
ATOM   232   N  N   . VAL A 1 32  ? -6.330  15.905  43.355  1.00 39.58 ? 35   VAL A N   1 
ATOM   233   C  CA  . VAL A 1 32  ? -5.742  14.607  43.696  1.00 39.43 ? 35   VAL A CA  1 
ATOM   234   C  C   . VAL A 1 32  ? -6.814  13.660  44.225  1.00 39.40 ? 35   VAL A C   1 
ATOM   235   O  O   . VAL A 1 32  ? -7.529  13.991  45.171  1.00 39.43 ? 35   VAL A O   1 
ATOM   236   C  CB  . VAL A 1 32  ? -4.609  14.748  44.754  1.00 39.42 ? 35   VAL A CB  1 
ATOM   237   C  CG1 . VAL A 1 32  ? -4.080  13.380  45.159  1.00 39.29 ? 35   VAL A CG1 1 
ATOM   238   C  CG2 . VAL A 1 32  ? -3.472  15.589  44.201  1.00 39.19 ? 35   VAL A CG2 1 
ATOM   239   N  N   . GLY A 1 33  ? -6.910  12.481  43.613  1.00 39.43 ? 36   GLY A N   1 
ATOM   240   C  CA  . GLY A 1 33  ? -7.893  11.486  44.020  1.00 39.13 ? 36   GLY A CA  1 
ATOM   241   C  C   . GLY A 1 33  ? -7.527  10.674  45.251  1.00 38.93 ? 36   GLY A C   1 
ATOM   242   O  O   . GLY A 1 33  ? -8.387  10.395  46.088  1.00 39.07 ? 36   GLY A O   1 
ATOM   243   N  N   . ASP A 1 34  ? -6.262  10.275  45.352  1.00 38.63 ? 37   ASP A N   1 
ATOM   244   C  CA  . ASP A 1 34  ? -5.777  9.503   46.486  1.00 38.27 ? 37   ASP A CA  1 
ATOM   245   C  C   . ASP A 1 34  ? -4.315  9.837   46.699  1.00 37.99 ? 37   ASP A C   1 
ATOM   246   O  O   . ASP A 1 34  ? -3.469  9.452   45.897  1.00 37.93 ? 37   ASP A O   1 
ATOM   247   C  CB  . ASP A 1 34  ? -5.923  8.005   46.217  1.00 38.38 ? 37   ASP A CB  1 
ATOM   248   C  CG  . ASP A 1 34  ? -5.471  7.142   47.394  1.00 38.71 ? 37   ASP A CG  1 
ATOM   249   O  OD1 . ASP A 1 34  ? -5.118  7.679   48.466  1.00 38.94 ? 37   ASP A OD1 1 
ATOM   250   O  OD2 . ASP A 1 34  ? -5.476  5.903   47.251  1.00 39.14 ? 37   ASP A OD2 1 
ATOM   251   N  N   . LYS A 1 35  ? -4.020  10.551  47.780  1.00 37.63 ? 38   LYS A N   1 
ATOM   252   C  CA  . LYS A 1 35  ? -2.647  10.922  48.073  1.00 37.38 ? 38   LYS A CA  1 
ATOM   253   C  C   . LYS A 1 35  ? -2.130  10.150  49.271  1.00 37.36 ? 38   LYS A C   1 
ATOM   254   O  O   . LYS A 1 35  ? -1.272  10.632  50.006  1.00 37.29 ? 38   LYS A O   1 
ATOM   255   C  CB  . LYS A 1 35  ? -2.532  12.422  48.340  1.00 37.01 ? 38   LYS A CB  1 
ATOM   256   C  CG  . LYS A 1 35  ? -1.147  12.970  48.035  1.00 36.59 ? 38   LYS A CG  1 
ATOM   257   C  CD  . LYS A 1 35  ? -0.803  14.190  48.860  1.00 36.18 ? 38   LYS A CD  1 
ATOM   258   C  CE  . LYS A 1 35  ? -0.576  13.828  50.312  1.00 36.09 ? 38   LYS A CE  1 
ATOM   259   N  NZ  . LYS A 1 35  ? 0.542   12.858  50.480  1.00 35.93 ? 38   LYS A NZ  1 
ATOM   260   N  N   . LEU A 1 36  ? -2.639  8.939   49.458  1.00 37.25 ? 39   LEU A N   1 
ATOM   261   C  CA  . LEU A 1 36  ? -2.217  8.110   50.582  1.00 37.13 ? 39   LEU A CA  1 
ATOM   262   C  C   . LEU A 1 36  ? -1.647  6.773   50.129  1.00 37.07 ? 39   LEU A C   1 
ATOM   263   O  O   . LEU A 1 36  ? -1.103  6.024   50.937  1.00 37.03 ? 39   LEU A O   1 
ATOM   264   C  CB  . LEU A 1 36  ? -3.379  7.896   51.567  1.00 37.12 ? 39   LEU A CB  1 
ATOM   265   C  CG  . LEU A 1 36  ? -3.998  9.132   52.246  1.00 36.82 ? 39   LEU A CG  1 
ATOM   266   C  CD1 . LEU A 1 36  ? -5.192  8.726   53.084  1.00 36.50 ? 39   LEU A CD1 1 
ATOM   267   C  CD2 . LEU A 1 36  ? -2.964  9.838   53.108  1.00 36.73 ? 39   LEU A CD2 1 
ATOM   268   N  N   . ASN A 1 37  ? -1.760  6.488   48.833  1.00 37.11 ? 40   ASN A N   1 
ATOM   269   C  CA  . ASN A 1 37  ? -1.245  5.247   48.248  1.00 37.15 ? 40   ASN A CA  1 
ATOM   270   C  C   . ASN A 1 37  ? -0.669  5.519   46.858  1.00 37.18 ? 40   ASN A C   1 
ATOM   271   O  O   . ASN A 1 37  ? -1.261  6.258   46.068  1.00 37.09 ? 40   ASN A O   1 
ATOM   272   C  CB  . ASN A 1 37  ? -2.352  4.193   48.128  1.00 37.12 ? 40   ASN A CB  1 
ATOM   273   C  CG  . ASN A 1 37  ? -2.977  3.844   49.463  1.00 37.26 ? 40   ASN A CG  1 
ATOM   274   O  OD1 . ASN A 1 37  ? -2.407  3.088   50.256  1.00 37.14 ? 40   ASN A OD1 1 
ATOM   275   N  ND2 . ASN A 1 37  ? -4.163  4.390   49.719  1.00 37.43 ? 40   ASN A ND2 1 
ATOM   276   N  N   . VAL A 1 38  ? 0.483   4.924   46.561  1.00 37.04 ? 41   VAL A N   1 
ATOM   277   C  CA  . VAL A 1 38  ? 1.119   5.112   45.260  1.00 36.88 ? 41   VAL A CA  1 
ATOM   278   C  C   . VAL A 1 38  ? 0.595   4.109   44.247  1.00 36.97 ? 41   VAL A C   1 
ATOM   279   O  O   . VAL A 1 38  ? -0.064  3.141   44.606  1.00 37.03 ? 41   VAL A O   1 
ATOM   280   C  CB  . VAL A 1 38  ? 2.667   4.994   45.336  1.00 36.69 ? 41   VAL A CB  1 
ATOM   281   C  CG1 . VAL A 1 38  ? 3.244   6.106   46.183  1.00 36.41 ? 41   VAL A CG1 1 
ATOM   282   C  CG2 . VAL A 1 38  ? 3.073   3.650   45.890  1.00 36.38 ? 41   VAL A CG2 1 
ATOM   283   N  N   . ILE A 1 39  ? 0.877   4.358   42.977  1.00 37.16 ? 42   ILE A N   1 
ATOM   284   C  CA  . ILE A 1 39  ? 0.443   3.473   41.907  1.00 37.42 ? 42   ILE A CA  1 
ATOM   285   C  C   . ILE A 1 39  ? 1.429   2.316   41.736  1.00 37.81 ? 42   ILE A C   1 
ATOM   286   O  O   . ILE A 1 39  ? 2.624   2.533   41.537  1.00 37.75 ? 42   ILE A O   1 
ATOM   287   C  CB  . ILE A 1 39  ? 0.337   4.225   40.556  1.00 37.26 ? 42   ILE A CB  1 
ATOM   288   C  CG1 . ILE A 1 39  ? -0.660  5.375   40.652  1.00 37.11 ? 42   ILE A CG1 1 
ATOM   289   C  CG2 . ILE A 1 39  ? -0.117  3.279   39.455  1.00 37.23 ? 42   ILE A CG2 1 
ATOM   290   C  CD1 . ILE A 1 39  ? -0.820  6.138   39.358  1.00 37.04 ? 42   ILE A CD1 1 
ATOM   291   N  N   . THR A 1 40  ? 0.920   1.090   41.816  1.00 38.12 ? 43   THR A N   1 
ATOM   292   C  CA  . THR A 1 40  ? 1.743   -0.104  41.644  1.00 38.43 ? 43   THR A CA  1 
ATOM   293   C  C   . THR A 1 40  ? 1.022   -1.080  40.718  1.00 38.79 ? 43   THR A C   1 
ATOM   294   O  O   . THR A 1 40  ? -0.169  -0.918  40.442  1.00 38.96 ? 43   THR A O   1 
ATOM   295   C  CB  . THR A 1 40  ? 2.011   -0.816  42.982  1.00 38.31 ? 43   THR A CB  1 
ATOM   296   O  OG1 . THR A 1 40  ? 0.766   -1.166  43.596  1.00 38.29 ? 43   THR A OG1 1 
ATOM   297   C  CG2 . THR A 1 40  ? 2.800   0.076   43.918  1.00 38.21 ? 43   THR A CG2 1 
ATOM   298   N  N   . VAL A 1 41  ? 1.755   -2.048  40.177  1.00 39.13 ? 44   VAL A N   1 
ATOM   299   C  CA  . VAL A 1 41  ? 1.147   -3.058  39.311  1.00 39.35 ? 44   VAL A CA  1 
ATOM   300   C  C   . VAL A 1 41  ? 0.806   -4.276  40.180  1.00 39.28 ? 44   VAL A C   1 
ATOM   301   O  O   . VAL A 1 41  ? 1.646   -5.154  40.436  1.00 39.22 ? 44   VAL A O   1 
ATOM   302   C  CB  . VAL A 1 41  ? 2.059   -3.425  38.111  1.00 39.53 ? 44   VAL A CB  1 
ATOM   303   C  CG1 . VAL A 1 41  ? 3.493   -3.548  38.554  1.00 39.83 ? 44   VAL A CG1 1 
ATOM   304   C  CG2 . VAL A 1 41  ? 1.588   -4.713  37.452  1.00 39.59 ? 44   VAL A CG2 1 
ATOM   305   N  N   . GLY A 1 42  ? -0.445  -4.307  40.630  1.00 39.09 ? 45   GLY A N   1 
ATOM   306   C  CA  . GLY A 1 42  ? -0.901  -5.368  41.502  1.00 38.78 ? 45   GLY A CA  1 
ATOM   307   C  C   . GLY A 1 42  ? -0.656  -4.867  42.911  1.00 38.71 ? 45   GLY A C   1 
ATOM   308   O  O   . GLY A 1 42  ? 0.130   -3.937  43.098  1.00 38.78 ? 45   GLY A O   1 
ATOM   309   N  N   . PRO A 1 43  ? -1.302  -5.449  43.928  1.00 38.55 ? 46   PRO A N   1 
ATOM   310   C  CA  . PRO A 1 43  ? -1.104  -5.002  45.307  1.00 38.43 ? 46   PRO A CA  1 
ATOM   311   C  C   . PRO A 1 43  ? 0.316   -5.154  45.829  1.00 38.53 ? 46   PRO A C   1 
ATOM   312   O  O   . PRO A 1 43  ? 0.674   -4.528  46.820  1.00 38.61 ? 46   PRO A O   1 
ATOM   313   C  CB  . PRO A 1 43  ? -2.096  -5.862  46.088  1.00 38.52 ? 46   PRO A CB  1 
ATOM   314   C  CG  . PRO A 1 43  ? -2.186  -7.103  45.271  1.00 38.45 ? 46   PRO A CG  1 
ATOM   315   C  CD  . PRO A 1 43  ? -2.260  -6.561  43.870  1.00 38.44 ? 46   PRO A CD  1 
ATOM   316   N  N   . ARG A 1 44  ? 1.126   -5.980  45.174  1.00 38.69 ? 47   ARG A N   1 
ATOM   317   C  CA  . ARG A 1 44  ? 2.505   -6.174  45.610  1.00 38.63 ? 47   ARG A CA  1 
ATOM   318   C  C   . ARG A 1 44  ? 3.504   -5.990  44.477  1.00 38.59 ? 47   ARG A C   1 
ATOM   319   O  O   . ARG A 1 44  ? 4.549   -6.638  44.450  1.00 38.61 ? 47   ARG A O   1 
ATOM   320   C  CB  . ARG A 1 44  ? 2.683   -7.545  46.270  1.00 38.73 ? 47   ARG A CB  1 
ATOM   321   C  CG  . ARG A 1 44  ? 1.912   -7.699  47.571  1.00 38.98 ? 47   ARG A CG  1 
ATOM   322   C  CD  . ARG A 1 44  ? 2.202   -9.026  48.246  1.00 39.32 ? 47   ARG A CD  1 
ATOM   323   N  NE  . ARG A 1 44  ? 1.466   -9.160  49.503  1.00 39.67 ? 47   ARG A NE  1 
ATOM   324   C  CZ  . ARG A 1 44  ? 1.455   -10.258 50.257  1.00 39.82 ? 47   ARG A CZ  1 
ATOM   325   N  NH1 . ARG A 1 44  ? 0.754   -10.283 51.386  1.00 39.80 ? 47   ARG A NH1 1 
ATOM   326   N  NH2 . ARG A 1 44  ? 2.146   -11.330 49.886  1.00 39.84 ? 47   ARG A NH2 1 
ATOM   327   N  N   . GLY A 1 45  ? 3.187   -5.081  43.558  1.00 38.65 ? 48   GLY A N   1 
ATOM   328   C  CA  . GLY A 1 45  ? 4.071   -4.811  42.435  1.00 38.53 ? 48   GLY A CA  1 
ATOM   329   C  C   . GLY A 1 45  ? 4.866   -3.526  42.599  1.00 38.47 ? 48   GLY A C   1 
ATOM   330   O  O   . GLY A 1 45  ? 4.614   -2.766  43.535  1.00 38.58 ? 48   GLY A O   1 
ATOM   331   N  N   . PRO A 1 46  ? 5.832   -3.249  41.700  1.00 38.41 ? 49   PRO A N   1 
ATOM   332   C  CA  . PRO A 1 46  ? 6.682   -2.051  41.728  1.00 38.22 ? 49   PRO A CA  1 
ATOM   333   C  C   . PRO A 1 46  ? 5.956   -0.739  41.425  1.00 38.07 ? 49   PRO A C   1 
ATOM   334   O  O   . PRO A 1 46  ? 4.839   -0.742  40.908  1.00 37.99 ? 49   PRO A O   1 
ATOM   335   C  CB  . PRO A 1 46  ? 7.745   -2.368  40.673  1.00 38.37 ? 49   PRO A CB  1 
ATOM   336   C  CG  . PRO A 1 46  ? 7.006   -3.211  39.700  1.00 38.39 ? 49   PRO A CG  1 
ATOM   337   C  CD  . PRO A 1 46  ? 6.255   -4.148  40.613  1.00 38.49 ? 49   PRO A CD  1 
ATOM   338   N  N   . LEU A 1 47  ? 6.618   0.373   41.745  1.00 37.74 ? 50   LEU A N   1 
ATOM   339   C  CA  . LEU A 1 47  ? 6.088   1.725   41.549  1.00 37.29 ? 50   LEU A CA  1 
ATOM   340   C  C   . LEU A 1 47  ? 6.217   2.225   40.115  1.00 37.20 ? 50   LEU A C   1 
ATOM   341   O  O   . LEU A 1 47  ? 7.245   2.035   39.465  1.00 37.16 ? 50   LEU A O   1 
ATOM   342   C  CB  . LEU A 1 47  ? 6.805   2.691   42.497  1.00 37.01 ? 50   LEU A CB  1 
ATOM   343   C  CG  . LEU A 1 47  ? 6.535   4.193   42.440  1.00 36.84 ? 50   LEU A CG  1 
ATOM   344   C  CD1 . LEU A 1 47  ? 5.102   4.500   42.820  1.00 36.88 ? 50   LEU A CD1 1 
ATOM   345   C  CD2 . LEU A 1 47  ? 7.487   4.894   43.379  1.00 36.78 ? 50   LEU A CD2 1 
ATOM   346   N  N   . LEU A 1 48  ? 5.176   2.896   39.638  1.00 37.16 ? 51   LEU A N   1 
ATOM   347   C  CA  . LEU A 1 48  ? 5.169   3.428   38.285  1.00 37.11 ? 51   LEU A CA  1 
ATOM   348   C  C   . LEU A 1 48  ? 5.520   4.902   38.169  1.00 36.94 ? 51   LEU A C   1 
ATOM   349   O  O   . LEU A 1 48  ? 5.149   5.713   39.016  1.00 36.67 ? 51   LEU A O   1 
ATOM   350   C  CB  . LEU A 1 48  ? 3.818   3.194   37.622  1.00 37.51 ? 51   LEU A CB  1 
ATOM   351   C  CG  . LEU A 1 48  ? 3.504   1.755   37.240  1.00 37.86 ? 51   LEU A CG  1 
ATOM   352   C  CD1 . LEU A 1 48  ? 3.022   0.994   38.450  1.00 38.19 ? 51   LEU A CD1 1 
ATOM   353   C  CD2 . LEU A 1 48  ? 2.432   1.772   36.194  1.00 38.36 ? 51   LEU A CD2 1 
ATOM   354   N  N   . VAL A 1 49  ? 6.201   5.236   37.079  1.00 36.74 ? 52   VAL A N   1 
ATOM   355   C  CA  . VAL A 1 49  ? 6.600   6.603   36.795  1.00 36.61 ? 52   VAL A CA  1 
ATOM   356   C  C   . VAL A 1 49  ? 5.382   7.476   36.547  1.00 36.66 ? 52   VAL A C   1 
ATOM   357   O  O   . VAL A 1 49  ? 5.439   8.684   36.761  1.00 36.31 ? 52   VAL A O   1 
ATOM   358   C  CB  . VAL A 1 49  ? 7.522   6.659   35.552  1.00 36.74 ? 52   VAL A CB  1 
ATOM   359   C  CG1 . VAL A 1 49  ? 7.700   8.093   35.064  1.00 36.67 ? 52   VAL A CG1 1 
ATOM   360   C  CG2 . VAL A 1 49  ? 8.872   6.056   35.883  1.00 36.72 ? 52   VAL A CG2 1 
ATOM   361   N  N   . GLN A 1 50  ? 4.276   6.876   36.108  1.00 36.76 ? 53   GLN A N   1 
ATOM   362   C  CA  . GLN A 1 50  ? 3.079   7.666   35.830  1.00 37.04 ? 53   GLN A CA  1 
ATOM   363   C  C   . GLN A 1 50  ? 2.361   8.184   37.067  1.00 37.13 ? 53   GLN A C   1 
ATOM   364   O  O   . GLN A 1 50  ? 1.338   8.861   36.968  1.00 37.08 ? 53   GLN A O   1 
ATOM   365   C  CB  . GLN A 1 50  ? 2.128   6.957   34.860  1.00 37.12 ? 53   GLN A CB  1 
ATOM   366   C  CG  . GLN A 1 50  ? 1.501   5.679   35.353  1.00 37.38 ? 53   GLN A CG  1 
ATOM   367   C  CD  . GLN A 1 50  ? 0.744   4.967   34.251  1.00 37.57 ? 53   GLN A CD  1 
ATOM   368   O  OE1 . GLN A 1 50  ? 1.124   5.032   33.074  1.00 37.52 ? 53   GLN A OE1 1 
ATOM   369   N  NE2 . GLN A 1 50  ? -0.331  4.278   34.622  1.00 37.67 ? 53   GLN A NE2 1 
ATOM   370   N  N   . ASP A 1 51  ? 2.895   7.860   38.240  1.00 37.16 ? 54   ASP A N   1 
ATOM   371   C  CA  . ASP A 1 51  ? 2.331   8.373   39.479  1.00 37.10 ? 54   ASP A CA  1 
ATOM   372   C  C   . ASP A 1 51  ? 3.028   9.715   39.680  1.00 37.03 ? 54   ASP A C   1 
ATOM   373   O  O   . ASP A 1 51  ? 4.020   9.814   40.416  1.00 36.97 ? 54   ASP A O   1 
ATOM   374   C  CB  . ASP A 1 51  ? 2.639   7.450   40.661  1.00 37.20 ? 54   ASP A CB  1 
ATOM   375   C  CG  . ASP A 1 51  ? 1.960   7.899   41.961  1.00 37.32 ? 54   ASP A CG  1 
ATOM   376   O  OD1 . ASP A 1 51  ? 2.073   7.159   42.957  1.00 37.57 ? 54   ASP A OD1 1 
ATOM   377   O  OD2 . ASP A 1 51  ? 1.315   8.975   42.005  1.00 37.29 ? 54   ASP A OD2 1 
ATOM   378   N  N   . VAL A 1 52  ? 2.543   10.732  38.975  1.00 36.79 ? 55   VAL A N   1 
ATOM   379   C  CA  . VAL A 1 52  ? 3.126   12.060  39.078  1.00 36.51 ? 55   VAL A CA  1 
ATOM   380   C  C   . VAL A 1 52  ? 2.702   12.764  40.356  1.00 36.29 ? 55   VAL A C   1 
ATOM   381   O  O   . VAL A 1 52  ? 3.387   13.672  40.814  1.00 36.26 ? 55   VAL A O   1 
ATOM   382   C  CB  . VAL A 1 52  ? 2.814   12.924  37.845  1.00 36.54 ? 55   VAL A CB  1 
ATOM   383   C  CG1 . VAL A 1 52  ? 3.335   12.234  36.595  1.00 36.25 ? 55   VAL A CG1 1 
ATOM   384   C  CG2 . VAL A 1 52  ? 1.327   13.170  37.737  1.00 36.67 ? 55   VAL A CG2 1 
ATOM   385   N  N   . VAL A 1 53  ? 1.579   12.347  40.932  1.00 35.98 ? 56   VAL A N   1 
ATOM   386   C  CA  . VAL A 1 53  ? 1.121   12.929  42.185  1.00 35.74 ? 56   VAL A CA  1 
ATOM   387   C  C   . VAL A 1 53  ? 2.245   12.719  43.199  1.00 35.74 ? 56   VAL A C   1 
ATOM   388   O  O   . VAL A 1 53  ? 2.643   13.650  43.899  1.00 35.59 ? 56   VAL A O   1 
ATOM   389   C  CB  . VAL A 1 53  ? -0.155  12.231  42.698  1.00 35.70 ? 56   VAL A CB  1 
ATOM   390   C  CG1 . VAL A 1 53  ? -0.464  12.661  44.121  1.00 35.42 ? 56   VAL A CG1 1 
ATOM   391   C  CG2 . VAL A 1 53  ? -1.330  12.549  41.791  1.00 35.61 ? 56   VAL A CG2 1 
ATOM   392   N  N   . PHE A 1 54  ? 2.779   11.499  43.233  1.00 35.50 ? 57   PHE A N   1 
ATOM   393   C  CA  . PHE A 1 54  ? 3.863   11.146  44.137  1.00 35.24 ? 57   PHE A CA  1 
ATOM   394   C  C   . PHE A 1 54  ? 5.140   11.898  43.832  1.00 35.25 ? 57   PHE A C   1 
ATOM   395   O  O   . PHE A 1 54  ? 5.790   12.419  44.737  1.00 35.16 ? 57   PHE A O   1 
ATOM   396   C  CB  . PHE A 1 54  ? 4.167   9.650   44.069  1.00 35.33 ? 57   PHE A CB  1 
ATOM   397   C  CG  . PHE A 1 54  ? 5.439   9.263   44.770  1.00 35.38 ? 57   PHE A CG  1 
ATOM   398   C  CD1 . PHE A 1 54  ? 5.516   9.288   46.156  1.00 35.34 ? 57   PHE A CD1 1 
ATOM   399   C  CD2 . PHE A 1 54  ? 6.573   8.916   44.045  1.00 35.39 ? 57   PHE A CD2 1 
ATOM   400   C  CE1 . PHE A 1 54  ? 6.702   8.979   46.810  1.00 35.37 ? 57   PHE A CE1 1 
ATOM   401   C  CE2 . PHE A 1 54  ? 7.767   8.603   44.694  1.00 35.38 ? 57   PHE A CE2 1 
ATOM   402   C  CZ  . PHE A 1 54  ? 7.829   8.637   46.078  1.00 35.39 ? 57   PHE A CZ  1 
ATOM   403   N  N   . THR A 1 55  ? 5.542   11.894  42.569  1.00 34.98 ? 58   THR A N   1 
ATOM   404   C  CA  . THR A 1 55  ? 6.768   12.578  42.196  1.00 34.88 ? 58   THR A CA  1 
ATOM   405   C  C   . THR A 1 55  ? 6.681   14.077  42.462  1.00 34.97 ? 58   THR A C   1 
ATOM   406   O  O   . THR A 1 55  ? 7.580   14.649  43.074  1.00 34.94 ? 58   THR A O   1 
ATOM   407   C  CB  . THR A 1 55  ? 7.136   12.311  40.732  1.00 34.96 ? 58   THR A CB  1 
ATOM   408   O  OG1 . THR A 1 55  ? 7.168   10.897  40.508  1.00 34.84 ? 58   THR A OG1 1 
ATOM   409   C  CG2 . THR A 1 55  ? 8.510   12.880  40.421  1.00 34.70 ? 58   THR A CG2 1 
ATOM   410   N  N   . ASP A 1 56  ? 5.576   14.694  42.054  1.00 34.84 ? 59   ASP A N   1 
ATOM   411   C  CA  . ASP A 1 56  ? 5.362   16.130  42.249  1.00 34.69 ? 59   ASP A CA  1 
ATOM   412   C  C   . ASP A 1 56  ? 5.565   16.507  43.709  1.00 34.51 ? 59   ASP A C   1 
ATOM   413   O  O   . ASP A 1 56  ? 6.256   17.478  44.012  1.00 34.43 ? 59   ASP A O   1 
ATOM   414   C  CB  . ASP A 1 56  ? 3.942   16.511  41.805  1.00 34.66 ? 59   ASP A CB  1 
ATOM   415   C  CG  . ASP A 1 56  ? 3.616   17.969  42.058  1.00 34.75 ? 59   ASP A CG  1 
ATOM   416   O  OD1 . ASP A 1 56  ? 2.647   18.257  42.795  1.00 34.92 ? 59   ASP A OD1 1 
ATOM   417   O  OD2 . ASP A 1 56  ? 4.325   18.833  41.511  1.00 35.06 ? 59   ASP A OD2 1 
ATOM   418   N  N   . GLU A 1 57  ? 4.976   15.722  44.611  1.00 34.30 ? 60   GLU A N   1 
ATOM   419   C  CA  . GLU A 1 57  ? 5.096   15.984  46.038  1.00 34.11 ? 60   GLU A CA  1 
ATOM   420   C  C   . GLU A 1 57  ? 6.481   15.651  46.578  1.00 34.19 ? 60   GLU A C   1 
ATOM   421   O  O   . GLU A 1 57  ? 7.073   16.447  47.306  1.00 34.04 ? 60   GLU A O   1 
ATOM   422   C  CB  . GLU A 1 57  ? 4.042   15.211  46.829  1.00 33.94 ? 60   GLU A CB  1 
ATOM   423   C  CG  . GLU A 1 57  ? 4.113   15.496  48.324  1.00 33.89 ? 60   GLU A CG  1 
ATOM   424   C  CD  . GLU A 1 57  ? 3.094   14.735  49.147  1.00 33.91 ? 60   GLU A CD  1 
ATOM   425   O  OE1 . GLU A 1 57  ? 2.593   15.302  50.144  1.00 33.80 ? 60   GLU A OE1 1 
ATOM   426   O  OE2 . GLU A 1 57  ? 2.813   13.564  48.820  1.00 34.06 ? 60   GLU A OE2 1 
ATOM   427   N  N   . MET A 1 58  ? 6.992   14.472  46.225  1.00 34.05 ? 61   MET A N   1 
ATOM   428   C  CA  . MET A 1 58  ? 8.299   14.038  46.696  1.00 33.94 ? 61   MET A CA  1 
ATOM   429   C  C   . MET A 1 58  ? 9.429   14.921  46.193  1.00 34.00 ? 61   MET A C   1 
ATOM   430   O  O   . MET A 1 58  ? 10.333  15.255  46.952  1.00 34.03 ? 61   MET A O   1 
ATOM   431   C  CB  . MET A 1 58  ? 8.553   12.578  46.321  1.00 33.89 ? 61   MET A CB  1 
ATOM   432   C  CG  . MET A 1 58  ? 9.852   11.993  46.880  1.00 33.83 ? 61   MET A CG  1 
ATOM   433   S  SD  . MET A 1 58  ? 9.987   12.096  48.682  1.00 34.29 ? 61   MET A SD  1 
ATOM   434   C  CE  . MET A 1 58  ? 8.688   11.007  49.183  1.00 33.88 ? 61   MET A CE  1 
ATOM   435   N  N   . ALA A 1 59  ? 9.378   15.326  44.932  1.00 33.86 ? 62   ALA A N   1 
ATOM   436   C  CA  . ALA A 1 59  ? 10.434  16.170  44.393  1.00 34.11 ? 62   ALA A CA  1 
ATOM   437   C  C   . ALA A 1 59  ? 10.493  17.515  45.104  1.00 34.54 ? 62   ALA A C   1 
ATOM   438   O  O   . ALA A 1 59  ? 11.565  18.112  45.232  1.00 34.42 ? 62   ALA A O   1 
ATOM   439   C  CB  . ALA A 1 59  ? 10.254  16.367  42.910  1.00 33.94 ? 62   ALA A CB  1 
ATOM   440   N  N   . HIS A 1 60  ? 9.348   17.999  45.576  1.00 34.64 ? 63   HIS A N   1 
ATOM   441   C  CA  . HIS A 1 60  ? 9.334   19.273  46.279  1.00 34.88 ? 63   HIS A CA  1 
ATOM   442   C  C   . HIS A 1 60  ? 9.855   19.109  47.704  1.00 34.81 ? 63   HIS A C   1 
ATOM   443   O  O   . HIS A 1 60  ? 10.559  19.969  48.220  1.00 34.68 ? 63   HIS A O   1 
ATOM   444   C  CB  . HIS A 1 60  ? 7.934   19.878  46.292  1.00 35.28 ? 63   HIS A CB  1 
ATOM   445   C  CG  . HIS A 1 60  ? 7.927   21.331  46.637  1.00 35.90 ? 63   HIS A CG  1 
ATOM   446   N  ND1 . HIS A 1 60  ? 8.054   21.790  47.930  1.00 35.99 ? 63   HIS A ND1 1 
ATOM   447   C  CD2 . HIS A 1 60  ? 7.878   22.431  45.849  1.00 36.08 ? 63   HIS A CD2 1 
ATOM   448   C  CE1 . HIS A 1 60  ? 8.090   23.111  47.923  1.00 36.21 ? 63   HIS A CE1 1 
ATOM   449   N  NE2 . HIS A 1 60  ? 7.985   23.525  46.674  1.00 36.39 ? 63   HIS A NE2 1 
ATOM   450   N  N   . PHE A 1 61  ? 9.498   17.999  48.336  1.00 34.71 ? 64   PHE A N   1 
ATOM   451   C  CA  . PHE A 1 61  ? 9.951   17.707  49.684  1.00 34.74 ? 64   PHE A CA  1 
ATOM   452   C  C   . PHE A 1 61  ? 11.465  17.661  49.643  1.00 34.71 ? 64   PHE A C   1 
ATOM   453   O  O   . PHE A 1 61  ? 12.142  18.183  50.527  1.00 34.64 ? 64   PHE A O   1 
ATOM   454   C  CB  . PHE A 1 61  ? 9.411   16.347  50.127  1.00 34.80 ? 64   PHE A CB  1 
ATOM   455   C  CG  . PHE A 1 61  ? 10.035  15.823  51.389  1.00 34.94 ? 64   PHE A CG  1 
ATOM   456   C  CD1 . PHE A 1 61  ? 9.720   16.385  52.626  1.00 34.99 ? 64   PHE A CD1 1 
ATOM   457   C  CD2 . PHE A 1 61  ? 10.928  14.753  51.347  1.00 35.03 ? 64   PHE A CD2 1 
ATOM   458   C  CE1 . PHE A 1 61  ? 10.285  15.889  53.804  1.00 35.02 ? 64   PHE A CE1 1 
ATOM   459   C  CE2 . PHE A 1 61  ? 11.498  14.250  52.521  1.00 35.10 ? 64   PHE A CE2 1 
ATOM   460   C  CZ  . PHE A 1 61  ? 11.174  14.819  53.749  1.00 35.05 ? 64   PHE A CZ  1 
ATOM   461   N  N   . ASP A 1 62  ? 11.986  17.061  48.581  1.00 34.61 ? 65   ASP A N   1 
ATOM   462   C  CA  . ASP A 1 62  ? 13.419  16.924  48.386  1.00 34.61 ? 65   ASP A CA  1 
ATOM   463   C  C   . ASP A 1 62  ? 14.146  18.263  48.257  1.00 34.69 ? 65   ASP A C   1 
ATOM   464   O  O   . ASP A 1 62  ? 15.368  18.329  48.406  1.00 34.70 ? 65   ASP A O   1 
ATOM   465   C  CB  . ASP A 1 62  ? 13.690  16.074  47.140  1.00 34.69 ? 65   ASP A CB  1 
ATOM   466   C  CG  . ASP A 1 62  ? 13.298  14.608  47.321  1.00 34.84 ? 65   ASP A CG  1 
ATOM   467   O  OD1 . ASP A 1 62  ? 13.148  13.899  46.307  1.00 34.92 ? 65   ASP A OD1 1 
ATOM   468   O  OD2 . ASP A 1 62  ? 13.162  14.147  48.471  1.00 34.99 ? 65   ASP A OD2 1 
ATOM   469   N  N   . ARG A 1 63  ? 13.397  19.334  48.024  1.00 34.48 ? 66   ARG A N   1 
ATOM   470   C  CA  . ARG A 1 63  ? 14.005  20.645  47.847  1.00 34.42 ? 66   ARG A CA  1 
ATOM   471   C  C   . ARG A 1 63  ? 13.603  21.697  48.868  1.00 34.46 ? 66   ARG A C   1 
ATOM   472   O  O   . ARG A 1 63  ? 13.875  22.888  48.666  1.00 34.40 ? 66   ARG A O   1 
ATOM   473   C  CB  . ARG A 1 63  ? 13.690  21.153  46.445  1.00 34.26 ? 66   ARG A CB  1 
ATOM   474   C  CG  . ARG A 1 63  ? 14.286  20.285  45.376  1.00 34.15 ? 66   ARG A CG  1 
ATOM   475   C  CD  . ARG A 1 63  ? 13.775  20.625  44.009  1.00 34.04 ? 66   ARG A CD  1 
ATOM   476   N  NE  . ARG A 1 63  ? 14.598  19.962  43.011  1.00 34.24 ? 66   ARG A NE  1 
ATOM   477   C  CZ  . ARG A 1 63  ? 14.583  18.656  42.780  1.00 34.27 ? 66   ARG A CZ  1 
ATOM   478   N  NH1 . ARG A 1 63  ? 13.766  17.872  43.464  1.00 34.44 ? 66   ARG A NH1 1 
ATOM   479   N  NH2 . ARG A 1 63  ? 15.455  18.122  41.939  1.00 34.18 ? 66   ARG A NH2 1 
ATOM   480   N  N   . GLU A 1 64  ? 13.007  21.263  49.976  1.00 34.18 ? 67   GLU A N   1 
ATOM   481   C  CA  . GLU A 1 64  ? 12.549  22.185  51.003  1.00 34.00 ? 67   GLU A CA  1 
ATOM   482   C  C   . GLU A 1 64  ? 13.613  23.051  51.627  1.00 34.00 ? 67   GLU A C   1 
ATOM   483   O  O   . GLU A 1 64  ? 13.360  24.220  51.920  1.00 34.00 ? 67   GLU A O   1 
ATOM   484   C  CB  . GLU A 1 64  ? 11.818  21.436  52.108  1.00 33.87 ? 67   GLU A CB  1 
ATOM   485   C  CG  . GLU A 1 64  ? 10.481  20.892  51.679  1.00 33.79 ? 67   GLU A CG  1 
ATOM   486   C  CD  . GLU A 1 64  ? 9.675   20.291  52.819  1.00 33.70 ? 67   GLU A CD  1 
ATOM   487   O  OE1 . GLU A 1 64  ? 8.608   19.709  52.531  1.00 33.54 ? 67   GLU A OE1 1 
ATOM   488   O  OE2 . GLU A 1 64  ? 10.089  20.401  53.995  1.00 33.64 ? 67   GLU A OE2 1 
ATOM   489   N  N   . ARG A 1 65  ? 14.809  22.496  51.800  1.00 33.94 ? 68   ARG A N   1 
ATOM   490   C  CA  . ARG A 1 65  ? 15.897  23.225  52.451  1.00 34.03 ? 68   ARG A CA  1 
ATOM   491   C  C   . ARG A 1 65  ? 16.747  24.178  51.628  1.00 33.92 ? 68   ARG A C   1 
ATOM   492   O  O   . ARG A 1 65  ? 17.128  23.903  50.490  1.00 33.78 ? 68   ARG A O   1 
ATOM   493   C  CB  . ARG A 1 65  ? 16.836  22.259  53.176  1.00 34.02 ? 68   ARG A CB  1 
ATOM   494   C  CG  . ARG A 1 65  ? 16.150  21.262  54.092  1.00 34.28 ? 68   ARG A CG  1 
ATOM   495   C  CD  . ARG A 1 65  ? 15.517  21.886  55.336  1.00 34.53 ? 68   ARG A CD  1 
ATOM   496   N  NE  . ARG A 1 65  ? 14.890  20.836  56.139  1.00 34.94 ? 68   ARG A NE  1 
ATOM   497   C  CZ  . ARG A 1 65  ? 13.592  20.537  56.123  1.00 35.14 ? 68   ARG A CZ  1 
ATOM   498   N  NH1 . ARG A 1 65  ? 12.745  21.221  55.361  1.00 35.02 ? 68   ARG A NH1 1 
ATOM   499   N  NH2 . ARG A 1 65  ? 13.152  19.483  56.797  1.00 35.30 ? 68   ARG A NH2 1 
ATOM   500   N  N   . ILE A 1 66  ? 17.038  25.315  52.240  1.00 33.87 ? 69   ILE A N   1 
ATOM   501   C  CA  . ILE A 1 66  ? 17.889  26.319  51.636  1.00 34.08 ? 69   ILE A CA  1 
ATOM   502   C  C   . ILE A 1 66  ? 19.019  26.494  52.653  1.00 34.10 ? 69   ILE A C   1 
ATOM   503   O  O   . ILE A 1 66  ? 18.879  26.106  53.819  1.00 34.27 ? 69   ILE A O   1 
ATOM   504   C  CB  . ILE A 1 66  ? 17.139  27.647  51.388  1.00 33.89 ? 69   ILE A CB  1 
ATOM   505   C  CG1 . ILE A 1 66  ? 16.738  28.311  52.697  1.00 33.80 ? 69   ILE A CG1 1 
ATOM   506   C  CG2 . ILE A 1 66  ? 15.887  27.392  50.583  1.00 33.97 ? 69   ILE A CG2 1 
ATOM   507   C  CD1 . ILE A 1 66  ? 16.144  29.689  52.493  1.00 33.56 ? 69   ILE A CD1 1 
ATOM   508   N  N   . PRO A 1 67  ? 20.176  27.011  52.222  1.00 34.12 ? 70   PRO A N   1 
ATOM   509   C  CA  . PRO A 1 67  ? 21.242  27.160  53.218  1.00 34.03 ? 70   PRO A CA  1 
ATOM   510   C  C   . PRO A 1 67  ? 20.883  28.119  54.344  1.00 33.98 ? 70   PRO A C   1 
ATOM   511   O  O   . PRO A 1 67  ? 20.158  29.084  54.134  1.00 33.88 ? 70   PRO A O   1 
ATOM   512   C  CB  . PRO A 1 67  ? 22.429  27.639  52.382  1.00 34.06 ? 70   PRO A CB  1 
ATOM   513   C  CG  . PRO A 1 67  ? 21.797  28.274  51.183  1.00 34.12 ? 70   PRO A CG  1 
ATOM   514   C  CD  . PRO A 1 67  ? 20.638  27.384  50.876  1.00 34.09 ? 70   PRO A CD  1 
ATOM   515   N  N   . GLU A 1 68  ? 21.311  27.795  55.561  1.00 34.08 ? 71   GLU A N   1 
ATOM   516   C  CA  . GLU A 1 68  ? 21.035  28.657  56.705  1.00 34.11 ? 71   GLU A CA  1 
ATOM   517   C  C   . GLU A 1 68  ? 22.023  29.818  56.668  1.00 34.04 ? 71   GLU A C   1 
ATOM   518   O  O   . GLU A 1 68  ? 23.047  29.748  55.982  1.00 34.09 ? 71   GLU A O   1 
ATOM   519   C  CB  . GLU A 1 68  ? 21.161  27.886  58.029  1.00 33.88 ? 71   GLU A CB  1 
ATOM   520   C  CG  . GLU A 1 68  ? 22.566  27.374  58.354  1.00 34.10 ? 71   GLU A CG  1 
ATOM   521   C  CD  . GLU A 1 68  ? 22.679  26.736  59.743  1.00 34.34 ? 71   GLU A CD  1 
ATOM   522   O  OE1 . GLU A 1 68  ? 21.727  26.064  60.190  1.00 34.33 ? 71   GLU A OE1 1 
ATOM   523   O  OE2 . GLU A 1 68  ? 23.735  26.894  60.392  1.00 34.32 ? 71   GLU A OE2 1 
ATOM   524   N  N   . ARG A 1 69  ? 21.697  30.898  57.368  1.00 33.94 ? 72   ARG A N   1 
ATOM   525   C  CA  . ARG A 1 69  ? 22.566  32.066  57.426  1.00 33.93 ? 72   ARG A CA  1 
ATOM   526   C  C   . ARG A 1 69  ? 23.948  31.621  57.894  1.00 34.05 ? 72   ARG A C   1 
ATOM   527   O  O   . ARG A 1 69  ? 24.062  30.791  58.804  1.00 33.93 ? 72   ARG A O   1 
ATOM   528   C  CB  . ARG A 1 69  ? 21.987  33.083  58.400  1.00 33.50 ? 72   ARG A CB  1 
ATOM   529   C  CG  . ARG A 1 69  ? 20.613  33.572  58.010  1.00 33.29 ? 72   ARG A CG  1 
ATOM   530   C  CD  . ARG A 1 69  ? 19.933  34.294  59.159  1.00 33.20 ? 72   ARG A CD  1 
ATOM   531   N  NE  . ARG A 1 69  ? 18.753  35.033  58.715  1.00 33.32 ? 72   ARG A NE  1 
ATOM   532   C  CZ  . ARG A 1 69  ? 17.624  34.476  58.284  1.00 33.38 ? 72   ARG A CZ  1 
ATOM   533   N  NH1 . ARG A 1 69  ? 17.495  33.161  58.233  1.00 33.45 ? 72   ARG A NH1 1 
ATOM   534   N  NH2 . ARG A 1 69  ? 16.622  35.242  57.888  1.00 33.51 ? 72   ARG A NH2 1 
ATOM   535   N  N   . VAL A 1 70  ? 24.994  32.143  57.259  1.00 34.17 ? 73   VAL A N   1 
ATOM   536   C  CA  . VAL A 1 70  ? 26.356  31.775  57.624  1.00 34.18 ? 73   VAL A CA  1 
ATOM   537   C  C   . VAL A 1 70  ? 26.604  32.026  59.118  1.00 34.48 ? 73   VAL A C   1 
ATOM   538   O  O   . VAL A 1 70  ? 27.370  31.296  59.762  1.00 34.50 ? 73   VAL A O   1 
ATOM   539   C  CB  . VAL A 1 70  ? 27.385  32.472  56.722  1.00 33.97 ? 73   VAL A CB  1 
ATOM   540   C  CG1 . VAL A 1 70  ? 27.346  33.966  56.926  1.00 33.83 ? 73   VAL A CG1 1 
ATOM   541   C  CG2 . VAL A 1 70  ? 28.770  31.903  56.962  1.00 33.86 ? 73   VAL A CG2 1 
ATOM   542   N  N   . VAL A 1 71  ? 25.945  33.056  59.653  1.00 34.36 ? 74   VAL A N   1 
ATOM   543   C  CA  . VAL A 1 71  ? 25.987  33.388  61.077  1.00 34.39 ? 74   VAL A CA  1 
ATOM   544   C  C   . VAL A 1 71  ? 24.583  33.824  61.448  1.00 34.49 ? 74   VAL A C   1 
ATOM   545   O  O   . VAL A 1 71  ? 23.812  34.246  60.587  1.00 34.41 ? 74   VAL A O   1 
ATOM   546   C  CB  . VAL A 1 71  ? 26.949  34.540  61.444  1.00 34.54 ? 74   VAL A CB  1 
ATOM   547   C  CG1 . VAL A 1 71  ? 28.384  34.058  61.442  1.00 34.59 ? 74   VAL A CG1 1 
ATOM   548   C  CG2 . VAL A 1 71  ? 26.764  35.712  60.519  1.00 34.41 ? 74   VAL A CG2 1 
ATOM   549   N  N   . HIS A 1 72  ? 24.246  33.718  62.726  1.00 34.46 ? 75   HIS A N   1 
ATOM   550   C  CA  . HIS A 1 72  ? 22.919  34.100  63.198  1.00 34.64 ? 75   HIS A CA  1 
ATOM   551   C  C   . HIS A 1 72  ? 21.829  33.195  62.610  1.00 34.60 ? 75   HIS A C   1 
ATOM   552   O  O   . HIS A 1 72  ? 20.681  33.617  62.441  1.00 34.52 ? 75   HIS A O   1 
ATOM   553   C  CB  . HIS A 1 72  ? 22.620  35.559  62.839  1.00 34.64 ? 75   HIS A CB  1 
ATOM   554   C  CG  . HIS A 1 72  ? 23.504  36.557  63.523  1.00 34.79 ? 75   HIS A CG  1 
ATOM   555   N  ND1 . HIS A 1 72  ? 23.078  37.321  64.588  1.00 34.90 ? 75   HIS A ND1 1 
ATOM   556   C  CD2 . HIS A 1 72  ? 24.771  36.954  63.258  1.00 34.82 ? 75   HIS A CD2 1 
ATOM   557   C  CE1 . HIS A 1 72  ? 24.043  38.149  64.949  1.00 34.87 ? 75   HIS A CE1 1 
ATOM   558   N  NE2 . HIS A 1 72  ? 25.081  37.947  64.158  1.00 34.90 ? 75   HIS A NE2 1 
ATOM   559   N  N   . ALA A 1 73  ? 22.179  31.941  62.344  1.00 34.60 ? 76   ALA A N   1 
ATOM   560   C  CA  . ALA A 1 73  ? 21.235  30.985  61.769  1.00 34.69 ? 76   ALA A CA  1 
ATOM   561   C  C   . ALA A 1 73  ? 19.993  30.697  62.619  1.00 34.71 ? 76   ALA A C   1 
ATOM   562   O  O   . ALA A 1 73  ? 18.912  30.479  62.076  1.00 34.75 ? 76   ALA A O   1 
ATOM   563   C  CB  . ALA A 1 73  ? 21.953  29.687  61.440  1.00 34.52 ? 76   ALA A CB  1 
ATOM   564   N  N   . LYS A 1 74  ? 20.149  30.682  63.942  1.00 34.74 ? 77   LYS A N   1 
ATOM   565   C  CA  . LYS A 1 74  ? 19.042  30.397  64.862  1.00 34.84 ? 77   LYS A CA  1 
ATOM   566   C  C   . LYS A 1 74  ? 18.338  31.680  65.322  1.00 35.07 ? 77   LYS A C   1 
ATOM   567   O  O   . LYS A 1 74  ? 18.925  32.483  66.048  1.00 35.33 ? 77   LYS A O   1 
ATOM   568   C  CB  . LYS A 1 74  ? 19.562  29.616  66.083  1.00 34.28 ? 77   LYS A CB  1 
ATOM   569   C  CG  . LYS A 1 74  ? 18.487  29.174  67.070  1.00 33.55 ? 77   LYS A CG  1 
ATOM   570   C  CD  . LYS A 1 74  ? 17.662  28.027  66.518  1.00 32.97 ? 77   LYS A CD  1 
ATOM   571   C  CE  . LYS A 1 74  ? 16.364  27.854  67.277  1.00 32.56 ? 77   LYS A CE  1 
ATOM   572   N  NZ  . LYS A 1 74  ? 16.566  27.548  68.713  1.00 32.23 ? 77   LYS A NZ  1 
ATOM   573   N  N   . GLY A 1 75  ? 17.071  31.851  64.941  1.00 35.35 ? 78   GLY A N   1 
ATOM   574   C  CA  . GLY A 1 75  ? 16.355  33.057  65.329  1.00 35.28 ? 78   GLY A CA  1 
ATOM   575   C  C   . GLY A 1 75  ? 14.837  33.028  65.393  1.00 35.35 ? 78   GLY A C   1 
ATOM   576   O  O   . GLY A 1 75  ? 14.193  32.002  65.162  1.00 35.20 ? 78   GLY A O   1 
ATOM   577   N  N   . ALA A 1 76  ? 14.271  34.186  65.721  1.00 35.51 ? 79   ALA A N   1 
ATOM   578   C  CA  . ALA A 1 76  ? 12.827  34.362  65.838  1.00 35.67 ? 79   ALA A CA  1 
ATOM   579   C  C   . ALA A 1 76  ? 12.444  35.667  65.161  1.00 35.86 ? 79   ALA A C   1 
ATOM   580   O  O   . ALA A 1 76  ? 13.222  36.622  65.161  1.00 36.03 ? 79   ALA A O   1 
ATOM   581   C  CB  . ALA A 1 76  ? 12.420  34.401  67.308  1.00 35.60 ? 79   ALA A CB  1 
ATOM   582   N  N   . GLY A 1 77  ? 11.249  35.714  64.583  1.00 36.06 ? 80   GLY A N   1 
ATOM   583   C  CA  . GLY A 1 77  ? 10.819  36.927  63.916  1.00 36.24 ? 80   GLY A CA  1 
ATOM   584   C  C   . GLY A 1 77  ? 9.489   37.471  64.392  1.00 36.51 ? 80   GLY A C   1 
ATOM   585   O  O   . GLY A 1 77  ? 8.718   36.783  65.053  1.00 36.50 ? 80   GLY A O   1 
ATOM   586   N  N   . ALA A 1 78  ? 9.234   38.729  64.070  1.00 36.62 ? 81   ALA A N   1 
ATOM   587   C  CA  . ALA A 1 78  ? 7.989   39.381  64.436  1.00 36.91 ? 81   ALA A CA  1 
ATOM   588   C  C   . ALA A 1 78  ? 7.855   40.660  63.618  1.00 37.20 ? 81   ALA A C   1 
ATOM   589   O  O   . ALA A 1 78  ? 8.798   41.083  62.939  1.00 37.15 ? 81   ALA A O   1 
ATOM   590   C  CB  . ALA A 1 78  ? 7.963   39.678  65.925  1.00 36.93 ? 81   ALA A CB  1 
ATOM   591   N  N   . PHE A 1 79  ? 6.674   41.263  63.654  1.00 37.44 ? 82   PHE A N   1 
ATOM   592   C  CA  . PHE A 1 79  ? 6.432   42.472  62.888  1.00 37.48 ? 82   PHE A CA  1 
ATOM   593   C  C   . PHE A 1 79  ? 5.662   43.496  63.693  1.00 37.59 ? 82   PHE A C   1 
ATOM   594   O  O   . PHE A 1 79  ? 5.047   43.172  64.712  1.00 37.46 ? 82   PHE A O   1 
ATOM   595   C  CB  . PHE A 1 79  ? 5.664   42.121  61.615  1.00 37.69 ? 82   PHE A CB  1 
ATOM   596   C  CG  . PHE A 1 79  ? 6.318   41.041  60.802  1.00 37.88 ? 82   PHE A CG  1 
ATOM   597   C  CD1 . PHE A 1 79  ? 6.205   39.708  61.178  1.00 37.77 ? 82   PHE A CD1 1 
ATOM   598   C  CD2 . PHE A 1 79  ? 7.111   41.363  59.706  1.00 37.89 ? 82   PHE A CD2 1 
ATOM   599   C  CE1 . PHE A 1 79  ? 6.880   38.719  60.483  1.00 37.82 ? 82   PHE A CE1 1 
ATOM   600   C  CE2 . PHE A 1 79  ? 7.788   40.375  59.006  1.00 37.78 ? 82   PHE A CE2 1 
ATOM   601   C  CZ  . PHE A 1 79  ? 7.674   39.056  59.396  1.00 37.88 ? 82   PHE A CZ  1 
ATOM   602   N  N   . GLY A 1 80  ? 5.709   44.738  63.226  1.00 37.74 ? 83   GLY A N   1 
ATOM   603   C  CA  . GLY A 1 80  ? 5.016   45.816  63.900  1.00 37.92 ? 83   GLY A CA  1 
ATOM   604   C  C   . GLY A 1 80  ? 5.228   47.156  63.224  1.00 38.06 ? 83   GLY A C   1 
ATOM   605   O  O   . GLY A 1 80  ? 5.135   47.269  62.004  1.00 37.95 ? 83   GLY A O   1 
ATOM   606   N  N   . TYR A 1 81  ? 5.544   48.173  64.022  1.00 38.33 ? 84   TYR A N   1 
ATOM   607   C  CA  . TYR A 1 81  ? 5.761   49.514  63.496  1.00 38.42 ? 84   TYR A CA  1 
ATOM   608   C  C   . TYR A 1 81  ? 6.742   50.338  64.325  1.00 38.33 ? 84   TYR A C   1 
ATOM   609   O  O   . TYR A 1 81  ? 7.086   49.982  65.455  1.00 38.16 ? 84   TYR A O   1 
ATOM   610   C  CB  . TYR A 1 81  ? 4.424   50.265  63.404  1.00 38.73 ? 84   TYR A CB  1 
ATOM   611   C  CG  . TYR A 1 81  ? 3.761   50.540  64.748  1.00 39.18 ? 84   TYR A CG  1 
ATOM   612   C  CD1 . TYR A 1 81  ? 4.144   51.628  65.530  1.00 39.31 ? 84   TYR A CD1 1 
ATOM   613   C  CD2 . TYR A 1 81  ? 2.761   49.705  65.240  1.00 39.49 ? 84   TYR A CD2 1 
ATOM   614   C  CE1 . TYR A 1 81  ? 3.556   51.877  66.766  1.00 39.64 ? 84   TYR A CE1 1 
ATOM   615   C  CE2 . TYR A 1 81  ? 2.163   49.947  66.480  1.00 39.82 ? 84   TYR A CE2 1 
ATOM   616   C  CZ  . TYR A 1 81  ? 2.568   51.034  67.236  1.00 39.91 ? 84   TYR A CZ  1 
ATOM   617   O  OH  . TYR A 1 81  ? 1.996   51.271  68.466  1.00 40.22 ? 84   TYR A OH  1 
ATOM   618   N  N   . PHE A 1 82  ? 7.233   51.411  63.710  1.00 38.23 ? 85   PHE A N   1 
ATOM   619   C  CA  . PHE A 1 82  ? 8.129   52.357  64.359  1.00 38.17 ? 85   PHE A CA  1 
ATOM   620   C  C   . PHE A 1 82  ? 7.342   53.659  64.370  1.00 38.33 ? 85   PHE A C   1 
ATOM   621   O  O   . PHE A 1 82  ? 6.778   54.054  63.347  1.00 38.18 ? 85   PHE A O   1 
ATOM   622   C  CB  . PHE A 1 82  ? 9.414   52.556  63.555  1.00 37.90 ? 85   PHE A CB  1 
ATOM   623   C  CG  . PHE A 1 82  ? 10.192  53.783  63.956  1.00 37.70 ? 85   PHE A CG  1 
ATOM   624   C  CD1 . PHE A 1 82  ? 10.922  53.806  65.135  1.00 37.57 ? 85   PHE A CD1 1 
ATOM   625   C  CD2 . PHE A 1 82  ? 10.185  54.920  63.154  1.00 37.49 ? 85   PHE A CD2 1 
ATOM   626   C  CE1 . PHE A 1 82  ? 11.634  54.940  65.509  1.00 37.39 ? 85   PHE A CE1 1 
ATOM   627   C  CE2 . PHE A 1 82  ? 10.894  56.054  63.525  1.00 37.34 ? 85   PHE A CE2 1 
ATOM   628   C  CZ  . PHE A 1 82  ? 11.618  56.062  64.701  1.00 37.42 ? 85   PHE A CZ  1 
ATOM   629   N  N   . GLU A 1 83  ? 7.288   54.316  65.521  1.00 38.45 ? 86   GLU A N   1 
ATOM   630   C  CA  . GLU A 1 83  ? 6.556   55.566  65.626  1.00 38.51 ? 86   GLU A CA  1 
ATOM   631   C  C   . GLU A 1 83  ? 7.469   56.676  66.114  1.00 38.35 ? 86   GLU A C   1 
ATOM   632   O  O   . GLU A 1 83  ? 8.203   56.505  67.082  1.00 38.16 ? 86   GLU A O   1 
ATOM   633   C  CB  . GLU A 1 83  ? 5.379   55.401  66.580  1.00 38.95 ? 86   GLU A CB  1 
ATOM   634   C  CG  . GLU A 1 83  ? 4.480   56.625  66.676  1.00 39.67 ? 86   GLU A CG  1 
ATOM   635   C  CD  . GLU A 1 83  ? 3.490   56.524  67.818  1.00 40.12 ? 86   GLU A CD  1 
ATOM   636   O  OE1 . GLU A 1 83  ? 3.277   57.548  68.502  1.00 40.48 ? 86   GLU A OE1 1 
ATOM   637   O  OE2 . GLU A 1 83  ? 2.934   55.421  68.043  1.00 40.55 ? 86   GLU A OE2 1 
ATOM   638   N  N   . VAL A 1 84  ? 7.429   57.808  65.421  1.00 38.13 ? 87   VAL A N   1 
ATOM   639   C  CA  . VAL A 1 84  ? 8.247   58.957  65.776  1.00 38.11 ? 87   VAL A CA  1 
ATOM   640   C  C   . VAL A 1 84  ? 7.609   59.694  66.945  1.00 38.21 ? 87   VAL A C   1 
ATOM   641   O  O   . VAL A 1 84  ? 6.413   59.995  66.915  1.00 38.21 ? 87   VAL A O   1 
ATOM   642   C  CB  . VAL A 1 84  ? 8.382   59.926  64.584  1.00 38.12 ? 87   VAL A CB  1 
ATOM   643   C  CG1 . VAL A 1 84  ? 9.147   61.181  64.991  1.00 37.93 ? 87   VAL A CG1 1 
ATOM   644   C  CG2 . VAL A 1 84  ? 9.078   59.231  63.421  1.00 38.04 ? 87   VAL A CG2 1 
ATOM   645   N  N   . THR A 1 85  ? 8.399   59.961  67.983  1.00 38.12 ? 88   THR A N   1 
ATOM   646   C  CA  . THR A 1 85  ? 7.896   60.673  69.151  1.00 38.09 ? 88   THR A CA  1 
ATOM   647   C  C   . THR A 1 85  ? 8.570   62.039  69.323  1.00 38.44 ? 88   THR A C   1 
ATOM   648   O  O   . THR A 1 85  ? 8.027   62.924  69.984  1.00 38.44 ? 88   THR A O   1 
ATOM   649   C  CB  . THR A 1 85  ? 8.063   59.852  70.441  1.00 37.84 ? 88   THR A CB  1 
ATOM   650   O  OG1 . THR A 1 85  ? 9.451   59.604  70.683  1.00 37.62 ? 88   THR A OG1 1 
ATOM   651   C  CG2 . THR A 1 85  ? 7.338   58.533  70.327  1.00 37.63 ? 88   THR A CG2 1 
ATOM   652   N  N   . HIS A 1 86  ? 9.747   62.212  68.728  1.00 38.50 ? 89   HIS A N   1 
ATOM   653   C  CA  . HIS A 1 86  ? 10.467  63.475  68.824  1.00 38.65 ? 89   HIS A CA  1 
ATOM   654   C  C   . HIS A 1 86  ? 10.987  63.916  67.467  1.00 38.97 ? 89   HIS A C   1 
ATOM   655   O  O   . HIS A 1 86  ? 11.162  63.105  66.553  1.00 39.04 ? 89   HIS A O   1 
ATOM   656   C  CB  . HIS A 1 86  ? 11.629  63.369  69.802  1.00 38.58 ? 89   HIS A CB  1 
ATOM   657   C  CG  . HIS A 1 86  ? 11.207  63.182  71.222  1.00 38.73 ? 89   HIS A CG  1 
ATOM   658   N  ND1 . HIS A 1 86  ? 10.560  62.049  71.664  1.00 38.94 ? 89   HIS A ND1 1 
ATOM   659   C  CD2 . HIS A 1 86  ? 11.348  63.980  72.305  1.00 38.82 ? 89   HIS A CD2 1 
ATOM   660   C  CE1 . HIS A 1 86  ? 10.321  62.157  72.959  1.00 39.00 ? 89   HIS A CE1 1 
ATOM   661   N  NE2 . HIS A 1 86  ? 10.790  63.319  73.373  1.00 38.96 ? 89   HIS A NE2 1 
ATOM   662   N  N   . ASP A 1 87  ? 11.262  65.208  67.353  1.00 39.08 ? 90   ASP A N   1 
ATOM   663   C  CA  . ASP A 1 87  ? 11.743  65.782  66.113  1.00 39.14 ? 90   ASP A CA  1 
ATOM   664   C  C   . ASP A 1 87  ? 13.260  65.873  66.047  1.00 39.22 ? 90   ASP A C   1 
ATOM   665   O  O   . ASP A 1 87  ? 13.879  66.639  66.788  1.00 39.18 ? 90   ASP A O   1 
ATOM   666   C  CB  . ASP A 1 87  ? 11.141  67.172  65.934  1.00 39.44 ? 90   ASP A CB  1 
ATOM   667   C  CG  . ASP A 1 87  ? 11.310  67.708  64.529  1.00 39.66 ? 90   ASP A CG  1 
ATOM   668   O  OD1 . ASP A 1 87  ? 12.450  67.756  64.027  1.00 39.90 ? 90   ASP A OD1 1 
ATOM   669   O  OD2 . ASP A 1 87  ? 10.295  68.092  63.920  1.00 40.14 ? 90   ASP A OD2 1 
ATOM   670   N  N   . ILE A 1 88  ? 13.853  65.096  65.144  1.00 39.22 ? 91   ILE A N   1 
ATOM   671   C  CA  . ILE A 1 88  ? 15.299  65.112  64.945  1.00 39.16 ? 91   ILE A CA  1 
ATOM   672   C  C   . ILE A 1 88  ? 15.591  65.475  63.491  1.00 39.39 ? 91   ILE A C   1 
ATOM   673   O  O   . ILE A 1 88  ? 16.649  65.135  62.959  1.00 39.25 ? 91   ILE A O   1 
ATOM   674   C  CB  . ILE A 1 88  ? 15.963  63.750  65.255  1.00 38.92 ? 91   ILE A CB  1 
ATOM   675   C  CG1 . ILE A 1 88  ? 15.402  62.665  64.337  1.00 38.85 ? 91   ILE A CG1 1 
ATOM   676   C  CG2 . ILE A 1 88  ? 15.769  63.382  66.709  1.00 38.78 ? 91   ILE A CG2 1 
ATOM   677   C  CD1 . ILE A 1 88  ? 16.269  61.440  64.251  1.00 38.55 ? 91   ILE A CD1 1 
ATOM   678   N  N   . THR A 1 89  ? 14.654  66.175  62.854  1.00 39.59 ? 92   THR A N   1 
ATOM   679   C  CA  . THR A 1 89  ? 14.822  66.572  61.461  1.00 39.88 ? 92   THR A CA  1 
ATOM   680   C  C   . THR A 1 89  ? 15.947  67.588  61.281  1.00 40.27 ? 92   THR A C   1 
ATOM   681   O  O   . THR A 1 89  ? 16.378  67.853  60.157  1.00 40.34 ? 92   THR A O   1 
ATOM   682   C  CB  . THR A 1 89  ? 13.517  67.111  60.841  1.00 39.89 ? 92   THR A CB  1 
ATOM   683   O  OG1 . THR A 1 89  ? 13.113  68.299  61.525  1.00 39.62 ? 92   THR A OG1 1 
ATOM   684   C  CG2 . THR A 1 89  ? 12.408  66.067  60.936  1.00 39.78 ? 92   THR A CG2 1 
ATOM   685   N  N   . LYS A 1 90  ? 16.410  68.176  62.381  1.00 40.48 ? 93   LYS A N   1 
ATOM   686   C  CA  . LYS A 1 90  ? 17.519  69.117  62.304  1.00 40.77 ? 93   LYS A CA  1 
ATOM   687   C  C   . LYS A 1 90  ? 18.791  68.321  62.006  1.00 40.66 ? 93   LYS A C   1 
ATOM   688   O  O   . LYS A 1 90  ? 19.770  68.875  61.513  1.00 40.62 ? 93   LYS A O   1 
ATOM   689   C  CB  . LYS A 1 90  ? 17.672  69.887  63.616  1.00 41.24 ? 93   LYS A CB  1 
ATOM   690   C  CG  . LYS A 1 90  ? 17.831  69.011  64.845  1.00 42.12 ? 93   LYS A CG  1 
ATOM   691   C  CD  . LYS A 1 90  ? 17.695  69.825  66.132  1.00 43.08 ? 93   LYS A CD  1 
ATOM   692   C  CE  . LYS A 1 90  ? 19.037  70.394  66.589  1.00 43.81 ? 93   LYS A CE  1 
ATOM   693   N  NZ  . LYS A 1 90  ? 19.781  71.119  65.499  1.00 44.61 ? 93   LYS A NZ  1 
ATOM   694   N  N   . TYR A 1 91  ? 18.744  67.010  62.267  1.00 40.50 ? 94   TYR A N   1 
ATOM   695   C  CA  . TYR A 1 91  ? 19.873  66.096  62.043  1.00 40.25 ? 94   TYR A CA  1 
ATOM   696   C  C   . TYR A 1 91  ? 19.735  65.242  60.781  1.00 40.00 ? 94   TYR A C   1 
ATOM   697   O  O   . TYR A 1 91  ? 20.713  65.021  60.067  1.00 39.96 ? 94   TYR A O   1 
ATOM   698   C  CB  . TYR A 1 91  ? 20.051  65.148  63.234  1.00 40.10 ? 94   TYR A CB  1 
ATOM   699   C  CG  . TYR A 1 91  ? 20.289  65.827  64.558  1.00 40.05 ? 94   TYR A CG  1 
ATOM   700   C  CD1 . TYR A 1 91  ? 19.393  65.670  65.610  1.00 39.96 ? 94   TYR A CD1 1 
ATOM   701   C  CD2 . TYR A 1 91  ? 21.411  66.621  64.765  1.00 40.01 ? 94   TYR A CD2 1 
ATOM   702   C  CE1 . TYR A 1 91  ? 19.606  66.287  66.836  1.00 40.01 ? 94   TYR A CE1 1 
ATOM   703   C  CE2 . TYR A 1 91  ? 21.635  67.243  65.994  1.00 40.03 ? 94   TYR A CE2 1 
ATOM   704   C  CZ  . TYR A 1 91  ? 20.727  67.068  67.020  1.00 40.03 ? 94   TYR A CZ  1 
ATOM   705   O  OH  . TYR A 1 91  ? 20.941  67.667  68.235  1.00 40.44 ? 94   TYR A OH  1 
ATOM   706   N  N   . SER A 1 92  ? 18.531  64.743  60.521  1.00 39.75 ? 95   SER A N   1 
ATOM   707   C  CA  . SER A 1 92  ? 18.303  63.898  59.358  1.00 39.61 ? 95   SER A CA  1 
ATOM   708   C  C   . SER A 1 92  ? 17.041  64.247  58.574  1.00 39.46 ? 95   SER A C   1 
ATOM   709   O  O   . SER A 1 92  ? 15.997  64.532  59.155  1.00 39.64 ? 95   SER A O   1 
ATOM   710   C  CB  . SER A 1 92  ? 18.243  62.433  59.795  1.00 39.52 ? 95   SER A CB  1 
ATOM   711   O  OG  . SER A 1 92  ? 18.086  61.573  58.678  1.00 39.55 ? 95   SER A OG  1 
ATOM   712   N  N   . LYS A 1 93  ? 17.142  64.196  57.250  1.00 39.15 ? 96   LYS A N   1 
ATOM   713   C  CA  . LYS A 1 93  ? 16.017  64.491  56.371  1.00 38.88 ? 96   LYS A CA  1 
ATOM   714   C  C   . LYS A 1 93  ? 15.253  63.231  55.959  1.00 38.91 ? 96   LYS A C   1 
ATOM   715   O  O   . LYS A 1 93  ? 14.280  63.311  55.215  1.00 38.70 ? 96   LYS A O   1 
ATOM   716   C  CB  . LYS A 1 93  ? 16.518  65.195  55.117  1.00 38.67 ? 96   LYS A CB  1 
ATOM   717   C  CG  . LYS A 1 93  ? 17.491  64.357  54.317  1.00 38.45 ? 96   LYS A CG  1 
ATOM   718   C  CD  . LYS A 1 93  ? 17.825  64.994  52.994  1.00 38.31 ? 96   LYS A CD  1 
ATOM   719   C  CE  . LYS A 1 93  ? 18.804  64.123  52.237  1.00 38.42 ? 96   LYS A CE  1 
ATOM   720   N  NZ  . LYS A 1 93  ? 19.012  64.581  50.830  1.00 38.65 ? 96   LYS A NZ  1 
ATOM   721   N  N   . ALA A 1 94  ? 15.702  62.070  56.428  1.00 38.94 ? 97   ALA A N   1 
ATOM   722   C  CA  . ALA A 1 94  ? 15.067  60.801  56.089  1.00 39.07 ? 97   ALA A CA  1 
ATOM   723   C  C   . ALA A 1 94  ? 13.572  60.854  56.368  1.00 39.35 ? 97   ALA A C   1 
ATOM   724   O  O   . ALA A 1 94  ? 13.161  61.256  57.457  1.00 39.33 ? 97   ALA A O   1 
ATOM   725   C  CB  . ALA A 1 94  ? 15.706  59.681  56.872  1.00 39.04 ? 97   ALA A CB  1 
ATOM   726   N  N   . LYS A 1 95  ? 12.767  60.448  55.386  1.00 39.41 ? 98   LYS A N   1 
ATOM   727   C  CA  . LYS A 1 95  ? 11.318  60.471  55.521  1.00 39.57 ? 98   LYS A CA  1 
ATOM   728   C  C   . LYS A 1 95  ? 10.790  59.715  56.714  1.00 39.54 ? 98   LYS A C   1 
ATOM   729   O  O   . LYS A 1 95  ? 9.731   60.054  57.241  1.00 39.49 ? 98   LYS A O   1 
ATOM   730   C  CB  . LYS A 1 95  ? 10.633  59.964  54.257  1.00 40.16 ? 98   LYS A CB  1 
ATOM   731   C  CG  . LYS A 1 95  ? 10.558  61.012  53.160  1.00 41.32 ? 98   LYS A CG  1 
ATOM   732   C  CD  . LYS A 1 95  ? 9.476   60.686  52.133  1.00 42.28 ? 98   LYS A CD  1 
ATOM   733   C  CE  . LYS A 1 95  ? 9.246   61.860  51.175  1.00 42.98 ? 98   LYS A CE  1 
ATOM   734   N  NZ  . LYS A 1 95  ? 10.442  62.171  50.329  1.00 43.62 ? 98   LYS A NZ  1 
ATOM   735   N  N   . VAL A 1 96  ? 11.534  58.708  57.157  1.00 39.30 ? 99   VAL A N   1 
ATOM   736   C  CA  . VAL A 1 96  ? 11.123  57.903  58.298  1.00 39.00 ? 99   VAL A CA  1 
ATOM   737   C  C   . VAL A 1 96  ? 11.016  58.723  59.592  1.00 39.23 ? 99   VAL A C   1 
ATOM   738   O  O   . VAL A 1 96  ? 10.308  58.333  60.518  1.00 39.22 ? 99   VAL A O   1 
ATOM   739   C  CB  . VAL A 1 96  ? 12.063  56.681  58.464  1.00 38.84 ? 99   VAL A CB  1 
ATOM   740   C  CG1 . VAL A 1 96  ? 13.479  57.129  58.755  1.00 38.55 ? 99   VAL A CG1 1 
ATOM   741   C  CG2 . VAL A 1 96  ? 11.543  55.733  59.521  1.00 38.48 ? 99   VAL A CG2 1 
ATOM   742   N  N   . PHE A 1 97  ? 11.657  59.889  59.627  1.00 39.32 ? 100  PHE A N   1 
ATOM   743   C  CA  . PHE A 1 97  ? 11.631  60.755  60.807  1.00 39.55 ? 100  PHE A CA  1 
ATOM   744   C  C   . PHE A 1 97  ? 10.933  62.092  60.555  1.00 39.90 ? 100  PHE A C   1 
ATOM   745   O  O   . PHE A 1 97  ? 10.998  62.982  61.402  1.00 40.03 ? 100  PHE A O   1 
ATOM   746   C  CB  . PHE A 1 97  ? 13.059  61.107  61.242  1.00 39.37 ? 100  PHE A CB  1 
ATOM   747   C  CG  . PHE A 1 97  ? 13.965  59.928  61.423  1.00 39.25 ? 100  PHE A CG  1 
ATOM   748   C  CD1 . PHE A 1 97  ? 13.615  58.878  62.258  1.00 38.99 ? 100  PHE A CD1 1 
ATOM   749   C  CD2 . PHE A 1 97  ? 15.196  59.888  60.779  1.00 39.17 ? 100  PHE A CD2 1 
ATOM   750   C  CE1 . PHE A 1 97  ? 14.475  57.814  62.449  1.00 38.93 ? 100  PHE A CE1 1 
ATOM   751   C  CE2 . PHE A 1 97  ? 16.065  58.819  60.967  1.00 38.95 ? 100  PHE A CE2 1 
ATOM   752   C  CZ  . PHE A 1 97  ? 15.704  57.786  61.802  1.00 38.91 ? 100  PHE A CZ  1 
ATOM   753   N  N   . GLU A 1 98  ? 10.225  62.232  59.440  1.00 40.13 ? 101  GLU A N   1 
ATOM   754   C  CA  . GLU A 1 98  ? 9.640   63.527  59.117  1.00 40.44 ? 101  GLU A CA  1 
ATOM   755   C  C   . GLU A 1 98  ? 8.689   64.228  60.072  1.00 40.11 ? 101  GLU A C   1 
ATOM   756   O  O   . GLU A 1 98  ? 8.692   65.456  60.136  1.00 40.04 ? 101  GLU A O   1 
ATOM   757   C  CB  . GLU A 1 98  ? 9.126   63.578  57.676  1.00 41.16 ? 101  GLU A CB  1 
ATOM   758   C  CG  . GLU A 1 98  ? 7.753   63.024  57.442  1.00 42.70 ? 101  GLU A CG  1 
ATOM   759   C  CD  . GLU A 1 98  ? 7.158   63.482  56.110  1.00 43.61 ? 101  GLU A CD  1 
ATOM   760   O  OE1 . GLU A 1 98  ? 5.913   63.408  55.963  1.00 44.20 ? 101  GLU A OE1 1 
ATOM   761   O  OE2 . GLU A 1 98  ? 7.925   63.913  55.212  1.00 44.12 ? 101  GLU A OE2 1 
ATOM   762   N  N   . HIS A 1 99  ? 7.892   63.491  60.829  1.00 39.72 ? 102  HIS A N   1 
ATOM   763   C  CA  . HIS A 1 99  ? 6.991   64.158  61.763  1.00 39.31 ? 102  HIS A CA  1 
ATOM   764   C  C   . HIS A 1 99  ? 6.577   63.286  62.923  1.00 39.22 ? 102  HIS A C   1 
ATOM   765   O  O   . HIS A 1 99  ? 6.503   62.067  62.803  1.00 39.31 ? 102  HIS A O   1 
ATOM   766   C  CB  . HIS A 1 99  ? 5.752   64.711  61.052  1.00 39.07 ? 102  HIS A CB  1 
ATOM   767   C  CG  . HIS A 1 99  ? 4.891   63.666  60.416  1.00 38.90 ? 102  HIS A CG  1 
ATOM   768   N  ND1 . HIS A 1 99  ? 3.923   62.972  61.111  1.00 38.77 ? 102  HIS A ND1 1 
ATOM   769   C  CD2 . HIS A 1 99  ? 4.835   63.213  59.142  1.00 38.69 ? 102  HIS A CD2 1 
ATOM   770   C  CE1 . HIS A 1 99  ? 3.306   62.140  60.291  1.00 38.59 ? 102  HIS A CE1 1 
ATOM   771   N  NE2 . HIS A 1 99  ? 3.841   62.267  59.090  1.00 38.71 ? 102  HIS A NE2 1 
ATOM   772   N  N   . ILE A 1 100 ? 6.326   63.922  64.058  1.00 38.99 ? 103  ILE A N   1 
ATOM   773   C  CA  . ILE A 1 100 ? 5.913   63.209  65.249  1.00 38.85 ? 103  ILE A CA  1 
ATOM   774   C  C   . ILE A 1 100 ? 4.608   62.469  64.952  1.00 38.93 ? 103  ILE A C   1 
ATOM   775   O  O   . ILE A 1 100 ? 3.716   62.994  64.277  1.00 38.86 ? 103  ILE A O   1 
ATOM   776   C  CB  . ILE A 1 100 ? 5.762   64.185  66.437  1.00 38.91 ? 103  ILE A CB  1 
ATOM   777   C  CG1 . ILE A 1 100 ? 7.121   64.815  66.749  1.00 38.77 ? 103  ILE A CG1 1 
ATOM   778   C  CG2 . ILE A 1 100 ? 5.217   63.468  67.672  1.00 38.73 ? 103  ILE A CG2 1 
ATOM   779   C  CD1 . ILE A 1 100 ? 7.097   65.811  67.888  1.00 38.90 ? 103  ILE A CD1 1 
ATOM   780   N  N   . GLY A 1 101 ? 4.548   61.214  65.389  1.00 38.81 ? 104  GLY A N   1 
ATOM   781   C  CA  . GLY A 1 101 ? 3.372   60.402  65.162  1.00 38.68 ? 104  GLY A CA  1 
ATOM   782   C  C   . GLY A 1 101 ? 3.457   59.567  63.900  1.00 38.65 ? 104  GLY A C   1 
ATOM   783   O  O   . GLY A 1 101 ? 2.616   58.702  63.685  1.00 38.69 ? 104  GLY A O   1 
ATOM   784   N  N   . LYS A 1 102 ? 4.449   59.825  63.052  1.00 38.50 ? 105  LYS A N   1 
ATOM   785   C  CA  . LYS A 1 102 ? 4.600   59.065  61.814  1.00 38.46 ? 105  LYS A CA  1 
ATOM   786   C  C   . LYS A 1 102 ? 4.937   57.619  62.108  1.00 38.46 ? 105  LYS A C   1 
ATOM   787   O  O   . LYS A 1 102 ? 5.924   57.332  62.781  1.00 38.54 ? 105  LYS A O   1 
ATOM   788   C  CB  . LYS A 1 102 ? 5.702   59.654  60.934  1.00 38.37 ? 105  LYS A CB  1 
ATOM   789   C  CG  . LYS A 1 102 ? 5.736   59.075  59.521  1.00 38.24 ? 105  LYS A CG  1 
ATOM   790   C  CD  . LYS A 1 102 ? 6.748   59.802  58.655  1.00 38.25 ? 105  LYS A CD  1 
ATOM   791   C  CE  . LYS A 1 102 ? 6.519   59.540  57.178  1.00 38.23 ? 105  LYS A CE  1 
ATOM   792   N  NZ  . LYS A 1 102 ? 6.730   58.114  56.847  1.00 38.74 ? 105  LYS A NZ  1 
ATOM   793   N  N   . LYS A 1 103 ? 4.107   56.712  61.605  1.00 38.61 ? 106  LYS A N   1 
ATOM   794   C  CA  . LYS A 1 103 ? 4.320   55.284  61.801  1.00 38.66 ? 106  LYS A CA  1 
ATOM   795   C  C   . LYS A 1 103 ? 4.805   54.613  60.515  1.00 38.52 ? 106  LYS A C   1 
ATOM   796   O  O   . LYS A 1 103 ? 4.285   54.875  59.426  1.00 38.55 ? 106  LYS A O   1 
ATOM   797   C  CB  . LYS A 1 103 ? 3.036   54.603  62.278  1.00 38.84 ? 106  LYS A CB  1 
ATOM   798   C  CG  . LYS A 1 103 ? 2.554   55.018  63.661  1.00 39.33 ? 106  LYS A CG  1 
ATOM   799   C  CD  . LYS A 1 103 ? 1.492   54.038  64.158  1.00 39.87 ? 106  LYS A CD  1 
ATOM   800   C  CE  . LYS A 1 103 ? 0.915   54.427  65.518  1.00 40.21 ? 106  LYS A CE  1 
ATOM   801   N  NZ  . LYS A 1 103 ? -0.036  55.570  65.415  1.00 40.55 ? 106  LYS A NZ  1 
ATOM   802   N  N   . THR A 1 104 ? 5.810   53.753  60.647  1.00 38.32 ? 107  THR A N   1 
ATOM   803   C  CA  . THR A 1 104 ? 6.371   53.027  59.515  1.00 38.13 ? 107  THR A CA  1 
ATOM   804   C  C   . THR A 1 104 ? 6.406   51.544  59.872  1.00 37.83 ? 107  THR A C   1 
ATOM   805   O  O   . THR A 1 104 ? 6.847   51.174  60.962  1.00 37.87 ? 107  THR A O   1 
ATOM   806   C  CB  . THR A 1 104 ? 7.798   53.507  59.211  1.00 38.22 ? 107  THR A CB  1 
ATOM   807   O  OG1 . THR A 1 104 ? 7.766   54.900  58.890  1.00 38.58 ? 107  THR A OG1 1 
ATOM   808   C  CG2 . THR A 1 104 ? 8.397   52.742  58.036  1.00 38.19 ? 107  THR A CG2 1 
ATOM   809   N  N   . PRO A 1 105 ? 5.899   50.678  58.978  1.00 37.50 ? 108  PRO A N   1 
ATOM   810   C  CA  . PRO A 1 105 ? 5.888   49.230  59.231  1.00 37.37 ? 108  PRO A CA  1 
ATOM   811   C  C   . PRO A 1 105 ? 7.298   48.669  59.382  1.00 36.99 ? 108  PRO A C   1 
ATOM   812   O  O   . PRO A 1 105 ? 8.216   49.091  58.681  1.00 36.89 ? 108  PRO A O   1 
ATOM   813   C  CB  . PRO A 1 105 ? 5.216   48.673  57.974  1.00 37.41 ? 108  PRO A CB  1 
ATOM   814   C  CG  . PRO A 1 105 ? 4.320   49.805  57.532  1.00 37.36 ? 108  PRO A CG  1 
ATOM   815   C  CD  . PRO A 1 105 ? 5.211   50.996  57.712  1.00 37.50 ? 108  PRO A CD  1 
ATOM   816   N  N   . ILE A 1 106 ? 7.482   47.738  60.314  1.00 36.64 ? 109  ILE A N   1 
ATOM   817   C  CA  . ILE A 1 106 ? 8.797   47.138  60.501  1.00 36.31 ? 109  ILE A CA  1 
ATOM   818   C  C   . ILE A 1 106 ? 8.737   45.625  60.603  1.00 36.20 ? 109  ILE A C   1 
ATOM   819   O  O   . ILE A 1 106 ? 7.701   45.044  60.927  1.00 36.27 ? 109  ILE A O   1 
ATOM   820   C  CB  . ILE A 1 106 ? 9.526   47.661  61.760  1.00 36.05 ? 109  ILE A CB  1 
ATOM   821   C  CG1 . ILE A 1 106 ? 8.750   47.271  63.016  1.00 35.76 ? 109  ILE A CG1 1 
ATOM   822   C  CG2 . ILE A 1 106 ? 9.740   49.164  61.677  1.00 36.00 ? 109  ILE A CG2 1 
ATOM   823   C  CD1 . ILE A 1 106 ? 9.469   47.581  64.290  1.00 35.33 ? 109  ILE A CD1 1 
ATOM   824   N  N   . ALA A 1 107 ? 9.866   45.003  60.289  1.00 35.95 ? 110  ALA A N   1 
ATOM   825   C  CA  . ALA A 1 107 ? 10.033  43.561  60.369  1.00 35.64 ? 110  ALA A CA  1 
ATOM   826   C  C   . ALA A 1 107 ? 11.266  43.380  61.243  1.00 35.51 ? 110  ALA A C   1 
ATOM   827   O  O   . ALA A 1 107 ? 12.268  44.071  61.048  1.00 35.46 ? 110  ALA A O   1 
ATOM   828   C  CB  . ALA A 1 107 ? 10.282  42.987  58.995  1.00 35.37 ? 110  ALA A CB  1 
ATOM   829   N  N   . VAL A 1 108 ? 11.193  42.476  62.216  1.00 35.23 ? 111  VAL A N   1 
ATOM   830   C  CA  . VAL A 1 108 ? 12.322  42.241  63.107  1.00 35.00 ? 111  VAL A CA  1 
ATOM   831   C  C   . VAL A 1 108 ? 12.673  40.762  63.251  1.00 35.07 ? 111  VAL A C   1 
ATOM   832   O  O   . VAL A 1 108 ? 11.798  39.897  63.248  1.00 35.02 ? 111  VAL A O   1 
ATOM   833   C  CB  . VAL A 1 108 ? 12.041  42.813  64.531  1.00 34.88 ? 111  VAL A CB  1 
ATOM   834   C  CG1 . VAL A 1 108 ? 13.210  42.549  65.464  1.00 34.59 ? 111  VAL A CG1 1 
ATOM   835   C  CG2 . VAL A 1 108 ? 11.789  44.287  64.458  1.00 34.58 ? 111  VAL A CG2 1 
ATOM   836   N  N   . ARG A 1 109 ? 13.968  40.481  63.334  1.00 34.83 ? 112  ARG A N   1 
ATOM   837   C  CA  . ARG A 1 109 ? 14.444  39.127  63.550  1.00 34.41 ? 112  ARG A CA  1 
ATOM   838   C  C   . ARG A 1 109 ? 15.507  39.176  64.635  1.00 34.61 ? 112  ARG A C   1 
ATOM   839   O  O   . ARG A 1 109 ? 16.441  39.975  64.569  1.00 34.43 ? 112  ARG A O   1 
ATOM   840   C  CB  . ARG A 1 109 ? 15.022  38.501  62.280  1.00 34.10 ? 112  ARG A CB  1 
ATOM   841   C  CG  . ARG A 1 109 ? 15.425  37.029  62.466  1.00 33.43 ? 112  ARG A CG  1 
ATOM   842   C  CD  . ARG A 1 109 ? 15.803  36.350  61.157  1.00 32.99 ? 112  ARG A CD  1 
ATOM   843   N  NE  . ARG A 1 109 ? 16.210  34.960  61.357  1.00 32.70 ? 112  ARG A NE  1 
ATOM   844   C  CZ  . ARG A 1 109 ? 17.418  34.581  61.762  1.00 32.60 ? 112  ARG A CZ  1 
ATOM   845   N  NH1 . ARG A 1 109 ? 18.358  35.477  62.013  1.00 32.45 ? 112  ARG A NH1 1 
ATOM   846   N  NH2 . ARG A 1 109 ? 17.689  33.298  61.923  1.00 32.56 ? 112  ARG A NH2 1 
ATOM   847   N  N   . PHE A 1 110 ? 15.304  38.373  65.673  1.00 34.55 ? 113  PHE A N   1 
ATOM   848   C  CA  . PHE A 1 110 ? 16.232  38.273  66.790  1.00 34.71 ? 113  PHE A CA  1 
ATOM   849   C  C   . PHE A 1 110 ? 16.971  36.967  66.591  1.00 34.94 ? 113  PHE A C   1 
ATOM   850   O  O   . PHE A 1 110 ? 16.418  36.041  65.992  1.00 35.09 ? 113  PHE A O   1 
ATOM   851   C  CB  . PHE A 1 110 ? 15.471  38.199  68.100  1.00 34.61 ? 113  PHE A CB  1 
ATOM   852   C  CG  . PHE A 1 110 ? 14.638  39.407  68.389  1.00 34.65 ? 113  PHE A CG  1 
ATOM   853   C  CD1 . PHE A 1 110 ? 13.250  39.341  68.317  1.00 34.37 ? 113  PHE A CD1 1 
ATOM   854   C  CD2 . PHE A 1 110 ? 15.234  40.594  68.797  1.00 34.44 ? 113  PHE A CD2 1 
ATOM   855   C  CE1 . PHE A 1 110 ? 12.472  40.431  68.656  1.00 34.29 ? 113  PHE A CE1 1 
ATOM   856   C  CE2 . PHE A 1 110 ? 14.462  41.683  69.136  1.00 34.36 ? 113  PHE A CE2 1 
ATOM   857   C  CZ  . PHE A 1 110 ? 13.078  41.604  69.068  1.00 34.38 ? 113  PHE A CZ  1 
ATOM   858   N  N   . SER A 1 111 ? 18.182  36.854  67.135  1.00 34.87 ? 114  SER A N   1 
ATOM   859   C  CA  . SER A 1 111 ? 18.958  35.631  66.953  1.00 34.76 ? 114  SER A CA  1 
ATOM   860   C  C   . SER A 1 111 ? 20.214  35.525  67.811  1.00 34.86 ? 114  SER A C   1 
ATOM   861   O  O   . SER A 1 111 ? 20.578  36.453  68.529  1.00 34.79 ? 114  SER A O   1 
ATOM   862   C  CB  . SER A 1 111 ? 19.386  35.538  65.488  1.00 34.65 ? 114  SER A CB  1 
ATOM   863   O  OG  . SER A 1 111 ? 20.178  36.664  65.142  1.00 34.86 ? 114  SER A OG  1 
ATOM   864   N  N   . THR A 1 112 ? 20.844  34.354  67.753  1.00 34.81 ? 115  THR A N   1 
ATOM   865   C  CA  . THR A 1 112 ? 22.105  34.115  68.436  1.00 34.71 ? 115  THR A CA  1 
ATOM   866   C  C   . THR A 1 112 ? 23.140  34.257  67.318  1.00 34.73 ? 115  THR A C   1 
ATOM   867   O  O   . THR A 1 112 ? 22.830  34.811  66.260  1.00 34.60 ? 115  THR A O   1 
ATOM   868   C  CB  . THR A 1 112 ? 22.185  32.718  69.061  1.00 34.76 ? 115  THR A CB  1 
ATOM   869   O  OG1 . THR A 1 112 ? 21.865  31.728  68.080  1.00 34.92 ? 115  THR A OG1 1 
ATOM   870   C  CG2 . THR A 1 112 ? 21.225  32.604  70.219  1.00 34.76 ? 115  THR A CG2 1 
ATOM   871   N  N   . VAL A 1 113 ? 24.344  33.730  67.504  1.00 34.50 ? 116  VAL A N   1 
ATOM   872   C  CA  . VAL A 1 113 ? 25.357  33.888  66.470  1.00 34.10 ? 116  VAL A CA  1 
ATOM   873   C  C   . VAL A 1 113 ? 26.034  32.634  65.940  1.00 34.21 ? 116  VAL A C   1 
ATOM   874   O  O   . VAL A 1 113 ? 25.970  32.351  64.746  1.00 34.11 ? 116  VAL A O   1 
ATOM   875   C  CB  . VAL A 1 113 ? 26.463  34.850  66.932  1.00 33.95 ? 116  VAL A CB  1 
ATOM   876   C  CG1 . VAL A 1 113 ? 27.477  35.055  65.816  1.00 33.87 ? 116  VAL A CG1 1 
ATOM   877   C  CG2 . VAL A 1 113 ? 25.865  36.165  67.370  1.00 33.52 ? 116  VAL A CG2 1 
ATOM   878   N  N   . ALA A 1 114 ? 26.705  31.904  66.823  1.00 34.15 ? 117  ALA A N   1 
ATOM   879   C  CA  . ALA A 1 114 ? 27.455  30.720  66.434  1.00 34.11 ? 117  ALA A CA  1 
ATOM   880   C  C   . ALA A 1 114 ? 26.671  29.448  66.133  1.00 34.45 ? 117  ALA A C   1 
ATOM   881   O  O   . ALA A 1 114 ? 27.056  28.679  65.251  1.00 34.25 ? 117  ALA A O   1 
ATOM   882   C  CB  . ALA A 1 114 ? 28.527  30.440  67.471  1.00 33.94 ? 117  ALA A CB  1 
ATOM   883   N  N   . GLY A 1 115 ? 25.580  29.221  66.854  1.00 34.59 ? 118  GLY A N   1 
ATOM   884   C  CA  . GLY A 1 115 ? 24.806  28.015  66.647  1.00 35.03 ? 118  GLY A CA  1 
ATOM   885   C  C   . GLY A 1 115 ? 24.074  27.889  65.327  1.00 35.49 ? 118  GLY A C   1 
ATOM   886   O  O   . GLY A 1 115 ? 23.673  28.884  64.727  1.00 35.51 ? 118  GLY A O   1 
ATOM   887   N  N   . GLU A 1 116 ? 23.912  26.649  64.870  1.00 36.02 ? 119  GLU A N   1 
ATOM   888   C  CA  . GLU A 1 116 ? 23.205  26.361  63.629  1.00 36.48 ? 119  GLU A CA  1 
ATOM   889   C  C   . GLU A 1 116 ? 21.713  26.283  63.934  1.00 36.43 ? 119  GLU A C   1 
ATOM   890   O  O   . GLU A 1 116 ? 21.305  26.398  65.094  1.00 36.85 ? 119  GLU A O   1 
ATOM   891   C  CB  . GLU A 1 116 ? 23.663  25.025  63.045  1.00 36.55 ? 119  GLU A CB  1 
ATOM   892   C  CG  . GLU A 1 116 ? 25.128  24.963  62.650  1.00 36.97 ? 119  GLU A CG  1 
ATOM   893   C  CD  . GLU A 1 116 ? 26.058  24.676  63.810  1.00 37.12 ? 119  GLU A CD  1 
ATOM   894   O  OE1 . GLU A 1 116 ? 25.572  24.394  64.928  1.00 37.29 ? 119  GLU A OE1 1 
ATOM   895   O  OE2 . GLU A 1 116 ? 27.287  24.718  63.597  1.00 37.26 ? 119  GLU A OE2 1 
ATOM   896   N  N   A SER A 1 117 ? 20.901  26.101  62.895  0.50 36.76 ? 120  SER A N   1 
ATOM   897   N  N   B SER A 1 117 ? 20.911  26.050  62.898  0.50 36.81 ? 120  SER A N   1 
ATOM   898   C  CA  A SER A 1 117 ? 19.437  26.048  63.011  0.50 36.71 ? 120  SER A CA  1 
ATOM   899   C  CA  B SER A 1 117 ? 19.472  25.903  63.080  0.50 36.83 ? 120  SER A CA  1 
ATOM   900   C  C   A SER A 1 117 ? 18.786  25.257  64.150  0.50 36.70 ? 120  SER A C   1 
ATOM   901   C  C   B SER A 1 117 ? 19.304  24.631  63.904  0.50 36.82 ? 120  SER A C   1 
ATOM   902   O  O   A SER A 1 117 ? 17.792  25.708  64.717  0.50 36.62 ? 120  SER A O   1 
ATOM   903   O  O   B SER A 1 117 ? 19.956  23.615  63.643  0.50 36.77 ? 120  SER A O   1 
ATOM   904   C  CB  A SER A 1 117 ? 18.819  25.612  61.681  0.50 36.49 ? 120  SER A CB  1 
ATOM   905   C  CB  B SER A 1 117 ? 18.763  25.756  61.730  0.50 36.60 ? 120  SER A CB  1 
ATOM   906   O  OG  A SER A 1 117 ? 19.076  26.566  60.666  0.50 36.44 ? 120  SER A OG  1 
ATOM   907   O  OG  B SER A 1 117 ? 18.944  26.911  60.928  0.50 36.58 ? 120  SER A OG  1 
ATOM   908   N  N   A GLY A 1 118 ? 19.320  24.082  64.476  0.50 36.73 ? 121  GLY A N   1 
ATOM   909   N  N   B GLY A 1 118 ? 18.466  24.701  64.927  0.50 36.89 ? 121  GLY A N   1 
ATOM   910   C  CA  A GLY A 1 118 ? 18.723  23.283  65.534  0.50 36.83 ? 121  GLY A CA  1 
ATOM   911   C  CA  B GLY A 1 118 ? 18.273  23.543  65.770  0.50 36.93 ? 121  GLY A CA  1 
ATOM   912   C  C   A GLY A 1 118 ? 19.364  23.431  66.898  0.50 36.84 ? 121  GLY A C   1 
ATOM   913   C  C   B GLY A 1 118 ? 18.961  23.749  67.100  0.50 36.94 ? 121  GLY A C   1 
ATOM   914   O  O   A GLY A 1 118 ? 19.244  22.544  67.745  0.50 36.91 ? 121  GLY A O   1 
ATOM   915   O  O   B GLY A 1 118 ? 18.549  23.154  68.097  0.50 37.01 ? 121  GLY A O   1 
ATOM   916   N  N   . SER A 1 119 ? 20.020  24.563  67.126  1.00 36.78 ? 122  SER A N   1 
ATOM   917   C  CA  . SER A 1 119 ? 20.711  24.829  68.386  1.00 36.80 ? 122  SER A CA  1 
ATOM   918   C  C   . SER A 1 119 ? 19.809  25.548  69.392  1.00 36.86 ? 122  SER A C   1 
ATOM   919   O  O   . SER A 1 119 ? 18.703  25.980  69.047  1.00 37.00 ? 122  SER A O   1 
ATOM   920   C  CB  . SER A 1 119 ? 22.008  25.607  68.152  1.00 36.53 ? 122  SER A CB  1 
ATOM   921   O  OG  . SER A 1 119 ? 21.756  26.902  67.645  1.00 36.30 ? 122  SER A OG  1 
ATOM   922   N  N   . ALA A 1 120 ? 20.278  25.662  70.631  1.00 36.78 ? 123  ALA A N   1 
ATOM   923   C  CA  . ALA A 1 120 ? 19.513  26.288  71.702  1.00 36.70 ? 123  ALA A CA  1 
ATOM   924   C  C   . ALA A 1 120 ? 19.561  27.807  71.731  1.00 36.79 ? 123  ALA A C   1 
ATOM   925   O  O   . ALA A 1 120 ? 20.580  28.418  71.407  1.00 36.70 ? 123  ALA A O   1 
ATOM   926   C  CB  . ALA A 1 120 ? 19.960  25.732  73.038  1.00 36.76 ? 123  ALA A CB  1 
ATOM   927   N  N   . ASP A 1 121 ? 18.458  28.406  72.168  1.00 36.81 ? 124  ASP A N   1 
ATOM   928   C  CA  . ASP A 1 121 ? 18.331  29.854  72.263  1.00 36.87 ? 124  ASP A CA  1 
ATOM   929   C  C   . ASP A 1 121 ? 19.051  30.432  73.468  1.00 36.93 ? 124  ASP A C   1 
ATOM   930   O  O   . ASP A 1 121 ? 19.674  31.483  73.378  1.00 36.90 ? 124  ASP A O   1 
ATOM   931   C  CB  . ASP A 1 121 ? 16.854  30.254  72.371  1.00 36.98 ? 124  ASP A CB  1 
ATOM   932   C  CG  . ASP A 1 121 ? 16.108  30.150  71.058  1.00 37.05 ? 124  ASP A CG  1 
ATOM   933   O  OD1 . ASP A 1 121 ? 16.741  29.979  69.996  1.00 37.31 ? 124  ASP A OD1 1 
ATOM   934   O  OD2 . ASP A 1 121 ? 14.867  30.259  71.088  1.00 37.23 ? 124  ASP A OD2 1 
ATOM   935   N  N   . THR A 1 122 ? 18.938  29.749  74.602  1.00 37.02 ? 125  THR A N   1 
ATOM   936   C  CA  . THR A 1 122 ? 19.524  30.209  75.856  1.00 37.07 ? 125  THR A CA  1 
ATOM   937   C  C   . THR A 1 122 ? 20.983  29.824  76.101  1.00 37.24 ? 125  THR A C   1 
ATOM   938   O  O   . THR A 1 122 ? 21.294  29.096  77.048  1.00 37.17 ? 125  THR A O   1 
ATOM   939   C  CB  . THR A 1 122 ? 18.657  29.747  77.056  1.00 37.20 ? 125  THR A CB  1 
ATOM   940   O  OG1 . THR A 1 122 ? 18.562  28.315  77.063  1.00 37.08 ? 125  THR A OG1 1 
ATOM   941   C  CG2 . THR A 1 122 ? 17.255  30.331  76.954  1.00 37.05 ? 125  THR A CG2 1 
ATOM   942   N  N   . VAL A 1 123 ? 21.882  30.337  75.266  1.00 37.07 ? 126  VAL A N   1 
ATOM   943   C  CA  . VAL A 1 123 ? 23.309  30.045  75.399  1.00 36.95 ? 126  VAL A CA  1 
ATOM   944   C  C   . VAL A 1 123 ? 24.076  31.359  75.356  1.00 36.97 ? 126  VAL A C   1 
ATOM   945   O  O   . VAL A 1 123 ? 23.562  32.346  74.835  1.00 37.03 ? 126  VAL A O   1 
ATOM   946   C  CB  . VAL A 1 123 ? 23.814  29.142  74.251  1.00 36.88 ? 126  VAL A CB  1 
ATOM   947   C  CG1 . VAL A 1 123 ? 23.156  27.778  74.316  1.00 36.61 ? 126  VAL A CG1 1 
ATOM   948   C  CG2 . VAL A 1 123 ? 23.534  29.798  72.904  1.00 36.74 ? 126  VAL A CG2 1 
ATOM   949   N  N   . ARG A 1 124 ? 25.286  31.384  75.916  1.00 36.86 ? 127  ARG A N   1 
ATOM   950   C  CA  . ARG A 1 124 ? 26.092  32.603  75.913  1.00 36.69 ? 127  ARG A CA  1 
ATOM   951   C  C   . ARG A 1 124 ? 26.472  32.901  74.479  1.00 36.62 ? 127  ARG A C   1 
ATOM   952   O  O   . ARG A 1 124 ? 27.065  32.065  73.796  1.00 36.67 ? 127  ARG A O   1 
ATOM   953   C  CB  . ARG A 1 124 ? 27.353  32.455  76.762  1.00 36.60 ? 127  ARG A CB  1 
ATOM   954   C  CG  . ARG A 1 124 ? 28.116  33.771  76.924  1.00 36.61 ? 127  ARG A CG  1 
ATOM   955   C  CD  . ARG A 1 124 ? 29.272  33.655  77.912  1.00 36.64 ? 127  ARG A CD  1 
ATOM   956   N  NE  . ARG A 1 124 ? 28.824  33.132  79.201  1.00 36.69 ? 127  ARG A NE  1 
ATOM   957   C  CZ  . ARG A 1 124 ? 28.106  33.814  80.087  1.00 36.66 ? 127  ARG A CZ  1 
ATOM   958   N  NH1 . ARG A 1 124 ? 27.738  33.227  81.217  1.00 36.61 ? 127  ARG A NH1 1 
ATOM   959   N  NH2 . ARG A 1 124 ? 27.785  35.085  79.866  1.00 36.45 ? 127  ARG A NH2 1 
ATOM   960   N  N   . ASP A 1 125 ? 26.156  34.109  74.035  1.00 36.40 ? 128  ASP A N   1 
ATOM   961   C  CA  . ASP A 1 125 ? 26.423  34.499  72.661  1.00 36.20 ? 128  ASP A CA  1 
ATOM   962   C  C   . ASP A 1 125 ? 25.788  35.870  72.513  1.00 36.03 ? 128  ASP A C   1 
ATOM   963   O  O   . ASP A 1 125 ? 24.883  36.218  73.277  1.00 36.06 ? 128  ASP A O   1 
ATOM   964   C  CB  . ASP A 1 125 ? 25.668  33.527  71.735  1.00 36.20 ? 128  ASP A CB  1 
ATOM   965   C  CG  . ASP A 1 125 ? 26.461  33.121  70.511  1.00 36.30 ? 128  ASP A CG  1 
ATOM   966   O  OD1 . ASP A 1 125 ? 25.842  32.564  69.576  1.00 36.27 ? 128  ASP A OD1 1 
ATOM   967   O  OD2 . ASP A 1 125 ? 27.692  33.324  70.479  1.00 36.54 ? 128  ASP A OD2 1 
ATOM   968   N  N   . PRO A 1 126 ? 26.319  36.715  71.617  1.00 35.80 ? 129  PRO A N   1 
ATOM   969   C  CA  . PRO A 1 126 ? 25.643  38.008  71.508  1.00 35.76 ? 129  PRO A CA  1 
ATOM   970   C  C   . PRO A 1 126 ? 24.286  37.749  70.834  1.00 35.72 ? 129  PRO A C   1 
ATOM   971   O  O   . PRO A 1 126 ? 23.980  36.607  70.482  1.00 35.66 ? 129  PRO A O   1 
ATOM   972   C  CB  . PRO A 1 126 ? 26.599  38.834  70.640  1.00 35.65 ? 129  PRO A CB  1 
ATOM   973   C  CG  . PRO A 1 126 ? 27.450  37.829  69.955  1.00 35.65 ? 129  PRO A CG  1 
ATOM   974   C  CD  . PRO A 1 126 ? 27.634  36.745  70.957  1.00 35.75 ? 129  PRO A CD  1 
ATOM   975   N  N   . ARG A 1 127 ? 23.436  38.760  70.732  1.00 35.65 ? 130  ARG A N   1 
ATOM   976   C  CA  . ARG A 1 127 ? 22.141  38.549  70.100  1.00 35.57 ? 130  ARG A CA  1 
ATOM   977   C  C   . ARG A 1 127 ? 21.951  39.513  68.950  1.00 35.43 ? 130  ARG A C   1 
ATOM   978   O  O   . ARG A 1 127 ? 22.373  40.672  69.028  1.00 35.45 ? 130  ARG A O   1 
ATOM   979   C  CB  . ARG A 1 127 ? 20.995  38.746  71.099  1.00 35.61 ? 130  ARG A CB  1 
ATOM   980   C  CG  . ARG A 1 127 ? 20.973  37.797  72.285  1.00 35.76 ? 130  ARG A CG  1 
ATOM   981   C  CD  . ARG A 1 127 ? 20.498  36.415  71.890  1.00 36.02 ? 130  ARG A CD  1 
ATOM   982   N  NE  . ARG A 1 127 ? 20.385  35.513  73.040  1.00 36.33 ? 130  ARG A NE  1 
ATOM   983   C  CZ  . ARG A 1 127 ? 21.386  34.800  73.560  1.00 36.26 ? 130  ARG A CZ  1 
ATOM   984   N  NH1 . ARG A 1 127 ? 22.607  34.870  73.051  1.00 36.22 ? 130  ARG A NH1 1 
ATOM   985   N  NH2 . ARG A 1 127 ? 21.156  33.980  74.574  1.00 36.22 ? 130  ARG A NH2 1 
ATOM   986   N  N   . GLY A 1 128 ? 21.335  39.013  67.879  1.00 35.31 ? 131  GLY A N   1 
ATOM   987   C  CA  . GLY A 1 128 ? 21.049  39.827  66.715  1.00 34.83 ? 131  GLY A CA  1 
ATOM   988   C  C   . GLY A 1 128 ? 19.722  40.524  66.922  1.00 34.63 ? 131  GLY A C   1 
ATOM   989   O  O   . GLY A 1 128 ? 18.794  39.940  67.474  1.00 34.59 ? 131  GLY A O   1 
ATOM   990   N  N   . PHE A 1 129 ? 19.635  41.776  66.489  1.00 34.62 ? 132  PHE A N   1 
ATOM   991   C  CA  . PHE A 1 129 ? 18.424  42.574  66.634  1.00 34.59 ? 132  PHE A CA  1 
ATOM   992   C  C   . PHE A 1 129 ? 18.319  43.452  65.389  1.00 34.47 ? 132  PHE A C   1 
ATOM   993   O  O   . PHE A 1 129 ? 18.599  44.662  65.418  1.00 34.34 ? 132  PHE A O   1 
ATOM   994   C  CB  . PHE A 1 129 ? 18.535  43.429  67.900  1.00 34.70 ? 132  PHE A CB  1 
ATOM   995   C  CG  . PHE A 1 129 ? 17.224  43.990  68.376  1.00 35.02 ? 132  PHE A CG  1 
ATOM   996   C  CD1 . PHE A 1 129 ? 16.159  44.186  67.497  1.00 35.15 ? 132  PHE A CD1 1 
ATOM   997   C  CD2 . PHE A 1 129 ? 17.065  44.358  69.703  1.00 34.91 ? 132  PHE A CD2 1 
ATOM   998   C  CE1 . PHE A 1 129 ? 14.961  44.746  67.937  1.00 35.10 ? 132  PHE A CE1 1 
ATOM   999   C  CE2 . PHE A 1 129 ? 15.877  44.916  70.147  1.00 34.88 ? 132  PHE A CE2 1 
ATOM   1000  C  CZ  . PHE A 1 129 ? 14.824  45.111  69.262  1.00 35.04 ? 132  PHE A CZ  1 
ATOM   1001  N  N   . ALA A 1 130 ? 17.908  42.821  64.294  1.00 34.24 ? 133  ALA A N   1 
ATOM   1002  C  CA  . ALA A 1 130 ? 17.790  43.484  63.007  1.00 34.04 ? 133  ALA A CA  1 
ATOM   1003  C  C   . ALA A 1 130 ? 16.418  44.052  62.777  1.00 33.98 ? 133  ALA A C   1 
ATOM   1004  O  O   . ALA A 1 130 ? 15.411  43.376  62.992  1.00 33.89 ? 133  ALA A O   1 
ATOM   1005  C  CB  . ALA A 1 130 ? 18.142  42.525  61.905  1.00 33.91 ? 133  ALA A CB  1 
ATOM   1006  N  N   . VAL A 1 131 ? 16.387  45.285  62.286  1.00 33.86 ? 134  VAL A N   1 
ATOM   1007  C  CA  . VAL A 1 131 ? 15.132  45.972  62.022  1.00 33.80 ? 134  VAL A CA  1 
ATOM   1008  C  C   . VAL A 1 131 ? 15.029  46.448  60.575  1.00 33.83 ? 134  VAL A C   1 
ATOM   1009  O  O   . VAL A 1 131 ? 15.938  47.092  60.056  1.00 33.77 ? 134  VAL A O   1 
ATOM   1010  C  CB  . VAL A 1 131 ? 14.967  47.195  62.954  1.00 33.75 ? 134  VAL A CB  1 
ATOM   1011  C  CG1 . VAL A 1 131 ? 13.516  47.690  62.935  1.00 33.40 ? 134  VAL A CG1 1 
ATOM   1012  C  CG2 . VAL A 1 131 ? 15.406  46.845  64.369  1.00 33.54 ? 134  VAL A CG2 1 
ATOM   1013  N  N   . LYS A 1 132 ? 13.922  46.106  59.926  1.00 33.74 ? 135  LYS A N   1 
ATOM   1014  C  CA  . LYS A 1 132 ? 13.674  46.521  58.557  1.00 33.65 ? 135  LYS A CA  1 
ATOM   1015  C  C   . LYS A 1 132 ? 12.530  47.527  58.577  1.00 33.88 ? 135  LYS A C   1 
ATOM   1016  O  O   . LYS A 1 132 ? 11.423  47.206  59.006  1.00 33.71 ? 135  LYS A O   1 
ATOM   1017  C  CB  . LYS A 1 132 ? 13.289  45.320  57.693  1.00 33.19 ? 135  LYS A CB  1 
ATOM   1018  C  CG  . LYS A 1 132 ? 13.024  45.681  56.238  1.00 32.90 ? 135  LYS A CG  1 
ATOM   1019  C  CD  . LYS A 1 132 ? 12.643  44.464  55.398  1.00 32.58 ? 135  LYS A CD  1 
ATOM   1020  C  CE  . LYS A 1 132 ? 13.794  43.475  55.263  1.00 32.43 ? 135  LYS A CE  1 
ATOM   1021  N  NZ  . LYS A 1 132 ? 14.979  44.048  54.565  1.00 32.02 ? 135  LYS A NZ  1 
ATOM   1022  N  N   . PHE A 1 133 ? 12.816  48.759  58.173  1.00 34.18 ? 136  PHE A N   1 
ATOM   1023  C  CA  . PHE A 1 133 ? 11.798  49.801  58.121  1.00 34.61 ? 136  PHE A CA  1 
ATOM   1024  C  C   . PHE A 1 133 ? 11.383  49.933  56.666  1.00 35.11 ? 136  PHE A C   1 
ATOM   1025  O  O   . PHE A 1 133 ? 12.217  50.225  55.812  1.00 35.16 ? 136  PHE A O   1 
ATOM   1026  C  CB  . PHE A 1 133 ? 12.365  51.145  58.561  1.00 34.36 ? 136  PHE A CB  1 
ATOM   1027  C  CG  . PHE A 1 133 ? 12.971  51.146  59.929  1.00 34.25 ? 136  PHE A CG  1 
ATOM   1028  C  CD1 . PHE A 1 133 ? 14.192  50.533  60.168  1.00 34.12 ? 136  PHE A CD1 1 
ATOM   1029  C  CD2 . PHE A 1 133 ? 12.358  51.834  60.968  1.00 34.28 ? 136  PHE A CD2 1 
ATOM   1030  C  CE1 . PHE A 1 133 ? 14.797  50.611  61.424  1.00 34.09 ? 136  PHE A CE1 1 
ATOM   1031  C  CE2 . PHE A 1 133 ? 12.960  51.918  62.232  1.00 34.08 ? 136  PHE A CE2 1 
ATOM   1032  C  CZ  . PHE A 1 133 ? 14.177  51.308  62.456  1.00 33.98 ? 136  PHE A CZ  1 
ATOM   1033  N  N   . TYR A 1 134 ? 10.108  49.725  56.369  1.00 35.58 ? 137  TYR A N   1 
ATOM   1034  C  CA  . TYR A 1 134 ? 9.633   49.834  54.989  1.00 36.21 ? 137  TYR A CA  1 
ATOM   1035  C  C   . TYR A 1 134 ? 9.199   51.271  54.721  1.00 36.76 ? 137  TYR A C   1 
ATOM   1036  O  O   . TYR A 1 134 ? 8.011   51.582  54.799  1.00 36.89 ? 137  TYR A O   1 
ATOM   1037  C  CB  . TYR A 1 134 ? 8.442   48.898  54.763  1.00 36.13 ? 137  TYR A CB  1 
ATOM   1038  C  CG  . TYR A 1 134 ? 8.701   47.431  55.063  1.00 36.11 ? 137  TYR A CG  1 
ATOM   1039  C  CD1 . TYR A 1 134 ? 9.207   46.583  54.086  1.00 35.97 ? 137  TYR A CD1 1 
ATOM   1040  C  CD2 . TYR A 1 134 ? 8.381   46.879  56.307  1.00 36.01 ? 137  TYR A CD2 1 
ATOM   1041  C  CE1 . TYR A 1 134 ? 9.382   45.227  54.330  1.00 35.89 ? 137  TYR A CE1 1 
ATOM   1042  C  CE2 . TYR A 1 134 ? 8.557   45.519  56.558  1.00 35.85 ? 137  TYR A CE2 1 
ATOM   1043  C  CZ  . TYR A 1 134 ? 9.056   44.706  55.559  1.00 35.91 ? 137  TYR A CZ  1 
ATOM   1044  O  OH  . TYR A 1 134 ? 9.228   43.364  55.772  1.00 35.98 ? 137  TYR A OH  1 
ATOM   1045  N  N   . THR A 1 135 ? 10.145  52.144  54.386  1.00 37.16 ? 138  THR A N   1 
ATOM   1046  C  CA  . THR A 1 135 ? 9.818   53.551  54.155  1.00 37.60 ? 138  THR A CA  1 
ATOM   1047  C  C   . THR A 1 135 ? 9.455   53.896  52.715  1.00 38.14 ? 138  THR A C   1 
ATOM   1048  O  O   . THR A 1 135 ? 9.623   53.080  51.804  1.00 38.13 ? 138  THR A O   1 
ATOM   1049  C  CB  . THR A 1 135 ? 10.961  54.490  54.622  1.00 37.62 ? 138  THR A CB  1 
ATOM   1050  O  OG1 . THR A 1 135 ? 11.901  54.682  53.563  1.00 37.38 ? 138  THR A OG1 1 
ATOM   1051  C  CG2 . THR A 1 135 ? 11.695  53.887  55.804  1.00 37.68 ? 138  THR A CG2 1 
ATOM   1052  N  N   . GLU A 1 136 ? 8.969   55.121  52.520  1.00 38.53 ? 139  GLU A N   1 
ATOM   1053  C  CA  . GLU A 1 136 ? 8.583   55.615  51.198  1.00 38.86 ? 139  GLU A CA  1 
ATOM   1054  C  C   . GLU A 1 136 ? 9.811   55.774  50.310  1.00 38.55 ? 139  GLU A C   1 
ATOM   1055  O  O   . GLU A 1 136 ? 9.696   55.751  49.088  1.00 38.53 ? 139  GLU A O   1 
ATOM   1056  C  CB  . GLU A 1 136 ? 7.846   56.955  51.303  1.00 39.45 ? 139  GLU A CB  1 
ATOM   1057  C  CG  . GLU A 1 136 ? 6.583   56.918  52.134  1.00 40.72 ? 139  GLU A CG  1 
ATOM   1058  C  CD  . GLU A 1 136 ? 6.780   57.498  53.524  1.00 41.66 ? 139  GLU A CD  1 
ATOM   1059  O  OE1 . GLU A 1 136 ? 7.693   57.039  54.268  1.00 42.11 ? 139  GLU A OE1 1 
ATOM   1060  O  OE2 . GLU A 1 136 ? 6.008   58.418  53.873  1.00 42.12 ? 139  GLU A OE2 1 
ATOM   1061  N  N   . ASP A 1 137 ? 10.974  55.975  50.926  1.00 38.12 ? 140  ASP A N   1 
ATOM   1062  C  CA  . ASP A 1 137 ? 12.229  56.110  50.189  1.00 37.69 ? 140  ASP A CA  1 
ATOM   1063  C  C   . ASP A 1 137 ? 12.960  54.765  50.130  1.00 37.32 ? 140  ASP A C   1 
ATOM   1064  O  O   . ASP A 1 137 ? 14.188  54.704  49.991  1.00 37.20 ? 140  ASP A O   1 
ATOM   1065  C  CB  . ASP A 1 137 ? 13.127  57.171  50.829  1.00 37.92 ? 140  ASP A CB  1 
ATOM   1066  C  CG  . ASP A 1 137 ? 12.774  58.583  50.394  1.00 38.26 ? 140  ASP A CG  1 
ATOM   1067  O  OD1 . ASP A 1 137 ? 13.145  59.537  51.113  1.00 38.51 ? 140  ASP A OD1 1 
ATOM   1068  O  OD2 . ASP A 1 137 ? 12.145  58.750  49.323  1.00 38.62 ? 140  ASP A OD2 1 
ATOM   1069  N  N   . GLY A 1 138 ? 12.190  53.687  50.226  1.00 36.90 ? 141  GLY A N   1 
ATOM   1070  C  CA  . GLY A 1 138 ? 12.770  52.365  50.178  1.00 36.51 ? 141  GLY A CA  1 
ATOM   1071  C  C   . GLY A 1 138 ? 12.986  51.783  51.551  1.00 36.21 ? 141  GLY A C   1 
ATOM   1072  O  O   . GLY A 1 138 ? 12.670  52.406  52.560  1.00 36.20 ? 141  GLY A O   1 
ATOM   1073  N  N   . ASN A 1 139 ? 13.527  50.575  51.584  1.00 36.01 ? 142  ASN A N   1 
ATOM   1074  C  CA  . ASN A 1 139 ? 13.786  49.892  52.837  1.00 35.77 ? 142  ASN A CA  1 
ATOM   1075  C  C   . ASN A 1 139 ? 15.043  50.383  53.521  1.00 35.76 ? 142  ASN A C   1 
ATOM   1076  O  O   . ASN A 1 139 ? 16.045  50.704  52.877  1.00 35.60 ? 142  ASN A O   1 
ATOM   1077  C  CB  . ASN A 1 139 ? 13.895  48.380  52.617  1.00 35.59 ? 142  ASN A CB  1 
ATOM   1078  C  CG  . ASN A 1 139 ? 12.561  47.733  52.308  1.00 35.48 ? 142  ASN A CG  1 
ATOM   1079  O  OD1 . ASN A 1 139 ? 11.502  48.338  52.484  1.00 35.66 ? 142  ASN A OD1 1 
ATOM   1080  N  ND2 . ASN A 1 139 ? 12.603  46.484  51.864  1.00 35.40 ? 142  ASN A ND2 1 
ATOM   1081  N  N   . TRP A 1 140 ? 14.955  50.471  54.839  1.00 35.82 ? 143  TRP A N   1 
ATOM   1082  C  CA  . TRP A 1 140 ? 16.065  50.874  55.669  1.00 35.87 ? 143  TRP A CA  1 
ATOM   1083  C  C   . TRP A 1 140 ? 16.287  49.706  56.610  1.00 36.03 ? 143  TRP A C   1 
ATOM   1084  O  O   . TRP A 1 140 ? 15.392  49.337  57.370  1.00 36.00 ? 143  TRP A O   1 
ATOM   1085  C  CB  . TRP A 1 140 ? 15.730  52.128  56.476  1.00 35.72 ? 143  TRP A CB  1 
ATOM   1086  C  CG  . TRP A 1 140 ? 16.813  52.489  57.451  1.00 35.70 ? 143  TRP A CG  1 
ATOM   1087  C  CD1 . TRP A 1 140 ? 18.152  52.251  57.314  1.00 35.69 ? 143  TRP A CD1 1 
ATOM   1088  C  CD2 . TRP A 1 140 ? 16.649  53.111  58.730  1.00 35.62 ? 143  TRP A CD2 1 
ATOM   1089  N  NE1 . TRP A 1 140 ? 18.830  52.678  58.430  1.00 35.71 ? 143  TRP A NE1 1 
ATOM   1090  C  CE2 . TRP A 1 140 ? 17.932  53.210  59.316  1.00 35.70 ? 143  TRP A CE2 1 
ATOM   1091  C  CE3 . TRP A 1 140 ? 15.546  53.592  59.439  1.00 35.54 ? 143  TRP A CE3 1 
ATOM   1092  C  CZ2 . TRP A 1 140 ? 18.139  53.770  60.579  1.00 35.58 ? 143  TRP A CZ2 1 
ATOM   1093  C  CZ3 . TRP A 1 140 ? 15.753  54.151  60.698  1.00 35.60 ? 143  TRP A CZ3 1 
ATOM   1094  C  CH2 . TRP A 1 140 ? 17.041  54.233  61.253  1.00 35.45 ? 143  TRP A CH2 1 
ATOM   1095  N  N   . ASP A 1 141 ? 17.457  49.084  56.507  1.00 36.17 ? 144  ASP A N   1 
ATOM   1096  C  CA  . ASP A 1 141 ? 17.801  47.959  57.362  1.00 36.32 ? 144  ASP A CA  1 
ATOM   1097  C  C   . ASP A 1 141 ? 18.820  48.357  58.410  1.00 36.56 ? 144  ASP A C   1 
ATOM   1098  O  O   . ASP A 1 141 ? 19.934  48.774  58.084  1.00 36.58 ? 144  ASP A O   1 
ATOM   1099  C  CB  . ASP A 1 141 ? 18.353  46.789  56.545  1.00 36.17 ? 144  ASP A CB  1 
ATOM   1100  C  CG  . ASP A 1 141 ? 17.301  46.128  55.687  1.00 36.19 ? 144  ASP A CG  1 
ATOM   1101  O  OD1 . ASP A 1 141 ? 17.639  45.654  54.580  1.00 36.18 ? 144  ASP A OD1 1 
ATOM   1102  O  OD2 . ASP A 1 141 ? 16.134  46.071  56.120  1.00 36.35 ? 144  ASP A OD2 1 
ATOM   1103  N  N   . LEU A 1 142 ? 18.405  48.288  59.670  1.00 36.61 ? 145  LEU A N   1 
ATOM   1104  C  CA  . LEU A 1 142 ? 19.278  48.585  60.792  1.00 36.72 ? 145  LEU A CA  1 
ATOM   1105  C  C   . LEU A 1 142 ? 19.536  47.215  61.416  1.00 36.83 ? 145  LEU A C   1 
ATOM   1106  O  O   . LEU A 1 142 ? 18.741  46.704  62.210  1.00 36.67 ? 145  LEU A O   1 
ATOM   1107  C  CB  . LEU A 1 142 ? 18.589  49.524  61.777  1.00 36.80 ? 145  LEU A CB  1 
ATOM   1108  C  CG  . LEU A 1 142 ? 19.452  50.033  62.935  1.00 36.99 ? 145  LEU A CG  1 
ATOM   1109  C  CD1 . LEU A 1 142 ? 20.705  50.743  62.414  1.00 36.88 ? 145  LEU A CD1 1 
ATOM   1110  C  CD2 . LEU A 1 142 ? 18.615  50.964  63.809  1.00 37.01 ? 145  LEU A CD2 1 
ATOM   1111  N  N   . VAL A 1 143 ? 20.610  46.589  60.948  1.00 37.05 ? 146  VAL A N   1 
ATOM   1112  C  CA  . VAL A 1 143 ? 21.018  45.257  61.376  1.00 37.13 ? 146  VAL A CA  1 
ATOM   1113  C  C   . VAL A 1 143 ? 21.849  45.357  62.653  1.00 37.40 ? 146  VAL A C   1 
ATOM   1114  O  O   . VAL A 1 143 ? 23.078  45.358  62.600  1.00 37.21 ? 146  VAL A O   1 
ATOM   1115  C  CB  . VAL A 1 143 ? 21.843  44.596  60.252  1.00 37.02 ? 146  VAL A CB  1 
ATOM   1116  C  CG1 . VAL A 1 143 ? 21.954  43.115  60.474  1.00 36.78 ? 146  VAL A CG1 1 
ATOM   1117  C  CG2 . VAL A 1 143 ? 21.210  44.893  58.898  1.00 36.88 ? 146  VAL A CG2 1 
ATOM   1118  N  N   . GLY A 1 144 ? 21.174  45.419  63.798  1.00 37.63 ? 147  GLY A N   1 
ATOM   1119  C  CA  . GLY A 1 144 ? 21.886  45.566  65.054  1.00 38.26 ? 147  GLY A CA  1 
ATOM   1120  C  C   . GLY A 1 144 ? 22.115  44.352  65.932  1.00 38.68 ? 147  GLY A C   1 
ATOM   1121  O  O   . GLY A 1 144 ? 21.718  43.240  65.598  1.00 38.80 ? 147  GLY A O   1 
ATOM   1122  N  N   . ASN A 1 145 ? 22.806  44.579  67.048  1.00 39.00 ? 148  ASN A N   1 
ATOM   1123  C  CA  . ASN A 1 145 ? 23.105  43.541  68.032  1.00 39.40 ? 148  ASN A CA  1 
ATOM   1124  C  C   . ASN A 1 145 ? 22.662  44.036  69.403  1.00 39.30 ? 148  ASN A C   1 
ATOM   1125  O  O   . ASN A 1 145 ? 22.243  45.187  69.542  1.00 39.34 ? 148  ASN A O   1 
ATOM   1126  C  CB  . ASN A 1 145 ? 24.605  43.233  68.063  1.00 39.97 ? 148  ASN A CB  1 
ATOM   1127  C  CG  . ASN A 1 145 ? 24.980  42.029  67.197  1.00 40.73 ? 148  ASN A CG  1 
ATOM   1128  O  OD1 . ASN A 1 145 ? 24.118  41.247  66.778  1.00 41.08 ? 148  ASN A OD1 1 
ATOM   1129  N  ND2 . ASN A 1 145 ? 26.281  41.866  66.939  1.00 41.02 ? 148  ASN A ND2 1 
ATOM   1130  N  N   . ASN A 1 146 ? 22.725  43.174  70.413  1.00 39.06 ? 149  ASN A N   1 
ATOM   1131  C  CA  . ASN A 1 146 ? 22.328  43.598  71.750  1.00 38.83 ? 149  ASN A CA  1 
ATOM   1132  C  C   . ASN A 1 146 ? 23.508  44.205  72.490  1.00 38.63 ? 149  ASN A C   1 
ATOM   1133  O  O   . ASN A 1 146 ? 23.514  44.289  73.718  1.00 38.74 ? 149  ASN A O   1 
ATOM   1134  C  CB  . ASN A 1 146 ? 21.708  42.449  72.548  1.00 38.82 ? 149  ASN A CB  1 
ATOM   1135  C  CG  . ASN A 1 146 ? 22.708  41.371  72.918  1.00 38.95 ? 149  ASN A CG  1 
ATOM   1136  O  OD1 . ASN A 1 146 ? 22.590  40.745  73.975  1.00 39.01 ? 149  ASN A OD1 1 
ATOM   1137  N  ND2 . ASN A 1 146 ? 23.680  41.128  72.045  1.00 38.87 ? 149  ASN A ND2 1 
ATOM   1138  N  N   . THR A 1 147 ? 24.504  44.630  71.719  1.00 38.41 ? 150  THR A N   1 
ATOM   1139  C  CA  . THR A 1 147 ? 25.711  45.253  72.248  1.00 38.22 ? 150  THR A CA  1 
ATOM   1140  C  C   . THR A 1 147 ? 26.086  46.425  71.343  1.00 37.90 ? 150  THR A C   1 
ATOM   1141  O  O   . THR A 1 147 ? 25.853  46.386  70.136  1.00 37.79 ? 150  THR A O   1 
ATOM   1142  C  CB  . THR A 1 147 ? 26.888  44.262  72.289  1.00 38.11 ? 150  THR A CB  1 
ATOM   1143  O  OG1 . THR A 1 147 ? 28.098  44.970  72.596  1.00 37.78 ? 150  THR A OG1 1 
ATOM   1144  C  CG2 . THR A 1 147 ? 27.035  43.546  70.945  1.00 38.02 ? 150  THR A CG2 1 
ATOM   1145  N  N   . PRO A 1 148 ? 26.628  47.506  71.923  1.00 37.74 ? 151  PRO A N   1 
ATOM   1146  C  CA  . PRO A 1 148 ? 27.016  48.673  71.127  1.00 37.59 ? 151  PRO A CA  1 
ATOM   1147  C  C   . PRO A 1 148 ? 28.363  48.508  70.434  1.00 37.33 ? 151  PRO A C   1 
ATOM   1148  O  O   . PRO A 1 148 ? 28.743  49.338  69.612  1.00 37.29 ? 151  PRO A O   1 
ATOM   1149  C  CB  . PRO A 1 148 ? 27.073  49.780  72.173  1.00 37.66 ? 151  PRO A CB  1 
ATOM   1150  C  CG  . PRO A 1 148 ? 27.573  49.055  73.374  1.00 37.68 ? 151  PRO A CG  1 
ATOM   1151  C  CD  . PRO A 1 148 ? 26.740  47.795  73.366  1.00 37.78 ? 151  PRO A CD  1 
ATOM   1152  N  N   . ILE A 1 149 ? 29.070  47.429  70.755  1.00 37.12 ? 152  ILE A N   1 
ATOM   1153  C  CA  . ILE A 1 149 ? 30.387  47.175  70.180  1.00 37.01 ? 152  ILE A CA  1 
ATOM   1154  C  C   . ILE A 1 149 ? 30.519  45.760  69.620  1.00 37.03 ? 152  ILE A C   1 
ATOM   1155  O  O   . ILE A 1 149 ? 29.561  44.983  69.636  1.00 37.10 ? 152  ILE A O   1 
ATOM   1156  C  CB  . ILE A 1 149 ? 31.475  47.361  71.243  1.00 36.77 ? 152  ILE A CB  1 
ATOM   1157  C  CG1 . ILE A 1 149 ? 31.134  46.513  72.469  1.00 36.74 ? 152  ILE A CG1 1 
ATOM   1158  C  CG2 . ILE A 1 149 ? 31.590  48.821  71.625  1.00 36.79 ? 152  ILE A CG2 1 
ATOM   1159  C  CD1 . ILE A 1 149 ? 32.189  46.503  73.528  1.00 36.49 ? 152  ILE A CD1 1 
ATOM   1160  N  N   . PHE A 1 150 ? 31.710  45.432  69.125  1.00 36.87 ? 153  PHE A N   1 
ATOM   1161  C  CA  . PHE A 1 150 ? 31.974  44.110  68.575  1.00 36.65 ? 153  PHE A CA  1 
ATOM   1162  C  C   . PHE A 1 150 ? 33.373  43.650  68.979  1.00 36.35 ? 153  PHE A C   1 
ATOM   1163  O  O   . PHE A 1 150 ? 34.142  44.419  69.551  1.00 36.28 ? 153  PHE A O   1 
ATOM   1164  C  CB  . PHE A 1 150 ? 31.820  44.118  67.057  1.00 36.96 ? 153  PHE A CB  1 
ATOM   1165  C  CG  . PHE A 1 150 ? 31.558  42.762  66.471  1.00 37.38 ? 153  PHE A CG  1 
ATOM   1166  C  CD1 . PHE A 1 150 ? 32.535  42.103  65.734  1.00 37.54 ? 153  PHE A CD1 1 
ATOM   1167  C  CD2 . PHE A 1 150 ? 30.336  42.130  66.672  1.00 37.50 ? 153  PHE A CD2 1 
ATOM   1168  C  CE1 . PHE A 1 150 ? 32.294  40.828  65.207  1.00 37.58 ? 153  PHE A CE1 1 
ATOM   1169  C  CE2 . PHE A 1 150 ? 30.092  40.857  66.149  1.00 37.56 ? 153  PHE A CE2 1 
ATOM   1170  C  CZ  . PHE A 1 150 ? 31.070  40.209  65.420  1.00 37.45 ? 153  PHE A CZ  1 
ATOM   1171  N  N   . PHE A 1 151 ? 33.698  42.399  68.675  1.00 36.00 ? 154  PHE A N   1 
ATOM   1172  C  CA  . PHE A 1 151 ? 34.983  41.820  69.044  1.00 35.79 ? 154  PHE A CA  1 
ATOM   1173  C  C   . PHE A 1 151 ? 36.190  42.316  68.263  1.00 35.76 ? 154  PHE A C   1 
ATOM   1174  O  O   . PHE A 1 151 ? 37.314  42.250  68.755  1.00 35.39 ? 154  PHE A O   1 
ATOM   1175  C  CB  . PHE A 1 151 ? 34.922  40.306  68.910  1.00 35.81 ? 154  PHE A CB  1 
ATOM   1176  C  CG  . PHE A 1 151 ? 33.817  39.662  69.697  1.00 36.03 ? 154  PHE A CG  1 
ATOM   1177  C  CD1 . PHE A 1 151 ? 32.540  39.544  69.158  1.00 36.11 ? 154  PHE A CD1 1 
ATOM   1178  C  CD2 . PHE A 1 151 ? 34.064  39.113  70.951  1.00 35.86 ? 154  PHE A CD2 1 
ATOM   1179  C  CE1 . PHE A 1 151 ? 31.532  38.882  69.855  1.00 36.05 ? 154  PHE A CE1 1 
ATOM   1180  C  CE2 . PHE A 1 151 ? 33.061  38.453  71.648  1.00 35.78 ? 154  PHE A CE2 1 
ATOM   1181  C  CZ  . PHE A 1 151 ? 31.797  38.337  71.100  1.00 35.86 ? 154  PHE A CZ  1 
ATOM   1182  N  N   . ILE A 1 152 ? 35.965  42.777  67.035  1.00 35.53 ? 155  ILE A N   1 
ATOM   1183  C  CA  . ILE A 1 152 ? 37.051  43.241  66.173  1.00 35.21 ? 155  ILE A CA  1 
ATOM   1184  C  C   . ILE A 1 152 ? 36.755  44.591  65.544  1.00 35.10 ? 155  ILE A C   1 
ATOM   1185  O  O   . ILE A 1 152 ? 35.628  45.070  65.606  1.00 35.08 ? 155  ILE A O   1 
ATOM   1186  C  CB  . ILE A 1 152 ? 37.326  42.229  65.047  1.00 35.21 ? 155  ILE A CB  1 
ATOM   1187  C  CG1 . ILE A 1 152 ? 36.010  41.805  64.392  1.00 35.05 ? 155  ILE A CG1 1 
ATOM   1188  C  CG2 . ILE A 1 152 ? 38.068  41.016  65.590  1.00 35.12 ? 155  ILE A CG2 1 
ATOM   1189  C  CD1 . ILE A 1 152 ? 36.184  40.952  63.152  1.00 34.82 ? 155  ILE A CD1 1 
ATOM   1190  N  N   . ARG A 1 153 ? 37.766  45.202  64.932  1.00 35.13 ? 156  ARG A N   1 
ATOM   1191  C  CA  . ARG A 1 153 ? 37.585  46.508  64.304  1.00 34.99 ? 156  ARG A CA  1 
ATOM   1192  C  C   . ARG A 1 153 ? 37.888  46.551  62.812  1.00 34.94 ? 156  ARG A C   1 
ATOM   1193  O  O   . ARG A 1 153 ? 37.723  47.589  62.184  1.00 34.94 ? 156  ARG A O   1 
ATOM   1194  C  CB  . ARG A 1 153 ? 38.364  47.600  65.056  1.00 34.95 ? 156  ARG A CB  1 
ATOM   1195  C  CG  . ARG A 1 153 ? 39.856  47.351  65.187  1.00 34.98 ? 156  ARG A CG  1 
ATOM   1196  C  CD  . ARG A 1 153 ? 40.551  48.480  65.950  1.00 35.07 ? 156  ARG A CD  1 
ATOM   1197  N  NE  . ARG A 1 153 ? 40.182  48.522  67.366  1.00 35.25 ? 156  ARG A NE  1 
ATOM   1198  C  CZ  . ARG A 1 153 ? 40.986  48.171  68.367  1.00 35.26 ? 156  ARG A CZ  1 
ATOM   1199  N  NH1 . ARG A 1 153 ? 40.554  48.244  69.615  1.00 35.26 ? 156  ARG A NH1 1 
ATOM   1200  N  NH2 . ARG A 1 153 ? 42.219  47.746  68.128  1.00 35.12 ? 156  ARG A NH2 1 
ATOM   1201  N  N   . ASP A 1 154 ? 38.328  45.430  62.246  1.00 34.93 ? 157  ASP A N   1 
ATOM   1202  C  CA  . ASP A 1 154 ? 38.610  45.349  60.810  1.00 34.88 ? 157  ASP A CA  1 
ATOM   1203  C  C   . ASP A 1 154 ? 37.846  44.155  60.246  1.00 34.96 ? 157  ASP A C   1 
ATOM   1204  O  O   . ASP A 1 154 ? 37.944  43.043  60.768  1.00 35.24 ? 157  ASP A O   1 
ATOM   1205  C  CB  . ASP A 1 154 ? 40.103  45.188  60.531  1.00 34.71 ? 157  ASP A CB  1 
ATOM   1206  C  CG  . ASP A 1 154 ? 40.431  45.338  59.055  1.00 34.75 ? 157  ASP A CG  1 
ATOM   1207  O  OD1 . ASP A 1 154 ? 41.073  46.339  58.673  1.00 34.78 ? 157  ASP A OD1 1 
ATOM   1208  O  OD2 . ASP A 1 154 ? 40.029  44.464  58.261  1.00 34.99 ? 157  ASP A OD2 1 
ATOM   1209  N  N   . PRO A 1 155 ? 37.101  44.361  59.146  1.00 34.85 ? 158  PRO A N   1 
ATOM   1210  C  CA  . PRO A 1 155 ? 36.309  43.306  58.511  1.00 34.64 ? 158  PRO A CA  1 
ATOM   1211  C  C   . PRO A 1 155 ? 37.051  42.090  57.976  1.00 34.61 ? 158  PRO A C   1 
ATOM   1212  O  O   . PRO A 1 155 ? 36.488  40.994  57.924  1.00 34.35 ? 158  PRO A O   1 
ATOM   1213  C  CB  . PRO A 1 155 ? 35.574  44.063  57.403  1.00 34.66 ? 158  PRO A CB  1 
ATOM   1214  C  CG  . PRO A 1 155 ? 36.513  45.158  57.059  1.00 34.65 ? 158  PRO A CG  1 
ATOM   1215  C  CD  . PRO A 1 155 ? 36.959  45.628  58.409  1.00 34.74 ? 158  PRO A CD  1 
ATOM   1216  N  N   . ILE A 1 156 ? 38.316  42.258  57.609  1.00 34.48 ? 159  ILE A N   1 
ATOM   1217  C  CA  . ILE A 1 156 ? 39.074  41.140  57.063  1.00 34.49 ? 159  ILE A CA  1 
ATOM   1218  C  C   . ILE A 1 156 ? 39.326  40.031  58.081  1.00 34.34 ? 159  ILE A C   1 
ATOM   1219  O  O   . ILE A 1 156 ? 39.716  38.924  57.721  1.00 34.46 ? 159  ILE A O   1 
ATOM   1220  C  CB  . ILE A 1 156 ? 40.386  41.620  56.405  1.00 34.64 ? 159  ILE A CB  1 
ATOM   1221  C  CG1 . ILE A 1 156 ? 40.822  40.627  55.329  1.00 34.73 ? 159  ILE A CG1 1 
ATOM   1222  C  CG2 . ILE A 1 156 ? 41.469  41.792  57.444  1.00 34.55 ? 159  ILE A CG2 1 
ATOM   1223  C  CD1 . ILE A 1 156 ? 41.888  41.168  54.417  1.00 35.08 ? 159  ILE A CD1 1 
ATOM   1224  N  N   . LEU A 1 157 ? 39.068  40.317  59.350  1.00 34.38 ? 160  LEU A N   1 
ATOM   1225  C  CA  . LEU A 1 157 ? 39.248  39.328  60.400  1.00 34.38 ? 160  LEU A CA  1 
ATOM   1226  C  C   . LEU A 1 157 ? 37.945  38.629  60.750  1.00 34.42 ? 160  LEU A C   1 
ATOM   1227  O  O   . LEU A 1 157 ? 37.949  37.640  61.481  1.00 34.31 ? 160  LEU A O   1 
ATOM   1228  C  CB  . LEU A 1 157 ? 39.809  39.975  61.662  1.00 34.46 ? 160  LEU A CB  1 
ATOM   1229  C  CG  . LEU A 1 157 ? 41.287  40.322  61.634  1.00 34.82 ? 160  LEU A CG  1 
ATOM   1230  C  CD1 . LEU A 1 157 ? 41.468  41.817  61.533  1.00 35.28 ? 160  LEU A CD1 1 
ATOM   1231  C  CD2 . LEU A 1 157 ? 41.911  39.818  62.903  1.00 35.15 ? 160  LEU A CD2 1 
ATOM   1232  N  N   . PHE A 1 158 ? 36.829  39.125  60.222  1.00 34.51 ? 161  PHE A N   1 
ATOM   1233  C  CA  . PHE A 1 158 ? 35.531  38.540  60.532  1.00 34.57 ? 161  PHE A CA  1 
ATOM   1234  C  C   . PHE A 1 158 ? 35.378  37.059  60.179  1.00 34.72 ? 161  PHE A C   1 
ATOM   1235  O  O   . PHE A 1 158 ? 34.849  36.288  60.976  1.00 34.64 ? 161  PHE A O   1 
ATOM   1236  C  CB  . PHE A 1 158 ? 34.404  39.360  59.912  1.00 34.93 ? 161  PHE A CB  1 
ATOM   1237  C  CG  . PHE A 1 158 ? 33.037  38.940  60.370  1.00 35.27 ? 161  PHE A CG  1 
ATOM   1238  C  CD1 . PHE A 1 158 ? 32.243  38.114  59.580  1.00 35.36 ? 161  PHE A CD1 1 
ATOM   1239  C  CD2 . PHE A 1 158 ? 32.533  39.383  61.587  1.00 35.33 ? 161  PHE A CD2 1 
ATOM   1240  C  CE1 . PHE A 1 158 ? 30.966  37.741  60.003  1.00 35.49 ? 161  PHE A CE1 1 
ATOM   1241  C  CE2 . PHE A 1 158 ? 31.257  39.014  62.014  1.00 35.38 ? 161  PHE A CE2 1 
ATOM   1242  C  CZ  . PHE A 1 158 ? 30.475  38.194  61.223  1.00 35.30 ? 161  PHE A CZ  1 
ATOM   1243  N  N   . PRO A 1 159 ? 35.794  36.641  58.970  1.00 34.78 ? 162  PRO A N   1 
ATOM   1244  C  CA  . PRO A 1 159 ? 35.640  35.214  58.665  1.00 34.78 ? 162  PRO A CA  1 
ATOM   1245  C  C   . PRO A 1 159 ? 36.415  34.340  59.655  1.00 34.67 ? 162  PRO A C   1 
ATOM   1246  O  O   . PRO A 1 159 ? 35.925  33.301  60.089  1.00 34.84 ? 162  PRO A O   1 
ATOM   1247  C  CB  . PRO A 1 159 ? 36.211  35.108  57.252  1.00 34.88 ? 162  PRO A CB  1 
ATOM   1248  C  CG  . PRO A 1 159 ? 35.879  36.434  56.662  1.00 34.78 ? 162  PRO A CG  1 
ATOM   1249  C  CD  . PRO A 1 159 ? 36.248  37.382  57.777  1.00 34.79 ? 162  PRO A CD  1 
ATOM   1250  N  N   . SER A 1 160 ? 37.608  34.779  60.038  1.00 34.63 ? 163  SER A N   1 
ATOM   1251  C  CA  . SER A 1 160 ? 38.423  34.028  60.986  1.00 34.51 ? 163  SER A CA  1 
ATOM   1252  C  C   . SER A 1 160 ? 37.772  33.966  62.351  1.00 34.42 ? 163  SER A C   1 
ATOM   1253  O  O   . SER A 1 160 ? 37.723  32.912  62.972  1.00 34.40 ? 163  SER A O   1 
ATOM   1254  C  CB  . SER A 1 160 ? 39.812  34.647  61.106  1.00 34.23 ? 163  SER A CB  1 
ATOM   1255  O  OG  . SER A 1 160 ? 40.523  34.472  59.899  1.00 34.33 ? 163  SER A OG  1 
ATOM   1256  N  N   . PHE A 1 161 ? 37.271  35.102  62.818  1.00 34.50 ? 164  PHE A N   1 
ATOM   1257  C  CA  . PHE A 1 161 ? 36.607  35.161  64.109  1.00 34.56 ? 164  PHE A CA  1 
ATOM   1258  C  C   . PHE A 1 161 ? 35.462  34.149  64.172  1.00 34.71 ? 164  PHE A C   1 
ATOM   1259  O  O   . PHE A 1 161 ? 35.388  33.339  65.099  1.00 34.42 ? 164  PHE A O   1 
ATOM   1260  C  CB  . PHE A 1 161 ? 36.065  36.566  64.361  1.00 34.41 ? 164  PHE A CB  1 
ATOM   1261  C  CG  . PHE A 1 161 ? 35.145  36.646  65.536  1.00 34.55 ? 164  PHE A CG  1 
ATOM   1262  C  CD1 . PHE A 1 161 ? 33.851  37.132  65.391  1.00 34.51 ? 164  PHE A CD1 1 
ATOM   1263  C  CD2 . PHE A 1 161 ? 35.549  36.181  66.782  1.00 34.50 ? 164  PHE A CD2 1 
ATOM   1264  C  CE1 . PHE A 1 161 ? 32.977  37.146  66.469  1.00 34.41 ? 164  PHE A CE1 1 
ATOM   1265  C  CE2 . PHE A 1 161 ? 34.678  36.195  67.862  1.00 34.44 ? 164  PHE A CE2 1 
ATOM   1266  C  CZ  . PHE A 1 161 ? 33.391  36.676  67.702  1.00 34.37 ? 164  PHE A CZ  1 
ATOM   1267  N  N   . ILE A 1 162 ? 34.574  34.204  63.179  1.00 34.85 ? 165  ILE A N   1 
ATOM   1268  C  CA  . ILE A 1 162 ? 33.430  33.302  63.114  1.00 34.83 ? 165  ILE A CA  1 
ATOM   1269  C  C   . ILE A 1 162 ? 33.889  31.860  63.076  1.00 35.23 ? 165  ILE A C   1 
ATOM   1270  O  O   . ILE A 1 162 ? 33.303  31.000  63.732  1.00 35.28 ? 165  ILE A O   1 
ATOM   1271  C  CB  . ILE A 1 162 ? 32.547  33.606  61.892  1.00 34.81 ? 165  ILE A CB  1 
ATOM   1272  C  CG1 . ILE A 1 162 ? 31.936  34.998  62.047  1.00 34.55 ? 165  ILE A CG1 1 
ATOM   1273  C  CG2 . ILE A 1 162 ? 31.449  32.562  61.746  1.00 34.70 ? 165  ILE A CG2 1 
ATOM   1274  C  CD1 . ILE A 1 162 ? 31.161  35.183  63.331  1.00 34.50 ? 165  ILE A CD1 1 
ATOM   1275  N  N   . HIS A 1 163 ? 34.945  31.601  62.316  1.00 35.29 ? 166  HIS A N   1 
ATOM   1276  C  CA  . HIS A 1 163 ? 35.490  30.259  62.223  1.00 35.51 ? 166  HIS A CA  1 
ATOM   1277  C  C   . HIS A 1 163 ? 35.934  29.771  63.601  1.00 35.70 ? 166  HIS A C   1 
ATOM   1278  O  O   . HIS A 1 163 ? 35.655  28.632  63.978  1.00 35.71 ? 166  HIS A O   1 
ATOM   1279  C  CB  . HIS A 1 163 ? 36.671  30.229  61.254  1.00 35.56 ? 166  HIS A CB  1 
ATOM   1280  C  CG  . HIS A 1 163 ? 36.271  30.162  59.814  1.00 35.78 ? 166  HIS A CG  1 
ATOM   1281  N  ND1 . HIS A 1 163 ? 37.191  30.090  58.788  1.00 35.90 ? 166  HIS A ND1 1 
ATOM   1282  C  CD2 . HIS A 1 163 ? 35.052  30.135  59.225  1.00 35.77 ? 166  HIS A CD2 1 
ATOM   1283  C  CE1 . HIS A 1 163 ? 36.555  30.019  57.631  1.00 35.84 ? 166  HIS A CE1 1 
ATOM   1284  N  NE2 . HIS A 1 163 ? 35.256  30.045  57.869  1.00 35.83 ? 166  HIS A NE2 1 
ATOM   1285  N  N   . SER A 1 164 ? 36.590  30.638  64.372  1.00 35.79 ? 167  SER A N   1 
ATOM   1286  C  CA  . SER A 1 164 ? 37.058  30.249  65.703  1.00 35.88 ? 167  SER A CA  1 
ATOM   1287  C  C   . SER A 1 164 ? 35.900  30.042  66.674  1.00 35.97 ? 167  SER A C   1 
ATOM   1288  O  O   . SER A 1 164 ? 36.009  29.276  67.630  1.00 36.07 ? 167  SER A O   1 
ATOM   1289  C  CB  . SER A 1 164 ? 38.048  31.276  66.257  1.00 35.62 ? 167  SER A CB  1 
ATOM   1290  O  OG  . SER A 1 164 ? 37.429  32.525  66.473  1.00 35.75 ? 167  SER A OG  1 
ATOM   1291  N  N   . GLN A 1 165 ? 34.786  30.718  66.414  1.00 36.07 ? 168  GLN A N   1 
ATOM   1292  C  CA  . GLN A 1 165 ? 33.601  30.606  67.250  1.00 35.95 ? 168  GLN A CA  1 
ATOM   1293  C  C   . GLN A 1 165 ? 32.798  29.383  66.898  1.00 36.03 ? 168  GLN A C   1 
ATOM   1294  O  O   . GLN A 1 165 ? 31.949  28.949  67.668  1.00 36.15 ? 168  GLN A O   1 
ATOM   1295  C  CB  . GLN A 1 165 ? 32.722  31.829  67.076  1.00 35.89 ? 168  GLN A CB  1 
ATOM   1296  C  CG  . GLN A 1 165 ? 33.266  33.060  67.743  1.00 35.95 ? 168  GLN A CG  1 
ATOM   1297  C  CD  . GLN A 1 165 ? 33.202  32.971  69.249  1.00 35.90 ? 168  GLN A CD  1 
ATOM   1298  O  OE1 . GLN A 1 165 ? 34.219  33.097  69.928  1.00 36.15 ? 168  GLN A OE1 1 
ATOM   1299  N  NE2 . GLN A 1 165 ? 32.007  32.754  69.783  1.00 35.70 ? 168  GLN A NE2 1 
ATOM   1300  N  N   . LYS A 1 166 ? 33.031  28.842  65.712  1.00 35.97 ? 169  LYS A N   1 
ATOM   1301  C  CA  . LYS A 1 166 ? 32.297  27.668  65.297  1.00 36.10 ? 169  LYS A CA  1 
ATOM   1302  C  C   . LYS A 1 166 ? 33.017  26.334  65.516  1.00 36.45 ? 169  LYS A C   1 
ATOM   1303  O  O   . LYS A 1 166 ? 33.824  26.187  66.441  1.00 36.42 ? 169  LYS A O   1 
ATOM   1304  C  CB  . LYS A 1 166 ? 31.792  27.839  63.868  1.00 35.78 ? 169  LYS A CB  1 
ATOM   1305  C  CG  . LYS A 1 166 ? 30.602  28.780  63.801  1.00 35.50 ? 169  LYS A CG  1 
ATOM   1306  C  CD  . LYS A 1 166 ? 30.290  29.207  62.387  1.00 35.33 ? 169  LYS A CD  1 
ATOM   1307  C  CE  . LYS A 1 166 ? 29.042  30.075  62.332  1.00 35.17 ? 169  LYS A CE  1 
ATOM   1308  N  NZ  . LYS A 1 166 ? 27.781  29.287  62.431  1.00 35.03 ? 169  LYS A NZ  1 
ATOM   1309  N  N   . ARG A 1 167 ? 32.720  25.359  64.665  1.00 36.65 ? 170  ARG A N   1 
ATOM   1310  C  CA  . ARG A 1 167 ? 33.288  24.023  64.800  1.00 36.70 ? 170  ARG A CA  1 
ATOM   1311  C  C   . ARG A 1 167 ? 34.667  23.781  64.207  1.00 36.83 ? 170  ARG A C   1 
ATOM   1312  O  O   . ARG A 1 167 ? 35.047  24.380  63.198  1.00 36.81 ? 170  ARG A O   1 
ATOM   1313  C  CB  . ARG A 1 167 ? 32.306  23.010  64.231  1.00 36.53 ? 170  ARG A CB  1 
ATOM   1314  C  CG  . ARG A 1 167 ? 30.946  23.095  64.869  1.00 36.50 ? 170  ARG A CG  1 
ATOM   1315  C  CD  . ARG A 1 167 ? 29.915  22.398  64.023  1.00 36.56 ? 170  ARG A CD  1 
ATOM   1316  N  NE  . ARG A 1 167 ? 28.595  22.493  64.624  1.00 37.05 ? 170  ARG A NE  1 
ATOM   1317  C  CZ  . ARG A 1 167 ? 28.091  21.603  65.472  1.00 37.43 ? 170  ARG A CZ  1 
ATOM   1318  N  NH1 . ARG A 1 167 ? 28.791  20.533  65.820  1.00 37.60 ? 170  ARG A NH1 1 
ATOM   1319  N  NH2 . ARG A 1 167 ? 26.902  21.812  66.019  1.00 37.86 ? 170  ARG A NH2 1 
ATOM   1320  N  N   . ASN A 1 168 ? 35.415  22.893  64.860  1.00 36.78 ? 171  ASN A N   1 
ATOM   1321  C  CA  . ASN A 1 168 ? 36.743  22.509  64.409  1.00 36.62 ? 171  ASN A CA  1 
ATOM   1322  C  C   . ASN A 1 168 ? 36.530  21.859  63.047  1.00 36.55 ? 171  ASN A C   1 
ATOM   1323  O  O   . ASN A 1 168 ? 35.644  21.015  62.888  1.00 36.71 ? 171  ASN A O   1 
ATOM   1324  C  CB  . ASN A 1 168 ? 37.342  21.501  65.385  1.00 36.54 ? 171  ASN A CB  1 
ATOM   1325  C  CG  . ASN A 1 168 ? 38.708  21.035  64.965  1.00 36.45 ? 171  ASN A CG  1 
ATOM   1326  O  OD1 . ASN A 1 168 ? 39.719  21.479  65.507  1.00 36.73 ? 171  ASN A OD1 1 
ATOM   1327  N  ND2 . ASN A 1 168 ? 38.752  20.140  63.989  1.00 36.39 ? 171  ASN A ND2 1 
ATOM   1328  N  N   . PRO A 1 169 ? 37.345  22.226  62.049  1.00 36.45 ? 172  PRO A N   1 
ATOM   1329  C  CA  . PRO A 1 169 ? 37.240  21.683  60.686  1.00 36.32 ? 172  PRO A CA  1 
ATOM   1330  C  C   . PRO A 1 169 ? 37.380  20.163  60.519  1.00 36.35 ? 172  PRO A C   1 
ATOM   1331  O  O   . PRO A 1 169 ? 36.919  19.601  59.516  1.00 36.28 ? 172  PRO A O   1 
ATOM   1332  C  CB  . PRO A 1 169 ? 38.320  22.454  59.926  1.00 36.31 ? 172  PRO A CB  1 
ATOM   1333  C  CG  . PRO A 1 169 ? 39.336  22.734  60.979  1.00 36.42 ? 172  PRO A CG  1 
ATOM   1334  C  CD  . PRO A 1 169 ? 38.491  23.145  62.160  1.00 36.43 ? 172  PRO A CD  1 
ATOM   1335  N  N   . GLN A 1 170 ? 38.011  19.492  61.477  1.00 36.15 ? 173  GLN A N   1 
ATOM   1336  C  CA  . GLN A 1 170 ? 38.153  18.050  61.372  1.00 35.90 ? 173  GLN A CA  1 
ATOM   1337  C  C   . GLN A 1 170 ? 37.178  17.305  62.273  1.00 35.82 ? 173  GLN A C   1 
ATOM   1338  O  O   . GLN A 1 170 ? 36.465  16.418  61.803  1.00 35.76 ? 173  GLN A O   1 
ATOM   1339  C  CB  . GLN A 1 170 ? 39.591  17.601  61.660  1.00 35.82 ? 173  GLN A CB  1 
ATOM   1340  C  CG  . GLN A 1 170 ? 39.744  16.080  61.633  1.00 35.85 ? 173  GLN A CG  1 
ATOM   1341  C  CD  . GLN A 1 170 ? 41.178  15.608  61.613  1.00 35.80 ? 173  GLN A CD  1 
ATOM   1342  O  OE1 . GLN A 1 170 ? 42.098  16.369  61.896  1.00 36.09 ? 173  GLN A OE1 1 
ATOM   1343  N  NE2 . GLN A 1 170 ? 41.378  14.342  61.275  1.00 35.57 ? 173  GLN A NE2 1 
ATOM   1344  N  N   . THR A 1 171 ? 37.121  17.688  63.548  1.00 35.62 ? 174  THR A N   1 
ATOM   1345  C  CA  . THR A 1 171 ? 36.245  17.020  64.510  1.00 35.30 ? 174  THR A CA  1 
ATOM   1346  C  C   . THR A 1 171 ? 34.806  17.489  64.476  1.00 35.56 ? 174  THR A C   1 
ATOM   1347  O  O   . THR A 1 171 ? 33.923  16.790  64.969  1.00 35.55 ? 174  THR A O   1 
ATOM   1348  C  CB  . THR A 1 171 ? 36.731  17.191  65.955  1.00 35.13 ? 174  THR A CB  1 
ATOM   1349  O  OG1 . THR A 1 171 ? 36.575  18.555  66.346  1.00 34.73 ? 174  THR A OG1 1 
ATOM   1350  C  CG2 . THR A 1 171 ? 38.181  16.797  66.088  1.00 34.94 ? 174  THR A CG2 1 
ATOM   1351  N  N   . HIS A 1 172 ? 34.576  18.677  63.925  1.00 35.53 ? 175  HIS A N   1 
ATOM   1352  C  CA  . HIS A 1 172 ? 33.237  19.257  63.854  1.00 35.64 ? 175  HIS A CA  1 
ATOM   1353  C  C   . HIS A 1 172 ? 32.720  19.551  65.258  1.00 35.86 ? 175  HIS A C   1 
ATOM   1354  O  O   . HIS A 1 172 ? 31.523  19.503  65.511  1.00 35.85 ? 175  HIS A O   1 
ATOM   1355  C  CB  . HIS A 1 172 ? 32.272  18.311  63.140  1.00 35.42 ? 175  HIS A CB  1 
ATOM   1356  C  CG  . HIS A 1 172 ? 31.065  18.992  62.576  1.00 35.35 ? 175  HIS A CG  1 
ATOM   1357  N  ND1 . HIS A 1 172 ? 31.153  20.065  61.718  1.00 35.32 ? 175  HIS A ND1 1 
ATOM   1358  C  CD2 . HIS A 1 172 ? 29.745  18.739  62.728  1.00 35.30 ? 175  HIS A CD2 1 
ATOM   1359  C  CE1 . HIS A 1 172 ? 29.939  20.444  61.362  1.00 35.22 ? 175  HIS A CE1 1 
ATOM   1360  N  NE2 . HIS A 1 172 ? 29.067  19.655  61.961  1.00 35.32 ? 175  HIS A NE2 1 
ATOM   1361  N  N   . LEU A 1 173 ? 33.634  19.848  66.172  1.00 35.99 ? 176  LEU A N   1 
ATOM   1362  C  CA  . LEU A 1 173 ? 33.263  20.138  67.547  1.00 36.31 ? 176  LEU A CA  1 
ATOM   1363  C  C   . LEU A 1 173 ? 33.631  21.568  67.904  1.00 36.54 ? 176  LEU A C   1 
ATOM   1364  O  O   . LEU A 1 173 ? 34.486  22.178  67.263  1.00 36.23 ? 176  LEU A O   1 
ATOM   1365  C  CB  . LEU A 1 173 ? 33.994  19.189  68.506  1.00 36.27 ? 176  LEU A CB  1 
ATOM   1366  C  CG  . LEU A 1 173 ? 33.822  17.676  68.342  1.00 36.35 ? 176  LEU A CG  1 
ATOM   1367  C  CD1 . LEU A 1 173 ? 34.857  16.941  69.159  1.00 36.30 ? 176  LEU A CD1 1 
ATOM   1368  C  CD2 . LEU A 1 173 ? 32.431  17.254  68.755  1.00 36.43 ? 176  LEU A CD2 1 
ATOM   1369  N  N   . LYS A 1 174 ? 32.949  22.111  68.908  1.00 36.95 ? 177  LYS A N   1 
ATOM   1370  C  CA  . LYS A 1 174 ? 33.252  23.448  69.386  1.00 37.51 ? 177  LYS A CA  1 
ATOM   1371  C  C   . LYS A 1 174 ? 34.672  23.294  69.937  1.00 37.56 ? 177  LYS A C   1 
ATOM   1372  O  O   . LYS A 1 174 ? 34.984  22.283  70.570  1.00 37.54 ? 177  LYS A O   1 
ATOM   1373  C  CB  . LYS A 1 174 ? 32.265  23.865  70.481  1.00 37.82 ? 177  LYS A CB  1 
ATOM   1374  C  CG  . LYS A 1 174 ? 30.847  24.131  69.977  1.00 38.52 ? 177  LYS A CG  1 
ATOM   1375  C  CD  . LYS A 1 174 ? 30.827  25.293  68.971  1.00 39.68 ? 177  LYS A CD  1 
ATOM   1376  C  CE  . LYS A 1 174 ? 29.413  25.845  68.701  1.00 40.31 ? 177  LYS A CE  1 
ATOM   1377  N  NZ  . LYS A 1 174 ? 28.516  24.896  67.952  1.00 40.86 ? 177  LYS A NZ  1 
ATOM   1378  N  N   . ASP A 1 175 ? 35.534  24.274  69.685  1.00 37.66 ? 178  ASP A N   1 
ATOM   1379  C  CA  . ASP A 1 175 ? 36.924  24.166  70.104  1.00 37.56 ? 178  ASP A CA  1 
ATOM   1380  C  C   . ASP A 1 175 ? 37.430  25.366  70.882  1.00 37.48 ? 178  ASP A C   1 
ATOM   1381  O  O   . ASP A 1 175 ? 37.786  26.384  70.297  1.00 37.58 ? 178  ASP A O   1 
ATOM   1382  C  CB  . ASP A 1 175 ? 37.785  23.967  68.853  1.00 37.73 ? 178  ASP A CB  1 
ATOM   1383  C  CG  . ASP A 1 175 ? 39.185  23.470  69.163  1.00 37.99 ? 178  ASP A CG  1 
ATOM   1384  O  OD1 . ASP A 1 175 ? 39.758  23.839  70.209  1.00 38.35 ? 178  ASP A OD1 1 
ATOM   1385  O  OD2 . ASP A 1 175 ? 39.731  22.721  68.330  1.00 38.03 ? 178  ASP A OD2 1 
ATOM   1386  N  N   . PRO A 1 176 ? 37.540  25.232  72.214  1.00 37.43 ? 179  PRO A N   1 
ATOM   1387  C  CA  . PRO A 1 176 ? 38.022  26.324  73.069  1.00 37.34 ? 179  PRO A CA  1 
ATOM   1388  C  C   . PRO A 1 176 ? 39.440  26.798  72.750  1.00 37.22 ? 179  PRO A C   1 
ATOM   1389  O  O   . PRO A 1 176 ? 39.802  27.923  73.083  1.00 37.26 ? 179  PRO A O   1 
ATOM   1390  C  CB  . PRO A 1 176 ? 37.884  25.749  74.483  1.00 37.28 ? 179  PRO A CB  1 
ATOM   1391  C  CG  . PRO A 1 176 ? 37.934  24.288  74.270  1.00 37.43 ? 179  PRO A CG  1 
ATOM   1392  C  CD  . PRO A 1 176 ? 37.130  24.080  73.027  1.00 37.35 ? 179  PRO A CD  1 
ATOM   1393  N  N   . ASP A 1 177 ? 40.249  25.952  72.116  1.00 37.17 ? 180  ASP A N   1 
ATOM   1394  C  CA  . ASP A 1 177 ? 41.598  26.371  71.731  1.00 37.05 ? 180  ASP A CA  1 
ATOM   1395  C  C   . ASP A 1 177 ? 41.436  27.399  70.618  1.00 36.91 ? 180  ASP A C   1 
ATOM   1396  O  O   . ASP A 1 177 ? 42.101  28.430  70.611  1.00 36.91 ? 180  ASP A O   1 
ATOM   1397  C  CB  . ASP A 1 177 ? 42.428  25.189  71.218  1.00 37.21 ? 180  ASP A CB  1 
ATOM   1398  C  CG  . ASP A 1 177 ? 43.342  24.597  72.280  1.00 37.39 ? 180  ASP A CG  1 
ATOM   1399  O  OD1 . ASP A 1 177 ? 44.163  23.721  71.926  1.00 37.49 ? 180  ASP A OD1 1 
ATOM   1400  O  OD2 . ASP A 1 177 ? 43.252  24.997  73.462  1.00 37.53 ? 180  ASP A OD2 1 
ATOM   1401  N  N   . MET A 1 178 ? 40.535  27.112  69.684  1.00 36.63 ? 181  MET A N   1 
ATOM   1402  C  CA  . MET A 1 178 ? 40.265  28.013  68.576  1.00 36.53 ? 181  MET A CA  1 
ATOM   1403  C  C   . MET A 1 178 ? 39.704  29.335  69.082  1.00 36.42 ? 181  MET A C   1 
ATOM   1404  O  O   . MET A 1 178 ? 40.145  30.408  68.673  1.00 36.27 ? 181  MET A O   1 
ATOM   1405  C  CB  . MET A 1 178 ? 39.269  27.374  67.611  1.00 36.83 ? 181  MET A CB  1 
ATOM   1406  C  CG  . MET A 1 178 ? 39.883  26.365  66.665  1.00 37.14 ? 181  MET A CG  1 
ATOM   1407  S  SD  . MET A 1 178 ? 38.651  25.468  65.699  1.00 37.83 ? 181  MET A SD  1 
ATOM   1408  C  CE  . MET A 1 178 ? 37.779  26.801  64.943  1.00 37.66 ? 181  MET A CE  1 
ATOM   1409  N  N   . VAL A 1 179 ? 38.739  29.246  69.991  1.00 36.21 ? 182  VAL A N   1 
ATOM   1410  C  CA  . VAL A 1 179 ? 38.096  30.427  70.559  1.00 36.00 ? 182  VAL A CA  1 
ATOM   1411  C  C   . VAL A 1 179 ? 39.081  31.361  71.239  1.00 36.22 ? 182  VAL A C   1 
ATOM   1412  O  O   . VAL A 1 179 ? 39.169  32.546  70.907  1.00 36.13 ? 182  VAL A O   1 
ATOM   1413  C  CB  . VAL A 1 179 ? 37.015  30.041  71.598  1.00 35.93 ? 182  VAL A CB  1 
ATOM   1414  C  CG1 . VAL A 1 179 ? 36.499  31.276  72.321  1.00 35.48 ? 182  VAL A CG1 1 
ATOM   1415  C  CG2 . VAL A 1 179 ? 35.872  29.325  70.913  1.00 35.78 ? 182  VAL A CG2 1 
ATOM   1416  N  N   . TRP A 1 180 ? 39.833  30.813  72.182  1.00 36.00 ? 183  TRP A N   1 
ATOM   1417  C  CA  . TRP A 1 180 ? 40.777  31.605  72.934  1.00 35.91 ? 183  TRP A CA  1 
ATOM   1418  C  C   . TRP A 1 180 ? 42.106  31.923  72.289  1.00 36.07 ? 183  TRP A C   1 
ATOM   1419  O  O   . TRP A 1 180 ? 42.746  32.898  72.678  1.00 36.11 ? 183  TRP A O   1 
ATOM   1420  C  CB  . TRP A 1 180 ? 40.928  31.033  74.334  1.00 35.69 ? 183  TRP A CB  1 
ATOM   1421  C  CG  . TRP A 1 180 ? 39.693  31.285  75.130  1.00 35.52 ? 183  TRP A CG  1 
ATOM   1422  C  CD1 . TRP A 1 180 ? 38.689  30.403  75.386  1.00 35.48 ? 183  TRP A CD1 1 
ATOM   1423  C  CD2 . TRP A 1 180 ? 39.312  32.518  75.748  1.00 35.49 ? 183  TRP A CD2 1 
ATOM   1424  N  NE1 . TRP A 1 180 ? 37.702  31.008  76.125  1.00 35.45 ? 183  TRP A NE1 1 
ATOM   1425  C  CE2 . TRP A 1 180 ? 38.063  32.307  76.363  1.00 35.58 ? 183  TRP A CE2 1 
ATOM   1426  C  CE3 . TRP A 1 180 ? 39.908  33.780  75.843  1.00 35.49 ? 183  TRP A CE3 1 
ATOM   1427  C  CZ2 . TRP A 1 180 ? 37.397  33.314  77.068  1.00 35.62 ? 183  TRP A CZ2 1 
ATOM   1428  C  CZ3 . TRP A 1 180 ? 39.246  34.780  76.544  1.00 35.60 ? 183  TRP A CZ3 1 
ATOM   1429  C  CH2 . TRP A 1 180 ? 38.004  34.541  77.148  1.00 35.44 ? 183  TRP A CH2 1 
ATOM   1430  N  N   . ASP A 1 181 ? 42.522  31.136  71.298  1.00 36.10 ? 184  ASP A N   1 
ATOM   1431  C  CA  . ASP A 1 181 ? 43.776  31.437  70.613  1.00 36.21 ? 184  ASP A CA  1 
ATOM   1432  C  C   . ASP A 1 181 ? 43.535  32.724  69.832  1.00 36.29 ? 184  ASP A C   1 
ATOM   1433  O  O   . ASP A 1 181 ? 44.370  33.628  69.833  1.00 36.28 ? 184  ASP A O   1 
ATOM   1434  C  CB  . ASP A 1 181 ? 44.201  30.313  69.659  1.00 36.14 ? 184  ASP A CB  1 
ATOM   1435  C  CG  . ASP A 1 181 ? 45.571  30.572  69.009  1.00 36.37 ? 184  ASP A CG  1 
ATOM   1436  O  OD1 . ASP A 1 181 ? 46.467  31.141  69.671  1.00 36.51 ? 184  ASP A OD1 1 
ATOM   1437  O  OD2 . ASP A 1 181 ? 45.763  30.199  67.830  1.00 36.51 ? 184  ASP A OD2 1 
ATOM   1438  N  N   . PHE A 1 182 ? 42.361  32.824  69.215  1.00 36.32 ? 185  PHE A N   1 
ATOM   1439  C  CA  . PHE A 1 182 ? 42.010  34.011  68.450  1.00 36.39 ? 185  PHE A CA  1 
ATOM   1440  C  C   . PHE A 1 182 ? 41.847  35.226  69.359  1.00 36.50 ? 185  PHE A C   1 
ATOM   1441  O  O   . PHE A 1 182 ? 42.438  36.274  69.111  1.00 36.47 ? 185  PHE A O   1 
ATOM   1442  C  CB  . PHE A 1 182 ? 40.724  33.788  67.645  1.00 36.31 ? 185  PHE A CB  1 
ATOM   1443  C  CG  . PHE A 1 182 ? 40.351  34.956  66.777  1.00 36.27 ? 185  PHE A CG  1 
ATOM   1444  C  CD1 . PHE A 1 182 ? 39.429  35.904  67.217  1.00 36.13 ? 185  PHE A CD1 1 
ATOM   1445  C  CD2 . PHE A 1 182 ? 40.963  35.142  65.543  1.00 36.17 ? 185  PHE A CD2 1 
ATOM   1446  C  CE1 . PHE A 1 182 ? 39.127  37.019  66.442  1.00 35.96 ? 185  PHE A CE1 1 
ATOM   1447  C  CE2 . PHE A 1 182 ? 40.666  36.256  64.763  1.00 36.11 ? 185  PHE A CE2 1 
ATOM   1448  C  CZ  . PHE A 1 182 ? 39.745  37.197  65.217  1.00 36.08 ? 185  PHE A CZ  1 
ATOM   1449  N  N   . TRP A 1 183 ? 41.051  35.087  70.412  1.00 36.47 ? 186  TRP A N   1 
ATOM   1450  C  CA  . TRP A 1 183 ? 40.831  36.193  71.333  1.00 36.62 ? 186  TRP A CA  1 
ATOM   1451  C  C   . TRP A 1 183 ? 42.097  36.655  72.045  1.00 36.66 ? 186  TRP A C   1 
ATOM   1452  O  O   . TRP A 1 183 ? 42.310  37.855  72.206  1.00 36.69 ? 186  TRP A O   1 
ATOM   1453  C  CB  . TRP A 1 183 ? 39.751  35.838  72.356  1.00 36.63 ? 186  TRP A CB  1 
ATOM   1454  C  CG  . TRP A 1 183 ? 38.360  36.041  71.856  1.00 36.58 ? 186  TRP A CG  1 
ATOM   1455  C  CD1 . TRP A 1 183 ? 37.979  36.805  70.795  1.00 36.53 ? 186  TRP A CD1 1 
ATOM   1456  C  CD2 . TRP A 1 183 ? 37.158  35.502  72.415  1.00 36.46 ? 186  TRP A CD2 1 
ATOM   1457  N  NE1 . TRP A 1 183 ? 36.610  36.782  70.659  1.00 36.52 ? 186  TRP A NE1 1 
ATOM   1458  C  CE2 . TRP A 1 183 ? 36.081  35.988  71.640  1.00 36.55 ? 186  TRP A CE2 1 
ATOM   1459  C  CE3 . TRP A 1 183 ? 36.886  34.658  73.498  1.00 36.40 ? 186  TRP A CE3 1 
ATOM   1460  C  CZ2 . TRP A 1 183 ? 34.750  35.660  71.913  1.00 36.47 ? 186  TRP A CZ2 1 
ATOM   1461  C  CZ3 . TRP A 1 183 ? 35.562  34.333  73.771  1.00 36.50 ? 186  TRP A CZ3 1 
ATOM   1462  C  CH2 . TRP A 1 183 ? 34.509  34.835  72.978  1.00 36.45 ? 186  TRP A CH2 1 
ATOM   1463  N  N   . SER A 1 184 ? 42.939  35.717  72.465  1.00 36.58 ? 187  SER A N   1 
ATOM   1464  C  CA  . SER A 1 184 ? 44.169  36.083  73.150  1.00 36.72 ? 187  SER A CA  1 
ATOM   1465  C  C   . SER A 1 184 ? 45.171  36.740  72.199  1.00 36.89 ? 187  SER A C   1 
ATOM   1466  O  O   . SER A 1 184 ? 45.962  37.587  72.611  1.00 37.04 ? 187  SER A O   1 
ATOM   1467  C  CB  . SER A 1 184 ? 44.788  34.868  73.839  1.00 36.58 ? 187  SER A CB  1 
ATOM   1468  O  OG  . SER A 1 184 ? 45.147  33.875  72.902  1.00 36.93 ? 187  SER A OG  1 
ATOM   1469  N  N   . LEU A 1 185 ? 45.138  36.359  70.927  1.00 36.97 ? 188  LEU A N   1 
ATOM   1470  C  CA  . LEU A 1 185 ? 46.037  36.946  69.938  1.00 37.06 ? 188  LEU A CA  1 
ATOM   1471  C  C   . LEU A 1 185 ? 45.544  38.304  69.457  1.00 37.02 ? 188  LEU A C   1 
ATOM   1472  O  O   . LEU A 1 185 ? 46.330  39.115  68.973  1.00 37.10 ? 188  LEU A O   1 
ATOM   1473  C  CB  . LEU A 1 185 ? 46.187  36.022  68.736  1.00 37.10 ? 188  LEU A CB  1 
ATOM   1474  C  CG  . LEU A 1 185 ? 46.997  34.752  68.965  1.00 37.26 ? 188  LEU A CG  1 
ATOM   1475  C  CD1 . LEU A 1 185 ? 46.942  33.918  67.710  1.00 37.45 ? 188  LEU A CD1 1 
ATOM   1476  C  CD2 . LEU A 1 185 ? 48.438  35.092  69.327  1.00 37.27 ? 188  LEU A CD2 1 
ATOM   1477  N  N   . ARG A 1 186 ? 44.236  38.530  69.554  1.00 37.03 ? 189  ARG A N   1 
ATOM   1478  C  CA  . ARG A 1 186 ? 43.614  39.788  69.133  1.00 36.87 ? 189  ARG A CA  1 
ATOM   1479  C  C   . ARG A 1 186 ? 42.913  40.441  70.327  1.00 36.88 ? 189  ARG A C   1 
ATOM   1480  O  O   . ARG A 1 186 ? 41.685  40.404  70.437  1.00 36.94 ? 189  ARG A O   1 
ATOM   1481  C  CB  . ARG A 1 186 ? 42.590  39.532  68.018  1.00 36.52 ? 189  ARG A CB  1 
ATOM   1482  C  CG  . ARG A 1 186 ? 43.142  38.837  66.778  1.00 36.20 ? 189  ARG A CG  1 
ATOM   1483  C  CD  . ARG A 1 186 ? 44.244  39.643  66.088  1.00 35.92 ? 189  ARG A CD  1 
ATOM   1484  N  NE  . ARG A 1 186 ? 43.811  40.988  65.711  1.00 35.53 ? 189  ARG A NE  1 
ATOM   1485  C  CZ  . ARG A 1 186 ? 44.478  41.789  64.884  1.00 35.27 ? 189  ARG A CZ  1 
ATOM   1486  N  NH1 . ARG A 1 186 ? 45.614  41.385  64.331  1.00 34.92 ? 189  ARG A NH1 1 
ATOM   1487  N  NH2 . ARG A 1 186 ? 44.023  43.009  64.639  1.00 34.97 ? 189  ARG A NH2 1 
ATOM   1488  N  N   . PRO A 1 187 ? 43.685  41.074  71.221  1.00 36.90 ? 190  PRO A N   1 
ATOM   1489  C  CA  . PRO A 1 187 ? 43.143  41.736  72.411  1.00 36.83 ? 190  PRO A CA  1 
ATOM   1490  C  C   . PRO A 1 187 ? 42.157  42.878  72.183  1.00 36.64 ? 190  PRO A C   1 
ATOM   1491  O  O   . PRO A 1 187 ? 41.653  43.444  73.146  1.00 36.64 ? 190  PRO A O   1 
ATOM   1492  C  CB  . PRO A 1 187 ? 44.401  42.203  73.149  1.00 36.97 ? 190  PRO A CB  1 
ATOM   1493  C  CG  . PRO A 1 187 ? 45.380  42.422  72.047  1.00 37.00 ? 190  PRO A CG  1 
ATOM   1494  C  CD  . PRO A 1 187 ? 45.150  41.214  71.174  1.00 37.01 ? 190  PRO A CD  1 
ATOM   1495  N  N   . GLU A 1 188 ? 41.879  43.238  70.935  1.00 36.51 ? 191  GLU A N   1 
ATOM   1496  C  CA  . GLU A 1 188 ? 40.911  44.306  70.706  1.00 36.42 ? 191  GLU A CA  1 
ATOM   1497  C  C   . GLU A 1 188 ? 39.544  43.769  71.105  1.00 36.34 ? 191  GLU A C   1 
ATOM   1498  O  O   . GLU A 1 188 ? 38.621  44.524  71.383  1.00 36.55 ? 191  GLU A O   1 
ATOM   1499  C  CB  . GLU A 1 188 ? 40.900  44.767  69.246  1.00 36.23 ? 191  GLU A CB  1 
ATOM   1500  C  CG  . GLU A 1 188 ? 40.458  43.720  68.235  1.00 36.19 ? 191  GLU A CG  1 
ATOM   1501  C  CD  . GLU A 1 188 ? 41.616  42.962  67.620  1.00 36.10 ? 191  GLU A CD  1 
ATOM   1502  O  OE1 . GLU A 1 188 ? 42.636  42.752  68.305  1.00 36.20 ? 191  GLU A OE1 1 
ATOM   1503  O  OE2 . GLU A 1 188 ? 41.510  42.578  66.440  1.00 35.90 ? 191  GLU A OE2 1 
ATOM   1504  N  N   . SER A 1 189 ? 39.446  42.450  71.179  1.00 36.25 ? 192  SER A N   1 
ATOM   1505  C  CA  . SER A 1 189 ? 38.217  41.775  71.555  1.00 36.20 ? 192  SER A CA  1 
ATOM   1506  C  C   . SER A 1 189 ? 37.884  41.916  73.036  1.00 36.30 ? 192  SER A C   1 
ATOM   1507  O  O   . SER A 1 189 ? 36.773  41.594  73.445  1.00 36.43 ? 192  SER A O   1 
ATOM   1508  C  CB  . SER A 1 189 ? 38.323  40.291  71.204  1.00 36.08 ? 192  SER A CB  1 
ATOM   1509  O  OG  . SER A 1 189 ? 39.416  39.683  71.876  1.00 35.90 ? 192  SER A OG  1 
ATOM   1510  N  N   . LEU A 1 190 ? 38.833  42.407  73.835  1.00 36.30 ? 193  LEU A N   1 
ATOM   1511  C  CA  . LEU A 1 190 ? 38.637  42.557  75.284  1.00 36.24 ? 193  LEU A CA  1 
ATOM   1512  C  C   . LEU A 1 190 ? 37.356  43.226  75.726  1.00 36.19 ? 193  LEU A C   1 
ATOM   1513  O  O   . LEU A 1 190 ? 36.719  42.786  76.680  1.00 36.11 ? 193  LEU A O   1 
ATOM   1514  C  CB  . LEU A 1 190 ? 39.809  43.297  75.924  1.00 36.12 ? 193  LEU A CB  1 
ATOM   1515  C  CG  . LEU A 1 190 ? 41.077  42.476  76.153  1.00 36.12 ? 193  LEU A CG  1 
ATOM   1516  C  CD1 . LEU A 1 190 ? 42.230  43.408  76.433  1.00 36.19 ? 193  LEU A CD1 1 
ATOM   1517  C  CD2 . LEU A 1 190 ? 40.882  41.489  77.283  1.00 35.93 ? 193  LEU A CD2 1 
ATOM   1518  N  N   . HIS A 1 191 ? 36.976  44.292  75.040  1.00 36.19 ? 194  HIS A N   1 
ATOM   1519  C  CA  . HIS A 1 191 ? 35.779  45.021  75.411  1.00 36.15 ? 194  HIS A CA  1 
ATOM   1520  C  C   . HIS A 1 191 ? 34.514  44.186  75.265  1.00 36.35 ? 194  HIS A C   1 
ATOM   1521  O  O   . HIS A 1 191 ? 33.786  43.989  76.238  1.00 36.26 ? 194  HIS A O   1 
ATOM   1522  C  CB  . HIS A 1 191 ? 35.682  46.310  74.603  1.00 36.07 ? 194  HIS A CB  1 
ATOM   1523  C  CG  . HIS A 1 191 ? 34.846  47.364  75.254  1.00 36.18 ? 194  HIS A CG  1 
ATOM   1524  N  ND1 . HIS A 1 191 ? 34.602  48.587  74.670  1.00 36.19 ? 194  HIS A ND1 1 
ATOM   1525  C  CD2 . HIS A 1 191 ? 34.202  47.380  76.444  1.00 36.19 ? 194  HIS A CD2 1 
ATOM   1526  C  CE1 . HIS A 1 191 ? 33.844  49.313  75.472  1.00 36.25 ? 194  HIS A CE1 1 
ATOM   1527  N  NE2 . HIS A 1 191 ? 33.587  48.603  76.556  1.00 36.24 ? 194  HIS A NE2 1 
ATOM   1528  N  N   . GLN A 1 192 ? 34.271  43.664  74.065  1.00 36.34 ? 195  GLN A N   1 
ATOM   1529  C  CA  . GLN A 1 192 ? 33.084  42.857  73.816  1.00 36.43 ? 195  GLN A CA  1 
ATOM   1530  C  C   . GLN A 1 192 ? 33.095  41.512  74.534  1.00 36.53 ? 195  GLN A C   1 
ATOM   1531  O  O   . GLN A 1 192 ? 32.035  40.965  74.850  1.00 36.48 ? 195  GLN A O   1 
ATOM   1532  C  CB  . GLN A 1 192 ? 32.855  42.691  72.315  1.00 36.54 ? 195  GLN A CB  1 
ATOM   1533  C  CG  . GLN A 1 192 ? 31.700  41.778  71.935  1.00 36.76 ? 195  GLN A CG  1 
ATOM   1534  C  CD  . GLN A 1 192 ? 30.366  42.179  72.534  1.00 36.91 ? 195  GLN A CD  1 
ATOM   1535  O  OE1 . GLN A 1 192 ? 30.168  43.312  72.970  1.00 37.06 ? 195  GLN A OE1 1 
ATOM   1536  N  NE2 . GLN A 1 192 ? 29.435  41.243  72.545  1.00 37.16 ? 195  GLN A NE2 1 
ATOM   1537  N  N   . VAL A 1 193 ? 34.284  40.979  74.801  1.00 36.57 ? 196  VAL A N   1 
ATOM   1538  C  CA  . VAL A 1 193 ? 34.397  39.714  75.531  1.00 36.60 ? 196  VAL A CA  1 
ATOM   1539  C  C   . VAL A 1 193 ? 33.925  39.931  76.970  1.00 36.91 ? 196  VAL A C   1 
ATOM   1540  O  O   . VAL A 1 193 ? 33.352  39.030  77.588  1.00 36.79 ? 196  VAL A O   1 
ATOM   1541  C  CB  . VAL A 1 193 ? 35.848  39.171  75.546  1.00 36.62 ? 196  VAL A CB  1 
ATOM   1542  C  CG1 . VAL A 1 193 ? 35.998  38.043  76.568  1.00 36.39 ? 196  VAL A CG1 1 
ATOM   1543  C  CG2 . VAL A 1 193 ? 36.223  38.664  74.175  1.00 36.35 ? 196  VAL A CG2 1 
ATOM   1544  N  N   . SER A 1 194 ? 34.163  41.136  77.488  1.00 37.06 ? 197  SER A N   1 
ATOM   1545  C  CA  . SER A 1 194 ? 33.758  41.493  78.841  1.00 37.19 ? 197  SER A CA  1 
ATOM   1546  C  C   . SER A 1 194 ? 32.254  41.633  78.907  1.00 37.37 ? 197  SER A C   1 
ATOM   1547  O  O   . SER A 1 194 ? 31.652  41.302  79.920  1.00 37.51 ? 197  SER A O   1 
ATOM   1548  C  CB  . SER A 1 194 ? 34.433  42.786  79.289  1.00 37.12 ? 197  SER A CB  1 
ATOM   1549  O  OG  . SER A 1 194 ? 35.829  42.594  79.452  1.00 37.36 ? 197  SER A OG  1 
ATOM   1550  N  N   . PHE A 1 195 ? 31.649  42.144  77.838  1.00 37.62 ? 198  PHE A N   1 
ATOM   1551  C  CA  . PHE A 1 195 ? 30.195  42.278  77.778  1.00 37.90 ? 198  PHE A CA  1 
ATOM   1552  C  C   . PHE A 1 195 ? 29.590  40.883  77.686  1.00 37.81 ? 198  PHE A C   1 
ATOM   1553  O  O   . PHE A 1 195 ? 28.662  40.540  78.420  1.00 37.68 ? 198  PHE A O   1 
ATOM   1554  C  CB  . PHE A 1 195 ? 29.768  43.052  76.527  1.00 38.61 ? 198  PHE A CB  1 
ATOM   1555  C  CG  . PHE A 1 195 ? 29.893  44.543  76.652  1.00 39.41 ? 198  PHE A CG  1 
ATOM   1556  C  CD1 . PHE A 1 195 ? 29.277  45.376  75.724  1.00 39.69 ? 198  PHE A CD1 1 
ATOM   1557  C  CD2 . PHE A 1 195 ? 30.612  45.125  77.696  1.00 39.74 ? 198  PHE A CD2 1 
ATOM   1558  C  CE1 . PHE A 1 195 ? 29.373  46.765  75.831  1.00 39.82 ? 198  PHE A CE1 1 
ATOM   1559  C  CE2 . PHE A 1 195 ? 30.712  46.518  77.810  1.00 39.90 ? 198  PHE A CE2 1 
ATOM   1560  C  CZ  . PHE A 1 195 ? 30.090  47.334  76.875  1.00 39.91 ? 198  PHE A CZ  1 
ATOM   1561  N  N   . LEU A 1 196 ? 30.132  40.086  76.767  1.00 37.57 ? 199  LEU A N   1 
ATOM   1562  C  CA  . LEU A 1 196 ? 29.667  38.730  76.519  1.00 37.30 ? 199  LEU A CA  1 
ATOM   1563  C  C   . LEU A 1 196 ? 29.672  37.833  77.744  1.00 37.25 ? 199  LEU A C   1 
ATOM   1564  O  O   . LEU A 1 196 ? 28.719  37.091  77.978  1.00 37.17 ? 199  LEU A O   1 
ATOM   1565  C  CB  . LEU A 1 196 ? 30.506  38.089  75.416  1.00 37.05 ? 199  LEU A CB  1 
ATOM   1566  C  CG  . LEU A 1 196 ? 30.154  36.643  75.067  1.00 37.06 ? 199  LEU A CG  1 
ATOM   1567  C  CD1 . LEU A 1 196 ? 28.806  36.562  74.385  1.00 36.80 ? 199  LEU A CD1 1 
ATOM   1568  C  CD2 . LEU A 1 196 ? 31.229  36.076  74.172  1.00 37.14 ? 199  LEU A CD2 1 
ATOM   1569  N  N   . PHE A 1 197 ? 30.744  37.886  78.522  1.00 37.11 ? 200  PHE A N   1 
ATOM   1570  C  CA  . PHE A 1 197 ? 30.825  37.045  79.698  1.00 37.22 ? 200  PHE A CA  1 
ATOM   1571  C  C   . PHE A 1 197 ? 30.193  37.613  80.954  1.00 37.62 ? 200  PHE A C   1 
ATOM   1572  O  O   . PHE A 1 197 ? 30.332  37.049  82.036  1.00 37.67 ? 200  PHE A O   1 
ATOM   1573  C  CB  . PHE A 1 197 ? 32.258  36.607  79.947  1.00 37.08 ? 200  PHE A CB  1 
ATOM   1574  C  CG  . PHE A 1 197 ? 32.706  35.505  79.037  1.00 36.77 ? 200  PHE A CG  1 
ATOM   1575  C  CD1 . PHE A 1 197 ? 33.360  35.789  77.847  1.00 36.60 ? 200  PHE A CD1 1 
ATOM   1576  C  CD2 . PHE A 1 197 ? 32.437  34.180  79.350  1.00 36.58 ? 200  PHE A CD2 1 
ATOM   1577  C  CE1 . PHE A 1 197 ? 33.739  34.773  76.982  1.00 36.32 ? 200  PHE A CE1 1 
ATOM   1578  C  CE2 . PHE A 1 197 ? 32.814  33.158  78.488  1.00 36.46 ? 200  PHE A CE2 1 
ATOM   1579  C  CZ  . PHE A 1 197 ? 33.465  33.459  77.302  1.00 36.30 ? 200  PHE A CZ  1 
ATOM   1580  N  N   . SER A 1 198 ? 29.494  38.732  80.815  1.00 38.00 ? 201  SER A N   1 
ATOM   1581  C  CA  . SER A 1 198 ? 28.822  39.331  81.953  1.00 38.35 ? 201  SER A CA  1 
ATOM   1582  C  C   . SER A 1 198 ? 27.412  38.757  82.002  1.00 38.78 ? 201  SER A C   1 
ATOM   1583  O  O   . SER A 1 198 ? 27.042  37.933  81.166  1.00 38.86 ? 201  SER A O   1 
ATOM   1584  C  CB  . SER A 1 198 ? 28.759  40.845  81.808  1.00 38.22 ? 201  SER A CB  1 
ATOM   1585  O  OG  . SER A 1 198 ? 27.789  41.217  80.850  1.00 38.68 ? 201  SER A OG  1 
ATOM   1586  N  N   . ASP A 1 199 ? 26.624  39.207  82.971  1.00 39.13 ? 202  ASP A N   1 
ATOM   1587  C  CA  . ASP A 1 199 ? 25.258  38.738  83.131  1.00 39.64 ? 202  ASP A CA  1 
ATOM   1588  C  C   . ASP A 1 199 ? 24.437  38.896  81.865  1.00 39.73 ? 202  ASP A C   1 
ATOM   1589  O  O   . ASP A 1 199 ? 23.529  38.108  81.618  1.00 40.02 ? 202  ASP A O   1 
ATOM   1590  C  CB  . ASP A 1 199 ? 24.554  39.487  84.269  1.00 40.02 ? 202  ASP A CB  1 
ATOM   1591  C  CG  . ASP A 1 199 ? 25.152  39.192  85.636  1.00 40.41 ? 202  ASP A CG  1 
ATOM   1592  O  OD1 . ASP A 1 199 ? 25.695  38.084  85.844  1.00 40.81 ? 202  ASP A OD1 1 
ATOM   1593  O  OD2 . ASP A 1 199 ? 25.066  40.074  86.517  1.00 40.61 ? 202  ASP A OD2 1 
ATOM   1594  N  N   . ARG A 1 200 ? 24.740  39.913  81.064  1.00 39.69 ? 203  ARG A N   1 
ATOM   1595  C  CA  . ARG A 1 200 ? 23.980  40.134  79.839  1.00 39.59 ? 203  ARG A CA  1 
ATOM   1596  C  C   . ARG A 1 200 ? 24.353  39.228  78.680  1.00 39.43 ? 203  ARG A C   1 
ATOM   1597  O  O   . ARG A 1 200 ? 23.844  39.394  77.573  1.00 39.58 ? 203  ARG A O   1 
ATOM   1598  C  CB  . ARG A 1 200 ? 24.027  41.600  79.411  1.00 39.73 ? 203  ARG A CB  1 
ATOM   1599  C  CG  . ARG A 1 200 ? 23.415  42.511  80.440  1.00 39.86 ? 203  ARG A CG  1 
ATOM   1600  C  CD  . ARG A 1 200 ? 23.106  43.875  79.896  1.00 39.99 ? 203  ARG A CD  1 
ATOM   1601  N  NE  . ARG A 1 200 ? 22.613  44.716  80.976  1.00 40.28 ? 203  ARG A NE  1 
ATOM   1602  C  CZ  . ARG A 1 200 ? 22.260  45.984  80.837  1.00 40.42 ? 203  ARG A CZ  1 
ATOM   1603  N  NH1 . ARG A 1 200 ? 21.825  46.667  81.889  1.00 40.44 ? 203  ARG A NH1 1 
ATOM   1604  N  NH2 . ARG A 1 200 ? 22.334  46.562  79.649  1.00 40.53 ? 203  ARG A NH2 1 
ATOM   1605  N  N   . GLY A 1 201 ? 25.225  38.261  78.936  1.00 39.23 ? 204  GLY A N   1 
ATOM   1606  C  CA  . GLY A 1 201 ? 25.614  37.331  77.892  1.00 39.08 ? 204  GLY A CA  1 
ATOM   1607  C  C   . GLY A 1 201 ? 24.470  36.392  77.541  1.00 39.00 ? 204  GLY A C   1 
ATOM   1608  O  O   . GLY A 1 201 ? 24.433  35.825  76.447  1.00 38.88 ? 204  GLY A O   1 
ATOM   1609  N  N   . ILE A 1 202 ? 23.532  36.224  78.471  1.00 38.97 ? 205  ILE A N   1 
ATOM   1610  C  CA  . ILE A 1 202 ? 22.382  35.352  78.252  1.00 39.03 ? 205  ILE A CA  1 
ATOM   1611  C  C   . ILE A 1 202 ? 21.093  36.048  78.689  1.00 39.06 ? 205  ILE A C   1 
ATOM   1612  O  O   . ILE A 1 202 ? 20.642  35.898  79.821  1.00 39.14 ? 205  ILE A O   1 
ATOM   1613  C  CB  . ILE A 1 202 ? 22.504  34.044  79.048  1.00 39.05 ? 205  ILE A CB  1 
ATOM   1614  C  CG1 . ILE A 1 202 ? 23.917  33.474  78.938  1.00 39.01 ? 205  ILE A CG1 1 
ATOM   1615  C  CG2 . ILE A 1 202 ? 21.505  33.033  78.519  1.00 39.25 ? 205  ILE A CG2 1 
ATOM   1616  C  CD1 . ILE A 1 202 ? 24.130  32.216  79.749  1.00 38.72 ? 205  ILE A CD1 1 
ATOM   1617  N  N   . PRO A 1 203 ? 20.470  36.809  77.786  1.00 39.09 ? 206  PRO A N   1 
ATOM   1618  C  CA  . PRO A 1 203 ? 19.229  37.531  78.080  1.00 39.11 ? 206  PRO A CA  1 
ATOM   1619  C  C   . PRO A 1 203 ? 18.063  36.583  78.322  1.00 39.22 ? 206  PRO A C   1 
ATOM   1620  O  O   . PRO A 1 203 ? 18.066  35.454  77.829  1.00 39.28 ? 206  PRO A O   1 
ATOM   1621  C  CB  . PRO A 1 203 ? 18.982  38.320  76.793  1.00 39.08 ? 206  PRO A CB  1 
ATOM   1622  C  CG  . PRO A 1 203 ? 20.327  38.411  76.154  1.00 39.17 ? 206  PRO A CG  1 
ATOM   1623  C  CD  . PRO A 1 203 ? 20.898  37.058  76.402  1.00 39.16 ? 206  PRO A CD  1 
ATOM   1624  N  N   . ASP A 1 204 ? 17.067  37.045  79.072  1.00 39.25 ? 207  ASP A N   1 
ATOM   1625  C  CA  . ASP A 1 204 ? 15.878  36.241  79.323  1.00 39.16 ? 207  ASP A CA  1 
ATOM   1626  C  C   . ASP A 1 204 ? 14.921  36.498  78.162  1.00 39.08 ? 207  ASP A C   1 
ATOM   1627  O  O   . ASP A 1 204 ? 13.968  37.273  78.278  1.00 39.23 ? 207  ASP A O   1 
ATOM   1628  C  CB  . ASP A 1 204 ? 15.217  36.642  80.639  1.00 39.20 ? 207  ASP A CB  1 
ATOM   1629  C  CG  . ASP A 1 204 ? 14.119  35.680  81.058  1.00 39.26 ? 207  ASP A CG  1 
ATOM   1630  O  OD1 . ASP A 1 204 ? 13.768  35.669  82.252  1.00 39.64 ? 207  ASP A OD1 1 
ATOM   1631  O  OD2 . ASP A 1 204 ? 13.609  34.923  80.204  1.00 39.26 ? 207  ASP A OD2 1 
ATOM   1632  N  N   . GLY A 1 205 ? 15.160  35.820  77.048  1.00 38.94 ? 208  GLY A N   1 
ATOM   1633  C  CA  . GLY A 1 205 ? 14.319  36.024  75.889  1.00 38.65 ? 208  GLY A CA  1 
ATOM   1634  C  C   . GLY A 1 205 ? 14.800  37.247  75.129  1.00 38.49 ? 208  GLY A C   1 
ATOM   1635  O  O   . GLY A 1 205 ? 15.783  37.885  75.518  1.00 38.43 ? 208  GLY A O   1 
ATOM   1636  N  N   . HIS A 1 206 ? 14.079  37.602  74.070  1.00 38.37 ? 209  HIS A N   1 
ATOM   1637  C  CA  . HIS A 1 206 ? 14.438  38.740  73.225  1.00 38.12 ? 209  HIS A CA  1 
ATOM   1638  C  C   . HIS A 1 206 ? 13.852  40.067  73.670  1.00 37.99 ? 209  HIS A C   1 
ATOM   1639  O  O   . HIS A 1 206 ? 14.350  41.128  73.291  1.00 37.85 ? 209  HIS A O   1 
ATOM   1640  C  CB  . HIS A 1 206 ? 13.986  38.470  71.794  1.00 37.71 ? 209  HIS A CB  1 
ATOM   1641  C  CG  . HIS A 1 206 ? 14.460  37.161  71.253  1.00 37.63 ? 209  HIS A CG  1 
ATOM   1642  N  ND1 . HIS A 1 206 ? 15.793  36.816  71.202  1.00 37.56 ? 209  HIS A ND1 1 
ATOM   1643  C  CD2 . HIS A 1 206 ? 13.780  36.117  70.727  1.00 37.54 ? 209  HIS A CD2 1 
ATOM   1644  C  CE1 . HIS A 1 206 ? 15.912  35.616  70.665  1.00 37.64 ? 209  HIS A CE1 1 
ATOM   1645  N  NE2 . HIS A 1 206 ? 14.706  35.170  70.367  1.00 37.57 ? 209  HIS A NE2 1 
ATOM   1646  N  N   . ARG A 1 207 ? 12.785  40.002  74.459  1.00 37.90 ? 210  ARG A N   1 
ATOM   1647  C  CA  . ARG A 1 207 ? 12.098  41.194  74.926  1.00 37.80 ? 210  ARG A CA  1 
ATOM   1648  C  C   . ARG A 1 207 ? 12.798  41.894  76.076  1.00 37.80 ? 210  ARG A C   1 
ATOM   1649  O  O   . ARG A 1 207 ? 12.498  43.053  76.367  1.00 37.62 ? 210  ARG A O   1 
ATOM   1650  C  CB  . ARG A 1 207 ? 10.674  40.834  75.336  1.00 37.82 ? 210  ARG A CB  1 
ATOM   1651  C  CG  . ARG A 1 207 ? 9.878   40.140  74.248  1.00 37.97 ? 210  ARG A CG  1 
ATOM   1652  C  CD  . ARG A 1 207 ? 8.509   39.702  74.748  1.00 38.06 ? 210  ARG A CD  1 
ATOM   1653  N  NE  . ARG A 1 207 ? 8.604   38.741  75.846  1.00 38.36 ? 210  ARG A NE  1 
ATOM   1654  C  CZ  . ARG A 1 207 ? 8.018   38.892  77.030  1.00 38.39 ? 210  ARG A CZ  1 
ATOM   1655  N  NH1 . ARG A 1 207 ? 7.284   39.968  77.282  1.00 38.48 ? 210  ARG A NH1 1 
ATOM   1656  N  NH2 . ARG A 1 207 ? 8.183   37.979  77.973  1.00 38.36 ? 210  ARG A NH2 1 
ATOM   1657  N  N   . HIS A 1 208 ? 13.744  41.205  76.708  1.00 37.71 ? 211  HIS A N   1 
ATOM   1658  C  CA  . HIS A 1 208 ? 14.460  41.768  77.844  1.00 37.86 ? 211  HIS A CA  1 
ATOM   1659  C  C   . HIS A 1 208 ? 15.922  42.106  77.592  1.00 37.73 ? 211  HIS A C   1 
ATOM   1660  O  O   . HIS A 1 208 ? 16.777  41.949  78.467  1.00 37.82 ? 211  HIS A O   1 
ATOM   1661  C  CB  . HIS A 1 208 ? 14.313  40.852  79.051  1.00 38.07 ? 211  HIS A CB  1 
ATOM   1662  C  CG  . HIS A 1 208 ? 12.905  40.743  79.541  1.00 38.68 ? 211  HIS A CG  1 
ATOM   1663  N  ND1 . HIS A 1 208 ? 12.209  39.552  79.553  1.00 38.96 ? 211  HIS A ND1 1 
ATOM   1664  C  CD2 . HIS A 1 208 ? 12.052  41.681  80.016  1.00 38.82 ? 211  HIS A CD2 1 
ATOM   1665  C  CE1 . HIS A 1 208 ? 10.988  39.763  80.012  1.00 39.06 ? 211  HIS A CE1 1 
ATOM   1666  N  NE2 . HIS A 1 208 ? 10.866  41.047  80.300  1.00 39.10 ? 211  HIS A NE2 1 
ATOM   1667  N  N   . MET A 1 209 ? 16.190  42.626  76.402  1.00 37.50 ? 212  MET A N   1 
ATOM   1668  C  CA  . MET A 1 209 ? 17.532  43.018  76.008  1.00 37.30 ? 212  MET A CA  1 
ATOM   1669  C  C   . MET A 1 209 ? 17.449  44.288  75.172  1.00 37.55 ? 212  MET A C   1 
ATOM   1670  O  O   . MET A 1 209 ? 16.397  44.608  74.607  1.00 37.52 ? 212  MET A O   1 
ATOM   1671  C  CB  . MET A 1 209 ? 18.191  41.913  75.186  1.00 36.92 ? 212  MET A CB  1 
ATOM   1672  C  CG  . MET A 1 209 ? 17.501  41.631  73.866  1.00 36.38 ? 212  MET A CG  1 
ATOM   1673  S  SD  . MET A 1 209 ? 18.266  40.261  73.004  1.00 36.19 ? 212  MET A SD  1 
ATOM   1674  C  CE  . MET A 1 209 ? 17.460  40.362  71.450  1.00 35.92 ? 212  MET A CE  1 
ATOM   1675  N  N   . ASN A 1 210 ? 18.552  45.026  75.115  1.00 37.45 ? 213  ASN A N   1 
ATOM   1676  C  CA  . ASN A 1 210 ? 18.600  46.250  74.330  1.00 37.31 ? 213  ASN A CA  1 
ATOM   1677  C  C   . ASN A 1 210 ? 19.082  45.950  72.921  1.00 37.20 ? 213  ASN A C   1 
ATOM   1678  O  O   . ASN A 1 210 ? 19.552  44.848  72.628  1.00 37.20 ? 213  ASN A O   1 
ATOM   1679  C  CB  . ASN A 1 210 ? 19.558  47.257  74.966  1.00 37.38 ? 213  ASN A CB  1 
ATOM   1680  C  CG  . ASN A 1 210 ? 19.067  47.772  76.296  1.00 37.46 ? 213  ASN A CG  1 
ATOM   1681  O  OD1 . ASN A 1 210 ? 17.859  47.875  76.531  1.00 37.41 ? 213  ASN A OD1 1 
ATOM   1682  N  ND2 . ASN A 1 210 ? 20.004  48.117  77.177  1.00 37.67 ? 213  ASN A ND2 1 
ATOM   1683  N  N   . GLY A 1 211 ? 18.968  46.950  72.055  1.00 37.17 ? 214  GLY A N   1 
ATOM   1684  C  CA  . GLY A 1 211 ? 19.422  46.815  70.686  1.00 36.90 ? 214  GLY A CA  1 
ATOM   1685  C  C   . GLY A 1 211 ? 20.249  48.041  70.375  1.00 36.88 ? 214  GLY A C   1 
ATOM   1686  O  O   . GLY A 1 211 ? 20.000  49.115  70.922  1.00 36.75 ? 214  GLY A O   1 
ATOM   1687  N  N   . TYR A 1 212 ? 21.264  47.881  69.536  1.00 36.98 ? 215  TYR A N   1 
ATOM   1688  C  CA  . TYR A 1 212 ? 22.127  48.995  69.164  1.00 36.94 ? 215  TYR A CA  1 
ATOM   1689  C  C   . TYR A 1 212 ? 22.518  48.826  67.714  1.00 36.90 ? 215  TYR A C   1 
ATOM   1690  O  O   . TYR A 1 212 ? 22.598  47.704  67.220  1.00 37.00 ? 215  TYR A O   1 
ATOM   1691  C  CB  . TYR A 1 212 ? 23.418  48.993  69.988  1.00 37.10 ? 215  TYR A CB  1 
ATOM   1692  C  CG  . TYR A 1 212 ? 23.250  48.903  71.490  1.00 37.39 ? 215  TYR A CG  1 
ATOM   1693  C  CD1 . TYR A 1 212 ? 23.387  50.028  72.295  1.00 37.43 ? 215  TYR A CD1 1 
ATOM   1694  C  CD2 . TYR A 1 212 ? 23.014  47.682  72.112  1.00 37.37 ? 215  TYR A CD2 1 
ATOM   1695  C  CE1 . TYR A 1 212 ? 23.299  49.937  73.682  1.00 37.57 ? 215  TYR A CE1 1 
ATOM   1696  C  CE2 . TYR A 1 212 ? 22.926  47.584  73.494  1.00 37.58 ? 215  TYR A CE2 1 
ATOM   1697  C  CZ  . TYR A 1 212 ? 23.071  48.712  74.271  1.00 37.63 ? 215  TYR A CZ  1 
ATOM   1698  O  OH  . TYR A 1 212 ? 23.008  48.609  75.641  1.00 37.89 ? 215  TYR A OH  1 
ATOM   1699  N  N   . GLY A 1 213 ? 22.728  49.940  67.023  1.00 36.88 ? 216  GLY A N   1 
ATOM   1700  C  CA  . GLY A 1 213 ? 23.168  49.873  65.646  1.00 36.76 ? 216  GLY A CA  1 
ATOM   1701  C  C   . GLY A 1 213 ? 24.663  49.591  65.684  1.00 36.81 ? 216  GLY A C   1 
ATOM   1702  O  O   . GLY A 1 213 ? 25.246  49.139  64.696  1.00 37.02 ? 216  GLY A O   1 
ATOM   1703  N  N   . SER A 1 214 ? 25.275  49.852  66.842  1.00 36.67 ? 217  SER A N   1 
ATOM   1704  C  CA  . SER A 1 214 ? 26.704  49.639  67.080  1.00 36.45 ? 217  SER A CA  1 
ATOM   1705  C  C   . SER A 1 214 ? 27.632  50.609  66.361  1.00 36.30 ? 217  SER A C   1 
ATOM   1706  O  O   . SER A 1 214 ? 28.368  51.360  67.004  1.00 36.51 ? 217  SER A O   1 
ATOM   1707  C  CB  . SER A 1 214 ? 27.107  48.201  66.743  1.00 36.49 ? 217  SER A CB  1 
ATOM   1708  O  OG  . SER A 1 214 ? 26.572  47.272  67.674  1.00 36.89 ? 217  SER A OG  1 
ATOM   1709  N  N   . HIS A 1 215 ? 27.617  50.582  65.033  1.00 36.00 ? 218  HIS A N   1 
ATOM   1710  C  CA  . HIS A 1 215 ? 28.473  51.459  64.246  1.00 35.68 ? 218  HIS A CA  1 
ATOM   1711  C  C   . HIS A 1 215 ? 28.091  52.913  64.373  1.00 35.63 ? 218  HIS A C   1 
ATOM   1712  O  O   . HIS A 1 215 ? 26.981  53.262  64.774  1.00 35.53 ? 218  HIS A O   1 
ATOM   1713  C  CB  . HIS A 1 215 ? 28.372  51.144  62.752  1.00 35.53 ? 218  HIS A CB  1 
ATOM   1714  C  CG  . HIS A 1 215 ? 28.657  49.725  62.394  1.00 35.66 ? 218  HIS A CG  1 
ATOM   1715  N  ND1 . HIS A 1 215 ? 29.921  49.181  62.442  1.00 35.72 ? 218  HIS A ND1 1 
ATOM   1716  C  CD2 . HIS A 1 215 ? 27.843  48.748  61.929  1.00 35.69 ? 218  HIS A CD2 1 
ATOM   1717  C  CE1 . HIS A 1 215 ? 29.874  47.930  62.022  1.00 35.87 ? 218  HIS A CE1 1 
ATOM   1718  N  NE2 . HIS A 1 215 ? 28.624  47.642  61.704  1.00 35.80 ? 218  HIS A NE2 1 
ATOM   1719  N  N   . THR A 1 216 ? 29.030  53.760  63.990  1.00 35.38 ? 219  THR A N   1 
ATOM   1720  C  CA  . THR A 1 216 ? 28.810  55.182  63.946  1.00 35.19 ? 219  THR A CA  1 
ATOM   1721  C  C   . THR A 1 216 ? 28.245  55.348  62.537  1.00 35.35 ? 219  THR A C   1 
ATOM   1722  O  O   . THR A 1 216 ? 28.783  54.774  61.589  1.00 35.09 ? 219  THR A O   1 
ATOM   1723  C  CB  . THR A 1 216 ? 30.139  55.928  64.007  1.00 35.16 ? 219  THR A CB  1 
ATOM   1724  O  OG1 . THR A 1 216 ? 30.739  55.729  65.289  1.00 35.14 ? 219  THR A OG1 1 
ATOM   1725  C  CG2 . THR A 1 216 ? 29.943  57.404  63.744  1.00 35.00 ? 219  THR A CG2 1 
ATOM   1726  N  N   . PHE A 1 217 ? 27.124  56.044  62.403  1.00 35.27 ? 220  PHE A N   1 
ATOM   1727  C  CA  . PHE A 1 217 ? 26.542  56.280  61.088  1.00 35.38 ? 220  PHE A CA  1 
ATOM   1728  C  C   . PHE A 1 217 ? 26.581  57.772  60.809  1.00 35.67 ? 220  PHE A C   1 
ATOM   1729  O  O   . PHE A 1 217 ? 27.075  58.549  61.626  1.00 35.65 ? 220  PHE A O   1 
ATOM   1730  C  CB  . PHE A 1 217 ? 25.097  55.796  61.026  1.00 34.93 ? 220  PHE A CB  1 
ATOM   1731  C  CG  . PHE A 1 217 ? 24.954  54.308  61.000  1.00 34.57 ? 220  PHE A CG  1 
ATOM   1732  C  CD1 . PHE A 1 217 ? 24.922  53.624  59.791  1.00 34.25 ? 220  PHE A CD1 1 
ATOM   1733  C  CD2 . PHE A 1 217 ? 24.820  53.591  62.182  1.00 34.48 ? 220  PHE A CD2 1 
ATOM   1734  C  CE1 . PHE A 1 217 ? 24.756  52.248  59.758  1.00 34.07 ? 220  PHE A CE1 1 
ATOM   1735  C  CE2 . PHE A 1 217 ? 24.653  52.205  62.159  1.00 34.19 ? 220  PHE A CE2 1 
ATOM   1736  C  CZ  . PHE A 1 217 ? 24.619  51.536  60.942  1.00 34.08 ? 220  PHE A CZ  1 
ATOM   1737  N  N   . LYS A 1 218 ? 26.046  58.173  59.662  1.00 36.00 ? 221  LYS A N   1 
ATOM   1738  C  CA  . LYS A 1 218 ? 26.014  59.578  59.286  1.00 36.40 ? 221  LYS A CA  1 
ATOM   1739  C  C   . LYS A 1 218 ? 24.600  60.034  58.953  1.00 36.65 ? 221  LYS A C   1 
ATOM   1740  O  O   . LYS A 1 218 ? 23.884  59.372  58.205  1.00 36.79 ? 221  LYS A O   1 
ATOM   1741  C  CB  . LYS A 1 218 ? 26.939  59.827  58.091  1.00 36.51 ? 221  LYS A CB  1 
ATOM   1742  C  CG  . LYS A 1 218 ? 27.119  61.293  57.744  1.00 36.70 ? 221  LYS A CG  1 
ATOM   1743  C  CD  . LYS A 1 218 ? 28.203  61.515  56.703  1.00 37.05 ? 221  LYS A CD  1 
ATOM   1744  C  CE  . LYS A 1 218 ? 27.785  61.001  55.345  1.00 37.38 ? 221  LYS A CE  1 
ATOM   1745  N  NZ  . LYS A 1 218 ? 28.714  61.456  54.271  1.00 37.62 ? 221  LYS A NZ  1 
ATOM   1746  N  N   . LEU A 1 219 ? 24.195  61.153  59.543  1.00 36.89 ? 222  LEU A N   1 
ATOM   1747  C  CA  . LEU A 1 219 ? 22.875  61.728  59.307  1.00 36.94 ? 222  LEU A CA  1 
ATOM   1748  C  C   . LEU A 1 219 ? 23.050  63.029  58.542  1.00 37.19 ? 222  LEU A C   1 
ATOM   1749  O  O   . LEU A 1 219 ? 23.898  63.848  58.888  1.00 37.24 ? 222  LEU A O   1 
ATOM   1750  C  CB  . LEU A 1 219 ? 22.161  62.000  60.630  1.00 36.72 ? 222  LEU A CB  1 
ATOM   1751  C  CG  . LEU A 1 219 ? 21.875  60.781  61.504  1.00 36.55 ? 222  LEU A CG  1 
ATOM   1752  C  CD1 . LEU A 1 219 ? 21.191  61.223  62.787  1.00 36.50 ? 222  LEU A CD1 1 
ATOM   1753  C  CD2 . LEU A 1 219 ? 21.014  59.783  60.748  1.00 36.47 ? 222  LEU A CD2 1 
ATOM   1754  N  N   . VAL A 1 220 ? 22.252  63.211  57.497  1.00 37.34 ? 223  VAL A N   1 
ATOM   1755  C  CA  . VAL A 1 220 ? 22.325  64.405  56.666  1.00 37.49 ? 223  VAL A CA  1 
ATOM   1756  C  C   . VAL A 1 220 ? 20.975  65.096  56.698  1.00 37.86 ? 223  VAL A C   1 
ATOM   1757  O  O   . VAL A 1 220 ? 19.951  64.448  56.527  1.00 37.76 ? 223  VAL A O   1 
ATOM   1758  C  CB  . VAL A 1 220 ? 22.660  64.025  55.218  1.00 37.38 ? 223  VAL A CB  1 
ATOM   1759  C  CG1 . VAL A 1 220 ? 22.835  65.263  54.368  1.00 37.28 ? 223  VAL A CG1 1 
ATOM   1760  C  CG2 . VAL A 1 220 ? 23.905  63.161  55.181  1.00 37.24 ? 223  VAL A CG2 1 
ATOM   1761  N  N   . ASN A 1 221 ? 20.962  66.407  56.922  1.00 38.32 ? 224  ASN A N   1 
ATOM   1762  C  CA  . ASN A 1 221 ? 19.694  67.124  56.977  1.00 38.85 ? 224  ASN A CA  1 
ATOM   1763  C  C   . ASN A 1 221 ? 19.338  67.827  55.679  1.00 39.39 ? 224  ASN A C   1 
ATOM   1764  O  O   . ASN A 1 221 ? 20.120  67.827  54.734  1.00 39.41 ? 224  ASN A O   1 
ATOM   1765  C  CB  . ASN A 1 221 ? 19.657  68.103  58.159  1.00 38.49 ? 224  ASN A CB  1 
ATOM   1766  C  CG  . ASN A 1 221 ? 20.542  69.313  57.955  1.00 38.46 ? 224  ASN A CG  1 
ATOM   1767  O  OD1 . ASN A 1 221 ? 20.996  69.599  56.845  1.00 38.46 ? 224  ASN A OD1 1 
ATOM   1768  N  ND2 . ASN A 1 221 ? 20.771  70.050  59.030  1.00 38.38 ? 224  ASN A ND2 1 
ATOM   1769  N  N   . ALA A 1 222 ? 18.174  68.470  55.669  1.00 40.09 ? 225  ALA A N   1 
ATOM   1770  C  CA  . ALA A 1 222 ? 17.667  69.181  54.504  1.00 40.70 ? 225  ALA A CA  1 
ATOM   1771  C  C   . ALA A 1 222 ? 18.646  70.142  53.835  1.00 41.24 ? 225  ALA A C   1 
ATOM   1772  O  O   . ALA A 1 222 ? 18.672  70.202  52.607  1.00 41.42 ? 225  ALA A O   1 
ATOM   1773  C  CB  . ALA A 1 222 ? 16.379  69.887  54.844  1.00 40.58 ? 225  ALA A CB  1 
ATOM   1774  N  N   . ASN A 1 223 ? 19.422  70.915  54.601  1.00 41.84 ? 226  ASN A N   1 
ATOM   1775  C  CA  . ASN A 1 223 ? 20.389  71.818  53.955  1.00 42.55 ? 226  ASN A CA  1 
ATOM   1776  C  C   . ASN A 1 223 ? 21.762  71.185  53.751  1.00 42.57 ? 226  ASN A C   1 
ATOM   1777  O  O   . ASN A 1 223 ? 22.781  71.873  53.816  1.00 42.73 ? 226  ASN A O   1 
ATOM   1778  C  CB  . ASN A 1 223 ? 20.567  73.179  54.658  1.00 43.13 ? 226  ASN A CB  1 
ATOM   1779  C  CG  . ASN A 1 223 ? 19.660  73.365  55.839  1.00 43.92 ? 226  ASN A CG  1 
ATOM   1780  O  OD1 . ASN A 1 223 ? 18.491  73.721  55.688  1.00 44.45 ? 226  ASN A OD1 1 
ATOM   1781  N  ND2 . ASN A 1 223 ? 20.206  73.177  57.038  1.00 44.44 ? 226  ASN A ND2 1 
ATOM   1782  N  N   . GLY A 1 224 ? 21.784  69.873  53.532  1.00 42.47 ? 227  GLY A N   1 
ATOM   1783  C  CA  . GLY A 1 224 ? 23.032  69.167  53.293  1.00 42.34 ? 227  GLY A CA  1 
ATOM   1784  C  C   . GLY A 1 224 ? 24.073  69.159  54.397  1.00 42.29 ? 227  GLY A C   1 
ATOM   1785  O  O   . GLY A 1 224 ? 25.248  68.896  54.136  1.00 42.23 ? 227  GLY A O   1 
ATOM   1786  N  N   . GLU A 1 225 ? 23.665  69.471  55.620  1.00 42.24 ? 228  GLU A N   1 
ATOM   1787  C  CA  . GLU A 1 225 ? 24.593  69.471  56.737  1.00 42.22 ? 228  GLU A CA  1 
ATOM   1788  C  C   . GLU A 1 225 ? 24.619  68.077  57.342  1.00 41.78 ? 228  GLU A C   1 
ATOM   1789  O  O   . GLU A 1 225 ? 23.588  67.406  57.407  1.00 41.67 ? 228  GLU A O   1 
ATOM   1790  C  CB  . GLU A 1 225 ? 24.177  70.517  57.762  1.00 43.11 ? 228  GLU A CB  1 
ATOM   1791  C  CG  . GLU A 1 225 ? 24.194  71.924  57.180  1.00 44.42 ? 228  GLU A CG  1 
ATOM   1792  C  CD  . GLU A 1 225 ? 23.462  72.949  58.035  1.00 45.34 ? 228  GLU A CD  1 
ATOM   1793  O  OE1 . GLU A 1 225 ? 22.736  72.557  58.989  1.00 45.60 ? 228  GLU A OE1 1 
ATOM   1794  O  OE2 . GLU A 1 225 ? 23.601  74.159  57.728  1.00 45.81 ? 228  GLU A OE2 1 
ATOM   1795  N  N   . ALA A 1 226 ? 25.793  67.644  57.790  1.00 41.08 ? 229  ALA A N   1 
ATOM   1796  C  CA  . ALA A 1 226 ? 25.928  66.307  58.343  1.00 40.51 ? 229  ALA A CA  1 
ATOM   1797  C  C   . ALA A 1 226 ? 26.525  66.218  59.731  1.00 40.19 ? 229  ALA A C   1 
ATOM   1798  O  O   . ALA A 1 226 ? 27.263  67.097  60.163  1.00 40.22 ? 229  ALA A O   1 
ATOM   1799  C  CB  . ALA A 1 226 ? 26.737  65.451  57.393  1.00 40.32 ? 229  ALA A CB  1 
ATOM   1800  N  N   . VAL A 1 227 ? 26.178  65.144  60.429  1.00 39.72 ? 230  VAL A N   1 
ATOM   1801  C  CA  . VAL A 1 227 ? 26.699  64.852  61.764  1.00 39.25 ? 230  VAL A CA  1 
ATOM   1802  C  C   . VAL A 1 227 ? 26.806  63.331  61.848  1.00 39.13 ? 230  VAL A C   1 
ATOM   1803  O  O   . VAL A 1 227 ? 26.242  62.619  61.014  1.00 39.08 ? 230  VAL A O   1 
ATOM   1804  C  CB  . VAL A 1 227 ? 25.771  65.353  62.905  1.00 39.19 ? 230  VAL A CB  1 
ATOM   1805  C  CG1 . VAL A 1 227 ? 25.694  66.873  62.906  1.00 38.90 ? 230  VAL A CG1 1 
ATOM   1806  C  CG2 . VAL A 1 227 ? 24.383  64.728  62.789  1.00 39.02 ? 230  VAL A CG2 1 
ATOM   1807  N  N   . TYR A 1 228 ? 27.571  62.831  62.808  1.00 38.63 ? 231  TYR A N   1 
ATOM   1808  C  CA  . TYR A 1 228 ? 27.703  61.388  62.976  1.00 38.22 ? 231  TYR A CA  1 
ATOM   1809  C  C   . TYR A 1 228 ? 26.746  60.962  64.081  1.00 37.98 ? 231  TYR A C   1 
ATOM   1810  O  O   . TYR A 1 228 ? 26.379  61.779  64.929  1.00 38.05 ? 231  TYR A O   1 
ATOM   1811  C  CB  . TYR A 1 228 ? 29.143  61.016  63.331  1.00 38.11 ? 231  TYR A CB  1 
ATOM   1812  C  CG  . TYR A 1 228 ? 30.115  61.219  62.197  1.00 37.96 ? 231  TYR A CG  1 
ATOM   1813  C  CD1 . TYR A 1 228 ? 29.964  60.532  60.996  1.00 37.94 ? 231  TYR A CD1 1 
ATOM   1814  C  CD2 . TYR A 1 228 ? 31.181  62.102  62.317  1.00 37.85 ? 231  TYR A CD2 1 
ATOM   1815  C  CE1 . TYR A 1 228 ? 30.852  60.724  59.938  1.00 38.00 ? 231  TYR A CE1 1 
ATOM   1816  C  CE2 . TYR A 1 228 ? 32.073  62.299  61.268  1.00 37.96 ? 231  TYR A CE2 1 
ATOM   1817  C  CZ  . TYR A 1 228 ? 31.902  61.607  60.083  1.00 37.97 ? 231  TYR A CZ  1 
ATOM   1818  O  OH  . TYR A 1 228 ? 32.783  61.795  59.045  1.00 38.17 ? 231  TYR A OH  1 
ATOM   1819  N  N   . CYS A 1 229 ? 26.326  59.701  64.076  1.00 37.59 ? 232  CYS A N   1 
ATOM   1820  C  CA  . CYS A 1 229 ? 25.399  59.237  65.102  1.00 37.22 ? 232  CYS A CA  1 
ATOM   1821  C  C   . CYS A 1 229 ? 25.536  57.769  65.464  1.00 37.00 ? 232  CYS A C   1 
ATOM   1822  O  O   . CYS A 1 229 ? 26.301  57.023  64.848  1.00 36.89 ? 232  CYS A O   1 
ATOM   1823  C  CB  . CYS A 1 229 ? 23.952  59.488  64.669  1.00 37.16 ? 232  CYS A CB  1 
ATOM   1824  S  SG  . CYS A 1 229 ? 23.308  58.277  63.477  1.00 37.24 ? 232  CYS A SG  1 
ATOM   1825  N  N   . LYS A 1 230 ? 24.790  57.388  66.497  1.00 36.66 ? 233  LYS A N   1 
ATOM   1826  C  CA  . LYS A 1 230 ? 24.716  56.019  66.992  1.00 36.40 ? 233  LYS A CA  1 
ATOM   1827  C  C   . LYS A 1 230 ? 23.235  55.806  67.252  1.00 36.39 ? 233  LYS A C   1 
ATOM   1828  O  O   . LYS A 1 230 ? 22.551  56.727  67.691  1.00 36.32 ? 233  LYS A O   1 
ATOM   1829  C  CB  . LYS A 1 230 ? 25.451  55.866  68.325  1.00 36.07 ? 233  LYS A CB  1 
ATOM   1830  C  CG  . LYS A 1 230 ? 26.947  56.017  68.278  1.00 35.74 ? 233  LYS A CG  1 
ATOM   1831  C  CD  . LYS A 1 230 ? 27.639  54.784  67.757  1.00 35.46 ? 233  LYS A CD  1 
ATOM   1832  C  CE  . LYS A 1 230 ? 29.120  54.866  68.061  1.00 35.34 ? 233  LYS A CE  1 
ATOM   1833  N  NZ  . LYS A 1 230 ? 29.865  53.693  67.546  1.00 35.32 ? 233  LYS A NZ  1 
ATOM   1834  N  N   . PHE A 1 231 ? 22.733  54.615  66.960  1.00 36.38 ? 234  PHE A N   1 
ATOM   1835  C  CA  . PHE A 1 231 ? 21.332  54.308  67.199  1.00 36.56 ? 234  PHE A CA  1 
ATOM   1836  C  C   . PHE A 1 231 ? 21.249  53.425  68.410  1.00 36.94 ? 234  PHE A C   1 
ATOM   1837  O  O   . PHE A 1 231 ? 22.055  52.511  68.561  1.00 37.19 ? 234  PHE A O   1 
ATOM   1838  C  CB  . PHE A 1 231 ? 20.723  53.584  66.009  1.00 36.13 ? 234  PHE A CB  1 
ATOM   1839  C  CG  . PHE A 1 231 ? 20.611  54.432  64.801  1.00 35.91 ? 234  PHE A CG  1 
ATOM   1840  C  CD1 . PHE A 1 231 ? 19.712  55.482  64.766  1.00 35.75 ? 234  PHE A CD1 1 
ATOM   1841  C  CD2 . PHE A 1 231 ? 21.433  54.216  63.709  1.00 35.86 ? 234  PHE A CD2 1 
ATOM   1842  C  CE1 . PHE A 1 231 ? 19.639  56.311  63.661  1.00 35.69 ? 234  PHE A CE1 1 
ATOM   1843  C  CE2 . PHE A 1 231 ? 21.365  55.041  62.596  1.00 35.66 ? 234  PHE A CE2 1 
ATOM   1844  C  CZ  . PHE A 1 231 ? 20.467  56.089  62.575  1.00 35.66 ? 234  PHE A CZ  1 
ATOM   1845  N  N   . HIS A 1 232 ? 20.290  53.707  69.284  1.00 37.22 ? 235  HIS A N   1 
ATOM   1846  C  CA  . HIS A 1 232 ? 20.100  52.924  70.503  1.00 37.38 ? 235  HIS A CA  1 
ATOM   1847  C  C   . HIS A 1 232 ? 18.625  52.647  70.696  1.00 37.47 ? 235  HIS A C   1 
ATOM   1848  O  O   . HIS A 1 232 ? 17.806  53.552  70.549  1.00 37.54 ? 235  HIS A O   1 
ATOM   1849  C  CB  . HIS A 1 232 ? 20.564  53.701  71.743  1.00 37.53 ? 235  HIS A CB  1 
ATOM   1850  C  CG  . HIS A 1 232 ? 22.036  53.968  71.801  1.00 37.74 ? 235  HIS A CG  1 
ATOM   1851  N  ND1 . HIS A 1 232 ? 22.831  53.506  72.827  1.00 37.83 ? 235  HIS A ND1 1 
ATOM   1852  C  CD2 . HIS A 1 232 ? 22.845  54.701  71.000  1.00 37.88 ? 235  HIS A CD2 1 
ATOM   1853  C  CE1 . HIS A 1 232 ? 24.066  53.943  72.657  1.00 37.92 ? 235  HIS A CE1 1 
ATOM   1854  N  NE2 . HIS A 1 232 ? 24.101  54.670  71.555  1.00 37.94 ? 235  HIS A NE2 1 
ATOM   1855  N  N   . TYR A 1 233 ? 18.277  51.400  70.991  1.00 37.57 ? 236  TYR A N   1 
ATOM   1856  C  CA  . TYR A 1 233 ? 16.885  51.066  71.266  1.00 37.83 ? 236  TYR A CA  1 
ATOM   1857  C  C   . TYR A 1 233 ? 16.772  50.261  72.555  1.00 38.11 ? 236  TYR A C   1 
ATOM   1858  O  O   . TYR A 1 233 ? 16.990  49.052  72.576  1.00 37.97 ? 236  TYR A O   1 
ATOM   1859  C  CB  . TYR A 1 233 ? 16.156  50.406  70.077  1.00 37.79 ? 236  TYR A CB  1 
ATOM   1860  C  CG  . TYR A 1 233 ? 16.974  49.614  69.067  1.00 38.02 ? 236  TYR A CG  1 
ATOM   1861  C  CD1 . TYR A 1 233 ? 16.693  48.275  68.829  1.00 38.12 ? 236  TYR A CD1 1 
ATOM   1862  C  CD2 . TYR A 1 233 ? 17.965  50.218  68.290  1.00 37.99 ? 236  TYR A CD2 1 
ATOM   1863  C  CE1 . TYR A 1 233 ? 17.363  47.557  67.848  1.00 38.38 ? 236  TYR A CE1 1 
ATOM   1864  C  CE2 . TYR A 1 233 ? 18.645  49.504  67.299  1.00 38.14 ? 236  TYR A CE2 1 
ATOM   1865  C  CZ  . TYR A 1 233 ? 18.334  48.171  67.085  1.00 38.46 ? 236  TYR A CZ  1 
ATOM   1866  O  OH  . TYR A 1 233 ? 18.976  47.432  66.110  1.00 38.85 ? 236  TYR A OH  1 
ATOM   1867  N  N   . LYS A 1 234 ? 16.468  50.972  73.639  1.00 38.34 ? 237  LYS A N   1 
ATOM   1868  C  CA  . LYS A 1 234 ? 16.351  50.393  74.974  1.00 38.61 ? 237  LYS A CA  1 
ATOM   1869  C  C   . LYS A 1 234 ? 15.031  49.689  75.225  1.00 38.68 ? 237  LYS A C   1 
ATOM   1870  O  O   . LYS A 1 234 ? 13.963  50.237  74.943  1.00 38.72 ? 237  LYS A O   1 
ATOM   1871  C  CB  . LYS A 1 234 ? 16.530  51.475  76.033  1.00 39.10 ? 237  LYS A CB  1 
ATOM   1872  C  CG  . LYS A 1 234 ? 17.782  52.315  75.885  1.00 39.71 ? 237  LYS A CG  1 
ATOM   1873  C  CD  . LYS A 1 234 ? 19.023  51.466  75.909  1.00 40.47 ? 237  LYS A CD  1 
ATOM   1874  C  CE  . LYS A 1 234 ? 20.121  52.144  76.706  1.00 41.05 ? 237  LYS A CE  1 
ATOM   1875  N  NZ  . LYS A 1 234 ? 19.718  52.323  78.138  1.00 41.40 ? 237  LYS A NZ  1 
ATOM   1876  N  N   . THR A 1 235 ? 15.116  48.503  75.824  1.00 38.44 ? 238  THR A N   1 
ATOM   1877  C  CA  . THR A 1 235 ? 13.944  47.694  76.125  1.00 38.22 ? 238  THR A CA  1 
ATOM   1878  C  C   . THR A 1 235 ? 12.993  48.318  77.138  1.00 38.48 ? 238  THR A C   1 
ATOM   1879  O  O   . THR A 1 235 ? 13.400  48.721  78.230  1.00 38.35 ? 238  THR A O   1 
ATOM   1880  C  CB  . THR A 1 235 ? 14.342  46.292  76.608  1.00 38.00 ? 238  THR A CB  1 
ATOM   1881  O  OG1 . THR A 1 235 ? 13.168  45.587  77.018  1.00 37.67 ? 238  THR A OG1 1 
ATOM   1882  C  CG2 . THR A 1 235 ? 15.313  46.370  77.768  1.00 37.59 ? 238  THR A CG2 1 
ATOM   1883  N  N   . ASP A 1 236 ? 11.722  48.400  76.763  1.00 38.51 ? 239  ASP A N   1 
ATOM   1884  C  CA  . ASP A 1 236 ? 10.714  48.961  77.648  1.00 38.67 ? 239  ASP A CA  1 
ATOM   1885  C  C   . ASP A 1 236 ? 10.248  47.921  78.659  1.00 38.91 ? 239  ASP A C   1 
ATOM   1886  O  O   . ASP A 1 236 ? 9.564   48.254  79.619  1.00 39.05 ? 239  ASP A O   1 
ATOM   1887  C  CB  . ASP A 1 236 ? 9.529   49.497  76.848  1.00 38.54 ? 239  ASP A CB  1 
ATOM   1888  C  CG  . ASP A 1 236 ? 9.884   50.731  76.039  1.00 38.64 ? 239  ASP A CG  1 
ATOM   1889  O  OD1 . ASP A 1 236 ? 9.115   51.099  75.117  1.00 38.55 ? 239  ASP A OD1 1 
ATOM   1890  O  OD2 . ASP A 1 236 ? 10.936  51.342  76.328  1.00 38.89 ? 239  ASP A OD2 1 
ATOM   1891  N  N   . GLN A 1 237 ? 10.616  46.659  78.437  1.00 39.09 ? 240  GLN A N   1 
ATOM   1892  C  CA  . GLN A 1 237 ? 10.244  45.566  79.338  1.00 39.05 ? 240  GLN A CA  1 
ATOM   1893  C  C   . GLN A 1 237 ? 11.291  45.412  80.437  1.00 39.40 ? 240  GLN A C   1 
ATOM   1894  O  O   . GLN A 1 237 ? 11.092  44.660  81.394  1.00 39.45 ? 240  GLN A O   1 
ATOM   1895  C  CB  . GLN A 1 237 ? 10.114  44.245  78.574  1.00 38.59 ? 240  GLN A CB  1 
ATOM   1896  C  CG  . GLN A 1 237 ? 8.987   44.196  77.555  1.00 38.14 ? 240  GLN A CG  1 
ATOM   1897  C  CD  . GLN A 1 237 ? 9.230   45.091  76.362  1.00 37.98 ? 240  GLN A CD  1 
ATOM   1898  O  OE1 . GLN A 1 237 ? 8.462   46.009  76.093  1.00 37.82 ? 240  GLN A OE1 1 
ATOM   1899  N  NE2 . GLN A 1 237 ? 10.307  44.830  75.640  1.00 37.85 ? 240  GLN A NE2 1 
ATOM   1900  N  N   . GLY A 1 238 ? 12.407  46.126  80.288  1.00 39.67 ? 241  GLY A N   1 
ATOM   1901  C  CA  . GLY A 1 238 ? 13.478  46.066  81.268  1.00 39.86 ? 241  GLY A CA  1 
ATOM   1902  C  C   . GLY A 1 238 ? 14.500  44.980  80.991  1.00 40.00 ? 241  GLY A C   1 
ATOM   1903  O  O   . GLY A 1 238 ? 14.180  43.957  80.388  1.00 40.06 ? 241  GLY A O   1 
ATOM   1904  N  N   . ILE A 1 239 ? 15.742  45.214  81.406  1.00 40.23 ? 242  ILE A N   1 
ATOM   1905  C  CA  . ILE A 1 239 ? 16.809  44.242  81.214  1.00 40.35 ? 242  ILE A CA  1 
ATOM   1906  C  C   . ILE A 1 239 ? 16.560  43.057  82.121  1.00 40.72 ? 242  ILE A C   1 
ATOM   1907  O  O   . ILE A 1 239 ? 16.357  43.220  83.322  1.00 40.72 ? 242  ILE A O   1 
ATOM   1908  C  CB  . ILE A 1 239 ? 18.178  44.842  81.551  1.00 40.20 ? 242  ILE A CB  1 
ATOM   1909  C  CG1 . ILE A 1 239 ? 18.527  45.918  80.531  1.00 40.16 ? 242  ILE A CG1 1 
ATOM   1910  C  CG2 . ILE A 1 239 ? 19.242  43.761  81.571  1.00 39.99 ? 242  ILE A CG2 1 
ATOM   1911  C  CD1 . ILE A 1 239 ? 18.533  45.413  79.114  1.00 40.35 ? 242  ILE A CD1 1 
ATOM   1912  N  N   . LYS A 1 240 ? 16.563  41.862  81.550  1.00 41.10 ? 243  LYS A N   1 
ATOM   1913  C  CA  . LYS A 1 240 ? 16.332  40.666  82.337  1.00 41.53 ? 243  LYS A CA  1 
ATOM   1914  C  C   . LYS A 1 240 ? 17.182  39.551  81.740  1.00 41.50 ? 243  LYS A C   1 
ATOM   1915  O  O   . LYS A 1 240 ? 17.084  39.250  80.551  1.00 41.56 ? 243  LYS A O   1 
ATOM   1916  C  CB  . LYS A 1 240 ? 14.842  40.311  82.322  1.00 42.08 ? 243  LYS A CB  1 
ATOM   1917  C  CG  . LYS A 1 240 ? 14.322  39.641  83.581  1.00 43.13 ? 243  LYS A CG  1 
ATOM   1918  C  CD  . LYS A 1 240 ? 14.955  38.273  83.766  1.00 44.28 ? 243  LYS A CD  1 
ATOM   1919  C  CE  . LYS A 1 240 ? 14.332  37.462  84.909  1.00 45.13 ? 243  LYS A CE  1 
ATOM   1920  N  NZ  . LYS A 1 240 ? 14.856  36.038  84.919  1.00 45.47 ? 243  LYS A NZ  1 
ATOM   1921  N  N   . ASN A 1 241 ? 18.036  38.964  82.572  1.00 41.32 ? 244  ASN A N   1 
ATOM   1922  C  CA  . ASN A 1 241 ? 18.930  37.897  82.144  1.00 41.22 ? 244  ASN A CA  1 
ATOM   1923  C  C   . ASN A 1 241 ? 18.609  36.562  82.789  1.00 41.32 ? 244  ASN A C   1 
ATOM   1924  O  O   . ASN A 1 241 ? 17.842  36.487  83.747  1.00 41.49 ? 244  ASN A O   1 
ATOM   1925  C  CB  . ASN A 1 241 ? 20.370  38.260  82.492  1.00 40.85 ? 244  ASN A CB  1 
ATOM   1926  C  CG  . ASN A 1 241 ? 20.774  39.607  81.958  1.00 40.51 ? 244  ASN A CG  1 
ATOM   1927  O  OD1 . ASN A 1 241 ? 20.528  39.926  80.799  1.00 40.37 ? 244  ASN A OD1 1 
ATOM   1928  N  ND2 . ASN A 1 241 ? 21.403  40.408  82.802  1.00 40.49 ? 244  ASN A ND2 1 
ATOM   1929  N  N   . LEU A 1 242 ? 19.214  35.509  82.254  1.00 41.31 ? 245  LEU A N   1 
ATOM   1930  C  CA  . LEU A 1 242 ? 19.047  34.161  82.778  1.00 41.41 ? 245  LEU A CA  1 
ATOM   1931  C  C   . LEU A 1 242 ? 20.366  33.720  83.404  1.00 41.70 ? 245  LEU A C   1 
ATOM   1932  O  O   . LEU A 1 242 ? 21.434  33.977  82.850  1.00 41.65 ? 245  LEU A O   1 
ATOM   1933  C  CB  . LEU A 1 242 ? 18.686  33.196  81.654  1.00 41.16 ? 245  LEU A CB  1 
ATOM   1934  C  CG  . LEU A 1 242 ? 17.255  33.215  81.139  1.00 40.92 ? 245  LEU A CG  1 
ATOM   1935  C  CD1 . LEU A 1 242 ? 17.163  32.413  79.863  1.00 40.80 ? 245  LEU A CD1 1 
ATOM   1936  C  CD2 . LEU A 1 242 ? 16.336  32.649  82.193  1.00 40.84 ? 245  LEU A CD2 1 
ATOM   1937  N  N   . SER A 1 243 ? 20.300  33.070  84.561  1.00 41.97 ? 246  SER A N   1 
ATOM   1938  C  CA  . SER A 1 243 ? 21.509  32.590  85.225  1.00 42.20 ? 246  SER A CA  1 
ATOM   1939  C  C   . SER A 1 243 ? 22.125  31.470  84.393  1.00 42.41 ? 246  SER A C   1 
ATOM   1940  O  O   . SER A 1 243 ? 21.441  30.850  83.578  1.00 42.32 ? 246  SER A O   1 
ATOM   1941  C  CB  . SER A 1 243 ? 21.173  32.058  86.617  1.00 42.24 ? 246  SER A CB  1 
ATOM   1942  O  OG  . SER A 1 243 ? 20.379  30.885  86.539  1.00 42.59 ? 246  SER A OG  1 
ATOM   1943  N  N   . VAL A 1 244 ? 23.405  31.193  84.610  1.00 42.49 ? 247  VAL A N   1 
ATOM   1944  C  CA  . VAL A 1 244 ? 24.065  30.141  83.863  1.00 42.88 ? 247  VAL A CA  1 
ATOM   1945  C  C   . VAL A 1 244 ? 23.384  28.796  84.076  1.00 43.28 ? 247  VAL A C   1 
ATOM   1946  O  O   . VAL A 1 244 ? 23.186  28.050  83.122  1.00 43.38 ? 247  VAL A O   1 
ATOM   1947  C  CB  . VAL A 1 244 ? 25.556  30.041  84.222  1.00 42.86 ? 247  VAL A CB  1 
ATOM   1948  C  CG1 . VAL A 1 244 ? 26.181  28.816  83.573  1.00 42.75 ? 247  VAL A CG1 1 
ATOM   1949  C  CG2 . VAL A 1 244 ? 26.277  31.289  83.753  1.00 42.80 ? 247  VAL A CG2 1 
ATOM   1950  N  N   . GLU A 1 245 ? 22.978  28.507  85.310  1.00 43.55 ? 248  GLU A N   1 
ATOM   1951  C  CA  . GLU A 1 245 ? 22.324  27.236  85.616  1.00 43.85 ? 248  GLU A CA  1 
ATOM   1952  C  C   . GLU A 1 245 ? 20.985  27.118  84.902  1.00 43.55 ? 248  GLU A C   1 
ATOM   1953  O  O   . GLU A 1 245 ? 20.701  26.097  84.281  1.00 43.40 ? 248  GLU A O   1 
ATOM   1954  C  CB  . GLU A 1 245 ? 22.113  27.068  87.125  1.00 44.64 ? 248  GLU A CB  1 
ATOM   1955  C  CG  . GLU A 1 245 ? 23.345  27.350  87.988  1.00 46.15 ? 248  GLU A CG  1 
ATOM   1956  C  CD  . GLU A 1 245 ? 23.462  28.826  88.413  1.00 46.88 ? 248  GLU A CD  1 
ATOM   1957  O  OE1 . GLU A 1 245 ? 22.827  29.193  89.434  1.00 47.44 ? 248  GLU A OE1 1 
ATOM   1958  O  OE2 . GLU A 1 245 ? 24.188  29.610  87.746  1.00 46.82 ? 248  GLU A OE2 1 
ATOM   1959  N  N   . ASP A 1 246 ? 20.173  28.167  84.980  1.00 43.33 ? 249  ASP A N   1 
ATOM   1960  C  CA  . ASP A 1 246 ? 18.863  28.167  84.339  1.00 43.27 ? 249  ASP A CA  1 
ATOM   1961  C  C   . ASP A 1 246 ? 18.937  28.144  82.825  1.00 43.04 ? 249  ASP A C   1 
ATOM   1962  O  O   . ASP A 1 246 ? 18.081  27.549  82.165  1.00 42.97 ? 249  ASP A O   1 
ATOM   1963  C  CB  . ASP A 1 246 ? 18.039  29.369  84.789  1.00 43.68 ? 249  ASP A CB  1 
ATOM   1964  C  CG  . ASP A 1 246 ? 17.560  29.240  86.213  1.00 43.98 ? 249  ASP A CG  1 
ATOM   1965  O  OD1 . ASP A 1 246 ? 17.396  30.280  86.883  1.00 44.24 ? 249  ASP A OD1 1 
ATOM   1966  O  OD2 . ASP A 1 246 ? 17.346  28.094  86.661  1.00 44.42 ? 249  ASP A OD2 1 
ATOM   1967  N  N   . ALA A 1 247 ? 19.942  28.815  82.275  1.00 42.74 ? 250  ALA A N   1 
ATOM   1968  C  CA  . ALA A 1 247 ? 20.123  28.850  80.832  1.00 42.56 ? 250  ALA A CA  1 
ATOM   1969  C  C   . ALA A 1 247 ? 20.440  27.441  80.352  1.00 42.52 ? 250  ALA A C   1 
ATOM   1970  O  O   . ALA A 1 247 ? 19.939  26.995  79.320  1.00 42.37 ? 250  ALA A O   1 
ATOM   1971  C  CB  . ALA A 1 247 ? 21.247  29.799  80.463  1.00 42.54 ? 250  ALA A CB  1 
ATOM   1972  N  N   . ALA A 1 248 ? 21.259  26.739  81.132  1.00 42.45 ? 251  ALA A N   1 
ATOM   1973  C  CA  . ALA A 1 248 ? 21.653  25.378  80.816  1.00 42.37 ? 251  ALA A CA  1 
ATOM   1974  C  C   . ALA A 1 248 ? 20.437  24.461  80.851  1.00 42.45 ? 251  ALA A C   1 
ATOM   1975  O  O   . ALA A 1 248 ? 20.223  23.672  79.934  1.00 42.42 ? 251  ALA A O   1 
ATOM   1976  C  CB  . ALA A 1 248 ? 22.709  24.903  81.795  1.00 42.41 ? 251  ALA A CB  1 
ATOM   1977  N  N   . ARG A 1 249 ? 19.621  24.589  81.892  1.00 42.45 ? 252  ARG A N   1 
ATOM   1978  C  CA  . ARG A 1 249 ? 18.423  23.769  82.012  1.00 42.66 ? 252  ARG A CA  1 
ATOM   1979  C  C   . ARG A 1 249 ? 17.477  24.017  80.838  1.00 42.57 ? 252  ARG A C   1 
ATOM   1980  O  O   . ARG A 1 249 ? 16.985  23.078  80.219  1.00 42.44 ? 252  ARG A O   1 
ATOM   1981  C  CB  . ARG A 1 249 ? 17.712  24.054  83.336  1.00 43.01 ? 252  ARG A CB  1 
ATOM   1982  C  CG  . ARG A 1 249 ? 16.385  23.331  83.505  1.00 43.55 ? 252  ARG A CG  1 
ATOM   1983  C  CD  . ARG A 1 249 ? 15.732  23.650  84.847  1.00 44.11 ? 252  ARG A CD  1 
ATOM   1984  N  NE  . ARG A 1 249 ? 15.608  25.088  85.092  1.00 44.70 ? 252  ARG A NE  1 
ATOM   1985  C  CZ  . ARG A 1 249 ? 14.596  25.850  84.675  1.00 44.93 ? 252  ARG A CZ  1 
ATOM   1986  N  NH1 . ARG A 1 249 ? 13.595  25.326  83.979  1.00 45.00 ? 252  ARG A NH1 1 
ATOM   1987  N  NH2 . ARG A 1 249 ? 14.575  27.143  84.973  1.00 45.10 ? 252  ARG A NH2 1 
ATOM   1988  N  N   . LEU A 1 250 ? 17.251  25.286  80.518  1.00 42.51 ? 253  LEU A N   1 
ATOM   1989  C  CA  . LEU A 1 250 ? 16.366  25.643  79.422  1.00 42.40 ? 253  LEU A CA  1 
ATOM   1990  C  C   . LEU A 1 250 ? 16.879  25.192  78.071  1.00 42.47 ? 253  LEU A C   1 
ATOM   1991  O  O   . LEU A 1 250 ? 16.088  24.873  77.192  1.00 42.69 ? 253  LEU A O   1 
ATOM   1992  C  CB  . LEU A 1 250 ? 16.124  27.146  79.396  1.00 42.21 ? 253  LEU A CB  1 
ATOM   1993  C  CG  . LEU A 1 250 ? 15.169  27.622  80.483  1.00 42.15 ? 253  LEU A CG  1 
ATOM   1994  C  CD1 . LEU A 1 250 ? 15.100  29.142  80.506  1.00 41.92 ? 253  LEU A CD1 1 
ATOM   1995  C  CD2 . LEU A 1 250 ? 13.804  27.007  80.233  1.00 42.07 ? 253  LEU A CD2 1 
ATOM   1996  N  N   . SER A 1 251 ? 18.195  25.157  77.895  1.00 42.46 ? 254  SER A N   1 
ATOM   1997  C  CA  . SER A 1 251 ? 18.755  24.739  76.614  1.00 42.48 ? 254  SER A CA  1 
ATOM   1998  C  C   . SER A 1 251 ? 18.394  23.292  76.344  1.00 42.49 ? 254  SER A C   1 
ATOM   1999  O  O   . SER A 1 251 ? 18.366  22.854  75.199  1.00 42.48 ? 254  SER A O   1 
ATOM   2000  C  CB  . SER A 1 251 ? 20.271  24.921  76.582  1.00 42.41 ? 254  SER A CB  1 
ATOM   2001  O  OG  . SER A 1 251 ? 20.921  23.963  77.392  1.00 42.82 ? 254  SER A OG  1 
ATOM   2002  N  N   . GLN A 1 252 ? 18.121  22.549  77.407  1.00 42.53 ? 255  GLN A N   1 
ATOM   2003  C  CA  . GLN A 1 252 ? 17.735  21.156  77.269  1.00 42.70 ? 255  GLN A CA  1 
ATOM   2004  C  C   . GLN A 1 252 ? 16.215  21.027  77.292  1.00 42.59 ? 255  GLN A C   1 
ATOM   2005  O  O   . GLN A 1 252 ? 15.634  20.279  76.509  1.00 42.47 ? 255  GLN A O   1 
ATOM   2006  C  CB  . GLN A 1 252 ? 18.367  20.317  78.382  1.00 43.04 ? 255  GLN A CB  1 
ATOM   2007  C  CG  . GLN A 1 252 ? 17.797  18.907  78.509  1.00 43.41 ? 255  GLN A CG  1 
ATOM   2008  C  CD  . GLN A 1 252 ? 16.726  18.799  79.583  1.00 43.65 ? 255  GLN A CD  1 
ATOM   2009  O  OE1 . GLN A 1 252 ? 15.608  18.347  79.322  1.00 43.70 ? 255  GLN A OE1 1 
ATOM   2010  N  NE2 . GLN A 1 252 ? 17.070  19.205  80.804  1.00 43.78 ? 255  GLN A NE2 1 
ATOM   2011  N  N   . GLU A 1 253 ? 15.574  21.771  78.188  1.00 42.58 ? 256  GLU A N   1 
ATOM   2012  C  CA  . GLU A 1 253 ? 14.125  21.724  78.310  1.00 42.48 ? 256  GLU A CA  1 
ATOM   2013  C  C   . GLU A 1 253 ? 13.401  22.344  77.135  1.00 42.18 ? 256  GLU A C   1 
ATOM   2014  O  O   . GLU A 1 253 ? 12.393  21.808  76.685  1.00 42.35 ? 256  GLU A O   1 
ATOM   2015  C  CB  . GLU A 1 253 ? 13.666  22.374  79.615  1.00 42.87 ? 256  GLU A CB  1 
ATOM   2016  C  CG  . GLU A 1 253 ? 13.973  21.526  80.846  1.00 43.59 ? 256  GLU A CG  1 
ATOM   2017  C  CD  . GLU A 1 253 ? 13.418  22.108  82.133  1.00 44.00 ? 256  GLU A CD  1 
ATOM   2018  O  OE1 . GLU A 1 253 ? 13.040  23.298  82.143  1.00 44.42 ? 256  GLU A OE1 1 
ATOM   2019  O  OE2 . GLU A 1 253 ? 13.370  21.378  83.145  1.00 44.16 ? 256  GLU A OE2 1 
ATOM   2020  N  N   . ASP A 1 254 ? 13.921  23.454  76.620  1.00 41.60 ? 257  ASP A N   1 
ATOM   2021  C  CA  . ASP A 1 254 ? 13.292  24.130  75.497  1.00 41.01 ? 257  ASP A CA  1 
ATOM   2022  C  C   . ASP A 1 254 ? 14.308  24.923  74.693  1.00 40.70 ? 257  ASP A C   1 
ATOM   2023  O  O   . ASP A 1 254 ? 14.552  26.097  74.972  1.00 40.54 ? 257  ASP A O   1 
ATOM   2024  C  CB  . ASP A 1 254 ? 12.185  25.063  75.996  1.00 41.11 ? 257  ASP A CB  1 
ATOM   2025  C  CG  . ASP A 1 254 ? 11.333  25.626  74.871  1.00 41.27 ? 257  ASP A CG  1 
ATOM   2026  O  OD1 . ASP A 1 254 ? 11.599  25.346  73.682  1.00 41.53 ? 257  ASP A OD1 1 
ATOM   2027  O  OD2 . ASP A 1 254 ? 10.368  26.350  75.180  1.00 41.63 ? 257  ASP A OD2 1 
ATOM   2028  N  N   . PRO A 1 255 ? 14.906  24.291  73.670  1.00 40.38 ? 258  PRO A N   1 
ATOM   2029  C  CA  . PRO A 1 255 ? 15.904  24.933  72.808  1.00 40.15 ? 258  PRO A CA  1 
ATOM   2030  C  C   . PRO A 1 255 ? 15.313  26.123  72.067  1.00 40.07 ? 258  PRO A C   1 
ATOM   2031  O  O   . PRO A 1 255 ? 16.040  27.000  71.613  1.00 40.25 ? 258  PRO A O   1 
ATOM   2032  C  CB  . PRO A 1 255 ? 16.270  23.821  71.828  1.00 40.08 ? 258  PRO A CB  1 
ATOM   2033  C  CG  . PRO A 1 255 ? 16.057  22.587  72.621  1.00 40.17 ? 258  PRO A CG  1 
ATOM   2034  C  CD  . PRO A 1 255 ? 14.750  22.873  73.308  1.00 40.22 ? 258  PRO A CD  1 
ATOM   2035  N  N   . ASP A 1 256 ? 13.989  26.154  71.961  1.00 39.86 ? 259  ASP A N   1 
ATOM   2036  C  CA  . ASP A 1 256 ? 13.302  27.227  71.262  1.00 39.65 ? 259  ASP A CA  1 
ATOM   2037  C  C   . ASP A 1 256 ? 12.618  28.200  72.199  1.00 39.41 ? 259  ASP A C   1 
ATOM   2038  O  O   . ASP A 1 256 ? 11.608  28.804  71.856  1.00 39.40 ? 259  ASP A O   1 
ATOM   2039  C  CB  . ASP A 1 256 ? 12.304  26.626  70.285  1.00 39.80 ? 259  ASP A CB  1 
ATOM   2040  C  CG  . ASP A 1 256 ? 12.964  25.684  69.312  1.00 40.14 ? 259  ASP A CG  1 
ATOM   2041  O  OD1 . ASP A 1 256 ? 14.095  25.985  68.875  1.00 40.38 ? 259  ASP A OD1 1 
ATOM   2042  O  OD2 . ASP A 1 256 ? 12.372  24.635  68.994  1.00 40.55 ? 259  ASP A OD2 1 
ATOM   2043  N  N   . TYR A 1 257 ? 13.211  28.368  73.374  1.00 39.26 ? 260  TYR A N   1 
ATOM   2044  C  CA  . TYR A 1 257 ? 12.707  29.257  74.412  1.00 38.93 ? 260  TYR A CA  1 
ATOM   2045  C  C   . TYR A 1 257 ? 12.405  30.677  73.925  1.00 38.65 ? 260  TYR A C   1 
ATOM   2046  O  O   . TYR A 1 257 ? 11.325  31.207  74.187  1.00 38.62 ? 260  TYR A O   1 
ATOM   2047  C  CB  . TYR A 1 257 ? 13.719  29.301  75.553  1.00 39.16 ? 260  TYR A CB  1 
ATOM   2048  C  CG  . TYR A 1 257 ? 13.312  30.155  76.724  1.00 39.64 ? 260  TYR A CG  1 
ATOM   2049  C  CD1 . TYR A 1 257 ? 13.723  31.484  76.815  1.00 39.76 ? 260  TYR A CD1 1 
ATOM   2050  C  CD2 . TYR A 1 257 ? 12.537  29.630  77.762  1.00 39.73 ? 260  TYR A CD2 1 
ATOM   2051  C  CE1 . TYR A 1 257 ? 13.378  32.275  77.912  1.00 39.98 ? 260  TYR A CE1 1 
ATOM   2052  C  CE2 . TYR A 1 257 ? 12.185  30.411  78.867  1.00 40.01 ? 260  TYR A CE2 1 
ATOM   2053  C  CZ  . TYR A 1 257 ? 12.613  31.734  78.936  1.00 40.15 ? 260  TYR A CZ  1 
ATOM   2054  O  OH  . TYR A 1 257 ? 12.300  32.512  80.032  1.00 40.35 ? 260  TYR A OH  1 
ATOM   2055  N  N   . GLY A 1 258 ? 13.363  31.295  73.237  1.00 38.45 ? 261  GLY A N   1 
ATOM   2056  C  CA  . GLY A 1 258 ? 13.171  32.646  72.732  1.00 38.01 ? 261  GLY A CA  1 
ATOM   2057  C  C   . GLY A 1 258 ? 12.034  32.749  71.734  1.00 37.79 ? 261  GLY A C   1 
ATOM   2058  O  O   . GLY A 1 258 ? 11.256  33.702  71.761  1.00 37.71 ? 261  GLY A O   1 
ATOM   2059  N  N   . ILE A 1 259 ? 11.945  31.771  70.843  1.00 37.46 ? 262  ILE A N   1 
ATOM   2060  C  CA  . ILE A 1 259 ? 10.890  31.742  69.846  1.00 37.33 ? 262  ILE A CA  1 
ATOM   2061  C  C   . ILE A 1 259 ? 9.535   31.682  70.535  1.00 37.40 ? 262  ILE A C   1 
ATOM   2062  O  O   . ILE A 1 259 ? 8.663   32.503  70.270  1.00 37.42 ? 262  ILE A O   1 
ATOM   2063  C  CB  . ILE A 1 259 ? 11.038  30.521  68.936  1.00 37.35 ? 262  ILE A CB  1 
ATOM   2064  C  CG1 . ILE A 1 259 ? 12.335  30.632  68.138  1.00 37.34 ? 262  ILE A CG1 1 
ATOM   2065  C  CG2 . ILE A 1 259 ? 9.843   30.395  68.007  1.00 37.17 ? 262  ILE A CG2 1 
ATOM   2066  C  CD1 . ILE A 1 259 ? 12.662  29.405  67.318  1.00 37.28 ? 262  ILE A CD1 1 
ATOM   2067  N  N   . ARG A 1 260 ? 9.381   30.725  71.441  1.00 37.45 ? 263  ARG A N   1 
ATOM   2068  C  CA  . ARG A 1 260 ? 8.139   30.535  72.181  1.00 37.41 ? 263  ARG A CA  1 
ATOM   2069  C  C   . ARG A 1 260 ? 7.739   31.760  73.001  1.00 37.43 ? 263  ARG A C   1 
ATOM   2070  O  O   . ARG A 1 260 ? 6.583   32.183  72.978  1.00 37.33 ? 263  ARG A O   1 
ATOM   2071  C  CB  . ARG A 1 260 ? 8.270   29.322  73.104  1.00 37.55 ? 263  ARG A CB  1 
ATOM   2072  C  CG  . ARG A 1 260 ? 6.998   28.959  73.843  1.00 37.78 ? 263  ARG A CG  1 
ATOM   2073  C  CD  . ARG A 1 260 ? 7.258   27.849  74.845  1.00 38.07 ? 263  ARG A CD  1 
ATOM   2074  N  NE  . ARG A 1 260 ? 7.792   26.651  74.204  1.00 38.39 ? 263  ARG A NE  1 
ATOM   2075  C  CZ  . ARG A 1 260 ? 7.047   25.747  73.578  1.00 38.61 ? 263  ARG A CZ  1 
ATOM   2076  N  NH1 . ARG A 1 260 ? 5.729   25.890  73.511  1.00 38.65 ? 263  ARG A NH1 1 
ATOM   2077  N  NH2 . ARG A 1 260 ? 7.628   24.718  72.985  1.00 38.67 ? 263  ARG A NH2 1 
ATOM   2078  N  N   . ASP A 1 261 ? 8.700   32.323  73.723  1.00 37.21 ? 264  ASP A N   1 
ATOM   2079  C  CA  . ASP A 1 261 ? 8.449   33.489  74.556  1.00 37.19 ? 264  ASP A CA  1 
ATOM   2080  C  C   . ASP A 1 261 ? 7.891   34.667  73.777  1.00 37.10 ? 264  ASP A C   1 
ATOM   2081  O  O   . ASP A 1 261 ? 6.935   35.303  74.210  1.00 36.93 ? 264  ASP A O   1 
ATOM   2082  C  CB  . ASP A 1 261 ? 9.735   33.911  75.271  1.00 37.51 ? 264  ASP A CB  1 
ATOM   2083  C  CG  . ASP A 1 261 ? 9.596   35.241  75.984  1.00 37.68 ? 264  ASP A CG  1 
ATOM   2084  O  OD1 . ASP A 1 261 ? 9.181   35.254  77.158  1.00 37.95 ? 264  ASP A OD1 1 
ATOM   2085  O  OD2 . ASP A 1 261 ? 9.892   36.282  75.366  1.00 37.97 ? 264  ASP A OD2 1 
ATOM   2086  N  N   . LEU A 1 262 ? 8.514   34.969  72.644  1.00 37.00 ? 265  LEU A N   1 
ATOM   2087  C  CA  . LEU A 1 262 ? 8.092   36.087  71.813  1.00 37.02 ? 265  LEU A CA  1 
ATOM   2088  C  C   . LEU A 1 262 ? 6.735   35.849  71.177  1.00 37.04 ? 265  LEU A C   1 
ATOM   2089  O  O   . LEU A 1 262 ? 5.901   36.752  71.128  1.00 36.97 ? 265  LEU A O   1 
ATOM   2090  C  CB  . LEU A 1 262 ? 9.132   36.360  70.725  1.00 36.99 ? 265  LEU A CB  1 
ATOM   2091  C  CG  . LEU A 1 262 ? 8.838   37.519  69.769  1.00 36.91 ? 265  LEU A CG  1 
ATOM   2092  C  CD1 . LEU A 1 262 ? 8.800   38.828  70.532  1.00 36.82 ? 265  LEU A CD1 1 
ATOM   2093  C  CD2 . LEU A 1 262 ? 9.889   37.564  68.674  1.00 36.73 ? 265  LEU A CD2 1 
ATOM   2094  N  N   . PHE A 1 263 ? 6.514   34.629  70.699  1.00 37.03 ? 266  PHE A N   1 
ATOM   2095  C  CA  . PHE A 1 263 ? 5.255   34.294  70.060  1.00 37.19 ? 266  PHE A CA  1 
ATOM   2096  C  C   . PHE A 1 263 ? 4.086   34.435  71.022  1.00 37.23 ? 266  PHE A C   1 
ATOM   2097  O  O   . PHE A 1 263 ? 3.095   35.104  70.714  1.00 37.12 ? 266  PHE A O   1 
ATOM   2098  C  CB  . PHE A 1 263 ? 5.297   32.875  69.499  1.00 37.20 ? 266  PHE A CB  1 
ATOM   2099  C  CG  . PHE A 1 263 ? 4.108   32.531  68.657  1.00 37.29 ? 266  PHE A CG  1 
ATOM   2100  C  CD1 . PHE A 1 263 ? 2.943   32.050  69.241  1.00 37.39 ? 266  PHE A CD1 1 
ATOM   2101  C  CD2 . PHE A 1 263 ? 4.139   32.717  67.284  1.00 37.38 ? 266  PHE A CD2 1 
ATOM   2102  C  CE1 . PHE A 1 263 ? 1.829   31.762  68.474  1.00 37.41 ? 266  PHE A CE1 1 
ATOM   2103  C  CE2 . PHE A 1 263 ? 3.023   32.431  66.504  1.00 37.54 ? 266  PHE A CE2 1 
ATOM   2104  C  CZ  . PHE A 1 263 ? 1.867   31.954  67.104  1.00 37.58 ? 266  PHE A CZ  1 
ATOM   2105  N  N   . ASN A 1 264 ? 4.206   33.809  72.190  1.00 37.21 ? 267  ASN A N   1 
ATOM   2106  C  CA  . ASN A 1 264 ? 3.150   33.864  73.191  1.00 37.13 ? 267  ASN A CA  1 
ATOM   2107  C  C   . ASN A 1 264 ? 2.906   35.281  73.682  1.00 37.18 ? 267  ASN A C   1 
ATOM   2108  O  O   . ASN A 1 264 ? 1.765   35.678  73.903  1.00 37.11 ? 267  ASN A O   1 
ATOM   2109  C  CB  . ASN A 1 264 ? 3.473   32.946  74.367  1.00 37.14 ? 267  ASN A CB  1 
ATOM   2110  C  CG  . ASN A 1 264 ? 3.376   31.474  74.003  1.00 37.14 ? 267  ASN A CG  1 
ATOM   2111  O  OD1 . ASN A 1 264 ? 2.617   31.086  73.113  1.00 37.22 ? 267  ASN A OD1 1 
ATOM   2112  N  ND2 . ASN A 1 264 ? 4.141   30.644  74.702  1.00 37.35 ? 267  ASN A ND2 1 
ATOM   2113  N  N   . ALA A 1 265 ? 3.980   36.047  73.840  1.00 37.30 ? 268  ALA A N   1 
ATOM   2114  C  CA  . ALA A 1 265 ? 3.867   37.427  74.298  1.00 37.51 ? 268  ALA A CA  1 
ATOM   2115  C  C   . ALA A 1 265 ? 2.979   38.222  73.350  1.00 37.63 ? 268  ALA A C   1 
ATOM   2116  O  O   . ALA A 1 265 ? 2.028   38.874  73.778  1.00 37.62 ? 268  ALA A O   1 
ATOM   2117  C  CB  . ALA A 1 265 ? 5.246   38.073  74.395  1.00 37.50 ? 268  ALA A CB  1 
ATOM   2118  N  N   . ILE A 1 266 ? 3.288   38.155  72.061  1.00 37.59 ? 269  ILE A N   1 
ATOM   2119  C  CA  . ILE A 1 266 ? 2.508   38.862  71.059  1.00 37.73 ? 269  ILE A CA  1 
ATOM   2120  C  C   . ILE A 1 266 ? 1.105   38.269  70.953  1.00 38.15 ? 269  ILE A C   1 
ATOM   2121  O  O   . ILE A 1 266 ? 0.125   39.005  70.850  1.00 38.15 ? 269  ILE A O   1 
ATOM   2122  C  CB  . ILE A 1 266 ? 3.198   38.812  69.686  1.00 37.49 ? 269  ILE A CB  1 
ATOM   2123  C  CG1 . ILE A 1 266 ? 4.470   39.658  69.712  1.00 37.29 ? 269  ILE A CG1 1 
ATOM   2124  C  CG2 . ILE A 1 266 ? 2.256   39.288  68.598  1.00 37.41 ? 269  ILE A CG2 1 
ATOM   2125  C  CD1 . ILE A 1 266 ? 5.271   39.591  68.431  1.00 37.10 ? 269  ILE A CD1 1 
ATOM   2126  N  N   . ALA A 1 267 ? 1.009   36.943  71.010  1.00 38.41 ? 270  ALA A N   1 
ATOM   2127  C  CA  . ALA A 1 267 ? -0.277  36.267  70.909  1.00 38.80 ? 270  ALA A CA  1 
ATOM   2128  C  C   . ALA A 1 267 ? -1.245  36.674  72.010  1.00 39.21 ? 270  ALA A C   1 
ATOM   2129  O  O   . ALA A 1 267 ? -2.448  36.753  71.781  1.00 39.22 ? 270  ALA A O   1 
ATOM   2130  C  CB  . ALA A 1 267 ? -0.082  34.771  70.918  1.00 38.78 ? 270  ALA A CB  1 
ATOM   2131  N  N   . THR A 1 268 ? -0.722  36.939  73.201  1.00 39.66 ? 271  THR A N   1 
ATOM   2132  C  CA  . THR A 1 268 ? -1.562  37.333  74.326  1.00 39.98 ? 271  THR A CA  1 
ATOM   2133  C  C   . THR A 1 268 ? -1.669  38.849  74.525  1.00 40.19 ? 271  THR A C   1 
ATOM   2134  O  O   . THR A 1 268 ? -2.084  39.306  75.589  1.00 40.39 ? 271  THR A O   1 
ATOM   2135  C  CB  . THR A 1 268 ? -1.096  36.666  75.638  1.00 40.09 ? 271  THR A CB  1 
ATOM   2136  O  OG1 . THR A 1 268 ? 0.248   37.063  75.938  1.00 40.19 ? 271  THR A OG1 1 
ATOM   2137  C  CG2 . THR A 1 268 ? -1.147  35.156  75.501  1.00 40.09 ? 271  THR A CG2 1 
ATOM   2138  N  N   . GLY A 1 269 ? -1.298  39.623  73.508  1.00 40.26 ? 272  GLY A N   1 
ATOM   2139  C  CA  . GLY A 1 269 ? -1.388  41.072  73.604  1.00 40.32 ? 272  GLY A CA  1 
ATOM   2140  C  C   . GLY A 1 269 ? -0.267  41.795  74.331  1.00 40.49 ? 272  GLY A C   1 
ATOM   2141  O  O   . GLY A 1 269 ? -0.281  43.023  74.411  1.00 40.54 ? 272  GLY A O   1 
ATOM   2142  N  N   . LYS A 1 270 ? 0.681   41.048  74.894  1.00 40.70 ? 273  LYS A N   1 
ATOM   2143  C  CA  . LYS A 1 270 ? 1.814   41.643  75.602  1.00 40.76 ? 273  LYS A CA  1 
ATOM   2144  C  C   . LYS A 1 270 ? 2.866   42.111  74.594  1.00 40.45 ? 273  LYS A C   1 
ATOM   2145  O  O   . LYS A 1 270 ? 3.984   41.590  74.551  1.00 40.21 ? 273  LYS A O   1 
ATOM   2146  C  CB  . LYS A 1 270 ? 2.421   40.628  76.571  1.00 41.43 ? 273  LYS A CB  1 
ATOM   2147  C  CG  . LYS A 1 270 ? 1.589   40.376  77.823  1.00 42.46 ? 273  LYS A CG  1 
ATOM   2148  C  CD  . LYS A 1 270 ? 2.084   39.149  78.605  1.00 43.70 ? 273  LYS A CD  1 
ATOM   2149  C  CE  . LYS A 1 270 ? 3.622   39.128  78.802  1.00 44.59 ? 273  LYS A CE  1 
ATOM   2150  N  NZ  . LYS A 1 270 ? 4.205   40.294  79.563  1.00 45.13 ? 273  LYS A NZ  1 
ATOM   2151  N  N   . TYR A 1 271 ? 2.495   43.113  73.798  1.00 40.12 ? 274  TYR A N   1 
ATOM   2152  C  CA  . TYR A 1 271 ? 3.361   43.668  72.758  1.00 39.64 ? 274  TYR A CA  1 
ATOM   2153  C  C   . TYR A 1 271 ? 4.612   44.326  73.300  1.00 39.32 ? 274  TYR A C   1 
ATOM   2154  O  O   . TYR A 1 271 ? 4.536   45.344  73.986  1.00 39.51 ? 274  TYR A O   1 
ATOM   2155  C  CB  . TYR A 1 271 ? 2.595   44.686  71.916  1.00 39.60 ? 274  TYR A CB  1 
ATOM   2156  C  CG  . TYR A 1 271 ? 1.314   44.153  71.337  1.00 39.73 ? 274  TYR A CG  1 
ATOM   2157  C  CD1 . TYR A 1 271 ? 0.196   44.963  71.225  1.00 39.82 ? 274  TYR A CD1 1 
ATOM   2158  C  CD2 . TYR A 1 271 ? 1.214   42.834  70.915  1.00 39.79 ? 274  TYR A CD2 1 
ATOM   2159  C  CE1 . TYR A 1 271 ? -0.989  44.479  70.710  1.00 40.07 ? 274  TYR A CE1 1 
ATOM   2160  C  CE2 . TYR A 1 271 ? 0.035   42.337  70.397  1.00 39.96 ? 274  TYR A CE2 1 
ATOM   2161  C  CZ  . TYR A 1 271 ? -1.064  43.164  70.297  1.00 40.14 ? 274  TYR A CZ  1 
ATOM   2162  O  OH  . TYR A 1 271 ? -2.240  42.681  69.776  1.00 40.41 ? 274  TYR A OH  1 
ATOM   2163  N  N   . PRO A 1 272 ? 5.788   43.769  72.976  1.00 38.96 ? 275  PRO A N   1 
ATOM   2164  C  CA  . PRO A 1 272 ? 7.057   44.323  73.444  1.00 38.52 ? 275  PRO A CA  1 
ATOM   2165  C  C   . PRO A 1 272 ? 7.410   45.593  72.680  1.00 38.22 ? 275  PRO A C   1 
ATOM   2166  O  O   . PRO A 1 272 ? 7.081   45.729  71.501  1.00 38.15 ? 275  PRO A O   1 
ATOM   2167  C  CB  . PRO A 1 272 ? 8.037   43.201  73.138  1.00 38.61 ? 275  PRO A CB  1 
ATOM   2168  C  CG  . PRO A 1 272 ? 7.494   42.644  71.870  1.00 38.70 ? 275  PRO A CG  1 
ATOM   2169  C  CD  . PRO A 1 272 ? 6.015   42.567  72.152  1.00 38.82 ? 275  PRO A CD  1 
ATOM   2170  N  N   . SER A 1 273 ? 8.056   46.531  73.363  1.00 37.92 ? 276  SER A N   1 
ATOM   2171  C  CA  . SER A 1 273 ? 8.457   47.782  72.739  1.00 37.51 ? 276  SER A CA  1 
ATOM   2172  C  C   . SER A 1 273 ? 9.835   48.201  73.205  1.00 37.24 ? 276  SER A C   1 
ATOM   2173  O  O   . SER A 1 273 ? 10.349  47.695  74.209  1.00 37.28 ? 276  SER A O   1 
ATOM   2174  C  CB  . SER A 1 273 ? 7.442   48.885  73.034  1.00 37.43 ? 276  SER A CB  1 
ATOM   2175  O  OG  . SER A 1 273 ? 7.299   49.084  74.425  1.00 37.79 ? 276  SER A OG  1 
ATOM   2176  N  N   . TRP A 1 274 ? 10.444  49.094  72.432  1.00 36.98 ? 277  TRP A N   1 
ATOM   2177  C  CA  . TRP A 1 274 ? 11.773  49.617  72.708  1.00 36.74 ? 277  TRP A CA  1 
ATOM   2178  C  C   . TRP A 1 274 ? 11.762  51.107  72.437  1.00 36.83 ? 277  TRP A C   1 
ATOM   2179  O  O   . TRP A 1 274 ? 11.140  51.552  71.471  1.00 36.89 ? 277  TRP A O   1 
ATOM   2180  C  CB  . TRP A 1 274 ? 12.806  48.968  71.777  1.00 36.53 ? 277  TRP A CB  1 
ATOM   2181  C  CG  . TRP A 1 274 ? 13.166  47.557  72.130  1.00 36.34 ? 277  TRP A CG  1 
ATOM   2182  C  CD1 . TRP A 1 274 ? 14.256  47.150  72.836  1.00 36.19 ? 277  TRP A CD1 1 
ATOM   2183  C  CD2 . TRP A 1 274 ? 12.430  46.366  71.807  1.00 36.17 ? 277  TRP A CD2 1 
ATOM   2184  N  NE1 . TRP A 1 274 ? 14.247  45.783  72.984  1.00 36.03 ? 277  TRP A NE1 1 
ATOM   2185  C  CE2 . TRP A 1 274 ? 13.136  45.276  72.361  1.00 36.06 ? 277  TRP A CE2 1 
ATOM   2186  C  CE3 . TRP A 1 274 ? 11.242  46.115  71.106  1.00 36.12 ? 277  TRP A CE3 1 
ATOM   2187  C  CZ2 . TRP A 1 274 ? 12.695  43.954  72.240  1.00 35.88 ? 277  TRP A CZ2 1 
ATOM   2188  C  CZ3 . TRP A 1 274 ? 10.804  44.796  70.987  1.00 35.99 ? 277  TRP A CZ3 1 
ATOM   2189  C  CH2 . TRP A 1 274 ? 11.531  43.735  71.552  1.00 35.77 ? 277  TRP A CH2 1 
ATOM   2190  N  N   . THR A 1 275 ? 12.426  51.880  73.290  1.00 36.74 ? 278  THR A N   1 
ATOM   2191  C  CA  . THR A 1 275 ? 12.496  53.320  73.085  1.00 36.83 ? 278  THR A CA  1 
ATOM   2192  C  C   . THR A 1 275 ? 13.723  53.578  72.216  1.00 37.02 ? 278  THR A C   1 
ATOM   2193  O  O   . THR A 1 275 ? 14.836  53.221  72.594  1.00 36.90 ? 278  THR A O   1 
ATOM   2194  C  CB  . THR A 1 275 ? 12.611  54.089  74.421  1.00 36.97 ? 278  THR A CB  1 
ATOM   2195  O  OG1 . THR A 1 275 ? 11.497  53.756  75.256  1.00 36.89 ? 278  THR A OG1 1 
ATOM   2196  C  CG2 . THR A 1 275 ? 12.594  55.604  74.180  1.00 36.90 ? 278  THR A CG2 1 
ATOM   2197  N  N   . PHE A 1 276 ? 13.500  54.180  71.047  1.00 36.90 ? 279  PHE A N   1 
ATOM   2198  C  CA  . PHE A 1 276 ? 14.545  54.484  70.066  1.00 36.81 ? 279  PHE A CA  1 
ATOM   2199  C  C   . PHE A 1 276 ? 15.225  55.846  70.297  1.00 36.93 ? 279  PHE A C   1 
ATOM   2200  O  O   . PHE A 1 276 ? 14.563  56.882  70.303  1.00 37.05 ? 279  PHE A O   1 
ATOM   2201  C  CB  . PHE A 1 276 ? 13.916  54.438  68.670  1.00 36.60 ? 279  PHE A CB  1 
ATOM   2202  C  CG  . PHE A 1 276 ? 14.896  54.243  67.555  1.00 36.54 ? 279  PHE A CG  1 
ATOM   2203  C  CD1 . PHE A 1 276 ? 15.254  52.972  67.148  1.00 36.46 ? 279  PHE A CD1 1 
ATOM   2204  C  CD2 . PHE A 1 276 ? 15.433  55.329  66.880  1.00 36.61 ? 279  PHE A CD2 1 
ATOM   2205  C  CE1 . PHE A 1 276 ? 16.130  52.784  66.082  1.00 36.54 ? 279  PHE A CE1 1 
ATOM   2206  C  CE2 . PHE A 1 276 ? 16.309  55.151  65.815  1.00 36.61 ? 279  PHE A CE2 1 
ATOM   2207  C  CZ  . PHE A 1 276 ? 16.658  53.875  65.417  1.00 36.61 ? 279  PHE A CZ  1 
ATOM   2208  N  N   . TYR A 1 277 ? 16.549  55.832  70.458  1.00 36.87 ? 280  TYR A N   1 
ATOM   2209  C  CA  . TYR A 1 277 ? 17.348  57.040  70.687  1.00 36.90 ? 280  TYR A CA  1 
ATOM   2210  C  C   . TYR A 1 277 ? 18.495  57.118  69.689  1.00 37.00 ? 280  TYR A C   1 
ATOM   2211  O  O   . TYR A 1 277 ? 18.754  56.172  68.945  1.00 36.98 ? 280  TYR A O   1 
ATOM   2212  C  CB  . TYR A 1 277 ? 18.045  56.994  72.052  1.00 36.93 ? 280  TYR A CB  1 
ATOM   2213  C  CG  . TYR A 1 277 ? 17.174  56.878  73.264  1.00 37.05 ? 280  TYR A CG  1 
ATOM   2214  C  CD1 . TYR A 1 277 ? 16.826  58.003  73.994  1.00 37.14 ? 280  TYR A CD1 1 
ATOM   2215  C  CD2 . TYR A 1 277 ? 16.764  55.637  73.728  1.00 37.11 ? 280  TYR A CD2 1 
ATOM   2216  C  CE1 . TYR A 1 277 ? 16.092  57.897  75.164  1.00 37.50 ? 280  TYR A CE1 1 
ATOM   2217  C  CE2 . TYR A 1 277 ? 16.033  55.518  74.893  1.00 37.46 ? 280  TYR A CE2 1 
ATOM   2218  C  CZ  . TYR A 1 277 ? 15.700  56.652  75.608  1.00 37.62 ? 280  TYR A CZ  1 
ATOM   2219  O  OH  . TYR A 1 277 ? 14.976  56.542  76.772  1.00 37.98 ? 280  TYR A OH  1 
ATOM   2220  N  N   . ILE A 1 278 ? 19.209  58.242  69.724  1.00 36.87 ? 281  ILE A N   1 
ATOM   2221  C  CA  . ILE A 1 278 ? 20.402  58.447  68.903  1.00 36.87 ? 281  ILE A CA  1 
ATOM   2222  C  C   . ILE A 1 278 ? 21.378  59.287  69.708  1.00 37.13 ? 281  ILE A C   1 
ATOM   2223  O  O   . ILE A 1 278 ? 20.990  59.989  70.641  1.00 37.14 ? 281  ILE A O   1 
ATOM   2224  C  CB  . ILE A 1 278 ? 20.168  59.231  67.566  1.00 36.56 ? 281  ILE A CB  1 
ATOM   2225  C  CG1 . ILE A 1 278 ? 19.670  60.647  67.844  1.00 36.22 ? 281  ILE A CG1 1 
ATOM   2226  C  CG2 . ILE A 1 278 ? 19.266  58.468  66.621  1.00 36.45 ? 281  ILE A CG2 1 
ATOM   2227  C  CD1 . ILE A 1 278 ? 19.712  61.547  66.637  1.00 35.99 ? 281  ILE A CD1 1 
ATOM   2228  N  N   . GLN A 1 279 ? 22.656  59.143  69.393  1.00 37.48 ? 282  GLN A N   1 
ATOM   2229  C  CA  . GLN A 1 279 ? 23.695  59.956  70.008  1.00 37.73 ? 282  GLN A CA  1 
ATOM   2230  C  C   . GLN A 1 279 ? 24.229  60.766  68.837  1.00 38.07 ? 282  GLN A C   1 
ATOM   2231  O  O   . GLN A 1 279 ? 24.305  60.254  67.714  1.00 37.82 ? 282  GLN A O   1 
ATOM   2232  C  CB  . GLN A 1 279 ? 24.822  59.102  70.573  1.00 37.84 ? 282  GLN A CB  1 
ATOM   2233  C  CG  . GLN A 1 279 ? 24.513  58.414  71.878  1.00 37.97 ? 282  GLN A CG  1 
ATOM   2234  C  CD  . GLN A 1 279 ? 25.714  57.667  72.402  1.00 38.02 ? 282  GLN A CD  1 
ATOM   2235  O  OE1 . GLN A 1 279 ? 26.276  58.024  73.432  1.00 38.43 ? 282  GLN A OE1 1 
ATOM   2236  N  NE2 . GLN A 1 279 ? 26.136  56.642  71.677  1.00 37.88 ? 282  GLN A NE2 1 
ATOM   2237  N  N   . VAL A 1 280 ? 24.568  62.028  69.075  1.00 38.30 ? 283  VAL A N   1 
ATOM   2238  C  CA  . VAL A 1 280 ? 25.090  62.868  68.003  1.00 38.63 ? 283  VAL A CA  1 
ATOM   2239  C  C   . VAL A 1 280 ? 26.477  63.432  68.297  1.00 38.84 ? 283  VAL A C   1 
ATOM   2240  O  O   . VAL A 1 280 ? 26.763  63.893  69.401  1.00 38.84 ? 283  VAL A O   1 
ATOM   2241  C  CB  . VAL A 1 280 ? 24.116  64.018  67.646  1.00 38.66 ? 283  VAL A CB  1 
ATOM   2242  C  CG1 . VAL A 1 280 ? 24.730  64.927  66.593  1.00 38.50 ? 283  VAL A CG1 1 
ATOM   2243  C  CG2 . VAL A 1 280 ? 22.803  63.448  67.123  1.00 38.65 ? 283  VAL A CG2 1 
ATOM   2244  N  N   . MET A 1 281 ? 27.341  63.344  67.293  1.00 39.10 ? 284  MET A N   1 
ATOM   2245  C  CA  . MET A 1 281 ? 28.702  63.840  67.377  1.00 39.44 ? 284  MET A CA  1 
ATOM   2246  C  C   . MET A 1 281 ? 28.946  64.661  66.121  1.00 39.96 ? 284  MET A C   1 
ATOM   2247  O  O   . MET A 1 281 ? 28.752  64.176  65.005  1.00 39.85 ? 284  MET A O   1 
ATOM   2248  C  CB  . MET A 1 281 ? 29.689  62.675  67.436  1.00 39.23 ? 284  MET A CB  1 
ATOM   2249  C  CG  . MET A 1 281 ? 31.142  63.088  67.538  1.00 38.99 ? 284  MET A CG  1 
ATOM   2250  S  SD  . MET A 1 281 ? 32.239  61.691  67.295  1.00 39.17 ? 284  MET A SD  1 
ATOM   2251  C  CE  . MET A 1 281 ? 32.366  61.074  68.936  1.00 38.84 ? 284  MET A CE  1 
ATOM   2252  N  N   . THR A 1 282 ? 29.308  65.925  66.307  1.00 40.52 ? 285  THR A N   1 
ATOM   2253  C  CA  . THR A 1 282 ? 29.575  66.817  65.185  1.00 41.04 ? 285  THR A CA  1 
ATOM   2254  C  C   . THR A 1 282 ? 30.911  66.425  64.587  1.00 41.51 ? 285  THR A C   1 
ATOM   2255  O  O   . THR A 1 282 ? 31.693  65.717  65.218  1.00 41.48 ? 285  THR A O   1 
ATOM   2256  C  CB  . THR A 1 282 ? 29.675  68.280  65.641  1.00 41.12 ? 285  THR A CB  1 
ATOM   2257  O  OG1 . THR A 1 282 ? 30.845  68.445  66.454  1.00 41.12 ? 285  THR A OG1 1 
ATOM   2258  C  CG2 . THR A 1 282 ? 28.443  68.675  66.445  1.00 41.02 ? 285  THR A CG2 1 
ATOM   2259  N  N   . PHE A 1 283 ? 31.183  66.901  63.382  1.00 42.11 ? 286  PHE A N   1 
ATOM   2260  C  CA  . PHE A 1 283 ? 32.442  66.598  62.727  1.00 42.82 ? 286  PHE A CA  1 
ATOM   2261  C  C   . PHE A 1 283 ? 33.638  67.111  63.525  1.00 43.30 ? 286  PHE A C   1 
ATOM   2262  O  O   . PHE A 1 283 ? 34.711  66.508  63.488  1.00 43.35 ? 286  PHE A O   1 
ATOM   2263  C  CB  . PHE A 1 283 ? 32.447  67.156  61.307  1.00 42.99 ? 286  PHE A CB  1 
ATOM   2264  C  CG  . PHE A 1 283 ? 31.698  66.306  60.322  1.00 43.21 ? 286  PHE A CG  1 
ATOM   2265  C  CD1 . PHE A 1 283 ? 30.646  65.497  60.736  1.00 43.30 ? 286  PHE A CD1 1 
ATOM   2266  C  CD2 . PHE A 1 283 ? 32.060  66.295  58.985  1.00 43.33 ? 286  PHE A CD2 1 
ATOM   2267  C  CE1 . PHE A 1 283 ? 29.967  64.689  59.833  1.00 43.27 ? 286  PHE A CE1 1 
ATOM   2268  C  CE2 . PHE A 1 283 ? 31.385  65.491  58.078  1.00 43.50 ? 286  PHE A CE2 1 
ATOM   2269  C  CZ  . PHE A 1 283 ? 30.336  64.686  58.507  1.00 43.40 ? 286  PHE A CZ  1 
ATOM   2270  N  N   . ASN A 1 284 ? 33.448  68.207  64.259  1.00 43.76 ? 287  ASN A N   1 
ATOM   2271  C  CA  . ASN A 1 284 ? 34.513  68.771  65.083  1.00 44.31 ? 287  ASN A CA  1 
ATOM   2272  C  C   . ASN A 1 284 ? 34.798  67.878  66.278  1.00 44.36 ? 287  ASN A C   1 
ATOM   2273  O  O   . ASN A 1 284 ? 35.955  67.659  66.638  1.00 44.32 ? 287  ASN A O   1 
ATOM   2274  C  CB  . ASN A 1 284 ? 34.141  70.165  65.574  1.00 45.01 ? 287  ASN A CB  1 
ATOM   2275  C  CG  . ASN A 1 284 ? 34.165  71.190  64.470  1.00 45.73 ? 287  ASN A CG  1 
ATOM   2276  O  OD1 . ASN A 1 284 ? 34.929  71.068  63.505  1.00 46.30 ? 287  ASN A OD1 1 
ATOM   2277  N  ND2 . ASN A 1 284 ? 33.324  72.213  64.597  1.00 46.19 ? 287  ASN A ND2 1 
ATOM   2278  N  N   . GLN A 1 285 ? 33.739  67.389  66.916  1.00 44.31 ? 288  GLN A N   1 
ATOM   2279  C  CA  . GLN A 1 285 ? 33.905  66.507  68.059  1.00 44.45 ? 288  GLN A CA  1 
ATOM   2280  C  C   . GLN A 1 285 ? 34.562  65.208  67.618  1.00 44.61 ? 288  GLN A C   1 
ATOM   2281  O  O   . GLN A 1 285 ? 35.243  64.553  68.406  1.00 44.50 ? 288  GLN A O   1 
ATOM   2282  C  CB  . GLN A 1 285 ? 32.560  66.207  68.705  1.00 44.30 ? 288  GLN A CB  1 
ATOM   2283  C  CG  . GLN A 1 285 ? 31.883  67.417  69.279  1.00 44.23 ? 288  GLN A CG  1 
ATOM   2284  C  CD  . GLN A 1 285 ? 30.503  67.092  69.773  1.00 44.37 ? 288  GLN A CD  1 
ATOM   2285  O  OE1 . GLN A 1 285 ? 29.614  66.774  68.989  1.00 44.30 ? 288  GLN A OE1 1 
ATOM   2286  N  NE2 . GLN A 1 285 ? 30.316  67.146  71.084  1.00 44.51 ? 288  GLN A NE2 1 
ATOM   2287  N  N   . ALA A 1 286 ? 34.348  64.836  66.357  1.00 44.85 ? 289  ALA A N   1 
ATOM   2288  C  CA  . ALA A 1 286 ? 34.930  63.620  65.804  1.00 45.22 ? 289  ALA A CA  1 
ATOM   2289  C  C   . ALA A 1 286 ? 36.448  63.777  65.745  1.00 45.55 ? 289  ALA A C   1 
ATOM   2290  O  O   . ALA A 1 286 ? 37.190  62.794  65.799  1.00 45.49 ? 289  ALA A O   1 
ATOM   2291  C  CB  . ALA A 1 286 ? 34.362  63.341  64.413  1.00 45.07 ? 289  ALA A CB  1 
ATOM   2292  N  N   . GLU A 1 287 ? 36.898  65.025  65.648  1.00 45.90 ? 290  GLU A N   1 
ATOM   2293  C  CA  . GLU A 1 287 ? 38.323  65.340  65.597  1.00 46.21 ? 290  GLU A CA  1 
ATOM   2294  C  C   . GLU A 1 287 ? 38.931  65.308  66.985  1.00 46.25 ? 290  GLU A C   1 
ATOM   2295  O  O   . GLU A 1 287 ? 40.074  64.893  67.156  1.00 46.49 ? 290  GLU A O   1 
ATOM   2296  C  CB  . GLU A 1 287 ? 38.543  66.732  65.008  1.00 46.70 ? 290  GLU A CB  1 
ATOM   2297  C  CG  . GLU A 1 287 ? 38.151  66.863  63.553  1.00 47.31 ? 290  GLU A CG  1 
ATOM   2298  C  CD  . GLU A 1 287 ? 38.951  65.940  62.667  1.00 47.66 ? 290  GLU A CD  1 
ATOM   2299  O  OE1 . GLU A 1 287 ? 40.199  66.013  62.710  1.00 47.99 ? 290  GLU A OE1 1 
ATOM   2300  O  OE2 . GLU A 1 287 ? 38.332  65.143  61.929  1.00 48.00 ? 290  GLU A OE2 1 
ATOM   2301  N  N   . THR A 1 288 ? 38.160  65.746  67.975  1.00 46.15 ? 291  THR A N   1 
ATOM   2302  C  CA  . THR A 1 288 ? 38.627  65.795  69.355  1.00 45.92 ? 291  THR A CA  1 
ATOM   2303  C  C   . THR A 1 288 ? 38.439  64.504  70.157  1.00 45.62 ? 291  THR A C   1 
ATOM   2304  O  O   . THR A 1 288 ? 39.056  64.341  71.206  1.00 45.72 ? 291  THR A O   1 
ATOM   2305  C  CB  . THR A 1 288 ? 37.971  66.978  70.124  1.00 46.04 ? 291  THR A CB  1 
ATOM   2306  O  OG1 . THR A 1 288 ? 36.574  66.721  70.326  1.00 46.25 ? 291  THR A OG1 1 
ATOM   2307  C  CG2 . THR A 1 288 ? 38.126  68.271  69.335  1.00 46.11 ? 291  THR A CG2 1 
ATOM   2308  N  N   . PHE A 1 289 ? 37.598  63.592  69.673  1.00 45.14 ? 292  PHE A N   1 
ATOM   2309  C  CA  . PHE A 1 289 ? 37.345  62.331  70.377  1.00 44.63 ? 292  PHE A CA  1 
ATOM   2310  C  C   . PHE A 1 289 ? 38.685  61.670  70.726  1.00 44.28 ? 292  PHE A C   1 
ATOM   2311  O  O   . PHE A 1 289 ? 39.614  61.676  69.914  1.00 44.39 ? 292  PHE A O   1 
ATOM   2312  C  CB  . PHE A 1 289 ? 36.489  61.407  69.500  1.00 44.62 ? 292  PHE A CB  1 
ATOM   2313  C  CG  . PHE A 1 289 ? 35.849  60.264  70.247  1.00 44.50 ? 292  PHE A CG  1 
ATOM   2314  C  CD1 . PHE A 1 289 ? 36.157  58.948  69.926  1.00 44.39 ? 292  PHE A CD1 1 
ATOM   2315  C  CD2 . PHE A 1 289 ? 34.918  60.502  71.252  1.00 44.52 ? 292  PHE A CD2 1 
ATOM   2316  C  CE1 . PHE A 1 289 ? 35.546  57.885  70.592  1.00 44.36 ? 292  PHE A CE1 1 
ATOM   2317  C  CE2 . PHE A 1 289 ? 34.301  59.445  71.923  1.00 44.46 ? 292  PHE A CE2 1 
ATOM   2318  C  CZ  . PHE A 1 289 ? 34.618  58.135  71.591  1.00 44.39 ? 292  PHE A CZ  1 
ATOM   2319  N  N   . PRO A 1 290 ? 38.812  61.126  71.951  1.00 43.81 ? 293  PRO A N   1 
ATOM   2320  C  CA  . PRO A 1 290 ? 40.043  60.472  72.415  1.00 43.39 ? 293  PRO A CA  1 
ATOM   2321  C  C   . PRO A 1 290 ? 40.488  59.273  71.589  1.00 42.96 ? 293  PRO A C   1 
ATOM   2322  O  O   . PRO A 1 290 ? 41.677  58.995  71.493  1.00 43.22 ? 293  PRO A O   1 
ATOM   2323  C  CB  . PRO A 1 290 ? 39.692  60.048  73.844  1.00 43.47 ? 293  PRO A CB  1 
ATOM   2324  C  CG  . PRO A 1 290 ? 38.640  61.017  74.249  1.00 43.68 ? 293  PRO A CG  1 
ATOM   2325  C  CD  . PRO A 1 290 ? 37.793  61.111  73.012  1.00 43.74 ? 293  PRO A CD  1 
ATOM   2326  N  N   . PHE A 1 291 ? 39.538  58.548  71.015  1.00 42.34 ? 294  PHE A N   1 
ATOM   2327  C  CA  . PHE A 1 291 ? 39.872  57.381  70.211  1.00 41.60 ? 294  PHE A CA  1 
ATOM   2328  C  C   . PHE A 1 291 ? 39.327  57.583  68.814  1.00 41.08 ? 294  PHE A C   1 
ATOM   2329  O  O   . PHE A 1 291 ? 38.933  58.686  68.443  1.00 41.08 ? 294  PHE A O   1 
ATOM   2330  C  CB  . PHE A 1 291 ? 39.236  56.130  70.806  1.00 41.65 ? 294  PHE A CB  1 
ATOM   2331  C  CG  . PHE A 1 291 ? 39.375  56.029  72.288  1.00 41.68 ? 294  PHE A CG  1 
ATOM   2332  C  CD1 . PHE A 1 291 ? 40.536  55.517  72.854  1.00 41.81 ? 294  PHE A CD1 1 
ATOM   2333  C  CD2 . PHE A 1 291 ? 38.344  56.438  73.123  1.00 41.64 ? 294  PHE A CD2 1 
ATOM   2334  C  CE1 . PHE A 1 291 ? 40.670  55.413  74.236  1.00 41.66 ? 294  PHE A CE1 1 
ATOM   2335  C  CE2 . PHE A 1 291 ? 38.466  56.338  74.503  1.00 41.67 ? 294  PHE A CE2 1 
ATOM   2336  C  CZ  . PHE A 1 291 ? 39.636  55.822  75.060  1.00 41.72 ? 294  PHE A CZ  1 
ATOM   2337  N  N   . ASN A 1 292 ? 39.348  56.519  68.021  1.00 40.48 ? 295  ASN A N   1 
ATOM   2338  C  CA  . ASN A 1 292 ? 38.812  56.589  66.678  1.00 39.77 ? 295  ASN A CA  1 
ATOM   2339  C  C   . ASN A 1 292 ? 37.306  56.462  66.839  1.00 39.52 ? 295  ASN A C   1 
ATOM   2340  O  O   . ASN A 1 292 ? 36.808  55.431  67.286  1.00 39.67 ? 295  ASN A O   1 
ATOM   2341  C  CB  . ASN A 1 292 ? 39.351  55.442  65.829  1.00 39.53 ? 295  ASN A CB  1 
ATOM   2342  C  CG  . ASN A 1 292 ? 38.745  55.414  64.442  1.00 39.27 ? 295  ASN A CG  1 
ATOM   2343  O  OD1 . ASN A 1 292 ? 38.916  54.451  63.702  1.00 39.32 ? 295  ASN A OD1 1 
ATOM   2344  N  ND2 . ASN A 1 292 ? 38.033  56.472  64.084  1.00 39.14 ? 295  ASN A ND2 1 
ATOM   2345  N  N   . PRO A 1 293 ? 36.556  57.517  66.493  1.00 39.19 ? 296  PRO A N   1 
ATOM   2346  C  CA  . PRO A 1 293 ? 35.097  57.450  66.633  1.00 38.80 ? 296  PRO A CA  1 
ATOM   2347  C  C   . PRO A 1 293 ? 34.444  56.390  65.753  1.00 38.58 ? 296  PRO A C   1 
ATOM   2348  O  O   . PRO A 1 293 ? 33.282  56.034  65.964  1.00 38.55 ? 296  PRO A O   1 
ATOM   2349  C  CB  . PRO A 1 293 ? 34.651  58.865  66.253  1.00 38.84 ? 296  PRO A CB  1 
ATOM   2350  C  CG  . PRO A 1 293 ? 35.718  59.320  65.300  1.00 38.92 ? 296  PRO A CG  1 
ATOM   2351  C  CD  . PRO A 1 293 ? 36.982  58.819  65.945  1.00 39.01 ? 296  PRO A CD  1 
ATOM   2352  N  N   . PHE A 1 294 ? 35.202  55.875  64.786  1.00 38.20 ? 297  PHE A N   1 
ATOM   2353  C  CA  . PHE A 1 294 ? 34.695  54.864  63.863  1.00 37.82 ? 297  PHE A CA  1 
ATOM   2354  C  C   . PHE A 1 294 ? 35.213  53.482  64.224  1.00 37.75 ? 297  PHE A C   1 
ATOM   2355  O  O   . PHE A 1 294 ? 35.140  52.551  63.420  1.00 37.87 ? 297  PHE A O   1 
ATOM   2356  C  CB  . PHE A 1 294 ? 35.089  55.215  62.428  1.00 37.46 ? 297  PHE A CB  1 
ATOM   2357  C  CG  . PHE A 1 294 ? 34.857  56.654  62.073  1.00 37.21 ? 297  PHE A CG  1 
ATOM   2358  C  CD1 . PHE A 1 294 ? 33.586  57.208  62.155  1.00 37.09 ? 297  PHE A CD1 1 
ATOM   2359  C  CD2 . PHE A 1 294 ? 35.918  57.462  61.681  1.00 37.03 ? 297  PHE A CD2 1 
ATOM   2360  C  CE1 . PHE A 1 294 ? 33.373  58.540  61.858  1.00 36.91 ? 297  PHE A CE1 1 
ATOM   2361  C  CE2 . PHE A 1 294 ? 35.719  58.797  61.382  1.00 36.94 ? 297  PHE A CE2 1 
ATOM   2362  C  CZ  . PHE A 1 294 ? 34.442  59.338  61.471  1.00 37.03 ? 297  PHE A CZ  1 
ATOM   2363  N  N   . ASP A 1 295 ? 35.758  53.365  65.429  1.00 37.60 ? 298  ASP A N   1 
ATOM   2364  C  CA  . ASP A 1 295 ? 36.291  52.106  65.942  1.00 37.55 ? 298  ASP A CA  1 
ATOM   2365  C  C   . ASP A 1 295 ? 35.132  51.347  66.611  1.00 37.34 ? 298  ASP A C   1 
ATOM   2366  O  O   . ASP A 1 295 ? 34.584  51.806  67.619  1.00 37.42 ? 298  ASP A O   1 
ATOM   2367  C  CB  . ASP A 1 295 ? 37.399  52.422  66.956  1.00 37.85 ? 298  ASP A CB  1 
ATOM   2368  C  CG  . ASP A 1 295 ? 38.055  51.180  67.552  1.00 38.21 ? 298  ASP A CG  1 
ATOM   2369  O  OD1 . ASP A 1 295 ? 39.053  51.369  68.276  1.00 38.40 ? 298  ASP A OD1 1 
ATOM   2370  O  OD2 . ASP A 1 295 ? 37.594  50.033  67.327  1.00 38.55 ? 298  ASP A OD2 1 
ATOM   2371  N  N   . LEU A 1 296 ? 34.778  50.181  66.070  1.00 36.83 ? 299  LEU A N   1 
ATOM   2372  C  CA  . LEU A 1 296 ? 33.673  49.386  66.611  1.00 36.29 ? 299  LEU A CA  1 
ATOM   2373  C  C   . LEU A 1 296 ? 33.844  48.904  68.042  1.00 36.20 ? 299  LEU A C   1 
ATOM   2374  O  O   . LEU A 1 296 ? 32.875  48.478  68.663  1.00 36.10 ? 299  LEU A O   1 
ATOM   2375  C  CB  . LEU A 1 296 ? 33.380  48.172  65.729  1.00 35.99 ? 299  LEU A CB  1 
ATOM   2376  C  CG  . LEU A 1 296 ? 31.986  48.058  65.108  1.00 35.80 ? 299  LEU A CG  1 
ATOM   2377  C  CD1 . LEU A 1 296 ? 31.741  46.616  64.699  1.00 35.58 ? 299  LEU A CD1 1 
ATOM   2378  C  CD2 . LEU A 1 296 ? 30.910  48.510  66.070  1.00 35.38 ? 299  LEU A CD2 1 
ATOM   2379  N  N   . THR A 1 297 ? 35.067  48.923  68.559  1.00 36.07 ? 300  THR A N   1 
ATOM   2380  C  CA  . THR A 1 297 ? 35.296  48.460  69.921  1.00 35.97 ? 300  THR A CA  1 
ATOM   2381  C  C   . THR A 1 297 ? 35.202  49.605  70.917  1.00 36.11 ? 300  THR A C   1 
ATOM   2382  O  O   . THR A 1 297 ? 35.541  49.448  72.090  1.00 35.98 ? 300  THR A O   1 
ATOM   2383  C  CB  . THR A 1 297 ? 36.665  47.774  70.072  1.00 35.97 ? 300  THR A CB  1 
ATOM   2384  O  OG1 . THR A 1 297 ? 37.708  48.735  69.875  1.00 35.92 ? 300  THR A OG1 1 
ATOM   2385  C  CG2 . THR A 1 297 ? 36.819  46.661  69.060  1.00 35.67 ? 300  THR A CG2 1 
ATOM   2386  N  N   . LYS A 1 298 ? 34.728  50.753  70.447  1.00 36.07 ? 301  LYS A N   1 
ATOM   2387  C  CA  . LYS A 1 298 ? 34.590  51.931  71.293  1.00 35.99 ? 301  LYS A CA  1 
ATOM   2388  C  C   . LYS A 1 298 ? 33.150  52.407  71.349  1.00 36.35 ? 301  LYS A C   1 
ATOM   2389  O  O   . LYS A 1 298 ? 32.398  52.255  70.381  1.00 36.52 ? 301  LYS A O   1 
ATOM   2390  C  CB  . LYS A 1 298 ? 35.448  53.074  70.755  1.00 35.52 ? 301  LYS A CB  1 
ATOM   2391  C  CG  . LYS A 1 298 ? 36.918  52.765  70.655  1.00 35.25 ? 301  LYS A CG  1 
ATOM   2392  C  CD  . LYS A 1 298 ? 37.533  52.503  72.016  1.00 34.87 ? 301  LYS A CD  1 
ATOM   2393  C  CE  . LYS A 1 298 ? 39.028  52.254  71.906  1.00 34.68 ? 301  LYS A CE  1 
ATOM   2394  N  NZ  . LYS A 1 298 ? 39.333  51.031  71.111  1.00 34.50 ? 301  LYS A NZ  1 
ATOM   2395  N  N   . VAL A 1 299 ? 32.769  52.971  72.494  1.00 36.49 ? 302  VAL A N   1 
ATOM   2396  C  CA  . VAL A 1 299 ? 31.431  53.525  72.689  1.00 36.57 ? 302  VAL A CA  1 
ATOM   2397  C  C   . VAL A 1 299 ? 31.586  55.017  72.919  1.00 36.80 ? 302  VAL A C   1 
ATOM   2398  O  O   . VAL A 1 299 ? 32.686  55.500  73.180  1.00 36.86 ? 302  VAL A O   1 
ATOM   2399  C  CB  . VAL A 1 299 ? 30.717  52.954  73.936  1.00 36.44 ? 302  VAL A CB  1 
ATOM   2400  C  CG1 . VAL A 1 299 ? 30.501  51.454  73.802  1.00 36.21 ? 302  VAL A CG1 1 
ATOM   2401  C  CG2 . VAL A 1 299 ? 31.504  53.293  75.191  1.00 36.30 ? 302  VAL A CG2 1 
ATOM   2402  N  N   . TRP A 1 300 ? 30.499  55.756  72.752  1.00 37.14 ? 303  TRP A N   1 
ATOM   2403  C  CA  . TRP A 1 300 ? 30.520  57.185  72.993  1.00 37.29 ? 303  TRP A CA  1 
ATOM   2404  C  C   . TRP A 1 300 ? 29.947  57.333  74.391  1.00 37.80 ? 303  TRP A C   1 
ATOM   2405  O  O   . TRP A 1 300 ? 28.788  57.001  74.636  1.00 37.71 ? 303  TRP A O   1 
ATOM   2406  C  CB  . TRP A 1 300 ? 29.622  57.930  72.010  1.00 36.88 ? 303  TRP A CB  1 
ATOM   2407  C  CG  . TRP A 1 300 ? 30.087  57.968  70.589  1.00 36.66 ? 303  TRP A CG  1 
ATOM   2408  C  CD1 . TRP A 1 300 ? 31.233  57.444  70.077  1.00 36.55 ? 303  TRP A CD1 1 
ATOM   2409  C  CD2 . TRP A 1 300 ? 29.384  58.550  69.486  1.00 36.59 ? 303  TRP A CD2 1 
ATOM   2410  N  NE1 . TRP A 1 300 ? 31.287  57.655  68.718  1.00 36.42 ? 303  TRP A NE1 1 
ATOM   2411  C  CE2 . TRP A 1 300 ? 30.163  58.332  68.331  1.00 36.46 ? 303  TRP A CE2 1 
ATOM   2412  C  CE3 . TRP A 1 300 ? 28.165  59.231  69.362  1.00 36.35 ? 303  TRP A CE3 1 
ATOM   2413  C  CZ2 . TRP A 1 300 ? 29.766  58.770  67.068  1.00 36.46 ? 303  TRP A CZ2 1 
ATOM   2414  C  CZ3 . TRP A 1 300 ? 27.771  59.663  68.111  1.00 36.30 ? 303  TRP A CZ3 1 
ATOM   2415  C  CH2 . TRP A 1 300 ? 28.571  59.431  66.978  1.00 36.22 ? 303  TRP A CH2 1 
ATOM   2416  N  N   . PRO A 1 301 ? 30.758  57.810  75.341  1.00 38.45 ? 304  PRO A N   1 
ATOM   2417  C  CA  . PRO A 1 301 ? 30.269  57.979  76.710  1.00 39.00 ? 304  PRO A CA  1 
ATOM   2418  C  C   . PRO A 1 301 ? 29.004  58.830  76.744  1.00 39.50 ? 304  PRO A C   1 
ATOM   2419  O  O   . PRO A 1 301 ? 28.929  59.869  76.091  1.00 39.48 ? 304  PRO A O   1 
ATOM   2420  C  CB  . PRO A 1 301 ? 31.442  58.678  77.397  1.00 38.89 ? 304  PRO A CB  1 
ATOM   2421  C  CG  . PRO A 1 301 ? 32.624  58.110  76.674  1.00 38.64 ? 304  PRO A CG  1 
ATOM   2422  C  CD  . PRO A 1 301 ? 32.173  58.204  75.236  1.00 38.54 ? 304  PRO A CD  1 
ATOM   2423  N  N   . HIS A 1 302 ? 28.009  58.365  77.490  1.00 40.27 ? 305  HIS A N   1 
ATOM   2424  C  CA  . HIS A 1 302 ? 26.738  59.063  77.618  1.00 41.10 ? 305  HIS A CA  1 
ATOM   2425  C  C   . HIS A 1 302 ? 26.861  60.470  78.174  1.00 41.74 ? 305  HIS A C   1 
ATOM   2426  O  O   . HIS A 1 302 ? 26.064  61.336  77.824  1.00 41.98 ? 305  HIS A O   1 
ATOM   2427  C  CB  . HIS A 1 302 ? 25.797  58.280  78.519  1.00 41.09 ? 305  HIS A CB  1 
ATOM   2428  C  CG  . HIS A 1 302 ? 25.355  56.972  77.947  1.00 41.18 ? 305  HIS A CG  1 
ATOM   2429  N  ND1 . HIS A 1 302 ? 25.573  55.770  78.586  1.00 41.14 ? 305  HIS A ND1 1 
ATOM   2430  C  CD2 . HIS A 1 302 ? 24.668  56.679  76.818  1.00 41.21 ? 305  HIS A CD2 1 
ATOM   2431  C  CE1 . HIS A 1 302 ? 25.038  54.794  77.877  1.00 41.19 ? 305  HIS A CE1 1 
ATOM   2432  N  NE2 . HIS A 1 302 ? 24.482  55.318  76.798  1.00 41.14 ? 305  HIS A NE2 1 
ATOM   2433  N  N   . LYS A 1 303 ? 27.832  60.691  79.058  1.00 42.26 ? 306  LYS A N   1 
ATOM   2434  C  CA  . LYS A 1 303 ? 28.037  62.005  79.669  1.00 42.90 ? 306  LYS A CA  1 
ATOM   2435  C  C   . LYS A 1 303 ? 28.385  63.066  78.634  1.00 42.87 ? 306  LYS A C   1 
ATOM   2436  O  O   . LYS A 1 303 ? 27.920  64.204  78.714  1.00 42.96 ? 306  LYS A O   1 
ATOM   2437  C  CB  . LYS A 1 303 ? 29.153  61.938  80.712  1.00 43.62 ? 306  LYS A CB  1 
ATOM   2438  C  CG  . LYS A 1 303 ? 29.044  62.981  81.817  1.00 44.69 ? 306  LYS A CG  1 
ATOM   2439  C  CD  . LYS A 1 303 ? 27.858  62.675  82.749  1.00 45.76 ? 306  LYS A CD  1 
ATOM   2440  C  CE  . LYS A 1 303 ? 27.825  63.615  83.967  1.00 46.33 ? 306  LYS A CE  1 
ATOM   2441  N  NZ  . LYS A 1 303 ? 26.636  63.398  84.850  1.00 46.44 ? 306  LYS A NZ  1 
ATOM   2442  N  N   . ASP A 1 304 ? 29.211  62.690  77.665  1.00 42.98 ? 307  ASP A N   1 
ATOM   2443  C  CA  . ASP A 1 304 ? 29.626  63.607  76.616  1.00 42.96 ? 307  ASP A CA  1 
ATOM   2444  C  C   . ASP A 1 304 ? 28.691  63.563  75.423  1.00 42.65 ? 307  ASP A C   1 
ATOM   2445  O  O   . ASP A 1 304 ? 28.589  64.535  74.686  1.00 42.68 ? 307  ASP A O   1 
ATOM   2446  C  CB  . ASP A 1 304 ? 31.050  63.289  76.161  1.00 43.53 ? 307  ASP A CB  1 
ATOM   2447  C  CG  . ASP A 1 304 ? 32.036  63.252  77.314  1.00 44.13 ? 307  ASP A CG  1 
ATOM   2448  O  OD1 . ASP A 1 304 ? 32.805  62.272  77.404  1.00 44.45 ? 307  ASP A OD1 1 
ATOM   2449  O  OD2 . ASP A 1 304 ? 32.035  64.196  78.137  1.00 44.56 ? 307  ASP A OD2 1 
ATOM   2450  N  N   . TYR A 1 305 ? 28.024  62.429  75.224  1.00 42.24 ? 308  TYR A N   1 
ATOM   2451  C  CA  . TYR A 1 305 ? 27.098  62.265  74.106  1.00 41.80 ? 308  TYR A CA  1 
ATOM   2452  C  C   . TYR A 1 305 ? 25.799  61.649  74.596  1.00 41.44 ? 308  TYR A C   1 
ATOM   2453  O  O   . TYR A 1 305 ? 25.575  60.447  74.467  1.00 41.53 ? 308  TYR A O   1 
ATOM   2454  C  CB  . TYR A 1 305 ? 27.731  61.393  73.022  1.00 41.98 ? 308  TYR A CB  1 
ATOM   2455  C  CG  . TYR A 1 305 ? 29.054  61.937  72.538  1.00 42.14 ? 308  TYR A CG  1 
ATOM   2456  C  CD1 . TYR A 1 305 ? 29.106  62.858  71.497  1.00 42.15 ? 308  TYR A CD1 1 
ATOM   2457  C  CD2 . TYR A 1 305 ? 30.251  61.568  73.156  1.00 42.21 ? 308  TYR A CD2 1 
ATOM   2458  C  CE1 . TYR A 1 305 ? 30.312  63.404  71.085  1.00 42.43 ? 308  TYR A CE1 1 
ATOM   2459  C  CE2 . TYR A 1 305 ? 31.467  62.108  72.751  1.00 42.34 ? 308  TYR A CE2 1 
ATOM   2460  C  CZ  . TYR A 1 305 ? 31.489  63.026  71.715  1.00 42.57 ? 308  TYR A CZ  1 
ATOM   2461  O  OH  . TYR A 1 305 ? 32.685  63.580  71.307  1.00 42.95 ? 308  TYR A OH  1 
ATOM   2462  N  N   . PRO A 1 306 ? 24.919  62.480  75.168  1.00 41.11 ? 309  PRO A N   1 
ATOM   2463  C  CA  . PRO A 1 306 ? 23.613  62.097  75.714  1.00 40.72 ? 309  PRO A CA  1 
ATOM   2464  C  C   . PRO A 1 306 ? 22.677  61.416  74.720  1.00 40.30 ? 309  PRO A C   1 
ATOM   2465  O  O   . PRO A 1 306 ? 22.716  61.696  73.523  1.00 40.17 ? 309  PRO A O   1 
ATOM   2466  C  CB  . PRO A 1 306 ? 23.033  63.439  76.164  1.00 40.86 ? 309  PRO A CB  1 
ATOM   2467  C  CG  . PRO A 1 306 ? 24.254  64.244  76.500  1.00 41.02 ? 309  PRO A CG  1 
ATOM   2468  C  CD  . PRO A 1 306 ? 25.148  63.925  75.339  1.00 41.10 ? 309  PRO A CD  1 
ATOM   2469  N  N   . LEU A 1 307 ? 21.848  60.508  75.226  1.00 39.90 ? 310  LEU A N   1 
ATOM   2470  C  CA  . LEU A 1 307 ? 20.875  59.822  74.395  1.00 39.45 ? 310  LEU A CA  1 
ATOM   2471  C  C   . LEU A 1 307 ? 19.778  60.814  74.072  1.00 39.19 ? 310  LEU A C   1 
ATOM   2472  O  O   . LEU A 1 307 ? 19.231  61.452  74.968  1.00 39.43 ? 310  LEU A O   1 
ATOM   2473  C  CB  . LEU A 1 307 ? 20.262  58.641  75.137  1.00 39.24 ? 310  LEU A CB  1 
ATOM   2474  C  CG  . LEU A 1 307 ? 21.184  57.465  75.422  1.00 39.38 ? 310  LEU A CG  1 
ATOM   2475  C  CD1 . LEU A 1 307 ? 20.414  56.382  76.170  1.00 39.32 ? 310  LEU A CD1 1 
ATOM   2476  C  CD2 . LEU A 1 307 ? 21.744  56.926  74.117  1.00 39.27 ? 310  LEU A CD2 1 
ATOM   2477  N  N   . ILE A 1 308 ? 19.490  60.969  72.787  1.00 38.95 ? 311  ILE A N   1 
ATOM   2478  C  CA  . ILE A 1 308 ? 18.451  61.878  72.320  1.00 38.54 ? 311  ILE A CA  1 
ATOM   2479  C  C   . ILE A 1 308 ? 17.300  61.000  71.845  1.00 38.43 ? 311  ILE A C   1 
ATOM   2480  O  O   . ILE A 1 308 ? 17.468  60.218  70.908  1.00 38.62 ? 311  ILE A O   1 
ATOM   2481  C  CB  . ILE A 1 308 ? 18.959  62.716  71.127  1.00 38.33 ? 311  ILE A CB  1 
ATOM   2482  C  CG1 . ILE A 1 308 ? 20.197  63.511  71.538  1.00 38.06 ? 311  ILE A CG1 1 
ATOM   2483  C  CG2 . ILE A 1 308 ? 17.863  63.636  70.607  1.00 38.24 ? 311  ILE A CG2 1 
ATOM   2484  C  CD1 . ILE A 1 308 ? 20.889  64.192  70.390  1.00 37.82 ? 311  ILE A CD1 1 
ATOM   2485  N  N   . PRO A 1 309 ? 16.125  61.094  72.501  1.00 38.20 ? 312  PRO A N   1 
ATOM   2486  C  CA  . PRO A 1 309 ? 14.942  60.300  72.140  1.00 37.88 ? 312  PRO A CA  1 
ATOM   2487  C  C   . PRO A 1 309 ? 14.400  60.608  70.749  1.00 37.67 ? 312  PRO A C   1 
ATOM   2488  O  O   . PRO A 1 309 ? 14.390  61.759  70.317  1.00 37.56 ? 312  PRO A O   1 
ATOM   2489  C  CB  . PRO A 1 309 ? 13.945  60.660  73.236  1.00 37.99 ? 312  PRO A CB  1 
ATOM   2490  C  CG  . PRO A 1 309 ? 14.344  62.055  73.607  1.00 38.15 ? 312  PRO A CG  1 
ATOM   2491  C  CD  . PRO A 1 309 ? 15.840  61.953  73.663  1.00 38.13 ? 312  PRO A CD  1 
ATOM   2492  N  N   . VAL A 1 310 ? 13.950  59.568  70.051  1.00 37.49 ? 313  VAL A N   1 
ATOM   2493  C  CA  . VAL A 1 310 ? 13.429  59.718  68.699  1.00 37.24 ? 313  VAL A CA  1 
ATOM   2494  C  C   . VAL A 1 310 ? 12.081  59.040  68.499  1.00 37.22 ? 313  VAL A C   1 
ATOM   2495  O  O   . VAL A 1 310 ? 11.179  59.609  67.887  1.00 37.14 ? 313  VAL A O   1 
ATOM   2496  C  CB  . VAL A 1 310 ? 14.408  59.140  67.667  1.00 37.15 ? 313  VAL A CB  1 
ATOM   2497  C  CG1 . VAL A 1 310 ? 13.836  59.271  66.271  1.00 36.84 ? 313  VAL A CG1 1 
ATOM   2498  C  CG2 . VAL A 1 310 ? 15.756  59.832  67.769  1.00 36.90 ? 313  VAL A CG2 1 
ATOM   2499  N  N   . GLY A 1 311 ? 11.945  57.816  68.993  1.00 37.33 ? 314  GLY A N   1 
ATOM   2500  C  CA  . GLY A 1 311 ? 10.686  57.124  68.819  1.00 37.50 ? 314  GLY A CA  1 
ATOM   2501  C  C   . GLY A 1 311 ? 10.567  55.811  69.549  1.00 37.65 ? 314  GLY A C   1 
ATOM   2502  O  O   . GLY A 1 311 ? 11.283  55.570  70.519  1.00 37.63 ? 314  GLY A O   1 
ATOM   2503  N  N   . LYS A 1 312 ? 9.658   54.969  69.060  1.00 37.97 ? 315  LYS A N   1 
ATOM   2504  C  CA  . LYS A 1 312 ? 9.369   53.659  69.634  1.00 38.19 ? 315  LYS A CA  1 
ATOM   2505  C  C   . LYS A 1 312 ? 9.312   52.557  68.588  1.00 38.07 ? 315  LYS A C   1 
ATOM   2506  O  O   . LYS A 1 312 ? 8.834   52.766  67.474  1.00 37.84 ? 315  LYS A O   1 
ATOM   2507  C  CB  . LYS A 1 312 ? 7.995   53.671  70.310  1.00 38.88 ? 315  LYS A CB  1 
ATOM   2508  C  CG  . LYS A 1 312 ? 7.873   54.536  71.538  1.00 40.30 ? 315  LYS A CG  1 
ATOM   2509  C  CD  . LYS A 1 312 ? 8.435   53.862  72.792  1.00 41.11 ? 315  LYS A CD  1 
ATOM   2510  C  CE  . LYS A 1 312 ? 8.337   54.797  73.997  1.00 41.57 ? 315  LYS A CE  1 
ATOM   2511  N  NZ  . LYS A 1 312 ? 8.836   54.130  75.227  1.00 42.12 ? 315  LYS A NZ  1 
ATOM   2512  N  N   . LEU A 1 313 ? 9.765   51.370  68.982  1.00 37.79 ? 316  LEU A N   1 
ATOM   2513  C  CA  . LEU A 1 313 ? 9.709   50.190  68.132  1.00 37.53 ? 316  LEU A CA  1 
ATOM   2514  C  C   . LEU A 1 313 ? 8.700   49.284  68.826  1.00 37.63 ? 316  LEU A C   1 
ATOM   2515  O  O   . LEU A 1 313 ? 8.845   48.993  70.014  1.00 37.53 ? 316  LEU A O   1 
ATOM   2516  C  CB  . LEU A 1 313 ? 11.060  49.488  68.071  1.00 37.20 ? 316  LEU A CB  1 
ATOM   2517  C  CG  . LEU A 1 313 ? 12.214  50.171  67.349  1.00 36.90 ? 316  LEU A CG  1 
ATOM   2518  C  CD1 . LEU A 1 313 ? 13.450  49.308  67.510  1.00 36.64 ? 316  LEU A CD1 1 
ATOM   2519  C  CD2 . LEU A 1 313 ? 11.884  50.379  65.876  1.00 36.68 ? 316  LEU A CD2 1 
ATOM   2520  N  N   . VAL A 1 314 ? 7.662   48.875  68.102  1.00 37.68 ? 317  VAL A N   1 
ATOM   2521  C  CA  . VAL A 1 314 ? 6.621   48.013  68.664  1.00 37.72 ? 317  VAL A CA  1 
ATOM   2522  C  C   . VAL A 1 314 ? 6.393   46.744  67.833  1.00 37.97 ? 317  VAL A C   1 
ATOM   2523  O  O   . VAL A 1 314 ? 6.139   46.823  66.629  1.00 38.03 ? 317  VAL A O   1 
ATOM   2524  C  CB  . VAL A 1 314 ? 5.269   48.770  68.779  1.00 37.63 ? 317  VAL A CB  1 
ATOM   2525  C  CG1 . VAL A 1 314 ? 4.181   47.847  69.317  1.00 37.29 ? 317  VAL A CG1 1 
ATOM   2526  C  CG2 . VAL A 1 314 ? 5.413   49.994  69.669  1.00 37.34 ? 317  VAL A CG2 1 
ATOM   2527  N  N   . LEU A 1 315 ? 6.481   45.583  68.484  1.00 37.95 ? 318  LEU A N   1 
ATOM   2528  C  CA  . LEU A 1 315 ? 6.264   44.292  67.834  1.00 37.97 ? 318  LEU A CA  1 
ATOM   2529  C  C   . LEU A 1 315 ? 4.892   43.762  68.237  1.00 38.14 ? 318  LEU A C   1 
ATOM   2530  O  O   . LEU A 1 315 ? 4.706   43.297  69.362  1.00 38.14 ? 318  LEU A O   1 
ATOM   2531  C  CB  . LEU A 1 315 ? 7.357   43.313  68.250  1.00 37.71 ? 318  LEU A CB  1 
ATOM   2532  C  CG  . LEU A 1 315 ? 8.530   43.167  67.276  1.00 37.96 ? 318  LEU A CG  1 
ATOM   2533  C  CD1 . LEU A 1 315 ? 8.626   44.350  66.337  1.00 37.94 ? 318  LEU A CD1 1 
ATOM   2534  C  CD2 . LEU A 1 315 ? 9.827   42.967  68.035  1.00 37.92 ? 318  LEU A CD2 1 
ATOM   2535  N  N   . ASN A 1 316 ? 3.940   43.804  67.310  1.00 38.20 ? 319  ASN A N   1 
ATOM   2536  C  CA  . ASN A 1 316 ? 2.582   43.367  67.615  1.00 38.42 ? 319  ASN A CA  1 
ATOM   2537  C  C   . ASN A 1 316 ? 1.975   42.343  66.673  1.00 38.51 ? 319  ASN A C   1 
ATOM   2538  O  O   . ASN A 1 316 ? 0.762   42.148  66.685  1.00 38.60 ? 319  ASN A O   1 
ATOM   2539  C  CB  . ASN A 1 316 ? 1.650   44.579  67.684  1.00 38.46 ? 319  ASN A CB  1 
ATOM   2540  C  CG  . ASN A 1 316 ? 1.540   45.310  66.362  1.00 38.54 ? 319  ASN A CG  1 
ATOM   2541  O  OD1 . ASN A 1 316 ? 2.076   44.871  65.345  1.00 38.58 ? 319  ASN A OD1 1 
ATOM   2542  N  ND2 . ASN A 1 316 ? 0.840   46.436  66.370  1.00 38.77 ? 319  ASN A ND2 1 
ATOM   2543  N  N   . ARG A 1 317 ? 2.798   41.701  65.851  1.00 38.59 ? 320  ARG A N   1 
ATOM   2544  C  CA  . ARG A 1 317 ? 2.289   40.706  64.923  1.00 38.56 ? 320  ARG A CA  1 
ATOM   2545  C  C   . ARG A 1 317 ? 3.283   39.579  64.738  1.00 38.48 ? 320  ARG A C   1 
ATOM   2546  O  O   . ARG A 1 317 ? 4.463   39.806  64.467  1.00 38.46 ? 320  ARG A O   1 
ATOM   2547  C  CB  . ARG A 1 317 ? 1.985   41.344  63.570  1.00 38.94 ? 320  ARG A CB  1 
ATOM   2548  C  CG  . ARG A 1 317 ? 1.161   40.467  62.646  1.00 39.58 ? 320  ARG A CG  1 
ATOM   2549  C  CD  . ARG A 1 317 ? 0.991   41.108  61.278  1.00 40.31 ? 320  ARG A CD  1 
ATOM   2550  N  NE  . ARG A 1 317 ? 2.196   40.982  60.456  1.00 41.10 ? 320  ARG A NE  1 
ATOM   2551  C  CZ  . ARG A 1 317 ? 2.799   41.990  59.829  1.00 41.36 ? 320  ARG A CZ  1 
ATOM   2552  N  NH1 . ARG A 1 317 ? 2.328   43.228  59.926  1.00 41.49 ? 320  ARG A NH1 1 
ATOM   2553  N  NH2 . ARG A 1 317 ? 3.856   41.752  59.067  1.00 41.44 ? 320  ARG A NH2 1 
ATOM   2554  N  N   . ASN A 1 318 ? 2.802   38.360  64.931  1.00 38.24 ? 321  ASN A N   1 
ATOM   2555  C  CA  . ASN A 1 318 ? 3.620   37.169  64.771  1.00 38.02 ? 321  ASN A CA  1 
ATOM   2556  C  C   . ASN A 1 318 ? 3.627   36.747  63.310  1.00 37.92 ? 321  ASN A C   1 
ATOM   2557  O  O   . ASN A 1 318 ? 2.815   37.218  62.515  1.00 38.05 ? 321  ASN A O   1 
ATOM   2558  C  CB  . ASN A 1 318 ? 3.038   36.019  65.590  1.00 37.84 ? 321  ASN A CB  1 
ATOM   2559  C  CG  . ASN A 1 318 ? 3.337   36.140  67.051  1.00 37.66 ? 321  ASN A CG  1 
ATOM   2560  O  OD1 . ASN A 1 318 ? 4.439   36.519  67.431  1.00 37.91 ? 321  ASN A OD1 1 
ATOM   2561  N  ND2 . ASN A 1 318 ? 2.367   35.799  67.887  1.00 37.61 ? 321  ASN A ND2 1 
ATOM   2562  N  N   . PRO A 1 319 ? 4.575   35.877  62.928  1.00 37.78 ? 322  PRO A N   1 
ATOM   2563  C  CA  . PRO A 1 319 ? 4.646   35.404  61.545  1.00 37.67 ? 322  PRO A CA  1 
ATOM   2564  C  C   . PRO A 1 319 ? 3.476   34.445  61.315  1.00 37.54 ? 322  PRO A C   1 
ATOM   2565  O  O   . PRO A 1 319 ? 2.988   33.841  62.267  1.00 37.50 ? 322  PRO A O   1 
ATOM   2566  C  CB  . PRO A 1 319 ? 5.960   34.618  61.531  1.00 37.67 ? 322  PRO A CB  1 
ATOM   2567  C  CG  . PRO A 1 319 ? 6.765   35.258  62.593  1.00 37.68 ? 322  PRO A CG  1 
ATOM   2568  C  CD  . PRO A 1 319 ? 5.760   35.440  63.684  1.00 37.76 ? 322  PRO A CD  1 
ATOM   2569  N  N   . VAL A 1 320 ? 2.977   34.355  60.085  1.00 37.41 ? 323  VAL A N   1 
ATOM   2570  C  CA  . VAL A 1 320 ? 1.898   33.414  59.793  1.00 37.25 ? 323  VAL A CA  1 
ATOM   2571  C  C   . VAL A 1 320 ? 2.574   32.146  59.274  1.00 37.20 ? 323  VAL A C   1 
ATOM   2572  O  O   . VAL A 1 320 ? 2.098   31.037  59.498  1.00 37.24 ? 323  VAL A O   1 
ATOM   2573  C  CB  . VAL A 1 320 ? 0.902   33.952  58.757  1.00 37.22 ? 323  VAL A CB  1 
ATOM   2574  C  CG1 . VAL A 1 320 ? -0.177  32.915  58.494  1.00 37.03 ? 323  VAL A CG1 1 
ATOM   2575  C  CG2 . VAL A 1 320 ? 0.264   35.230  59.267  1.00 37.04 ? 323  VAL A CG2 1 
ATOM   2576  N  N   . ASN A 1 321 ? 3.695   32.327  58.582  1.00 36.96 ? 324  ASN A N   1 
ATOM   2577  C  CA  . ASN A 1 321 ? 4.489   31.216  58.072  1.00 36.58 ? 324  ASN A CA  1 
ATOM   2578  C  C   . ASN A 1 321 ? 5.935   31.583  58.384  1.00 36.46 ? 324  ASN A C   1 
ATOM   2579  O  O   . ASN A 1 321 ? 6.440   32.612  57.926  1.00 36.38 ? 324  ASN A O   1 
ATOM   2580  C  CB  . ASN A 1 321 ? 4.301   31.030  56.570  1.00 36.49 ? 324  ASN A CB  1 
ATOM   2581  C  CG  . ASN A 1 321 ? 4.989   29.789  56.058  1.00 36.40 ? 324  ASN A CG  1 
ATOM   2582  O  OD1 . ASN A 1 321 ? 6.165   29.820  55.701  1.00 36.53 ? 324  ASN A OD1 1 
ATOM   2583  N  ND2 . ASN A 1 321 ? 4.269   28.676  56.049  1.00 36.51 ? 324  ASN A ND2 1 
ATOM   2584  N  N   . TYR A 1 322 ? 6.587   30.755  59.192  1.00 36.17 ? 325  TYR A N   1 
ATOM   2585  C  CA  . TYR A 1 322 ? 7.956   31.012  59.603  1.00 35.94 ? 325  TYR A CA  1 
ATOM   2586  C  C   . TYR A 1 322 ? 8.962   31.027  58.456  1.00 36.01 ? 325  TYR A C   1 
ATOM   2587  O  O   . TYR A 1 322 ? 9.762   31.959  58.341  1.00 35.90 ? 325  TYR A O   1 
ATOM   2588  C  CB  . TYR A 1 322 ? 8.390   30.006  60.676  1.00 35.67 ? 325  TYR A CB  1 
ATOM   2589  C  CG  . TYR A 1 322 ? 9.762   30.288  61.249  1.00 35.45 ? 325  TYR A CG  1 
ATOM   2590  C  CD1 . TYR A 1 322 ? 9.921   31.119  62.361  1.00 35.30 ? 325  TYR A CD1 1 
ATOM   2591  C  CD2 . TYR A 1 322 ? 10.907  29.747  60.664  1.00 35.29 ? 325  TYR A CD2 1 
ATOM   2592  C  CE1 . TYR A 1 322 ? 11.190  31.406  62.875  1.00 35.23 ? 325  TYR A CE1 1 
ATOM   2593  C  CE2 . TYR A 1 322 ? 12.172  30.029  61.168  1.00 35.27 ? 325  TYR A CE2 1 
ATOM   2594  C  CZ  . TYR A 1 322 ? 12.308  30.856  62.269  1.00 35.26 ? 325  TYR A CZ  1 
ATOM   2595  O  OH  . TYR A 1 322 ? 13.564  31.131  62.750  1.00 35.08 ? 325  TYR A OH  1 
ATOM   2596  N  N   . PHE A 1 323 ? 8.932   30.001  57.614  1.00 35.75 ? 326  PHE A N   1 
ATOM   2597  C  CA  . PHE A 1 323 ? 9.875   29.928  56.513  1.00 35.73 ? 326  PHE A CA  1 
ATOM   2598  C  C   . PHE A 1 323 ? 9.799   31.149  55.622  1.00 35.82 ? 326  PHE A C   1 
ATOM   2599  O  O   . PHE A 1 323 ? 10.816  31.754  55.292  1.00 35.81 ? 326  PHE A O   1 
ATOM   2600  C  CB  . PHE A 1 323 ? 9.630   28.678  55.676  1.00 35.53 ? 326  PHE A CB  1 
ATOM   2601  C  CG  . PHE A 1 323 ? 10.629  28.488  54.573  1.00 35.26 ? 326  PHE A CG  1 
ATOM   2602  C  CD1 . PHE A 1 323 ? 10.339  28.885  53.274  1.00 35.26 ? 326  PHE A CD1 1 
ATOM   2603  C  CD2 . PHE A 1 323 ? 11.874  27.937  54.839  1.00 35.05 ? 326  PHE A CD2 1 
ATOM   2604  C  CE1 . PHE A 1 323 ? 11.281  28.738  52.258  1.00 35.12 ? 326  PHE A CE1 1 
ATOM   2605  C  CE2 . PHE A 1 323 ? 12.816  27.785  53.833  1.00 34.90 ? 326  PHE A CE2 1 
ATOM   2606  C  CZ  . PHE A 1 323 ? 12.520  28.186  52.542  1.00 34.98 ? 326  PHE A CZ  1 
ATOM   2607  N  N   . ALA A 1 324 ? 8.579   31.524  55.260  1.00 36.07 ? 327  ALA A N   1 
ATOM   2608  C  CA  . ALA A 1 324 ? 8.341   32.652  54.370  1.00 36.27 ? 327  ALA A CA  1 
ATOM   2609  C  C   . ALA A 1 324 ? 8.675   34.035  54.903  1.00 36.46 ? 327  ALA A C   1 
ATOM   2610  O  O   . ALA A 1 324 ? 9.244   34.855  54.186  1.00 36.45 ? 327  ALA A O   1 
ATOM   2611  C  CB  . ALA A 1 324 ? 6.899   32.630  53.886  1.00 36.17 ? 327  ALA A CB  1 
ATOM   2612  N  N   . GLU A 1 325 ? 8.309   34.306  56.147  1.00 36.53 ? 328  GLU A N   1 
ATOM   2613  C  CA  . GLU A 1 325 ? 8.538   35.620  56.715  1.00 36.62 ? 328  GLU A CA  1 
ATOM   2614  C  C   . GLU A 1 325 ? 9.775   35.763  57.564  1.00 36.64 ? 328  GLU A C   1 
ATOM   2615  O  O   . GLU A 1 325 ? 10.252  36.878  57.755  1.00 36.78 ? 328  GLU A O   1 
ATOM   2616  C  CB  . GLU A 1 325 ? 7.323   36.044  57.534  1.00 37.15 ? 328  GLU A CB  1 
ATOM   2617  C  CG  . GLU A 1 325 ? 6.052   36.146  56.728  1.00 37.97 ? 328  GLU A CG  1 
ATOM   2618  C  CD  . GLU A 1 325 ? 4.827   36.309  57.602  1.00 38.46 ? 328  GLU A CD  1 
ATOM   2619  O  OE1 . GLU A 1 325 ? 4.726   37.339  58.299  1.00 38.79 ? 328  GLU A OE1 1 
ATOM   2620  O  OE2 . GLU A 1 325 ? 3.963   35.408  57.592  1.00 38.78 ? 328  GLU A OE2 1 
ATOM   2621  N  N   . VAL A 1 326 ? 10.293  34.659  58.090  1.00 36.23 ? 329  VAL A N   1 
ATOM   2622  C  CA  . VAL A 1 326 ? 11.464  34.743  58.948  1.00 35.73 ? 329  VAL A CA  1 
ATOM   2623  C  C   . VAL A 1 326 ? 12.701  34.124  58.354  1.00 35.72 ? 329  VAL A C   1 
ATOM   2624  O  O   . VAL A 1 326 ? 13.713  34.802  58.182  1.00 35.64 ? 329  VAL A O   1 
ATOM   2625  C  CB  . VAL A 1 326 ? 11.191  34.121  60.313  1.00 35.73 ? 329  VAL A CB  1 
ATOM   2626  C  CG1 . VAL A 1 326 ? 12.396  34.274  61.215  1.00 35.58 ? 329  VAL A CG1 1 
ATOM   2627  C  CG2 . VAL A 1 326 ? 9.985   34.784  60.939  1.00 35.73 ? 329  VAL A CG2 1 
ATOM   2628  N  N   . GLU A 1 327 ? 12.637  32.836  58.045  1.00 35.36 ? 330  GLU A N   1 
ATOM   2629  C  CA  . GLU A 1 327 ? 13.790  32.170  57.477  1.00 35.13 ? 330  GLU A CA  1 
ATOM   2630  C  C   . GLU A 1 327 ? 14.272  32.862  56.209  1.00 35.12 ? 330  GLU A C   1 
ATOM   2631  O  O   . GLU A 1 327 ? 15.477  32.973  55.996  1.00 35.21 ? 330  GLU A O   1 
ATOM   2632  C  CB  . GLU A 1 327 ? 13.486  30.701  57.202  1.00 35.27 ? 330  GLU A CB  1 
ATOM   2633  C  CG  . GLU A 1 327 ? 14.707  29.883  56.811  1.00 35.61 ? 330  GLU A CG  1 
ATOM   2634  C  CD  . GLU A 1 327 ? 15.819  29.927  57.851  1.00 35.84 ? 330  GLU A CD  1 
ATOM   2635  O  OE1 . GLU A 1 327 ? 16.998  29.768  57.476  1.00 36.15 ? 330  GLU A OE1 1 
ATOM   2636  O  OE2 . GLU A 1 327 ? 15.532  30.106  59.050  1.00 35.95 ? 330  GLU A OE2 1 
ATOM   2637  N  N   . GLN A 1 328 ? 13.343  33.383  55.408  1.00 34.72 ? 331  GLN A N   1 
ATOM   2638  C  CA  . GLN A 1 328 ? 13.689  34.064  54.159  1.00 34.43 ? 331  GLN A CA  1 
ATOM   2639  C  C   . GLN A 1 328 ? 13.899  35.570  54.241  1.00 34.31 ? 331  GLN A C   1 
ATOM   2640  O  O   . GLN A 1 328 ? 14.147  36.202  53.214  1.00 34.36 ? 331  GLN A O   1 
ATOM   2641  C  CB  . GLN A 1 328 ? 12.639  33.801  53.075  1.00 34.50 ? 331  GLN A CB  1 
ATOM   2642  C  CG  . GLN A 1 328 ? 12.564  32.368  52.587  1.00 34.63 ? 331  GLN A CG  1 
ATOM   2643  C  CD  . GLN A 1 328 ? 11.746  32.222  51.316  1.00 34.75 ? 331  GLN A CD  1 
ATOM   2644  O  OE1 . GLN A 1 328 ? 12.171  31.559  50.375  1.00 34.89 ? 331  GLN A OE1 1 
ATOM   2645  N  NE2 . GLN A 1 328 ? 10.572  32.839  51.281  1.00 34.63 ? 331  GLN A NE2 1 
ATOM   2646  N  N   . ILE A 1 329 ? 13.774  36.169  55.422  1.00 33.97 ? 332  ILE A N   1 
ATOM   2647  C  CA  . ILE A 1 329 ? 13.959  37.614  55.512  1.00 33.78 ? 332  ILE A CA  1 
ATOM   2648  C  C   . ILE A 1 329 ? 15.430  37.981  55.338  1.00 34.02 ? 332  ILE A C   1 
ATOM   2649  O  O   . ILE A 1 329 ? 16.317  37.232  55.747  1.00 33.91 ? 332  ILE A O   1 
ATOM   2650  C  CB  . ILE A 1 329 ? 13.364  38.214  56.811  1.00 33.37 ? 332  ILE A CB  1 
ATOM   2651  C  CG1 . ILE A 1 329 ? 13.259  39.732  56.674  1.00 32.91 ? 332  ILE A CG1 1 
ATOM   2652  C  CG2 . ILE A 1 329 ? 14.214  37.852  58.010  1.00 33.24 ? 332  ILE A CG2 1 
ATOM   2653  C  CD1 . ILE A 1 329 ? 12.441  40.375  57.745  1.00 32.60 ? 332  ILE A CD1 1 
ATOM   2654  N  N   . ALA A 1 330 ? 15.679  39.125  54.711  1.00 34.12 ? 333  ALA A N   1 
ATOM   2655  C  CA  . ALA A 1 330 ? 17.036  39.585  54.440  1.00 34.20 ? 333  ALA A CA  1 
ATOM   2656  C  C   . ALA A 1 330 ? 17.255  41.061  54.751  1.00 34.31 ? 333  ALA A C   1 
ATOM   2657  O  O   . ALA A 1 330 ? 16.593  41.934  54.190  1.00 34.41 ? 333  ALA A O   1 
ATOM   2658  C  CB  . ALA A 1 330 ? 17.377  39.312  52.990  1.00 34.18 ? 333  ALA A CB  1 
ATOM   2659  N  N   . PHE A 1 331 ? 18.207  41.336  55.633  1.00 34.39 ? 334  PHE A N   1 
ATOM   2660  C  CA  . PHE A 1 331 ? 18.529  42.703  56.019  1.00 34.61 ? 334  PHE A CA  1 
ATOM   2661  C  C   . PHE A 1 331 ? 19.887  43.087  55.432  1.00 34.89 ? 334  PHE A C   1 
ATOM   2662  O  O   . PHE A 1 331 ? 20.865  42.363  55.622  1.00 35.05 ? 334  PHE A O   1 
ATOM   2663  C  CB  . PHE A 1 331 ? 18.609  42.830  57.546  1.00 34.33 ? 334  PHE A CB  1 
ATOM   2664  C  CG  . PHE A 1 331 ? 17.390  42.322  58.286  1.00 34.16 ? 334  PHE A CG  1 
ATOM   2665  C  CD1 . PHE A 1 331 ? 16.367  43.188  58.653  1.00 33.87 ? 334  PHE A CD1 1 
ATOM   2666  C  CD2 . PHE A 1 331 ? 17.299  40.988  58.673  1.00 33.97 ? 334  PHE A CD2 1 
ATOM   2667  C  CE1 . PHE A 1 331 ? 15.281  42.734  59.397  1.00 33.70 ? 334  PHE A CE1 1 
ATOM   2668  C  CE2 . PHE A 1 331 ? 16.212  40.534  59.418  1.00 33.78 ? 334  PHE A CE2 1 
ATOM   2669  C  CZ  . PHE A 1 331 ? 15.208  41.409  59.779  1.00 33.62 ? 334  PHE A CZ  1 
ATOM   2670  N  N   . ASP A 1 332 ? 19.943  44.210  54.717  1.00 35.15 ? 335  ASP A N   1 
ATOM   2671  C  CA  . ASP A 1 332 ? 21.191  44.699  54.127  1.00 35.19 ? 335  ASP A CA  1 
ATOM   2672  C  C   . ASP A 1 332 ? 21.524  46.050  54.724  1.00 35.22 ? 335  ASP A C   1 
ATOM   2673  O  O   . ASP A 1 332 ? 20.781  47.007  54.527  1.00 35.35 ? 335  ASP A O   1 
ATOM   2674  C  CB  . ASP A 1 332 ? 21.052  44.903  52.622  1.00 35.36 ? 335  ASP A CB  1 
ATOM   2675  C  CG  . ASP A 1 332 ? 20.712  43.639  51.890  1.00 35.88 ? 335  ASP A CG  1 
ATOM   2676  O  OD1 . ASP A 1 332 ? 19.793  43.674  51.040  1.00 36.12 ? 335  ASP A OD1 1 
ATOM   2677  O  OD2 . ASP A 1 332 ? 21.366  42.608  52.155  1.00 36.30 ? 335  ASP A OD2 1 
ATOM   2678  N  N   . PRO A 1 333 ? 22.644  46.154  55.456  1.00 35.23 ? 336  PRO A N   1 
ATOM   2679  C  CA  . PRO A 1 333 ? 23.072  47.409  56.076  1.00 35.23 ? 336  PRO A CA  1 
ATOM   2680  C  C   . PRO A 1 333 ? 23.195  48.531  55.050  1.00 35.34 ? 336  PRO A C   1 
ATOM   2681  O  O   . PRO A 1 333 ? 22.989  49.704  55.375  1.00 35.32 ? 336  PRO A O   1 
ATOM   2682  C  CB  . PRO A 1 333 ? 24.429  47.042  56.659  1.00 35.24 ? 336  PRO A CB  1 
ATOM   2683  C  CG  . PRO A 1 333 ? 24.213  45.645  57.086  1.00 35.23 ? 336  PRO A CG  1 
ATOM   2684  C  CD  . PRO A 1 333 ? 23.516  45.052  55.883  1.00 35.32 ? 336  PRO A CD  1 
ATOM   2685  N  N   . SER A 1 334 ? 23.514  48.161  53.812  1.00 35.43 ? 337  SER A N   1 
ATOM   2686  C  CA  . SER A 1 334 ? 23.651  49.125  52.726  1.00 35.53 ? 337  SER A CA  1 
ATOM   2687  C  C   . SER A 1 334 ? 22.307  49.720  52.299  1.00 35.63 ? 337  SER A C   1 
ATOM   2688  O  O   . SER A 1 334 ? 22.260  50.675  51.517  1.00 35.54 ? 337  SER A O   1 
ATOM   2689  C  CB  . SER A 1 334 ? 24.357  48.479  51.537  1.00 35.50 ? 337  SER A CB  1 
ATOM   2690  O  OG  . SER A 1 334 ? 23.737  47.259  51.178  1.00 35.74 ? 337  SER A OG  1 
ATOM   2691  N  N   . ASN A 1 335 ? 21.214  49.138  52.790  1.00 35.79 ? 338  ASN A N   1 
ATOM   2692  C  CA  . ASN A 1 335 ? 19.883  49.651  52.488  1.00 35.93 ? 338  ASN A CA  1 
ATOM   2693  C  C   . ASN A 1 335 ? 19.638  50.865  53.362  1.00 36.07 ? 338  ASN A C   1 
ATOM   2694  O  O   . ASN A 1 335 ? 19.238  50.727  54.516  1.00 36.08 ? 338  ASN A O   1 
ATOM   2695  C  CB  . ASN A 1 335 ? 18.811  48.607  52.774  1.00 35.72 ? 338  ASN A CB  1 
ATOM   2696  C  CG  . ASN A 1 335 ? 18.706  47.565  51.689  1.00 35.78 ? 338  ASN A CG  1 
ATOM   2697  O  OD1 . ASN A 1 335 ? 18.039  46.545  51.868  1.00 36.12 ? 338  ASN A OD1 1 
ATOM   2698  N  ND2 . ASN A 1 335 ? 19.353  47.811  50.554  1.00 35.41 ? 338  ASN A ND2 1 
ATOM   2699  N  N   . MET A 1 336 ? 19.938  52.044  52.825  1.00 36.36 ? 339  MET A N   1 
ATOM   2700  C  CA  . MET A 1 336 ? 19.755  53.298  53.545  1.00 36.50 ? 339  MET A CA  1 
ATOM   2701  C  C   . MET A 1 336 ? 19.081  54.310  52.633  1.00 36.77 ? 339  MET A C   1 
ATOM   2702  O  O   . MET A 1 336 ? 19.467  54.470  51.473  1.00 37.13 ? 339  MET A O   1 
ATOM   2703  C  CB  . MET A 1 336 ? 21.101  53.856  54.021  1.00 36.54 ? 339  MET A CB  1 
ATOM   2704  C  CG  . MET A 1 336 ? 21.840  52.948  54.984  1.00 36.85 ? 339  MET A CG  1 
ATOM   2705  S  SD  . MET A 1 336 ? 23.431  53.580  55.516  1.00 37.23 ? 339  MET A SD  1 
ATOM   2706  C  CE  . MET A 1 336 ? 24.209  53.715  54.007  1.00 36.89 ? 339  MET A CE  1 
ATOM   2707  N  N   . PRO A 1 337 ? 18.029  54.978  53.130  1.00 36.79 ? 340  PRO A N   1 
ATOM   2708  C  CA  . PRO A 1 337 ? 17.311  55.977  52.340  1.00 36.41 ? 340  PRO A CA  1 
ATOM   2709  C  C   . PRO A 1 337 ? 18.010  57.321  52.502  1.00 36.49 ? 340  PRO A C   1 
ATOM   2710  O  O   . PRO A 1 337 ? 18.900  57.456  53.341  1.00 36.45 ? 340  PRO A O   1 
ATOM   2711  C  CB  . PRO A 1 337 ? 15.946  55.988  53.007  1.00 36.65 ? 340  PRO A CB  1 
ATOM   2712  C  CG  . PRO A 1 337 ? 16.304  55.832  54.445  1.00 36.61 ? 340  PRO A CG  1 
ATOM   2713  C  CD  . PRO A 1 337 ? 17.359  54.748  54.424  1.00 36.63 ? 340  PRO A CD  1 
ATOM   2714  N  N   . PRO A 1 338 ? 17.650  58.319  51.680  1.00 36.57 ? 341  PRO A N   1 
ATOM   2715  C  CA  . PRO A 1 338 ? 18.282  59.639  51.792  1.00 36.46 ? 341  PRO A CA  1 
ATOM   2716  C  C   . PRO A 1 338 ? 18.139  60.190  53.214  1.00 36.47 ? 341  PRO A C   1 
ATOM   2717  O  O   . PRO A 1 338 ? 17.065  60.112  53.813  1.00 36.57 ? 341  PRO A O   1 
ATOM   2718  C  CB  . PRO A 1 338 ? 17.495  60.476  50.784  1.00 36.63 ? 341  PRO A CB  1 
ATOM   2719  C  CG  . PRO A 1 338 ? 17.179  59.480  49.718  1.00 36.59 ? 341  PRO A CG  1 
ATOM   2720  C  CD  . PRO A 1 338 ? 16.747  58.268  50.517  1.00 36.60 ? 341  PRO A CD  1 
ATOM   2721  N  N   . GLY A 1 339 ? 19.240  60.694  53.763  1.00 36.40 ? 342  GLY A N   1 
ATOM   2722  C  CA  . GLY A 1 339 ? 19.225  61.239  55.107  1.00 36.21 ? 342  GLY A CA  1 
ATOM   2723  C  C   . GLY A 1 339 ? 19.999  60.391  56.096  1.00 36.23 ? 342  GLY A C   1 
ATOM   2724  O  O   . GLY A 1 339 ? 20.278  60.832  57.214  1.00 36.27 ? 342  GLY A O   1 
ATOM   2725  N  N   . ILE A 1 340 ? 20.326  59.164  55.694  1.00 36.14 ? 343  ILE A N   1 
ATOM   2726  C  CA  . ILE A 1 340 ? 21.074  58.233  56.532  1.00 36.15 ? 343  ILE A CA  1 
ATOM   2727  C  C   . ILE A 1 340 ? 22.179  57.620  55.686  1.00 36.21 ? 343  ILE A C   1 
ATOM   2728  O  O   . ILE A 1 340 ? 21.908  56.991  54.670  1.00 36.17 ? 343  ILE A O   1 
ATOM   2729  C  CB  . ILE A 1 340 ? 20.165  57.115  57.076  1.00 36.06 ? 343  ILE A CB  1 
ATOM   2730  C  CG1 . ILE A 1 340 ? 19.025  57.725  57.892  1.00 36.10 ? 343  ILE A CG1 1 
ATOM   2731  C  CG2 . ILE A 1 340 ? 20.967  56.152  57.933  1.00 35.76 ? 343  ILE A CG2 1 
ATOM   2732  C  CD1 . ILE A 1 340 ? 17.947  56.734  58.282  1.00 36.22 ? 343  ILE A CD1 1 
ATOM   2733  N  N   . GLU A 1 341 ? 23.426  57.818  56.100  1.00 36.42 ? 344  GLU A N   1 
ATOM   2734  C  CA  . GLU A 1 341 ? 24.567  57.301  55.359  1.00 36.60 ? 344  GLU A CA  1 
ATOM   2735  C  C   . GLU A 1 341 ? 25.559  56.545  56.237  1.00 36.72 ? 344  GLU A C   1 
ATOM   2736  O  O   . GLU A 1 341 ? 25.431  56.504  57.460  1.00 36.74 ? 344  GLU A O   1 
ATOM   2737  C  CB  . GLU A 1 341 ? 25.273  58.447  54.622  1.00 36.61 ? 344  GLU A CB  1 
ATOM   2738  C  CG  . GLU A 1 341 ? 24.411  59.110  53.551  1.00 36.96 ? 344  GLU A CG  1 
ATOM   2739  C  CD  . GLU A 1 341 ? 25.064  60.311  52.885  1.00 37.17 ? 344  GLU A CD  1 
ATOM   2740  O  OE1 . GLU A 1 341 ? 24.330  61.236  52.489  1.00 37.48 ? 344  GLU A OE1 1 
ATOM   2741  O  OE2 . GLU A 1 341 ? 26.302  60.344  52.737  1.00 37.53 ? 344  GLU A OE2 1 
ATOM   2742  N  N   . ALA A 1 342 ? 26.530  55.914  55.590  1.00 36.68 ? 345  ALA A N   1 
ATOM   2743  C  CA  . ALA A 1 342 ? 27.557  55.155  56.282  1.00 36.68 ? 345  ALA A CA  1 
ATOM   2744  C  C   . ALA A 1 342 ? 28.636  56.095  56.795  1.00 36.68 ? 345  ALA A C   1 
ATOM   2745  O  O   . ALA A 1 342 ? 28.628  57.287  56.495  1.00 37.00 ? 345  ALA A O   1 
ATOM   2746  C  CB  . ALA A 1 342 ? 28.180  54.148  55.322  1.00 36.64 ? 345  ALA A CB  1 
ATOM   2747  N  N   . SER A 1 343 ? 29.552  55.554  57.588  1.00 36.51 ? 346  SER A N   1 
ATOM   2748  C  CA  . SER A 1 343 ? 30.677  56.320  58.108  1.00 36.24 ? 346  SER A CA  1 
ATOM   2749  C  C   . SER A 1 343 ? 31.896  55.505  57.696  1.00 36.18 ? 346  SER A C   1 
ATOM   2750  O  O   . SER A 1 343 ? 31.750  54.380  57.213  1.00 36.21 ? 346  SER A O   1 
ATOM   2751  C  CB  . SER A 1 343 ? 30.611  56.417  59.629  1.00 35.97 ? 346  SER A CB  1 
ATOM   2752  O  OG  . SER A 1 343 ? 30.885  55.157  60.221  1.00 36.09 ? 346  SER A OG  1 
ATOM   2753  N  N   . PRO A 1 344 ? 33.108  56.069  57.824  1.00 36.13 ? 347  PRO A N   1 
ATOM   2754  C  CA  . PRO A 1 344 ? 34.279  55.281  57.429  1.00 36.11 ? 347  PRO A CA  1 
ATOM   2755  C  C   . PRO A 1 344 ? 34.647  54.097  58.329  1.00 36.15 ? 347  PRO A C   1 
ATOM   2756  O  O   . PRO A 1 344 ? 35.738  53.546  58.201  1.00 36.39 ? 347  PRO A O   1 
ATOM   2757  C  CB  . PRO A 1 344 ? 35.394  56.330  57.343  1.00 36.06 ? 347  PRO A CB  1 
ATOM   2758  C  CG  . PRO A 1 344 ? 34.928  57.406  58.240  1.00 36.13 ? 347  PRO A CG  1 
ATOM   2759  C  CD  . PRO A 1 344 ? 33.463  57.488  57.975  1.00 36.04 ? 347  PRO A CD  1 
ATOM   2760  N  N   . ASP A 1 345 ? 33.747  53.702  59.230  1.00 36.06 ? 348  ASP A N   1 
ATOM   2761  C  CA  . ASP A 1 345 ? 33.986  52.558  60.113  1.00 35.83 ? 348  ASP A CA  1 
ATOM   2762  C  C   . ASP A 1 345 ? 34.299  51.373  59.197  1.00 35.93 ? 348  ASP A C   1 
ATOM   2763  O  O   . ASP A 1 345 ? 33.447  50.945  58.420  1.00 36.15 ? 348  ASP A O   1 
ATOM   2764  C  CB  . ASP A 1 345 ? 32.720  52.275  60.938  1.00 35.69 ? 348  ASP A CB  1 
ATOM   2765  C  CG  . ASP A 1 345 ? 32.851  51.065  61.873  1.00 35.59 ? 348  ASP A CG  1 
ATOM   2766  O  OD1 . ASP A 1 345 ? 33.804  50.263  61.759  1.00 35.76 ? 348  ASP A OD1 1 
ATOM   2767  O  OD2 . ASP A 1 345 ? 31.967  50.906  62.738  1.00 35.56 ? 348  ASP A OD2 1 
ATOM   2768  N  N   . LYS A 1 346 ? 35.525  50.860  59.281  1.00 35.67 ? 349  LYS A N   1 
ATOM   2769  C  CA  . LYS A 1 346 ? 35.953  49.738  58.446  1.00 35.41 ? 349  LYS A CA  1 
ATOM   2770  C  C   . LYS A 1 346 ? 35.026  48.527  58.486  1.00 35.22 ? 349  LYS A C   1 
ATOM   2771  O  O   . LYS A 1 346 ? 34.837  47.868  57.471  1.00 35.14 ? 349  LYS A O   1 
ATOM   2772  C  CB  . LYS A 1 346 ? 37.372  49.300  58.817  1.00 35.39 ? 349  LYS A CB  1 
ATOM   2773  C  CG  . LYS A 1 346 ? 38.450  50.326  58.523  1.00 35.21 ? 349  LYS A CG  1 
ATOM   2774  C  CD  . LYS A 1 346 ? 39.834  49.746  58.766  1.00 35.11 ? 349  LYS A CD  1 
ATOM   2775  C  CE  . LYS A 1 346 ? 40.894  50.835  58.695  1.00 35.26 ? 349  LYS A CE  1 
ATOM   2776  N  NZ  . LYS A 1 346 ? 42.287  50.319  58.822  1.00 35.19 ? 349  LYS A NZ  1 
ATOM   2777  N  N   . MET A 1 347 ? 34.478  48.217  59.659  1.00 35.04 ? 350  MET A N   1 
ATOM   2778  C  CA  . MET A 1 347 ? 33.577  47.077  59.822  1.00 34.67 ? 350  MET A CA  1 
ATOM   2779  C  C   . MET A 1 347 ? 32.291  47.288  59.043  1.00 34.62 ? 350  MET A C   1 
ATOM   2780  O  O   . MET A 1 347 ? 31.845  46.397  58.324  1.00 34.55 ? 350  MET A O   1 
ATOM   2781  C  CB  . MET A 1 347 ? 33.253  46.861  61.301  1.00 34.48 ? 350  MET A CB  1 
ATOM   2782  C  CG  . MET A 1 347 ? 34.420  46.370  62.133  1.00 34.37 ? 350  MET A CG  1 
ATOM   2783  S  SD  . MET A 1 347 ? 34.823  44.640  61.800  1.00 34.70 ? 350  MET A SD  1 
ATOM   2784  C  CE  . MET A 1 347 ? 33.527  43.832  62.742  1.00 34.32 ? 350  MET A CE  1 
ATOM   2785  N  N   . LEU A 1 348 ? 31.697  48.470  59.193  1.00 34.26 ? 351  LEU A N   1 
ATOM   2786  C  CA  . LEU A 1 348 ? 30.467  48.806  58.491  1.00 34.18 ? 351  LEU A CA  1 
ATOM   2787  C  C   . LEU A 1 348 ? 30.701  48.761  56.983  1.00 34.22 ? 351  LEU A C   1 
ATOM   2788  O  O   . LEU A 1 348 ? 29.880  48.227  56.236  1.00 34.22 ? 351  LEU A O   1 
ATOM   2789  C  CB  . LEU A 1 348 ? 29.984  50.195  58.907  1.00 33.92 ? 351  LEU A CB  1 
ATOM   2790  C  CG  . LEU A 1 348 ? 28.806  50.810  58.133  1.00 33.87 ? 351  LEU A CG  1 
ATOM   2791  C  CD1 . LEU A 1 348 ? 27.526  49.975  58.245  1.00 33.66 ? 351  LEU A CD1 1 
ATOM   2792  C  CD2 . LEU A 1 348 ? 28.568  52.209  58.657  1.00 33.63 ? 351  LEU A CD2 1 
ATOM   2793  N  N   . GLN A 1 349 ? 31.832  49.310  56.545  1.00 34.27 ? 352  GLN A N   1 
ATOM   2794  C  CA  . GLN A 1 349 ? 32.186  49.332  55.129  1.00 34.22 ? 352  GLN A CA  1 
ATOM   2795  C  C   . GLN A 1 349 ? 32.215  47.913  54.554  1.00 34.19 ? 352  GLN A C   1 
ATOM   2796  O  O   . GLN A 1 349 ? 31.782  47.688  53.427  1.00 34.27 ? 352  GLN A O   1 
ATOM   2797  C  CB  . GLN A 1 349 ? 33.537  50.027  54.935  1.00 34.11 ? 352  GLN A CB  1 
ATOM   2798  C  CG  . GLN A 1 349 ? 33.547  51.502  55.322  1.00 34.17 ? 352  GLN A CG  1 
ATOM   2799  C  CD  . GLN A 1 349 ? 33.189  52.428  54.164  1.00 34.54 ? 352  GLN A CD  1 
ATOM   2800  O  OE1 . GLN A 1 349 ? 33.708  52.281  53.054  1.00 34.53 ? 352  GLN A OE1 1 
ATOM   2801  N  NE2 . GLN A 1 349 ? 32.324  53.406  54.426  1.00 34.40 ? 352  GLN A NE2 1 
ATOM   2802  N  N   . GLY A 1 350 ? 32.693  46.956  55.345  1.00 34.12 ? 353  GLY A N   1 
ATOM   2803  C  CA  . GLY A 1 350 ? 32.743  45.575  54.899  1.00 34.08 ? 353  GLY A CA  1 
ATOM   2804  C  C   . GLY A 1 350 ? 31.361  44.956  54.816  1.00 34.03 ? 353  GLY A C   1 
ATOM   2805  O  O   . GLY A 1 350 ? 31.092  44.136  53.941  1.00 33.96 ? 353  GLY A O   1 
ATOM   2806  N  N   . ARG A 1 351 ? 30.481  45.348  55.732  1.00 34.05 ? 354  ARG A N   1 
ATOM   2807  C  CA  . ARG A 1 351 ? 29.115  44.840  55.757  1.00 34.02 ? 354  ARG A CA  1 
ATOM   2808  C  C   . ARG A 1 351 ? 28.320  45.336  54.558  1.00 34.00 ? 354  ARG A C   1 
ATOM   2809  O  O   . ARG A 1 351 ? 27.408  44.661  54.086  1.00 33.91 ? 354  ARG A O   1 
ATOM   2810  C  CB  . ARG A 1 351 ? 28.428  45.239  57.066  1.00 33.82 ? 354  ARG A CB  1 
ATOM   2811  C  CG  . ARG A 1 351 ? 29.064  44.576  58.290  1.00 33.47 ? 354  ARG A CG  1 
ATOM   2812  C  CD  . ARG A 1 351 ? 28.418  44.993  59.595  1.00 33.13 ? 354  ARG A CD  1 
ATOM   2813  N  NE  . ARG A 1 351 ? 27.119  44.361  59.810  1.00 32.85 ? 354  ARG A NE  1 
ATOM   2814  C  CZ  . ARG A 1 351 ? 26.126  44.919  60.496  1.00 32.82 ? 354  ARG A CZ  1 
ATOM   2815  N  NH1 . ARG A 1 351 ? 26.277  46.128  61.028  1.00 32.61 ? 354  ARG A NH1 1 
ATOM   2816  N  NH2 . ARG A 1 351 ? 24.991  44.255  60.677  1.00 32.60 ? 354  ARG A NH2 1 
ATOM   2817  N  N   . LEU A 1 352 ? 28.693  46.506  54.051  1.00 34.10 ? 355  LEU A N   1 
ATOM   2818  C  CA  . LEU A 1 352 ? 28.042  47.094  52.884  1.00 34.35 ? 355  LEU A CA  1 
ATOM   2819  C  C   . LEU A 1 352 ? 28.086  46.123  51.707  1.00 34.43 ? 355  LEU A C   1 
ATOM   2820  O  O   . LEU A 1 352 ? 27.177  46.096  50.877  1.00 34.48 ? 355  LEU A O   1 
ATOM   2821  C  CB  . LEU A 1 352 ? 28.751  48.393  52.505  1.00 34.39 ? 355  LEU A CB  1 
ATOM   2822  C  CG  . LEU A 1 352 ? 28.105  49.733  52.872  1.00 34.67 ? 355  LEU A CG  1 
ATOM   2823  C  CD1 . LEU A 1 352 ? 27.266  49.634  54.122  1.00 34.59 ? 355  LEU A CD1 1 
ATOM   2824  C  CD2 . LEU A 1 352 ? 29.194  50.783  53.027  1.00 34.76 ? 355  LEU A CD2 1 
ATOM   2825  N  N   . PHE A 1 353 ? 29.134  45.307  51.654  1.00 34.20 ? 356  PHE A N   1 
ATOM   2826  C  CA  . PHE A 1 353 ? 29.297  44.336  50.586  1.00 33.97 ? 356  PHE A CA  1 
ATOM   2827  C  C   . PHE A 1 353 ? 28.710  42.969  50.886  1.00 33.93 ? 356  PHE A C   1 
ATOM   2828  O  O   . PHE A 1 353 ? 27.943  42.425  50.099  1.00 33.96 ? 356  PHE A O   1 
ATOM   2829  C  CB  . PHE A 1 353 ? 30.787  44.150  50.249  1.00 33.97 ? 356  PHE A CB  1 
ATOM   2830  C  CG  . PHE A 1 353 ? 31.081  42.872  49.497  1.00 33.97 ? 356  PHE A CG  1 
ATOM   2831  C  CD1 . PHE A 1 353 ? 30.781  42.759  48.144  1.00 33.88 ? 356  PHE A CD1 1 
ATOM   2832  C  CD2 . PHE A 1 353 ? 31.579  41.755  50.165  1.00 33.84 ? 356  PHE A CD2 1 
ATOM   2833  C  CE1 . PHE A 1 353 ? 30.967  41.553  47.472  1.00 33.83 ? 356  PHE A CE1 1 
ATOM   2834  C  CE2 . PHE A 1 353 ? 31.764  40.549  49.498  1.00 33.73 ? 356  PHE A CE2 1 
ATOM   2835  C  CZ  . PHE A 1 353 ? 31.457  40.448  48.154  1.00 33.79 ? 356  PHE A CZ  1 
ATOM   2836  N  N   . ALA A 1 354 ? 29.128  42.405  52.010  1.00 33.90 ? 357  ALA A N   1 
ATOM   2837  C  CA  . ALA A 1 354 ? 28.748  41.063  52.425  1.00 33.77 ? 357  ALA A CA  1 
ATOM   2838  C  C   . ALA A 1 354 ? 27.293  40.648  52.425  1.00 33.62 ? 357  ALA A C   1 
ATOM   2839  O  O   . ALA A 1 354 ? 26.958  39.581  51.919  1.00 33.71 ? 357  ALA A O   1 
ATOM   2840  C  CB  . ALA A 1 354 ? 29.362  40.753  53.776  1.00 33.93 ? 357  ALA A CB  1 
ATOM   2841  N  N   . TYR A 1 355 ? 26.427  41.457  53.014  1.00 33.57 ? 358  TYR A N   1 
ATOM   2842  C  CA  . TYR A 1 355 ? 25.025  41.079  53.105  1.00 33.36 ? 358  TYR A CA  1 
ATOM   2843  C  C   . TYR A 1 355 ? 24.312  40.864  51.779  1.00 33.07 ? 358  TYR A C   1 
ATOM   2844  O  O   . TYR A 1 355 ? 23.802  39.773  51.525  1.00 33.04 ? 358  TYR A O   1 
ATOM   2845  C  CB  . TYR A 1 355 ? 24.264  42.025  54.035  1.00 33.44 ? 358  TYR A CB  1 
ATOM   2846  C  CG  . TYR A 1 355 ? 24.716  41.938  55.479  1.00 33.53 ? 358  TYR A CG  1 
ATOM   2847  C  CD1 . TYR A 1 355 ? 23.914  41.334  56.448  1.00 33.50 ? 358  TYR A CD1 1 
ATOM   2848  C  CD2 . TYR A 1 355 ? 25.933  42.487  55.884  1.00 33.39 ? 358  TYR A CD2 1 
ATOM   2849  C  CE1 . TYR A 1 355 ? 24.315  41.289  57.788  1.00 33.62 ? 358  TYR A CE1 1 
ATOM   2850  C  CE2 . TYR A 1 355 ? 26.339  42.444  57.218  1.00 33.38 ? 358  TYR A CE2 1 
ATOM   2851  C  CZ  . TYR A 1 355 ? 25.527  41.849  58.165  1.00 33.47 ? 358  TYR A CZ  1 
ATOM   2852  O  OH  . TYR A 1 355 ? 25.915  41.830  59.488  1.00 33.09 ? 358  TYR A OH  1 
ATOM   2853  N  N   . PRO A 1 356 ? 24.281  41.878  50.900  1.00 33.05 ? 359  PRO A N   1 
ATOM   2854  C  CA  . PRO A 1 356 ? 23.593  41.629  49.632  1.00 32.88 ? 359  PRO A CA  1 
ATOM   2855  C  C   . PRO A 1 356 ? 24.245  40.433  48.935  1.00 32.91 ? 359  PRO A C   1 
ATOM   2856  O  O   . PRO A 1 356 ? 23.561  39.581  48.359  1.00 32.77 ? 359  PRO A O   1 
ATOM   2857  C  CB  . PRO A 1 356 ? 23.836  42.924  48.860  1.00 32.92 ? 359  PRO A CB  1 
ATOM   2858  C  CG  . PRO A 1 356 ? 23.934  43.954  49.947  1.00 32.97 ? 359  PRO A CG  1 
ATOM   2859  C  CD  . PRO A 1 356 ? 24.797  43.258  50.960  1.00 32.96 ? 359  PRO A CD  1 
ATOM   2860  N  N   . ASP A 1 357 ? 25.567  40.337  49.077  1.00 32.80 ? 360  ASP A N   1 
ATOM   2861  C  CA  . ASP A 1 357 ? 26.344  39.268  48.477  1.00 32.64 ? 360  ASP A CA  1 
ATOM   2862  C  C   . ASP A 1 357 ? 25.915  37.908  48.986  1.00 32.75 ? 360  ASP A C   1 
ATOM   2863  O  O   . ASP A 1 357 ? 25.637  37.015  48.193  1.00 32.74 ? 360  ASP A O   1 
ATOM   2864  C  CB  . ASP A 1 357 ? 27.837  39.469  48.746  1.00 32.58 ? 360  ASP A CB  1 
ATOM   2865  C  CG  . ASP A 1 357 ? 28.694  38.404  48.091  1.00 32.68 ? 360  ASP A CG  1 
ATOM   2866  O  OD1 . ASP A 1 357 ? 28.631  38.266  46.853  1.00 32.85 ? 360  ASP A OD1 1 
ATOM   2867  O  OD2 . ASP A 1 357 ? 29.422  37.688  48.808  1.00 32.73 ? 360  ASP A OD2 1 
ATOM   2868  N  N   . THR A 1 358 ? 25.856  37.747  50.304  1.00 32.71 ? 361  THR A N   1 
ATOM   2869  C  CA  . THR A 1 358 ? 25.459  36.471  50.880  1.00 32.74 ? 361  THR A CA  1 
ATOM   2870  C  C   . THR A 1 358 ? 23.992  36.153  50.576  1.00 32.99 ? 361  THR A C   1 
ATOM   2871  O  O   . THR A 1 358 ? 23.615  34.987  50.426  1.00 32.74 ? 361  THR A O   1 
ATOM   2872  C  CB  . THR A 1 358 ? 25.717  36.431  52.403  1.00 32.89 ? 361  THR A CB  1 
ATOM   2873  O  OG1 . THR A 1 358 ? 25.692  35.072  52.857  1.00 32.85 ? 361  THR A OG1 1 
ATOM   2874  C  CG2 . THR A 1 358 ? 24.666  37.231  53.162  1.00 32.62 ? 361  THR A CG2 1 
ATOM   2875  N  N   . HIS A 1 359 ? 23.174  37.195  50.440  1.00 33.03 ? 362  HIS A N   1 
ATOM   2876  C  CA  . HIS A 1 359 ? 21.760  37.017  50.141  1.00 33.21 ? 362  HIS A CA  1 
ATOM   2877  C  C   . HIS A 1 359 ? 21.507  36.473  48.730  1.00 33.39 ? 362  HIS A C   1 
ATOM   2878  O  O   . HIS A 1 359 ? 20.567  35.707  48.515  1.00 33.43 ? 362  HIS A O   1 
ATOM   2879  C  CB  . HIS A 1 359 ? 21.002  38.323  50.371  1.00 33.28 ? 362  HIS A CB  1 
ATOM   2880  C  CG  . HIS A 1 359 ? 20.859  38.692  51.817  1.00 33.41 ? 362  HIS A CG  1 
ATOM   2881  N  ND1 . HIS A 1 359 ? 20.895  39.997  52.263  1.00 33.37 ? 362  HIS A ND1 1 
ATOM   2882  C  CD2 . HIS A 1 359 ? 20.693  37.923  52.920  1.00 33.30 ? 362  HIS A CD2 1 
ATOM   2883  C  CE1 . HIS A 1 359 ? 20.763  40.015  53.579  1.00 33.47 ? 362  HIS A CE1 1 
ATOM   2884  N  NE2 . HIS A 1 359 ? 20.638  38.770  54.002  1.00 33.39 ? 362  HIS A NE2 1 
ATOM   2885  N  N   . ARG A 1 360 ? 22.344  36.863  47.772  1.00 33.33 ? 363  ARG A N   1 
ATOM   2886  C  CA  . ARG A 1 360 ? 22.220  36.383  46.399  1.00 33.35 ? 363  ARG A CA  1 
ATOM   2887  C  C   . ARG A 1 360 ? 22.549  34.887  46.341  1.00 33.66 ? 363  ARG A C   1 
ATOM   2888  O  O   . ARG A 1 360 ? 22.111  34.169  45.434  1.00 33.49 ? 363  ARG A O   1 
ATOM   2889  C  CB  . ARG A 1 360 ? 23.143  37.193  45.486  1.00 33.22 ? 363  ARG A CB  1 
ATOM   2890  C  CG  . ARG A 1 360 ? 22.766  38.678  45.452  1.00 33.08 ? 363  ARG A CG  1 
ATOM   2891  C  CD  . ARG A 1 360 ? 23.821  39.576  44.810  1.00 32.66 ? 363  ARG A CD  1 
ATOM   2892  N  NE  . ARG A 1 360 ? 23.454  40.983  44.947  1.00 32.39 ? 363  ARG A NE  1 
ATOM   2893  C  CZ  . ARG A 1 360 ? 24.262  41.930  45.416  1.00 32.49 ? 363  ARG A CZ  1 
ATOM   2894  N  NH1 . ARG A 1 360 ? 25.500  41.630  45.793  1.00 32.19 ? 363  ARG A NH1 1 
ATOM   2895  N  NH2 . ARG A 1 360 ? 23.823  43.179  45.536  1.00 32.21 ? 363  ARG A NH2 1 
ATOM   2896  N  N   . HIS A 1 361 ? 23.299  34.418  47.334  1.00 33.77 ? 364  HIS A N   1 
ATOM   2897  C  CA  . HIS A 1 361 ? 23.665  33.012  47.437  1.00 34.03 ? 364  HIS A CA  1 
ATOM   2898  C  C   . HIS A 1 361 ? 22.634  32.215  48.241  1.00 34.07 ? 364  HIS A C   1 
ATOM   2899  O  O   . HIS A 1 361 ? 22.150  31.184  47.779  1.00 34.23 ? 364  HIS A O   1 
ATOM   2900  C  CB  . HIS A 1 361 ? 25.047  32.857  48.087  1.00 34.05 ? 364  HIS A CB  1 
ATOM   2901  C  CG  . HIS A 1 361 ? 25.288  31.501  48.688  1.00 34.40 ? 364  HIS A CG  1 
ATOM   2902  N  ND1 . HIS A 1 361 ? 25.616  30.395  47.931  1.00 34.36 ? 364  HIS A ND1 1 
ATOM   2903  C  CD2 . HIS A 1 361 ? 25.233  31.073  49.974  1.00 34.29 ? 364  HIS A CD2 1 
ATOM   2904  C  CE1 . HIS A 1 361 ? 25.753  29.346  48.725  1.00 34.31 ? 364  HIS A CE1 1 
ATOM   2905  N  NE2 . HIS A 1 361 ? 25.526  29.730  49.969  1.00 34.28 ? 364  HIS A NE2 1 
ATOM   2906  N  N   . ARG A 1 362 ? 22.326  32.670  49.452  1.00 33.91 ? 365  ARG A N   1 
ATOM   2907  C  CA  . ARG A 1 362 ? 21.383  31.969  50.321  1.00 33.78 ? 365  ARG A CA  1 
ATOM   2908  C  C   . ARG A 1 362 ? 19.945  31.961  49.835  1.00 33.75 ? 365  ARG A C   1 
ATOM   2909  O  O   . ARG A 1 362 ? 19.258  30.952  49.953  1.00 33.77 ? 365  ARG A O   1 
ATOM   2910  C  CB  . ARG A 1 362 ? 21.440  32.543  51.735  1.00 33.90 ? 365  ARG A CB  1 
ATOM   2911  C  CG  . ARG A 1 362 ? 20.447  31.918  52.694  1.00 33.90 ? 365  ARG A CG  1 
ATOM   2912  C  CD  . ARG A 1 362 ? 20.645  32.418  54.117  1.00 34.05 ? 365  ARG A CD  1 
ATOM   2913  N  NE  . ARG A 1 362 ? 20.200  33.795  54.329  1.00 34.06 ? 365  ARG A NE  1 
ATOM   2914  C  CZ  . ARG A 1 362 ? 18.971  34.132  54.716  1.00 34.07 ? 365  ARG A CZ  1 
ATOM   2915  N  NH1 . ARG A 1 362 ? 18.654  35.405  54.896  1.00 33.90 ? 365  ARG A NH1 1 
ATOM   2916  N  NH2 . ARG A 1 362 ? 18.052  33.199  54.907  1.00 34.16 ? 365  ARG A NH2 1 
ATOM   2917  N  N   . LEU A 1 363 ? 19.481  33.101  49.341  1.00 33.69 ? 366  LEU A N   1 
ATOM   2918  C  CA  . LEU A 1 363 ? 18.121  33.225  48.852  1.00 33.64 ? 366  LEU A CA  1 
ATOM   2919  C  C   . LEU A 1 363 ? 18.060  33.123  47.340  1.00 33.76 ? 366  LEU A C   1 
ATOM   2920  O  O   . LEU A 1 363 ? 17.325  32.306  46.801  1.00 33.98 ? 366  LEU A O   1 
ATOM   2921  C  CB  . LEU A 1 363 ? 17.516  34.541  49.322  1.00 33.53 ? 366  LEU A CB  1 
ATOM   2922  C  CG  . LEU A 1 363 ? 16.880  34.604  50.717  1.00 33.56 ? 366  LEU A CG  1 
ATOM   2923  C  CD1 . LEU A 1 363 ? 17.079  33.333  51.491  1.00 33.88 ? 366  LEU A CD1 1 
ATOM   2924  C  CD2 . LEU A 1 363 ? 17.421  35.773  51.471  1.00 33.47 ? 366  LEU A CD2 1 
ATOM   2925  N  N   . GLY A 1 364 ? 18.850  33.933  46.651  1.00 33.87 ? 367  GLY A N   1 
ATOM   2926  C  CA  . GLY A 1 364 ? 18.857  33.888  45.202  1.00 33.81 ? 367  GLY A CA  1 
ATOM   2927  C  C   . GLY A 1 364 ? 19.092  35.267  44.635  1.00 33.98 ? 367  GLY A C   1 
ATOM   2928  O  O   . GLY A 1 364 ? 19.024  36.248  45.376  1.00 34.06 ? 367  GLY A O   1 
ATOM   2929  N  N   . PRO A 1 365 ? 19.395  35.386  43.335  1.00 34.09 ? 368  PRO A N   1 
ATOM   2930  C  CA  . PRO A 1 365 ? 19.636  36.691  42.715  1.00 34.12 ? 368  PRO A CA  1 
ATOM   2931  C  C   . PRO A 1 365 ? 18.486  37.679  42.906  1.00 34.41 ? 368  PRO A C   1 
ATOM   2932  O  O   . PRO A 1 365 ? 18.720  38.870  43.131  1.00 34.26 ? 368  PRO A O   1 
ATOM   2933  C  CB  . PRO A 1 365 ? 19.838  36.328  41.251  1.00 34.18 ? 368  PRO A CB  1 
ATOM   2934  C  CG  . PRO A 1 365 ? 20.544  35.006  41.358  1.00 33.98 ? 368  PRO A CG  1 
ATOM   2935  C  CD  . PRO A 1 365 ? 19.710  34.297  42.393  1.00 34.07 ? 368  PRO A CD  1 
ATOM   2936  N  N   . ASN A 1 366 ? 17.252  37.184  42.844  1.00 34.53 ? 369  ASN A N   1 
ATOM   2937  C  CA  . ASN A 1 366 ? 16.083  38.040  43.011  1.00 34.56 ? 369  ASN A CA  1 
ATOM   2938  C  C   . ASN A 1 366 ? 15.453  37.942  44.389  1.00 34.71 ? 369  ASN A C   1 
ATOM   2939  O  O   . ASN A 1 366 ? 14.229  37.918  44.503  1.00 34.81 ? 369  ASN A O   1 
ATOM   2940  C  CB  . ASN A 1 366 ? 15.034  37.727  41.947  1.00 34.27 ? 369  ASN A CB  1 
ATOM   2941  C  CG  . ASN A 1 366 ? 15.384  38.314  40.608  1.00 34.28 ? 369  ASN A CG  1 
ATOM   2942  O  OD1 . ASN A 1 366 ? 15.279  37.651  39.583  1.00 34.84 ? 369  ASN A OD1 1 
ATOM   2943  N  ND2 . ASN A 1 366 ? 15.806  39.564  40.606  1.00 34.05 ? 369  ASN A ND2 1 
ATOM   2944  N  N   . TYR A 1 367 ? 16.283  37.942  45.435  1.00 34.78 ? 370  TYR A N   1 
ATOM   2945  C  CA  . TYR A 1 367 ? 15.786  37.840  46.807  1.00 34.71 ? 370  TYR A CA  1 
ATOM   2946  C  C   . TYR A 1 367 ? 14.919  39.020  47.242  1.00 35.01 ? 370  TYR A C   1 
ATOM   2947  O  O   . TYR A 1 367 ? 14.061  38.867  48.111  1.00 34.93 ? 370  TYR A O   1 
ATOM   2948  C  CB  . TYR A 1 367 ? 16.931  37.597  47.807  1.00 34.09 ? 370  TYR A CB  1 
ATOM   2949  C  CG  . TYR A 1 367 ? 17.815  38.791  48.114  1.00 33.66 ? 370  TYR A CG  1 
ATOM   2950  C  CD1 . TYR A 1 367 ? 17.578  39.591  49.233  1.00 33.31 ? 370  TYR A CD1 1 
ATOM   2951  C  CD2 . TYR A 1 367 ? 18.893  39.113  47.298  1.00 33.35 ? 370  TYR A CD2 1 
ATOM   2952  C  CE1 . TYR A 1 367 ? 18.391  40.674  49.524  1.00 33.11 ? 370  TYR A CE1 1 
ATOM   2953  C  CE2 . TYR A 1 367 ? 19.708  40.197  47.584  1.00 33.18 ? 370  TYR A CE2 1 
ATOM   2954  C  CZ  . TYR A 1 367 ? 19.449  40.969  48.694  1.00 33.07 ? 370  TYR A CZ  1 
ATOM   2955  O  OH  . TYR A 1 367 ? 20.244  42.047  48.963  1.00 33.25 ? 370  TYR A OH  1 
ATOM   2956  N  N   . LEU A 1 368 ? 15.119  40.188  46.632  1.00 35.32 ? 371  LEU A N   1 
ATOM   2957  C  CA  . LEU A 1 368 ? 14.323  41.357  46.984  1.00 35.81 ? 371  LEU A CA  1 
ATOM   2958  C  C   . LEU A 1 368 ? 12.890  41.222  46.471  1.00 36.34 ? 371  LEU A C   1 
ATOM   2959  O  O   . LEU A 1 368 ? 12.022  42.032  46.807  1.00 36.52 ? 371  LEU A O   1 
ATOM   2960  C  CB  . LEU A 1 368 ? 14.971  42.637  46.460  1.00 35.58 ? 371  LEU A CB  1 
ATOM   2961  C  CG  . LEU A 1 368 ? 16.307  43.016  47.109  1.00 35.44 ? 371  LEU A CG  1 
ATOM   2962  C  CD1 . LEU A 1 368 ? 16.888  44.210  46.401  1.00 35.59 ? 371  LEU A CD1 1 
ATOM   2963  C  CD2 . LEU A 1 368 ? 16.135  43.322  48.590  1.00 35.38 ? 371  LEU A CD2 1 
ATOM   2964  N  N   . HIS A 1 369 ? 12.647  40.192  45.660  1.00 36.70 ? 372  HIS A N   1 
ATOM   2965  C  CA  . HIS A 1 369 ? 11.313  39.927  45.128  1.00 37.12 ? 372  HIS A CA  1 
ATOM   2966  C  C   . HIS A 1 369 ? 10.495  39.116  46.131  1.00 37.13 ? 372  HIS A C   1 
ATOM   2967  O  O   . HIS A 1 369 ? 9.283   38.968  45.969  1.00 37.28 ? 372  HIS A O   1 
ATOM   2968  C  CB  . HIS A 1 369 ? 11.376  39.138  43.818  1.00 37.63 ? 372  HIS A CB  1 
ATOM   2969  C  CG  . HIS A 1 369 ? 11.906  39.914  42.655  1.00 38.11 ? 372  HIS A CG  1 
ATOM   2970  N  ND1 . HIS A 1 369 ? 11.873  39.423  41.366  1.00 38.29 ? 372  HIS A ND1 1 
ATOM   2971  C  CD2 . HIS A 1 369 ? 12.505  41.126  42.583  1.00 38.27 ? 372  HIS A CD2 1 
ATOM   2972  C  CE1 . HIS A 1 369 ? 12.431  40.300  40.552  1.00 38.62 ? 372  HIS A CE1 1 
ATOM   2973  N  NE2 . HIS A 1 369 ? 12.824  41.342  41.265  1.00 38.52 ? 372  HIS A NE2 1 
ATOM   2974  N  N   . ILE A 1 370 ? 11.163  38.514  47.111  1.00 37.13 ? 373  ILE A N   1 
ATOM   2975  C  CA  . ILE A 1 370 ? 10.460  37.742  48.135  1.00 37.18 ? 373  ILE A CA  1 
ATOM   2976  C  C   . ILE A 1 370 ? 9.632   38.757  48.925  1.00 37.28 ? 373  ILE A C   1 
ATOM   2977  O  O   . ILE A 1 370 ? 10.156  39.777  49.366  1.00 37.52 ? 373  ILE A O   1 
ATOM   2978  C  CB  . ILE A 1 370 ? 11.458  36.997  49.048  1.00 36.87 ? 373  ILE A CB  1 
ATOM   2979  C  CG1 . ILE A 1 370 ? 12.255  35.993  48.219  1.00 36.57 ? 373  ILE A CG1 1 
ATOM   2980  C  CG2 . ILE A 1 370 ? 10.726  36.263  50.150  1.00 36.86 ? 373  ILE A CG2 1 
ATOM   2981  C  CD1 . ILE A 1 370 ? 13.276  35.238  49.004  1.00 36.58 ? 373  ILE A CD1 1 
ATOM   2982  N  N   . PRO A 1 371 ? 8.318   38.515  49.074  1.00 37.37 ? 374  PRO A N   1 
ATOM   2983  C  CA  . PRO A 1 371 ? 7.389   39.397  49.790  1.00 37.46 ? 374  PRO A CA  1 
ATOM   2984  C  C   . PRO A 1 371 ? 7.908   40.141  51.012  1.00 37.42 ? 374  PRO A C   1 
ATOM   2985  O  O   . PRO A 1 371 ? 7.824   41.365  51.076  1.00 37.35 ? 374  PRO A O   1 
ATOM   2986  C  CB  . PRO A 1 371 ? 6.244   38.454  50.136  1.00 37.40 ? 374  PRO A CB  1 
ATOM   2987  C  CG  . PRO A 1 371 ? 6.154   37.642  48.915  1.00 37.38 ? 374  PRO A CG  1 
ATOM   2988  C  CD  . PRO A 1 371 ? 7.615   37.295  48.639  1.00 37.49 ? 374  PRO A CD  1 
ATOM   2989  N  N   . VAL A 1 372 ? 8.441   39.403  51.976  1.00 37.58 ? 375  VAL A N   1 
ATOM   2990  C  CA  . VAL A 1 372 ? 8.959   39.999  53.202  1.00 37.79 ? 375  VAL A CA  1 
ATOM   2991  C  C   . VAL A 1 372 ? 10.127  40.962  52.967  1.00 38.04 ? 375  VAL A C   1 
ATOM   2992  O  O   . VAL A 1 372 ? 10.353  41.871  53.759  1.00 38.03 ? 375  VAL A O   1 
ATOM   2993  C  CB  . VAL A 1 372 ? 9.367   38.901  54.209  1.00 37.47 ? 375  VAL A CB  1 
ATOM   2994  C  CG1 . VAL A 1 372 ? 10.657  38.227  53.785  1.00 37.03 ? 375  VAL A CG1 1 
ATOM   2995  C  CG2 . VAL A 1 372 ? 9.466   39.475  55.594  1.00 37.33 ? 375  VAL A CG2 1 
ATOM   2996  N  N   . ASN A 1 373 ? 10.849  40.772  51.866  1.00 38.56 ? 376  ASN A N   1 
ATOM   2997  C  CA  . ASN A 1 373 ? 11.987  41.615  51.528  1.00 39.10 ? 376  ASN A CA  1 
ATOM   2998  C  C   . ASN A 1 373 ? 11.650  42.723  50.546  1.00 39.63 ? 376  ASN A C   1 
ATOM   2999  O  O   . ASN A 1 373 ? 12.439  43.643  50.366  1.00 39.61 ? 376  ASN A O   1 
ATOM   3000  C  CB  . ASN A 1 373 ? 13.109  40.773  50.927  1.00 38.93 ? 376  ASN A CB  1 
ATOM   3001  C  CG  . ASN A 1 373 ? 13.637  39.746  51.886  1.00 38.91 ? 376  ASN A CG  1 
ATOM   3002  O  OD1 . ASN A 1 373 ? 13.661  39.970  53.094  1.00 39.02 ? 376  ASN A OD1 1 
ATOM   3003  N  ND2 . ASN A 1 373 ? 14.060  38.601  51.359  1.00 38.92 ? 376  ASN A ND2 1 
ATOM   3004  N  N   . CYS A 1 374 ? 10.502  42.618  49.885  1.00 40.49 ? 377  CYS A N   1 
ATOM   3005  C  CA  . CYS A 1 374 ? 10.093  43.609  48.893  1.00 41.55 ? 377  CYS A CA  1 
ATOM   3006  C  C   . CYS A 1 374 ? 9.804   44.962  49.546  1.00 41.67 ? 377  CYS A C   1 
ATOM   3007  O  O   . CYS A 1 374 ? 9.151   45.024  50.588  1.00 41.88 ? 377  CYS A O   1 
ATOM   3008  C  CB  . CYS A 1 374 ? 8.866   43.096  48.120  1.00 42.08 ? 377  CYS A CB  1 
ATOM   3009  S  SG  . CYS A 1 374 ? 8.390   44.063  46.651  1.00 44.70 ? 377  CYS A SG  1 
ATOM   3010  N  N   . PRO A 1 375 ? 10.362  46.055  48.994  1.00 41.75 ? 378  PRO A N   1 
ATOM   3011  C  CA  . PRO A 1 375 ? 10.137  47.399  49.546  1.00 41.92 ? 378  PRO A CA  1 
ATOM   3012  C  C   . PRO A 1 375 ? 8.751   47.849  49.112  1.00 42.27 ? 378  PRO A C   1 
ATOM   3013  O  O   . PRO A 1 375 ? 8.615   48.726  48.263  1.00 42.31 ? 378  PRO A O   1 
ATOM   3014  C  CB  . PRO A 1 375 ? 11.230  48.222  48.867  1.00 41.74 ? 378  PRO A CB  1 
ATOM   3015  C  CG  . PRO A 1 375 ? 11.339  47.572  47.534  1.00 41.64 ? 378  PRO A CG  1 
ATOM   3016  C  CD  . PRO A 1 375 ? 11.304  46.103  47.862  1.00 41.60 ? 378  PRO A CD  1 
ATOM   3017  N  N   . TYR A 1 376 ? 7.726   47.272  49.730  1.00 42.63 ? 379  TYR A N   1 
ATOM   3018  C  CA  . TYR A 1 376 ? 6.353   47.553  49.346  1.00 43.02 ? 379  TYR A CA  1 
ATOM   3019  C  C   . TYR A 1 376 ? 5.787   48.956  49.494  1.00 43.28 ? 379  TYR A C   1 
ATOM   3020  O  O   . TYR A 1 376 ? 4.701   49.232  48.980  1.00 43.49 ? 379  TYR A O   1 
ATOM   3021  C  CB  . TYR A 1 376 ? 5.407   46.519  49.954  1.00 43.10 ? 379  TYR A CB  1 
ATOM   3022  C  CG  . TYR A 1 376 ? 5.140   46.655  51.436  1.00 43.35 ? 379  TYR A CG  1 
ATOM   3023  C  CD1 . TYR A 1 376 ? 5.939   46.009  52.376  1.00 43.37 ? 379  TYR A CD1 1 
ATOM   3024  C  CD2 . TYR A 1 376 ? 4.021   47.356  51.897  1.00 43.48 ? 379  TYR A CD2 1 
ATOM   3025  C  CE1 . TYR A 1 376 ? 5.623   46.049  53.742  1.00 43.56 ? 379  TYR A CE1 1 
ATOM   3026  C  CE2 . TYR A 1 376 ? 3.699   47.403  53.254  1.00 43.53 ? 379  TYR A CE2 1 
ATOM   3027  C  CZ  . TYR A 1 376 ? 4.499   46.747  54.171  1.00 43.66 ? 379  TYR A CZ  1 
ATOM   3028  O  OH  . TYR A 1 376 ? 4.158   46.780  55.508  1.00 43.89 ? 379  TYR A OH  1 
ATOM   3029  N  N   . ARG A 1 377 ? 6.495   49.850  50.174  1.00 43.52 ? 380  ARG A N   1 
ATOM   3030  C  CA  . ARG A 1 377 ? 5.985   51.209  50.319  1.00 43.66 ? 380  ARG A CA  1 
ATOM   3031  C  C   . ARG A 1 377 ? 6.741   52.208  49.458  1.00 43.68 ? 380  ARG A C   1 
ATOM   3032  O  O   . ARG A 1 377 ? 6.710   53.416  49.700  1.00 43.77 ? 380  ARG A O   1 
ATOM   3033  C  CB  . ARG A 1 377 ? 5.951   51.622  51.786  1.00 43.81 ? 380  ARG A CB  1 
ATOM   3034  C  CG  . ARG A 1 377 ? 4.927   50.817  52.566  1.00 44.19 ? 380  ARG A CG  1 
ATOM   3035  C  CD  . ARG A 1 377 ? 4.840   51.229  54.012  1.00 44.74 ? 380  ARG A CD  1 
ATOM   3036  N  NE  . ARG A 1 377 ? 4.138   52.497  54.192  1.00 45.25 ? 380  ARG A NE  1 
ATOM   3037  C  CZ  . ARG A 1 377 ? 4.707   53.621  54.622  1.00 45.40 ? 380  ARG A CZ  1 
ATOM   3038  N  NH1 . ARG A 1 377 ? 6.002   53.658  54.922  1.00 45.33 ? 380  ARG A NH1 1 
ATOM   3039  N  NH2 . ARG A 1 377 ? 3.969   54.711  54.766  1.00 45.77 ? 380  ARG A NH2 1 
ATOM   3040  N  N   . ALA A 1 378 ? 7.373   51.689  48.412  1.00 43.70 ? 381  ALA A N   1 
ATOM   3041  C  CA  . ALA A 1 378 ? 8.131   52.501  47.475  1.00 43.79 ? 381  ALA A CA  1 
ATOM   3042  C  C   . ALA A 1 378 ? 7.951   51.935  46.078  1.00 43.92 ? 381  ALA A C   1 
ATOM   3043  O  O   . ALA A 1 378 ? 7.668   50.750  45.909  1.00 43.92 ? 381  ALA A O   1 
ATOM   3044  C  CB  . ALA A 1 378 ? 9.605   52.507  47.851  1.00 43.70 ? 381  ALA A CB  1 
ATOM   3045  N  N   . ARG A 1 379 ? 8.073   52.795  45.075  1.00 44.03 ? 382  ARG A N   1 
ATOM   3046  C  CA  . ARG A 1 379 ? 7.942   52.367  43.693  1.00 44.15 ? 382  ARG A CA  1 
ATOM   3047  C  C   . ARG A 1 379 ? 9.332   52.035  43.152  1.00 43.29 ? 382  ARG A C   1 
ATOM   3048  O  O   . ARG A 1 379 ? 10.166  52.927  42.998  1.00 43.23 ? 382  ARG A O   1 
ATOM   3049  C  CB  . ARG A 1 379 ? 7.288   53.481  42.864  1.00 45.57 ? 382  ARG A CB  1 
ATOM   3050  C  CG  . ARG A 1 379 ? 7.457   53.342  41.342  1.00 47.71 ? 382  ARG A CG  1 
ATOM   3051  C  CD  . ARG A 1 379 ? 6.630   52.200  40.747  1.00 49.52 ? 382  ARG A CD  1 
ATOM   3052  N  NE  . ARG A 1 379 ? 5.300   52.655  40.339  1.00 51.25 ? 382  ARG A NE  1 
ATOM   3053  C  CZ  . ARG A 1 379 ? 4.850   52.620  39.085  1.00 51.96 ? 382  ARG A CZ  1 
ATOM   3054  N  NH1 . ARG A 1 379 ? 5.627   52.146  38.109  1.00 52.18 ? 382  ARG A NH1 1 
ATOM   3055  N  NH2 . ARG A 1 379 ? 3.624   53.065  38.806  1.00 52.34 ? 382  ARG A NH2 1 
ATOM   3056  N  N   . VAL A 1 380 ? 9.598   50.752  42.921  1.00 42.25 ? 383  VAL A N   1 
ATOM   3057  C  CA  . VAL A 1 380 ? 10.895  50.344  42.390  1.00 41.13 ? 383  VAL A CA  1 
ATOM   3058  C  C   . VAL A 1 380 ? 10.864  50.494  40.882  1.00 40.54 ? 383  VAL A C   1 
ATOM   3059  O  O   . VAL A 1 380 ? 10.016  49.913  40.206  1.00 40.36 ? 383  VAL A O   1 
ATOM   3060  C  CB  . VAL A 1 380 ? 11.256  48.889  42.752  1.00 41.05 ? 383  VAL A CB  1 
ATOM   3061  C  CG1 . VAL A 1 380 ? 12.620  48.537  42.192  1.00 40.78 ? 383  VAL A CG1 1 
ATOM   3062  C  CG2 . VAL A 1 380 ? 11.261  48.710  44.253  1.00 40.73 ? 383  VAL A CG2 1 
ATOM   3063  N  N   . ALA A 1 381 ? 11.787  51.296  40.368  1.00 39.76 ? 384  ALA A N   1 
ATOM   3064  C  CA  . ALA A 1 381 ? 11.875  51.554  38.942  1.00 39.08 ? 384  ALA A CA  1 
ATOM   3065  C  C   . ALA A 1 381 ? 13.322  51.816  38.589  1.00 38.75 ? 384  ALA A C   1 
ATOM   3066  O  O   . ALA A 1 381 ? 13.926  52.769  39.078  1.00 38.70 ? 384  ALA A O   1 
ATOM   3067  C  CB  . ALA A 1 381 ? 11.027  52.754  38.577  1.00 38.94 ? 384  ALA A CB  1 
ATOM   3068  N  N   . ASN A 1 382 ? 13.872  50.976  37.723  1.00 38.29 ? 385  ASN A N   1 
ATOM   3069  C  CA  . ASN A 1 382 ? 15.255  51.110  37.316  1.00 37.72 ? 385  ASN A CA  1 
ATOM   3070  C  C   . ASN A 1 382 ? 15.540  50.379  36.011  1.00 37.48 ? 385  ASN A C   1 
ATOM   3071  O  O   . ASN A 1 382 ? 14.626  50.098  35.238  1.00 37.34 ? 385  ASN A O   1 
ATOM   3072  C  CB  . ASN A 1 382 ? 16.175  50.607  38.430  1.00 37.63 ? 385  ASN A CB  1 
ATOM   3073  C  CG  . ASN A 1 382 ? 15.778  49.241  38.948  1.00 37.71 ? 385  ASN A CG  1 
ATOM   3074  O  OD1 . ASN A 1 382 ? 15.728  49.019  40.159  1.00 38.02 ? 385  ASN A OD1 1 
ATOM   3075  N  ND2 . ASN A 1 382 ? 15.511  48.311  38.038  1.00 37.59 ? 385  ASN A ND2 1 
ATOM   3076  N  N   . TYR A 1 383 ? 16.812  50.057  35.791  1.00 37.16 ? 386  TYR A N   1 
ATOM   3077  C  CA  . TYR A 1 383 ? 17.257  49.378  34.580  1.00 36.86 ? 386  TYR A CA  1 
ATOM   3078  C  C   . TYR A 1 383 ? 17.771  47.958  34.815  1.00 36.82 ? 386  TYR A C   1 
ATOM   3079  O  O   . TYR A 1 383 ? 18.531  47.416  34.007  1.00 36.72 ? 386  TYR A O   1 
ATOM   3080  C  CB  . TYR A 1 383 ? 18.301  50.249  33.876  1.00 36.53 ? 386  TYR A CB  1 
ATOM   3081  C  CG  . TYR A 1 383 ? 17.697  51.576  33.501  1.00 36.67 ? 386  TYR A CG  1 
ATOM   3082  C  CD1 . TYR A 1 383 ? 17.736  52.660  34.377  1.00 36.44 ? 386  TYR A CD1 1 
ATOM   3083  C  CD2 . TYR A 1 383 ? 16.960  51.710  32.324  1.00 36.70 ? 386  TYR A CD2 1 
ATOM   3084  C  CE1 . TYR A 1 383 ? 17.045  53.833  34.097  1.00 36.41 ? 386  TYR A CE1 1 
ATOM   3085  C  CE2 . TYR A 1 383 ? 16.269  52.880  32.033  1.00 36.58 ? 386  TYR A CE2 1 
ATOM   3086  C  CZ  . TYR A 1 383 ? 16.313  53.932  32.925  1.00 36.59 ? 386  TYR A CZ  1 
ATOM   3087  O  OH  . TYR A 1 383 ? 15.604  55.069  32.639  1.00 36.72 ? 386  TYR A OH  1 
ATOM   3088  N  N   . GLN A 1 384 ? 17.342  47.354  35.921  1.00 36.51 ? 387  GLN A N   1 
ATOM   3089  C  CA  . GLN A 1 384 ? 17.736  45.998  36.258  1.00 36.45 ? 387  GLN A CA  1 
ATOM   3090  C  C   . GLN A 1 384 ? 16.676  45.052  35.696  1.00 36.48 ? 387  GLN A C   1 
ATOM   3091  O  O   . GLN A 1 384 ? 15.479  45.341  35.770  1.00 36.36 ? 387  GLN A O   1 
ATOM   3092  C  CB  . GLN A 1 384 ? 17.862  45.857  37.773  1.00 36.35 ? 387  GLN A CB  1 
ATOM   3093  C  CG  . GLN A 1 384 ? 18.892  46.797  38.379  1.00 36.28 ? 387  GLN A CG  1 
ATOM   3094  C  CD  . GLN A 1 384 ? 19.033  46.633  39.879  1.00 36.36 ? 387  GLN A CD  1 
ATOM   3095  O  OE1 . GLN A 1 384 ? 18.859  45.536  40.419  1.00 36.35 ? 387  GLN A OE1 1 
ATOM   3096  N  NE2 . GLN A 1 384 ? 19.352  47.728  40.567  1.00 36.29 ? 387  GLN A NE2 1 
ATOM   3097  N  N   . ARG A 1 385 ? 17.116  43.937  35.114  1.00 36.43 ? 388  ARG A N   1 
ATOM   3098  C  CA  . ARG A 1 385 ? 16.200  42.979  34.502  1.00 36.43 ? 388  ARG A CA  1 
ATOM   3099  C  C   . ARG A 1 385 ? 16.633  41.529  34.632  1.00 36.60 ? 388  ARG A C   1 
ATOM   3100  O  O   . ARG A 1 385 ? 17.797  41.232  34.885  1.00 36.62 ? 388  ARG A O   1 
ATOM   3101  C  CB  . ARG A 1 385 ? 16.072  43.266  33.002  1.00 36.04 ? 388  ARG A CB  1 
ATOM   3102  C  CG  . ARG A 1 385 ? 15.514  44.628  32.632  1.00 35.70 ? 388  ARG A CG  1 
ATOM   3103  C  CD  . ARG A 1 385 ? 14.032  44.732  32.934  1.00 35.22 ? 388  ARG A CD  1 
ATOM   3104  N  NE  . ARG A 1 385 ? 13.455  45.932  32.340  1.00 34.83 ? 388  ARG A NE  1 
ATOM   3105  C  CZ  . ARG A 1 385 ? 13.583  47.155  32.841  1.00 34.74 ? 388  ARG A CZ  1 
ATOM   3106  N  NH1 . ARG A 1 385 ? 14.266  47.357  33.962  1.00 34.59 ? 388  ARG A NH1 1 
ATOM   3107  N  NH2 . ARG A 1 385 ? 13.046  48.181  32.202  1.00 34.65 ? 388  ARG A NH2 1 
ATOM   3108  N  N   . ASP A 1 386 ? 15.666  40.636  34.447  1.00 36.91 ? 389  ASP A N   1 
ATOM   3109  C  CA  . ASP A 1 386 ? 15.889  39.197  34.452  1.00 37.34 ? 389  ASP A CA  1 
ATOM   3110  C  C   . ASP A 1 386 ? 16.408  38.560  35.735  1.00 37.91 ? 389  ASP A C   1 
ATOM   3111  O  O   . ASP A 1 386 ? 16.099  39.017  36.836  1.00 37.92 ? 389  ASP A O   1 
ATOM   3112  C  CB  . ASP A 1 386 ? 16.793  38.830  33.272  1.00 37.17 ? 389  ASP A CB  1 
ATOM   3113  C  CG  . ASP A 1 386 ? 16.281  39.385  31.948  1.00 37.05 ? 389  ASP A CG  1 
ATOM   3114  O  OD1 . ASP A 1 386 ? 15.180  39.980  31.912  1.00 37.07 ? 389  ASP A OD1 1 
ATOM   3115  O  OD2 . ASP A 1 386 ? 16.985  39.230  30.932  1.00 36.94 ? 389  ASP A OD2 1 
ATOM   3116  N  N   . GLY A 1 387 ? 17.188  37.490  35.581  1.00 38.50 ? 390  GLY A N   1 
ATOM   3117  C  CA  . GLY A 1 387 ? 17.724  36.776  36.725  1.00 39.12 ? 390  GLY A CA  1 
ATOM   3118  C  C   . GLY A 1 387 ? 16.822  35.613  37.098  1.00 39.97 ? 390  GLY A C   1 
ATOM   3119  O  O   . GLY A 1 387 ? 15.639  35.616  36.773  1.00 39.94 ? 390  GLY A O   1 
ATOM   3120  N  N   . PRO A 1 388 ? 17.355  34.587  37.771  1.00 40.68 ? 391  PRO A N   1 
ATOM   3121  C  CA  . PRO A 1 388 ? 16.592  33.410  38.189  1.00 41.33 ? 391  PRO A CA  1 
ATOM   3122  C  C   . PRO A 1 388 ? 15.362  33.776  39.003  1.00 42.10 ? 391  PRO A C   1 
ATOM   3123  O  O   . PRO A 1 388 ? 15.368  34.768  39.733  1.00 41.99 ? 391  PRO A O   1 
ATOM   3124  C  CB  . PRO A 1 388 ? 17.593  32.660  39.055  1.00 41.28 ? 391  PRO A CB  1 
ATOM   3125  C  CG  . PRO A 1 388 ? 18.890  32.984  38.410  1.00 41.23 ? 391  PRO A CG  1 
ATOM   3126  C  CD  . PRO A 1 388 ? 18.768  34.457  38.156  1.00 40.99 ? 391  PRO A CD  1 
ATOM   3127  N  N   . MET A 1 389 ? 14.316  32.960  38.871  1.00 43.10 ? 392  MET A N   1 
ATOM   3128  C  CA  . MET A 1 389 ? 13.056  33.145  39.593  1.00 44.04 ? 392  MET A CA  1 
ATOM   3129  C  C   . MET A 1 389 ? 12.598  34.586  39.553  1.00 44.85 ? 392  MET A C   1 
ATOM   3130  O  O   . MET A 1 389 ? 12.309  35.192  40.582  1.00 45.00 ? 392  MET A O   1 
ATOM   3131  C  CB  . MET A 1 389 ? 13.190  32.684  41.049  1.00 43.74 ? 392  MET A CB  1 
ATOM   3132  C  CG  . MET A 1 389 ? 13.437  31.201  41.212  1.00 43.66 ? 392  MET A CG  1 
ATOM   3133  S  SD  . MET A 1 389 ? 12.060  30.241  40.605  1.00 43.94 ? 392  MET A SD  1 
ATOM   3134  C  CE  . MET A 1 389 ? 10.900  30.500  41.882  1.00 43.61 ? 392  MET A CE  1 
ATOM   3135  N  N   . CYS A 1 390 ? 12.583  35.151  38.357  1.00 45.91 ? 393  CYS A N   1 
ATOM   3136  C  CA  . CYS A 1 390 ? 12.158  36.523  38.204  1.00 47.07 ? 393  CYS A CA  1 
ATOM   3137  C  C   . CYS A 1 390 ? 10.650  36.622  38.305  1.00 47.86 ? 393  CYS A C   1 
ATOM   3138  O  O   . CYS A 1 390 ? 9.939   36.286  37.355  1.00 47.97 ? 393  CYS A O   1 
ATOM   3139  C  CB  . CYS A 1 390 ? 12.613  37.078  36.860  1.00 47.06 ? 393  CYS A CB  1 
ATOM   3140  S  SG  . CYS A 1 390 ? 12.035  38.751  36.569  1.00 47.71 ? 393  CYS A SG  1 
ATOM   3141  N  N   . MET A 1 391 ? 10.159  37.015  39.480  1.00 48.91 ? 394  MET A N   1 
ATOM   3142  C  CA  . MET A 1 391 ? 8.723   37.186  39.678  1.00 49.78 ? 394  MET A CA  1 
ATOM   3143  C  C   . MET A 1 391 ? 8.349   38.563  39.161  1.00 50.10 ? 394  MET A C   1 
ATOM   3144  O  O   . MET A 1 391 ? 9.184   39.252  38.558  1.00 50.33 ? 394  MET A O   1 
ATOM   3145  C  CB  . MET A 1 391 ? 8.337   37.040  41.149  1.00 50.22 ? 394  MET A CB  1 
ATOM   3146  C  CG  . MET A 1 391 ? 7.810   35.660  41.480  1.00 51.03 ? 394  MET A CG  1 
ATOM   3147  S  SD  . MET A 1 391 ? 9.007   34.421  40.985  1.00 52.65 ? 394  MET A SD  1 
ATOM   3148  C  CE  . MET A 1 391 ? 8.836   33.155  42.266  1.00 52.17 ? 394  MET A CE  1 
ATOM   3149  N  N   . GLN A 1 392 ? 7.088   38.945  39.334  1.00 50.23 ? 395  GLN A N   1 
ATOM   3150  C  CA  . GLN A 1 392 ? 6.634   40.253  38.872  1.00 50.20 ? 395  GLN A CA  1 
ATOM   3151  C  C   . GLN A 1 392 ? 6.556   40.313  37.336  1.00 49.45 ? 395  GLN A C   1 
ATOM   3152  O  O   . GLN A 1 392 ? 6.595   39.288  36.649  1.00 49.44 ? 395  GLN A O   1 
ATOM   3153  C  CB  . GLN A 1 392 ? 7.591   41.336  39.401  1.00 51.30 ? 395  GLN A CB  1 
ATOM   3154  C  CG  . GLN A 1 392 ? 7.033   42.738  39.423  1.00 52.72 ? 395  GLN A CG  1 
ATOM   3155  C  CD  . GLN A 1 392 ? 5.906   42.889  40.424  1.00 53.56 ? 395  GLN A CD  1 
ATOM   3156  O  OE1 . GLN A 1 392 ? 4.834   42.292  40.269  1.00 54.01 ? 395  GLN A OE1 1 
ATOM   3157  N  NE2 . GLN A 1 392 ? 6.142   43.684  41.468  1.00 53.98 ? 395  GLN A NE2 1 
ATOM   3158  N  N   . ASP A 1 393 ? 6.414   41.520  36.806  1.00 48.39 ? 396  ASP A N   1 
ATOM   3159  C  CA  . ASP A 1 393 ? 6.332   41.715  35.370  1.00 47.23 ? 396  ASP A CA  1 
ATOM   3160  C  C   . ASP A 1 393 ? 7.718   41.991  34.790  1.00 46.03 ? 396  ASP A C   1 
ATOM   3161  O  O   . ASP A 1 393 ? 7.853   42.201  33.588  1.00 45.97 ? 396  ASP A O   1 
ATOM   3162  C  CB  . ASP A 1 393 ? 5.375   42.879  35.045  1.00 47.68 ? 396  ASP A CB  1 
ATOM   3163  C  CG  . ASP A 1 393 ? 5.886   44.246  35.548  1.00 48.03 ? 396  ASP A CG  1 
ATOM   3164  O  OD1 . ASP A 1 393 ? 6.626   44.313  36.562  1.00 48.14 ? 396  ASP A OD1 1 
ATOM   3165  O  OD2 . ASP A 1 393 ? 5.530   45.270  34.917  1.00 48.35 ? 396  ASP A OD2 1 
ATOM   3166  N  N   . ASN A 1 394 ? 8.737   41.986  35.649  1.00 44.58 ? 397  ASN A N   1 
ATOM   3167  C  CA  . ASN A 1 394 ? 10.107  42.266  35.231  1.00 43.20 ? 397  ASN A CA  1 
ATOM   3168  C  C   . ASN A 1 394 ? 10.137  43.659  34.583  1.00 42.50 ? 397  ASN A C   1 
ATOM   3169  O  O   . ASN A 1 394 ? 10.877  43.910  33.634  1.00 42.23 ? 397  ASN A O   1 
ATOM   3170  C  CB  . ASN A 1 394 ? 10.598  41.196  34.255  1.00 42.77 ? 397  ASN A CB  1 
ATOM   3171  C  CG  . ASN A 1 394 ? 12.108  41.176  34.118  1.00 42.47 ? 397  ASN A CG  1 
ATOM   3172  O  OD1 . ASN A 1 394 ? 12.832  41.553  35.036  1.00 42.36 ? 397  ASN A OD1 1 
ATOM   3173  N  ND2 . ASN A 1 394 ? 12.590  40.717  32.974  1.00 42.42 ? 397  ASN A ND2 1 
ATOM   3174  N  N   . GLN A 1 395 ? 9.306   44.553  35.118  1.00 41.69 ? 398  GLN A N   1 
ATOM   3175  C  CA  . GLN A 1 395 ? 9.173   45.927  34.646  1.00 40.87 ? 398  GLN A CA  1 
ATOM   3176  C  C   . GLN A 1 395 ? 8.651   46.071  33.224  1.00 40.45 ? 398  GLN A C   1 
ATOM   3177  O  O   . GLN A 1 395 ? 8.825   47.106  32.595  1.00 40.54 ? 398  GLN A O   1 
ATOM   3178  C  CB  . GLN A 1 395 ? 10.463  46.720  34.870  1.00 40.54 ? 398  GLN A CB  1 
ATOM   3179  C  CG  . GLN A 1 395 ? 10.653  47.105  36.334  1.00 40.27 ? 398  GLN A CG  1 
ATOM   3180  C  CD  . GLN A 1 395 ? 12.003  47.725  36.633  1.00 40.15 ? 398  GLN A CD  1 
ATOM   3181  O  OE1 . GLN A 1 395 ? 12.972  47.022  36.930  1.00 40.03 ? 398  GLN A OE1 1 
ATOM   3182  N  NE2 . GLN A 1 395 ? 12.068  49.048  36.592  1.00 39.76 ? 398  GLN A NE2 1 
ATOM   3183  N  N   . GLY A 1 396 ? 7.974   45.035  32.742  1.00 40.13 ? 399  GLY A N   1 
ATOM   3184  C  CA  . GLY A 1 396 ? 7.378   45.056  31.414  1.00 39.37 ? 399  GLY A CA  1 
ATOM   3185  C  C   . GLY A 1 396 ? 8.255   45.378  30.221  1.00 38.92 ? 399  GLY A C   1 
ATOM   3186  O  O   . GLY A 1 396 ? 9.363   44.857  30.083  1.00 38.82 ? 399  GLY A O   1 
ATOM   3187  N  N   . GLY A 1 397 ? 7.736   46.231  29.343  1.00 38.57 ? 400  GLY A N   1 
ATOM   3188  C  CA  . GLY A 1 397 ? 8.463   46.609  28.147  1.00 38.19 ? 400  GLY A CA  1 
ATOM   3189  C  C   . GLY A 1 397 ? 9.162   47.947  28.217  1.00 37.94 ? 400  GLY A C   1 
ATOM   3190  O  O   . GLY A 1 397 ? 9.536   48.499  27.187  1.00 37.92 ? 400  GLY A O   1 
ATOM   3191  N  N   . ALA A 1 398 ? 9.357   48.459  29.429  1.00 37.75 ? 401  ALA A N   1 
ATOM   3192  C  CA  . ALA A 1 398 ? 10.017  49.743  29.642  1.00 37.44 ? 401  ALA A CA  1 
ATOM   3193  C  C   . ALA A 1 398 ? 11.462  49.702  29.172  1.00 37.44 ? 401  ALA A C   1 
ATOM   3194  O  O   . ALA A 1 398 ? 12.153  48.711  29.394  1.00 37.48 ? 401  ALA A O   1 
ATOM   3195  C  CB  . ALA A 1 398 ? 9.969   50.106  31.114  1.00 37.18 ? 401  ALA A CB  1 
ATOM   3196  N  N   . PRO A 1 399 ? 11.935  50.775  28.500  1.00 37.45 ? 402  PRO A N   1 
ATOM   3197  C  CA  . PRO A 1 399 ? 13.312  50.874  27.997  1.00 37.31 ? 402  PRO A CA  1 
ATOM   3198  C  C   . PRO A 1 399 ? 14.273  50.425  29.094  1.00 37.30 ? 402  PRO A C   1 
ATOM   3199  O  O   . PRO A 1 399 ? 14.198  50.901  30.230  1.00 37.17 ? 402  PRO A O   1 
ATOM   3200  C  CB  . PRO A 1 399 ? 13.443  52.362  27.694  1.00 37.29 ? 402  PRO A CB  1 
ATOM   3201  C  CG  . PRO A 1 399 ? 12.078  52.687  27.164  1.00 37.22 ? 402  PRO A CG  1 
ATOM   3202  C  CD  . PRO A 1 399 ? 11.168  51.988  28.159  1.00 37.37 ? 402  PRO A CD  1 
ATOM   3203  N  N   . ASN A 1 400 ? 15.148  49.482  28.758  1.00 37.40 ? 403  ASN A N   1 
ATOM   3204  C  CA  . ASN A 1 400 ? 16.074  48.911  29.733  1.00 37.36 ? 403  ASN A CA  1 
ATOM   3205  C  C   . ASN A 1 400 ? 17.474  49.511  29.808  1.00 37.44 ? 403  ASN A C   1 
ATOM   3206  O  O   . ASN A 1 400 ? 18.362  48.928  30.431  1.00 37.47 ? 403  ASN A O   1 
ATOM   3207  C  CB  . ASN A 1 400 ? 16.184  47.407  29.496  1.00 37.00 ? 403  ASN A CB  1 
ATOM   3208  C  CG  . ASN A 1 400 ? 16.801  47.081  28.163  1.00 36.63 ? 403  ASN A CG  1 
ATOM   3209  O  OD1 . ASN A 1 400 ? 17.180  47.973  27.411  1.00 36.53 ? 403  ASN A OD1 1 
ATOM   3210  N  ND2 . ASN A 1 400 ? 16.916  45.800  27.863  1.00 36.85 ? 403  ASN A ND2 1 
ATOM   3211  N  N   . TYR A 1 401 ? 17.677  50.670  29.193  1.00 37.55 ? 404  TYR A N   1 
ATOM   3212  C  CA  . TYR A 1 401 ? 18.988  51.301  29.222  1.00 37.61 ? 404  TYR A CA  1 
ATOM   3213  C  C   . TYR A 1 401 ? 18.892  52.763  29.658  1.00 37.47 ? 404  TYR A C   1 
ATOM   3214  O  O   . TYR A 1 401 ? 17.895  53.436  29.384  1.00 37.43 ? 404  TYR A O   1 
ATOM   3215  C  CB  . TYR A 1 401 ? 19.647  51.185  27.850  1.00 37.81 ? 404  TYR A CB  1 
ATOM   3216  C  CG  . TYR A 1 401 ? 18.872  51.882  26.757  1.00 38.15 ? 404  TYR A CG  1 
ATOM   3217  C  CD1 . TYR A 1 401 ? 19.263  53.142  26.293  1.00 38.15 ? 404  TYR A CD1 1 
ATOM   3218  C  CD2 . TYR A 1 401 ? 17.733  51.300  26.202  1.00 38.11 ? 404  TYR A CD2 1 
ATOM   3219  C  CE1 . TYR A 1 401 ? 18.540  53.806  25.302  1.00 38.22 ? 404  TYR A CE1 1 
ATOM   3220  C  CE2 . TYR A 1 401 ? 17.002  51.962  25.211  1.00 38.32 ? 404  TYR A CE2 1 
ATOM   3221  C  CZ  . TYR A 1 401 ? 17.414  53.212  24.767  1.00 38.25 ? 404  TYR A CZ  1 
ATOM   3222  O  OH  . TYR A 1 401 ? 16.707  53.861  23.785  1.00 38.15 ? 404  TYR A OH  1 
ATOM   3223  N  N   . TYR A 1 402 ? 19.926  53.238  30.353  1.00 37.40 ? 405  TYR A N   1 
ATOM   3224  C  CA  . TYR A 1 402 ? 19.984  54.612  30.846  1.00 37.26 ? 405  TYR A CA  1 
ATOM   3225  C  C   . TYR A 1 402 ? 21.313  55.237  30.416  1.00 37.21 ? 405  TYR A C   1 
ATOM   3226  O  O   . TYR A 1 402 ? 22.377  54.669  30.648  1.00 37.10 ? 405  TYR A O   1 
ATOM   3227  C  CB  . TYR A 1 402 ? 19.882  54.613  32.373  1.00 37.29 ? 405  TYR A CB  1 
ATOM   3228  C  CG  . TYR A 1 402 ? 19.644  55.975  32.995  1.00 37.52 ? 405  TYR A CG  1 
ATOM   3229  C  CD1 . TYR A 1 402 ? 18.491  56.701  32.708  1.00 37.61 ? 405  TYR A CD1 1 
ATOM   3230  C  CD2 . TYR A 1 402 ? 20.556  56.526  33.896  1.00 37.50 ? 405  TYR A CD2 1 
ATOM   3231  C  CE1 . TYR A 1 402 ? 18.249  57.942  33.305  1.00 37.64 ? 405  TYR A CE1 1 
ATOM   3232  C  CE2 . TYR A 1 402 ? 20.322  57.769  34.498  1.00 37.58 ? 405  TYR A CE2 1 
ATOM   3233  C  CZ  . TYR A 1 402 ? 19.167  58.468  34.196  1.00 37.63 ? 405  TYR A CZ  1 
ATOM   3234  O  OH  . TYR A 1 402 ? 18.919  59.689  34.774  1.00 37.52 ? 405  TYR A OH  1 
ATOM   3235  N  N   . PRO A 1 403 ? 21.274  56.432  29.808  1.00 37.27 ? 406  PRO A N   1 
ATOM   3236  C  CA  . PRO A 1 403 ? 20.105  57.253  29.487  1.00 37.34 ? 406  PRO A CA  1 
ATOM   3237  C  C   . PRO A 1 403 ? 19.380  56.838  28.206  1.00 37.57 ? 406  PRO A C   1 
ATOM   3238  O  O   . PRO A 1 403 ? 19.946  56.161  27.347  1.00 37.51 ? 406  PRO A O   1 
ATOM   3239  C  CB  . PRO A 1 403 ? 20.715  58.635  29.340  1.00 37.35 ? 406  PRO A CB  1 
ATOM   3240  C  CG  . PRO A 1 403 ? 22.010  58.327  28.674  1.00 37.25 ? 406  PRO A CG  1 
ATOM   3241  C  CD  . PRO A 1 403 ? 22.517  57.155  29.481  1.00 37.26 ? 406  PRO A CD  1 
ATOM   3242  N  N   . ASN A 1 404 ? 18.133  57.275  28.078  1.00 37.82 ? 407  ASN A N   1 
ATOM   3243  C  CA  . ASN A 1 404 ? 17.311  56.963  26.914  1.00 38.09 ? 407  ASN A CA  1 
ATOM   3244  C  C   . ASN A 1 404 ? 16.400  58.134  26.602  1.00 38.09 ? 407  ASN A C   1 
ATOM   3245  O  O   . ASN A 1 404 ? 16.143  58.973  27.464  1.00 38.17 ? 407  ASN A O   1 
ATOM   3246  C  CB  . ASN A 1 404 ? 16.453  55.735  27.190  1.00 38.25 ? 407  ASN A CB  1 
ATOM   3247  C  CG  . ASN A 1 404 ? 15.497  55.950  28.338  1.00 38.57 ? 407  ASN A CG  1 
ATOM   3248  O  OD1 . ASN A 1 404 ? 15.797  55.591  29.482  1.00 39.15 ? 407  ASN A OD1 1 
ATOM   3249  N  ND2 . ASN A 1 404 ? 14.345  56.550  28.049  1.00 38.21 ? 407  ASN A ND2 1 
ATOM   3250  N  N   . SER A 1 405 ? 15.880  58.162  25.381  1.00 38.16 ? 408  SER A N   1 
ATOM   3251  C  CA  . SER A 1 405 ? 14.995  59.237  24.953  1.00 38.22 ? 408  SER A CA  1 
ATOM   3252  C  C   . SER A 1 405 ? 13.553  58.751  24.939  1.00 38.33 ? 408  SER A C   1 
ATOM   3253  O  O   . SER A 1 405 ? 12.705  59.339  24.271  1.00 38.41 ? 408  SER A O   1 
ATOM   3254  C  CB  . SER A 1 405 ? 15.379  59.692  23.542  1.00 38.04 ? 408  SER A CB  1 
ATOM   3255  O  OG  . SER A 1 405 ? 16.748  60.051  23.460  1.00 37.88 ? 408  SER A OG  1 
ATOM   3256  N  N   . PHE A 1 406 ? 13.256  57.702  25.697  1.00 38.34 ? 409  PHE A N   1 
ATOM   3257  C  CA  . PHE A 1 406 ? 11.906  57.169  25.674  1.00 38.47 ? 409  PHE A CA  1 
ATOM   3258  C  C   . PHE A 1 406 ? 11.074  57.218  26.946  1.00 38.52 ? 409  PHE A C   1 
ATOM   3259  O  O   . PHE A 1 406 ? 10.125  56.455  27.090  1.00 38.65 ? 409  PHE A O   1 
ATOM   3260  C  CB  . PHE A 1 406 ? 11.925  55.767  25.073  1.00 38.41 ? 409  PHE A CB  1 
ATOM   3261  C  CG  . PHE A 1 406 ? 12.454  55.732  23.667  1.00 38.31 ? 409  PHE A CG  1 
ATOM   3262  C  CD1 . PHE A 1 406 ? 13.822  55.708  23.424  1.00 38.25 ? 409  PHE A CD1 1 
ATOM   3263  C  CD2 . PHE A 1 406 ? 11.587  55.745  22.583  1.00 38.30 ? 409  PHE A CD2 1 
ATOM   3264  C  CE1 . PHE A 1 406 ? 14.319  55.698  22.119  1.00 38.25 ? 409  PHE A CE1 1 
ATOM   3265  C  CE2 . PHE A 1 406 ? 12.077  55.735  21.272  1.00 38.28 ? 409  PHE A CE2 1 
ATOM   3266  C  CZ  . PHE A 1 406 ? 13.445  55.712  21.043  1.00 38.12 ? 409  PHE A CZ  1 
ATOM   3267  N  N   . GLY A 1 407 ? 11.422  58.125  27.856  1.00 38.72 ? 410  GLY A N   1 
ATOM   3268  C  CA  . GLY A 1 407 ? 10.668  58.295  29.092  1.00 38.85 ? 410  GLY A CA  1 
ATOM   3269  C  C   . GLY A 1 407 ? 10.794  57.293  30.227  1.00 38.99 ? 410  GLY A C   1 
ATOM   3270  O  O   . GLY A 1 407 ? 9.890   57.201  31.051  1.00 39.05 ? 410  GLY A O   1 
ATOM   3271  N  N   . ALA A 1 408 ? 11.896  56.551  30.285  1.00 39.20 ? 411  ALA A N   1 
ATOM   3272  C  CA  . ALA A 1 408 ? 12.108  55.568  31.343  1.00 39.24 ? 411  ALA A CA  1 
ATOM   3273  C  C   . ALA A 1 408 ? 12.569  56.291  32.614  1.00 39.52 ? 411  ALA A C   1 
ATOM   3274  O  O   . ALA A 1 408 ? 12.789  57.498  32.590  1.00 39.49 ? 411  ALA A O   1 
ATOM   3275  C  CB  . ALA A 1 408 ? 13.128  54.547  30.889  1.00 39.33 ? 411  ALA A CB  1 
ATOM   3276  N  N   . PRO A 1 409 ? 12.709  55.572  33.741  1.00 39.66 ? 412  PRO A N   1 
ATOM   3277  C  CA  . PRO A 1 409 ? 13.136  56.161  35.019  1.00 39.94 ? 412  PRO A CA  1 
ATOM   3278  C  C   . PRO A 1 409 ? 14.343  57.106  34.999  1.00 40.19 ? 412  PRO A C   1 
ATOM   3279  O  O   . PRO A 1 409 ? 15.342  56.840  34.343  1.00 40.08 ? 412  PRO A O   1 
ATOM   3280  C  CB  . PRO A 1 409 ? 13.398  54.928  35.874  1.00 39.89 ? 412  PRO A CB  1 
ATOM   3281  C  CG  . PRO A 1 409 ? 12.337  53.998  35.409  1.00 39.59 ? 412  PRO A CG  1 
ATOM   3282  C  CD  . PRO A 1 409 ? 12.409  54.138  33.912  1.00 39.55 ? 412  PRO A CD  1 
ATOM   3283  N  N   . GLU A 1 410 ? 14.254  58.184  35.771  1.00 40.71 ? 413  GLU A N   1 
ATOM   3284  C  CA  . GLU A 1 410 ? 15.316  59.187  35.848  1.00 41.40 ? 413  GLU A CA  1 
ATOM   3285  C  C   . GLU A 1 410 ? 15.915  59.352  37.243  1.00 41.82 ? 413  GLU A C   1 
ATOM   3286  O  O   . GLU A 1 410 ? 15.207  59.251  38.247  1.00 41.79 ? 413  GLU A O   1 
ATOM   3287  C  CB  . GLU A 1 410 ? 14.778  60.548  35.402  1.00 41.46 ? 413  GLU A CB  1 
ATOM   3288  C  CG  . GLU A 1 410 ? 14.472  60.666  33.929  1.00 41.60 ? 413  GLU A CG  1 
ATOM   3289  C  CD  . GLU A 1 410 ? 15.720  60.692  33.079  1.00 41.83 ? 413  GLU A CD  1 
ATOM   3290  O  OE1 . GLU A 1 410 ? 15.668  60.170  31.945  1.00 41.99 ? 413  GLU A OE1 1 
ATOM   3291  O  OE2 . GLU A 1 410 ? 16.753  61.236  33.536  1.00 41.92 ? 413  GLU A OE2 1 
ATOM   3292  N  N   . GLN A 1 411 ? 17.212  59.646  37.302  1.00 42.41 ? 414  GLN A N   1 
ATOM   3293  C  CA  . GLN A 1 411 ? 17.888  59.849  38.582  1.00 43.03 ? 414  GLN A CA  1 
ATOM   3294  C  C   . GLN A 1 411 ? 17.319  61.101  39.231  1.00 43.75 ? 414  GLN A C   1 
ATOM   3295  O  O   . GLN A 1 411 ? 16.827  62.001  38.546  1.00 43.88 ? 414  GLN A O   1 
ATOM   3296  C  CB  . GLN A 1 411 ? 19.405  59.972  38.397  1.00 42.63 ? 414  GLN A CB  1 
ATOM   3297  C  CG  . GLN A 1 411 ? 19.854  61.162  37.570  1.00 42.51 ? 414  GLN A CG  1 
ATOM   3298  C  CD  . GLN A 1 411 ? 21.205  60.947  36.909  1.00 42.60 ? 414  GLN A CD  1 
ATOM   3299  O  OE1 . GLN A 1 411 ? 21.790  59.865  36.990  1.00 42.63 ? 414  GLN A OE1 1 
ATOM   3300  N  NE2 . GLN A 1 411 ? 21.695  61.971  36.223  1.00 42.55 ? 414  GLN A NE2 1 
ATOM   3301  N  N   . GLN A 1 412 ? 17.380  61.151  40.555  1.00 44.65 ? 415  GLN A N   1 
ATOM   3302  C  CA  . GLN A 1 412 ? 16.843  62.274  41.302  1.00 45.47 ? 415  GLN A CA  1 
ATOM   3303  C  C   . GLN A 1 412 ? 17.968  62.929  42.097  1.00 45.99 ? 415  GLN A C   1 
ATOM   3304  O  O   . GLN A 1 412 ? 18.389  62.407  43.131  1.00 45.98 ? 415  GLN A O   1 
ATOM   3305  C  CB  . GLN A 1 412 ? 15.755  61.756  42.235  1.00 45.77 ? 415  GLN A CB  1 
ATOM   3306  C  CG  . GLN A 1 412 ? 14.851  62.807  42.825  1.00 46.39 ? 415  GLN A CG  1 
ATOM   3307  C  CD  . GLN A 1 412 ? 13.833  62.193  43.763  1.00 46.75 ? 415  GLN A CD  1 
ATOM   3308  O  OE1 . GLN A 1 412 ? 14.166  61.781  44.877  1.00 46.98 ? 415  GLN A OE1 1 
ATOM   3309  N  NE2 . GLN A 1 412 ? 12.590  62.103  43.309  1.00 47.00 ? 415  GLN A NE2 1 
ATOM   3310  N  N   . PRO A 1 413 ? 18.460  64.089  41.623  1.00 46.40 ? 416  PRO A N   1 
ATOM   3311  C  CA  . PRO A 1 413 ? 19.539  64.900  42.202  1.00 46.78 ? 416  PRO A CA  1 
ATOM   3312  C  C   . PRO A 1 413 ? 19.488  65.174  43.703  1.00 47.15 ? 416  PRO A C   1 
ATOM   3313  O  O   . PRO A 1 413 ? 20.529  65.378  44.329  1.00 47.20 ? 416  PRO A O   1 
ATOM   3314  C  CB  . PRO A 1 413 ? 19.453  66.186  41.391  1.00 46.78 ? 416  PRO A CB  1 
ATOM   3315  C  CG  . PRO A 1 413 ? 19.094  65.674  40.046  1.00 46.67 ? 416  PRO A CG  1 
ATOM   3316  C  CD  . PRO A 1 413 ? 17.975  64.709  40.379  1.00 46.55 ? 416  PRO A CD  1 
ATOM   3317  N  N   . SER A 1 414 ? 18.293  65.189  44.283  1.00 47.59 ? 417  SER A N   1 
ATOM   3318  C  CA  . SER A 1 414 ? 18.167  65.434  45.719  1.00 48.17 ? 417  SER A CA  1 
ATOM   3319  C  C   . SER A 1 414 ? 18.583  64.220  46.554  1.00 48.44 ? 417  SER A C   1 
ATOM   3320  O  O   . SER A 1 414 ? 18.702  64.310  47.781  1.00 48.52 ? 417  SER A O   1 
ATOM   3321  C  CB  . SER A 1 414 ? 16.731  65.831  46.069  1.00 48.25 ? 417  SER A CB  1 
ATOM   3322  O  OG  . SER A 1 414 ? 15.819  64.787  45.766  1.00 48.58 ? 417  SER A OG  1 
ATOM   3323  N  N   . ALA A 1 415 ? 18.797  63.090  45.883  1.00 48.73 ? 418  ALA A N   1 
ATOM   3324  C  CA  . ALA A 1 415 ? 19.186  61.851  46.555  1.00 48.95 ? 418  ALA A CA  1 
ATOM   3325  C  C   . ALA A 1 415 ? 20.696  61.630  46.628  1.00 49.15 ? 418  ALA A C   1 
ATOM   3326  O  O   . ALA A 1 415 ? 21.146  60.590  47.129  1.00 49.18 ? 418  ALA A O   1 
ATOM   3327  C  CB  . ALA A 1 415 ? 18.516  60.659  45.887  1.00 48.95 ? 418  ALA A CB  1 
ATOM   3328  N  N   . LEU A 1 416 ? 21.474  62.597  46.134  1.00 49.16 ? 419  LEU A N   1 
ATOM   3329  C  CA  . LEU A 1 416 ? 22.928  62.489  46.160  1.00 49.22 ? 419  LEU A CA  1 
ATOM   3330  C  C   . LEU A 1 416 ? 23.494  62.421  47.568  1.00 49.39 ? 419  LEU A C   1 
ATOM   3331  O  O   . LEU A 1 416 ? 23.005  63.086  48.489  1.00 49.45 ? 419  LEU A O   1 
ATOM   3332  C  CB  . LEU A 1 416 ? 23.588  63.637  45.399  1.00 49.08 ? 419  LEU A CB  1 
ATOM   3333  C  CG  . LEU A 1 416 ? 23.961  63.339  43.945  1.00 49.15 ? 419  LEU A CG  1 
ATOM   3334  C  CD1 . LEU A 1 416 ? 24.697  64.535  43.357  1.00 49.25 ? 419  LEU A CD1 1 
ATOM   3335  C  CD2 . LEU A 1 416 ? 24.829  62.087  43.856  1.00 49.06 ? 419  LEU A CD2 1 
ATOM   3336  N  N   . GLU A 1 417 ? 24.534  61.605  47.717  1.00 49.42 ? 420  GLU A N   1 
ATOM   3337  C  CA  . GLU A 1 417 ? 25.209  61.405  48.991  1.00 49.49 ? 420  GLU A CA  1 
ATOM   3338  C  C   . GLU A 1 417 ? 25.988  62.647  49.440  1.00 49.43 ? 420  GLU A C   1 
ATOM   3339  O  O   . GLU A 1 417 ? 26.292  63.532  48.634  1.00 49.49 ? 420  GLU A O   1 
ATOM   3340  C  CB  . GLU A 1 417 ? 26.163  60.214  48.882  1.00 49.67 ? 420  GLU A CB  1 
ATOM   3341  C  CG  . GLU A 1 417 ? 25.552  58.956  48.249  1.00 49.96 ? 420  GLU A CG  1 
ATOM   3342  C  CD  . GLU A 1 417 ? 25.805  58.826  46.735  1.00 50.00 ? 420  GLU A CD  1 
ATOM   3343  O  OE1 . GLU A 1 417 ? 26.308  59.784  46.090  1.00 49.82 ? 420  GLU A OE1 1 
ATOM   3344  O  OE2 . GLU A 1 417 ? 25.499  57.739  46.195  1.00 49.88 ? 420  GLU A OE2 1 
ATOM   3345  N  N   . HIS A 1 418 ? 26.283  62.718  50.735  1.00 49.23 ? 421  HIS A N   1 
ATOM   3346  C  CA  . HIS A 1 418 ? 27.034  63.836  51.295  1.00 49.06 ? 421  HIS A CA  1 
ATOM   3347  C  C   . HIS A 1 418 ? 28.514  63.588  51.040  1.00 49.04 ? 421  HIS A C   1 
ATOM   3348  O  O   . HIS A 1 418 ? 29.033  62.535  51.407  1.00 49.18 ? 421  HIS A O   1 
ATOM   3349  C  CB  . HIS A 1 418 ? 26.763  63.933  52.801  1.00 48.93 ? 421  HIS A CB  1 
ATOM   3350  C  CG  . HIS A 1 418 ? 27.711  64.829  53.542  1.00 48.74 ? 421  HIS A CG  1 
ATOM   3351  N  ND1 . HIS A 1 418 ? 27.529  66.193  53.636  1.00 48.60 ? 421  HIS A ND1 1 
ATOM   3352  C  CD2 . HIS A 1 418 ? 28.839  64.552  54.238  1.00 48.48 ? 421  HIS A CD2 1 
ATOM   3353  C  CE1 . HIS A 1 418 ? 28.505  66.717  54.356  1.00 48.47 ? 421  HIS A CE1 1 
ATOM   3354  N  NE2 . HIS A 1 418 ? 29.313  65.743  54.733  1.00 48.50 ? 421  HIS A NE2 1 
ATOM   3355  N  N   . SER A 1 419 ? 29.194  64.544  50.410  1.00 48.94 ? 422  SER A N   1 
ATOM   3356  C  CA  . SER A 1 419 ? 30.620  64.379  50.134  1.00 48.92 ? 422  SER A CA  1 
ATOM   3357  C  C   . SER A 1 419 ? 31.570  64.997  51.167  1.00 48.77 ? 422  SER A C   1 
ATOM   3358  O  O   . SER A 1 419 ? 31.360  66.115  51.657  1.00 48.70 ? 422  SER A O   1 
ATOM   3359  C  CB  . SER A 1 419 ? 30.977  64.833  48.710  1.00 49.03 ? 422  SER A CB  1 
ATOM   3360  O  OG  . SER A 1 419 ? 30.658  66.191  48.483  1.00 49.32 ? 422  SER A OG  1 
ATOM   3361  N  N   . ILE A 1 420 ? 32.616  64.236  51.486  1.00 48.52 ? 423  ILE A N   1 
ATOM   3362  C  CA  . ILE A 1 420 ? 33.635  64.623  52.453  1.00 48.25 ? 423  ILE A CA  1 
ATOM   3363  C  C   . ILE A 1 420 ? 35.005  64.560  51.789  1.00 48.09 ? 423  ILE A C   1 
ATOM   3364  O  O   . ILE A 1 420 ? 35.216  63.779  50.864  1.00 48.05 ? 423  ILE A O   1 
ATOM   3365  C  CB  . ILE A 1 420 ? 33.631  63.652  53.653  1.00 48.28 ? 423  ILE A CB  1 
ATOM   3366  C  CG1 . ILE A 1 420 ? 32.245  63.628  54.298  1.00 48.21 ? 423  ILE A CG1 1 
ATOM   3367  C  CG2 . ILE A 1 420 ? 34.690  64.051  54.677  1.00 48.40 ? 423  ILE A CG2 1 
ATOM   3368  C  CD1 . ILE A 1 420 ? 32.092  62.585  55.370  1.00 48.16 ? 423  ILE A CD1 1 
ATOM   3369  N  N   . GLN A 1 421 ? 35.934  65.377  52.275  1.00 47.91 ? 424  GLN A N   1 
ATOM   3370  C  CA  . GLN A 1 421 ? 37.292  65.426  51.744  1.00 47.65 ? 424  GLN A CA  1 
ATOM   3371  C  C   . GLN A 1 421 ? 38.197  64.448  52.492  1.00 47.05 ? 424  GLN A C   1 
ATOM   3372  O  O   . GLN A 1 421 ? 38.108  64.308  53.710  1.00 46.88 ? 424  GLN A O   1 
ATOM   3373  C  CB  . GLN A 1 421 ? 37.840  66.854  51.873  1.00 48.38 ? 424  GLN A CB  1 
ATOM   3374  C  CG  . GLN A 1 421 ? 38.675  67.356  50.680  1.00 49.51 ? 424  GLN A CG  1 
ATOM   3375  C  CD  . GLN A 1 421 ? 40.156  66.981  50.772  1.00 50.12 ? 424  GLN A CD  1 
ATOM   3376  O  OE1 . GLN A 1 421 ? 40.674  66.704  51.861  1.00 50.66 ? 424  GLN A OE1 1 
ATOM   3377  N  NE2 . GLN A 1 421 ? 40.850  67.000  49.632  1.00 50.10 ? 424  GLN A NE2 1 
ATOM   3378  N  N   . TYR A 1 422 ? 39.033  63.733  51.747  1.00 46.32 ? 425  TYR A N   1 
ATOM   3379  C  CA  . TYR A 1 422 ? 39.974  62.784  52.335  1.00 45.64 ? 425  TYR A CA  1 
ATOM   3380  C  C   . TYR A 1 422 ? 41.326  62.990  51.696  1.00 45.21 ? 425  TYR A C   1 
ATOM   3381  O  O   . TYR A 1 422 ? 41.422  63.546  50.603  1.00 45.30 ? 425  TYR A O   1 
ATOM   3382  C  CB  . TYR A 1 422 ? 39.541  61.337  52.100  1.00 45.50 ? 425  TYR A CB  1 
ATOM   3383  C  CG  . TYR A 1 422 ? 38.339  60.907  52.903  1.00 45.46 ? 425  TYR A CG  1 
ATOM   3384  C  CD1 . TYR A 1 422 ? 38.478  60.401  54.194  1.00 45.34 ? 425  TYR A CD1 1 
ATOM   3385  C  CD2 . TYR A 1 422 ? 37.056  61.000  52.368  1.00 45.47 ? 425  TYR A CD2 1 
ATOM   3386  C  CE1 . TYR A 1 422 ? 37.365  59.999  54.929  1.00 45.32 ? 425  TYR A CE1 1 
ATOM   3387  C  CE2 . TYR A 1 422 ? 35.945  60.601  53.092  1.00 45.41 ? 425  TYR A CE2 1 
ATOM   3388  C  CZ  . TYR A 1 422 ? 36.105  60.103  54.366  1.00 45.41 ? 425  TYR A CZ  1 
ATOM   3389  O  OH  . TYR A 1 422 ? 34.995  59.704  55.065  1.00 45.90 ? 425  TYR A OH  1 
ATOM   3390  N  N   . SER A 1 423 ? 42.369  62.546  52.384  1.00 44.68 ? 426  SER A N   1 
ATOM   3391  C  CA  . SER A 1 423 ? 43.728  62.664  51.882  1.00 44.14 ? 426  SER A CA  1 
ATOM   3392  C  C   . SER A 1 423 ? 44.568  61.580  52.507  1.00 43.79 ? 426  SER A C   1 
ATOM   3393  O  O   . SER A 1 423 ? 44.557  61.407  53.726  1.00 44.03 ? 426  SER A O   1 
ATOM   3394  C  CB  . SER A 1 423 ? 44.326  64.024  52.238  1.00 44.11 ? 426  SER A CB  1 
ATOM   3395  O  OG  . SER A 1 423 ? 45.698  64.073  51.885  1.00 43.95 ? 426  SER A OG  1 
ATOM   3396  N  N   . GLY A 1 424 ? 45.286  60.840  51.674  1.00 43.33 ? 427  GLY A N   1 
ATOM   3397  C  CA  . GLY A 1 424 ? 46.130  59.783  52.194  1.00 42.60 ? 427  GLY A CA  1 
ATOM   3398  C  C   . GLY A 1 424 ? 46.439  58.690  51.200  1.00 42.14 ? 427  GLY A C   1 
ATOM   3399  O  O   . GLY A 1 424 ? 45.914  58.675  50.088  1.00 42.09 ? 427  GLY A O   1 
ATOM   3400  N  N   . GLU A 1 425 ? 47.340  57.798  51.583  1.00 41.71 ? 428  GLU A N   1 
ATOM   3401  C  CA  . GLU A 1 425 ? 47.699  56.689  50.724  1.00 41.37 ? 428  GLU A CA  1 
ATOM   3402  C  C   . GLU A 1 425 ? 46.615  55.641  50.788  1.00 40.97 ? 428  GLU A C   1 
ATOM   3403  O  O   . GLU A 1 425 ? 45.957  55.463  51.818  1.00 40.76 ? 428  GLU A O   1 
ATOM   3404  C  CB  . GLU A 1 425 ? 49.012  56.054  51.163  1.00 41.60 ? 428  GLU A CB  1 
ATOM   3405  C  CG  . GLU A 1 425 ? 50.237  56.866  50.835  1.00 42.00 ? 428  GLU A CG  1 
ATOM   3406  C  CD  . GLU A 1 425 ? 51.510  56.163  51.242  1.00 42.27 ? 428  GLU A CD  1 
ATOM   3407  O  OE1 . GLU A 1 425 ? 52.453  56.125  50.432  1.00 42.66 ? 428  GLU A OE1 1 
ATOM   3408  O  OE2 . GLU A 1 425 ? 51.575  55.639  52.372  1.00 42.57 ? 428  GLU A OE2 1 
ATOM   3409  N  N   . VAL A 1 426 ? 46.406  54.980  49.661  1.00 40.55 ? 429  VAL A N   1 
ATOM   3410  C  CA  . VAL A 1 426 ? 45.429  53.923  49.574  1.00 40.15 ? 429  VAL A CA  1 
ATOM   3411  C  C   . VAL A 1 426 ? 46.197  52.665  49.951  1.00 39.91 ? 429  VAL A C   1 
ATOM   3412  O  O   . VAL A 1 426 ? 46.829  52.027  49.110  1.00 39.91 ? 429  VAL A O   1 
ATOM   3413  C  CB  . VAL A 1 426 ? 44.853  53.849  48.152  1.00 40.19 ? 429  VAL A CB  1 
ATOM   3414  C  CG1 . VAL A 1 426 ? 44.168  52.531  47.925  1.00 40.49 ? 429  VAL A CG1 1 
ATOM   3415  C  CG2 . VAL A 1 426 ? 43.859  54.977  47.944  1.00 40.04 ? 429  VAL A CG2 1 
ATOM   3416  N  N   . ARG A 1 427 ? 46.207  52.360  51.242  1.00 39.53 ? 430  ARG A N   1 
ATOM   3417  C  CA  . ARG A 1 427 ? 46.921  51.194  51.737  1.00 39.23 ? 430  ARG A CA  1 
ATOM   3418  C  C   . ARG A 1 427 ? 46.254  50.555  52.939  1.00 38.86 ? 430  ARG A C   1 
ATOM   3419  O  O   . ARG A 1 427 ? 45.176  50.971  53.359  1.00 38.81 ? 430  ARG A O   1 
ATOM   3420  C  CB  . ARG A 1 427 ? 48.375  51.548  52.072  1.00 39.64 ? 430  ARG A CB  1 
ATOM   3421  C  CG  . ARG A 1 427 ? 48.566  52.605  53.138  1.00 39.99 ? 430  ARG A CG  1 
ATOM   3422  C  CD  . ARG A 1 427 ? 50.045  52.872  53.383  1.00 40.93 ? 430  ARG A CD  1 
ATOM   3423  N  NE  . ARG A 1 427 ? 50.748  51.699  53.905  1.00 42.12 ? 430  ARG A NE  1 
ATOM   3424  C  CZ  . ARG A 1 427 ? 50.740  51.315  55.186  1.00 42.86 ? 430  ARG A CZ  1 
ATOM   3425  N  NH1 . ARG A 1 427 ? 50.068  52.004  56.102  1.00 43.07 ? 430  ARG A NH1 1 
ATOM   3426  N  NH2 . ARG A 1 427 ? 51.410  50.233  55.564  1.00 43.18 ? 430  ARG A NH2 1 
ATOM   3427  N  N   . ARG A 1 428 ? 46.896  49.526  53.477  1.00 38.23 ? 431  ARG A N   1 
ATOM   3428  C  CA  . ARG A 1 428 ? 46.369  48.804  54.624  1.00 37.77 ? 431  ARG A CA  1 
ATOM   3429  C  C   . ARG A 1 428 ? 46.954  49.336  55.926  1.00 37.64 ? 431  ARG A C   1 
ATOM   3430  O  O   . ARG A 1 428 ? 48.070  48.987  56.308  1.00 37.63 ? 431  ARG A O   1 
ATOM   3431  C  CB  . ARG A 1 428 ? 46.657  47.310  54.467  1.00 37.33 ? 431  ARG A CB  1 
ATOM   3432  C  CG  . ARG A 1 428 ? 46.152  46.733  53.146  1.00 36.73 ? 431  ARG A CG  1 
ATOM   3433  C  CD  . ARG A 1 428 ? 46.501  45.255  52.991  1.00 36.24 ? 431  ARG A CD  1 
ATOM   3434  N  NE  . ARG A 1 428 ? 46.103  44.737  51.686  1.00 35.71 ? 431  ARG A NE  1 
ATOM   3435  C  CZ  . ARG A 1 428 ? 44.911  44.217  51.408  1.00 35.48 ? 431  ARG A CZ  1 
ATOM   3436  N  NH1 . ARG A 1 428 ? 43.979  44.130  52.346  1.00 35.13 ? 431  ARG A NH1 1 
ATOM   3437  N  NH2 . ARG A 1 428 ? 44.645  43.811  50.177  1.00 35.17 ? 431  ARG A NH2 1 
ATOM   3438  N  N   . PHE A 1 429 ? 46.197  50.197  56.598  1.00 37.53 ? 432  PHE A N   1 
ATOM   3439  C  CA  . PHE A 1 429 ? 46.634  50.792  57.856  1.00 37.46 ? 432  PHE A CA  1 
ATOM   3440  C  C   . PHE A 1 429 ? 46.323  49.885  59.046  1.00 37.47 ? 432  PHE A C   1 
ATOM   3441  O  O   . PHE A 1 429 ? 45.191  49.426  59.209  1.00 37.50 ? 432  PHE A O   1 
ATOM   3442  C  CB  . PHE A 1 429 ? 45.986  52.168  58.036  1.00 37.28 ? 432  PHE A CB  1 
ATOM   3443  C  CG  . PHE A 1 429 ? 46.342  53.151  56.950  1.00 37.19 ? 432  PHE A CG  1 
ATOM   3444  C  CD1 . PHE A 1 429 ? 47.488  53.940  57.052  1.00 37.08 ? 432  PHE A CD1 1 
ATOM   3445  C  CD2 . PHE A 1 429 ? 45.537  53.287  55.822  1.00 36.98 ? 432  PHE A CD2 1 
ATOM   3446  C  CE1 . PHE A 1 429 ? 47.826  54.850  56.042  1.00 36.92 ? 432  PHE A CE1 1 
ATOM   3447  C  CE2 . PHE A 1 429 ? 45.867  54.191  54.814  1.00 36.87 ? 432  PHE A CE2 1 
ATOM   3448  C  CZ  . PHE A 1 429 ? 47.014  54.973  54.926  1.00 36.90 ? 432  PHE A CZ  1 
ATOM   3449  N  N   . ASN A 1 430 ? 47.329  49.643  59.884  1.00 37.33 ? 433  ASN A N   1 
ATOM   3450  C  CA  . ASN A 1 430 ? 47.172  48.774  61.047  1.00 37.29 ? 433  ASN A CA  1 
ATOM   3451  C  C   . ASN A 1 430 ? 46.382  49.417  62.187  1.00 37.56 ? 433  ASN A C   1 
ATOM   3452  O  O   . ASN A 1 430 ? 46.674  50.537  62.615  1.00 37.39 ? 433  ASN A O   1 
ATOM   3453  C  CB  . ASN A 1 430 ? 48.545  48.315  61.548  1.00 36.98 ? 433  ASN A CB  1 
ATOM   3454  C  CG  . ASN A 1 430 ? 48.469  47.074  62.419  1.00 36.81 ? 433  ASN A CG  1 
ATOM   3455  O  OD1 . ASN A 1 430 ? 47.458  46.379  62.449  1.00 36.87 ? 433  ASN A OD1 1 
ATOM   3456  N  ND2 . ASN A 1 430 ? 49.547  46.789  63.129  1.00 36.78 ? 433  ASN A ND2 1 
ATOM   3457  N  N   . THR A 1 431 ? 45.377  48.697  62.678  1.00 37.85 ? 434  THR A N   1 
ATOM   3458  C  CA  . THR A 1 431 ? 44.545  49.184  63.776  1.00 38.10 ? 434  THR A CA  1 
ATOM   3459  C  C   . THR A 1 431 ? 44.590  48.216  64.943  1.00 38.42 ? 434  THR A C   1 
ATOM   3460  O  O   . THR A 1 431 ? 43.888  48.403  65.938  1.00 38.49 ? 434  THR A O   1 
ATOM   3461  C  CB  . THR A 1 431 ? 43.071  49.343  63.359  1.00 38.06 ? 434  THR A CB  1 
ATOM   3462  O  OG1 . THR A 1 431 ? 42.583  48.102  62.831  1.00 37.82 ? 434  THR A OG1 1 
ATOM   3463  C  CG2 . THR A 1 431 ? 42.922  50.432  62.325  1.00 37.89 ? 434  THR A CG2 1 
ATOM   3464  N  N   . ALA A 1 432 ? 45.410  47.176  64.811  1.00 38.68 ? 435  ALA A N   1 
ATOM   3465  C  CA  . ALA A 1 432 ? 45.549  46.158  65.846  1.00 38.99 ? 435  ALA A CA  1 
ATOM   3466  C  C   . ALA A 1 432 ? 46.004  46.756  67.164  1.00 39.33 ? 435  ALA A C   1 
ATOM   3467  O  O   . ALA A 1 432 ? 45.652  46.253  68.231  1.00 39.26 ? 435  ALA A O   1 
ATOM   3468  C  CB  . ALA A 1 432 ? 46.535  45.092  65.401  1.00 38.95 ? 435  ALA A CB  1 
ATOM   3469  N  N   . ASN A 1 433 ? 46.750  47.854  67.097  1.00 39.72 ? 436  ASN A N   1 
ATOM   3470  C  CA  . ASN A 1 433 ? 47.256  48.465  68.309  1.00 40.11 ? 436  ASN A CA  1 
ATOM   3471  C  C   . ASN A 1 433 ? 46.582  49.726  68.781  1.00 40.30 ? 436  ASN A C   1 
ATOM   3472  O  O   . ASN A 1 433 ? 47.181  50.521  69.500  1.00 40.36 ? 436  ASN A O   1 
ATOM   3473  C  CB  . ASN A 1 433 ? 48.756  48.652  68.221  1.00 40.11 ? 436  ASN A CB  1 
ATOM   3474  C  CG  . ASN A 1 433 ? 49.460  47.369  67.909  1.00 40.30 ? 436  ASN A CG  1 
ATOM   3475  O  OD1 . ASN A 1 433 ? 50.181  47.279  66.921  1.00 40.86 ? 436  ASN A OD1 1 
ATOM   3476  N  ND2 . ASN A 1 433 ? 49.218  46.344  68.718  1.00 40.24 ? 436  ASN A ND2 1 
ATOM   3477  N  N   . ASP A 1 434 ? 45.342  49.931  68.361  1.00 40.53 ? 437  ASP A N   1 
ATOM   3478  C  CA  . ASP A 1 434 ? 44.605  51.068  68.864  1.00 40.98 ? 437  ASP A CA  1 
ATOM   3479  C  C   . ASP A 1 434 ? 44.384  50.698  70.324  1.00 40.98 ? 437  ASP A C   1 
ATOM   3480  O  O   . ASP A 1 434 ? 44.728  49.590  70.744  1.00 41.13 ? 437  ASP A O   1 
ATOM   3481  C  CB  . ASP A 1 434 ? 43.252  51.184  68.178  1.00 41.54 ? 437  ASP A CB  1 
ATOM   3482  C  CG  . ASP A 1 434 ? 43.361  51.694  66.774  1.00 42.17 ? 437  ASP A CG  1 
ATOM   3483  O  OD1 . ASP A 1 434 ? 42.357  51.629  66.044  1.00 42.87 ? 437  ASP A OD1 1 
ATOM   3484  O  OD2 . ASP A 1 434 ? 44.447  52.167  66.388  1.00 42.91 ? 437  ASP A OD2 1 
ATOM   3485  N  N   . ASP A 1 435 ? 43.818  51.603  71.107  1.00 40.70 ? 438  ASP A N   1 
ATOM   3486  C  CA  . ASP A 1 435 ? 43.571  51.294  72.506  1.00 40.41 ? 438  ASP A CA  1 
ATOM   3487  C  C   . ASP A 1 435 ? 42.638  50.096  72.606  1.00 40.23 ? 438  ASP A C   1 
ATOM   3488  O  O   . ASP A 1 435 ? 41.563  50.090  72.018  1.00 40.29 ? 438  ASP A O   1 
ATOM   3489  C  CB  . ASP A 1 435 ? 42.929  52.478  73.207  1.00 40.42 ? 438  ASP A CB  1 
ATOM   3490  C  CG  . ASP A 1 435 ? 42.864  52.287  74.688  1.00 40.34 ? 438  ASP A CG  1 
ATOM   3491  O  OD1 . ASP A 1 435 ? 43.587  53.022  75.378  1.00 40.85 ? 438  ASP A OD1 1 
ATOM   3492  O  OD2 . ASP A 1 435 ? 42.122  51.399  75.166  1.00 40.27 ? 438  ASP A OD2 1 
ATOM   3493  N  N   . ASN A 1 436 ? 43.044  49.089  73.364  1.00 39.92 ? 439  ASN A N   1 
ATOM   3494  C  CA  . ASN A 1 436 ? 42.227  47.899  73.523  1.00 39.67 ? 439  ASN A CA  1 
ATOM   3495  C  C   . ASN A 1 436 ? 41.793  47.701  74.960  1.00 39.72 ? 439  ASN A C   1 
ATOM   3496  O  O   . ASN A 1 436 ? 41.078  46.741  75.255  1.00 39.70 ? 439  ASN A O   1 
ATOM   3497  C  CB  . ASN A 1 436 ? 43.016  46.656  73.108  1.00 39.47 ? 439  ASN A CB  1 
ATOM   3498  C  CG  . ASN A 1 436 ? 43.465  46.696  71.664  1.00 39.24 ? 439  ASN A CG  1 
ATOM   3499  O  OD1 . ASN A 1 436 ? 44.560  46.248  71.337  1.00 39.18 ? 439  ASN A OD1 1 
ATOM   3500  N  ND2 . ASN A 1 436 ? 42.617  47.214  70.790  1.00 39.16 ? 439  ASN A ND2 1 
ATOM   3501  N  N   . VAL A 1 437 ? 42.169  48.615  75.852  1.00 39.55 ? 440  VAL A N   1 
ATOM   3502  C  CA  . VAL A 1 437 ? 41.842  48.409  77.255  1.00 39.44 ? 440  VAL A CA  1 
ATOM   3503  C  C   . VAL A 1 437 ? 41.167  49.503  78.063  1.00 39.61 ? 440  VAL A C   1 
ATOM   3504  O  O   . VAL A 1 437 ? 40.470  49.194  79.031  1.00 39.59 ? 440  VAL A O   1 
ATOM   3505  C  CB  . VAL A 1 437 ? 43.102  47.980  78.045  1.00 39.32 ? 440  VAL A CB  1 
ATOM   3506  C  CG1 . VAL A 1 437 ? 43.687  46.711  77.466  1.00 39.12 ? 440  VAL A CG1 1 
ATOM   3507  C  CG2 . VAL A 1 437 ? 44.142  49.087  78.027  1.00 39.20 ? 440  VAL A CG2 1 
ATOM   3508  N  N   . THR A 1 438 ? 41.358  50.765  77.693  1.00 39.65 ? 441  THR A N   1 
ATOM   3509  C  CA  . THR A 1 438 ? 40.788  51.862  78.477  1.00 39.82 ? 441  THR A CA  1 
ATOM   3510  C  C   . THR A 1 438 ? 39.294  51.819  78.774  1.00 40.12 ? 441  THR A C   1 
ATOM   3511  O  O   . THR A 1 438 ? 38.893  51.882  79.938  1.00 40.02 ? 441  THR A O   1 
ATOM   3512  C  CB  . THR A 1 438 ? 41.170  53.230  77.904  1.00 39.77 ? 441  THR A CB  1 
ATOM   3513  O  OG1 . THR A 1 438 ? 42.594  53.359  77.922  1.00 39.58 ? 441  THR A OG1 1 
ATOM   3514  C  CG2 . THR A 1 438 ? 40.573  54.346  78.745  1.00 39.64 ? 441  THR A CG2 1 
ATOM   3515  N  N   . GLN A 1 439 ? 38.464  51.724  77.743  1.00 40.17 ? 442  GLN A N   1 
ATOM   3516  C  CA  . GLN A 1 439 ? 37.027  51.676  77.971  1.00 40.27 ? 442  GLN A CA  1 
ATOM   3517  C  C   . GLN A 1 439 ? 36.627  50.398  78.682  1.00 40.46 ? 442  GLN A C   1 
ATOM   3518  O  O   . GLN A 1 439 ? 35.602  50.348  79.363  1.00 40.48 ? 442  GLN A O   1 
ATOM   3519  C  CB  . GLN A 1 439 ? 36.263  51.791  76.659  1.00 40.24 ? 442  GLN A CB  1 
ATOM   3520  C  CG  . GLN A 1 439 ? 36.361  53.156  76.024  1.00 40.25 ? 442  GLN A CG  1 
ATOM   3521  C  CD  . GLN A 1 439 ? 35.291  53.385  74.984  1.00 40.30 ? 442  GLN A CD  1 
ATOM   3522  O  OE1 . GLN A 1 439 ? 34.617  52.450  74.556  1.00 40.26 ? 442  GLN A OE1 1 
ATOM   3523  N  NE2 . GLN A 1 439 ? 35.114  54.639  74.582  1.00 40.33 ? 442  GLN A NE2 1 
ATOM   3524  N  N   . VAL A 1 440 ? 37.443  49.365  78.524  1.00 40.59 ? 443  VAL A N   1 
ATOM   3525  C  CA  . VAL A 1 440 ? 37.170  48.082  79.144  1.00 40.77 ? 443  VAL A CA  1 
ATOM   3526  C  C   . VAL A 1 440 ? 37.332  48.221  80.651  1.00 41.14 ? 443  VAL A C   1 
ATOM   3527  O  O   . VAL A 1 440 ? 36.537  47.677  81.426  1.00 40.96 ? 443  VAL A O   1 
ATOM   3528  C  CB  . VAL A 1 440 ? 38.121  46.997  78.617  1.00 40.62 ? 443  VAL A CB  1 
ATOM   3529  C  CG1 . VAL A 1 440 ? 37.630  45.625  79.049  1.00 40.55 ? 443  VAL A CG1 1 
ATOM   3530  C  CG2 . VAL A 1 440 ? 38.222  47.076  77.107  1.00 40.41 ? 443  VAL A CG2 1 
ATOM   3531  N  N   . ARG A 1 441 ? 38.362  48.965  81.051  1.00 41.38 ? 444  ARG A N   1 
ATOM   3532  C  CA  . ARG A 1 441 ? 38.643  49.216  82.456  1.00 41.58 ? 444  ARG A CA  1 
ATOM   3533  C  C   . ARG A 1 441 ? 37.495  50.008  83.072  1.00 41.68 ? 444  ARG A C   1 
ATOM   3534  O  O   . ARG A 1 441 ? 37.056  49.715  84.182  1.00 41.77 ? 444  ARG A O   1 
ATOM   3535  C  CB  . ARG A 1 441 ? 39.959  49.980  82.595  1.00 41.81 ? 444  ARG A CB  1 
ATOM   3536  C  CG  . ARG A 1 441 ? 40.338  50.329  84.024  1.00 42.01 ? 444  ARG A CG  1 
ATOM   3537  C  CD  . ARG A 1 441 ? 41.839  50.440  84.165  1.00 42.26 ? 444  ARG A CD  1 
ATOM   3538  N  NE  . ARG A 1 441 ? 42.417  51.324  83.163  1.00 42.92 ? 444  ARG A NE  1 
ATOM   3539  C  CZ  . ARG A 1 441 ? 43.407  50.990  82.336  1.00 43.20 ? 444  ARG A CZ  1 
ATOM   3540  N  NH1 . ARG A 1 441 ? 43.858  51.878  81.462  1.00 43.45 ? 444  ARG A NH1 1 
ATOM   3541  N  NH2 . ARG A 1 441 ? 43.937  49.773  82.366  1.00 43.11 ? 444  ARG A NH2 1 
ATOM   3542  N  N   . ALA A 1 442 ? 36.989  50.994  82.338  1.00 41.59 ? 445  ALA A N   1 
ATOM   3543  C  CA  . ALA A 1 442 ? 35.878  51.794  82.828  1.00 41.75 ? 445  ALA A CA  1 
ATOM   3544  C  C   . ALA A 1 442 ? 34.657  50.909  83.050  1.00 41.93 ? 445  ALA A C   1 
ATOM   3545  O  O   . ALA A 1 442 ? 33.824  51.196  83.900  1.00 42.09 ? 445  ALA A O   1 
ATOM   3546  C  CB  . ALA A 1 442 ? 35.553  52.907  81.850  1.00 41.72 ? 445  ALA A CB  1 
ATOM   3547  N  N   . PHE A 1 443 ? 34.548  49.837  82.272  1.00 42.06 ? 446  PHE A N   1 
ATOM   3548  C  CA  . PHE A 1 443 ? 33.429  48.909  82.394  1.00 42.10 ? 446  PHE A CA  1 
ATOM   3549  C  C   . PHE A 1 443 ? 33.603  48.048  83.638  1.00 42.28 ? 446  PHE A C   1 
ATOM   3550  O  O   . PHE A 1 443 ? 32.704  47.942  84.470  1.00 42.29 ? 446  PHE A O   1 
ATOM   3551  C  CB  . PHE A 1 443 ? 33.353  48.013  81.150  1.00 41.98 ? 446  PHE A CB  1 
ATOM   3552  C  CG  . PHE A 1 443 ? 32.285  46.947  81.220  1.00 41.80 ? 446  PHE A CG  1 
ATOM   3553  C  CD1 . PHE A 1 443 ? 30.936  47.287  81.208  1.00 41.67 ? 446  PHE A CD1 1 
ATOM   3554  C  CD2 . PHE A 1 443 ? 32.631  45.603  81.300  1.00 41.57 ? 446  PHE A CD2 1 
ATOM   3555  C  CE1 . PHE A 1 443 ? 29.951  46.300  81.276  1.00 41.50 ? 446  PHE A CE1 1 
ATOM   3556  C  CE2 . PHE A 1 443 ? 31.650  44.616  81.367  1.00 41.44 ? 446  PHE A CE2 1 
ATOM   3557  C  CZ  . PHE A 1 443 ? 30.312  44.966  81.355  1.00 41.40 ? 446  PHE A CZ  1 
ATOM   3558  N  N   . TYR A 1 444 ? 34.777  47.446  83.766  1.00 42.43 ? 447  TYR A N   1 
ATOM   3559  C  CA  . TYR A 1 444 ? 35.073  46.584  84.893  1.00 42.62 ? 447  TYR A CA  1 
ATOM   3560  C  C   . TYR A 1 444 ? 34.997  47.324  86.221  1.00 42.84 ? 447  TYR A C   1 
ATOM   3561  O  O   . TYR A 1 444 ? 34.372  46.847  87.168  1.00 42.63 ? 447  TYR A O   1 
ATOM   3562  C  CB  . TYR A 1 444 ? 36.464  45.960  84.720  1.00 42.62 ? 447  TYR A CB  1 
ATOM   3563  C  CG  . TYR A 1 444 ? 36.831  44.955  85.784  1.00 42.78 ? 447  TYR A CG  1 
ATOM   3564  C  CD1 . TYR A 1 444 ? 37.636  45.315  86.864  1.00 42.95 ? 447  TYR A CD1 1 
ATOM   3565  C  CD2 . TYR A 1 444 ? 36.355  43.648  85.728  1.00 42.78 ? 447  TYR A CD2 1 
ATOM   3566  C  CE1 . TYR A 1 444 ? 37.954  44.394  87.871  1.00 43.09 ? 447  TYR A CE1 1 
ATOM   3567  C  CE2 . TYR A 1 444 ? 36.668  42.720  86.727  1.00 43.00 ? 447  TYR A CE2 1 
ATOM   3568  C  CZ  . TYR A 1 444 ? 37.465  43.100  87.795  1.00 43.06 ? 447  TYR A CZ  1 
ATOM   3569  O  OH  . TYR A 1 444 ? 37.765  42.196  88.788  1.00 43.14 ? 447  TYR A OH  1 
ATOM   3570  N  N   . VAL A 1 445 ? 35.590  48.512  86.269  1.00 43.10 ? 448  VAL A N   1 
ATOM   3571  C  CA  . VAL A 1 445 ? 35.632  49.295  87.497  1.00 43.35 ? 448  VAL A CA  1 
ATOM   3572  C  C   . VAL A 1 445 ? 34.391  50.095  87.874  1.00 43.64 ? 448  VAL A C   1 
ATOM   3573  O  O   . VAL A 1 445 ? 33.860  49.940  88.975  1.00 43.67 ? 448  VAL A O   1 
ATOM   3574  C  CB  . VAL A 1 445 ? 36.841  50.249  87.498  1.00 43.38 ? 448  VAL A CB  1 
ATOM   3575  C  CG1 . VAL A 1 445 ? 36.925  51.003  88.823  1.00 43.33 ? 448  VAL A CG1 1 
ATOM   3576  C  CG2 . VAL A 1 445 ? 38.122  49.470  87.236  1.00 43.36 ? 448  VAL A CG2 1 
ATOM   3577  N  N   . ASN A 1 446 ? 33.923  50.941  86.968  1.00 43.80 ? 449  ASN A N   1 
ATOM   3578  C  CA  . ASN A 1 446 ? 32.784  51.795  87.264  1.00 44.10 ? 449  ASN A CA  1 
ATOM   3579  C  C   . ASN A 1 446 ? 31.393  51.234  87.010  1.00 44.28 ? 449  ASN A C   1 
ATOM   3580  O  O   . ASN A 1 446 ? 30.501  51.403  87.837  1.00 44.38 ? 449  ASN A O   1 
ATOM   3581  C  CB  . ASN A 1 446 ? 32.952  53.133  86.546  1.00 44.30 ? 449  ASN A CB  1 
ATOM   3582  C  CG  . ASN A 1 446 ? 34.348  53.710  86.715  1.00 44.53 ? 449  ASN A CG  1 
ATOM   3583  O  OD1 . ASN A 1 446 ? 34.909  54.294  85.784  1.00 45.00 ? 449  ASN A OD1 1 
ATOM   3584  N  ND2 . ASN A 1 446 ? 34.925  53.531  87.895  1.00 44.58 ? 449  ASN A ND2 1 
ATOM   3585  N  N   . VAL A 1 447 ? 31.204  50.566  85.880  1.00 44.36 ? 450  VAL A N   1 
ATOM   3586  C  CA  . VAL A 1 447 ? 29.896  50.022  85.537  1.00 44.43 ? 450  VAL A CA  1 
ATOM   3587  C  C   . VAL A 1 447 ? 29.471  48.817  86.367  1.00 44.79 ? 450  VAL A C   1 
ATOM   3588  O  O   . VAL A 1 447 ? 28.315  48.731  86.780  1.00 44.91 ? 450  VAL A O   1 
ATOM   3589  C  CB  . VAL A 1 447 ? 29.811  49.671  84.034  1.00 44.41 ? 450  VAL A CB  1 
ATOM   3590  C  CG1 . VAL A 1 447 ? 28.449  49.065  83.704  1.00 44.18 ? 450  VAL A CG1 1 
ATOM   3591  C  CG2 . VAL A 1 447 ? 30.067  50.914  83.188  1.00 44.13 ? 450  VAL A CG2 1 
ATOM   3592  N  N   . LEU A 1 448 ? 30.397  47.891  86.607  1.00 44.99 ? 451  LEU A N   1 
ATOM   3593  C  CA  . LEU A 1 448 ? 30.105  46.683  87.378  1.00 45.17 ? 451  LEU A CA  1 
ATOM   3594  C  C   . LEU A 1 448 ? 30.424  46.793  88.869  1.00 45.51 ? 451  LEU A C   1 
ATOM   3595  O  O   . LEU A 1 448 ? 31.239  47.619  89.279  1.00 45.52 ? 451  LEU A O   1 
ATOM   3596  C  CB  . LEU A 1 448 ? 30.873  45.491  86.803  1.00 44.82 ? 451  LEU A CB  1 
ATOM   3597  C  CG  . LEU A 1 448 ? 30.600  45.019  85.378  1.00 44.57 ? 451  LEU A CG  1 
ATOM   3598  C  CD1 . LEU A 1 448 ? 31.464  43.804  85.087  1.00 44.38 ? 451  LEU A CD1 1 
ATOM   3599  C  CD2 . LEU A 1 448 ? 29.129  44.678  85.202  1.00 44.44 ? 451  LEU A CD2 1 
ATOM   3600  N  N   . ASN A 1 449 ? 29.762  45.958  89.671  1.00 46.03 ? 452  ASN A N   1 
ATOM   3601  C  CA  . ASN A 1 449 ? 29.987  45.906  91.116  1.00 46.51 ? 452  ASN A CA  1 
ATOM   3602  C  C   . ASN A 1 449 ? 30.762  44.619  91.403  1.00 47.03 ? 452  ASN A C   1 
ATOM   3603  O  O   . ASN A 1 449 ? 31.038  43.856  90.476  1.00 46.94 ? 452  ASN A O   1 
ATOM   3604  C  CB  . ASN A 1 449 ? 28.658  45.950  91.897  1.00 46.22 ? 452  ASN A CB  1 
ATOM   3605  C  CG  . ASN A 1 449 ? 27.734  44.772  91.592  1.00 46.05 ? 452  ASN A CG  1 
ATOM   3606  O  OD1 . ASN A 1 449 ? 28.179  43.676  91.260  1.00 46.02 ? 452  ASN A OD1 1 
ATOM   3607  N  ND2 . ASN A 1 449 ? 26.436  44.995  91.737  1.00 45.97 ? 452  ASN A ND2 1 
ATOM   3608  N  N   . GLU A 1 450 ? 31.095  44.356  92.664  1.00 47.74 ? 453  GLU A N   1 
ATOM   3609  C  CA  . GLU A 1 450 ? 31.847  43.149  92.977  1.00 48.59 ? 453  GLU A CA  1 
ATOM   3610  C  C   . GLU A 1 450 ? 31.195  41.813  92.620  1.00 48.80 ? 453  GLU A C   1 
ATOM   3611  O  O   . GLU A 1 450 ? 31.887  40.918  92.127  1.00 48.84 ? 453  GLU A O   1 
ATOM   3612  C  CB  . GLU A 1 450 ? 32.350  43.147  94.422  1.00 49.27 ? 453  GLU A CB  1 
ATOM   3613  C  CG  . GLU A 1 450 ? 33.750  43.750  94.575  1.00 50.81 ? 453  GLU A CG  1 
ATOM   3614  C  CD  . GLU A 1 450 ? 34.801  43.144  93.612  1.00 51.87 ? 453  GLU A CD  1 
ATOM   3615  O  OE1 . GLU A 1 450 ? 34.739  41.926  93.308  1.00 52.60 ? 453  GLU A OE1 1 
ATOM   3616  O  OE2 . GLU A 1 450 ? 35.710  43.883  93.161  1.00 52.33 ? 453  GLU A OE2 1 
ATOM   3617  N  N   . GLU A 1 451 ? 29.885  41.670  92.842  1.00 49.08 ? 454  GLU A N   1 
ATOM   3618  C  CA  . GLU A 1 451 ? 29.185  40.416  92.509  1.00 49.25 ? 454  GLU A CA  1 
ATOM   3619  C  C   . GLU A 1 451 ? 29.346  40.111  91.030  1.00 48.83 ? 454  GLU A C   1 
ATOM   3620  O  O   . GLU A 1 451 ? 29.669  38.985  90.645  1.00 48.74 ? 454  GLU A O   1 
ATOM   3621  C  CB  . GLU A 1 451 ? 27.686  40.533  92.746  1.00 50.06 ? 454  GLU A CB  1 
ATOM   3622  C  CG  . GLU A 1 451 ? 27.217  40.627  94.169  1.00 51.57 ? 454  GLU A CG  1 
ATOM   3623  C  CD  . GLU A 1 451 ? 25.710  40.866  94.219  1.00 52.48 ? 454  GLU A CD  1 
ATOM   3624  O  OE1 . GLU A 1 451 ? 24.946  39.962  93.779  1.00 52.73 ? 454  GLU A OE1 1 
ATOM   3625  O  OE2 . GLU A 1 451 ? 25.297  41.974  94.652  1.00 52.93 ? 454  GLU A OE2 1 
ATOM   3626  N  N   . GLN A 1 452 ? 29.051  41.127  90.218  1.00 48.23 ? 455  GLN A N   1 
ATOM   3627  C  CA  . GLN A 1 452 ? 29.124  41.050  88.768  1.00 47.65 ? 455  GLN A CA  1 
ATOM   3628  C  C   . GLN A 1 452 ? 30.527  40.763  88.254  1.00 47.49 ? 455  GLN A C   1 
ATOM   3629  O  O   . GLN A 1 452 ? 30.686  39.970  87.330  1.00 47.48 ? 455  GLN A O   1 
ATOM   3630  C  CB  . GLN A 1 452 ? 28.559  42.329  88.152  1.00 47.36 ? 455  GLN A CB  1 
ATOM   3631  C  CG  . GLN A 1 452 ? 27.076  42.496  88.429  1.00 47.01 ? 455  GLN A CG  1 
ATOM   3632  C  CD  . GLN A 1 452 ? 26.587  43.911  88.229  1.00 46.88 ? 455  GLN A CD  1 
ATOM   3633  O  OE1 . GLN A 1 452 ? 27.369  44.857  88.174  1.00 46.76 ? 455  GLN A OE1 1 
ATOM   3634  N  NE2 . GLN A 1 452 ? 25.277  44.067  88.140  1.00 46.91 ? 455  GLN A NE2 1 
ATOM   3635  N  N   . ARG A 1 453 ? 31.542  41.399  88.841  1.00 47.31 ? 456  ARG A N   1 
ATOM   3636  C  CA  . ARG A 1 453 ? 32.926  41.147  88.428  1.00 47.07 ? 456  ARG A CA  1 
ATOM   3637  C  C   . ARG A 1 453 ? 33.252  39.693  88.749  1.00 47.05 ? 456  ARG A C   1 
ATOM   3638  O  O   . ARG A 1 453 ? 33.916  39.013  87.967  1.00 46.98 ? 456  ARG A O   1 
ATOM   3639  C  CB  . ARG A 1 453 ? 33.913  42.050  89.170  1.00 46.79 ? 456  ARG A CB  1 
ATOM   3640  C  CG  . ARG A 1 453 ? 33.783  43.519  88.867  1.00 46.49 ? 456  ARG A CG  1 
ATOM   3641  C  CD  . ARG A 1 453 ? 34.727  44.334  89.740  1.00 46.36 ? 456  ARG A CD  1 
ATOM   3642  N  NE  . ARG A 1 453 ? 34.364  45.748  89.737  1.00 46.26 ? 456  ARG A NE  1 
ATOM   3643  C  CZ  . ARG A 1 453 ? 34.141  46.468  90.831  1.00 46.11 ? 456  ARG A CZ  1 
ATOM   3644  N  NH1 . ARG A 1 453 ? 34.251  45.915  92.028  1.00 45.95 ? 456  ARG A NH1 1 
ATOM   3645  N  NH2 . ARG A 1 453 ? 33.767  47.734  90.726  1.00 46.20 ? 456  ARG A NH2 1 
ATOM   3646  N  N   . LYS A 1 454 ? 32.778  39.231  89.907  1.00 47.02 ? 457  LYS A N   1 
ATOM   3647  C  CA  . LYS A 1 454 ? 32.994  37.856  90.341  1.00 47.10 ? 457  LYS A CA  1 
ATOM   3648  C  C   . LYS A 1 454 ? 32.364  36.914  89.318  1.00 46.80 ? 457  LYS A C   1 
ATOM   3649  O  O   . LYS A 1 454 ? 33.007  35.972  88.855  1.00 46.71 ? 457  LYS A O   1 
ATOM   3650  C  CB  . LYS A 1 454 ? 32.376  37.611  91.725  1.00 47.44 ? 457  LYS A CB  1 
ATOM   3651  C  CG  . LYS A 1 454 ? 32.641  36.200  92.268  1.00 48.13 ? 457  LYS A CG  1 
ATOM   3652  C  CD  . LYS A 1 454 ? 31.993  35.942  93.632  1.00 48.76 ? 457  LYS A CD  1 
ATOM   3653  C  CE  . LYS A 1 454 ? 30.459  35.962  93.560  1.00 49.45 ? 457  LYS A CE  1 
ATOM   3654  N  NZ  . LYS A 1 454 ? 29.864  34.894  92.675  1.00 49.66 ? 457  LYS A NZ  1 
ATOM   3655  N  N   . ARG A 1 455 ? 31.113  37.191  88.951  1.00 46.43 ? 458  ARG A N   1 
ATOM   3656  C  CA  . ARG A 1 455 ? 30.405  36.374  87.974  1.00 45.95 ? 458  ARG A CA  1 
ATOM   3657  C  C   . ARG A 1 455 ? 31.102  36.416  86.629  1.00 45.54 ? 458  ARG A C   1 
ATOM   3658  O  O   . ARG A 1 455 ? 31.263  35.388  85.980  1.00 45.61 ? 458  ARG A O   1 
ATOM   3659  C  CB  . ARG A 1 455 ? 28.951  36.818  87.846  1.00 46.19 ? 458  ARG A CB  1 
ATOM   3660  C  CG  . ARG A 1 455 ? 28.000  35.921  88.615  1.00 46.62 ? 458  ARG A CG  1 
ATOM   3661  C  CD  . ARG A 1 455 ? 26.616  36.509  88.704  1.00 47.01 ? 458  ARG A CD  1 
ATOM   3662  N  NE  . ARG A 1 455 ? 26.532  37.505  89.764  1.00 47.75 ? 458  ARG A NE  1 
ATOM   3663  C  CZ  . ARG A 1 455 ? 25.694  38.534  89.753  1.00 47.98 ? 458  ARG A CZ  1 
ATOM   3664  N  NH1 . ARG A 1 455 ? 24.871  38.703  88.734  1.00 48.24 ? 458  ARG A NH1 1 
ATOM   3665  N  NH2 . ARG A 1 455 ? 25.668  39.381  90.770  1.00 48.38 ? 458  ARG A NH2 1 
ATOM   3666  N  N   . LEU A 1 456 ? 31.569  37.596  86.239  1.00 44.94 ? 459  LEU A N   1 
ATOM   3667  C  CA  . LEU A 1 456 ? 32.270  37.754  84.976  1.00 44.41 ? 459  LEU A CA  1 
ATOM   3668  C  C   . LEU A 1 456 ? 33.506  36.870  84.908  1.00 44.25 ? 459  LEU A C   1 
ATOM   3669  O  O   . LEU A 1 456 ? 33.696  36.147  83.936  1.00 44.29 ? 459  LEU A O   1 
ATOM   3670  C  CB  . LEU A 1 456 ? 32.676  39.208  84.773  1.00 44.25 ? 459  LEU A CB  1 
ATOM   3671  C  CG  . LEU A 1 456 ? 33.622  39.484  83.607  1.00 44.02 ? 459  LEU A CG  1 
ATOM   3672  C  CD1 . LEU A 1 456 ? 33.001  39.042  82.290  1.00 43.85 ? 459  LEU A CD1 1 
ATOM   3673  C  CD2 . LEU A 1 456 ? 33.948  40.964  83.586  1.00 43.91 ? 459  LEU A CD2 1 
ATOM   3674  N  N   . CYS A 1 457 ? 34.341  36.919  85.941  1.00 43.94 ? 460  CYS A N   1 
ATOM   3675  C  CA  . CYS A 1 457 ? 35.561  36.117  85.972  1.00 43.76 ? 460  CYS A CA  1 
ATOM   3676  C  C   . CYS A 1 457 ? 35.286  34.619  86.005  1.00 43.69 ? 460  CYS A C   1 
ATOM   3677  O  O   . CYS A 1 457 ? 36.028  33.831  85.418  1.00 43.67 ? 460  CYS A O   1 
ATOM   3678  C  CB  . CYS A 1 457 ? 36.430  36.510  87.163  1.00 43.59 ? 460  CYS A CB  1 
ATOM   3679  S  SG  . CYS A 1 457 ? 37.068  38.180  87.058  1.00 43.67 ? 460  CYS A SG  1 
ATOM   3680  N  N   . GLU A 1 458 ? 34.219  34.231  86.694  1.00 43.66 ? 461  GLU A N   1 
ATOM   3681  C  CA  . GLU A 1 458 ? 33.845  32.831  86.791  1.00 43.66 ? 461  GLU A CA  1 
ATOM   3682  C  C   . GLU A 1 458 ? 33.362  32.322  85.446  1.00 43.30 ? 461  GLU A C   1 
ATOM   3683  O  O   . GLU A 1 458 ? 33.680  31.202  85.044  1.00 43.31 ? 461  GLU A O   1 
ATOM   3684  C  CB  . GLU A 1 458 ? 32.770  32.648  87.861  1.00 44.15 ? 461  GLU A CB  1 
ATOM   3685  C  CG  . GLU A 1 458 ? 33.283  32.963  89.260  1.00 44.98 ? 461  GLU A CG  1 
ATOM   3686  C  CD  . GLU A 1 458 ? 32.194  33.010  90.319  1.00 45.48 ? 461  GLU A CD  1 
ATOM   3687  O  OE1 . GLU A 1 458 ? 31.004  33.201  89.970  1.00 45.61 ? 461  GLU A OE1 1 
ATOM   3688  O  OE2 . GLU A 1 458 ? 32.542  32.879  91.516  1.00 45.94 ? 461  GLU A OE2 1 
ATOM   3689  N  N   . ASN A 1 459 ? 32.614  33.161  84.738  1.00 42.80 ? 462  ASN A N   1 
ATOM   3690  C  CA  . ASN A 1 459 ? 32.097  32.791  83.428  1.00 42.27 ? 462  ASN A CA  1 
ATOM   3691  C  C   . ASN A 1 459 ? 33.256  32.588  82.470  1.00 42.09 ? 462  ASN A C   1 
ATOM   3692  O  O   . ASN A 1 459 ? 33.326  31.562  81.793  1.00 42.19 ? 462  ASN A O   1 
ATOM   3693  C  CB  . ASN A 1 459 ? 31.129  33.856  82.901  1.00 41.84 ? 462  ASN A CB  1 
ATOM   3694  C  CG  . ASN A 1 459 ? 29.824  33.892  83.679  1.00 41.38 ? 462  ASN A CG  1 
ATOM   3695  O  OD1 . ASN A 1 459 ? 29.463  32.921  84.342  1.00 41.00 ? 462  ASN A OD1 1 
ATOM   3696  N  ND2 . ASN A 1 459 ? 29.111  35.012  83.601  1.00 41.16 ? 462  ASN A ND2 1 
ATOM   3697  N  N   . ILE A 1 460 ? 34.189  33.540  82.460  1.00 41.62 ? 463  ILE A N   1 
ATOM   3698  C  CA  . ILE A 1 460 ? 35.364  33.462  81.593  1.00 41.03 ? 463  ILE A CA  1 
ATOM   3699  C  C   . ILE A 1 460 ? 36.217  32.235  81.915  1.00 40.98 ? 463  ILE A C   1 
ATOM   3700  O  O   . ILE A 1 460 ? 36.476  31.417  81.037  1.00 40.89 ? 463  ILE A O   1 
ATOM   3701  C  CB  . ILE A 1 460 ? 36.243  34.735  81.693  1.00 40.75 ? 463  ILE A CB  1 
ATOM   3702  C  CG1 . ILE A 1 460 ? 35.478  35.939  81.142  1.00 40.43 ? 463  ILE A CG1 1 
ATOM   3703  C  CG2 . ILE A 1 460 ? 37.537  34.542  80.915  1.00 40.41 ? 463  ILE A CG2 1 
ATOM   3704  C  CD1 . ILE A 1 460 ? 36.203  37.247  81.253  1.00 40.18 ? 463  ILE A CD1 1 
ATOM   3705  N  N   . ALA A 1 461 ? 36.625  32.098  83.175  1.00 40.84 ? 464  ALA A N   1 
ATOM   3706  C  CA  . ALA A 1 461 ? 37.451  30.972  83.596  1.00 40.72 ? 464  ALA A CA  1 
ATOM   3707  C  C   . ALA A 1 461 ? 36.780  29.637  83.285  1.00 40.89 ? 464  ALA A C   1 
ATOM   3708  O  O   . ALA A 1 461 ? 37.441  28.697  82.840  1.00 40.71 ? 464  ALA A O   1 
ATOM   3709  C  CB  . ALA A 1 461 ? 37.761  31.073  85.077  1.00 40.52 ? 464  ALA A CB  1 
ATOM   3710  N  N   . GLY A 1 462 ? 35.464  29.577  83.488  1.00 40.93 ? 465  GLY A N   1 
ATOM   3711  C  CA  . GLY A 1 462 ? 34.711  28.361  83.241  1.00 41.05 ? 465  GLY A CA  1 
ATOM   3712  C  C   . GLY A 1 462 ? 34.871  27.832  81.832  1.00 41.25 ? 465  GLY A C   1 
ATOM   3713  O  O   . GLY A 1 462 ? 34.872  26.621  81.614  1.00 41.20 ? 465  GLY A O   1 
ATOM   3714  N  N   . HIS A 1 463 ? 35.010  28.739  80.873  1.00 41.57 ? 466  HIS A N   1 
ATOM   3715  C  CA  . HIS A 1 463 ? 35.175  28.347  79.477  1.00 41.83 ? 466  HIS A CA  1 
ATOM   3716  C  C   . HIS A 1 463 ? 36.648  28.278  79.076  1.00 41.86 ? 466  HIS A C   1 
ATOM   3717  O  O   . HIS A 1 463 ? 37.082  27.329  78.413  1.00 41.81 ? 466  HIS A O   1 
ATOM   3718  C  CB  . HIS A 1 463 ? 34.432  29.320  78.562  1.00 42.05 ? 466  HIS A CB  1 
ATOM   3719  C  CG  . HIS A 1 463 ? 34.489  28.941  77.117  1.00 42.53 ? 466  HIS A CG  1 
ATOM   3720  N  ND1 . HIS A 1 463 ? 35.367  29.525  76.229  1.00 42.67 ? 466  HIS A ND1 1 
ATOM   3721  C  CD2 . HIS A 1 463 ? 33.799  28.013  76.413  1.00 42.63 ? 466  HIS A CD2 1 
ATOM   3722  C  CE1 . HIS A 1 463 ? 35.216  28.972  75.040  1.00 42.82 ? 466  HIS A CE1 1 
ATOM   3723  N  NE2 . HIS A 1 463 ? 34.271  28.051  75.125  1.00 42.93 ? 466  HIS A NE2 1 
ATOM   3724  N  N   . LEU A 1 464 ? 37.402  29.295  79.483  1.00 41.87 ? 467  LEU A N   1 
ATOM   3725  C  CA  . LEU A 1 464 ? 38.831  29.408  79.203  1.00 41.82 ? 467  LEU A CA  1 
ATOM   3726  C  C   . LEU A 1 464 ? 39.657  28.246  79.778  1.00 41.92 ? 467  LEU A C   1 
ATOM   3727  O  O   . LEU A 1 464 ? 40.722  27.918  79.256  1.00 41.85 ? 467  LEU A O   1 
ATOM   3728  C  CB  . LEU A 1 464 ? 39.342  30.744  79.746  1.00 41.61 ? 467  LEU A CB  1 
ATOM   3729  C  CG  . LEU A 1 464 ? 40.830  31.065  79.635  1.00 41.69 ? 467  LEU A CG  1 
ATOM   3730  C  CD1 . LEU A 1 464 ? 41.308  30.865  78.204  1.00 41.66 ? 467  LEU A CD1 1 
ATOM   3731  C  CD2 . LEU A 1 464 ? 41.084  32.495  80.104  1.00 41.57 ? 467  LEU A CD2 1 
ATOM   3732  N  N   . LYS A 1 465 ? 39.148  27.605  80.828  1.00 41.92 ? 468  LYS A N   1 
ATOM   3733  C  CA  . LYS A 1 465 ? 39.843  26.489  81.461  1.00 41.89 ? 468  LYS A CA  1 
ATOM   3734  C  C   . LYS A 1 465 ? 40.116  25.293  80.549  1.00 41.87 ? 468  LYS A C   1 
ATOM   3735  O  O   . LYS A 1 465 ? 40.997  24.479  80.839  1.00 41.86 ? 468  LYS A O   1 
ATOM   3736  C  CB  . LYS A 1 465 ? 39.075  26.015  82.693  1.00 42.08 ? 468  LYS A CB  1 
ATOM   3737  C  CG  . LYS A 1 465 ? 37.725  25.374  82.398  1.00 42.29 ? 468  LYS A CG  1 
ATOM   3738  C  CD  . LYS A 1 465 ? 37.612  24.048  83.126  1.00 42.64 ? 468  LYS A CD  1 
ATOM   3739  C  CE  . LYS A 1 465 ? 36.178  23.587  83.261  1.00 42.87 ? 468  LYS A CE  1 
ATOM   3740  N  NZ  . LYS A 1 465 ? 35.545  23.342  81.936  1.00 43.16 ? 468  LYS A NZ  1 
ATOM   3741  N  N   . ASP A 1 466 ? 39.372  25.179  79.451  1.00 41.68 ? 469  ASP A N   1 
ATOM   3742  C  CA  . ASP A 1 466 ? 39.559  24.058  78.536  1.00 41.55 ? 469  ASP A CA  1 
ATOM   3743  C  C   . ASP A 1 466 ? 40.569  24.280  77.423  1.00 41.39 ? 469  ASP A C   1 
ATOM   3744  O  O   . ASP A 1 466 ? 40.832  23.379  76.628  1.00 41.36 ? 469  ASP A O   1 
ATOM   3745  C  CB  . ASP A 1 466 ? 38.220  23.599  77.977  1.00 41.57 ? 469  ASP A CB  1 
ATOM   3746  C  CG  . ASP A 1 466 ? 37.331  23.012  79.045  1.00 41.65 ? 469  ASP A CG  1 
ATOM   3747  O  OD1 . ASP A 1 466 ? 36.184  23.477  79.192  1.00 41.89 ? 469  ASP A OD1 1 
ATOM   3748  O  OD2 . ASP A 1 466 ? 37.790  22.096  79.758  1.00 41.78 ? 469  ASP A OD2 1 
ATOM   3749  N  N   . ALA A 1 467 ? 41.134  25.479  77.367  1.00 41.20 ? 470  ALA A N   1 
ATOM   3750  C  CA  . ALA A 1 467 ? 42.140  25.793  76.367  1.00 41.09 ? 470  ALA A CA  1 
ATOM   3751  C  C   . ALA A 1 467 ? 43.500  25.406  76.946  1.00 41.12 ? 470  ALA A C   1 
ATOM   3752  O  O   . ALA A 1 467 ? 43.623  25.168  78.154  1.00 41.20 ? 470  ALA A O   1 
ATOM   3753  C  CB  . ALA A 1 467 ? 42.106  27.273  76.035  1.00 40.78 ? 470  ALA A CB  1 
ATOM   3754  N  N   . GLN A 1 468 ? 44.513  25.310  76.090  1.00 41.03 ? 471  GLN A N   1 
ATOM   3755  C  CA  . GLN A 1 468 ? 45.852  24.965  76.556  1.00 40.87 ? 471  GLN A CA  1 
ATOM   3756  C  C   . GLN A 1 468 ? 46.390  26.062  77.453  1.00 41.03 ? 471  GLN A C   1 
ATOM   3757  O  O   . GLN A 1 468 ? 46.017  27.228  77.310  1.00 41.07 ? 471  GLN A O   1 
ATOM   3758  C  CB  . GLN A 1 468 ? 46.800  24.770  75.386  1.00 40.56 ? 471  GLN A CB  1 
ATOM   3759  C  CG  . GLN A 1 468 ? 46.610  23.468  74.678  1.00 40.31 ? 471  GLN A CG  1 
ATOM   3760  C  CD  . GLN A 1 468 ? 47.614  23.288  73.581  1.00 40.19 ? 471  GLN A CD  1 
ATOM   3761  O  OE1 . GLN A 1 468 ? 48.776  22.981  73.832  1.00 39.93 ? 471  GLN A OE1 1 
ATOM   3762  N  NE2 . GLN A 1 468 ? 47.180  23.502  72.348  1.00 40.17 ? 471  GLN A NE2 1 
ATOM   3763  N  N   . ILE A 1 469 ? 47.295  25.686  78.352  1.00 40.94 ? 472  ILE A N   1 
ATOM   3764  C  CA  . ILE A 1 469 ? 47.890  26.629  79.289  1.00 40.88 ? 472  ILE A CA  1 
ATOM   3765  C  C   . ILE A 1 469 ? 48.511  27.860  78.633  1.00 40.87 ? 472  ILE A C   1 
ATOM   3766  O  O   . ILE A 1 469 ? 48.284  28.979  79.095  1.00 40.76 ? 472  ILE A O   1 
ATOM   3767  C  CB  . ILE A 1 469 ? 48.940  25.939  80.195  1.00 41.09 ? 472  ILE A CB  1 
ATOM   3768  C  CG1 . ILE A 1 469 ? 48.272  24.860  81.047  1.00 41.16 ? 472  ILE A CG1 1 
ATOM   3769  C  CG2 . ILE A 1 469 ? 49.613  26.958  81.111  1.00 41.13 ? 472  ILE A CG2 1 
ATOM   3770  C  CD1 . ILE A 1 469 ? 47.259  25.402  82.025  1.00 41.36 ? 472  ILE A CD1 1 
ATOM   3771  N  N   . PHE A 1 470 ? 49.265  27.673  77.550  1.00 40.65 ? 473  PHE A N   1 
ATOM   3772  C  CA  . PHE A 1 470 ? 49.896  28.815  76.903  1.00 40.52 ? 473  PHE A CA  1 
ATOM   3773  C  C   . PHE A 1 470 ? 48.858  29.807  76.398  1.00 40.63 ? 473  PHE A C   1 
ATOM   3774  O  O   . PHE A 1 470 ? 49.113  31.006  76.360  1.00 40.55 ? 473  PHE A O   1 
ATOM   3775  C  CB  . PHE A 1 470 ? 50.883  28.383  75.805  1.00 40.52 ? 473  PHE A CB  1 
ATOM   3776  C  CG  . PHE A 1 470 ? 50.256  28.130  74.463  1.00 40.61 ? 473  PHE A CG  1 
ATOM   3777  C  CD1 . PHE A 1 470 ? 50.145  29.155  73.530  1.00 40.64 ? 473  PHE A CD1 1 
ATOM   3778  C  CD2 . PHE A 1 470 ? 49.826  26.861  74.108  1.00 40.70 ? 473  PHE A CD2 1 
ATOM   3779  C  CE1 . PHE A 1 470 ? 49.620  28.919  72.264  1.00 40.62 ? 473  PHE A CE1 1 
ATOM   3780  C  CE2 . PHE A 1 470 ? 49.298  26.615  72.840  1.00 40.73 ? 473  PHE A CE2 1 
ATOM   3781  C  CZ  . PHE A 1 470 ? 49.197  27.647  71.918  1.00 40.68 ? 473  PHE A CZ  1 
ATOM   3782  N  N   . ILE A 1 471 ? 47.681  29.309  76.032  1.00 40.54 ? 474  ILE A N   1 
ATOM   3783  C  CA  . ILE A 1 471 ? 46.609  30.174  75.568  1.00 40.47 ? 474  ILE A CA  1 
ATOM   3784  C  C   . ILE A 1 471 ? 46.013  30.862  76.795  1.00 40.95 ? 474  ILE A C   1 
ATOM   3785  O  O   . ILE A 1 471 ? 45.712  32.054  76.771  1.00 40.86 ? 474  ILE A O   1 
ATOM   3786  C  CB  . ILE A 1 471 ? 45.530  29.371  74.830  1.00 40.16 ? 474  ILE A CB  1 
ATOM   3787  C  CG1 . ILE A 1 471 ? 46.124  28.755  73.567  1.00 39.78 ? 474  ILE A CG1 1 
ATOM   3788  C  CG2 . ILE A 1 471 ? 44.356  30.260  74.478  1.00 40.00 ? 474  ILE A CG2 1 
ATOM   3789  C  CD1 . ILE A 1 471 ? 45.169  27.907  72.783  1.00 39.41 ? 474  ILE A CD1 1 
ATOM   3790  N  N   . GLN A 1 472 ? 45.893  30.111  77.886  1.00 41.49 ? 475  GLN A N   1 
ATOM   3791  C  CA  . GLN A 1 472 ? 45.362  30.650  79.128  1.00 42.03 ? 475  GLN A CA  1 
ATOM   3792  C  C   . GLN A 1 472 ? 46.205  31.822  79.606  1.00 42.54 ? 475  GLN A C   1 
ATOM   3793  O  O   . GLN A 1 472 ? 45.667  32.864  79.975  1.00 42.60 ? 475  GLN A O   1 
ATOM   3794  C  CB  . GLN A 1 472 ? 45.321  29.574  80.216  1.00 41.92 ? 475  GLN A CB  1 
ATOM   3795  C  CG  . GLN A 1 472 ? 44.303  28.482  79.968  1.00 41.91 ? 475  GLN A CG  1 
ATOM   3796  C  CD  . GLN A 1 472 ? 44.161  27.508  81.129  1.00 42.01 ? 475  GLN A CD  1 
ATOM   3797  O  OE1 . GLN A 1 472 ? 43.686  26.389  80.946  1.00 42.17 ? 475  GLN A OE1 1 
ATOM   3798  N  NE2 . GLN A 1 472 ? 44.553  27.933  82.327  1.00 41.98 ? 475  GLN A NE2 1 
ATOM   3799  N  N   . LYS A 1 473 ? 47.526  31.665  79.573  1.00 43.16 ? 476  LYS A N   1 
ATOM   3800  C  CA  . LYS A 1 473 ? 48.416  32.729  80.021  1.00 43.91 ? 476  LYS A CA  1 
ATOM   3801  C  C   . LYS A 1 473 ? 48.303  33.987  79.181  1.00 44.05 ? 476  LYS A C   1 
ATOM   3802  O  O   . LYS A 1 473 ? 48.213  35.090  79.724  1.00 44.17 ? 476  LYS A O   1 
ATOM   3803  C  CB  . LYS A 1 473 ? 49.870  32.254  80.080  1.00 44.37 ? 476  LYS A CB  1 
ATOM   3804  C  CG  . LYS A 1 473 ? 50.100  31.127  81.088  1.00 45.42 ? 476  LYS A CG  1 
ATOM   3805  C  CD  . LYS A 1 473 ? 49.335  31.370  82.403  1.00 46.17 ? 476  LYS A CD  1 
ATOM   3806  C  CE  . LYS A 1 473 ? 49.738  30.383  83.498  1.00 46.61 ? 476  LYS A CE  1 
ATOM   3807  N  NZ  . LYS A 1 473 ? 51.127  30.628  83.985  1.00 46.91 ? 476  LYS A NZ  1 
ATOM   3808  N  N   . LYS A 1 474 ? 48.271  33.826  77.861  1.00 43.99 ? 477  LYS A N   1 
ATOM   3809  C  CA  . LYS A 1 474 ? 48.154  34.973  76.973  1.00 43.87 ? 477  LYS A CA  1 
ATOM   3810  C  C   . LYS A 1 474 ? 46.856  35.703  77.280  1.00 43.49 ? 477  LYS A C   1 
ATOM   3811  O  O   . LYS A 1 474 ? 46.854  36.915  77.463  1.00 43.34 ? 477  LYS A O   1 
ATOM   3812  C  CB  . LYS A 1 474 ? 48.187  34.536  75.506  1.00 44.52 ? 477  LYS A CB  1 
ATOM   3813  C  CG  . LYS A 1 474 ? 48.329  35.687  74.514  1.00 45.31 ? 477  LYS A CG  1 
ATOM   3814  C  CD  . LYS A 1 474 ? 49.708  36.331  74.598  1.00 46.35 ? 477  LYS A CD  1 
ATOM   3815  C  CE  . LYS A 1 474 ? 49.750  37.715  73.931  1.00 47.12 ? 477  LYS A CE  1 
ATOM   3816  N  NZ  . LYS A 1 474 ? 48.995  38.786  74.689  1.00 47.31 ? 477  LYS A NZ  1 
ATOM   3817  N  N   . ALA A 1 475 ? 45.767  34.951  77.398  1.00 43.08 ? 478  ALA A N   1 
ATOM   3818  C  CA  . ALA A 1 475 ? 44.465  35.532  77.699  1.00 42.97 ? 478  ALA A CA  1 
ATOM   3819  C  C   . ALA A 1 475 ? 44.521  36.321  79.005  1.00 43.08 ? 478  ALA A C   1 
ATOM   3820  O  O   . ALA A 1 475 ? 44.097  37.475  79.071  1.00 42.78 ? 478  ALA A O   1 
ATOM   3821  C  CB  . ALA A 1 475 ? 43.416  34.442  77.789  1.00 42.62 ? 478  ALA A CB  1 
ATOM   3822  N  N   . VAL A 1 476 ? 45.074  35.696  80.040  1.00 43.26 ? 479  VAL A N   1 
ATOM   3823  C  CA  . VAL A 1 476 ? 45.186  36.331  81.345  1.00 43.43 ? 479  VAL A CA  1 
ATOM   3824  C  C   . VAL A 1 476 ? 46.053  37.588  81.287  1.00 43.72 ? 479  VAL A C   1 
ATOM   3825  O  O   . VAL A 1 476 ? 45.783  38.566  81.999  1.00 43.64 ? 479  VAL A O   1 
ATOM   3826  C  CB  . VAL A 1 476 ? 45.721  35.343  82.409  1.00 43.40 ? 479  VAL A CB  1 
ATOM   3827  C  CG1 . VAL A 1 476 ? 46.055  36.075  83.695  1.00 43.31 ? 479  VAL A CG1 1 
ATOM   3828  C  CG2 . VAL A 1 476 ? 44.676  34.277  82.697  1.00 43.10 ? 479  VAL A CG2 1 
ATOM   3829  N  N   . LYS A 1 477 ? 47.068  37.570  80.421  1.00 43.87 ? 480  LYS A N   1 
ATOM   3830  C  CA  . LYS A 1 477 ? 47.950  38.718  80.261  1.00 44.12 ? 480  LYS A CA  1 
ATOM   3831  C  C   . LYS A 1 477 ? 47.152  39.932  79.790  1.00 43.99 ? 480  LYS A C   1 
ATOM   3832  O  O   . LYS A 1 477 ? 47.333  41.041  80.304  1.00 44.01 ? 480  LYS A O   1 
ATOM   3833  C  CB  . LYS A 1 477 ? 49.079  38.421  79.272  1.00 44.64 ? 480  LYS A CB  1 
ATOM   3834  C  CG  . LYS A 1 477 ? 50.083  39.565  79.175  1.00 45.67 ? 480  LYS A CG  1 
ATOM   3835  C  CD  . LYS A 1 477 ? 51.362  39.177  78.447  1.00 46.69 ? 480  LYS A CD  1 
ATOM   3836  C  CE  . LYS A 1 477 ? 51.171  39.135  76.933  1.00 47.58 ? 480  LYS A CE  1 
ATOM   3837  N  NZ  . LYS A 1 477 ? 50.852  40.484  76.348  1.00 48.19 ? 480  LYS A NZ  1 
ATOM   3838  N  N   . ASN A 1 478 ? 46.257  39.713  78.829  1.00 43.68 ? 481  ASN A N   1 
ATOM   3839  C  CA  . ASN A 1 478 ? 45.417  40.785  78.299  1.00 43.48 ? 481  ASN A CA  1 
ATOM   3840  C  C   . ASN A 1 478 ? 44.467  41.310  79.370  1.00 43.36 ? 481  ASN A C   1 
ATOM   3841  O  O   . ASN A 1 478 ? 44.310  42.515  79.523  1.00 43.14 ? 481  ASN A O   1 
ATOM   3842  C  CB  . ASN A 1 478 ? 44.606  40.295  77.096  1.00 43.33 ? 481  ASN A CB  1 
ATOM   3843  C  CG  . ASN A 1 478 ? 45.479  39.908  75.914  1.00 43.26 ? 481  ASN A CG  1 
ATOM   3844  O  OD1 . ASN A 1 478 ? 46.620  40.359  75.783  1.00 43.05 ? 481  ASN A OD1 1 
ATOM   3845  N  ND2 . ASN A 1 478 ? 44.938  39.067  75.039  1.00 43.31 ? 481  ASN A ND2 1 
ATOM   3846  N  N   . PHE A 1 479 ? 43.832  40.396  80.100  1.00 43.48 ? 482  PHE A N   1 
ATOM   3847  C  CA  . PHE A 1 479 ? 42.901  40.768  81.164  1.00 43.57 ? 482  PHE A CA  1 
ATOM   3848  C  C   . PHE A 1 479 ? 43.626  41.536  82.258  1.00 43.86 ? 482  PHE A C   1 
ATOM   3849  O  O   . PHE A 1 479 ? 43.060  42.429  82.880  1.00 43.66 ? 482  PHE A O   1 
ATOM   3850  C  CB  . PHE A 1 479 ? 42.227  39.529  81.753  1.00 43.24 ? 482  PHE A CB  1 
ATOM   3851  C  CG  . PHE A 1 479 ? 41.204  38.907  80.847  1.00 42.99 ? 482  PHE A CG  1 
ATOM   3852  C  CD1 . PHE A 1 479 ? 40.094  39.633  80.426  1.00 42.84 ? 482  PHE A CD1 1 
ATOM   3853  C  CD2 . PHE A 1 479 ? 41.338  37.588  80.424  1.00 42.80 ? 482  PHE A CD2 1 
ATOM   3854  C  CE1 . PHE A 1 479 ? 39.128  39.052  79.593  1.00 42.77 ? 482  PHE A CE1 1 
ATOM   3855  C  CE2 . PHE A 1 479 ? 40.380  37.003  79.595  1.00 42.70 ? 482  PHE A CE2 1 
ATOM   3856  C  CZ  . PHE A 1 479 ? 39.273  37.738  79.180  1.00 42.62 ? 482  PHE A CZ  1 
ATOM   3857  N  N   . THR A 1 480 ? 44.890  41.195  82.475  1.00 44.26 ? 483  THR A N   1 
ATOM   3858  C  CA  . THR A 1 480 ? 45.699  41.871  83.473  1.00 44.63 ? 483  THR A CA  1 
ATOM   3859  C  C   . THR A 1 480 ? 45.956  43.312  83.048  1.00 45.05 ? 483  THR A C   1 
ATOM   3860  O  O   . THR A 1 480 ? 45.982  44.218  83.887  1.00 45.01 ? 483  THR A O   1 
ATOM   3861  C  CB  . THR A 1 480 ? 47.021  41.136  83.689  1.00 44.59 ? 483  THR A CB  1 
ATOM   3862  O  OG1 . THR A 1 480 ? 46.746  39.872  84.297  1.00 44.52 ? 483  THR A OG1 1 
ATOM   3863  C  CG2 . THR A 1 480 ? 47.955  41.933  84.592  1.00 44.70 ? 483  THR A CG2 1 
ATOM   3864  N  N   . GLU A 1 481 ? 46.115  43.529  81.745  1.00 45.36 ? 484  GLU A N   1 
ATOM   3865  C  CA  . GLU A 1 481 ? 46.352  44.873  81.235  1.00 45.74 ? 484  GLU A CA  1 
ATOM   3866  C  C   . GLU A 1 481 ? 45.137  45.752  81.430  1.00 45.60 ? 484  GLU A C   1 
ATOM   3867  O  O   . GLU A 1 481 ? 45.257  46.968  81.479  1.00 45.61 ? 484  GLU A O   1 
ATOM   3868  C  CB  . GLU A 1 481 ? 46.738  44.839  79.765  1.00 46.59 ? 484  GLU A CB  1 
ATOM   3869  C  CG  . GLU A 1 481 ? 48.102  44.225  79.529  1.00 48.01 ? 484  GLU A CG  1 
ATOM   3870  C  CD  . GLU A 1 481 ? 48.503  44.237  78.067  1.00 48.89 ? 484  GLU A CD  1 
ATOM   3871  O  OE1 . GLU A 1 481 ? 49.331  43.373  77.669  1.00 49.26 ? 484  GLU A OE1 1 
ATOM   3872  O  OE2 . GLU A 1 481 ? 47.990  45.115  77.322  1.00 49.39 ? 484  GLU A OE2 1 
ATOM   3873  N  N   . VAL A 1 482 ? 43.964  45.136  81.518  1.00 45.50 ? 485  VAL A N   1 
ATOM   3874  C  CA  . VAL A 1 482 ? 42.733  45.881  81.736  1.00 45.40 ? 485  VAL A CA  1 
ATOM   3875  C  C   . VAL A 1 482 ? 42.754  46.328  83.190  1.00 45.67 ? 485  VAL A C   1 
ATOM   3876  O  O   . VAL A 1 482 ? 42.653  47.517  83.486  1.00 45.54 ? 485  VAL A O   1 
ATOM   3877  C  CB  . VAL A 1 482 ? 41.497  45.006  81.483  1.00 45.10 ? 485  VAL A CB  1 
ATOM   3878  C  CG1 . VAL A 1 482 ? 40.229  45.790  81.755  1.00 44.84 ? 485  VAL A CG1 1 
ATOM   3879  C  CG2 . VAL A 1 482 ? 41.507  44.495  80.060  1.00 44.83 ? 485  VAL A CG2 1 
ATOM   3880  N  N   . HIS A 1 483 ? 42.927  45.361  84.084  1.00 45.97 ? 486  HIS A N   1 
ATOM   3881  C  CA  . HIS A 1 483 ? 43.001  45.611  85.519  1.00 46.34 ? 486  HIS A CA  1 
ATOM   3882  C  C   . HIS A 1 483 ? 43.659  44.393  86.168  1.00 46.66 ? 486  HIS A C   1 
ATOM   3883  O  O   . HIS A 1 483 ? 43.335  43.256  85.836  1.00 46.62 ? 486  HIS A O   1 
ATOM   3884  C  CB  . HIS A 1 483 ? 41.603  45.836  86.106  1.00 46.43 ? 486  HIS A CB  1 
ATOM   3885  C  CG  . HIS A 1 483 ? 41.612  46.424  87.487  1.00 46.60 ? 486  HIS A CG  1 
ATOM   3886  N  ND1 . HIS A 1 483 ? 41.549  47.781  87.722  1.00 46.72 ? 486  HIS A ND1 1 
ATOM   3887  C  CD2 . HIS A 1 483 ? 41.678  45.836  88.705  1.00 46.52 ? 486  HIS A CD2 1 
ATOM   3888  C  CE1 . HIS A 1 483 ? 41.577  48.004  89.024  1.00 46.65 ? 486  HIS A CE1 1 
ATOM   3889  N  NE2 . HIS A 1 483 ? 41.656  46.840  89.642  1.00 46.59 ? 486  HIS A NE2 1 
ATOM   3890  N  N   . PRO A 1 484 ? 44.613  44.621  87.089  1.00 46.92 ? 487  PRO A N   1 
ATOM   3891  C  CA  . PRO A 1 484 ? 45.329  43.548  87.791  1.00 47.15 ? 487  PRO A CA  1 
ATOM   3892  C  C   . PRO A 1 484 ? 44.383  42.544  88.447  1.00 47.48 ? 487  PRO A C   1 
ATOM   3893  O  O   . PRO A 1 484 ? 44.571  41.332  88.344  1.00 47.60 ? 487  PRO A O   1 
ATOM   3894  C  CB  . PRO A 1 484 ? 46.119  44.317  88.849  1.00 47.07 ? 487  PRO A CB  1 
ATOM   3895  C  CG  . PRO A 1 484 ? 46.401  45.620  88.172  1.00 46.99 ? 487  PRO A CG  1 
ATOM   3896  C  CD  . PRO A 1 484 ? 45.073  45.944  87.552  1.00 46.90 ? 487  PRO A CD  1 
ATOM   3897  N  N   . ASP A 1 485 ? 43.369  43.079  89.119  1.00 47.77 ? 488  ASP A N   1 
ATOM   3898  C  CA  . ASP A 1 485 ? 42.356  42.314  89.830  1.00 48.02 ? 488  ASP A CA  1 
ATOM   3899  C  C   . ASP A 1 485 ? 41.519  41.437  88.875  1.00 47.39 ? 488  ASP A C   1 
ATOM   3900  O  O   . ASP A 1 485 ? 41.074  40.351  89.245  1.00 47.20 ? 488  ASP A O   1 
ATOM   3901  C  CB  . ASP A 1 485 ? 41.502  43.325  90.627  1.00 49.39 ? 488  ASP A CB  1 
ATOM   3902  C  CG  . ASP A 1 485 ? 40.373  42.681  91.422  1.00 50.92 ? 488  ASP A CG  1 
ATOM   3903  O  OD1 . ASP A 1 485 ? 39.235  43.233  91.382  1.00 51.64 ? 488  ASP A OD1 1 
ATOM   3904  O  OD2 . ASP A 1 485 ? 40.621  41.648  92.106  1.00 51.97 ? 488  ASP A OD2 1 
ATOM   3905  N  N   . TYR A 1 486 ? 41.369  41.885  87.632  1.00 46.91 ? 489  TYR A N   1 
ATOM   3906  C  CA  . TYR A 1 486 ? 40.608  41.166  86.600  1.00 46.37 ? 489  TYR A CA  1 
ATOM   3907  C  C   . TYR A 1 486 ? 41.361  39.890  86.226  1.00 46.20 ? 489  TYR A C   1 
ATOM   3908  O  O   . TYR A 1 486 ? 40.792  38.800  86.225  1.00 46.05 ? 489  TYR A O   1 
ATOM   3909  C  CB  . TYR A 1 486 ? 40.454  42.069  85.363  1.00 46.03 ? 489  TYR A CB  1 
ATOM   3910  C  CG  . TYR A 1 486 ? 39.397  41.694  84.331  1.00 45.55 ? 489  TYR A CG  1 
ATOM   3911  C  CD1 . TYR A 1 486 ? 39.112  42.557  83.276  1.00 45.43 ? 489  TYR A CD1 1 
ATOM   3912  C  CD2 . TYR A 1 486 ? 38.693  40.496  84.398  1.00 45.43 ? 489  TYR A CD2 1 
ATOM   3913  C  CE1 . TYR A 1 486 ? 38.158  42.240  82.312  1.00 45.39 ? 489  TYR A CE1 1 
ATOM   3914  C  CE2 . TYR A 1 486 ? 37.729  40.167  83.432  1.00 45.34 ? 489  TYR A CE2 1 
ATOM   3915  C  CZ  . TYR A 1 486 ? 37.470  41.045  82.395  1.00 45.40 ? 489  TYR A CZ  1 
ATOM   3916  O  OH  . TYR A 1 486 ? 36.531  40.742  81.433  1.00 45.29 ? 489  TYR A OH  1 
ATOM   3917  N  N   . GLY A 1 487 ? 42.649  40.039  85.927  1.00 46.09 ? 490  GLY A N   1 
ATOM   3918  C  CA  . GLY A 1 487 ? 43.473  38.902  85.559  1.00 46.04 ? 490  GLY A CA  1 
ATOM   3919  C  C   . GLY A 1 487 ? 43.800  37.953  86.701  1.00 45.95 ? 490  GLY A C   1 
ATOM   3920  O  O   . GLY A 1 487 ? 43.794  36.740  86.510  1.00 45.94 ? 490  GLY A O   1 
ATOM   3921  N  N   . SER A 1 488 ? 44.076  38.492  87.887  1.00 46.03 ? 491  SER A N   1 
ATOM   3922  C  CA  . SER A 1 488 ? 44.418  37.669  89.054  1.00 46.04 ? 491  SER A CA  1 
ATOM   3923  C  C   . SER A 1 488 ? 43.278  36.759  89.501  1.00 45.98 ? 491  SER A C   1 
ATOM   3924  O  O   . SER A 1 488 ? 43.504  35.597  89.858  1.00 45.94 ? 491  SER A O   1 
ATOM   3925  C  CB  . SER A 1 488 ? 44.872  38.548  90.228  1.00 46.10 ? 491  SER A CB  1 
ATOM   3926  O  OG  . SER A 1 488 ? 43.814  39.345  90.735  1.00 46.40 ? 491  SER A OG  1 
ATOM   3927  N  N   . HIS A 1 489 ? 42.060  37.297  89.482  1.00 45.89 ? 492  HIS A N   1 
ATOM   3928  C  CA  . HIS A 1 489 ? 40.869  36.556  89.878  1.00 45.79 ? 492  HIS A CA  1 
ATOM   3929  C  C   . HIS A 1 489 ? 40.603  35.435  88.871  1.00 45.62 ? 492  HIS A C   1 
ATOM   3930  O  O   . HIS A 1 489 ? 40.270  34.316  89.260  1.00 45.55 ? 492  HIS A O   1 
ATOM   3931  C  CB  . HIS A 1 489 ? 39.674  37.513  89.980  1.00 46.10 ? 492  HIS A CB  1 
ATOM   3932  C  CG  . HIS A 1 489 ? 38.503  36.959  90.734  1.00 46.53 ? 492  HIS A CG  1 
ATOM   3933  N  ND1 . HIS A 1 489 ? 38.470  35.673  91.228  1.00 46.71 ? 492  HIS A ND1 1 
ATOM   3934  C  CD2 . HIS A 1 489 ? 37.307  37.514  91.050  1.00 46.73 ? 492  HIS A CD2 1 
ATOM   3935  C  CE1 . HIS A 1 489 ? 37.303  35.456  91.810  1.00 46.78 ? 492  HIS A CE1 1 
ATOM   3936  N  NE2 . HIS A 1 489 ? 36.579  36.558  91.715  1.00 46.85 ? 492  HIS A NE2 1 
ATOM   3937  N  N   . ILE A 1 490 ? 40.774  35.722  87.583  1.00 45.37 ? 493  ILE A N   1 
ATOM   3938  C  CA  . ILE A 1 490 ? 40.567  34.698  86.562  1.00 45.23 ? 493  ILE A CA  1 
ATOM   3939  C  C   . ILE A 1 490 ? 41.630  33.613  86.701  1.00 45.36 ? 493  ILE A C   1 
ATOM   3940  O  O   . ILE A 1 490 ? 41.321  32.426  86.612  1.00 45.31 ? 493  ILE A O   1 
ATOM   3941  C  CB  . ILE A 1 490 ? 40.633  35.269  85.129  1.00 45.15 ? 493  ILE A CB  1 
ATOM   3942  C  CG1 . ILE A 1 490 ? 39.459  36.214  84.880  1.00 45.00 ? 493  ILE A CG1 1 
ATOM   3943  C  CG2 . ILE A 1 490 ? 40.603  34.138  84.105  1.00 44.86 ? 493  ILE A CG2 1 
ATOM   3944  C  CD1 . ILE A 1 490 ? 39.487  36.860  83.523  1.00 44.77 ? 493  ILE A CD1 1 
ATOM   3945  N  N   . GLN A 1 491 ? 42.875  34.026  86.937  1.00 45.34 ? 494  GLN A N   1 
ATOM   3946  C  CA  . GLN A 1 491 ? 43.985  33.092  87.090  1.00 45.36 ? 494  GLN A CA  1 
ATOM   3947  C  C   . GLN A 1 491 ? 43.801  32.188  88.308  1.00 45.60 ? 494  GLN A C   1 
ATOM   3948  O  O   . GLN A 1 491 ? 44.090  30.994  88.254  1.00 45.56 ? 494  GLN A O   1 
ATOM   3949  C  CB  . GLN A 1 491 ? 45.307  33.855  87.186  1.00 45.18 ? 494  GLN A CB  1 
ATOM   3950  C  CG  . GLN A 1 491 ? 46.540  32.969  87.227  1.00 45.19 ? 494  GLN A CG  1 
ATOM   3951  C  CD  . GLN A 1 491 ? 46.701  32.111  85.985  1.00 45.07 ? 494  GLN A CD  1 
ATOM   3952  O  OE1 . GLN A 1 491 ? 47.232  32.563  84.970  1.00 45.27 ? 494  GLN A OE1 1 
ATOM   3953  N  NE2 . GLN A 1 491 ? 46.266  30.861  86.069  1.00 44.83 ? 494  GLN A NE2 1 
ATOM   3954  N  N   . ALA A 1 492 ? 43.303  32.761  89.400  1.00 45.91 ? 495  ALA A N   1 
ATOM   3955  C  CA  . ALA A 1 492 ? 43.062  32.008  90.630  1.00 46.26 ? 495  ALA A CA  1 
ATOM   3956  C  C   . ALA A 1 492 ? 41.977  30.954  90.410  1.00 46.48 ? 495  ALA A C   1 
ATOM   3957  O  O   . ALA A 1 492 ? 42.015  29.871  91.000  1.00 46.53 ? 495  ALA A O   1 
ATOM   3958  C  CB  . ALA A 1 492 ? 42.654  32.955  91.750  1.00 46.36 ? 495  ALA A CB  1 
ATOM   3959  N  N   . LEU A 1 493 ? 40.985  31.296  89.592  1.00 46.67 ? 496  LEU A N   1 
ATOM   3960  C  CA  . LEU A 1 493 ? 39.910  30.371  89.280  1.00 46.93 ? 496  LEU A CA  1 
ATOM   3961  C  C   . LEU A 1 493 ? 40.457  29.305  88.355  1.00 47.17 ? 496  LEU A C   1 
ATOM   3962  O  O   . LEU A 1 493 ? 40.152  28.129  88.515  1.00 47.25 ? 496  LEU A O   1 
ATOM   3963  C  CB  . LEU A 1 493 ? 38.744  31.098  88.623  1.00 46.78 ? 496  LEU A CB  1 
ATOM   3964  C  CG  . LEU A 1 493 ? 37.975  32.006  89.578  1.00 46.68 ? 496  LEU A CG  1 
ATOM   3965  C  CD1 . LEU A 1 493 ? 37.024  32.888  88.796  1.00 46.56 ? 496  LEU A CD1 1 
ATOM   3966  C  CD2 . LEU A 1 493 ? 37.234  31.164  90.615  1.00 46.56 ? 496  LEU A CD2 1 
ATOM   3967  N  N   . LEU A 1 494 ? 41.281  29.716  87.397  1.00 47.56 ? 497  LEU A N   1 
ATOM   3968  C  CA  . LEU A 1 494 ? 41.889  28.769  86.470  1.00 48.11 ? 497  LEU A CA  1 
ATOM   3969  C  C   . LEU A 1 494 ? 42.773  27.795  87.249  1.00 48.78 ? 497  LEU A C   1 
ATOM   3970  O  O   . LEU A 1 494 ? 42.719  26.590  87.004  1.00 48.82 ? 497  LEU A O   1 
ATOM   3971  C  CB  . LEU A 1 494 ? 42.720  29.486  85.399  1.00 47.64 ? 497  LEU A CB  1 
ATOM   3972  C  CG  . LEU A 1 494 ? 42.017  30.195  84.239  1.00 47.24 ? 497  LEU A CG  1 
ATOM   3973  C  CD1 . LEU A 1 494 ? 43.051  30.902  83.398  1.00 46.93 ? 497  LEU A CD1 1 
ATOM   3974  C  CD2 . LEU A 1 494 ? 41.235  29.213  83.394  1.00 46.96 ? 497  LEU A CD2 1 
ATOM   3975  N  N   . ASP A 1 495 ? 43.555  28.310  88.203  1.00 49.56 ? 498  ASP A N   1 
ATOM   3976  C  CA  . ASP A 1 495 ? 44.430  27.463  89.018  1.00 50.42 ? 498  ASP A CA  1 
ATOM   3977  C  C   . ASP A 1 495 ? 43.618  26.351  89.648  1.00 51.13 ? 498  ASP A C   1 
ATOM   3978  O  O   . ASP A 1 495 ? 44.057  25.205  89.699  1.00 51.16 ? 498  ASP A O   1 
ATOM   3979  C  CB  . ASP A 1 495 ? 45.119  28.269  90.120  1.00 50.25 ? 498  ASP A CB  1 
ATOM   3980  C  CG  . ASP A 1 495 ? 46.217  29.173  89.593  1.00 50.32 ? 498  ASP A CG  1 
ATOM   3981  O  OD1 . ASP A 1 495 ? 46.652  28.989  88.438  1.00 50.48 ? 498  ASP A OD1 1 
ATOM   3982  O  OD2 . ASP A 1 495 ? 46.656  30.072  90.342  1.00 50.40 ? 498  ASP A OD2 1 
ATOM   3983  N  N   . LYS A 1 496 ? 42.407  26.699  90.073  1.00 52.14 ? 499  LYS A N   1 
ATOM   3984  C  CA  . LYS A 1 496 ? 41.493  25.756  90.692  1.00 53.22 ? 499  LYS A CA  1 
ATOM   3985  C  C   . LYS A 1 496 ? 40.956  24.716  89.699  1.00 53.85 ? 499  LYS A C   1 
ATOM   3986  O  O   . LYS A 1 496 ? 41.059  23.517  89.956  1.00 54.00 ? 499  LYS A O   1 
ATOM   3987  C  CB  . LYS A 1 496 ? 40.341  26.501  91.359  1.00 53.44 ? 499  LYS A CB  1 
ATOM   3988  C  CG  . LYS A 1 496 ? 39.469  25.613  92.220  1.00 54.08 ? 499  LYS A CG  1 
ATOM   3989  C  CD  . LYS A 1 496 ? 38.287  26.376  92.790  1.00 54.45 ? 499  LYS A CD  1 
ATOM   3990  C  CE  . LYS A 1 496 ? 37.379  25.452  93.588  1.00 54.64 ? 499  LYS A CE  1 
ATOM   3991  N  NZ  . LYS A 1 496 ? 36.133  26.158  94.000  1.00 54.74 ? 499  LYS A NZ  1 
ATOM   3992  N  N   . TYR A 1 497 ? 40.383  25.163  88.579  1.00 54.54 ? 500  TYR A N   1 
ATOM   3993  C  CA  . TYR A 1 497 ? 39.861  24.239  87.568  1.00 55.28 ? 500  TYR A CA  1 
ATOM   3994  C  C   . TYR A 1 497 ? 40.971  23.335  87.063  1.00 55.65 ? 500  TYR A C   1 
ATOM   3995  O  O   . TYR A 1 497 ? 40.734  22.177  86.725  1.00 55.81 ? 500  TYR A O   1 
ATOM   3996  C  CB  . TYR A 1 497 ? 39.284  24.985  86.371  1.00 55.68 ? 500  TYR A CB  1 
ATOM   3997  C  CG  . TYR A 1 497 ? 38.062  25.810  86.666  1.00 56.33 ? 500  TYR A CG  1 
ATOM   3998  C  CD1 . TYR A 1 497 ? 36.947  25.261  87.303  1.00 56.73 ? 500  TYR A CD1 1 
ATOM   3999  C  CD2 . TYR A 1 497 ? 38.017  27.149  86.300  1.00 56.64 ? 500  TYR A CD2 1 
ATOM   4000  C  CE1 . TYR A 1 497 ? 35.812  26.044  87.568  1.00 57.06 ? 500  TYR A CE1 1 
ATOM   4001  C  CE2 . TYR A 1 497 ? 36.902  27.934  86.557  1.00 56.96 ? 500  TYR A CE2 1 
ATOM   4002  C  CZ  . TYR A 1 497 ? 35.807  27.385  87.188  1.00 57.15 ? 500  TYR A CZ  1 
ATOM   4003  O  OH  . TYR A 1 497 ? 34.728  28.204  87.435  1.00 57.39 ? 500  TYR A OH  1 
ATOM   4004  N  N   . ASN A 1 498 ? 42.180  23.879  86.984  1.00 56.00 ? 501  ASN A N   1 
ATOM   4005  C  CA  . ASN A 1 498 ? 43.333  23.109  86.531  1.00 56.35 ? 501  ASN A CA  1 
ATOM   4006  C  C   . ASN A 1 498 ? 43.830  22.153  87.624  1.00 56.65 ? 501  ASN A C   1 
ATOM   4007  O  O   . ASN A 1 498 ? 44.883  21.520  87.394  1.00 56.93 ? 501  ASN A O   1 
ATOM   4008  C  CB  . ASN A 1 498 ? 44.474  24.043  86.092  1.00 56.30 ? 501  ASN A CB  1 
ATOM   4009  C  CG  . ASN A 1 498 ? 44.158  24.804  84.806  1.00 56.31 ? 501  ASN A CG  1 
ATOM   4010  O  OD1 . ASN A 1 498 ? 44.762  25.843  84.524  1.00 56.28 ? 501  ASN A OD1 1 
ATOM   4011  N  ND2 . ASN A 1 498 ? 43.218  24.287  84.021  1.00 56.20 ? 501  ASN A ND2 1 
ATOM   4012  O  OXT . ASN A 1 498 ? 43.172  22.031  88.689  1.00 56.80 ? 501  ASN A OXT 1 
ATOM   4013  N  N   . SER B 2 1   ? 6.285   55.710  10.607  1.00 57.48 ? 4    SER B N   1 
ATOM   4014  C  CA  . SER B 2 1   ? 6.552   54.493  11.440  1.00 57.32 ? 4    SER B CA  1 
ATOM   4015  C  C   . SER B 2 1   ? 6.732   53.197  10.610  1.00 56.87 ? 4    SER B C   1 
ATOM   4016  O  O   . SER B 2 1   ? 6.180   53.061  9.502   1.00 56.89 ? 4    SER B O   1 
ATOM   4017  C  CB  . SER B 2 1   ? 5.443   54.324  12.493  1.00 57.72 ? 4    SER B CB  1 
ATOM   4018  O  OG  . SER B 2 1   ? 4.153   54.295  11.899  1.00 58.32 ? 4    SER B OG  1 
ATOM   4019  N  N   . ARG B 2 2   ? 7.546   52.278  11.138  1.00 56.08 ? 5    ARG B N   1 
ATOM   4020  C  CA  . ARG B 2 2   ? 7.824   50.995  10.483  1.00 54.99 ? 5    ARG B CA  1 
ATOM   4021  C  C   . ARG B 2 2   ? 6.891   49.927  11.060  1.00 54.39 ? 5    ARG B C   1 
ATOM   4022  O  O   . ARG B 2 2   ? 5.782   50.244  11.507  1.00 54.44 ? 5    ARG B O   1 
ATOM   4023  C  CB  . ARG B 2 2   ? 9.284   50.573  10.701  1.00 54.85 ? 5    ARG B CB  1 
ATOM   4024  C  CG  . ARG B 2 2   ? 10.273  51.690  11.069  1.00 54.38 ? 5    ARG B CG  1 
ATOM   4025  C  CD  . ARG B 2 2   ? 10.397  51.848  12.583  1.00 53.99 ? 5    ARG B CD  1 
ATOM   4026  N  NE  . ARG B 2 2   ? 11.742  52.252  12.990  1.00 53.53 ? 5    ARG B NE  1 
ATOM   4027  C  CZ  . ARG B 2 2   ? 12.095  52.581  14.233  1.00 53.37 ? 5    ARG B CZ  1 
ATOM   4028  N  NH1 . ARG B 2 2   ? 11.213  52.563  15.221  1.00 53.22 ? 5    ARG B NH1 1 
ATOM   4029  N  NH2 . ARG B 2 2   ? 13.345  52.929  14.493  1.00 53.20 ? 5    ARG B NH2 1 
ATOM   4030  N  N   . ASP B 2 3   ? 7.331   48.668  11.052  1.00 53.39 ? 6    ASP B N   1 
ATOM   4031  C  CA  . ASP B 2 3   ? 6.520   47.574  11.595  1.00 52.37 ? 6    ASP B CA  1 
ATOM   4032  C  C   . ASP B 2 3   ? 6.367   47.736  13.111  1.00 51.54 ? 6    ASP B C   1 
ATOM   4033  O  O   . ASP B 2 3   ? 7.213   48.346  13.767  1.00 51.57 ? 6    ASP B O   1 
ATOM   4034  C  CB  . ASP B 2 3   ? 7.164   46.226  11.278  1.00 52.53 ? 6    ASP B CB  1 
ATOM   4035  C  CG  . ASP B 2 3   ? 8.538   46.093  11.877  1.00 52.74 ? 6    ASP B CG  1 
ATOM   4036  O  OD1 . ASP B 2 3   ? 9.313   47.060  11.760  1.00 53.40 ? 6    ASP B OD1 1 
ATOM   4037  O  OD2 . ASP B 2 3   ? 8.847   45.040  12.469  1.00 52.73 ? 6    ASP B OD2 1 
ATOM   4038  N  N   . PRO B 2 4   ? 5.277   47.203  13.683  1.00 50.59 ? 7    PRO B N   1 
ATOM   4039  C  CA  . PRO B 2 4   ? 5.017   47.295  15.122  1.00 49.81 ? 7    PRO B CA  1 
ATOM   4040  C  C   . PRO B 2 4   ? 6.174   46.869  16.027  1.00 49.13 ? 7    PRO B C   1 
ATOM   4041  O  O   . PRO B 2 4   ? 6.437   47.521  17.035  1.00 49.12 ? 7    PRO B O   1 
ATOM   4042  C  CB  . PRO B 2 4   ? 3.798   46.398  15.295  1.00 49.93 ? 7    PRO B CB  1 
ATOM   4043  C  CG  . PRO B 2 4   ? 3.062   46.619  14.024  1.00 50.03 ? 7    PRO B CG  1 
ATOM   4044  C  CD  . PRO B 2 4   ? 4.162   46.523  13.000  1.00 50.35 ? 7    PRO B CD  1 
ATOM   4045  N  N   . ALA B 2 5   ? 6.872   45.793  15.670  1.00 48.38 ? 8    ALA B N   1 
ATOM   4046  C  CA  . ALA B 2 5   ? 7.992   45.319  16.482  1.00 47.48 ? 8    ALA B CA  1 
ATOM   4047  C  C   . ALA B 2 5   ? 9.057   46.399  16.662  1.00 46.84 ? 8    ALA B C   1 
ATOM   4048  O  O   . ALA B 2 5   ? 9.475   46.676  17.782  1.00 46.83 ? 8    ALA B O   1 
ATOM   4049  C  CB  . ALA B 2 5   ? 8.603   44.072  15.869  1.00 47.57 ? 8    ALA B CB  1 
ATOM   4050  N  N   . SER B 2 6   ? 9.458   47.032  15.562  1.00 46.04 ? 9    SER B N   1 
ATOM   4051  C  CA  . SER B 2 6   ? 10.469  48.088  15.594  1.00 45.30 ? 9    SER B CA  1 
ATOM   4052  C  C   . SER B 2 6   ? 10.067  49.295  16.432  1.00 44.76 ? 9    SER B C   1 
ATOM   4053  O  O   . SER B 2 6   ? 10.917  49.960  17.017  1.00 44.61 ? 9    SER B O   1 
ATOM   4054  C  CB  . SER B 2 6   ? 10.778  48.563  14.177  1.00 45.36 ? 9    SER B CB  1 
ATOM   4055  O  OG  . SER B 2 6   ? 11.349  47.522  13.412  1.00 45.66 ? 9    SER B OG  1 
ATOM   4056  N  N   . ASP B 2 7   ? 8.771   49.580  16.474  1.00 44.20 ? 10   ASP B N   1 
ATOM   4057  C  CA  . ASP B 2 7   ? 8.262   50.720  17.219  1.00 43.68 ? 10   ASP B CA  1 
ATOM   4058  C  C   . ASP B 2 7   ? 7.918   50.437  18.671  1.00 43.23 ? 10   ASP B C   1 
ATOM   4059  O  O   . ASP B 2 7   ? 7.244   51.243  19.313  1.00 43.06 ? 10   ASP B O   1 
ATOM   4060  C  CB  . ASP B 2 7   ? 7.040   51.301  16.512  1.00 43.97 ? 10   ASP B CB  1 
ATOM   4061  C  CG  . ASP B 2 7   ? 7.390   52.000  15.212  1.00 44.35 ? 10   ASP B CG  1 
ATOM   4062  O  OD1 . ASP B 2 7   ? 8.532   52.486  15.067  1.00 44.53 ? 10   ASP B OD1 1 
ATOM   4063  O  OD2 . ASP B 2 7   ? 6.509   52.081  14.332  1.00 44.72 ? 10   ASP B OD2 1 
ATOM   4064  N  N   . GLN B 2 8   ? 8.411   49.323  19.203  1.00 42.74 ? 11   GLN B N   1 
ATOM   4065  C  CA  . GLN B 2 8   ? 8.135   48.950  20.587  1.00 42.44 ? 11   GLN B CA  1 
ATOM   4066  C  C   . GLN B 2 8   ? 8.399   50.086  21.575  1.00 42.38 ? 11   GLN B C   1 
ATOM   4067  O  O   . GLN B 2 8   ? 7.513   50.458  22.343  1.00 42.31 ? 11   GLN B O   1 
ATOM   4068  C  CB  . GLN B 2 8   ? 8.941   47.710  20.981  1.00 42.13 ? 11   GLN B CB  1 
ATOM   4069  C  CG  . GLN B 2 8   ? 8.493   47.042  22.280  1.00 41.76 ? 11   GLN B CG  1 
ATOM   4070  C  CD  . GLN B 2 8   ? 8.954   47.769  23.529  1.00 41.57 ? 11   GLN B CD  1 
ATOM   4071  O  OE1 . GLN B 2 8   ? 10.077  48.261  23.594  1.00 41.32 ? 11   GLN B OE1 1 
ATOM   4072  N  NE2 . GLN B 2 8   ? 8.088   47.832  24.530  1.00 41.40 ? 11   GLN B NE2 1 
ATOM   4073  N  N   . MET B 2 9   ? 9.605   50.646  21.546  1.00 42.20 ? 12   MET B N   1 
ATOM   4074  C  CA  . MET B 2 9   ? 9.947   51.726  22.454  1.00 42.19 ? 12   MET B CA  1 
ATOM   4075  C  C   . MET B 2 9   ? 9.134   52.976  22.216  1.00 42.45 ? 12   MET B C   1 
ATOM   4076  O  O   . MET B 2 9   ? 8.669   53.594  23.171  1.00 42.57 ? 12   MET B O   1 
ATOM   4077  C  CB  . MET B 2 9   ? 11.435  52.040  22.399  1.00 41.86 ? 12   MET B CB  1 
ATOM   4078  C  CG  . MET B 2 9   ? 12.294  50.923  22.947  1.00 41.45 ? 12   MET B CG  1 
ATOM   4079  S  SD  . MET B 2 9   ? 13.834  51.541  23.578  1.00 41.09 ? 12   MET B SD  1 
ATOM   4080  C  CE  . MET B 2 9   ? 14.594  52.065  22.062  1.00 41.16 ? 12   MET B CE  1 
ATOM   4081  N  N   . GLN B 2 10  ? 8.947   53.342  20.950  1.00 42.78 ? 13   GLN B N   1 
ATOM   4082  C  CA  . GLN B 2 10  ? 8.158   54.525  20.611  1.00 43.18 ? 13   GLN B CA  1 
ATOM   4083  C  C   . GLN B 2 10  ? 6.752   54.439  21.178  1.00 43.30 ? 13   GLN B C   1 
ATOM   4084  O  O   . GLN B 2 10  ? 6.284   55.387  21.800  1.00 43.25 ? 13   GLN B O   1 
ATOM   4085  C  CB  . GLN B 2 10  ? 8.057   54.718  19.101  1.00 43.41 ? 13   GLN B CB  1 
ATOM   4086  C  CG  . GLN B 2 10  ? 8.762   55.953  18.589  1.00 43.94 ? 13   GLN B CG  1 
ATOM   4087  C  CD  . GLN B 2 10  ? 8.449   57.207  19.387  1.00 44.10 ? 13   GLN B CD  1 
ATOM   4088  O  OE1 . GLN B 2 10  ? 9.318   57.750  20.069  1.00 44.34 ? 13   GLN B OE1 1 
ATOM   4089  N  NE2 . GLN B 2 10  ? 7.214   57.687  19.286  1.00 44.20 ? 13   GLN B NE2 1 
ATOM   4090  N  N   . HIS B 2 11  ? 6.077   53.314  20.953  1.00 43.45 ? 14   HIS B N   1 
ATOM   4091  C  CA  . HIS B 2 11  ? 4.721   53.125  21.460  1.00 43.91 ? 14   HIS B CA  1 
ATOM   4092  C  C   . HIS B 2 11  ? 4.678   53.198  22.984  1.00 44.16 ? 14   HIS B C   1 
ATOM   4093  O  O   . HIS B 2 11  ? 3.716   53.709  23.551  1.00 44.18 ? 14   HIS B O   1 
ATOM   4094  C  CB  . HIS B 2 11  ? 4.140   51.790  20.994  1.00 43.96 ? 14   HIS B CB  1 
ATOM   4095  C  CG  . HIS B 2 11  ? 3.966   51.692  19.511  1.00 44.40 ? 14   HIS B CG  1 
ATOM   4096  N  ND1 . HIS B 2 11  ? 3.946   50.488  18.840  1.00 44.42 ? 14   HIS B ND1 1 
ATOM   4097  C  CD2 . HIS B 2 11  ? 3.816   52.651  18.565  1.00 44.53 ? 14   HIS B CD2 1 
ATOM   4098  C  CE1 . HIS B 2 11  ? 3.795   50.707  17.546  1.00 44.50 ? 14   HIS B CE1 1 
ATOM   4099  N  NE2 . HIS B 2 11  ? 3.714   52.012  17.352  1.00 44.67 ? 14   HIS B NE2 1 
ATOM   4100  N  N   . TRP B 2 12  ? 5.720   52.689  23.641  1.00 44.42 ? 15   TRP B N   1 
ATOM   4101  C  CA  . TRP B 2 12  ? 5.797   52.706  25.102  1.00 44.70 ? 15   TRP B CA  1 
ATOM   4102  C  C   . TRP B 2 12  ? 5.875   54.148  25.590  1.00 45.36 ? 15   TRP B C   1 
ATOM   4103  O  O   . TRP B 2 12  ? 5.192   54.531  26.539  1.00 45.24 ? 15   TRP B O   1 
ATOM   4104  C  CB  . TRP B 2 12  ? 7.026   51.923  25.591  1.00 44.02 ? 15   TRP B CB  1 
ATOM   4105  C  CG  . TRP B 2 12  ? 7.070   51.699  27.093  1.00 43.27 ? 15   TRP B CG  1 
ATOM   4106  C  CD1 . TRP B 2 12  ? 6.620   50.600  27.768  1.00 42.90 ? 15   TRP B CD1 1 
ATOM   4107  C  CD2 . TRP B 2 12  ? 7.584   52.596  28.089  1.00 42.79 ? 15   TRP B CD2 1 
ATOM   4108  N  NE1 . TRP B 2 12  ? 6.818   50.758  29.117  1.00 42.61 ? 15   TRP B NE1 1 
ATOM   4109  C  CE2 . TRP B 2 12  ? 7.407   51.974  29.342  1.00 42.67 ? 15   TRP B CE2 1 
ATOM   4110  C  CE3 . TRP B 2 12  ? 8.179   53.863  28.043  1.00 42.66 ? 15   TRP B CE3 1 
ATOM   4111  C  CZ2 . TRP B 2 12  ? 7.798   52.575  30.537  1.00 42.51 ? 15   TRP B CZ2 1 
ATOM   4112  C  CZ3 . TRP B 2 12  ? 8.569   54.459  29.234  1.00 42.57 ? 15   TRP B CZ3 1 
ATOM   4113  C  CH2 . TRP B 2 12  ? 8.377   53.813  30.463  1.00 42.48 ? 15   TRP B CH2 1 
ATOM   4114  N  N   . LYS B 2 13  ? 6.718   54.936  24.934  1.00 46.20 ? 16   LYS B N   1 
ATOM   4115  C  CA  . LYS B 2 13  ? 6.888   56.339  25.274  1.00 47.34 ? 16   LYS B CA  1 
ATOM   4116  C  C   . LYS B 2 13  ? 5.573   57.079  25.070  1.00 48.31 ? 16   LYS B C   1 
ATOM   4117  O  O   . LYS B 2 13  ? 5.140   57.849  25.932  1.00 48.37 ? 16   LYS B O   1 
ATOM   4118  C  CB  . LYS B 2 13  ? 7.962   56.954  24.384  1.00 47.14 ? 16   LYS B CB  1 
ATOM   4119  C  CG  . LYS B 2 13  ? 8.216   58.427  24.613  1.00 47.12 ? 16   LYS B CG  1 
ATOM   4120  C  CD  . LYS B 2 13  ? 9.221   58.907  23.605  1.00 47.36 ? 16   LYS B CD  1 
ATOM   4121  C  CE  . LYS B 2 13  ? 9.601   60.350  23.824  1.00 47.65 ? 16   LYS B CE  1 
ATOM   4122  N  NZ  . LYS B 2 13  ? 10.633  60.760  22.820  1.00 47.94 ? 16   LYS B NZ  1 
ATOM   4123  N  N   . GLU B 2 14  ? 4.939   56.823  23.929  1.00 49.38 ? 17   GLU B N   1 
ATOM   4124  C  CA  . GLU B 2 14  ? 3.675   57.456  23.584  1.00 50.51 ? 17   GLU B CA  1 
ATOM   4125  C  C   . GLU B 2 14  ? 2.562   57.172  24.584  1.00 51.40 ? 17   GLU B C   1 
ATOM   4126  O  O   . GLU B 2 14  ? 1.827   58.088  24.938  1.00 51.56 ? 17   GLU B O   1 
ATOM   4127  C  CB  . GLU B 2 14  ? 3.254   57.077  22.164  1.00 50.43 ? 17   GLU B CB  1 
ATOM   4128  C  CG  . GLU B 2 14  ? 4.104   57.743  21.091  1.00 50.30 ? 17   GLU B CG  1 
ATOM   4129  C  CD  . GLU B 2 14  ? 3.843   57.201  19.699  1.00 50.47 ? 17   GLU B CD  1 
ATOM   4130  O  OE1 . GLU B 2 14  ? 2.996   56.288  19.543  1.00 50.53 ? 17   GLU B OE1 1 
ATOM   4131  O  OE2 . GLU B 2 14  ? 4.498   57.692  18.754  1.00 50.50 ? 17   GLU B OE2 1 
ATOM   4132  N  N   . GLN B 2 15  ? 2.455   55.929  25.060  1.00 52.55 ? 18   GLN B N   1 
ATOM   4133  C  CA  . GLN B 2 15  ? 1.435   55.554  26.050  1.00 53.85 ? 18   GLN B CA  1 
ATOM   4134  C  C   . GLN B 2 15  ? 1.669   56.247  27.394  1.00 54.43 ? 18   GLN B C   1 
ATOM   4135  O  O   . GLN B 2 15  ? 1.118   55.852  28.427  1.00 54.53 ? 18   GLN B O   1 
ATOM   4136  C  CB  . GLN B 2 15  ? 1.403   54.039  26.246  1.00 54.37 ? 18   GLN B CB  1 
ATOM   4137  C  CG  . GLN B 2 15  ? 0.610   53.309  25.178  1.00 55.68 ? 18   GLN B CG  1 
ATOM   4138  C  CD  . GLN B 2 15  ? 1.284   52.018  24.705  1.00 56.60 ? 18   GLN B CD  1 
ATOM   4139  O  OE1 . GLN B 2 15  ? 1.464   51.802  23.495  1.00 57.21 ? 18   GLN B OE1 1 
ATOM   4140  N  NE2 . GLN B 2 15  ? 1.654   51.151  25.651  1.00 56.65 ? 18   GLN B NE2 1 
ATOM   4141  N  N   . ARG B 2 16  ? 2.513   57.274  27.354  1.00 55.06 ? 19   ARG B N   1 
ATOM   4142  C  CA  . ARG B 2 16  ? 2.873   58.098  28.498  1.00 55.66 ? 19   ARG B CA  1 
ATOM   4143  C  C   . ARG B 2 16  ? 3.032   59.532  27.970  1.00 56.05 ? 19   ARG B C   1 
ATOM   4144  O  O   . ARG B 2 16  ? 4.137   59.967  27.628  1.00 56.21 ? 19   ARG B O   1 
ATOM   4145  C  CB  . ARG B 2 16  ? 4.194   57.620  29.101  1.00 55.64 ? 19   ARG B CB  1 
ATOM   4146  C  CG  . ARG B 2 16  ? 4.130   56.308  29.859  1.00 55.76 ? 19   ARG B CG  1 
ATOM   4147  C  CD  . ARG B 2 16  ? 5.498   55.970  30.432  1.00 55.84 ? 19   ARG B CD  1 
ATOM   4148  N  NE  . ARG B 2 16  ? 6.098   57.115  31.117  1.00 56.01 ? 19   ARG B NE  1 
ATOM   4149  C  CZ  . ARG B 2 16  ? 5.937   57.398  32.409  1.00 56.03 ? 19   ARG B CZ  1 
ATOM   4150  N  NH1 . ARG B 2 16  ? 5.195   56.611  33.186  1.00 55.69 ? 19   ARG B NH1 1 
ATOM   4151  N  NH2 . ARG B 2 16  ? 6.491   58.496  32.916  1.00 56.03 ? 19   ARG B NH2 1 
ATOM   4152  N  N   . ALA B 2 17  ? 1.907   60.230  27.823  1.00 56.46 ? 20   ALA B N   1 
ATOM   4153  C  CA  . ALA B 2 17  ? 1.906   61.612  27.334  1.00 56.68 ? 20   ALA B CA  1 
ATOM   4154  C  C   . ALA B 2 17  ? 2.634   62.501  28.347  1.00 56.78 ? 20   ALA B C   1 
ATOM   4155  O  O   . ALA B 2 17  ? 3.734   62.991  28.064  1.00 56.65 ? 20   ALA B O   1 
ATOM   4156  C  CB  . ALA B 2 17  ? 0.474   62.089  27.125  1.00 56.75 ? 20   ALA B CB  1 
ATOM   4157  N  N   . ALA B 2 18  ? 2.009   62.711  29.512  1.00 56.92 ? 21   ALA B N   1 
ATOM   4158  C  CA  . ALA B 2 18  ? 2.596   63.495  30.615  1.00 56.89 ? 21   ALA B CA  1 
ATOM   4159  C  C   . ALA B 2 18  ? 3.771   62.640  31.106  1.00 56.75 ? 21   ALA B C   1 
ATOM   4160  O  O   . ALA B 2 18  ? 3.717   61.941  32.136  1.00 56.50 ? 21   ALA B O   1 
ATOM   4161  C  CB  . ALA B 2 18  ? 1.569   63.708  31.735  1.00 57.07 ? 21   ALA B CB  1 
ATOM   4162  N  N   . GLN B 2 19  ? 4.825   62.704  30.300  1.00 56.66 ? 22   GLN B N   1 
ATOM   4163  C  CA  . GLN B 2 19  ? 6.050   61.945  30.480  1.00 56.16 ? 22   GLN B CA  1 
ATOM   4164  C  C   . GLN B 2 19  ? 6.877   62.091  31.737  1.00 55.14 ? 22   GLN B C   1 
ATOM   4165  O  O   . GLN B 2 19  ? 8.062   61.730  31.705  1.00 55.41 ? 22   GLN B O   1 
ATOM   4166  C  CB  . GLN B 2 19  ? 6.979   62.142  29.266  1.00 56.75 ? 22   GLN B CB  1 
ATOM   4167  C  CG  . GLN B 2 19  ? 7.048   60.940  28.324  1.00 57.47 ? 22   GLN B CG  1 
ATOM   4168  C  CD  . GLN B 2 19  ? 7.216   59.601  29.057  1.00 57.91 ? 22   GLN B CD  1 
ATOM   4169  O  OE1 . GLN B 2 19  ? 7.641   59.543  30.222  1.00 57.91 ? 22   GLN B OE1 1 
ATOM   4170  N  NE2 . GLN B 2 19  ? 6.879   58.515  28.366  1.00 58.13 ? 22   GLN B NE2 1 
ATOM   4171  N  N   . LYS B 2 20  ? 6.318   62.584  32.839  1.00 53.71 ? 23   LYS B N   1 
ATOM   4172  C  CA  . LYS B 2 20  ? 7.182   62.692  34.004  1.00 52.31 ? 23   LYS B CA  1 
ATOM   4173  C  C   . LYS B 2 20  ? 7.609   61.300  34.440  1.00 51.17 ? 23   LYS B C   1 
ATOM   4174  O  O   . LYS B 2 20  ? 6.802   60.497  34.916  1.00 50.97 ? 23   LYS B O   1 
ATOM   4175  C  CB  . LYS B 2 20  ? 6.551   63.463  35.144  1.00 52.56 ? 23   LYS B CB  1 
ATOM   4176  C  CG  . LYS B 2 20  ? 7.521   63.667  36.298  1.00 52.84 ? 23   LYS B CG  1 
ATOM   4177  C  CD  . LYS B 2 20  ? 8.771   64.425  35.882  1.00 52.94 ? 23   LYS B CD  1 
ATOM   4178  C  CE  . LYS B 2 20  ? 9.760   64.497  37.037  1.00 53.14 ? 23   LYS B CE  1 
ATOM   4179  N  NZ  . LYS B 2 20  ? 11.007  65.218  36.660  1.00 53.16 ? 23   LYS B NZ  1 
ATOM   4180  N  N   . ALA B 2 21  ? 8.879   61.009  34.183  1.00 49.67 ? 24   ALA B N   1 
ATOM   4181  C  CA  . ALA B 2 21  ? 9.471   59.727  34.497  1.00 48.17 ? 24   ALA B CA  1 
ATOM   4182  C  C   . ALA B 2 21  ? 9.417   59.403  35.971  1.00 47.18 ? 24   ALA B C   1 
ATOM   4183  O  O   . ALA B 2 21  ? 9.381   60.287  36.826  1.00 47.08 ? 24   ALA B O   1 
ATOM   4184  C  CB  . ALA B 2 21  ? 10.908  59.686  34.010  1.00 48.11 ? 24   ALA B CB  1 
ATOM   4185  N  N   . ASP B 2 22  ? 9.361   58.114  36.256  1.00 46.05 ? 25   ASP B N   1 
ATOM   4186  C  CA  . ASP B 2 22  ? 9.352   57.657  37.622  1.00 44.91 ? 25   ASP B CA  1 
ATOM   4187  C  C   . ASP B 2 22  ? 10.762  57.850  38.149  1.00 44.13 ? 25   ASP B C   1 
ATOM   4188  O  O   . ASP B 2 22  ? 11.709  58.038  37.380  1.00 43.82 ? 25   ASP B O   1 
ATOM   4189  C  CB  . ASP B 2 22  ? 8.957   56.185  37.689  1.00 45.06 ? 25   ASP B CB  1 
ATOM   4190  C  CG  . ASP B 2 22  ? 7.503   55.957  37.346  1.00 45.18 ? 25   ASP B CG  1 
ATOM   4191  O  OD1 . ASP B 2 22  ? 7.207   54.971  36.647  1.00 45.42 ? 25   ASP B OD1 1 
ATOM   4192  O  OD2 . ASP B 2 22  ? 6.648   56.755  37.779  1.00 45.41 ? 25   ASP B OD2 1 
ATOM   4193  N  N   . VAL B 2 23  ? 10.892  57.840  39.467  1.00 43.00 ? 26   VAL B N   1 
ATOM   4194  C  CA  . VAL B 2 23  ? 12.183  58.020  40.090  1.00 42.01 ? 26   VAL B CA  1 
ATOM   4195  C  C   . VAL B 2 23  ? 13.002  56.736  39.978  1.00 41.41 ? 26   VAL B C   1 
ATOM   4196  O  O   . VAL B 2 23  ? 12.483  55.634  40.155  1.00 41.26 ? 26   VAL B O   1 
ATOM   4197  C  CB  . VAL B 2 23  ? 12.016  58.453  41.564  1.00 42.09 ? 26   VAL B CB  1 
ATOM   4198  C  CG1 . VAL B 2 23  ? 13.370  58.652  42.217  1.00 41.90 ? 26   VAL B CG1 1 
ATOM   4199  C  CG2 . VAL B 2 23  ? 11.197  59.741  41.642  1.00 41.80 ? 26   VAL B CG2 1 
ATOM   4200  N  N   . LEU B 2 24  ? 14.270  56.893  39.615  1.00 40.65 ? 27   LEU B N   1 
ATOM   4201  C  CA  . LEU B 2 24  ? 15.200  55.778  39.471  1.00 39.97 ? 27   LEU B CA  1 
ATOM   4202  C  C   . LEU B 2 24  ? 15.660  55.324  40.861  1.00 39.62 ? 27   LEU B C   1 
ATOM   4203  O  O   . LEU B 2 24  ? 16.236  56.108  41.613  1.00 39.53 ? 27   LEU B O   1 
ATOM   4204  C  CB  . LEU B 2 24  ? 16.383  56.234  38.614  1.00 39.64 ? 27   LEU B CB  1 
ATOM   4205  C  CG  . LEU B 2 24  ? 17.603  55.358  38.352  1.00 39.44 ? 27   LEU B CG  1 
ATOM   4206  C  CD1 . LEU B 2 24  ? 17.203  53.940  38.068  1.00 39.36 ? 27   LEU B CD1 1 
ATOM   4207  C  CD2 . LEU B 2 24  ? 18.371  55.942  37.179  1.00 39.40 ? 27   LEU B CD2 1 
ATOM   4208  N  N   . THR B 2 25  ? 15.401  54.062  41.199  1.00 38.99 ? 28   THR B N   1 
ATOM   4209  C  CA  . THR B 2 25  ? 15.762  53.531  42.511  1.00 38.36 ? 28   THR B CA  1 
ATOM   4210  C  C   . THR B 2 25  ? 16.638  52.284  42.476  1.00 38.14 ? 28   THR B C   1 
ATOM   4211  O  O   . THR B 2 25  ? 16.828  51.658  41.436  1.00 38.04 ? 28   THR B O   1 
ATOM   4212  C  CB  . THR B 2 25  ? 14.504  53.141  43.331  1.00 38.22 ? 28   THR B CB  1 
ATOM   4213  O  OG1 . THR B 2 25  ? 13.953  51.918  42.822  1.00 38.01 ? 28   THR B OG1 1 
ATOM   4214  C  CG2 . THR B 2 25  ? 13.452  54.222  43.265  1.00 38.05 ? 28   THR B CG2 1 
ATOM   4215  N  N   . THR B 2 26  ? 17.167  51.927  43.640  1.00 37.82 ? 29   THR B N   1 
ATOM   4216  C  CA  . THR B 2 26  ? 17.975  50.727  43.779  1.00 37.45 ? 29   THR B CA  1 
ATOM   4217  C  C   . THR B 2 26  ? 16.965  49.590  43.869  1.00 37.48 ? 29   THR B C   1 
ATOM   4218  O  O   . THR B 2 26  ? 15.755  49.834  43.824  1.00 37.64 ? 29   THR B O   1 
ATOM   4219  C  CB  . THR B 2 26  ? 18.786  50.757  45.083  1.00 37.31 ? 29   THR B CB  1 
ATOM   4220  O  OG1 . THR B 2 26  ? 17.907  50.999  46.186  1.00 36.89 ? 29   THR B OG1 1 
ATOM   4221  C  CG2 . THR B 2 26  ? 19.833  51.845  45.037  1.00 37.14 ? 29   THR B CG2 1 
ATOM   4222  N  N   . GLY B 2 27  ? 17.441  48.355  43.995  1.00 37.44 ? 30   GLY B N   1 
ATOM   4223  C  CA  . GLY B 2 27  ? 16.526  47.231  44.113  1.00 37.22 ? 30   GLY B CA  1 
ATOM   4224  C  C   . GLY B 2 27  ? 15.676  47.339  45.376  1.00 37.29 ? 30   GLY B C   1 
ATOM   4225  O  O   . GLY B 2 27  ? 14.531  46.882  45.419  1.00 37.20 ? 30   GLY B O   1 
ATOM   4226  N  N   . ALA B 2 28  ? 16.239  47.955  46.409  1.00 37.12 ? 31   ALA B N   1 
ATOM   4227  C  CA  . ALA B 2 28  ? 15.541  48.131  47.670  1.00 36.75 ? 31   ALA B CA  1 
ATOM   4228  C  C   . ALA B 2 28  ? 14.656  49.378  47.688  1.00 36.80 ? 31   ALA B C   1 
ATOM   4229  O  O   . ALA B 2 28  ? 14.146  49.761  48.737  1.00 36.79 ? 31   ALA B O   1 
ATOM   4230  C  CB  . ALA B 2 28  ? 16.529  48.169  48.809  1.00 36.83 ? 31   ALA B CB  1 
ATOM   4231  N  N   . GLY B 2 29  ? 14.488  50.017  46.533  1.00 36.91 ? 32   GLY B N   1 
ATOM   4232  C  CA  . GLY B 2 29  ? 13.638  51.192  46.447  1.00 36.93 ? 32   GLY B CA  1 
ATOM   4233  C  C   . GLY B 2 29  ? 14.192  52.536  46.884  1.00 37.10 ? 32   GLY B C   1 
ATOM   4234  O  O   . GLY B 2 29  ? 13.443  53.511  46.967  1.00 37.07 ? 32   GLY B O   1 
ATOM   4235  N  N   . ASN B 2 30  ? 15.482  52.607  47.187  1.00 37.38 ? 33   ASN B N   1 
ATOM   4236  C  CA  . ASN B 2 30  ? 16.090  53.870  47.595  1.00 37.54 ? 33   ASN B CA  1 
ATOM   4237  C  C   . ASN B 2 30  ? 16.361  54.690  46.344  1.00 37.60 ? 33   ASN B C   1 
ATOM   4238  O  O   . ASN B 2 30  ? 16.949  54.183  45.382  1.00 37.63 ? 33   ASN B O   1 
ATOM   4239  C  CB  . ASN B 2 30  ? 17.406  53.617  48.324  1.00 37.93 ? 33   ASN B CB  1 
ATOM   4240  C  CG  . ASN B 2 30  ? 17.264  52.625  49.459  1.00 38.31 ? 33   ASN B CG  1 
ATOM   4241  O  OD1 . ASN B 2 30  ? 18.016  51.655  49.537  1.00 38.68 ? 33   ASN B OD1 1 
ATOM   4242  N  ND2 . ASN B 2 30  ? 16.297  52.860  50.347  1.00 38.43 ? 33   ASN B ND2 1 
ATOM   4243  N  N   . PRO B 2 31  ? 15.943  55.971  46.332  1.00 37.67 ? 34   PRO B N   1 
ATOM   4244  C  CA  . PRO B 2 31  ? 16.164  56.832  45.163  1.00 37.63 ? 34   PRO B CA  1 
ATOM   4245  C  C   . PRO B 2 31  ? 17.656  57.020  44.867  1.00 37.71 ? 34   PRO B C   1 
ATOM   4246  O  O   . PRO B 2 31  ? 18.480  57.084  45.782  1.00 37.81 ? 34   PRO B O   1 
ATOM   4247  C  CB  . PRO B 2 31  ? 15.509  58.149  45.580  1.00 37.57 ? 34   PRO B CB  1 
ATOM   4248  C  CG  . PRO B 2 31  ? 14.473  57.727  46.567  1.00 37.62 ? 34   PRO B CG  1 
ATOM   4249  C  CD  . PRO B 2 31  ? 15.199  56.693  47.376  1.00 37.62 ? 34   PRO B CD  1 
ATOM   4250  N  N   . VAL B 2 32  ? 17.992  57.103  43.586  1.00 37.70 ? 35   VAL B N   1 
ATOM   4251  C  CA  . VAL B 2 32  ? 19.371  57.279  43.133  1.00 37.50 ? 35   VAL B CA  1 
ATOM   4252  C  C   . VAL B 2 32  ? 19.629  58.716  42.680  1.00 37.46 ? 35   VAL B C   1 
ATOM   4253  O  O   . VAL B 2 32  ? 18.922  59.242  41.820  1.00 37.53 ? 35   VAL B O   1 
ATOM   4254  C  CB  . VAL B 2 32  ? 19.671  56.330  41.961  1.00 37.41 ? 35   VAL B CB  1 
ATOM   4255  C  CG1 . VAL B 2 32  ? 21.071  56.551  41.440  1.00 37.40 ? 35   VAL B CG1 1 
ATOM   4256  C  CG2 . VAL B 2 32  ? 19.492  54.894  42.400  1.00 37.27 ? 35   VAL B CG2 1 
ATOM   4257  N  N   . GLY B 2 33  ? 20.656  59.340  43.245  1.00 37.44 ? 36   GLY B N   1 
ATOM   4258  C  CA  . GLY B 2 33  ? 20.977  60.709  42.882  1.00 37.38 ? 36   GLY B CA  1 
ATOM   4259  C  C   . GLY B 2 33  ? 21.697  60.859  41.555  1.00 37.41 ? 36   GLY B C   1 
ATOM   4260  O  O   . GLY B 2 33  ? 21.486  61.832  40.828  1.00 37.52 ? 36   GLY B O   1 
ATOM   4261  N  N   . ASP B 2 34  ? 22.560  59.899  41.243  1.00 37.50 ? 37   ASP B N   1 
ATOM   4262  C  CA  . ASP B 2 34  ? 23.313  59.920  40.002  1.00 37.59 ? 37   ASP B CA  1 
ATOM   4263  C  C   . ASP B 2 34  ? 23.697  58.494  39.659  1.00 37.54 ? 37   ASP B C   1 
ATOM   4264  O  O   . ASP B 2 34  ? 24.501  57.883  40.360  1.00 37.68 ? 37   ASP B O   1 
ATOM   4265  C  CB  . ASP B 2 34  ? 24.574  60.776  40.175  1.00 37.83 ? 37   ASP B CB  1 
ATOM   4266  C  CG  . ASP B 2 34  ? 25.417  60.877  38.901  1.00 38.04 ? 37   ASP B CG  1 
ATOM   4267  O  OD1 . ASP B 2 34  ? 26.473  61.535  38.959  1.00 38.48 ? 37   ASP B OD1 1 
ATOM   4268  O  OD2 . ASP B 2 34  ? 25.050  60.320  37.845  1.00 38.27 ? 37   ASP B OD2 1 
ATOM   4269  N  N   . LYS B 2 35  ? 23.105  57.957  38.599  1.00 37.29 ? 38   LYS B N   1 
ATOM   4270  C  CA  . LYS B 2 35  ? 23.421  56.601  38.180  1.00 37.24 ? 38   LYS B CA  1 
ATOM   4271  C  C   . LYS B 2 35  ? 24.299  56.621  36.933  1.00 37.25 ? 38   LYS B C   1 
ATOM   4272  O  O   . LYS B 2 35  ? 24.374  55.627  36.209  1.00 37.22 ? 38   LYS B O   1 
ATOM   4273  C  CB  . LYS B 2 35  ? 22.147  55.804  37.899  1.00 37.07 ? 38   LYS B CB  1 
ATOM   4274  C  CG  . LYS B 2 35  ? 22.304  54.323  38.223  1.00 37.00 ? 38   LYS B CG  1 
ATOM   4275  C  CD  . LYS B 2 35  ? 21.371  53.443  37.425  1.00 36.97 ? 38   LYS B CD  1 
ATOM   4276  C  CE  . LYS B 2 35  ? 21.724  53.474  35.939  1.00 37.10 ? 38   LYS B CE  1 
ATOM   4277  N  NZ  . LYS B 2 35  ? 23.125  53.031  35.681  1.00 36.82 ? 38   LYS B NZ  1 
ATOM   4278  N  N   . LEU B 2 36  ? 24.983  57.743  36.705  1.00 37.07 ? 39   LEU B N   1 
ATOM   4279  C  CA  . LEU B 2 36  ? 25.844  57.896  35.535  1.00 36.85 ? 39   LEU B CA  1 
ATOM   4280  C  C   . LEU B 2 36  ? 27.333  57.998  35.845  1.00 36.81 ? 39   LEU B C   1 
ATOM   4281  O  O   . LEU B 2 36  ? 28.165  57.956  34.936  1.00 36.77 ? 39   LEU B O   1 
ATOM   4282  C  CB  . LEU B 2 36  ? 25.401  59.105  34.712  1.00 36.85 ? 39   LEU B CB  1 
ATOM   4283  C  CG  . LEU B 2 36  ? 24.003  59.006  34.101  1.00 36.83 ? 39   LEU B CG  1 
ATOM   4284  C  CD1 . LEU B 2 36  ? 23.632  60.316  33.437  1.00 36.89 ? 39   LEU B CD1 1 
ATOM   4285  C  CD2 . LEU B 2 36  ? 23.963  57.869  33.099  1.00 36.91 ? 39   LEU B CD2 1 
ATOM   4286  N  N   . ASN B 2 37  ? 27.673  58.138  37.119  1.00 36.60 ? 40   ASN B N   1 
ATOM   4287  C  CA  . ASN B 2 37  ? 29.069  58.235  37.529  1.00 36.59 ? 40   ASN B CA  1 
ATOM   4288  C  C   . ASN B 2 37  ? 29.223  57.494  38.844  1.00 36.61 ? 40   ASN B C   1 
ATOM   4289  O  O   . ASN B 2 37  ? 28.312  57.496  39.674  1.00 36.65 ? 40   ASN B O   1 
ATOM   4290  C  CB  . ASN B 2 37  ? 29.487  59.698  37.728  1.00 36.66 ? 40   ASN B CB  1 
ATOM   4291  C  CG  . ASN B 2 37  ? 29.371  60.527  36.459  1.00 37.13 ? 40   ASN B CG  1 
ATOM   4292  O  OD1 . ASN B 2 37  ? 28.409  61.277  36.284  1.00 37.60 ? 40   ASN B OD1 1 
ATOM   4293  N  ND2 . ASN B 2 37  ? 30.363  60.418  35.578  1.00 37.32 ? 40   ASN B ND2 1 
ATOM   4294  N  N   . VAL B 2 38  ? 30.361  56.841  39.034  1.00 36.48 ? 41   VAL B N   1 
ATOM   4295  C  CA  . VAL B 2 38  ? 30.604  56.114  40.274  1.00 36.37 ? 41   VAL B CA  1 
ATOM   4296  C  C   . VAL B 2 38  ? 31.320  56.989  41.297  1.00 36.40 ? 41   VAL B C   1 
ATOM   4297  O  O   . VAL B 2 38  ? 31.790  58.084  40.970  1.00 36.39 ? 41   VAL B O   1 
ATOM   4298  C  CB  . VAL B 2 38  ? 31.409  54.820  40.034  1.00 36.40 ? 41   VAL B CB  1 
ATOM   4299  C  CG1 . VAL B 2 38  ? 30.578  53.840  39.230  1.00 36.15 ? 41   VAL B CG1 1 
ATOM   4300  C  CG2 . VAL B 2 38  ? 32.729  55.127  39.323  1.00 36.21 ? 41   VAL B CG2 1 
ATOM   4301  N  N   . ILE B 2 39  ? 31.363  56.522  42.541  1.00 36.33 ? 42   ILE B N   1 
ATOM   4302  C  CA  . ILE B 2 39  ? 32.022  57.257  43.617  1.00 36.25 ? 42   ILE B CA  1 
ATOM   4303  C  C   . ILE B 2 39  ? 33.500  56.917  43.672  1.00 36.43 ? 42   ILE B C   1 
ATOM   4304  O  O   . ILE B 2 39  ? 33.871  55.755  43.828  1.00 36.46 ? 42   ILE B O   1 
ATOM   4305  C  CB  . ILE B 2 39  ? 31.433  56.922  44.987  1.00 35.91 ? 42   ILE B CB  1 
ATOM   4306  C  CG1 . ILE B 2 39  ? 29.938  57.195  45.006  1.00 35.55 ? 42   ILE B CG1 1 
ATOM   4307  C  CG2 . ILE B 2 39  ? 32.106  57.758  46.053  1.00 35.86 ? 42   ILE B CG2 1 
ATOM   4308  C  CD1 . ILE B 2 39  ? 29.302  56.810  46.307  1.00 35.70 ? 42   ILE B CD1 1 
ATOM   4309  N  N   . THR B 2 40  ? 34.338  57.939  43.574  1.00 36.46 ? 43   THR B N   1 
ATOM   4310  C  CA  . THR B 2 40  ? 35.780  57.751  43.618  1.00 36.67 ? 43   THR B CA  1 
ATOM   4311  C  C   . THR B 2 40  ? 36.366  58.782  44.564  1.00 36.79 ? 43   THR B C   1 
ATOM   4312  O  O   . THR B 2 40  ? 35.683  59.732  44.945  1.00 36.81 ? 43   THR B O   1 
ATOM   4313  C  CB  . THR B 2 40  ? 36.421  57.961  42.219  1.00 36.67 ? 43   THR B CB  1 
ATOM   4314  O  OG1 . THR B 2 40  ? 36.078  59.259  41.718  1.00 36.58 ? 43   THR B OG1 1 
ATOM   4315  C  CG2 . THR B 2 40  ? 35.943  56.911  41.233  1.00 36.43 ? 43   THR B CG2 1 
ATOM   4316  N  N   . VAL B 2 41  ? 37.602  58.573  45.002  1.00 36.93 ? 44   VAL B N   1 
ATOM   4317  C  CA  . VAL B 2 41  ? 38.233  59.565  45.863  1.00 37.20 ? 44   VAL B CA  1 
ATOM   4318  C  C   . VAL B 2 41  ? 39.020  60.505  44.941  1.00 37.38 ? 44   VAL B C   1 
ATOM   4319  O  O   . VAL B 2 41  ? 40.093  60.163  44.431  1.00 37.46 ? 44   VAL B O   1 
ATOM   4320  C  CB  . VAL B 2 41  ? 39.116  58.935  46.981  1.00 37.19 ? 44   VAL B CB  1 
ATOM   4321  C  CG1 . VAL B 2 41  ? 40.067  57.911  46.424  1.00 37.15 ? 44   VAL B CG1 1 
ATOM   4322  C  CG2 . VAL B 2 41  ? 39.876  60.022  47.724  1.00 37.08 ? 44   VAL B CG2 1 
ATOM   4323  N  N   . GLY B 2 42  ? 38.449  61.678  44.684  1.00 37.35 ? 45   GLY B N   1 
ATOM   4324  C  CA  . GLY B 2 42  ? 39.095  62.616  43.790  1.00 37.25 ? 45   GLY B CA  1 
ATOM   4325  C  C   . GLY B 2 42  ? 38.689  62.232  42.382  1.00 37.27 ? 45   GLY B C   1 
ATOM   4326  O  O   . GLY B 2 42  ? 38.336  61.075  42.142  1.00 37.50 ? 45   GLY B O   1 
ATOM   4327  N  N   . PRO B 2 43  ? 38.733  63.163  41.421  1.00 37.02 ? 46   PRO B N   1 
ATOM   4328  C  CA  . PRO B 2 43  ? 38.351  62.872  40.038  1.00 36.90 ? 46   PRO B CA  1 
ATOM   4329  C  C   . PRO B 2 43  ? 39.072  61.701  39.374  1.00 36.84 ? 46   PRO B C   1 
ATOM   4330  O  O   . PRO B 2 43  ? 38.497  61.017  38.529  1.00 36.66 ? 46   PRO B O   1 
ATOM   4331  C  CB  . PRO B 2 43  ? 38.608  64.203  39.330  1.00 36.97 ? 46   PRO B CB  1 
ATOM   4332  C  CG  . PRO B 2 43  ? 39.648  64.864  40.186  1.00 36.98 ? 46   PRO B CG  1 
ATOM   4333  C  CD  . PRO B 2 43  ? 39.168  64.561  41.563  1.00 37.02 ? 46   PRO B CD  1 
ATOM   4334  N  N   . ARG B 2 44  ? 40.319  61.459  39.762  1.00 37.07 ? 47   ARG B N   1 
ATOM   4335  C  CA  . ARG B 2 44  ? 41.091  60.361  39.191  1.00 37.33 ? 47   ARG B CA  1 
ATOM   4336  C  C   . ARG B 2 44  ? 41.553  59.361  40.250  1.00 37.59 ? 47   ARG B C   1 
ATOM   4337  O  O   . ARG B 2 44  ? 42.641  58.787  40.144  1.00 37.76 ? 47   ARG B O   1 
ATOM   4338  C  CB  . ARG B 2 44  ? 42.290  60.900  38.405  1.00 37.13 ? 47   ARG B CB  1 
ATOM   4339  C  CG  . ARG B 2 44  ? 41.895  61.756  37.210  1.00 37.06 ? 47   ARG B CG  1 
ATOM   4340  C  CD  . ARG B 2 44  ? 43.106  62.202  36.404  1.00 37.09 ? 47   ARG B CD  1 
ATOM   4341  N  NE  . ARG B 2 44  ? 42.718  63.090  35.310  1.00 37.13 ? 47   ARG B NE  1 
ATOM   4342  C  CZ  . ARG B 2 44  ? 43.556  63.587  34.405  1.00 37.23 ? 47   ARG B CZ  1 
ATOM   4343  N  NH1 . ARG B 2 44  ? 43.098  64.387  33.452  1.00 37.18 ? 47   ARG B NH1 1 
ATOM   4344  N  NH2 . ARG B 2 44  ? 44.848  63.278  34.439  1.00 37.37 ? 47   ARG B NH2 1 
ATOM   4345  N  N   . GLY B 2 45  ? 40.715  59.148  41.263  1.00 37.75 ? 48   GLY B N   1 
ATOM   4346  C  CA  . GLY B 2 45  ? 41.040  58.210  42.324  1.00 37.52 ? 48   GLY B CA  1 
ATOM   4347  C  C   . GLY B 2 45  ? 40.306  56.886  42.175  1.00 37.52 ? 48   GLY B C   1 
ATOM   4348  O  O   . GLY B 2 45  ? 39.497  56.729  41.257  1.00 37.52 ? 48   GLY B O   1 
ATOM   4349  N  N   . PRO B 2 46  ? 40.559  55.914  43.072  1.00 37.36 ? 49   PRO B N   1 
ATOM   4350  C  CA  . PRO B 2 46  ? 39.924  54.588  43.043  1.00 37.11 ? 49   PRO B CA  1 
ATOM   4351  C  C   . PRO B 2 46  ? 38.448  54.556  43.433  1.00 36.85 ? 49   PRO B C   1 
ATOM   4352  O  O   . PRO B 2 46  ? 37.927  55.488  44.051  1.00 36.80 ? 49   PRO B O   1 
ATOM   4353  C  CB  . PRO B 2 46  ? 40.764  53.780  44.036  1.00 37.21 ? 49   PRO B CB  1 
ATOM   4354  C  CG  . PRO B 2 46  ? 42.072  54.521  44.103  1.00 37.31 ? 49   PRO B CG  1 
ATOM   4355  C  CD  . PRO B 2 46  ? 41.620  55.951  44.091  1.00 37.34 ? 49   PRO B CD  1 
ATOM   4356  N  N   . LEU B 2 47  ? 37.800  53.446  43.087  1.00 36.65 ? 50   LEU B N   1 
ATOM   4357  C  CA  . LEU B 2 47  ? 36.382  53.204  43.360  1.00 36.38 ? 50   LEU B CA  1 
ATOM   4358  C  C   . LEU B 2 47  ? 36.135  52.750  44.792  1.00 36.41 ? 50   LEU B C   1 
ATOM   4359  O  O   . LEU B 2 47  ? 36.852  51.895  45.316  1.00 36.30 ? 50   LEU B O   1 
ATOM   4360  C  CB  . LEU B 2 47  ? 35.858  52.141  42.398  1.00 36.17 ? 50   LEU B CB  1 
ATOM   4361  C  CG  . LEU B 2 47  ? 34.441  51.598  42.558  1.00 36.04 ? 50   LEU B CG  1 
ATOM   4362  C  CD1 . LEU B 2 47  ? 33.415  52.701  42.331  1.00 36.03 ? 50   LEU B CD1 1 
ATOM   4363  C  CD2 . LEU B 2 47  ? 34.246  50.461  41.575  1.00 35.81 ? 50   LEU B CD2 1 
ATOM   4364  N  N   . LEU B 2 48  ? 35.084  53.293  45.400  1.00 36.45 ? 51   LEU B N   1 
ATOM   4365  C  CA  . LEU B 2 48  ? 34.729  52.967  46.775  1.00 36.42 ? 51   LEU B CA  1 
ATOM   4366  C  C   . LEU B 2 48  ? 33.656  51.915  46.913  1.00 36.43 ? 51   LEU B C   1 
ATOM   4367  O  O   . LEU B 2 48  ? 32.685  51.921  46.162  1.00 36.31 ? 51   LEU B O   1 
ATOM   4368  C  CB  . LEU B 2 48  ? 34.264  54.215  47.508  1.00 36.66 ? 51   LEU B CB  1 
ATOM   4369  C  CG  . LEU B 2 48  ? 35.379  55.123  48.009  1.00 37.05 ? 51   LEU B CG  1 
ATOM   4370  C  CD1 . LEU B 2 48  ? 35.954  55.965  46.889  1.00 37.26 ? 51   LEU B CD1 1 
ATOM   4371  C  CD2 . LEU B 2 48  ? 34.790  56.007  49.062  1.00 37.60 ? 51   LEU B CD2 1 
ATOM   4372  N  N   . VAL B 2 49  ? 33.822  51.026  47.893  1.00 36.39 ? 52   VAL B N   1 
ATOM   4373  C  CA  . VAL B 2 49  ? 32.834  49.974  48.161  1.00 36.34 ? 52   VAL B CA  1 
ATOM   4374  C  C   . VAL B 2 49  ? 31.536  50.664  48.567  1.00 36.51 ? 52   VAL B C   1 
ATOM   4375  O  O   . VAL B 2 49  ? 30.443  50.133  48.377  1.00 36.41 ? 52   VAL B O   1 
ATOM   4376  C  CB  . VAL B 2 49  ? 33.311  49.026  49.299  1.00 36.33 ? 52   VAL B CB  1 
ATOM   4377  C  CG1 . VAL B 2 49  ? 32.153  48.212  49.861  1.00 35.97 ? 52   VAL B CG1 1 
ATOM   4378  C  CG2 . VAL B 2 49  ? 34.383  48.088  48.776  1.00 36.25 ? 52   VAL B CG2 1 
ATOM   4379  N  N   . GLN B 2 50  ? 31.698  51.876  49.087  1.00 36.52 ? 53   GLN B N   1 
ATOM   4380  C  CA  . GLN B 2 50  ? 30.638  52.767  49.546  1.00 36.59 ? 53   GLN B CA  1 
ATOM   4381  C  C   . GLN B 2 50  ? 29.607  53.050  48.442  1.00 36.54 ? 53   GLN B C   1 
ATOM   4382  O  O   . GLN B 2 50  ? 28.495  53.496  48.721  1.00 36.56 ? 53   GLN B O   1 
ATOM   4383  C  CB  . GLN B 2 50  ? 31.311  54.067  49.965  1.00 36.84 ? 53   GLN B CB  1 
ATOM   4384  C  CG  . GLN B 2 50  ? 30.528  54.974  50.825  1.00 37.39 ? 53   GLN B CG  1 
ATOM   4385  C  CD  . GLN B 2 50  ? 31.426  56.004  51.474  1.00 37.56 ? 53   GLN B CD  1 
ATOM   4386  O  OE1 . GLN B 2 50  ? 32.184  55.684  52.394  1.00 37.93 ? 53   GLN B OE1 1 
ATOM   4387  N  NE2 . GLN B 2 50  ? 31.362  57.239  50.993  1.00 37.50 ? 53   GLN B NE2 1 
ATOM   4388  N  N   . ASP B 2 51  ? 30.005  52.868  47.185  1.00 36.34 ? 54   ASP B N   1 
ATOM   4389  C  CA  . ASP B 2 51  ? 29.101  53.079  46.058  1.00 36.13 ? 54   ASP B CA  1 
ATOM   4390  C  C   . ASP B 2 51  ? 28.219  51.842  45.943  1.00 35.99 ? 54   ASP B C   1 
ATOM   4391  O  O   . ASP B 2 51  ? 28.509  50.923  45.178  1.00 35.80 ? 54   ASP B O   1 
ATOM   4392  C  CB  . ASP B 2 51  ? 29.878  53.284  44.752  1.00 36.14 ? 54   ASP B CB  1 
ATOM   4393  C  CG  . ASP B 2 51  ? 28.996  53.792  43.613  1.00 36.25 ? 54   ASP B CG  1 
ATOM   4394  O  OD1 . ASP B 2 51  ? 29.551  54.305  42.623  1.00 36.32 ? 54   ASP B OD1 1 
ATOM   4395  O  OD2 . ASP B 2 51  ? 27.751  53.698  43.700  1.00 36.60 ? 54   ASP B OD2 1 
ATOM   4396  N  N   . VAL B 2 52  ? 27.147  51.833  46.724  1.00 35.75 ? 55   VAL B N   1 
ATOM   4397  C  CA  . VAL B 2 52  ? 26.205  50.728  46.745  1.00 35.56 ? 55   VAL B CA  1 
ATOM   4398  C  C   . VAL B 2 52  ? 25.285  50.748  45.534  1.00 35.46 ? 55   VAL B C   1 
ATOM   4399  O  O   . VAL B 2 52  ? 24.781  49.713  45.108  1.00 35.49 ? 55   VAL B O   1 
ATOM   4400  C  CB  . VAL B 2 52  ? 25.386  50.754  48.044  1.00 35.64 ? 55   VAL B CB  1 
ATOM   4401  C  CG1 . VAL B 2 52  ? 24.219  49.770  47.969  1.00 35.81 ? 55   VAL B CG1 1 
ATOM   4402  C  CG2 . VAL B 2 52  ? 26.295  50.417  49.217  1.00 35.42 ? 55   VAL B CG2 1 
ATOM   4403  N  N   . VAL B 2 53  ? 25.062  51.930  44.979  1.00 35.04 ? 56   VAL B N   1 
ATOM   4404  C  CA  . VAL B 2 53  ? 24.221  52.047  43.808  1.00 34.68 ? 56   VAL B CA  1 
ATOM   4405  C  C   . VAL B 2 53  ? 24.860  51.252  42.680  1.00 34.52 ? 56   VAL B C   1 
ATOM   4406  O  O   . VAL B 2 53  ? 24.176  50.538  41.951  1.00 34.45 ? 56   VAL B O   1 
ATOM   4407  C  CB  . VAL B 2 53  ? 24.073  53.512  43.384  1.00 34.65 ? 56   VAL B CB  1 
ATOM   4408  C  CG1 . VAL B 2 53  ? 23.322  53.611  42.071  1.00 34.66 ? 56   VAL B CG1 1 
ATOM   4409  C  CG2 . VAL B 2 53  ? 23.336  54.283  44.453  1.00 34.65 ? 56   VAL B CG2 1 
ATOM   4410  N  N   . PHE B 2 54  ? 26.178  51.360  42.556  1.00 34.12 ? 57   PHE B N   1 
ATOM   4411  C  CA  . PHE B 2 54  ? 26.899  50.648  41.518  1.00 33.88 ? 57   PHE B CA  1 
ATOM   4412  C  C   . PHE B 2 54  ? 26.832  49.142  41.704  1.00 33.89 ? 57   PHE B C   1 
ATOM   4413  O  O   . PHE B 2 54  ? 26.438  48.412  40.792  1.00 33.87 ? 57   PHE B O   1 
ATOM   4414  C  CB  . PHE B 2 54  ? 28.359  51.088  41.490  1.00 33.81 ? 57   PHE B CB  1 
ATOM   4415  C  CG  . PHE B 2 54  ? 29.224  50.239  40.605  1.00 33.92 ? 57   PHE B CG  1 
ATOM   4416  C  CD1 . PHE B 2 54  ? 29.082  50.280  39.226  1.00 33.89 ? 57   PHE B CD1 1 
ATOM   4417  C  CD2 . PHE B 2 54  ? 30.154  49.361  41.154  1.00 33.96 ? 57   PHE B CD2 1 
ATOM   4418  C  CE1 . PHE B 2 54  ? 29.847  49.457  38.407  1.00 33.98 ? 57   PHE B CE1 1 
ATOM   4419  C  CE2 . PHE B 2 54  ? 30.926  48.532  40.338  1.00 34.01 ? 57   PHE B CE2 1 
ATOM   4420  C  CZ  . PHE B 2 54  ? 30.771  48.580  38.967  1.00 33.99 ? 57   PHE B CZ  1 
ATOM   4421  N  N   . THR B 2 55  ? 27.242  48.681  42.881  1.00 33.80 ? 58   THR B N   1 
ATOM   4422  C  CA  . THR B 2 55  ? 27.255  47.261  43.197  1.00 33.68 ? 58   THR B CA  1 
ATOM   4423  C  C   . THR B 2 55  ? 25.882  46.644  43.042  1.00 33.83 ? 58   THR B C   1 
ATOM   4424  O  O   . THR B 2 55  ? 25.743  45.592  42.420  1.00 34.00 ? 58   THR B O   1 
ATOM   4425  C  CB  . THR B 2 55  ? 27.750  47.014  44.623  1.00 33.53 ? 58   THR B CB  1 
ATOM   4426  O  OG1 . THR B 2 55  ? 29.029  47.625  44.791  1.00 33.61 ? 58   THR B OG1 1 
ATOM   4427  C  CG2 . THR B 2 55  ? 27.889  45.537  44.890  1.00 33.43 ? 58   THR B CG2 1 
ATOM   4428  N  N   . ASP B 2 56  ? 24.867  47.304  43.586  1.00 33.67 ? 59   ASP B N   1 
ATOM   4429  C  CA  . ASP B 2 56  ? 23.498  46.807  43.507  1.00 33.68 ? 59   ASP B CA  1 
ATOM   4430  C  C   . ASP B 2 56  ? 23.096  46.526  42.061  1.00 33.78 ? 59   ASP B C   1 
ATOM   4431  O  O   . ASP B 2 56  ? 22.552  45.462  41.757  1.00 33.82 ? 59   ASP B O   1 
ATOM   4432  C  CB  . ASP B 2 56  ? 22.536  47.817  44.138  1.00 33.64 ? 59   ASP B CB  1 
ATOM   4433  C  CG  . ASP B 2 56  ? 21.097  47.375  44.063  1.00 33.67 ? 59   ASP B CG  1 
ATOM   4434  O  OD1 . ASP B 2 56  ? 20.300  48.035  43.361  1.00 33.90 ? 59   ASP B OD1 1 
ATOM   4435  O  OD2 . ASP B 2 56  ? 20.761  46.362  44.701  1.00 34.07 ? 59   ASP B OD2 1 
ATOM   4436  N  N   . GLU B 2 57  ? 23.397  47.463  41.168  1.00 33.73 ? 60   GLU B N   1 
ATOM   4437  C  CA  . GLU B 2 57  ? 23.063  47.312  39.765  1.00 33.87 ? 60   GLU B CA  1 
ATOM   4438  C  C   . GLU B 2 57  ? 23.964  46.308  39.068  1.00 33.85 ? 60   GLU B C   1 
ATOM   4439  O  O   . GLU B 2 57  ? 23.489  45.435  38.345  1.00 33.91 ? 60   GLU B O   1 
ATOM   4440  C  CB  . GLU B 2 57  ? 23.154  48.651  39.043  1.00 33.90 ? 60   GLU B CB  1 
ATOM   4441  C  CG  . GLU B 2 57  ? 22.781  48.540  37.580  1.00 34.18 ? 60   GLU B CG  1 
ATOM   4442  C  CD  . GLU B 2 57  ? 22.880  49.851  36.825  1.00 34.32 ? 60   GLU B CD  1 
ATOM   4443  O  OE1 . GLU B 2 57  ? 22.032  50.080  35.934  1.00 34.44 ? 60   GLU B OE1 1 
ATOM   4444  O  OE2 . GLU B 2 57  ? 23.815  50.636  37.088  1.00 34.26 ? 60   GLU B OE2 1 
ATOM   4445  N  N   . MET B 2 58  ? 25.268  46.432  39.282  1.00 33.72 ? 61   MET B N   1 
ATOM   4446  C  CA  . MET B 2 58  ? 26.221  45.531  38.647  1.00 33.75 ? 61   MET B CA  1 
ATOM   4447  C  C   . MET B 2 58  ? 25.997  44.072  39.043  1.00 33.77 ? 61   MET B C   1 
ATOM   4448  O  O   . MET B 2 58  ? 26.022  43.181  38.195  1.00 33.75 ? 61   MET B O   1 
ATOM   4449  C  CB  . MET B 2 58  ? 27.652  45.961  38.966  1.00 33.60 ? 61   MET B CB  1 
ATOM   4450  C  CG  . MET B 2 58  ? 28.710  45.207  38.199  1.00 33.66 ? 61   MET B CG  1 
ATOM   4451  S  SD  . MET B 2 58  ? 28.436  45.289  36.433  1.00 34.40 ? 61   MET B SD  1 
ATOM   4452  C  CE  . MET B 2 58  ? 28.807  46.990  36.106  1.00 33.73 ? 61   MET B CE  1 
ATOM   4453  N  N   . ALA B 2 59  ? 25.752  43.835  40.328  1.00 33.85 ? 62   ALA B N   1 
ATOM   4454  C  CA  . ALA B 2 59  ? 25.524  42.487  40.832  1.00 33.87 ? 62   ALA B CA  1 
ATOM   4455  C  C   . ALA B 2 59  ? 24.311  41.832  40.185  1.00 34.03 ? 62   ALA B C   1 
ATOM   4456  O  O   . ALA B 2 59  ? 24.325  40.629  39.925  1.00 33.98 ? 62   ALA B O   1 
ATOM   4457  C  CB  . ALA B 2 59  ? 25.374  42.506  42.335  1.00 33.58 ? 62   ALA B CB  1 
ATOM   4458  N  N   . HIS B 2 60  ? 23.258  42.611  39.932  1.00 33.98 ? 63   HIS B N   1 
ATOM   4459  C  CA  . HIS B 2 60  ? 22.074  42.056  39.290  1.00 33.88 ? 63   HIS B CA  1 
ATOM   4460  C  C   . HIS B 2 60  ? 22.400  41.747  37.845  1.00 33.88 ? 63   HIS B C   1 
ATOM   4461  O  O   . HIS B 2 60  ? 22.016  40.700  37.331  1.00 33.74 ? 63   HIS B O   1 
ATOM   4462  C  CB  . HIS B 2 60  ? 20.878  42.999  39.350  1.00 33.95 ? 63   HIS B CB  1 
ATOM   4463  C  CG  . HIS B 2 60  ? 19.594  42.339  38.960  1.00 34.14 ? 63   HIS B CG  1 
ATOM   4464  N  ND1 . HIS B 2 60  ? 18.807  41.657  39.861  1.00 34.20 ? 63   HIS B ND1 1 
ATOM   4465  C  CD2 . HIS B 2 60  ? 19.000  42.181  37.753  1.00 34.23 ? 63   HIS B CD2 1 
ATOM   4466  C  CE1 . HIS B 2 60  ? 17.790  41.102  39.228  1.00 34.26 ? 63   HIS B CE1 1 
ATOM   4467  N  NE2 . HIS B 2 60  ? 17.885  41.406  37.947  1.00 34.54 ? 63   HIS B NE2 1 
ATOM   4468  N  N   . PHE B 2 61  ? 23.112  42.661  37.194  1.00 33.87 ? 64   PHE B N   1 
ATOM   4469  C  CA  . PHE B 2 61  ? 23.519  42.468  35.812  1.00 34.12 ? 64   PHE B CA  1 
ATOM   4470  C  C   . PHE B 2 61  ? 24.318  41.170  35.680  1.00 34.30 ? 64   PHE B C   1 
ATOM   4471  O  O   . PHE B 2 61  ? 24.121  40.398  34.739  1.00 34.07 ? 64   PHE B O   1 
ATOM   4472  C  CB  . PHE B 2 61  ? 24.376  43.646  35.350  1.00 34.05 ? 64   PHE B CB  1 
ATOM   4473  C  CG  . PHE B 2 61  ? 25.020  43.435  34.010  1.00 34.39 ? 64   PHE B CG  1 
ATOM   4474  C  CD1 . PHE B 2 61  ? 24.289  43.598  32.837  1.00 34.43 ? 64   PHE B CD1 1 
ATOM   4475  C  CD2 . PHE B 2 61  ? 26.356  43.047  33.918  1.00 34.36 ? 64   PHE B CD2 1 
ATOM   4476  C  CE1 . PHE B 2 61  ? 24.880  43.375  31.589  1.00 34.45 ? 64   PHE B CE1 1 
ATOM   4477  C  CE2 . PHE B 2 61  ? 26.951  42.822  32.677  1.00 34.45 ? 64   PHE B CE2 1 
ATOM   4478  C  CZ  . PHE B 2 61  ? 26.212  42.986  31.512  1.00 34.41 ? 64   PHE B CZ  1 
ATOM   4479  N  N   . ASP B 2 62  ? 25.201  40.925  36.644  1.00 34.43 ? 65   ASP B N   1 
ATOM   4480  C  CA  . ASP B 2 62  ? 26.043  39.734  36.644  1.00 34.58 ? 65   ASP B CA  1 
ATOM   4481  C  C   . ASP B 2 62  ? 25.273  38.436  36.791  1.00 34.74 ? 65   ASP B C   1 
ATOM   4482  O  O   . ASP B 2 62  ? 25.826  37.357  36.569  1.00 34.83 ? 65   ASP B O   1 
ATOM   4483  C  CB  . ASP B 2 62  ? 27.076  39.824  37.766  1.00 34.78 ? 65   ASP B CB  1 
ATOM   4484  C  CG  . ASP B 2 62  ? 28.065  40.959  37.565  1.00 35.05 ? 65   ASP B CG  1 
ATOM   4485  O  OD1 . ASP B 2 62  ? 28.655  41.424  38.563  1.00 35.43 ? 65   ASP B OD1 1 
ATOM   4486  O  OD2 . ASP B 2 62  ? 28.268  41.386  36.410  1.00 35.31 ? 65   ASP B OD2 1 
ATOM   4487  N  N   . ARG B 2 63  ? 23.993  38.540  37.140  1.00 34.60 ? 66   ARG B N   1 
ATOM   4488  C  CA  . ARG B 2 63  ? 23.157  37.365  37.346  1.00 34.58 ? 66   ARG B CA  1 
ATOM   4489  C  C   . ARG B 2 63  ? 21.916  37.307  36.466  1.00 34.53 ? 66   ARG B C   1 
ATOM   4490  O  O   . ARG B 2 63  ? 20.970  36.585  36.782  1.00 34.43 ? 66   ARG B O   1 
ATOM   4491  C  CB  . ARG B 2 63  ? 22.726  37.310  38.812  1.00 34.51 ? 66   ARG B CB  1 
ATOM   4492  C  CG  . ARG B 2 63  ? 23.875  37.186  39.778  1.00 34.30 ? 66   ARG B CG  1 
ATOM   4493  C  CD  . ARG B 2 63  ? 23.438  37.372  41.216  1.00 33.90 ? 66   ARG B CD  1 
ATOM   4494  N  NE  . ARG B 2 63  ? 24.520  36.981  42.109  1.00 33.73 ? 66   ARG B NE  1 
ATOM   4495  C  CZ  . ARG B 2 63  ? 25.672  37.634  42.225  1.00 33.72 ? 66   ARG B CZ  1 
ATOM   4496  N  NH1 . ARG B 2 63  ? 25.898  38.737  41.522  1.00 33.51 ? 66   ARG B NH1 1 
ATOM   4497  N  NH2 . ARG B 2 63  ? 26.641  37.125  42.974  1.00 33.69 ? 66   ARG B NH2 1 
ATOM   4498  N  N   . GLU B 2 64  ? 21.913  38.040  35.357  1.00 34.51 ? 67   GLU B N   1 
ATOM   4499  C  CA  . GLU B 2 64  ? 20.746  38.058  34.480  1.00 34.45 ? 67   GLU B CA  1 
ATOM   4500  C  C   . GLU B 2 64  ? 20.446  36.746  33.786  1.00 34.54 ? 67   GLU B C   1 
ATOM   4501  O  O   . GLU B 2 64  ? 19.284  36.419  33.567  1.00 34.62 ? 67   GLU B O   1 
ATOM   4502  C  CB  . GLU B 2 64  ? 20.872  39.152  33.423  1.00 34.26 ? 67   GLU B CB  1 
ATOM   4503  C  CG  . GLU B 2 64  ? 20.779  40.559  33.957  1.00 34.09 ? 67   GLU B CG  1 
ATOM   4504  C  CD  . GLU B 2 64  ? 20.808  41.607  32.860  1.00 34.26 ? 67   GLU B CD  1 
ATOM   4505  O  OE1 . GLU B 2 64  ? 20.793  41.237  31.657  1.00 34.20 ? 67   GLU B OE1 1 
ATOM   4506  O  OE2 . GLU B 2 64  ? 20.838  42.810  33.202  1.00 34.01 ? 67   GLU B OE2 1 
ATOM   4507  N  N   . ARG B 2 65  ? 21.485  35.991  33.453  1.00 34.62 ? 68   ARG B N   1 
ATOM   4508  C  CA  . ARG B 2 65  ? 21.309  34.736  32.737  1.00 34.90 ? 68   ARG B CA  1 
ATOM   4509  C  C   . ARG B 2 65  ? 20.966  33.511  33.560  1.00 35.11 ? 68   ARG B C   1 
ATOM   4510  O  O   . ARG B 2 65  ? 21.425  33.349  34.693  1.00 35.17 ? 68   ARG B O   1 
ATOM   4511  C  CB  . ARG B 2 65  ? 22.554  34.416  31.916  1.00 34.61 ? 68   ARG B CB  1 
ATOM   4512  C  CG  . ARG B 2 65  ? 23.022  35.539  31.030  1.00 34.71 ? 68   ARG B CG  1 
ATOM   4513  C  CD  . ARG B 2 65  ? 22.037  35.860  29.925  1.00 34.86 ? 68   ARG B CD  1 
ATOM   4514  N  NE  . ARG B 2 65  ? 22.545  36.964  29.123  1.00 35.12 ? 68   ARG B NE  1 
ATOM   4515  C  CZ  . ARG B 2 65  ? 22.142  38.226  29.238  1.00 35.31 ? 68   ARG B CZ  1 
ATOM   4516  N  NH1 . ARG B 2 65  ? 21.198  38.557  30.110  1.00 35.32 ? 68   ARG B NH1 1 
ATOM   4517  N  NH2 . ARG B 2 65  ? 22.752  39.177  28.544  1.00 35.24 ? 68   ARG B NH2 1 
ATOM   4518  N  N   . ILE B 2 66  ? 20.144  32.654  32.959  1.00 35.36 ? 69   ILE B N   1 
ATOM   4519  C  CA  . ILE B 2 66  ? 19.745  31.377  33.541  1.00 35.50 ? 69   ILE B CA  1 
ATOM   4520  C  C   . ILE B 2 66  ? 20.028  30.371  32.415  1.00 35.72 ? 69   ILE B C   1 
ATOM   4521  O  O   . ILE B 2 66  ? 20.159  30.762  31.248  1.00 35.63 ? 69   ILE B O   1 
ATOM   4522  C  CB  . ILE B 2 66  ? 18.250  31.343  33.913  1.00 35.31 ? 69   ILE B CB  1 
ATOM   4523  C  CG1 . ILE B 2 66  ? 17.392  31.410  32.650  1.00 35.30 ? 69   ILE B CG1 1 
ATOM   4524  C  CG2 . ILE B 2 66  ? 17.924  32.474  34.871  1.00 35.17 ? 69   ILE B CG2 1 
ATOM   4525  C  CD1 . ILE B 2 66  ? 15.913  31.155  32.898  1.00 35.41 ? 69   ILE B CD1 1 
ATOM   4526  N  N   . PRO B 2 67  ? 20.160  29.072  32.743  1.00 36.03 ? 70   PRO B N   1 
ATOM   4527  C  CA  . PRO B 2 67  ? 20.434  28.079  31.693  1.00 36.12 ? 70   PRO B CA  1 
ATOM   4528  C  C   . PRO B 2 67  ? 19.323  28.064  30.645  1.00 36.26 ? 70   PRO B C   1 
ATOM   4529  O  O   . PRO B 2 67  ? 18.147  28.192  30.989  1.00 36.25 ? 70   PRO B O   1 
ATOM   4530  C  CB  . PRO B 2 67  ? 20.437  26.757  32.468  1.00 36.14 ? 70   PRO B CB  1 
ATOM   4531  C  CG  . PRO B 2 67  ? 20.787  27.158  33.859  1.00 36.08 ? 70   PRO B CG  1 
ATOM   4532  C  CD  . PRO B 2 67  ? 20.002  28.417  34.052  1.00 36.04 ? 70   PRO B CD  1 
ATOM   4533  N  N   . GLU B 2 68  ? 19.683  27.951  29.369  1.00 36.38 ? 71   GLU B N   1 
ATOM   4534  C  CA  . GLU B 2 68  ? 18.667  27.886  28.324  1.00 36.51 ? 71   GLU B CA  1 
ATOM   4535  C  C   . GLU B 2 68  ? 18.123  26.459  28.350  1.00 36.61 ? 71   GLU B C   1 
ATOM   4536  O  O   . GLU B 2 68  ? 18.707  25.571  28.984  1.00 36.69 ? 71   GLU B O   1 
ATOM   4537  C  CB  . GLU B 2 68  ? 19.264  28.185  26.949  1.00 36.32 ? 71   GLU B CB  1 
ATOM   4538  C  CG  . GLU B 2 68  ? 20.294  27.167  26.480  1.00 36.38 ? 71   GLU B CG  1 
ATOM   4539  C  CD  . GLU B 2 68  ? 20.759  27.401  25.056  1.00 36.49 ? 71   GLU B CD  1 
ATOM   4540  O  OE1 . GLU B 2 68  ? 20.792  28.566  24.612  1.00 36.40 ? 71   GLU B OE1 1 
ATOM   4541  O  OE2 . GLU B 2 68  ? 21.100  26.411  24.374  1.00 36.60 ? 71   GLU B OE2 1 
ATOM   4542  N  N   . ARG B 2 69  ? 16.996  26.233  27.691  1.00 36.53 ? 72   ARG B N   1 
ATOM   4543  C  CA  . ARG B 2 69  ? 16.417  24.899  27.653  1.00 36.39 ? 72   ARG B CA  1 
ATOM   4544  C  C   . ARG B 2 69  ? 17.443  23.953  27.041  1.00 36.16 ? 72   ARG B C   1 
ATOM   4545  O  O   . ARG B 2 69  ? 18.142  24.322  26.097  1.00 36.13 ? 72   ARG B O   1 
ATOM   4546  C  CB  . ARG B 2 69  ? 15.151  24.915  26.807  1.00 36.70 ? 72   ARG B CB  1 
ATOM   4547  C  CG  . ARG B 2 69  ? 14.103  25.881  27.308  1.00 36.75 ? 72   ARG B CG  1 
ATOM   4548  C  CD  . ARG B 2 69  ? 13.004  26.064  26.288  1.00 36.80 ? 72   ARG B CD  1 
ATOM   4549  N  NE  . ARG B 2 69  ? 11.864  26.774  26.854  1.00 37.03 ? 72   ARG B NE  1 
ATOM   4550  C  CZ  . ARG B 2 69  ? 11.915  27.995  27.380  1.00 37.14 ? 72   ARG B CZ  1 
ATOM   4551  N  NH1 . ARG B 2 69  ? 13.058  28.675  27.419  1.00 37.13 ? 72   ARG B NH1 1 
ATOM   4552  N  NH2 . ARG B 2 69  ? 10.817  28.527  27.895  1.00 37.11 ? 72   ARG B NH2 1 
ATOM   4553  N  N   . VAL B 2 70  ? 17.549  22.746  27.584  1.00 35.88 ? 73   VAL B N   1 
ATOM   4554  C  CA  . VAL B 2 70  ? 18.508  21.780  27.071  1.00 35.61 ? 73   VAL B CA  1 
ATOM   4555  C  C   . VAL B 2 70  ? 18.224  21.474  25.595  1.00 35.46 ? 73   VAL B C   1 
ATOM   4556  O  O   . VAL B 2 70  ? 19.124  21.120  24.846  1.00 35.13 ? 73   VAL B O   1 
ATOM   4557  C  CB  . VAL B 2 70  ? 18.544  20.508  27.943  1.00 35.70 ? 73   VAL B CB  1 
ATOM   4558  C  CG1 . VAL B 2 70  ? 17.218  19.768  27.901  1.00 35.72 ? 73   VAL B CG1 1 
ATOM   4559  C  CG2 . VAL B 2 70  ? 19.696  19.622  27.520  1.00 35.75 ? 73   VAL B CG2 1 
ATOM   4560  N  N   . VAL B 2 71  ? 16.967  21.634  25.187  1.00 35.15 ? 74   VAL B N   1 
ATOM   4561  C  CA  . VAL B 2 71  ? 16.530  21.476  23.787  1.00 34.49 ? 74   VAL B CA  1 
ATOM   4562  C  C   . VAL B 2 71  ? 15.423  22.489  23.571  1.00 34.79 ? 74   VAL B C   1 
ATOM   4563  O  O   . VAL B 2 71  ? 14.734  22.824  24.528  1.00 34.53 ? 74   VAL B O   1 
ATOM   4564  C  CB  . VAL B 2 71  ? 15.979  20.071  23.442  1.00 33.68 ? 74   VAL B CB  1 
ATOM   4565  C  CG1 . VAL B 2 71  ? 17.097  19.114  23.185  1.00 33.42 ? 74   VAL B CG1 1 
ATOM   4566  C  CG2 . VAL B 2 71  ? 15.066  19.552  24.534  1.00 33.14 ? 74   VAL B CG2 1 
HETATM 4567  N  N   . 3AH B 2 72  ? 15.250  22.957  22.333  1.00 35.05 ? 75   3AH B N   1 
HETATM 4568  C  CA  . 3AH B 2 72  ? 14.238  23.957  21.997  1.00 35.83 ? 75   3AH B CA  1 
HETATM 4569  C  CB  . 3AH B 2 72  ? 12.853  23.514  22.451  1.00 36.42 ? 75   3AH B CB  1 
HETATM 4570  C  CG  . 3AH B 2 72  ? 12.372  22.254  21.819  1.00 38.94 ? 75   3AH B CG  1 
HETATM 4571  C  CD2 . 3AH B 2 72  ? 11.482  22.037  20.821  1.00 38.66 ? 75   3AH B CD2 1 
HETATM 4572  N  ND1 . 3AH B 2 72  ? 12.804  21.013  22.230  1.00 39.10 ? 75   3AH B ND1 1 
HETATM 4573  C  CE1 . 3AH B 2 72  ? 12.198  20.079  21.513  1.00 40.20 ? 75   3AH B CE1 1 
HETATM 4574  N  NE2 . 3AH B 2 72  ? 11.390  20.672  20.651  1.00 41.32 ? 75   3AH B NE2 1 
HETATM 4575  C  C   . 3AH B 2 72  ? 14.544  25.311  22.633  1.00 35.77 ? 75   3AH B C   1 
HETATM 4576  O  O   . 3AH B 2 72  ? 13.630  26.053  23.011  1.00 35.67 ? 75   3AH B O   1 
HETATM 4577  N  N1  . 3AH B 2 72  ? 9.578   20.013  19.351  1.00 50.73 ? 75   3AH B N1  1 
HETATM 4578  N  N2  . 3AH B 2 72  ? 9.012   18.857  19.004  1.00 50.82 ? 75   3AH B N2  1 
HETATM 4579  C  C3  . 3AH B 2 72  ? 9.945   17.992  19.218  1.00 51.03 ? 75   3AH B C3  1 
HETATM 4580  N  N4  . 3AH B 2 72  ? 11.107  18.426  19.666  1.00 50.77 ? 75   3AH B N4  1 
HETATM 4581  C  C5  . 3AH B 2 72  ? 10.861  19.716  19.753  1.00 49.60 ? 75   3AH B C5  1 
HETATM 4582  N  N3A . 3AH B 2 72  ? 9.807   16.629  18.999  1.00 52.27 ? 75   3AH B N3A 1 
ATOM   4583  N  N   . ALA B 2 73  ? 15.830  25.605  22.801  1.00 35.54 ? 76   ALA B N   1 
ATOM   4584  C  CA  . ALA B 2 73  ? 16.268  26.846  23.413  1.00 34.96 ? 76   ALA B CA  1 
ATOM   4585  C  C   . ALA B 2 73  ? 15.815  28.088  22.671  1.00 34.73 ? 76   ALA B C   1 
ATOM   4586  O  O   . ALA B 2 73  ? 15.462  29.092  23.285  1.00 34.34 ? 76   ALA B O   1 
ATOM   4587  C  CB  . ALA B 2 73  ? 17.765  26.841  23.545  1.00 34.22 ? 76   ALA B CB  1 
ATOM   4588  N  N   . LYS B 2 74  ? 15.818  28.014  21.345  1.00 34.61 ? 77   LYS B N   1 
ATOM   4589  C  CA  . LYS B 2 74  ? 15.424  29.145  20.506  1.00 34.59 ? 77   LYS B CA  1 
ATOM   4590  C  C   . LYS B 2 74  ? 13.918  29.144  20.230  1.00 34.58 ? 77   LYS B C   1 
ATOM   4591  O  O   . LYS B 2 74  ? 13.411  28.244  19.559  1.00 34.55 ? 77   LYS B O   1 
ATOM   4592  C  CB  . LYS B 2 74  ? 16.196  29.108  19.177  1.00 34.89 ? 77   LYS B CB  1 
ATOM   4593  C  CG  . LYS B 2 74  ? 15.970  30.317  18.282  1.00 35.69 ? 77   LYS B CG  1 
ATOM   4594  C  CD  . LYS B 2 74  ? 16.444  31.582  18.968  1.00 36.91 ? 77   LYS B CD  1 
ATOM   4595  C  CE  . LYS B 2 74  ? 15.888  32.827  18.312  1.00 37.69 ? 77   LYS B CE  1 
ATOM   4596  N  NZ  . LYS B 2 74  ? 16.409  33.010  16.936  1.00 38.62 ? 77   LYS B NZ  1 
ATOM   4597  N  N   . GLY B 2 75  ? 13.206  30.168  20.699  1.00 34.87 ? 78   GLY B N   1 
ATOM   4598  C  CA  . GLY B 2 75  ? 11.769  30.210  20.468  1.00 35.37 ? 78   GLY B CA  1 
ATOM   4599  C  C   . GLY B 2 75  ? 11.041  31.539  20.569  1.00 35.76 ? 78   GLY B C   1 
ATOM   4600  O  O   . GLY B 2 75  ? 11.642  32.577  20.807  1.00 35.56 ? 78   GLY B O   1 
ATOM   4601  N  N   . ALA B 2 76  ? 9.727   31.488  20.380  1.00 36.48 ? 79   ALA B N   1 
ATOM   4602  C  CA  . ALA B 2 76  ? 8.870   32.666  20.439  1.00 37.13 ? 79   ALA B CA  1 
ATOM   4603  C  C   . ALA B 2 76  ? 7.602   32.308  21.210  1.00 37.66 ? 79   ALA B C   1 
ATOM   4604  O  O   . ALA B 2 76  ? 7.204   31.143  21.247  1.00 37.95 ? 79   ALA B O   1 
ATOM   4605  C  CB  . ALA B 2 76  ? 8.516   33.121  19.037  1.00 37.28 ? 79   ALA B CB  1 
ATOM   4606  N  N   . GLY B 2 77  ? 6.962   33.301  21.821  1.00 37.89 ? 80   GLY B N   1 
ATOM   4607  C  CA  . GLY B 2 77  ? 5.757   33.019  22.586  1.00 37.87 ? 80   GLY B CA  1 
ATOM   4608  C  C   . GLY B 2 77  ? 4.612   33.983  22.359  1.00 37.80 ? 80   GLY B C   1 
ATOM   4609  O  O   . GLY B 2 77  ? 4.814   35.113  21.917  1.00 37.97 ? 80   GLY B O   1 
ATOM   4610  N  N   . ALA B 2 78  ? 3.403   33.532  22.657  1.00 37.60 ? 81   ALA B N   1 
ATOM   4611  C  CA  . ALA B 2 78  ? 2.212   34.349  22.497  1.00 37.49 ? 81   ALA B CA  1 
ATOM   4612  C  C   . ALA B 2 78  ? 1.116   33.813  23.408  1.00 37.59 ? 81   ALA B C   1 
ATOM   4613  O  O   . ALA B 2 78  ? 1.232   32.710  23.948  1.00 37.45 ? 81   ALA B O   1 
ATOM   4614  C  CB  . ALA B 2 78  ? 1.760   34.342  21.053  1.00 37.34 ? 81   ALA B CB  1 
ATOM   4615  N  N   . PHE B 2 79  ? 0.062   34.599  23.600  1.00 37.82 ? 82   PHE B N   1 
ATOM   4616  C  CA  . PHE B 2 79  ? -1.039  34.197  24.472  1.00 38.05 ? 82   PHE B CA  1 
ATOM   4617  C  C   . PHE B 2 79  ? -2.391  34.348  23.791  1.00 38.13 ? 82   PHE B C   1 
ATOM   4618  O  O   . PHE B 2 79  ? -2.539  35.118  22.841  1.00 38.03 ? 82   PHE B O   1 
ATOM   4619  C  CB  . PHE B 2 79  ? -1.001  35.009  25.771  1.00 37.96 ? 82   PHE B CB  1 
ATOM   4620  C  CG  . PHE B 2 79  ? 0.288   34.872  26.520  1.00 38.15 ? 82   PHE B CG  1 
ATOM   4621  C  CD1 . PHE B 2 79  ? 1.406   35.611  26.143  1.00 38.14 ? 82   PHE B CD1 1 
ATOM   4622  C  CD2 . PHE B 2 79  ? 0.414   33.945  27.547  1.00 38.14 ? 82   PHE B CD2 1 
ATOM   4623  C  CE1 . PHE B 2 79  ? 2.638   35.424  26.769  1.00 38.19 ? 82   PHE B CE1 1 
ATOM   4624  C  CE2 . PHE B 2 79  ? 1.639   33.751  28.181  1.00 38.31 ? 82   PHE B CE2 1 
ATOM   4625  C  CZ  . PHE B 2 79  ? 2.756   34.493  27.787  1.00 38.27 ? 82   PHE B CZ  1 
ATOM   4626  N  N   . GLY B 2 80  ? -3.373  33.597  24.279  1.00 38.34 ? 83   GLY B N   1 
ATOM   4627  C  CA  . GLY B 2 80  ? -4.701  33.659  23.705  1.00 38.66 ? 83   GLY B CA  1 
ATOM   4628  C  C   . GLY B 2 80  ? -5.694  32.778  24.430  1.00 38.98 ? 83   GLY B C   1 
ATOM   4629  O  O   . GLY B 2 80  ? -5.690  32.708  25.661  1.00 39.04 ? 83   GLY B O   1 
ATOM   4630  N  N   . TYR B 2 81  ? -6.525  32.073  23.670  1.00 39.23 ? 84   TYR B N   1 
ATOM   4631  C  CA  . TYR B 2 81  ? -7.530  31.211  24.277  1.00 39.57 ? 84   TYR B CA  1 
ATOM   4632  C  C   . TYR B 2 81  ? -7.915  29.993  23.449  1.00 39.65 ? 84   TYR B C   1 
ATOM   4633  O  O   . TYR B 2 81  ? -7.672  29.931  22.246  1.00 39.53 ? 84   TYR B O   1 
ATOM   4634  C  CB  . TYR B 2 81  ? -8.796  32.023  24.589  1.00 39.51 ? 84   TYR B CB  1 
ATOM   4635  C  CG  . TYR B 2 81  ? -9.532  32.513  23.360  1.00 39.71 ? 84   TYR B CG  1 
ATOM   4636  C  CD1 . TYR B 2 81  ? -10.439 31.691  22.693  1.00 39.76 ? 84   TYR B CD1 1 
ATOM   4637  C  CD2 . TYR B 2 81  ? -9.310  33.791  22.851  1.00 39.93 ? 84   TYR B CD2 1 
ATOM   4638  C  CE1 . TYR B 2 81  ? -11.104 32.127  21.547  1.00 39.91 ? 84   TYR B CE1 1 
ATOM   4639  C  CE2 . TYR B 2 81  ? -9.978  34.238  21.698  1.00 40.06 ? 84   TYR B CE2 1 
ATOM   4640  C  CZ  . TYR B 2 81  ? -10.871 33.397  21.056  1.00 39.97 ? 84   TYR B CZ  1 
ATOM   4641  O  OH  . TYR B 2 81  ? -11.534 33.820  19.929  1.00 40.01 ? 84   TYR B OH  1 
ATOM   4642  N  N   . PHE B 2 82  ? -8.481  29.007  24.130  1.00 39.91 ? 85   PHE B N   1 
ATOM   4643  C  CA  . PHE B 2 82  ? -8.973  27.808  23.480  1.00 40.32 ? 85   PHE B CA  1 
ATOM   4644  C  C   . PHE B 2 82  ? -10.483 27.872  23.642  1.00 40.69 ? 85   PHE B C   1 
ATOM   4645  O  O   . PHE B 2 82  ? -10.979 28.146  24.734  1.00 40.62 ? 85   PHE B O   1 
ATOM   4646  C  CB  . PHE B 2 82  ? -8.459  26.544  24.159  1.00 40.16 ? 85   PHE B CB  1 
ATOM   4647  C  CG  . PHE B 2 82  ? -9.217  25.309  23.765  1.00 40.07 ? 85   PHE B CG  1 
ATOM   4648  C  CD1 . PHE B 2 82  ? -9.118  24.795  22.475  1.00 40.05 ? 85   PHE B CD1 1 
ATOM   4649  C  CD2 . PHE B 2 82  ? -10.061 24.679  24.671  1.00 39.98 ? 85   PHE B CD2 1 
ATOM   4650  C  CE1 . PHE B 2 82  ? -9.850  23.671  22.092  1.00 39.94 ? 85   PHE B CE1 1 
ATOM   4651  C  CE2 . PHE B 2 82  ? -10.801 23.550  24.296  1.00 39.99 ? 85   PHE B CE2 1 
ATOM   4652  C  CZ  . PHE B 2 82  ? -10.694 23.050  23.008  1.00 39.95 ? 85   PHE B CZ  1 
ATOM   4653  N  N   . GLU B 2 83  ? -11.212 27.610  22.566  1.00 41.15 ? 86   GLU B N   1 
ATOM   4654  C  CA  . GLU B 2 83  ? -12.666 27.650  22.621  1.00 41.65 ? 86   GLU B CA  1 
ATOM   4655  C  C   . GLU B 2 83  ? -13.278 26.359  22.116  1.00 41.61 ? 86   GLU B C   1 
ATOM   4656  O  O   . GLU B 2 83  ? -12.947 25.895  21.025  1.00 41.54 ? 86   GLU B O   1 
ATOM   4657  C  CB  . GLU B 2 83  ? -13.194 28.822  21.804  1.00 42.29 ? 86   GLU B CB  1 
ATOM   4658  C  CG  . GLU B 2 83  ? -14.708 28.976  21.840  1.00 43.37 ? 86   GLU B CG  1 
ATOM   4659  C  CD  . GLU B 2 83  ? -15.196 30.183  21.046  1.00 44.18 ? 86   GLU B CD  1 
ATOM   4660  O  OE1 . GLU B 2 83  ? -16.376 30.555  21.230  1.00 44.84 ? 86   GLU B OE1 1 
ATOM   4661  O  OE2 . GLU B 2 83  ? -14.418 30.764  20.246  1.00 44.45 ? 86   GLU B OE2 1 
ATOM   4662  N  N   . VAL B 2 84  ? -14.166 25.780  22.919  1.00 41.48 ? 87   VAL B N   1 
ATOM   4663  C  CA  . VAL B 2 84  ? -14.828 24.542  22.543  1.00 41.40 ? 87   VAL B CA  1 
ATOM   4664  C  C   . VAL B 2 84  ? -15.881 24.842  21.492  1.00 41.56 ? 87   VAL B C   1 
ATOM   4665  O  O   . VAL B 2 84  ? -16.680 25.758  21.659  1.00 41.50 ? 87   VAL B O   1 
ATOM   4666  C  CB  . VAL B 2 84  ? -15.495 23.887  23.750  1.00 41.25 ? 87   VAL B CB  1 
ATOM   4667  C  CG1 . VAL B 2 84  ? -16.200 22.610  23.336  1.00 40.97 ? 87   VAL B CG1 1 
ATOM   4668  C  CG2 . VAL B 2 84  ? -14.459 23.608  24.811  1.00 41.09 ? 87   VAL B CG2 1 
ATOM   4669  N  N   . THR B 2 85  ? -15.858 24.088  20.398  1.00 41.65 ? 88   THR B N   1 
ATOM   4670  C  CA  . THR B 2 85  ? -16.823 24.285  19.321  1.00 41.68 ? 88   THR B CA  1 
ATOM   4671  C  C   . THR B 2 85  ? -17.705 23.057  19.140  1.00 41.82 ? 88   THR B C   1 
ATOM   4672  O  O   . THR B 2 85  ? -18.778 23.141  18.541  1.00 41.75 ? 88   THR B O   1 
ATOM   4673  C  CB  . THR B 2 85  ? -16.129 24.591  17.979  1.00 41.61 ? 88   THR B CB  1 
ATOM   4674  O  OG1 . THR B 2 85  ? -15.263 23.507  17.634  1.00 41.43 ? 88   THR B OG1 1 
ATOM   4675  C  CG2 . THR B 2 85  ? -15.322 25.877  18.066  1.00 41.43 ? 88   THR B CG2 1 
ATOM   4676  N  N   . HIS B 2 86  ? -17.248 21.921  19.659  1.00 41.86 ? 89   HIS B N   1 
ATOM   4677  C  CA  . HIS B 2 86  ? -17.992 20.675  19.549  1.00 42.02 ? 89   HIS B CA  1 
ATOM   4678  C  C   . HIS B 2 86  ? -18.002 19.921  20.856  1.00 42.01 ? 89   HIS B C   1 
ATOM   4679  O  O   . HIS B 2 86  ? -17.106 20.075  21.681  1.00 42.09 ? 89   HIS B O   1 
ATOM   4680  C  CB  . HIS B 2 86  ? -17.399 19.777  18.468  1.00 42.30 ? 89   HIS B CB  1 
ATOM   4681  C  CG  . HIS B 2 86  ? -17.511 20.335  17.084  1.00 42.63 ? 89   HIS B CG  1 
ATOM   4682  N  ND1 . HIS B 2 86  ? -16.837 21.469  16.681  1.00 42.73 ? 89   HIS B ND1 1 
ATOM   4683  C  CD2 . HIS B 2 86  ? -18.205 19.906  16.005  1.00 42.74 ? 89   HIS B CD2 1 
ATOM   4684  C  CE1 . HIS B 2 86  ? -17.112 21.713  15.413  1.00 42.89 ? 89   HIS B CE1 1 
ATOM   4685  N  NE2 . HIS B 2 86  ? -17.940 20.779  14.978  1.00 42.94 ? 89   HIS B NE2 1 
ATOM   4686  N  N   . ASP B 2 87  ? -19.000 19.062  21.003  1.00 42.03 ? 90   ASP B N   1 
ATOM   4687  C  CA  . ASP B 2 87  ? -19.186 18.263  22.203  1.00 42.14 ? 90   ASP B CA  1 
ATOM   4688  C  C   . ASP B 2 87  ? -18.505 16.901  22.112  1.00 42.31 ? 90   ASP B C   1 
ATOM   4689  O  O   . ASP B 2 87  ? -18.910 16.042  21.328  1.00 42.19 ? 90   ASP B O   1 
ATOM   4690  C  CB  . ASP B 2 87  ? -20.685 18.078  22.445  1.00 42.25 ? 90   ASP B CB  1 
ATOM   4691  C  CG  . ASP B 2 87  ? -21.002 17.418  23.773  1.00 42.43 ? 90   ASP B CG  1 
ATOM   4692  O  OD1 . ASP B 2 87  ? -20.113 16.826  24.414  1.00 42.53 ? 90   ASP B OD1 1 
ATOM   4693  O  OD2 . ASP B 2 87  ? -22.174 17.490  24.180  1.00 42.63 ? 90   ASP B OD2 1 
ATOM   4694  N  N   . ILE B 2 88  ? -17.489 16.702  22.946  1.00 42.31 ? 91   ILE B N   1 
ATOM   4695  C  CA  . ILE B 2 88  ? -16.776 15.434  22.984  1.00 42.34 ? 91   ILE B CA  1 
ATOM   4696  C  C   . ILE B 2 88  ? -16.801 14.866  24.401  1.00 42.56 ? 91   ILE B C   1 
ATOM   4697  O  O   . ILE B 2 88  ? -15.973 14.026  24.760  1.00 42.56 ? 91   ILE B O   1 
ATOM   4698  C  CB  . ILE B 2 88  ? -15.313 15.563  22.499  1.00 42.26 ? 91   ILE B CB  1 
ATOM   4699  C  CG1 . ILE B 2 88  ? -14.524 16.510  23.401  1.00 42.16 ? 91   ILE B CG1 1 
ATOM   4700  C  CG2 . ILE B 2 88  ? -15.273 16.040  21.061  1.00 41.97 ? 91   ILE B CG2 1 
ATOM   4701  C  CD1 . ILE B 2 88  ? -13.024 16.406  23.215  1.00 42.02 ? 91   ILE B CD1 1 
ATOM   4702  N  N   . THR B 2 89  ? -17.774 15.307  25.195  1.00 42.81 ? 92   THR B N   1 
ATOM   4703  C  CA  . THR B 2 89  ? -17.908 14.840  26.571  1.00 43.15 ? 92   THR B CA  1 
ATOM   4704  C  C   . THR B 2 89  ? -18.145 13.331  26.642  1.00 43.35 ? 92   THR B C   1 
ATOM   4705  O  O   . THR B 2 89  ? -18.020 12.726  27.705  1.00 43.32 ? 92   THR B O   1 
ATOM   4706  C  CB  . THR B 2 89  ? -19.040 15.578  27.340  1.00 43.17 ? 92   THR B CB  1 
ATOM   4707  O  OG1 . THR B 2 89  ? -20.309 15.279  26.746  1.00 43.35 ? 92   THR B OG1 1 
ATOM   4708  C  CG2 . THR B 2 89  ? -18.816 17.079  27.318  1.00 42.97 ? 92   THR B CG2 1 
ATOM   4709  N  N   . LYS B 2 90  ? -18.506 12.724  25.519  1.00 43.49 ? 93   LYS B N   1 
ATOM   4710  C  CA  . LYS B 2 90  ? -18.723 11.285  25.496  1.00 43.87 ? 93   LYS B CA  1 
ATOM   4711  C  C   . LYS B 2 90  ? -17.388 10.555  25.653  1.00 43.85 ? 93   LYS B C   1 
ATOM   4712  O  O   . LYS B 2 90  ? -17.342 9.410   26.104  1.00 43.87 ? 93   LYS B O   1 
ATOM   4713  C  CB  . LYS B 2 90  ? -19.419 10.867  24.198  1.00 44.37 ? 93   LYS B CB  1 
ATOM   4714  C  CG  . LYS B 2 90  ? -18.781 11.407  22.924  1.00 45.10 ? 93   LYS B CG  1 
ATOM   4715  C  CD  . LYS B 2 90  ? -19.805 11.499  21.780  1.00 45.60 ? 93   LYS B CD  1 
ATOM   4716  C  CE  . LYS B 2 90  ? -19.622 10.394  20.741  1.00 45.91 ? 93   LYS B CE  1 
ATOM   4717  N  NZ  . LYS B 2 90  ? -19.790 9.013   21.300  1.00 46.29 ? 93   LYS B NZ  1 
ATOM   4718  N  N   . TYR B 2 91  ? -16.300 11.235  25.305  1.00 43.70 ? 94   TYR B N   1 
ATOM   4719  C  CA  . TYR B 2 91  ? -14.970 10.651  25.411  1.00 43.36 ? 94   TYR B CA  1 
ATOM   4720  C  C   . TYR B 2 91  ? -14.215 11.150  26.643  1.00 43.03 ? 94   TYR B C   1 
ATOM   4721  O  O   . TYR B 2 91  ? -13.561 10.364  27.330  1.00 42.93 ? 94   TYR B O   1 
ATOM   4722  C  CB  . TYR B 2 91  ? -14.141 10.971  24.167  1.00 43.50 ? 94   TYR B CB  1 
ATOM   4723  C  CG  . TYR B 2 91  ? -14.764 10.558  22.858  1.00 43.72 ? 94   TYR B CG  1 
ATOM   4724  C  CD1 . TYR B 2 91  ? -15.010 11.498  21.863  1.00 43.90 ? 94   TYR B CD1 1 
ATOM   4725  C  CD2 . TYR B 2 91  ? -15.091 9.233   22.604  1.00 43.74 ? 94   TYR B CD2 1 
ATOM   4726  C  CE1 . TYR B 2 91  ? -15.565 11.132  20.645  1.00 44.07 ? 94   TYR B CE1 1 
ATOM   4727  C  CE2 . TYR B 2 91  ? -15.647 8.855   21.388  1.00 43.92 ? 94   TYR B CE2 1 
ATOM   4728  C  CZ  . TYR B 2 91  ? -15.881 9.810   20.413  1.00 44.08 ? 94   TYR B CZ  1 
ATOM   4729  O  OH  . TYR B 2 91  ? -16.433 9.451   19.206  1.00 44.31 ? 94   TYR B OH  1 
ATOM   4730  N  N   . SER B 2 92  ? -14.297 12.452  26.913  1.00 42.56 ? 95   SER B N   1 
ATOM   4731  C  CA  . SER B 2 92  ? -13.592 13.039  28.050  1.00 42.22 ? 95   SER B CA  1 
ATOM   4732  C  C   . SER B 2 92  ? -14.426 13.926  28.948  1.00 42.05 ? 95   SER B C   1 
ATOM   4733  O  O   . SER B 2 92  ? -15.193 14.758  28.476  1.00 42.00 ? 95   SER B O   1 
ATOM   4734  C  CB  . SER B 2 92  ? -12.382 13.839  27.578  1.00 41.93 ? 95   SER B CB  1 
ATOM   4735  O  OG  . SER B 2 92  ? -11.706 14.411  28.685  1.00 41.82 ? 95   SER B OG  1 
ATOM   4736  N  N   . LYS B 2 93  ? -14.200 13.783  30.249  1.00 41.92 ? 96   LYS B N   1 
ATOM   4737  C  CA  . LYS B 2 93  ? -14.904 14.553  31.260  1.00 41.87 ? 96   LYS B CA  1 
ATOM   4738  C  C   . LYS B 2 93  ? -14.149 15.817  31.665  1.00 41.62 ? 96   LYS B C   1 
ATOM   4739  O  O   . LYS B 2 93  ? -14.629 16.577  32.502  1.00 41.67 ? 96   LYS B O   1 
ATOM   4740  C  CB  . LYS B 2 93  ? -15.127 13.689  32.501  1.00 42.11 ? 96   LYS B CB  1 
ATOM   4741  C  CG  . LYS B 2 93  ? -13.834 13.211  33.137  1.00 42.40 ? 96   LYS B CG  1 
ATOM   4742  C  CD  . LYS B 2 93  ? -14.069 12.577  34.488  1.00 42.66 ? 96   LYS B CD  1 
ATOM   4743  C  CE  . LYS B 2 93  ? -12.747 12.312  35.188  1.00 42.89 ? 96   LYS B CE  1 
ATOM   4744  N  NZ  . LYS B 2 93  ? -12.935 11.937  36.623  1.00 43.15 ? 96   LYS B NZ  1 
ATOM   4745  N  N   . ALA B 2 94  ? -12.977 16.042  31.077  1.00 41.37 ? 97   ALA B N   1 
ATOM   4746  C  CA  . ALA B 2 94  ? -12.160 17.208  31.400  1.00 41.21 ? 97   ALA B CA  1 
ATOM   4747  C  C   . ALA B 2 94  ? -12.944 18.509  31.346  1.00 41.22 ? 97   ALA B C   1 
ATOM   4748  O  O   . ALA B 2 94  ? -13.641 18.780  30.379  1.00 41.19 ? 97   ALA B O   1 
ATOM   4749  C  CB  . ALA B 2 94  ? -10.973 17.281  30.475  1.00 41.13 ? 97   ALA B CB  1 
ATOM   4750  N  N   . LYS B 2 95  ? -12.809 19.319  32.387  1.00 41.32 ? 98   LYS B N   1 
ATOM   4751  C  CA  . LYS B 2 95  ? -13.510 20.591  32.464  1.00 41.57 ? 98   LYS B CA  1 
ATOM   4752  C  C   . LYS B 2 95  ? -13.253 21.501  31.272  1.00 41.51 ? 98   LYS B C   1 
ATOM   4753  O  O   . LYS B 2 95  ? -14.112 22.289  30.888  1.00 41.51 ? 98   LYS B O   1 
ATOM   4754  C  CB  . LYS B 2 95  ? -13.136 21.333  33.744  1.00 42.01 ? 98   LYS B CB  1 
ATOM   4755  C  CG  . LYS B 2 95  ? -13.787 20.805  35.008  1.00 42.61 ? 98   LYS B CG  1 
ATOM   4756  C  CD  . LYS B 2 95  ? -13.690 21.864  36.103  1.00 43.54 ? 98   LYS B CD  1 
ATOM   4757  C  CE  . LYS B 2 95  ? -14.463 21.474  37.357  1.00 44.13 ? 98   LYS B CE  1 
ATOM   4758  N  NZ  . LYS B 2 95  ? -13.786 20.395  38.131  1.00 44.88 ? 98   LYS B NZ  1 
ATOM   4759  N  N   . VAL B 2 96  ? -12.070 21.400  30.684  1.00 41.38 ? 99   VAL B N   1 
ATOM   4760  C  CA  . VAL B 2 96  ? -11.731 22.234  29.543  1.00 41.28 ? 99   VAL B CA  1 
ATOM   4761  C  C   . VAL B 2 96  ? -12.647 21.994  28.338  1.00 41.45 ? 99   VAL B C   1 
ATOM   4762  O  O   . VAL B 2 96  ? -12.802 22.867  27.487  1.00 41.42 ? 99   VAL B O   1 
ATOM   4763  C  CB  . VAL B 2 96  ? -10.244 22.045  29.150  1.00 41.22 ? 99   VAL B CB  1 
ATOM   4764  C  CG1 . VAL B 2 96  ? -9.978  20.617  28.718  1.00 41.09 ? 99   VAL B CG1 1 
ATOM   4765  C  CG2 . VAL B 2 96  ? -9.847  23.022  28.071  1.00 41.17 ? 99   VAL B CG2 1 
ATOM   4766  N  N   . PHE B 2 97  ? -13.288 20.829  28.295  1.00 41.39 ? 100  PHE B N   1 
ATOM   4767  C  CA  . PHE B 2 97  ? -14.177 20.478  27.192  1.00 41.35 ? 100  PHE B CA  1 
ATOM   4768  C  C   . PHE B 2 97  ? -15.643 20.435  27.617  1.00 41.63 ? 100  PHE B C   1 
ATOM   4769  O  O   . PHE B 2 97  ? -16.518 20.220  26.775  1.00 41.76 ? 100  PHE B O   1 
ATOM   4770  C  CB  . PHE B 2 97  ? -13.857 19.070  26.672  1.00 41.08 ? 100  PHE B CB  1 
ATOM   4771  C  CG  . PHE B 2 97  ? -12.418 18.843  26.312  1.00 40.97 ? 100  PHE B CG  1 
ATOM   4772  C  CD1 . PHE B 2 97  ? -11.740 19.712  25.464  1.00 40.94 ? 100  PHE B CD1 1 
ATOM   4773  C  CD2 . PHE B 2 97  ? -11.751 17.716  26.778  1.00 40.82 ? 100  PHE B CD2 1 
ATOM   4774  C  CE1 . PHE B 2 97  ? -10.416 19.451  25.087  1.00 40.73 ? 100  PHE B CE1 1 
ATOM   4775  C  CE2 . PHE B 2 97  ? -10.428 17.452  26.405  1.00 40.57 ? 100  PHE B CE2 1 
ATOM   4776  C  CZ  . PHE B 2 97  ? -9.765  18.317  25.561  1.00 40.52 ? 100  PHE B CZ  1 
ATOM   4777  N  N   . GLU B 2 98  ? -15.920 20.673  28.898  1.00 41.78 ? 101  GLU B N   1 
ATOM   4778  C  CA  . GLU B 2 98  ? -17.280 20.534  29.408  1.00 41.88 ? 101  GLU B CA  1 
ATOM   4779  C  C   . GLU B 2 98  ? -18.471 21.064  28.635  1.00 41.77 ? 101  GLU B C   1 
ATOM   4780  O  O   . GLU B 2 98  ? -19.530 20.442  28.666  1.00 41.79 ? 101  GLU B O   1 
ATOM   4781  C  CB  . GLU B 2 98  ? -17.376 20.889  30.887  1.00 42.25 ? 101  GLU B CB  1 
ATOM   4782  C  CG  . GLU B 2 98  ? -17.364 22.352  31.225  1.00 43.00 ? 101  GLU B CG  1 
ATOM   4783  C  CD  . GLU B 2 98  ? -17.373 22.577  32.729  1.00 43.65 ? 101  GLU B CD  1 
ATOM   4784  O  OE1 . GLU B 2 98  ? -17.464 23.751  33.157  1.00 44.16 ? 101  GLU B OE1 1 
ATOM   4785  O  OE2 . GLU B 2 98  ? -17.280 21.585  33.491  1.00 43.86 ? 101  GLU B OE2 1 
ATOM   4786  N  N   . HIS B 2 99  ? -18.327 22.171  27.919  1.00 41.45 ? 102  HIS B N   1 
ATOM   4787  C  CA  . HIS B 2 99  ? -19.466 22.659  27.159  1.00 41.20 ? 102  HIS B CA  1 
ATOM   4788  C  C   . HIS B 2 99  ? -19.096 23.520  25.971  1.00 41.01 ? 102  HIS B C   1 
ATOM   4789  O  O   . HIS B 2 99  ? -18.122 24.273  26.014  1.00 40.95 ? 102  HIS B O   1 
ATOM   4790  C  CB  . HIS B 2 99  ? -20.474 23.380  28.070  1.00 41.26 ? 102  HIS B CB  1 
ATOM   4791  C  CG  . HIS B 2 99  ? -20.022 24.724  28.548  1.00 41.31 ? 102  HIS B CG  1 
ATOM   4792  N  ND1 . HIS B 2 99  ? -20.043 25.845  27.747  1.00 41.42 ? 102  HIS B ND1 1 
ATOM   4793  C  CD2 . HIS B 2 99  ? -19.564 25.132  29.754  1.00 41.31 ? 102  HIS B CD2 1 
ATOM   4794  C  CE1 . HIS B 2 99  ? -19.618 26.887  28.440  1.00 41.48 ? 102  HIS B CE1 1 
ATOM   4795  N  NE2 . HIS B 2 99  ? -19.321 26.482  29.661  1.00 41.45 ? 102  HIS B NE2 1 
ATOM   4796  N  N   . ILE B 2 100 ? -19.873 23.382  24.901  1.00 40.76 ? 103  ILE B N   1 
ATOM   4797  C  CA  . ILE B 2 100 ? -19.652 24.148  23.686  1.00 40.61 ? 103  ILE B CA  1 
ATOM   4798  C  C   . ILE B 2 100 ? -19.648 25.639  24.013  1.00 40.73 ? 103  ILE B C   1 
ATOM   4799  O  O   . ILE B 2 100 ? -20.487 26.124  24.785  1.00 40.76 ? 103  ILE B O   1 
ATOM   4800  C  CB  . ILE B 2 100 ? -20.731 23.853  22.631  1.00 40.36 ? 103  ILE B CB  1 
ATOM   4801  C  CG1 . ILE B 2 100 ? -20.653 22.393  22.201  1.00 40.12 ? 103  ILE B CG1 1 
ATOM   4802  C  CG2 . ILE B 2 100 ? -20.550 24.748  21.422  1.00 40.20 ? 103  ILE B CG2 1 
ATOM   4803  C  CD1 . ILE B 2 100 ? -21.658 22.024  21.133  1.00 40.02 ? 103  ILE B CD1 1 
ATOM   4804  N  N   . GLY B 2 101 ? -18.668 26.346  23.458  1.00 40.70 ? 104  GLY B N   1 
ATOM   4805  C  CA  . GLY B 2 101 ? -18.545 27.771  23.690  1.00 40.73 ? 104  GLY B CA  1 
ATOM   4806  C  C   . GLY B 2 101 ? -17.643 28.136  24.852  1.00 40.77 ? 104  GLY B C   1 
ATOM   4807  O  O   . GLY B 2 101 ? -17.328 29.311  25.030  1.00 40.96 ? 104  GLY B O   1 
ATOM   4808  N  N   . LYS B 2 102 ? -17.221 27.154  25.643  1.00 40.64 ? 105  LYS B N   1 
ATOM   4809  C  CA  . LYS B 2 102 ? -16.356 27.430  26.787  1.00 40.52 ? 105  LYS B CA  1 
ATOM   4810  C  C   . LYS B 2 102 ? -14.961 27.896  26.393  1.00 40.43 ? 105  LYS B C   1 
ATOM   4811  O  O   . LYS B 2 102 ? -14.280 27.232  25.611  1.00 40.50 ? 105  LYS B O   1 
ATOM   4812  C  CB  . LYS B 2 102 ? -16.243 26.204  27.677  1.00 40.56 ? 105  LYS B CB  1 
ATOM   4813  C  CG  . LYS B 2 102 ? -15.443 26.476  28.917  1.00 40.56 ? 105  LYS B CG  1 
ATOM   4814  C  CD  . LYS B 2 102 ? -15.550 25.358  29.909  1.00 40.58 ? 105  LYS B CD  1 
ATOM   4815  C  CE  . LYS B 2 102 ? -14.987 25.804  31.231  1.00 40.58 ? 105  LYS B CE  1 
ATOM   4816  N  NZ  . LYS B 2 102 ? -15.060 24.707  32.208  1.00 40.96 ? 105  LYS B NZ  1 
ATOM   4817  N  N   . LYS B 2 103 ? -14.541 29.032  26.951  1.00 40.36 ? 106  LYS B N   1 
ATOM   4818  C  CA  . LYS B 2 103 ? -13.227 29.606  26.669  1.00 40.24 ? 106  LYS B CA  1 
ATOM   4819  C  C   . LYS B 2 103 ? -12.250 29.468  27.826  1.00 39.92 ? 106  LYS B C   1 
ATOM   4820  O  O   . LYS B 2 103 ? -12.570 29.816  28.966  1.00 39.97 ? 106  LYS B O   1 
ATOM   4821  C  CB  . LYS B 2 103 ? -13.343 31.084  26.275  1.00 40.38 ? 106  LYS B CB  1 
ATOM   4822  C  CG  . LYS B 2 103 ? -14.044 31.314  24.940  1.00 40.85 ? 106  LYS B CG  1 
ATOM   4823  C  CD  . LYS B 2 103 ? -13.980 32.772  24.482  1.00 41.18 ? 106  LYS B CD  1 
ATOM   4824  C  CE  . LYS B 2 103 ? -14.801 32.969  23.205  1.00 41.56 ? 106  LYS B CE  1 
ATOM   4825  N  NZ  . LYS B 2 103 ? -14.786 34.371  22.680  1.00 41.87 ? 106  LYS B NZ  1 
ATOM   4826  N  N   . THR B 2 104 ? -11.051 28.975  27.504  1.00 39.61 ? 107  THR B N   1 
ATOM   4827  C  CA  . THR B 2 104 ? -9.963  28.773  28.468  1.00 39.19 ? 107  THR B CA  1 
ATOM   4828  C  C   . THR B 2 104 ? -8.702  29.490  27.984  1.00 38.65 ? 107  THR B C   1 
ATOM   4829  O  O   . THR B 2 104 ? -8.274  29.301  26.844  1.00 38.67 ? 107  THR B O   1 
ATOM   4830  C  CB  . THR B 2 104 ? -9.641  27.272  28.648  1.00 39.09 ? 107  THR B CB  1 
ATOM   4831  O  OG1 . THR B 2 104 ? -10.766 26.607  29.232  1.00 39.12 ? 107  THR B OG1 1 
ATOM   4832  C  CG2 . THR B 2 104 ? -8.432  27.080  29.549  1.00 39.05 ? 107  THR B CG2 1 
ATOM   4833  N  N   . PRO B 2 105 ? -8.082  30.312  28.854  1.00 38.24 ? 108  PRO B N   1 
ATOM   4834  C  CA  . PRO B 2 105 ? -6.869  31.057  28.510  1.00 37.92 ? 108  PRO B CA  1 
ATOM   4835  C  C   . PRO B 2 105 ? -5.733  30.104  28.202  1.00 37.55 ? 108  PRO B C   1 
ATOM   4836  O  O   . PRO B 2 105 ? -5.609  29.055  28.840  1.00 37.51 ? 108  PRO B O   1 
ATOM   4837  C  CB  . PRO B 2 105 ? -6.565  31.827  29.797  1.00 37.93 ? 108  PRO B CB  1 
ATOM   4838  C  CG  . PRO B 2 105 ? -7.889  31.931  30.480  1.00 37.99 ? 108  PRO B CG  1 
ATOM   4839  C  CD  . PRO B 2 105 ? -8.467  30.571  30.250  1.00 38.15 ? 108  PRO B CD  1 
ATOM   4840  N  N   . ILE B 2 106 ? -4.912  30.453  27.219  1.00 37.17 ? 109  ILE B N   1 
ATOM   4841  C  CA  . ILE B 2 106 ? -3.780  29.607  26.874  1.00 36.88 ? 109  ILE B CA  1 
ATOM   4842  C  C   . ILE B 2 106 ? -2.500  30.397  26.693  1.00 36.68 ? 109  ILE B C   1 
ATOM   4843  O  O   . ILE B 2 106 ? -2.524  31.610  26.457  1.00 36.60 ? 109  ILE B O   1 
ATOM   4844  C  CB  . ILE B 2 106 ? -4.012  28.784  25.582  1.00 36.59 ? 109  ILE B CB  1 
ATOM   4845  C  CG1 . ILE B 2 106 ? -4.067  29.699  24.363  1.00 36.42 ? 109  ILE B CG1 1 
ATOM   4846  C  CG2 . ILE B 2 106 ? -5.274  27.953  25.690  1.00 36.52 ? 109  ILE B CG2 1 
ATOM   4847  C  CD1 . ILE B 2 106 ? -4.064  28.948  23.054  1.00 36.40 ? 109  ILE B CD1 1 
ATOM   4848  N  N   . ALA B 2 107 ? -1.386  29.685  26.833  1.00 36.47 ? 110  ALA B N   1 
ATOM   4849  C  CA  . ALA B 2 107 ? -0.053  30.238  26.650  1.00 36.28 ? 110  ALA B CA  1 
ATOM   4850  C  C   . ALA B 2 107 ? 0.630   29.301  25.658  1.00 36.25 ? 110  ALA B C   1 
ATOM   4851  O  O   . ALA B 2 107 ? 0.493   28.080  25.760  1.00 36.27 ? 110  ALA B O   1 
ATOM   4852  C  CB  . ALA B 2 107 ? 0.693   30.254  27.965  1.00 36.28 ? 110  ALA B CB  1 
ATOM   4853  N  N   . VAL B 2 108 ? 1.352   29.862  24.691  1.00 36.06 ? 111  VAL B N   1 
ATOM   4854  C  CA  . VAL B 2 108 ? 2.020   29.046  23.683  1.00 35.96 ? 111  VAL B CA  1 
ATOM   4855  C  C   . VAL B 2 108 ? 3.456   29.480  23.423  1.00 36.04 ? 111  VAL B C   1 
ATOM   4856  O  O   . VAL B 2 108 ? 3.792   30.658  23.533  1.00 36.13 ? 111  VAL B O   1 
ATOM   4857  C  CB  . VAL B 2 108 ? 1.256   29.114  22.338  1.00 36.01 ? 111  VAL B CB  1 
ATOM   4858  C  CG1 . VAL B 2 108 ? 2.025   28.396  21.236  1.00 35.79 ? 111  VAL B CG1 1 
ATOM   4859  C  CG2 . VAL B 2 108 ? -0.130  28.524  22.489  1.00 35.85 ? 111  VAL B CG2 1 
ATOM   4860  N  N   . ARG B 2 109 ? 4.308   28.518  23.090  1.00 35.74 ? 112  ARG B N   1 
ATOM   4861  C  CA  . ARG B 2 109 ? 5.694   28.815  22.763  1.00 35.33 ? 112  ARG B CA  1 
ATOM   4862  C  C   . ARG B 2 109 ? 6.103   27.928  21.602  1.00 35.32 ? 112  ARG B C   1 
ATOM   4863  O  O   . ARG B 2 109 ? 5.899   26.716  21.634  1.00 35.40 ? 112  ARG B O   1 
ATOM   4864  C  CB  . ARG B 2 109 ? 6.626   28.592  23.954  1.00 34.98 ? 112  ARG B CB  1 
ATOM   4865  C  CG  . ARG B 2 109 ? 8.060   29.003  23.667  1.00 34.36 ? 112  ARG B CG  1 
ATOM   4866  C  CD  . ARG B 2 109 ? 8.976   28.731  24.838  1.00 34.21 ? 112  ARG B CD  1 
ATOM   4867  N  NE  . ARG B 2 109 ? 10.354  29.114  24.541  1.00 34.12 ? 112  ARG B NE  1 
ATOM   4868  C  CZ  . ARG B 2 109 ? 11.257  28.326  23.960  1.00 34.11 ? 112  ARG B CZ  1 
ATOM   4869  N  NH1 . ARG B 2 109 ? 10.946  27.087  23.606  1.00 33.98 ? 112  ARG B NH1 1 
ATOM   4870  N  NH2 . ARG B 2 109 ? 12.477  28.788  23.717  1.00 34.02 ? 112  ARG B NH2 1 
ATOM   4871  N  N   . PHE B 2 110 ? 6.608   28.553  20.547  1.00 35.09 ? 113  PHE B N   1 
ATOM   4872  C  CA  . PHE B 2 110 ? 7.056   27.841  19.354  1.00 35.05 ? 113  PHE B CA  1 
ATOM   4873  C  C   . PHE B 2 110 ? 8.570   27.821  19.409  1.00 34.89 ? 113  PHE B C   1 
ATOM   4874  O  O   . PHE B 2 110 ? 9.177   28.709  20.011  1.00 34.82 ? 113  PHE B O   1 
ATOM   4875  C  CB  . PHE B 2 110 ? 6.630   28.586  18.093  1.00 34.97 ? 113  PHE B CB  1 
ATOM   4876  C  CG  . PHE B 2 110 ? 5.145   28.754  17.941  1.00 34.94 ? 113  PHE B CG  1 
ATOM   4877  C  CD1 . PHE B 2 110 ? 4.545   29.990  18.173  1.00 34.91 ? 113  PHE B CD1 1 
ATOM   4878  C  CD2 . PHE B 2 110 ? 4.355   27.701  17.483  1.00 34.77 ? 113  PHE B CD2 1 
ATOM   4879  C  CE1 . PHE B 2 110 ? 3.177   30.178  17.941  1.00 34.92 ? 113  PHE B CE1 1 
ATOM   4880  C  CE2 . PHE B 2 110 ? 2.993   27.881  17.249  1.00 34.70 ? 113  PHE B CE2 1 
ATOM   4881  C  CZ  . PHE B 2 110 ? 2.403   29.118  17.477  1.00 34.74 ? 113  PHE B CZ  1 
ATOM   4882  N  N   . SER B 2 111 ? 9.194   26.861  18.737  1.00 34.70 ? 114  SER B N   1 
ATOM   4883  C  CA  . SER B 2 111 ? 10.646  26.790  18.783  1.00 34.64 ? 114  SER B CA  1 
ATOM   4884  C  C   . SER B 2 111 ? 11.267  25.802  17.817  1.00 34.63 ? 114  SER B C   1 
ATOM   4885  O  O   . SER B 2 111 ? 10.566  25.085  17.116  1.00 34.52 ? 114  SER B O   1 
ATOM   4886  C  CB  . SER B 2 111 ? 11.077  26.408  20.198  1.00 34.72 ? 114  SER B CB  1 
ATOM   4887  O  OG  . SER B 2 111 ? 10.440  25.204  20.599  1.00 35.08 ? 114  SER B OG  1 
ATOM   4888  N  N   . THR B 2 112 ? 12.597  25.826  17.753  1.00 34.54 ? 115  THR B N   1 
ATOM   4889  C  CA  . THR B 2 112 ? 13.361  24.898  16.933  1.00 34.38 ? 115  THR B CA  1 
ATOM   4890  C  C   . THR B 2 112 ? 13.862  23.871  17.937  1.00 34.47 ? 115  THR B C   1 
ATOM   4891  O  O   . THR B 2 112 ? 13.415  23.871  19.075  1.00 34.28 ? 115  THR B O   1 
ATOM   4892  C  CB  . THR B 2 112 ? 14.539  25.572  16.252  1.00 34.50 ? 115  THR B CB  1 
ATOM   4893  O  OG1 . THR B 2 112 ? 15.311  26.292  17.222  1.00 34.52 ? 115  THR B OG1 1 
ATOM   4894  C  CG2 . THR B 2 112 ? 14.050  26.518  15.177  1.00 34.57 ? 115  THR B CG2 1 
ATOM   4895  N  N   . VAL B 2 113 ? 14.807  23.021  17.565  1.00 34.43 ? 116  VAL B N   1 
ATOM   4896  C  CA  . VAL B 2 113 ? 15.251  22.020  18.523  1.00 34.46 ? 116  VAL B CA  1 
ATOM   4897  C  C   . VAL B 2 113 ? 16.718  22.028  18.923  1.00 34.68 ? 116  VAL B C   1 
ATOM   4898  O  O   . VAL B 2 113 ? 17.035  22.150  20.115  1.00 34.64 ? 116  VAL B O   1 
ATOM   4899  C  CB  . VAL B 2 113 ? 14.889  20.590  18.056  1.00 34.42 ? 116  VAL B CB  1 
ATOM   4900  C  CG1 . VAL B 2 113 ? 15.199  19.584  19.150  1.00 34.10 ? 116  VAL B CG1 1 
ATOM   4901  C  CG2 . VAL B 2 113 ? 13.428  20.514  17.672  1.00 34.27 ? 116  VAL B CG2 1 
ATOM   4902  N  N   . ALA B 2 114 ? 17.602  21.890  17.935  1.00 34.70 ? 117  ALA B N   1 
ATOM   4903  C  CA  . ALA B 2 114 ? 19.042  21.799  18.171  1.00 34.68 ? 117  ALA B CA  1 
ATOM   4904  C  C   . ALA B 2 114 ? 19.839  23.051  18.488  1.00 34.80 ? 117  ALA B C   1 
ATOM   4905  O  O   . ALA B 2 114 ? 20.750  23.008  19.314  1.00 34.87 ? 117  ALA B O   1 
ATOM   4906  C  CB  . ALA B 2 114 ? 19.700  21.058  17.019  1.00 34.79 ? 117  ALA B CB  1 
ATOM   4907  N  N   . GLY B 2 115 ? 19.532  24.150  17.813  1.00 34.82 ? 118  GLY B N   1 
ATOM   4908  C  CA  . GLY B 2 115 ? 20.274  25.378  18.033  1.00 34.85 ? 118  GLY B CA  1 
ATOM   4909  C  C   . GLY B 2 115 ? 20.080  26.023  19.387  1.00 34.88 ? 118  GLY B C   1 
ATOM   4910  O  O   . GLY B 2 115 ? 19.048  25.847  20.031  1.00 34.80 ? 118  GLY B O   1 
ATOM   4911  N  N   . GLU B 2 116 ? 21.085  26.775  19.817  1.00 35.01 ? 119  GLU B N   1 
ATOM   4912  C  CA  . GLU B 2 116 ? 21.030  27.470  21.095  1.00 35.23 ? 119  GLU B CA  1 
ATOM   4913  C  C   . GLU B 2 116 ? 20.318  28.805  20.932  1.00 35.07 ? 119  GLU B C   1 
ATOM   4914  O  O   . GLU B 2 116 ? 19.861  29.149  19.842  1.00 35.18 ? 119  GLU B O   1 
ATOM   4915  C  CB  . GLU B 2 116 ? 22.442  27.724  21.641  1.00 35.72 ? 119  GLU B CB  1 
ATOM   4916  C  CG  . GLU B 2 116 ? 23.270  26.478  21.882  1.00 36.35 ? 119  GLU B CG  1 
ATOM   4917  C  CD  . GLU B 2 116 ? 23.830  25.886  20.608  1.00 36.95 ? 119  GLU B CD  1 
ATOM   4918  O  OE1 . GLU B 2 116 ? 24.397  24.775  20.676  1.00 37.54 ? 119  GLU B OE1 1 
ATOM   4919  O  OE2 . GLU B 2 116 ? 23.718  26.523  19.536  1.00 37.28 ? 119  GLU B OE2 1 
ATOM   4920  N  N   A SER B 2 117 ? 20.225  29.552  22.027  0.50 34.92 ? 120  SER B N   1 
ATOM   4921  N  N   B SER B 2 117 ? 20.248  29.562  22.021  0.50 35.02 ? 120  SER B N   1 
ATOM   4922  C  CA  A SER B 2 117 ? 19.544  30.846  22.069  0.50 34.73 ? 120  SER B CA  1 
ATOM   4923  C  CA  B SER B 2 117 ? 19.648  30.882  21.974  0.50 34.89 ? 120  SER B CA  1 
ATOM   4924  C  C   A SER B 2 117 ? 19.835  31.887  20.987  0.50 34.71 ? 120  SER B C   1 
ATOM   4925  C  C   B SER B 2 117 ? 20.588  31.671  21.069  0.50 34.93 ? 120  SER B C   1 
ATOM   4926  O  O   A SER B 2 117 ? 18.946  32.648  20.620  0.50 34.59 ? 120  SER B O   1 
ATOM   4927  O  O   B SER B 2 117 ? 21.812  31.504  21.131  0.50 34.94 ? 120  SER B O   1 
ATOM   4928  C  CB  A SER B 2 117 ? 19.737  31.481  23.445  0.50 34.61 ? 120  SER B CB  1 
ATOM   4929  C  CB  B SER B 2 117 ? 19.614  31.500  23.371  0.50 34.78 ? 120  SER B CB  1 
ATOM   4930  O  OG  A SER B 2 117 ? 19.145  30.683  24.454  0.50 34.59 ? 120  SER B OG  1 
ATOM   4931  O  OG  B SER B 2 117 ? 18.861  30.694  24.259  0.50 34.79 ? 120  SER B OG  1 
ATOM   4932  N  N   A GLY B 2 118 ? 21.066  31.952  20.492  0.50 34.66 ? 121  GLY B N   1 
ATOM   4933  N  N   B GLY B 2 118 ? 20.025  32.496  20.200  0.50 34.82 ? 121  GLY B N   1 
ATOM   4934  C  CA  A GLY B 2 118 ? 21.376  32.943  19.473  0.50 34.80 ? 121  GLY B CA  1 
ATOM   4935  C  CA  B GLY B 2 118 ? 20.864  33.254  19.294  0.50 34.90 ? 121  GLY B CA  1 
ATOM   4936  C  C   A GLY B 2 118 ? 21.408  32.383  18.068  0.50 34.73 ? 121  GLY B C   1 
ATOM   4937  C  C   B GLY B 2 118 ? 20.884  32.615  17.922  0.50 34.82 ? 121  GLY B C   1 
ATOM   4938  O  O   A GLY B 2 118 ? 22.057  32.939  17.186  0.50 34.70 ? 121  GLY B O   1 
ATOM   4939  O  O   B GLY B 2 118 ? 21.120  33.305  16.932  0.50 34.85 ? 121  GLY B O   1 
ATOM   4940  N  N   . SER B 2 119 ? 20.674  31.298  17.853  1.00 34.12 ? 122  SER B N   1 
ATOM   4941  C  CA  . SER B 2 119 ? 20.638  30.620  16.568  1.00 34.54 ? 122  SER B CA  1 
ATOM   4942  C  C   . SER B 2 119 ? 19.492  31.134  15.718  1.00 34.63 ? 122  SER B C   1 
ATOM   4943  O  O   . SER B 2 119 ? 18.615  31.852  16.207  1.00 34.57 ? 122  SER B O   1 
ATOM   4944  C  CB  . SER B 2 119 ? 20.521  29.111  16.762  1.00 33.83 ? 122  SER B CB  1 
ATOM   4945  O  OG  . SER B 2 119 ? 19.332  28.777  17.447  1.00 33.59 ? 122  SER B OG  1 
ATOM   4946  N  N   . ALA B 2 120 ? 19.506  30.757  14.445  1.00 34.71 ? 123  ALA B N   1 
ATOM   4947  C  CA  . ALA B 2 120 ? 18.497  31.183  13.492  1.00 34.94 ? 123  ALA B CA  1 
ATOM   4948  C  C   . ALA B 2 120 ? 17.203  30.390  13.558  1.00 35.13 ? 123  ALA B C   1 
ATOM   4949  O  O   . ALA B 2 120 ? 17.193  29.202  13.886  1.00 35.15 ? 123  ALA B O   1 
ATOM   4950  C  CB  . ALA B 2 120 ? 19.065  31.133  12.097  1.00 34.94 ? 123  ALA B CB  1 
ATOM   4951  N  N   . ASP B 2 121 ? 16.111  31.069  13.230  1.00 35.30 ? 124  ASP B N   1 
ATOM   4952  C  CA  . ASP B 2 121 ? 14.782  30.484  13.230  1.00 35.41 ? 124  ASP B CA  1 
ATOM   4953  C  C   . ASP B 2 121 ? 14.501  29.644  11.992  1.00 35.55 ? 124  ASP B C   1 
ATOM   4954  O  O   . ASP B 2 121 ? 13.941  28.556  12.080  1.00 35.69 ? 124  ASP B O   1 
ATOM   4955  C  CB  . ASP B 2 121 ? 13.725  31.591  13.286  1.00 35.31 ? 124  ASP B CB  1 
ATOM   4956  C  CG  . ASP B 2 121 ? 13.526  32.164  14.673  1.00 35.45 ? 124  ASP B CG  1 
ATOM   4957  O  OD1 . ASP B 2 121 ? 14.115  31.657  15.655  1.00 35.81 ? 124  ASP B OD1 1 
ATOM   4958  O  OD2 . ASP B 2 121 ? 12.739  33.125  14.783  1.00 35.54 ? 124  ASP B OD2 1 
ATOM   4959  N  N   . THR B 2 122 ? 14.861  30.171  10.829  1.00 35.63 ? 125  THR B N   1 
ATOM   4960  C  CA  . THR B 2 122 ? 14.584  29.497  9.569   1.00 35.66 ? 125  THR B CA  1 
ATOM   4961  C  C   . THR B 2 122 ? 15.574  28.415  9.160   1.00 35.99 ? 125  THR B C   1 
ATOM   4962  O  O   . THR B 2 122 ? 16.215  28.511  8.114   1.00 35.86 ? 125  THR B O   1 
ATOM   4963  C  CB  . THR B 2 122 ? 14.422  30.520  8.435   1.00 35.64 ? 125  THR B CB  1 
ATOM   4964  O  OG1 . THR B 2 122 ? 15.646  31.242  8.260   1.00 35.43 ? 125  THR B OG1 1 
ATOM   4965  C  CG2 . THR B 2 122 ? 13.323  31.508  8.779   1.00 35.36 ? 125  THR B CG2 1 
ATOM   4966  N  N   . VAL B 2 123 ? 15.673  27.373  9.982   1.00 36.12 ? 126  VAL B N   1 
ATOM   4967  C  CA  . VAL B 2 123 ? 16.562  26.250  9.716   1.00 36.11 ? 126  VAL B CA  1 
ATOM   4968  C  C   . VAL B 2 123 ? 15.766  24.955  9.717   1.00 36.27 ? 126  VAL B C   1 
ATOM   4969  O  O   . VAL B 2 123 ? 14.650  24.896  10.244  1.00 36.27 ? 126  VAL B O   1 
ATOM   4970  C  CB  . VAL B 2 123 ? 17.675  26.124  10.782  1.00 36.01 ? 126  VAL B CB  1 
ATOM   4971  C  CG1 . VAL B 2 123 ? 18.584  27.338  10.737  1.00 35.89 ? 126  VAL B CG1 1 
ATOM   4972  C  CG2 . VAL B 2 123 ? 17.070  25.963  12.164  1.00 35.82 ? 126  VAL B CG2 1 
ATOM   4973  N  N   . ARG B 2 124 ? 16.323  23.932  9.081   1.00 36.33 ? 127  ARG B N   1 
ATOM   4974  C  CA  . ARG B 2 124 ? 15.683  22.627  9.036   1.00 36.37 ? 127  ARG B CA  1 
ATOM   4975  C  C   . ARG B 2 124 ? 15.798  22.034  10.430  1.00 36.41 ? 127  ARG B C   1 
ATOM   4976  O  O   . ARG B 2 124 ? 16.896  21.920  10.988  1.00 36.40 ? 127  ARG B O   1 
ATOM   4977  C  CB  . ARG B 2 124 ? 16.362  21.741  7.995   1.00 36.39 ? 127  ARG B CB  1 
ATOM   4978  C  CG  . ARG B 2 124 ? 16.048  20.274  8.116   1.00 36.40 ? 127  ARG B CG  1 
ATOM   4979  C  CD  . ARG B 2 124 ? 16.361  19.575  6.831   1.00 36.43 ? 127  ARG B CD  1 
ATOM   4980  N  NE  . ARG B 2 124 ? 15.218  19.702  5.947   1.00 37.19 ? 127  ARG B NE  1 
ATOM   4981  C  CZ  . ARG B 2 124 ? 15.214  20.343  4.787   1.00 37.08 ? 127  ARG B CZ  1 
ATOM   4982  N  NH1 . ARG B 2 124 ? 14.099  20.389  4.090   1.00 37.48 ? 127  ARG B NH1 1 
ATOM   4983  N  NH2 . ARG B 2 124 ? 16.312  20.903  4.309   1.00 37.23 ? 127  ARG B NH2 1 
ATOM   4984  N  N   . ASP B 2 125 ? 14.657  21.664  10.993  1.00 36.37 ? 128  ASP B N   1 
ATOM   4985  C  CA  . ASP B 2 125 ? 14.613  21.132  12.342  1.00 36.41 ? 128  ASP B CA  1 
ATOM   4986  C  C   . ASP B 2 125 ? 13.130  21.014  12.648  1.00 36.36 ? 128  ASP B C   1 
ATOM   4987  O  O   . ASP B 2 125 ? 12.314  21.712  12.030  1.00 36.69 ? 128  ASP B O   1 
ATOM   4988  C  CB  . ASP B 2 125 ? 15.208  22.188  13.289  1.00 36.40 ? 128  ASP B CB  1 
ATOM   4989  C  CG  . ASP B 2 125 ? 16.073  21.600  14.382  1.00 36.54 ? 128  ASP B CG  1 
ATOM   4990  O  OD1 . ASP B 2 125 ? 16.440  22.359  15.303  1.00 36.63 ? 128  ASP B OD1 1 
ATOM   4991  O  OD2 . ASP B 2 125 ? 16.412  20.402  14.326  1.00 37.01 ? 128  ASP B OD2 1 
ATOM   4992  N  N   . PRO B 2 126 ? 12.736  20.073  13.523  1.00 36.11 ? 129  PRO B N   1 
ATOM   4993  C  CA  . PRO B 2 126 ? 11.293  20.050  13.773  1.00 35.83 ? 129  PRO B CA  1 
ATOM   4994  C  C   . PRO B 2 126 ? 10.962  21.321  14.560  1.00 35.67 ? 129  PRO B C   1 
ATOM   4995  O  O   . PRO B 2 126 ? 11.862  22.069  14.933  1.00 35.58 ? 129  PRO B O   1 
ATOM   4996  C  CB  . PRO B 2 126 ? 11.101  18.769  14.594  1.00 35.83 ? 129  PRO B CB  1 
ATOM   4997  C  CG  . PRO B 2 126 ? 12.443  18.481  15.161  1.00 35.75 ? 129  PRO B CG  1 
ATOM   4998  C  CD  . PRO B 2 126 ? 13.395  18.881  14.084  1.00 35.94 ? 129  PRO B CD  1 
ATOM   4999  N  N   . ARG B 2 127 ? 9.690   21.616  14.759  1.00 35.58 ? 130  ARG B N   1 
ATOM   5000  C  CA  . ARG B 2 127 ? 9.335   22.818  15.498  1.00 35.59 ? 130  ARG B CA  1 
ATOM   5001  C  C   . ARG B 2 127 ? 8.497   22.473  16.716  1.00 35.83 ? 130  ARG B C   1 
ATOM   5002  O  O   . ARG B 2 127 ? 7.634   21.601  16.646  1.00 35.98 ? 130  ARG B O   1 
ATOM   5003  C  CB  . ARG B 2 127 ? 8.540   23.781  14.610  1.00 35.35 ? 130  ARG B CB  1 
ATOM   5004  C  CG  . ARG B 2 127 ? 9.272   24.308  13.392  1.00 35.08 ? 130  ARG B CG  1 
ATOM   5005  C  CD  . ARG B 2 127 ? 10.316  25.355  13.756  1.00 34.91 ? 130  ARG B CD  1 
ATOM   5006  N  NE  . ARG B 2 127 ? 10.874  25.996  12.566  1.00 34.74 ? 130  ARG B NE  1 
ATOM   5007  C  CZ  . ARG B 2 127 ? 11.889  25.513  11.856  1.00 34.75 ? 130  ARG B CZ  1 
ATOM   5008  N  NH1 . ARG B 2 127 ? 12.478  24.380  12.211  1.00 34.62 ? 130  ARG B NH1 1 
ATOM   5009  N  NH2 . ARG B 2 127 ? 12.297  26.147  10.767  1.00 34.66 ? 130  ARG B NH2 1 
ATOM   5010  N  N   . GLY B 2 128 ? 8.770   23.142  17.834  1.00 35.97 ? 131  GLY B N   1 
ATOM   5011  C  CA  . GLY B 2 128 ? 8.002   22.917  19.044  1.00 36.06 ? 131  GLY B CA  1 
ATOM   5012  C  C   . GLY B 2 128 ? 6.726   23.741  19.012  1.00 36.04 ? 131  GLY B C   1 
ATOM   5013  O  O   . GLY B 2 128 ? 6.715   24.859  18.496  1.00 36.17 ? 131  GLY B O   1 
ATOM   5014  N  N   . PHE B 2 129 ? 5.651   23.202  19.573  1.00 36.15 ? 132  PHE B N   1 
ATOM   5015  C  CA  . PHE B 2 129 ? 4.367   23.890  19.592  1.00 36.25 ? 132  PHE B CA  1 
ATOM   5016  C  C   . PHE B 2 129 ? 3.685   23.467  20.883  1.00 36.22 ? 132  PHE B C   1 
ATOM   5017  O  O   . PHE B 2 129 ? 2.812   22.600  20.892  1.00 36.35 ? 132  PHE B O   1 
ATOM   5018  C  CB  . PHE B 2 129 ? 3.541   23.464  18.368  1.00 36.24 ? 132  PHE B CB  1 
ATOM   5019  C  CG  . PHE B 2 129 ? 2.335   24.334  18.086  1.00 36.31 ? 132  PHE B CG  1 
ATOM   5020  C  CD1 . PHE B 2 129 ? 1.792   25.167  19.061  1.00 36.22 ? 132  PHE B CD1 1 
ATOM   5021  C  CD2 . PHE B 2 129 ? 1.727   24.294  16.833  1.00 36.19 ? 132  PHE B CD2 1 
ATOM   5022  C  CE1 . PHE B 2 129 ? 0.664   25.943  18.787  1.00 36.20 ? 132  PHE B CE1 1 
ATOM   5023  C  CE2 . PHE B 2 129 ? 0.599   25.067  16.556  1.00 36.03 ? 132  PHE B CE2 1 
ATOM   5024  C  CZ  . PHE B 2 129 ? 0.069   25.888  17.532  1.00 36.07 ? 132  PHE B CZ  1 
ATOM   5025  N  N   . ALA B 2 130 ? 4.107   24.075  21.981  1.00 36.22 ? 133  ALA B N   1 
ATOM   5026  C  CA  . ALA B 2 130 ? 3.563   23.750  23.286  1.00 36.17 ? 133  ALA B CA  1 
ATOM   5027  C  C   . ALA B 2 130 ? 2.428   24.679  23.679  1.00 36.24 ? 133  ALA B C   1 
ATOM   5028  O  O   . ALA B 2 130 ? 2.504   25.899  23.485  1.00 36.09 ? 133  ALA B O   1 
ATOM   5029  C  CB  . ALA B 2 130 ? 4.664   23.791  24.323  1.00 36.27 ? 133  ALA B CB  1 
ATOM   5030  N  N   . VAL B 2 131 ? 1.377   24.087  24.240  1.00 36.14 ? 134  VAL B N   1 
ATOM   5031  C  CA  . VAL B 2 131 ? 0.200   24.835  24.668  1.00 36.09 ? 134  VAL B CA  1 
ATOM   5032  C  C   . VAL B 2 131 ? -0.086  24.618  26.146  1.00 36.12 ? 134  VAL B C   1 
ATOM   5033  O  O   . VAL B 2 131 ? -0.162  23.483  26.615  1.00 36.01 ? 134  VAL B O   1 
ATOM   5034  C  CB  . VAL B 2 131 ? -1.075  24.386  23.905  1.00 36.20 ? 134  VAL B CB  1 
ATOM   5035  C  CG1 . VAL B 2 131 ? -2.200  25.378  24.154  1.00 36.07 ? 134  VAL B CG1 1 
ATOM   5036  C  CG2 . VAL B 2 131 ? -0.798  24.223  22.411  1.00 35.97 ? 134  VAL B CG2 1 
ATOM   5037  N  N   . LYS B 2 132 ? -0.266  25.711  26.874  1.00 36.07 ? 135  LYS B N   1 
ATOM   5038  C  CA  . LYS B 2 132 ? -0.578  25.635  28.293  1.00 36.07 ? 135  LYS B CA  1 
ATOM   5039  C  C   . LYS B 2 132 ? -2.010  26.111  28.466  1.00 36.29 ? 135  LYS B C   1 
ATOM   5040  O  O   . LYS B 2 132 ? -2.326  27.257  28.134  1.00 36.24 ? 135  LYS B O   1 
ATOM   5041  C  CB  . LYS B 2 132 ? 0.366   26.527  29.105  1.00 35.89 ? 135  LYS B CB  1 
ATOM   5042  C  CG  . LYS B 2 132 ? 0.030   26.599  30.598  1.00 35.59 ? 135  LYS B CG  1 
ATOM   5043  C  CD  . LYS B 2 132 ? 1.011   27.473  31.379  1.00 35.38 ? 135  LYS B CD  1 
ATOM   5044  C  CE  . LYS B 2 132 ? 2.427   26.912  31.363  1.00 35.27 ? 135  LYS B CE  1 
ATOM   5045  N  NZ  . LYS B 2 132 ? 2.511   25.536  31.939  1.00 35.27 ? 135  LYS B NZ  1 
ATOM   5046  N  N   . PHE B 2 133 ? -2.878  25.213  28.927  1.00 36.46 ? 136  PHE B N   1 
ATOM   5047  C  CA  . PHE B 2 133 ? -4.287  25.531  29.159  1.00 36.67 ? 136  PHE B CA  1 
ATOM   5048  C  C   . PHE B 2 133 ? -4.490  25.786  30.643  1.00 37.05 ? 136  PHE B C   1 
ATOM   5049  O  O   . PHE B 2 133 ? -4.287  24.883  31.452  1.00 37.12 ? 136  PHE B O   1 
ATOM   5050  C  CB  . PHE B 2 133 ? -5.176  24.348  28.788  1.00 36.49 ? 136  PHE B CB  1 
ATOM   5051  C  CG  . PHE B 2 133 ? -5.081  23.928  27.358  1.00 36.39 ? 136  PHE B CG  1 
ATOM   5052  C  CD1 . PHE B 2 133 ? -4.078  23.071  26.940  1.00 36.23 ? 136  PHE B CD1 1 
ATOM   5053  C  CD2 . PHE B 2 133 ? -6.043  24.331  26.441  1.00 36.31 ? 136  PHE B CD2 1 
ATOM   5054  C  CE1 . PHE B 2 133 ? -4.034  22.610  25.627  1.00 36.26 ? 136  PHE B CE1 1 
ATOM   5055  C  CE2 . PHE B 2 133 ? -6.010  23.880  25.131  1.00 36.29 ? 136  PHE B CE2 1 
ATOM   5056  C  CZ  . PHE B 2 133 ? -5.002  23.015  24.721  1.00 36.27 ? 136  PHE B CZ  1 
ATOM   5057  N  N   . TYR B 2 134 ? -4.898  26.992  31.014  1.00 37.25 ? 137  TYR B N   1 
ATOM   5058  C  CA  . TYR B 2 134 ? -5.123  27.293  32.424  1.00 37.63 ? 137  TYR B CA  1 
ATOM   5059  C  C   . TYR B 2 134 ? -6.555  26.919  32.815  1.00 38.00 ? 137  TYR B C   1 
ATOM   5060  O  O   . TYR B 2 134 ? -7.435  27.777  32.890  1.00 37.92 ? 137  TYR B O   1 
ATOM   5061  C  CB  . TYR B 2 134 ? -4.880  28.774  32.692  1.00 37.62 ? 137  TYR B CB  1 
ATOM   5062  C  CG  . TYR B 2 134 ? -3.498  29.261  32.324  1.00 37.64 ? 137  TYR B CG  1 
ATOM   5063  C  CD1 . TYR B 2 134 ? -2.470  29.266  33.260  1.00 37.67 ? 137  TYR B CD1 1 
ATOM   5064  C  CD2 . TYR B 2 134 ? -3.231  29.771  31.055  1.00 37.63 ? 137  TYR B CD2 1 
ATOM   5065  C  CE1 . TYR B 2 134 ? -1.205  29.777  32.945  1.00 37.79 ? 137  TYR B CE1 1 
ATOM   5066  C  CE2 . TYR B 2 134 ? -1.969  30.284  30.730  1.00 37.70 ? 137  TYR B CE2 1 
ATOM   5067  C  CZ  . TYR B 2 134 ? -0.965  30.285  31.682  1.00 37.72 ? 137  TYR B CZ  1 
ATOM   5068  O  OH  . TYR B 2 134 ? 0.268   30.811  31.389  1.00 37.59 ? 137  TYR B OH  1 
ATOM   5069  N  N   . THR B 2 135 ? -6.783  25.641  33.086  1.00 38.38 ? 138  THR B N   1 
ATOM   5070  C  CA  . THR B 2 135 ? -8.119  25.182  33.433  1.00 38.94 ? 138  THR B CA  1 
ATOM   5071  C  C   . THR B 2 135 ? -8.445  25.293  34.920  1.00 39.66 ? 138  THR B C   1 
ATOM   5072  O  O   . THR B 2 135 ? -7.563  25.535  35.749  1.00 39.59 ? 138  THR B O   1 
ATOM   5073  C  CB  . THR B 2 135 ? -8.356  23.724  32.967  1.00 38.89 ? 138  THR B CB  1 
ATOM   5074  O  OG1 . THR B 2 135 ? -8.027  22.811  34.023  1.00 38.79 ? 138  THR B OG1 1 
ATOM   5075  C  CG2 . THR B 2 135 ? -7.498  23.406  31.756  1.00 38.66 ? 138  THR B CG2 1 
ATOM   5076  N  N   . GLU B 2 136 ? -9.720  25.094  35.248  1.00 40.14 ? 139  GLU B N   1 
ATOM   5077  C  CA  . GLU B 2 136 ? -10.185 25.158  36.628  1.00 40.70 ? 139  GLU B CA  1 
ATOM   5078  C  C   . GLU B 2 136 ? -9.664  23.958  37.388  1.00 40.60 ? 139  GLU B C   1 
ATOM   5079  O  O   . GLU B 2 136 ? -9.636  23.947  38.620  1.00 40.78 ? 139  GLU B O   1 
ATOM   5080  C  CB  . GLU B 2 136 ? -11.706 25.165  36.677  1.00 41.55 ? 139  GLU B CB  1 
ATOM   5081  C  CG  . GLU B 2 136 ? -12.335 26.261  35.838  1.00 42.87 ? 139  GLU B CG  1 
ATOM   5082  C  CD  . GLU B 2 136 ? -12.965 25.728  34.558  1.00 43.70 ? 139  GLU B CD  1 
ATOM   5083  O  OE1 . GLU B 2 136 ? -14.212 25.826  34.471  1.00 43.84 ? 139  GLU B OE1 1 
ATOM   5084  O  OE2 . GLU B 2 136 ? -12.223 25.222  33.657  1.00 43.88 ? 139  GLU B OE2 1 
ATOM   5085  N  N   . ASP B 2 137 ? -9.308  22.919  36.645  1.00 40.29 ? 140  ASP B N   1 
ATOM   5086  C  CA  . ASP B 2 137 ? -8.761  21.719  37.244  1.00 39.92 ? 140  ASP B CA  1 
ATOM   5087  C  C   . ASP B 2 137 ? -7.244  21.749  37.123  1.00 39.64 ? 140  ASP B C   1 
ATOM   5088  O  O   . ASP B 2 137 ? -6.594  20.708  37.017  1.00 39.56 ? 140  ASP B O   1 
ATOM   5089  C  CB  . ASP B 2 137 ? -9.335  20.474  36.573  1.00 40.15 ? 140  ASP B CB  1 
ATOM   5090  C  CG  . ASP B 2 137 ? -10.558 19.930  37.294  1.00 40.37 ? 140  ASP B CG  1 
ATOM   5091  O  OD1 . ASP B 2 137 ? -11.158 18.965  36.782  1.00 40.60 ? 140  ASP B OD1 1 
ATOM   5092  O  OD2 . ASP B 2 137 ? -10.917 20.449  38.375  1.00 40.71 ? 140  ASP B OD2 1 
ATOM   5093  N  N   . GLY B 2 138 ? -6.685  22.956  37.158  1.00 39.24 ? 141  GLY B N   1 
ATOM   5094  C  CA  . GLY B 2 138 ? -5.249  23.109  37.060  1.00 38.74 ? 141  GLY B CA  1 
ATOM   5095  C  C   . GLY B 2 138 ? -4.771  23.249  35.636  1.00 38.45 ? 141  GLY B C   1 
ATOM   5096  O  O   . GLY B 2 138 ? -5.568  23.247  34.702  1.00 38.27 ? 141  GLY B O   1 
ATOM   5097  N  N   . ASN B 2 139 ? -3.459  23.366  35.473  1.00 38.24 ? 142  ASN B N   1 
ATOM   5098  C  CA  . ASN B 2 139 ? -2.860  23.515  34.161  1.00 38.01 ? 142  ASN B CA  1 
ATOM   5099  C  C   . ASN B 2 139 ? -2.729  22.213  33.397  1.00 37.91 ? 142  ASN B C   1 
ATOM   5100  O  O   . ASN B 2 139 ? -2.399  21.169  33.961  1.00 37.87 ? 142  ASN B O   1 
ATOM   5101  C  CB  . ASN B 2 139 ? -1.483  24.173  34.270  1.00 38.07 ? 142  ASN B CB  1 
ATOM   5102  C  CG  . ASN B 2 139 ? -1.567  25.648  34.607  1.00 38.23 ? 142  ASN B CG  1 
ATOM   5103  O  OD1 . ASN B 2 139 ? -2.648  26.238  34.601  1.00 38.53 ? 142  ASN B OD1 1 
ATOM   5104  N  ND2 . ASN B 2 139 ? -0.422  26.254  34.901  1.00 38.33 ? 142  ASN B ND2 1 
ATOM   5105  N  N   . TRP B 2 140 ? -3.022  22.290  32.103  1.00 37.81 ? 143  TRP B N   1 
ATOM   5106  C  CA  . TRP B 2 140 ? -2.905  21.155  31.209  1.00 37.66 ? 143  TRP B CA  1 
ATOM   5107  C  C   . TRP B 2 140 ? -1.929  21.580  30.132  1.00 37.50 ? 143  TRP B C   1 
ATOM   5108  O  O   . TRP B 2 140 ? -2.191  22.517  29.374  1.00 37.42 ? 143  TRP B O   1 
ATOM   5109  C  CB  . TRP B 2 140 ? -4.248  20.794  30.579  1.00 37.84 ? 143  TRP B CB  1 
ATOM   5110  C  CG  . TRP B 2 140 ? -4.129  19.764  29.483  1.00 38.07 ? 143  TRP B CG  1 
ATOM   5111  C  CD1 . TRP B 2 140 ? -3.244  18.726  29.423  1.00 38.05 ? 143  TRP B CD1 1 
ATOM   5112  C  CD2 . TRP B 2 140 ? -4.900  19.703  28.279  1.00 38.13 ? 143  TRP B CD2 1 
ATOM   5113  N  NE1 . TRP B 2 140 ? -3.412  18.027  28.252  1.00 38.15 ? 143  TRP B NE1 1 
ATOM   5114  C  CE2 . TRP B 2 140 ? -4.423  18.604  27.533  1.00 38.19 ? 143  TRP B CE2 1 
ATOM   5115  C  CE3 . TRP B 2 140 ? -5.948  20.474  27.757  1.00 38.13 ? 143  TRP B CE3 1 
ATOM   5116  C  CZ2 . TRP B 2 140 ? -4.956  18.252  26.293  1.00 38.32 ? 143  TRP B CZ2 1 
ATOM   5117  C  CZ3 . TRP B 2 140 ? -6.478  20.127  26.527  1.00 38.28 ? 143  TRP B CZ3 1 
ATOM   5118  C  CH2 . TRP B 2 140 ? -5.980  19.024  25.807  1.00 38.41 ? 143  TRP B CH2 1 
ATOM   5119  N  N   . ASP B 2 141 ? -0.784  20.908  30.102  1.00 37.29 ? 144  ASP B N   1 
ATOM   5120  C  CA  . ASP B 2 141 ? 0.243   21.209  29.124  1.00 36.99 ? 144  ASP B CA  1 
ATOM   5121  C  C   . ASP B 2 141 ? 0.266   20.170  28.028  1.00 37.02 ? 144  ASP B C   1 
ATOM   5122  O  O   . ASP B 2 141 ? 0.512   18.990  28.281  1.00 36.92 ? 144  ASP B O   1 
ATOM   5123  C  CB  . ASP B 2 141 ? 1.620   21.269  29.784  1.00 36.73 ? 144  ASP B CB  1 
ATOM   5124  C  CG  . ASP B 2 141 ? 1.774   22.452  30.708  1.00 36.54 ? 144  ASP B CG  1 
ATOM   5125  O  OD1 . ASP B 2 141 ? 2.382   22.293  31.784  1.00 36.58 ? 144  ASP B OD1 1 
ATOM   5126  O  OD2 . ASP B 2 141 ? 1.304   23.550  30.358  1.00 36.43 ? 144  ASP B OD2 1 
ATOM   5127  N  N   . LEU B 2 142 ? -0.065  20.605  26.819  1.00 36.90 ? 145  LEU B N   1 
ATOM   5128  C  CA  . LEU B 2 142 ? -0.033  19.742  25.655  1.00 36.86 ? 145  LEU B CA  1 
ATOM   5129  C  C   . LEU B 2 142 ? 1.244   20.180  24.938  1.00 37.07 ? 145  LEU B C   1 
ATOM   5130  O  O   . LEU B 2 142 ? 1.249   21.164  24.195  1.00 37.14 ? 145  LEU B O   1 
ATOM   5131  C  CB  . LEU B 2 142 ? -1.259  19.979  24.782  1.00 36.60 ? 145  LEU B CB  1 
ATOM   5132  C  CG  . LEU B 2 142 ? -1.352  19.116  23.521  1.00 36.45 ? 145  LEU B CG  1 
ATOM   5133  C  CD1 . LEU B 2 142 ? -1.230  17.643  23.876  1.00 36.28 ? 145  LEU B CD1 1 
ATOM   5134  C  CD2 . LEU B 2 142 ? -2.658  19.391  22.809  1.00 36.24 ? 145  LEU B CD2 1 
ATOM   5135  N  N   . VAL B 2 143 ? 2.341   19.486  25.227  1.00 37.21 ? 146  VAL B N   1 
ATOM   5136  C  CA  . VAL B 2 143 ? 3.636   19.827  24.656  1.00 37.24 ? 146  VAL B CA  1 
ATOM   5137  C  C   . VAL B 2 143 ? 3.863   19.167  23.303  1.00 37.60 ? 146  VAL B C   1 
ATOM   5138  O  O   . VAL B 2 143 ? 4.516   18.129  23.206  1.00 37.53 ? 146  VAL B O   1 
ATOM   5139  C  CB  . VAL B 2 143 ? 4.770   19.465  25.635  1.00 37.07 ? 146  VAL B CB  1 
ATOM   5140  C  CG1 . VAL B 2 143 ? 6.059   20.129  25.212  1.00 36.79 ? 146  VAL B CG1 1 
ATOM   5141  C  CG2 . VAL B 2 143 ? 4.391   19.882  27.049  1.00 36.67 ? 146  VAL B CG2 1 
ATOM   5142  N  N   . GLY B 2 144 ? 3.359   19.801  22.251  1.00 37.80 ? 147  GLY B N   1 
ATOM   5143  C  CA  . GLY B 2 144 ? 3.504   19.231  20.930  1.00 38.25 ? 147  GLY B CA  1 
ATOM   5144  C  C   . GLY B 2 144 ? 4.535   19.847  20.003  1.00 38.60 ? 147  GLY B C   1 
ATOM   5145  O  O   . GLY B 2 144 ? 5.395   20.624  20.414  1.00 38.58 ? 147  GLY B O   1 
ATOM   5146  N  N   . ASN B 2 145 ? 4.440   19.463  18.732  1.00 38.97 ? 148  ASN B N   1 
ATOM   5147  C  CA  . ASN B 2 145 ? 5.320   19.941  17.685  1.00 39.41 ? 148  ASN B CA  1 
ATOM   5148  C  C   . ASN B 2 145 ? 4.603   19.889  16.344  1.00 39.20 ? 148  ASN B C   1 
ATOM   5149  O  O   . ASN B 2 145 ? 3.435   19.519  16.283  1.00 38.99 ? 148  ASN B O   1 
ATOM   5150  C  CB  . ASN B 2 145 ? 6.580   19.099  17.636  1.00 40.35 ? 148  ASN B CB  1 
ATOM   5151  C  CG  . ASN B 2 145 ? 6.297   17.645  17.436  1.00 41.15 ? 148  ASN B CG  1 
ATOM   5152  O  OD1 . ASN B 2 145 ? 5.161   17.191  17.595  1.00 42.24 ? 148  ASN B OD1 1 
ATOM   5153  N  ND2 . ASN B 2 145 ? 7.333   16.887  17.113  1.00 41.88 ? 148  ASN B ND2 1 
ATOM   5154  N  N   . ASN B 2 146 ? 5.323   20.194  15.266  1.00 39.05 ? 149  ASN B N   1 
ATOM   5155  C  CA  . ASN B 2 146 ? 4.729   20.223  13.933  1.00 38.88 ? 149  ASN B CA  1 
ATOM   5156  C  C   . ASN B 2 146 ? 4.697   18.918  13.145  1.00 38.58 ? 149  ASN B C   1 
ATOM   5157  O  O   . ASN B 2 146 ? 4.447   18.926  11.943  1.00 38.72 ? 149  ASN B O   1 
ATOM   5158  C  CB  . ASN B 2 146 ? 5.390   21.313  13.097  1.00 38.84 ? 149  ASN B CB  1 
ATOM   5159  C  CG  . ASN B 2 146 ? 6.826   21.007  12.776  1.00 38.86 ? 149  ASN B CG  1 
ATOM   5160  O  OD1 . ASN B 2 146 ? 7.364   21.504  11.784  1.00 39.18 ? 149  ASN B OD1 1 
ATOM   5161  N  ND2 . ASN B 2 146 ? 7.464   20.185  13.608  1.00 38.62 ? 149  ASN B ND2 1 
ATOM   5162  N  N   . THR B 2 147 ? 4.935   17.805  13.826  1.00 38.34 ? 150  THR B N   1 
ATOM   5163  C  CA  . THR B 2 147 ? 4.926   16.490  13.196  1.00 38.03 ? 150  THR B CA  1 
ATOM   5164  C  C   . THR B 2 147 ? 4.167   15.536  14.109  1.00 37.74 ? 150  THR B C   1 
ATOM   5165  O  O   . THR B 2 147 ? 4.160   15.710  15.327  1.00 37.67 ? 150  THR B O   1 
ATOM   5166  C  CB  . THR B 2 147 ? 6.364   15.956  12.996  1.00 38.03 ? 150  THR B CB  1 
ATOM   5167  O  OG1 . THR B 2 147 ? 6.323   14.605  12.528  1.00 37.79 ? 150  THR B OG1 1 
ATOM   5168  C  CG2 . THR B 2 147 ? 7.140   15.998  14.298  1.00 37.88 ? 150  THR B CG2 1 
ATOM   5169  N  N   . PRO B 2 148 ? 3.451   14.558  13.530  1.00 37.40 ? 151  PRO B N   1 
ATOM   5170  C  CA  . PRO B 2 148 ? 2.703   13.606  14.357  1.00 37.13 ? 151  PRO B CA  1 
ATOM   5171  C  C   . PRO B 2 148 ? 3.565   12.486  14.946  1.00 36.84 ? 151  PRO B C   1 
ATOM   5172  O  O   . PRO B 2 148 ? 3.118   11.749  15.813  1.00 36.87 ? 151  PRO B O   1 
ATOM   5173  C  CB  . PRO B 2 148 ? 1.671   13.056  13.375  1.00 37.18 ? 151  PRO B CB  1 
ATOM   5174  C  CG  . PRO B 2 148 ? 2.401   13.082  12.076  1.00 37.18 ? 151  PRO B CG  1 
ATOM   5175  C  CD  . PRO B 2 148 ? 3.077   14.432  12.108  1.00 37.35 ? 151  PRO B CD  1 
ATOM   5176  N  N   . ILE B 2 149 ? 4.816   12.393  14.509  1.00 36.63 ? 152  ILE B N   1 
ATOM   5177  C  CA  . ILE B 2 149 ? 5.727   11.341  14.963  1.00 36.45 ? 152  ILE B CA  1 
ATOM   5178  C  C   . ILE B 2 149 ? 7.073   11.887  15.442  1.00 36.39 ? 152  ILE B C   1 
ATOM   5179  O  O   . ILE B 2 149 ? 7.298   13.096  15.446  1.00 36.38 ? 152  ILE B O   1 
ATOM   5180  C  CB  . ILE B 2 149 ? 6.028   10.361  13.813  1.00 36.19 ? 152  ILE B CB  1 
ATOM   5181  C  CG1 . ILE B 2 149 ? 6.450   11.154  12.578  1.00 36.07 ? 152  ILE B CG1 1 
ATOM   5182  C  CG2 . ILE B 2 149 ? 4.826   9.497   13.508  1.00 35.97 ? 152  ILE B CG2 1 
ATOM   5183  C  CD1 . ILE B 2 149 ? 6.892   10.315  11.431  1.00 36.07 ? 152  ILE B CD1 1 
ATOM   5184  N  N   . PHE B 2 150 ? 7.970   10.977  15.816  1.00 36.17 ? 153  PHE B N   1 
ATOM   5185  C  CA  . PHE B 2 150 ? 9.303   11.343  16.272  1.00 35.86 ? 153  PHE B CA  1 
ATOM   5186  C  C   . PHE B 2 150 ? 10.347  10.343  15.770  1.00 35.83 ? 153  PHE B C   1 
ATOM   5187  O  O   . PHE B 2 150 ? 10.003  9.281   15.240  1.00 35.60 ? 153  PHE B O   1 
ATOM   5188  C  CB  . PHE B 2 150 ? 9.348   11.450  17.792  1.00 35.86 ? 153  PHE B CB  1 
ATOM   5189  C  CG  . PHE B 2 150 ? 10.523  12.219  18.295  1.00 36.01 ? 153  PHE B CG  1 
ATOM   5190  C  CD1 . PHE B 2 150 ? 11.520  11.596  19.027  1.00 36.00 ? 153  PHE B CD1 1 
ATOM   5191  C  CD2 . PHE B 2 150 ? 10.653  13.572  18.003  1.00 36.05 ? 153  PHE B CD2 1 
ATOM   5192  C  CE1 . PHE B 2 150 ? 12.639  12.309  19.463  1.00 36.00 ? 153  PHE B CE1 1 
ATOM   5193  C  CE2 . PHE B 2 150 ? 11.766  14.294  18.432  1.00 36.11 ? 153  PHE B CE2 1 
ATOM   5194  C  CZ  . PHE B 2 150 ? 12.761  13.660  19.164  1.00 36.06 ? 153  PHE B CZ  1 
ATOM   5195  N  N   . PHE B 2 151 ? 11.621  10.680  15.962  1.00 35.74 ? 154  PHE B N   1 
ATOM   5196  C  CA  . PHE B 2 151 ? 12.738  9.855   15.501  1.00 35.62 ? 154  PHE B CA  1 
ATOM   5197  C  C   . PHE B 2 151 ? 12.937  8.513   16.189  1.00 35.87 ? 154  PHE B C   1 
ATOM   5198  O  O   . PHE B 2 151 ? 13.449  7.580   15.581  1.00 35.94 ? 154  PHE B O   1 
ATOM   5199  C  CB  . PHE B 2 151 ? 14.055  10.630  15.609  1.00 35.36 ? 154  PHE B CB  1 
ATOM   5200  C  CG  . PHE B 2 151 ? 14.053  11.946  14.893  1.00 35.19 ? 154  PHE B CG  1 
ATOM   5201  C  CD1 . PHE B 2 151 ? 13.673  13.106  15.552  1.00 34.96 ? 154  PHE B CD1 1 
ATOM   5202  C  CD2 . PHE B 2 151 ? 14.455  12.034  13.569  1.00 35.11 ? 154  PHE B CD2 1 
ATOM   5203  C  CE1 . PHE B 2 151 ? 13.695  14.331  14.908  1.00 34.91 ? 154  PHE B CE1 1 
ATOM   5204  C  CE2 . PHE B 2 151 ? 14.479  13.266  12.912  1.00 35.06 ? 154  PHE B CE2 1 
ATOM   5205  C  CZ  . PHE B 2 151 ? 14.100  14.413  13.584  1.00 34.97 ? 154  PHE B CZ  1 
ATOM   5206  N  N   . ILE B 2 152 ? 12.578  8.419   17.461  1.00 35.88 ? 155  ILE B N   1 
ATOM   5207  C  CA  . ILE B 2 152 ? 12.783  7.184   18.215  1.00 35.81 ? 155  ILE B CA  1 
ATOM   5208  C  C   . ILE B 2 152 ? 11.544  6.758   18.999  1.00 35.96 ? 155  ILE B C   1 
ATOM   5209  O  O   . ILE B 2 152 ? 10.627  7.552   19.203  1.00 35.83 ? 155  ILE B O   1 
ATOM   5210  C  CB  . ILE B 2 152 ? 13.987  7.336   19.171  1.00 35.80 ? 155  ILE B CB  1 
ATOM   5211  C  CG1 . ILE B 2 152 ? 13.826  8.616   19.996  1.00 35.72 ? 155  ILE B CG1 1 
ATOM   5212  C  CG2 . ILE B 2 152 ? 15.296  7.377   18.373  1.00 35.47 ? 155  ILE B CG2 1 
ATOM   5213  C  CD1 . ILE B 2 152 ? 14.838  8.779   21.086  1.00 35.86 ? 155  ILE B CD1 1 
ATOM   5214  N  N   . ARG B 2 153 ? 11.527  5.506   19.454  1.00 36.18 ? 156  ARG B N   1 
ATOM   5215  C  CA  . ARG B 2 153 ? 10.374  4.983   20.184  1.00 36.25 ? 156  ARG B CA  1 
ATOM   5216  C  C   . ARG B 2 153 ? 10.616  4.567   21.637  1.00 36.20 ? 156  ARG B C   1 
ATOM   5217  O  O   . ARG B 2 153 ? 9.715   4.040   22.295  1.00 36.04 ? 156  ARG B O   1 
ATOM   5218  C  CB  . ARG B 2 153 ? 9.729   3.842   19.394  1.00 36.18 ? 156  ARG B CB  1 
ATOM   5219  C  CG  . ARG B 2 153 ? 10.674  2.718   19.048  1.00 36.28 ? 156  ARG B CG  1 
ATOM   5220  C  CD  . ARG B 2 153 ? 9.949   1.626   18.296  1.00 36.36 ? 156  ARG B CD  1 
ATOM   5221  N  NE  . ARG B 2 153 ? 9.600   2.036   16.940  1.00 36.56 ? 156  ARG B NE  1 
ATOM   5222  C  CZ  . ARG B 2 153 ? 10.196  1.571   15.847  1.00 36.62 ? 156  ARG B CZ  1 
ATOM   5223  N  NH1 . ARG B 2 153 ? 11.171  0.677   15.948  1.00 36.57 ? 156  ARG B NH1 1 
ATOM   5224  N  NH2 . ARG B 2 153 ? 9.814   1.996   14.651  1.00 36.50 ? 156  ARG B NH2 1 
ATOM   5225  N  N   . ASP B 2 154 ? 11.826  4.811   22.133  1.00 36.13 ? 157  ASP B N   1 
ATOM   5226  C  CA  . ASP B 2 154 ? 12.178  4.501   23.515  1.00 36.10 ? 157  ASP B CA  1 
ATOM   5227  C  C   . ASP B 2 154 ? 12.940  5.708   24.053  1.00 36.07 ? 157  ASP B C   1 
ATOM   5228  O  O   . ASP B 2 154 ? 13.947  6.120   23.471  1.00 36.16 ? 157  ASP B O   1 
ATOM   5229  C  CB  . ASP B 2 154 ? 13.050  3.259   23.588  1.00 36.09 ? 157  ASP B CB  1 
ATOM   5230  C  CG  . ASP B 2 154 ? 13.298  2.813   25.013  1.00 36.28 ? 157  ASP B CG  1 
ATOM   5231  O  OD1 . ASP B 2 154 ? 12.882  1.689   25.365  1.00 36.48 ? 157  ASP B OD1 1 
ATOM   5232  O  OD2 . ASP B 2 154 ? 13.903  3.584   25.787  1.00 36.40 ? 157  ASP B OD2 1 
ATOM   5233  N  N   . PRO B 2 155 ? 12.502  6.259   25.202  1.00 36.00 ? 158  PRO B N   1 
ATOM   5234  C  CA  . PRO B 2 155 ? 13.098  7.435   25.862  1.00 35.78 ? 158  PRO B CA  1 
ATOM   5235  C  C   . PRO B 2 155 ? 14.577  7.386   26.272  1.00 35.76 ? 158  PRO B C   1 
ATOM   5236  O  O   . PRO B 2 155 ? 15.243  8.425   26.318  1.00 35.52 ? 158  PRO B O   1 
ATOM   5237  C  CB  . PRO B 2 155 ? 12.181  7.641   27.065  1.00 35.76 ? 158  PRO B CB  1 
ATOM   5238  C  CG  . PRO B 2 155 ? 11.750  6.248   27.392  1.00 35.76 ? 158  PRO B CG  1 
ATOM   5239  C  CD  . PRO B 2 155 ? 11.427  5.691   26.035  1.00 35.76 ? 158  PRO B CD  1 
ATOM   5240  N  N   . ILE B 2 156 ? 15.094  6.189   26.537  1.00 35.50 ? 159  ILE B N   1 
ATOM   5241  C  CA  . ILE B 2 156 ? 16.477  6.035   26.955  1.00 35.37 ? 159  ILE B CA  1 
ATOM   5242  C  C   . ILE B 2 156 ? 17.490  6.422   25.879  1.00 35.22 ? 159  ILE B C   1 
ATOM   5243  O  O   . ILE B 2 156 ? 18.681  6.555   26.158  1.00 35.28 ? 159  ILE B O   1 
ATOM   5244  C  CB  . ILE B 2 156 ? 16.739  4.606   27.445  1.00 35.40 ? 159  ILE B CB  1 
ATOM   5245  C  CG1 . ILE B 2 156 ? 17.860  4.603   28.485  1.00 35.51 ? 159  ILE B CG1 1 
ATOM   5246  C  CG2 . ILE B 2 156 ? 17.096  3.712   26.277  1.00 35.45 ? 159  ILE B CG2 1 
ATOM   5247  C  CD1 . ILE B 2 156 ? 17.955  3.306   29.281  1.00 35.49 ? 159  ILE B CD1 1 
ATOM   5248  N  N   . LEU B 2 157 ? 17.028  6.583   24.644  1.00 35.13 ? 160  LEU B N   1 
ATOM   5249  C  CA  . LEU B 2 157 ? 17.923  6.974   23.563  1.00 34.90 ? 160  LEU B CA  1 
ATOM   5250  C  C   . LEU B 2 157 ? 17.838  8.463   23.292  1.00 34.77 ? 160  LEU B C   1 
ATOM   5251  O  O   . LEU B 2 157 ? 18.613  8.997   22.501  1.00 34.54 ? 160  LEU B O   1 
ATOM   5252  C  CB  . LEU B 2 157 ? 17.595  6.225   22.278  1.00 35.10 ? 160  LEU B CB  1 
ATOM   5253  C  CG  . LEU B 2 157 ? 18.014  4.766   22.154  1.00 35.46 ? 160  LEU B CG  1 
ATOM   5254  C  CD1 . LEU B 2 157 ? 16.783  3.884   22.178  1.00 35.78 ? 160  LEU B CD1 1 
ATOM   5255  C  CD2 . LEU B 2 157 ? 18.753  4.576   20.846  1.00 35.71 ? 160  LEU B CD2 1 
ATOM   5256  N  N   . PHE B 2 158 ? 16.893  9.135   23.942  1.00 34.73 ? 161  PHE B N   1 
ATOM   5257  C  CA  . PHE B 2 158 ? 16.724  10.559  23.727  1.00 34.67 ? 161  PHE B CA  1 
ATOM   5258  C  C   . PHE B 2 158 ? 17.977  11.388  23.978  1.00 34.66 ? 161  PHE B C   1 
ATOM   5259  O  O   . PHE B 2 158 ? 18.344  12.200  23.133  1.00 34.72 ? 161  PHE B O   1 
ATOM   5260  C  CB  . PHE B 2 158 ? 15.557  11.112  24.525  1.00 34.93 ? 161  PHE B CB  1 
ATOM   5261  C  CG  . PHE B 2 158 ? 15.212  12.527  24.160  1.00 35.34 ? 161  PHE B CG  1 
ATOM   5262  C  CD1 . PHE B 2 158 ? 15.565  13.582  24.987  1.00 35.45 ? 161  PHE B CD1 1 
ATOM   5263  C  CD2 . PHE B 2 158 ? 14.535  12.805  22.979  1.00 35.45 ? 161  PHE B CD2 1 
ATOM   5264  C  CE1 . PHE B 2 158 ? 15.244  14.892  24.639  1.00 35.57 ? 161  PHE B CE1 1 
ATOM   5265  C  CE2 . PHE B 2 158 ? 14.214  14.110  22.630  1.00 35.46 ? 161  PHE B CE2 1 
ATOM   5266  C  CZ  . PHE B 2 158 ? 14.567  15.151  23.461  1.00 35.48 ? 161  PHE B CZ  1 
ATOM   5267  N  N   . PRO B 2 159 ? 18.626  11.234  25.148  1.00 34.51 ? 162  PRO B N   1 
ATOM   5268  C  CA  . PRO B 2 159 ? 19.840  12.014  25.410  1.00 34.44 ? 162  PRO B CA  1 
ATOM   5269  C  C   . PRO B 2 159 ? 20.882  11.815  24.308  1.00 34.43 ? 162  PRO B C   1 
ATOM   5270  O  O   . PRO B 2 159 ? 21.507  12.775  23.854  1.00 34.39 ? 162  PRO B O   1 
ATOM   5271  C  CB  . PRO B 2 159 ? 20.314  11.444  26.738  1.00 34.49 ? 162  PRO B CB  1 
ATOM   5272  C  CG  . PRO B 2 159 ? 19.035  11.146  27.428  1.00 34.42 ? 162  PRO B CG  1 
ATOM   5273  C  CD  . PRO B 2 159 ? 18.248  10.457  26.342  1.00 34.47 ? 162  PRO B CD  1 
ATOM   5274  N  N   . SER B 2 160 ? 21.031  10.572  23.850  1.00 34.56 ? 163  SER B N   1 
ATOM   5275  C  CA  . SER B 2 160 ? 21.982  10.251  22.786  1.00 34.53 ? 163  SER B CA  1 
ATOM   5276  C  C   . SER B 2 160 ? 21.575  10.884  21.462  1.00 34.60 ? 163  SER B C   1 
ATOM   5277  O  O   . SER B 2 160 ? 22.420  11.423  20.740  1.00 34.62 ? 163  SER B O   1 
ATOM   5278  C  CB  . SER B 2 160 ? 22.105  8.738   22.606  1.00 34.27 ? 163  SER B CB  1 
ATOM   5279  O  OG  . SER B 2 160 ? 22.827  8.152   23.670  1.00 34.36 ? 163  SER B OG  1 
ATOM   5280  N  N   . PHE B 2 161 ? 20.289  10.800  21.131  1.00 34.51 ? 164  PHE B N   1 
ATOM   5281  C  CA  . PHE B 2 161 ? 19.807  11.385  19.894  1.00 34.56 ? 164  PHE B CA  1 
ATOM   5282  C  C   . PHE B 2 161 ? 20.094  12.883  19.882  1.00 34.59 ? 164  PHE B C   1 
ATOM   5283  O  O   . PHE B 2 161 ? 20.582  13.425  18.889  1.00 34.62 ? 164  PHE B O   1 
ATOM   5284  C  CB  . PHE B 2 161 ? 18.305  11.160  19.721  1.00 34.56 ? 164  PHE B CB  1 
ATOM   5285  C  CG  . PHE B 2 161 ? 17.713  11.965  18.606  1.00 34.53 ? 164  PHE B CG  1 
ATOM   5286  C  CD1 . PHE B 2 161 ? 16.693  12.866  18.853  1.00 34.53 ? 164  PHE B CD1 1 
ATOM   5287  C  CD2 . PHE B 2 161 ? 18.242  11.886  17.328  1.00 34.37 ? 164  PHE B CD2 1 
ATOM   5288  C  CE1 . PHE B 2 161 ? 16.219  13.681  17.845  1.00 34.57 ? 164  PHE B CE1 1 
ATOM   5289  C  CE2 . PHE B 2 161 ? 17.774  12.695  16.316  1.00 34.55 ? 164  PHE B CE2 1 
ATOM   5290  C  CZ  . PHE B 2 161 ? 16.764  13.595  16.573  1.00 34.67 ? 164  PHE B CZ  1 
ATOM   5291  N  N   . ILE B 2 162 ? 19.777  13.547  20.985  1.00 34.36 ? 165  ILE B N   1 
ATOM   5292  C  CA  . ILE B 2 162 ? 20.001  14.979  21.103  1.00 34.24 ? 165  ILE B CA  1 
ATOM   5293  C  C   . ILE B 2 162 ? 21.481  15.320  20.979  1.00 34.60 ? 165  ILE B C   1 
ATOM   5294  O  O   . ILE B 2 162 ? 21.845  16.277  20.293  1.00 34.41 ? 165  ILE B O   1 
ATOM   5295  C  CB  . ILE B 2 162 ? 19.401  15.519  22.420  1.00 34.19 ? 165  ILE B CB  1 
ATOM   5296  C  CG1 . ILE B 2 162 ? 17.880  15.399  22.360  1.00 33.88 ? 165  ILE B CG1 1 
ATOM   5297  C  CG2 . ILE B 2 162 ? 19.804  16.963  22.656  1.00 34.00 ? 165  ILE B CG2 1 
ATOM   5298  C  CD1 . ILE B 2 162 ? 17.259  16.029  21.124  1.00 33.48 ? 165  ILE B CD1 1 
ATOM   5299  N  N   . HIS B 2 163 ? 22.336  14.524  21.617  1.00 34.47 ? 166  HIS B N   1 
ATOM   5300  C  CA  . HIS B 2 163 ? 23.773  14.744  21.535  1.00 34.57 ? 166  HIS B CA  1 
ATOM   5301  C  C   . HIS B 2 163 ? 24.245  14.676  20.082  1.00 34.72 ? 166  HIS B C   1 
ATOM   5302  O  O   . HIS B 2 163 ? 25.003  15.532  19.624  1.00 34.65 ? 166  HIS B O   1 
ATOM   5303  C  CB  . HIS B 2 163 ? 24.518  13.695  22.363  1.00 34.48 ? 166  HIS B CB  1 
ATOM   5304  C  CG  . HIS B 2 163 ? 24.501  13.959  23.836  1.00 34.38 ? 166  HIS B CG  1 
ATOM   5305  N  ND1 . HIS B 2 163 ? 25.173  13.165  24.740  1.00 34.15 ? 166  HIS B ND1 1 
ATOM   5306  C  CD2 . HIS B 2 163 ? 23.894  14.927  24.563  1.00 34.21 ? 166  HIS B CD2 1 
ATOM   5307  C  CE1 . HIS B 2 163 ? 24.979  13.631  25.961  1.00 34.13 ? 166  HIS B CE1 1 
ATOM   5308  N  NE2 . HIS B 2 163 ? 24.207  14.700  25.880  1.00 34.20 ? 166  HIS B NE2 1 
ATOM   5309  N  N   . SER B 2 164 ? 23.775  13.669  19.352  1.00 34.83 ? 167  SER B N   1 
ATOM   5310  C  CA  . SER B 2 164 ? 24.156  13.501  17.956  1.00 34.98 ? 167  SER B CA  1 
ATOM   5311  C  C   . SER B 2 164 ? 23.708  14.680  17.104  1.00 35.19 ? 167  SER B C   1 
ATOM   5312  O  O   . SER B 2 164 ? 24.308  14.960  16.073  1.00 35.38 ? 167  SER B O   1 
ATOM   5313  C  CB  . SER B 2 164 ? 23.569  12.208  17.388  1.00 34.72 ? 167  SER B CB  1 
ATOM   5314  O  OG  . SER B 2 164 ? 22.177  12.333  17.147  1.00 34.62 ? 167  SER B OG  1 
ATOM   5315  N  N   . GLN B 2 165 ? 22.647  15.361  17.529  1.00 35.41 ? 168  GLN B N   1 
ATOM   5316  C  CA  . GLN B 2 165 ? 22.106  16.513  16.801  1.00 35.57 ? 168  GLN B CA  1 
ATOM   5317  C  C   . GLN B 2 165 ? 22.806  17.822  17.136  1.00 35.68 ? 168  GLN B C   1 
ATOM   5318  O  O   . GLN B 2 165 ? 22.714  18.796  16.389  1.00 35.67 ? 168  GLN B O   1 
ATOM   5319  C  CB  . GLN B 2 165 ? 20.614  16.673  17.096  1.00 35.50 ? 168  GLN B CB  1 
ATOM   5320  C  CG  . GLN B 2 165 ? 19.742  15.597  16.508  1.00 35.45 ? 168  GLN B CG  1 
ATOM   5321  C  CD  . GLN B 2 165 ? 19.574  15.758  15.024  1.00 35.57 ? 168  GLN B CD  1 
ATOM   5322  O  OE1 . GLN B 2 165 ? 19.882  14.853  14.251  1.00 35.82 ? 168  GLN B OE1 1 
ATOM   5323  N  NE2 . GLN B 2 165 ? 19.075  16.913  14.611  1.00 35.47 ? 168  GLN B NE2 1 
ATOM   5324  N  N   . LYS B 2 166 ? 23.465  17.863  18.285  1.00 35.57 ? 169  LYS B N   1 
ATOM   5325  C  CA  . LYS B 2 166 ? 24.148  19.073  18.693  1.00 35.61 ? 169  LYS B CA  1 
ATOM   5326  C  C   . LYS B 2 166 ? 25.630  19.096  18.332  1.00 35.94 ? 169  LYS B C   1 
ATOM   5327  O  O   . LYS B 2 166 ? 26.025  18.494  17.332  1.00 36.07 ? 169  LYS B O   1 
ATOM   5328  C  CB  . LYS B 2 166 ? 23.873  19.362  20.164  1.00 35.18 ? 169  LYS B CB  1 
ATOM   5329  C  CG  . LYS B 2 166 ? 22.435  19.830  20.397  1.00 34.66 ? 169  LYS B CG  1 
ATOM   5330  C  CD  . LYS B 2 166 ? 22.081  19.897  21.876  1.00 34.50 ? 169  LYS B CD  1 
ATOM   5331  C  CE  . LYS B 2 166 ? 20.747  20.606  22.112  1.00 34.24 ? 169  LYS B CE  1 
ATOM   5332  N  NZ  . LYS B 2 166 ? 20.804  22.079  21.887  1.00 33.93 ? 169  LYS B NZ  1 
ATOM   5333  N  N   . ARG B 2 167 ? 26.451  19.768  19.135  1.00 36.11 ? 170  ARG B N   1 
ATOM   5334  C  CA  . ARG B 2 167 ? 27.876  19.909  18.826  1.00 36.12 ? 170  ARG B CA  1 
ATOM   5335  C  C   . ARG B 2 167 ? 28.831  18.809  19.278  1.00 36.15 ? 170  ARG B C   1 
ATOM   5336  O  O   . ARG B 2 167 ? 28.575  18.108  20.258  1.00 36.33 ? 170  ARG B O   1 
ATOM   5337  C  CB  . ARG B 2 167 ? 28.371  21.247  19.358  1.00 35.91 ? 170  ARG B CB  1 
ATOM   5338  C  CG  . ARG B 2 167 ? 27.538  22.423  18.919  1.00 35.90 ? 170  ARG B CG  1 
ATOM   5339  C  CD  . ARG B 2 167 ? 27.819  23.602  19.809  1.00 36.21 ? 170  ARG B CD  1 
ATOM   5340  N  NE  . ARG B 2 167 ? 27.028  24.776  19.462  1.00 36.73 ? 170  ARG B NE  1 
ATOM   5341  C  CZ  . ARG B 2 167 ? 27.338  25.637  18.497  1.00 37.17 ? 170  ARG B CZ  1 
ATOM   5342  N  NH1 . ARG B 2 167 ? 28.431  25.467  17.761  1.00 37.48 ? 170  ARG B NH1 1 
ATOM   5343  N  NH2 . ARG B 2 167 ? 26.557  26.683  18.274  1.00 37.25 ? 170  ARG B NH2 1 
ATOM   5344  N  N   . ASN B 2 168 ? 29.943  18.675  18.556  1.00 35.95 ? 171  ASN B N   1 
ATOM   5345  C  CA  . ASN B 2 168 ? 30.972  17.695  18.889  1.00 35.77 ? 171  ASN B CA  1 
ATOM   5346  C  C   . ASN B 2 168 ? 31.532  18.144  20.232  1.00 35.59 ? 171  ASN B C   1 
ATOM   5347  O  O   . ASN B 2 168 ? 31.872  19.320  20.407  1.00 35.63 ? 171  ASN B O   1 
ATOM   5348  C  CB  . ASN B 2 168 ? 32.081  17.710  17.834  1.00 35.74 ? 171  ASN B CB  1 
ATOM   5349  C  CG  . ASN B 2 168 ? 33.179  16.687  18.111  1.00 35.69 ? 171  ASN B CG  1 
ATOM   5350  O  OD1 . ASN B 2 168 ? 33.202  15.612  17.513  1.00 35.95 ? 171  ASN B OD1 1 
ATOM   5351  N  ND2 . ASN B 2 168 ? 34.099  17.024  19.001  1.00 35.76 ? 171  ASN B ND2 1 
ATOM   5352  N  N   . PRO B 2 169 ? 31.646  17.213  21.194  1.00 35.38 ? 172  PRO B N   1 
ATOM   5353  C  CA  . PRO B 2 169 ? 32.160  17.487  22.541  1.00 35.19 ? 172  PRO B CA  1 
ATOM   5354  C  C   . PRO B 2 169 ? 33.552  18.091  22.588  1.00 35.14 ? 172  PRO B C   1 
ATOM   5355  O  O   . PRO B 2 169 ? 33.904  18.757  23.558  1.00 34.92 ? 172  PRO B O   1 
ATOM   5356  C  CB  . PRO B 2 169 ? 32.103  16.118  23.211  1.00 35.20 ? 172  PRO B CB  1 
ATOM   5357  C  CG  . PRO B 2 169 ? 32.273  15.174  22.066  1.00 35.25 ? 172  PRO B CG  1 
ATOM   5358  C  CD  . PRO B 2 169 ? 31.373  15.777  21.028  1.00 35.28 ? 172  PRO B CD  1 
ATOM   5359  N  N   . GLN B 2 170 ? 34.341  17.878  21.541  1.00 35.13 ? 173  GLN B N   1 
ATOM   5360  C  CA  . GLN B 2 170 ? 35.682  18.436  21.509  1.00 35.18 ? 173  GLN B CA  1 
ATOM   5361  C  C   . GLN B 2 170 ? 35.812  19.693  20.667  1.00 35.37 ? 173  GLN B C   1 
ATOM   5362  O  O   . GLN B 2 170 ? 36.376  20.688  21.122  1.00 35.38 ? 173  GLN B O   1 
ATOM   5363  C  CB  . GLN B 2 170 ? 36.708  17.410  21.030  1.00 35.03 ? 173  GLN B CB  1 
ATOM   5364  C  CG  . GLN B 2 170 ? 38.087  18.044  20.842  1.00 35.08 ? 173  GLN B CG  1 
ATOM   5365  C  CD  . GLN B 2 170 ? 39.194  17.042  20.660  1.00 34.89 ? 173  GLN B CD  1 
ATOM   5366  O  OE1 . GLN B 2 170 ? 38.952  15.870  20.406  1.00 34.83 ? 173  GLN B OE1 1 
ATOM   5367  N  NE2 . GLN B 2 170 ? 40.426  17.503  20.798  1.00 34.93 ? 173  GLN B NE2 1 
ATOM   5368  N  N   . THR B 2 171 ? 35.301  19.644  19.441  1.00 35.42 ? 174  THR B N   1 
ATOM   5369  C  CA  . THR B 2 171 ? 35.396  20.774  18.520  1.00 35.38 ? 174  THR B CA  1 
ATOM   5370  C  C   . THR B 2 171 ? 34.320  21.834  18.665  1.00 35.45 ? 174  THR B C   1 
ATOM   5371  O  O   . THR B 2 171 ? 34.521  22.976  18.260  1.00 35.17 ? 174  THR B O   1 
ATOM   5372  C  CB  . THR B 2 171 ? 35.386  20.293  17.067  1.00 35.53 ? 174  THR B CB  1 
ATOM   5373  O  OG1 . THR B 2 171 ? 34.132  19.665  16.779  1.00 35.44 ? 174  THR B OG1 1 
ATOM   5374  C  CG2 . THR B 2 171 ? 36.501  19.295  16.829  1.00 35.48 ? 174  THR B CG2 1 
ATOM   5375  N  N   . HIS B 2 172 ? 33.177  21.436  19.218  1.00 35.67 ? 175  HIS B N   1 
ATOM   5376  C  CA  . HIS B 2 172 ? 32.026  22.315  19.419  1.00 35.91 ? 175  HIS B CA  1 
ATOM   5377  C  C   . HIS B 2 172 ? 31.347  22.678  18.101  1.00 36.18 ? 175  HIS B C   1 
ATOM   5378  O  O   . HIS B 2 172 ? 30.614  23.655  18.012  1.00 36.10 ? 175  HIS B O   1 
ATOM   5379  C  CB  . HIS B 2 172 ? 32.434  23.579  20.179  1.00 35.69 ? 175  HIS B CB  1 
ATOM   5380  C  CG  . HIS B 2 172 ? 31.308  24.219  20.930  1.00 35.78 ? 175  HIS B CG  1 
ATOM   5381  N  ND1 . HIS B 2 172 ? 30.655  23.591  21.968  1.00 35.62 ? 175  HIS B ND1 1 
ATOM   5382  C  CD2 . HIS B 2 172 ? 30.717  25.430  20.791  1.00 35.68 ? 175  HIS B CD2 1 
ATOM   5383  C  CE1 . HIS B 2 172 ? 29.709  24.387  22.435  1.00 35.68 ? 175  HIS B CE1 1 
ATOM   5384  N  NE2 . HIS B 2 172 ? 29.726  25.508  21.738  1.00 35.64 ? 175  HIS B NE2 1 
ATOM   5385  N  N   . LEU B 2 173 ? 31.591  21.875  17.077  1.00 36.49 ? 176  LEU B N   1 
ATOM   5386  C  CA  . LEU B 2 173 ? 30.996  22.097  15.764  1.00 36.90 ? 176  LEU B CA  1 
ATOM   5387  C  C   . LEU B 2 173 ? 29.937  21.040  15.504  1.00 37.39 ? 176  LEU B C   1 
ATOM   5388  O  O   . LEU B 2 173 ? 29.993  19.936  16.053  1.00 37.46 ? 176  LEU B O   1 
ATOM   5389  C  CB  . LEU B 2 173 ? 32.057  21.973  14.669  1.00 36.58 ? 176  LEU B CB  1 
ATOM   5390  C  CG  . LEU B 2 173 ? 33.342  22.777  14.806  1.00 36.29 ? 176  LEU B CG  1 
ATOM   5391  C  CD1 . LEU B 2 173 ? 34.348  22.273  13.800  1.00 36.19 ? 176  LEU B CD1 1 
ATOM   5392  C  CD2 . LEU B 2 173 ? 33.062  24.255  14.620  1.00 36.23 ? 176  LEU B CD2 1 
ATOM   5393  N  N   . LYS B 2 174 ? 28.957  21.382  14.681  1.00 37.90 ? 177  LYS B N   1 
ATOM   5394  C  CA  . LYS B 2 174 ? 27.928  20.427  14.327  1.00 38.46 ? 177  LYS B CA  1 
ATOM   5395  C  C   . LYS B 2 174 ? 28.692  19.316  13.617  1.00 38.31 ? 177  LYS B C   1 
ATOM   5396  O  O   . LYS B 2 174 ? 29.681  19.584  12.928  1.00 38.36 ? 177  LYS B O   1 
ATOM   5397  C  CB  . LYS B 2 174 ? 26.902  21.089  13.419  1.00 39.25 ? 177  LYS B CB  1 
ATOM   5398  C  CG  . LYS B 2 174 ? 26.035  22.105  14.154  1.00 40.64 ? 177  LYS B CG  1 
ATOM   5399  C  CD  . LYS B 2 174 ? 25.167  22.866  13.168  1.00 42.29 ? 177  LYS B CD  1 
ATOM   5400  C  CE  . LYS B 2 174 ? 24.038  23.636  13.863  1.00 43.15 ? 177  LYS B CE  1 
ATOM   5401  N  NZ  . LYS B 2 174 ? 23.266  24.436  12.845  1.00 43.84 ? 177  LYS B NZ  1 
ATOM   5402  N  N   . ASP B 2 175 ? 28.273  18.072  13.815  1.00 37.99 ? 178  ASP B N   1 
ATOM   5403  C  CA  . ASP B 2 175 ? 28.990  16.950  13.233  1.00 37.57 ? 178  ASP B CA  1 
ATOM   5404  C  C   . ASP B 2 175 ? 28.099  15.985  12.466  1.00 37.36 ? 178  ASP B C   1 
ATOM   5405  O  O   . ASP B 2 175 ? 27.342  15.216  13.052  1.00 37.47 ? 178  ASP B O   1 
ATOM   5406  C  CB  . ASP B 2 175 ? 29.724  16.216  14.362  1.00 37.77 ? 178  ASP B CB  1 
ATOM   5407  C  CG  . ASP B 2 175 ? 30.768  15.238  13.861  1.00 37.84 ? 178  ASP B CG  1 
ATOM   5408  O  OD1 . ASP B 2 175 ? 30.623  14.683  12.756  1.00 38.06 ? 178  ASP B OD1 1 
ATOM   5409  O  OD2 . ASP B 2 175 ? 31.742  15.003  14.598  1.00 38.21 ? 178  ASP B OD2 1 
ATOM   5410  N  N   . PRO B 2 176 ? 28.184  16.006  11.132  1.00 37.18 ? 179  PRO B N   1 
ATOM   5411  C  CA  . PRO B 2 176 ? 27.358  15.101  10.327  1.00 36.98 ? 179  PRO B CA  1 
ATOM   5412  C  C   . PRO B 2 176 ? 27.648  13.609  10.532  1.00 36.80 ? 179  PRO B C   1 
ATOM   5413  O  O   . PRO B 2 176 ? 26.813  12.770  10.218  1.00 36.73 ? 179  PRO B O   1 
ATOM   5414  C  CB  . PRO B 2 176 ? 27.604  15.581  8.893   1.00 37.06 ? 179  PRO B CB  1 
ATOM   5415  C  CG  . PRO B 2 176 ? 28.887  16.322  8.973   1.00 37.30 ? 179  PRO B CG  1 
ATOM   5416  C  CD  . PRO B 2 176 ? 28.831  17.020  10.289  1.00 37.15 ? 179  PRO B CD  1 
ATOM   5417  N  N   . ASP B 2 177 ? 28.824  13.274  11.052  1.00 36.71 ? 180  ASP B N   1 
ATOM   5418  C  CA  . ASP B 2 177 ? 29.142  11.876  11.328  1.00 36.50 ? 180  ASP B CA  1 
ATOM   5419  C  C   . ASP B 2 177 ? 28.277  11.426  12.507  1.00 36.45 ? 180  ASP B C   1 
ATOM   5420  O  O   . ASP B 2 177 ? 27.737  10.316  12.519  1.00 36.36 ? 180  ASP B O   1 
ATOM   5421  C  CB  . ASP B 2 177 ? 30.615  11.717  11.694  1.00 36.71 ? 180  ASP B CB  1 
ATOM   5422  C  CG  . ASP B 2 177 ? 31.475  11.296  10.518  1.00 37.00 ? 180  ASP B CG  1 
ATOM   5423  O  OD1 . ASP B 2 177 ? 32.634  10.891  10.754  1.00 37.21 ? 180  ASP B OD1 1 
ATOM   5424  O  OD2 . ASP B 2 177 ? 31.006  11.357  9.362   1.00 37.23 ? 180  ASP B OD2 1 
ATOM   5425  N  N   . MET B 2 178 ? 28.148  12.302  13.500  1.00 36.08 ? 181  MET B N   1 
ATOM   5426  C  CA  . MET B 2 178 ? 27.345  12.011  14.677  1.00 35.71 ? 181  MET B CA  1 
ATOM   5427  C  C   . MET B 2 178 ? 25.888  11.891  14.273  1.00 35.62 ? 181  MET B C   1 
ATOM   5428  O  O   . MET B 2 178 ? 25.203  10.942  14.652  1.00 35.48 ? 181  MET B O   1 
ATOM   5429  C  CB  . MET B 2 178 ? 27.509  13.125  15.713  1.00 35.63 ? 181  MET B CB  1 
ATOM   5430  C  CG  . MET B 2 178 ? 28.865  13.126  16.376  1.00 35.74 ? 181  MET B CG  1 
ATOM   5431  S  SD  . MET B 2 178 ? 29.174  14.521  17.466  1.00 36.59 ? 181  MET B SD  1 
ATOM   5432  C  CE  . MET B 2 178 ? 27.698  14.538  18.449  1.00 36.25 ? 181  MET B CE  1 
ATOM   5433  N  N   . VAL B 2 179 ? 25.432  12.848  13.473  1.00 35.33 ? 182  VAL B N   1 
ATOM   5434  C  CA  . VAL B 2 179 ? 24.052  12.871  13.016  1.00 35.04 ? 182  VAL B CA  1 
ATOM   5435  C  C   . VAL B 2 179 ? 23.678  11.604  12.273  1.00 35.21 ? 182  VAL B C   1 
ATOM   5436  O  O   . VAL B 2 179 ? 22.686  10.948  12.603  1.00 35.04 ? 182  VAL B O   1 
ATOM   5437  C  CB  . VAL B 2 179 ? 23.786  14.073  12.084  1.00 34.88 ? 182  VAL B CB  1 
ATOM   5438  C  CG1 . VAL B 2 179 ? 22.383  14.005  11.513  1.00 34.31 ? 182  VAL B CG1 1 
ATOM   5439  C  CG2 . VAL B 2 179 ? 23.982  15.364  12.838  1.00 34.69 ? 182  VAL B CG2 1 
ATOM   5440  N  N   . TRP B 2 180 ? 24.491  11.243  11.289  1.00 35.14 ? 183  TRP B N   1 
ATOM   5441  C  CA  . TRP B 2 180 ? 24.199  10.072  10.475  1.00 35.07 ? 183  TRP B CA  1 
ATOM   5442  C  C   . TRP B 2 180 ? 24.637  8.724   11.010  1.00 35.02 ? 183  TRP B C   1 
ATOM   5443  O  O   . TRP B 2 180 ? 24.113  7.695   10.582  1.00 34.95 ? 183  TRP B O   1 
ATOM   5444  C  CB  . TRP B 2 180 ? 24.649  10.299  9.031   1.00 35.04 ? 183  TRP B CB  1 
ATOM   5445  C  CG  . TRP B 2 180 ? 23.781  11.292  8.358   1.00 34.93 ? 183  TRP B CG  1 
ATOM   5446  C  CD1 . TRP B 2 180 ? 24.070  12.601  8.116   1.00 34.95 ? 183  TRP B CD1 1 
ATOM   5447  C  CD2 . TRP B 2 180 ? 22.438  11.088  7.909   1.00 35.12 ? 183  TRP B CD2 1 
ATOM   5448  N  NE1 . TRP B 2 180 ? 22.989  13.232  7.554   1.00 34.97 ? 183  TRP B NE1 1 
ATOM   5449  C  CE2 . TRP B 2 180 ? 21.972  12.325  7.414   1.00 35.16 ? 183  TRP B CE2 1 
ATOM   5450  C  CE3 . TRP B 2 180 ? 21.580  9.980   7.881   1.00 35.06 ? 183  TRP B CE3 1 
ATOM   5451  C  CZ2 . TRP B 2 180 ? 20.686  12.486  6.895   1.00 35.14 ? 183  TRP B CZ2 1 
ATOM   5452  C  CZ3 . TRP B 2 180 ? 20.305  10.139  7.366   1.00 35.17 ? 183  TRP B CZ3 1 
ATOM   5453  C  CH2 . TRP B 2 180 ? 19.869  11.386  6.879   1.00 35.23 ? 183  TRP B CH2 1 
ATOM   5454  N  N   . ASP B 2 181 ? 25.579  8.715   11.947  1.00 34.81 ? 184  ASP B N   1 
ATOM   5455  C  CA  . ASP B 2 181 ? 25.996  7.456   12.531  1.00 34.76 ? 184  ASP B CA  1 
ATOM   5456  C  C   . ASP B 2 181 ? 24.815  6.995   13.373  1.00 35.00 ? 184  ASP B C   1 
ATOM   5457  O  O   . ASP B 2 181 ? 24.401  5.843   13.299  1.00 35.05 ? 184  ASP B O   1 
ATOM   5458  C  CB  . ASP B 2 181 ? 27.230  7.635   13.413  1.00 34.54 ? 184  ASP B CB  1 
ATOM   5459  C  CG  . ASP B 2 181 ? 27.777  6.318   13.918  1.00 34.38 ? 184  ASP B CG  1 
ATOM   5460  O  OD1 . ASP B 2 181 ? 27.635  5.303   13.216  1.00 34.46 ? 184  ASP B OD1 1 
ATOM   5461  O  OD2 . ASP B 2 181 ? 28.359  6.289   15.016  1.00 34.51 ? 184  ASP B OD2 1 
ATOM   5462  N  N   . PHE B 2 182 ? 24.236  7.916   14.135  1.00 35.13 ? 185  PHE B N   1 
ATOM   5463  C  CA  . PHE B 2 182 ? 23.094  7.582   14.972  1.00 35.35 ? 185  PHE B CA  1 
ATOM   5464  C  C   . PHE B 2 182 ? 21.874  7.161   14.161  1.00 35.49 ? 185  PHE B C   1 
ATOM   5465  O  O   . PHE B 2 182 ? 21.289  6.114   14.422  1.00 35.27 ? 185  PHE B O   1 
ATOM   5466  C  CB  . PHE B 2 182 ? 22.721  8.754   15.876  1.00 35.36 ? 185  PHE B CB  1 
ATOM   5467  C  CG  . PHE B 2 182 ? 21.605  8.438   16.828  1.00 35.36 ? 185  PHE B CG  1 
ATOM   5468  C  CD1 . PHE B 2 182 ? 20.297  8.826   16.543  1.00 35.19 ? 185  PHE B CD1 1 
ATOM   5469  C  CD2 . PHE B 2 182 ? 21.855  7.717   17.991  1.00 35.18 ? 185  PHE B CD2 1 
ATOM   5470  C  CE1 . PHE B 2 182 ? 19.256  8.496   17.400  1.00 35.12 ? 185  PHE B CE1 1 
ATOM   5471  C  CE2 . PHE B 2 182 ? 20.821  7.382   18.857  1.00 35.15 ? 185  PHE B CE2 1 
ATOM   5472  C  CZ  . PHE B 2 182 ? 19.516  7.773   18.560  1.00 35.17 ? 185  PHE B CZ  1 
ATOM   5473  N  N   . TRP B 2 183 ? 21.478  7.987   13.197  1.00 35.67 ? 186  TRP B N   1 
ATOM   5474  C  CA  . TRP B 2 183 ? 20.318  7.684   12.367  1.00 35.96 ? 186  TRP B CA  1 
ATOM   5475  C  C   . TRP B 2 183 ? 20.465  6.385   11.583  1.00 36.25 ? 186  TRP B C   1 
ATOM   5476  O  O   . TRP B 2 183 ? 19.535  5.582   11.549  1.00 36.52 ? 186  TRP B O   1 
ATOM   5477  C  CB  . TRP B 2 183 ? 19.990  8.845   11.421  1.00 35.69 ? 186  TRP B CB  1 
ATOM   5478  C  CG  . TRP B 2 183 ? 19.171  9.953   12.055  1.00 35.48 ? 186  TRP B CG  1 
ATOM   5479  C  CD1 . TRP B 2 183 ? 18.420  9.877   13.201  1.00 35.29 ? 186  TRP B CD1 1 
ATOM   5480  C  CD2 . TRP B 2 183 ? 19.028  11.296  11.574  1.00 35.26 ? 186  TRP B CD2 1 
ATOM   5481  N  NE1 . TRP B 2 183 ? 17.823  11.090  13.458  1.00 35.15 ? 186  TRP B NE1 1 
ATOM   5482  C  CE2 . TRP B 2 183 ? 18.180  11.977  12.477  1.00 35.28 ? 186  TRP B CE2 1 
ATOM   5483  C  CE3 . TRP B 2 183 ? 19.536  11.990  10.468  1.00 35.11 ? 186  TRP B CE3 1 
ATOM   5484  C  CZ2 . TRP B 2 183 ? 17.829  13.318  12.305  1.00 35.15 ? 186  TRP B CZ2 1 
ATOM   5485  C  CZ3 . TRP B 2 183 ? 19.186  13.320  10.298  1.00 35.04 ? 186  TRP B CZ3 1 
ATOM   5486  C  CH2 . TRP B 2 183 ? 18.339  13.970  11.214  1.00 34.96 ? 186  TRP B CH2 1 
ATOM   5487  N  N   . SER B 2 184 ? 21.624  6.152   10.974  1.00 36.41 ? 187  SER B N   1 
ATOM   5488  C  CA  . SER B 2 184 ? 21.819  4.916   10.216  1.00 36.55 ? 187  SER B CA  1 
ATOM   5489  C  C   . SER B 2 184 ? 21.816  3.703   11.140  1.00 36.74 ? 187  SER B C   1 
ATOM   5490  O  O   . SER B 2 184 ? 21.380  2.619   10.756  1.00 36.85 ? 187  SER B O   1 
ATOM   5491  C  CB  . SER B 2 184 ? 23.107  4.962   9.389   1.00 36.43 ? 187  SER B CB  1 
ATOM   5492  O  OG  . SER B 2 184 ? 24.265  4.943   10.201  1.00 36.62 ? 187  SER B OG  1 
ATOM   5493  N  N   . LEU B 2 185 ? 22.285  3.886   12.369  1.00 36.91 ? 188  LEU B N   1 
ATOM   5494  C  CA  . LEU B 2 185 ? 22.298  2.790   13.336  1.00 37.07 ? 188  LEU B CA  1 
ATOM   5495  C  C   . LEU B 2 185 ? 20.916  2.552   13.939  1.00 37.18 ? 188  LEU B C   1 
ATOM   5496  O  O   . LEU B 2 185 ? 20.654  1.486   14.498  1.00 37.28 ? 188  LEU B O   1 
ATOM   5497  C  CB  . LEU B 2 185 ? 23.304  3.052   14.457  1.00 36.89 ? 188  LEU B CB  1 
ATOM   5498  C  CG  . LEU B 2 185 ? 24.784  2.951   14.098  1.00 36.90 ? 188  LEU B CG  1 
ATOM   5499  C  CD1 . LEU B 2 185 ? 25.605  3.224   15.347  1.00 36.86 ? 188  LEU B CD1 1 
ATOM   5500  C  CD2 . LEU B 2 185 ? 25.107  1.575   13.521  1.00 36.83 ? 188  LEU B CD2 1 
ATOM   5501  N  N   . ARG B 2 186 ? 20.043  3.552   13.853  1.00 37.22 ? 189  ARG B N   1 
ATOM   5502  C  CA  . ARG B 2 186 ? 18.692  3.436   14.387  1.00 37.13 ? 189  ARG B CA  1 
ATOM   5503  C  C   . ARG B 2 186 ? 17.695  3.823   13.294  1.00 37.24 ? 189  ARG B C   1 
ATOM   5504  O  O   . ARG B 2 186 ? 17.154  4.928   13.296  1.00 37.01 ? 189  ARG B O   1 
ATOM   5505  C  CB  . ARG B 2 186 ? 18.521  4.344   15.611  1.00 37.05 ? 189  ARG B CB  1 
ATOM   5506  C  CG  . ARG B 2 186 ? 19.519  4.108   16.746  1.00 36.92 ? 189  ARG B CG  1 
ATOM   5507  C  CD  . ARG B 2 186 ? 19.415  2.706   17.337  1.00 37.04 ? 189  ARG B CD  1 
ATOM   5508  N  NE  . ARG B 2 186 ? 18.073  2.403   17.832  1.00 37.31 ? 189  ARG B NE  1 
ATOM   5509  C  CZ  . ARG B 2 186 ? 17.786  1.441   18.710  1.00 37.54 ? 189  ARG B CZ  1 
ATOM   5510  N  NH1 . ARG B 2 186 ? 18.746  0.673   19.209  1.00 37.50 ? 189  ARG B NH1 1 
ATOM   5511  N  NH2 . ARG B 2 186 ? 16.529  1.240   19.086  1.00 37.50 ? 189  ARG B NH2 1 
ATOM   5512  N  N   . PRO B 2 187 ? 17.431  2.902   12.350  1.00 37.43 ? 190  PRO B N   1 
ATOM   5513  C  CA  . PRO B 2 187 ? 16.509  3.108   11.232  1.00 37.57 ? 190  PRO B CA  1 
ATOM   5514  C  C   . PRO B 2 187 ? 15.053  3.393   11.596  1.00 37.82 ? 190  PRO B C   1 
ATOM   5515  O  O   . PRO B 2 187 ? 14.242  3.663   10.718  1.00 37.85 ? 190  PRO B O   1 
ATOM   5516  C  CB  . PRO B 2 187 ? 16.661  1.818   10.426  1.00 37.47 ? 190  PRO B CB  1 
ATOM   5517  C  CG  . PRO B 2 187 ? 16.979  0.818   11.459  1.00 37.36 ? 190  PRO B CG  1 
ATOM   5518  C  CD  . PRO B 2 187 ? 17.999  1.546   12.291  1.00 37.39 ? 190  PRO B CD  1 
ATOM   5519  N  N   . GLU B 2 188 ? 14.699  3.331   12.873  1.00 38.28 ? 191  GLU B N   1 
ATOM   5520  C  CA  . GLU B 2 188 ? 13.316  3.636   13.246  1.00 38.65 ? 191  GLU B CA  1 
ATOM   5521  C  C   . GLU B 2 188 ? 13.075  5.127   13.004  1.00 38.70 ? 191  GLU B C   1 
ATOM   5522  O  O   . GLU B 2 188 ? 11.934  5.576   12.892  1.00 38.55 ? 191  GLU B O   1 
ATOM   5523  C  CB  . GLU B 2 188 ? 13.020  3.270   14.708  1.00 38.75 ? 191  GLU B CB  1 
ATOM   5524  C  CG  . GLU B 2 188 ? 13.762  4.083   15.750  1.00 39.29 ? 191  GLU B CG  1 
ATOM   5525  C  CD  . GLU B 2 188 ? 15.070  3.450   16.192  1.00 39.69 ? 191  GLU B CD  1 
ATOM   5526  O  OE1 . GLU B 2 188 ? 15.703  2.720   15.392  1.00 39.67 ? 191  GLU B OE1 1 
ATOM   5527  O  OE2 . GLU B 2 188 ? 15.469  3.692   17.352  1.00 40.04 ? 191  GLU B OE2 1 
ATOM   5528  N  N   . SER B 2 189 ? 14.178  5.872   12.886  1.00 38.73 ? 192  SER B N   1 
ATOM   5529  C  CA  . SER B 2 189 ? 14.159  7.314   12.637  1.00 38.71 ? 192  SER B CA  1 
ATOM   5530  C  C   . SER B 2 189 ? 13.809  7.665   11.192  1.00 38.74 ? 192  SER B C   1 
ATOM   5531  O  O   . SER B 2 189 ? 13.595  8.829   10.867  1.00 38.85 ? 192  SER B O   1 
ATOM   5532  C  CB  . SER B 2 189 ? 15.521  7.922   12.983  1.00 38.54 ? 192  SER B CB  1 
ATOM   5533  O  OG  . SER B 2 189 ? 16.542  7.368   12.173  1.00 38.42 ? 192  SER B OG  1 
ATOM   5534  N  N   . LEU B 2 190 ? 13.749  6.655   10.331  1.00 38.80 ? 193  LEU B N   1 
ATOM   5535  C  CA  . LEU B 2 190 ? 13.441  6.860   8.925   1.00 38.86 ? 193  LEU B CA  1 
ATOM   5536  C  C   . LEU B 2 190 ? 12.152  7.627   8.670   1.00 38.93 ? 193  LEU B C   1 
ATOM   5537  O  O   . LEU B 2 190 ? 12.116  8.507   7.813   1.00 39.09 ? 193  LEU B O   1 
ATOM   5538  C  CB  . LEU B 2 190 ? 13.396  5.521   8.196   1.00 38.84 ? 193  LEU B CB  1 
ATOM   5539  C  CG  . LEU B 2 190 ? 14.735  4.844   7.892   1.00 38.87 ? 193  LEU B CG  1 
ATOM   5540  C  CD1 . LEU B 2 190 ? 14.519  3.349   7.609   1.00 38.83 ? 193  LEU B CD1 1 
ATOM   5541  C  CD2 . LEU B 2 190 ? 15.421  5.540   6.722   1.00 38.62 ? 193  LEU B CD2 1 
ATOM   5542  N  N   . HIS B 2 191 ? 11.097  7.321   9.416   1.00 38.87 ? 194  HIS B N   1 
ATOM   5543  C  CA  . HIS B 2 191 ? 9.835   8.009   9.204   1.00 38.88 ? 194  HIS B CA  1 
ATOM   5544  C  C   . HIS B 2 191 ? 9.937   9.512   9.453   1.00 39.03 ? 194  HIS B C   1 
ATOM   5545  O  O   . HIS B 2 191 ? 9.597   10.314  8.578   1.00 38.86 ? 194  HIS B O   1 
ATOM   5546  C  CB  . HIS B 2 191 ? 8.731   7.399   10.065  1.00 38.99 ? 194  HIS B CB  1 
ATOM   5547  C  CG  . HIS B 2 191 ? 7.355   7.616   9.517   1.00 39.26 ? 194  HIS B CG  1 
ATOM   5548  N  ND1 . HIS B 2 191 ? 6.218   7.179   10.160  1.00 39.33 ? 194  HIS B ND1 1 
ATOM   5549  C  CD2 . HIS B 2 191 ? 6.934   8.219   8.379   1.00 39.34 ? 194  HIS B CD2 1 
ATOM   5550  C  CE1 . HIS B 2 191 ? 5.156   7.503   9.443   1.00 39.42 ? 194  HIS B CE1 1 
ATOM   5551  N  NE2 . HIS B 2 191 ? 5.565   8.135   8.358   1.00 39.45 ? 194  HIS B NE2 1 
ATOM   5552  N  N   . GLN B 2 192 ? 10.409  9.896   10.638  1.00 39.04 ? 195  GLN B N   1 
ATOM   5553  C  CA  . GLN B 2 192 ? 10.541  11.307  10.971  1.00 39.03 ? 195  GLN B CA  1 
ATOM   5554  C  C   . GLN B 2 192 ? 11.647  12.000  10.174  1.00 39.17 ? 195  GLN B C   1 
ATOM   5555  O  O   . GLN B 2 192 ? 11.564  13.198  9.913   1.00 38.93 ? 195  GLN B O   1 
ATOM   5556  C  CB  . GLN B 2 192 ? 10.736  11.494  12.475  1.00 38.95 ? 195  GLN B CB  1 
ATOM   5557  C  CG  . GLN B 2 192 ? 10.966  12.938  12.918  1.00 39.08 ? 195  GLN B CG  1 
ATOM   5558  C  CD  . GLN B 2 192 ? 9.868   13.913  12.492  1.00 39.36 ? 195  GLN B CD  1 
ATOM   5559  O  OE1 . GLN B 2 192 ? 8.770   13.522  12.085  1.00 39.39 ? 195  GLN B OE1 1 
ATOM   5560  N  NE2 . GLN B 2 192 ? 10.168  15.201  12.600  1.00 39.36 ? 195  GLN B NE2 1 
ATOM   5561  N  N   . VAL B 2 193 ? 12.668  11.247  9.772   1.00 39.21 ? 196  VAL B N   1 
ATOM   5562  C  CA  . VAL B 2 193 ? 13.753  11.810  8.972   1.00 39.35 ? 196  VAL B CA  1 
ATOM   5563  C  C   . VAL B 2 193 ? 13.219  12.158  7.584   1.00 39.69 ? 196  VAL B C   1 
ATOM   5564  O  O   . VAL B 2 193 ? 13.620  13.158  6.987   1.00 39.82 ? 196  VAL B O   1 
ATOM   5565  C  CB  . VAL B 2 193 ? 14.940  10.834  8.843   1.00 39.38 ? 196  VAL B CB  1 
ATOM   5566  C  CG1 . VAL B 2 193 ? 15.885  11.275  7.724   1.00 39.20 ? 196  VAL B CG1 1 
ATOM   5567  C  CG2 . VAL B 2 193 ? 15.692  10.767  10.159  1.00 39.18 ? 196  VAL B CG2 1 
ATOM   5568  N  N   . SER B 2 194 ? 12.309  11.335  7.074   1.00 39.76 ? 197  SER B N   1 
ATOM   5569  C  CA  . SER B 2 194 ? 11.710  11.587  5.772   1.00 39.95 ? 197  SER B CA  1 
ATOM   5570  C  C   . SER B 2 194 ? 10.830  12.836  5.839   1.00 40.28 ? 197  SER B C   1 
ATOM   5571  O  O   . SER B 2 194 ? 10.802  13.641  4.908   1.00 40.45 ? 197  SER B O   1 
ATOM   5572  C  CB  . SER B 2 194 ? 10.895  10.380  5.336   1.00 39.69 ? 197  SER B CB  1 
ATOM   5573  O  OG  . SER B 2 194 ? 11.744  9.263   5.184   1.00 39.63 ? 197  SER B OG  1 
ATOM   5574  N  N   . PHE B 2 195 ? 10.117  13.004  6.944   1.00 40.42 ? 198  PHE B N   1 
ATOM   5575  C  CA  . PHE B 2 195 ? 9.270   14.169  7.119   1.00 40.50 ? 198  PHE B CA  1 
ATOM   5576  C  C   . PHE B 2 195 ? 10.153  15.423  7.246   1.00 40.22 ? 198  PHE B C   1 
ATOM   5577  O  O   . PHE B 2 195 ? 9.918   16.423  6.572   1.00 40.27 ? 198  PHE B O   1 
ATOM   5578  C  CB  . PHE B 2 195 ? 8.385   13.986  8.357   1.00 41.24 ? 198  PHE B CB  1 
ATOM   5579  C  CG  . PHE B 2 195 ? 7.419   15.108  8.582   1.00 42.28 ? 198  PHE B CG  1 
ATOM   5580  C  CD1 . PHE B 2 195 ? 7.779   16.209  9.363   1.00 42.84 ? 198  PHE B CD1 1 
ATOM   5581  C  CD2 . PHE B 2 195 ? 6.159   15.088  7.998   1.00 42.67 ? 198  PHE B CD2 1 
ATOM   5582  C  CE1 . PHE B 2 195 ? 6.895   17.282  9.557   1.00 43.07 ? 198  PHE B CE1 1 
ATOM   5583  C  CE2 . PHE B 2 195 ? 5.263   16.156  8.183   1.00 43.15 ? 198  PHE B CE2 1 
ATOM   5584  C  CZ  . PHE B 2 195 ? 5.634   17.255  8.965   1.00 43.12 ? 198  PHE B CZ  1 
ATOM   5585  N  N   . LEU B 2 196 ? 11.212  15.330  8.046   1.00 39.70 ? 199  LEU B N   1 
ATOM   5586  C  CA  . LEU B 2 196 ? 12.137  16.440  8.286   1.00 39.21 ? 199  LEU B CA  1 
ATOM   5587  C  C   . LEU B 2 196 ? 12.811  17.014  7.044   1.00 39.10 ? 199  LEU B C   1 
ATOM   5588  O  O   . LEU B 2 196 ? 12.960  18.228  6.920   1.00 38.95 ? 199  LEU B O   1 
ATOM   5589  C  CB  . LEU B 2 196 ? 13.212  16.012  9.284   1.00 38.98 ? 199  LEU B CB  1 
ATOM   5590  C  CG  . LEU B 2 196 ? 14.265  17.052  9.666   1.00 38.90 ? 199  LEU B CG  1 
ATOM   5591  C  CD1 . LEU B 2 196 ? 13.602  18.253  10.332  1.00 38.70 ? 199  LEU B CD1 1 
ATOM   5592  C  CD2 . LEU B 2 196 ? 15.298  16.426  10.589  1.00 38.79 ? 199  LEU B CD2 1 
ATOM   5593  N  N   . PHE B 2 197 ? 13.260  16.144  6.148   1.00 38.96 ? 200  PHE B N   1 
ATOM   5594  C  CA  . PHE B 2 197 ? 13.921  16.601  4.936   1.00 38.82 ? 200  PHE B CA  1 
ATOM   5595  C  C   . PHE B 2 197 ? 12.966  16.881  3.788   1.00 38.95 ? 200  PHE B C   1 
ATOM   5596  O  O   . PHE B 2 197 ? 13.393  17.058  2.646   1.00 38.78 ? 200  PHE B O   1 
ATOM   5597  C  CB  . PHE B 2 197 ? 15.012  15.626  4.515   1.00 38.48 ? 200  PHE B CB  1 
ATOM   5598  C  CG  . PHE B 2 197 ? 16.231  15.685  5.379   1.00 38.20 ? 200  PHE B CG  1 
ATOM   5599  C  CD1 . PHE B 2 197 ? 16.319  14.920  6.531   1.00 37.94 ? 200  PHE B CD1 1 
ATOM   5600  C  CD2 . PHE B 2 197 ? 17.299  16.506  5.038   1.00 38.01 ? 200  PHE B CD2 1 
ATOM   5601  C  CE1 . PHE B 2 197 ? 17.454  14.970  7.331   1.00 37.86 ? 200  PHE B CE1 1 
ATOM   5602  C  CE2 . PHE B 2 197 ? 18.438  16.563  5.833   1.00 37.87 ? 200  PHE B CE2 1 
ATOM   5603  C  CZ  . PHE B 2 197 ? 18.516  15.793  6.981   1.00 37.84 ? 200  PHE B CZ  1 
ATOM   5604  N  N   . SER B 2 198 ? 11.669  16.896  4.092   1.00 39.19 ? 201  SER B N   1 
ATOM   5605  C  CA  . SER B 2 198 ? 10.659  17.207  3.092   1.00 39.57 ? 201  SER B CA  1 
ATOM   5606  C  C   . SER B 2 198 ? 10.408  18.714  3.205   1.00 39.95 ? 201  SER B C   1 
ATOM   5607  O  O   . SER B 2 198 ? 11.040  19.390  4.019   1.00 39.90 ? 201  SER B O   1 
ATOM   5608  C  CB  . SER B 2 198 ? 9.367   16.425  3.349   1.00 39.37 ? 201  SER B CB  1 
ATOM   5609  O  OG  . SER B 2 198 ? 8.608   16.995  4.398   1.00 39.53 ? 201  SER B OG  1 
ATOM   5610  N  N   . ASP B 2 199 ? 9.479   19.241  2.412   1.00 40.37 ? 202  ASP B N   1 
ATOM   5611  C  CA  . ASP B 2 199 ? 9.180   20.672  2.437   1.00 40.77 ? 202  ASP B CA  1 
ATOM   5612  C  C   . ASP B 2 199 ? 8.776   21.189  3.815   1.00 41.08 ? 202  ASP B C   1 
ATOM   5613  O  O   . ASP B 2 199 ? 9.130   22.305  4.181   1.00 41.22 ? 202  ASP B O   1 
ATOM   5614  C  CB  . ASP B 2 199 ? 8.086   21.028  1.417   1.00 40.56 ? 202  ASP B CB  1 
ATOM   5615  C  CG  . ASP B 2 199 ? 8.497   20.747  -0.023  1.00 40.38 ? 202  ASP B CG  1 
ATOM   5616  O  OD1 . ASP B 2 199 ? 9.688   20.904  -0.367  1.00 40.24 ? 202  ASP B OD1 1 
ATOM   5617  O  OD2 . ASP B 2 199 ? 7.612   20.380  -0.820  1.00 40.33 ? 202  ASP B OD2 1 
ATOM   5618  N  N   . ARG B 2 200 ? 8.057   20.373  4.585   1.00 41.49 ? 203  ARG B N   1 
ATOM   5619  C  CA  . ARG B 2 200 ? 7.602   20.764  5.922   1.00 41.69 ? 203  ARG B CA  1 
ATOM   5620  C  C   . ARG B 2 200 ? 8.753   20.951  6.906   1.00 41.42 ? 203  ARG B C   1 
ATOM   5621  O  O   . ARG B 2 200 ? 8.532   21.353  8.048   1.00 41.49 ? 203  ARG B O   1 
ATOM   5622  C  CB  . ARG B 2 200 ? 6.648   19.713  6.490   1.00 42.63 ? 203  ARG B CB  1 
ATOM   5623  C  CG  . ARG B 2 200 ? 5.484   19.354  5.587   1.00 44.07 ? 203  ARG B CG  1 
ATOM   5624  C  CD  . ARG B 2 200 ? 4.238   20.160  5.889   1.00 45.12 ? 203  ARG B CD  1 
ATOM   5625  N  NE  . ARG B 2 200 ? 3.168   19.827  4.948   1.00 46.48 ? 203  ARG B NE  1 
ATOM   5626  C  CZ  . ARG B 2 200 ? 1.924   19.485  5.291   1.00 47.08 ? 203  ARG B CZ  1 
ATOM   5627  N  NH1 . ARG B 2 200 ? 1.026   19.203  4.350   1.00 47.39 ? 203  ARG B NH1 1 
ATOM   5628  N  NH2 . ARG B 2 200 ? 1.568   19.429  6.568   1.00 47.40 ? 203  ARG B NH2 1 
ATOM   5629  N  N   . GLY B 2 201 ? 9.972   20.648  6.460   1.00 41.04 ? 204  GLY B N   1 
ATOM   5630  C  CA  . GLY B 2 201 ? 11.148  20.771  7.304   1.00 40.51 ? 204  GLY B CA  1 
ATOM   5631  C  C   . GLY B 2 201 ? 11.456  22.184  7.753   1.00 40.18 ? 204  GLY B C   1 
ATOM   5632  O  O   . GLY B 2 201 ? 12.043  22.381  8.823   1.00 40.18 ? 204  GLY B O   1 
ATOM   5633  N  N   . ILE B 2 202 ? 11.087  23.166  6.933   1.00 39.79 ? 205  ILE B N   1 
ATOM   5634  C  CA  . ILE B 2 202 ? 11.320  24.569  7.262   1.00 39.45 ? 205  ILE B CA  1 
ATOM   5635  C  C   . ILE B 2 202 ? 10.047  25.362  7.014   1.00 39.36 ? 205  ILE B C   1 
ATOM   5636  O  O   . ILE B 2 202 ? 9.822   25.886  5.921   1.00 39.32 ? 205  ILE B O   1 
ATOM   5637  C  CB  . ILE B 2 202 ? 12.442  25.195  6.416   1.00 39.45 ? 205  ILE B CB  1 
ATOM   5638  C  CG1 . ILE B 2 202 ? 13.633  24.247  6.312   1.00 39.38 ? 205  ILE B CG1 1 
ATOM   5639  C  CG2 . ILE B 2 202 ? 12.896  26.496  7.051   1.00 39.22 ? 205  ILE B CG2 1 
ATOM   5640  C  CD1 . ILE B 2 202 ? 14.710  24.740  5.387   1.00 39.34 ? 205  ILE B CD1 1 
ATOM   5641  N  N   . PRO B 2 203 ? 9.184   25.451  8.031   1.00 39.25 ? 206  PRO B N   1 
ATOM   5642  C  CA  . PRO B 2 203 ? 7.920   26.179  7.941   1.00 39.27 ? 206  PRO B CA  1 
ATOM   5643  C  C   . PRO B 2 203 ? 8.182   27.662  7.734   1.00 39.30 ? 206  PRO B C   1 
ATOM   5644  O  O   . PRO B 2 203 ? 9.226   28.168  8.143   1.00 39.44 ? 206  PRO B O   1 
ATOM   5645  C  CB  . PRO B 2 203 ? 7.304   25.954  9.322   1.00 39.24 ? 206  PRO B CB  1 
ATOM   5646  C  CG  . PRO B 2 203 ? 7.930   24.700  9.794   1.00 39.26 ? 206  PRO B CG  1 
ATOM   5647  C  CD  . PRO B 2 203 ? 9.345   24.854  9.364   1.00 39.26 ? 206  PRO B CD  1 
ATOM   5648  N  N   . ASP B 2 204 ? 7.254   28.347  7.074   1.00 39.30 ? 207  ASP B N   1 
ATOM   5649  C  CA  . ASP B 2 204 ? 7.380   29.781  6.868   1.00 39.21 ? 207  ASP B CA  1 
ATOM   5650  C  C   . ASP B 2 204 ? 6.796   30.412  8.134   1.00 39.15 ? 207  ASP B C   1 
ATOM   5651  O  O   . ASP B 2 204 ? 5.636   30.842  8.156   1.00 39.18 ? 207  ASP B O   1 
ATOM   5652  C  CB  . ASP B 2 204 ? 6.585   30.229  5.638   1.00 39.26 ? 207  ASP B CB  1 
ATOM   5653  C  CG  . ASP B 2 204 ? 6.829   31.690  5.278   1.00 39.57 ? 207  ASP B CG  1 
ATOM   5654  O  OD1 . ASP B 2 204 ? 6.553   32.077  4.125   1.00 40.07 ? 207  ASP B OD1 1 
ATOM   5655  O  OD2 . ASP B 2 204 ? 7.304   32.462  6.136   1.00 39.66 ? 207  ASP B OD2 1 
ATOM   5656  N  N   . GLY B 2 205 ? 7.607   30.459  9.189   1.00 38.94 ? 208  GLY B N   1 
ATOM   5657  C  CA  . GLY B 2 205 ? 7.146   31.017  10.448  1.00 38.59 ? 208  GLY B CA  1 
ATOM   5658  C  C   . GLY B 2 205 ? 6.384   29.979  11.247  1.00 38.27 ? 208  GLY B C   1 
ATOM   5659  O  O   . GLY B 2 205 ? 6.298   28.825  10.837  1.00 38.39 ? 208  GLY B O   1 
ATOM   5660  N  N   . HIS B 2 206 ? 5.795   30.391  12.362  1.00 38.12 ? 209  HIS B N   1 
ATOM   5661  C  CA  . HIS B 2 206 ? 5.054   29.475  13.225  1.00 37.83 ? 209  HIS B CA  1 
ATOM   5662  C  C   . HIS B 2 206 ? 3.576   29.390  12.904  1.00 37.81 ? 209  HIS B C   1 
ATOM   5663  O  O   . HIS B 2 206 ? 2.927   28.396  13.203  1.00 37.80 ? 209  HIS B O   1 
ATOM   5664  C  CB  . HIS B 2 206 ? 5.210   29.907  14.676  1.00 37.38 ? 209  HIS B CB  1 
ATOM   5665  C  CG  . HIS B 2 206 ? 6.632   30.056  15.104  1.00 37.21 ? 209  HIS B CG  1 
ATOM   5666  N  ND1 . HIS B 2 206 ? 7.569   29.065  14.920  1.00 37.09 ? 209  HIS B ND1 1 
ATOM   5667  C  CD2 . HIS B 2 206 ? 7.279   31.082  15.703  1.00 37.12 ? 209  HIS B CD2 1 
ATOM   5668  C  CE1 . HIS B 2 206 ? 8.735   29.474  15.388  1.00 37.16 ? 209  HIS B CE1 1 
ATOM   5669  N  NE2 . HIS B 2 206 ? 8.586   30.695  15.869  1.00 37.05 ? 209  HIS B NE2 1 
ATOM   5670  N  N   . ARG B 2 207 ? 3.046   30.438  12.295  1.00 37.80 ? 210  ARG B N   1 
ATOM   5671  C  CA  . ARG B 2 207 ? 1.631   30.504  11.973  1.00 37.85 ? 210  ARG B CA  1 
ATOM   5672  C  C   . ARG B 2 207 ? 1.190   29.605  10.833  1.00 38.08 ? 210  ARG B C   1 
ATOM   5673  O  O   . ARG B 2 207 ? 0.001   29.297  10.708  1.00 37.89 ? 210  ARG B O   1 
ATOM   5674  C  CB  . ARG B 2 207 ? 1.271   31.949  11.670  1.00 37.72 ? 210  ARG B CB  1 
ATOM   5675  C  CG  . ARG B 2 207 ? 1.515   32.875  12.839  1.00 37.82 ? 210  ARG B CG  1 
ATOM   5676  C  CD  . ARG B 2 207 ? 1.829   34.288  12.388  1.00 38.02 ? 210  ARG B CD  1 
ATOM   5677  N  NE  . ARG B 2 207 ? 0.890   34.735  11.380  1.00 38.35 ? 210  ARG B NE  1 
ATOM   5678  C  CZ  . ARG B 2 207 ? 1.232   35.178  10.180  1.00 38.33 ? 210  ARG B CZ  1 
ATOM   5679  N  NH1 . ARG B 2 207 ? 2.503   35.254  9.827   1.00 38.37 ? 210  ARG B NH1 1 
ATOM   5680  N  NH2 . ARG B 2 207 ? 0.288   35.482  9.308   1.00 38.51 ? 210  ARG B NH2 1 
ATOM   5681  N  N   . HIS B 2 208 ? 2.156   29.152  10.033  1.00 38.35 ? 211  HIS B N   1 
ATOM   5682  C  CA  . HIS B 2 208 ? 1.880   28.308  8.872   1.00 38.43 ? 211  HIS B CA  1 
ATOM   5683  C  C   . HIS B 2 208 ? 2.310   26.844  8.985   1.00 38.42 ? 211  HIS B C   1 
ATOM   5684  O  O   . HIS B 2 208 ? 2.761   26.242  8.007   1.00 38.38 ? 211  HIS B O   1 
ATOM   5685  C  CB  . HIS B 2 208 ? 2.486   28.940  7.616   1.00 38.54 ? 211  HIS B CB  1 
ATOM   5686  C  CG  . HIS B 2 208 ? 1.890   30.268  7.259   1.00 38.95 ? 211  HIS B CG  1 
ATOM   5687  N  ND1 . HIS B 2 208 ? 0.637   30.397  6.696   1.00 39.14 ? 211  HIS B ND1 1 
ATOM   5688  C  CD2 . HIS B 2 208 ? 2.379   31.526  7.375   1.00 39.07 ? 211  HIS B CD2 1 
ATOM   5689  C  CE1 . HIS B 2 208 ? 0.380   31.676  6.481   1.00 39.16 ? 211  HIS B CE1 1 
ATOM   5690  N  NE2 . HIS B 2 208 ? 1.422   32.382  6.885   1.00 39.19 ? 211  HIS B NE2 1 
ATOM   5691  N  N   . MET B 2 209 ? 2.143   26.265  10.170  1.00 38.31 ? 212  MET B N   1 
ATOM   5692  C  CA  . MET B 2 209 ? 2.487   24.866  10.398  1.00 38.28 ? 212  MET B CA  1 
ATOM   5693  C  C   . MET B 2 209 ? 1.409   24.265  11.277  1.00 38.22 ? 212  MET B C   1 
ATOM   5694  O  O   . MET B 2 209 ? 0.645   24.996  11.902  1.00 38.18 ? 212  MET B O   1 
ATOM   5695  C  CB  . MET B 2 209 ? 3.851   24.742  11.083  1.00 38.40 ? 212  MET B CB  1 
ATOM   5696  C  CG  . MET B 2 209 ? 3.920   25.400  12.453  1.00 38.58 ? 212  MET B CG  1 
ATOM   5697  S  SD  . MET B 2 209 ? 5.591   25.479  13.124  1.00 39.02 ? 212  MET B SD  1 
ATOM   5698  C  CE  . MET B 2 209 ? 5.260   25.485  14.855  1.00 38.81 ? 212  MET B CE  1 
ATOM   5699  N  N   . ASN B 2 210 ? 1.312   22.940  11.287  1.00 38.18 ? 213  ASN B N   1 
ATOM   5700  C  CA  . ASN B 2 210 ? 0.319   22.259  12.109  1.00 38.10 ? 213  ASN B CA  1 
ATOM   5701  C  C   . ASN B 2 210 ? 0.890   21.921  13.470  1.00 38.12 ? 213  ASN B C   1 
ATOM   5702  O  O   . ASN B 2 210 ? 2.095   22.016  13.696  1.00 38.21 ? 213  ASN B O   1 
ATOM   5703  C  CB  . ASN B 2 210 ? -0.146  20.964  11.447  1.00 38.05 ? 213  ASN B CB  1 
ATOM   5704  C  CG  . ASN B 2 210 ? -0.956  21.207  10.199  1.00 38.13 ? 213  ASN B CG  1 
ATOM   5705  O  OD1 . ASN B 2 210 ? -1.649  22.226  10.070  1.00 38.04 ? 213  ASN B OD1 1 
ATOM   5706  N  ND2 . ASN B 2 210 ? -0.882  20.266  9.266   1.00 38.17 ? 213  ASN B ND2 1 
ATOM   5707  N  N   . GLY B 2 211 ? 0.008   21.535  14.380  1.00 38.16 ? 214  GLY B N   1 
ATOM   5708  C  CA  . GLY B 2 211 ? 0.430   21.157  15.712  1.00 38.10 ? 214  GLY B CA  1 
ATOM   5709  C  C   . GLY B 2 211 ? -0.080  19.754  15.970  1.00 38.18 ? 214  GLY B C   1 
ATOM   5710  O  O   . GLY B 2 211 ? -1.140  19.375  15.464  1.00 38.26 ? 214  GLY B O   1 
ATOM   5711  N  N   . TYR B 2 212 ? 0.679   18.975  16.734  1.00 38.11 ? 215  TYR B N   1 
ATOM   5712  C  CA  . TYR B 2 212 ? 0.306   17.602  17.044  1.00 37.94 ? 215  TYR B CA  1 
ATOM   5713  C  C   . TYR B 2 212 ? 0.790   17.221  18.433  1.00 37.89 ? 215  TYR B C   1 
ATOM   5714  O  O   . TYR B 2 212 ? 1.882   17.611  18.839  1.00 37.93 ? 215  TYR B O   1 
ATOM   5715  C  CB  . TYR B 2 212 ? 0.970   16.636  16.060  1.00 37.97 ? 215  TYR B CB  1 
ATOM   5716  C  CG  . TYR B 2 212 ? 0.709   16.883  14.596  1.00 38.09 ? 215  TYR B CG  1 
ATOM   5717  C  CD1 . TYR B 2 212 ? -0.350  16.263  13.947  1.00 38.30 ? 215  TYR B CD1 1 
ATOM   5718  C  CD2 . TYR B 2 212 ? 1.570   17.671  13.837  1.00 38.12 ? 215  TYR B CD2 1 
ATOM   5719  C  CE1 . TYR B 2 212 ? -0.541  16.411  12.577  1.00 38.58 ? 215  TYR B CE1 1 
ATOM   5720  C  CE2 . TYR B 2 212 ? 1.387   17.824  12.468  1.00 38.35 ? 215  TYR B CE2 1 
ATOM   5721  C  CZ  . TYR B 2 212 ? 0.333   17.186  11.847  1.00 38.45 ? 215  TYR B CZ  1 
ATOM   5722  O  OH  . TYR B 2 212 ? 0.167   17.285  10.490  1.00 38.75 ? 215  TYR B OH  1 
ATOM   5723  N  N   . GLY B 2 213 ? -0.021  16.463  19.161  1.00 37.79 ? 216  GLY B N   1 
ATOM   5724  C  CA  . GLY B 2 213 ? 0.397   16.008  20.474  1.00 37.64 ? 216  GLY B CA  1 
ATOM   5725  C  C   . GLY B 2 213 ? 1.365   14.858  20.250  1.00 37.63 ? 216  GLY B C   1 
ATOM   5726  O  O   . GLY B 2 213 ? 2.156   14.518  21.132  1.00 37.60 ? 216  GLY B O   1 
ATOM   5727  N  N   . SER B 2 214 ? 1.297   14.286  19.044  1.00 37.62 ? 217  SER B N   1 
ATOM   5728  C  CA  . SER B 2 214 ? 2.125   13.169  18.589  1.00 37.65 ? 217  SER B CA  1 
ATOM   5729  C  C   . SER B 2 214 ? 1.803   11.848  19.272  1.00 37.94 ? 217  SER B C   1 
ATOM   5730  O  O   . SER B 2 214 ? 1.329   10.910  18.629  1.00 38.01 ? 217  SER B O   1 
ATOM   5731  C  CB  . SER B 2 214 ? 3.614   13.491  18.730  1.00 37.47 ? 217  SER B CB  1 
ATOM   5732  O  OG  . SER B 2 214 ? 3.977   14.587  17.912  1.00 37.25 ? 217  SER B OG  1 
ATOM   5733  N  N   . HIS B 2 215 ? 2.057   11.776  20.575  1.00 38.15 ? 218  HIS B N   1 
ATOM   5734  C  CA  . HIS B 2 215 ? 1.793   10.571  21.346  1.00 38.26 ? 218  HIS B CA  1 
ATOM   5735  C  C   . HIS B 2 215 ? 0.321   10.207  21.352  1.00 38.58 ? 218  HIS B C   1 
ATOM   5736  O  O   . HIS B 2 215 ? -0.554  10.985  20.969  1.00 38.61 ? 218  HIS B O   1 
ATOM   5737  C  CB  . HIS B 2 215 ? 2.162   10.763  22.820  1.00 38.19 ? 218  HIS B CB  1 
ATOM   5738  C  CG  . HIS B 2 215 ? 3.571   11.196  23.062  1.00 38.19 ? 218  HIS B CG  1 
ATOM   5739  N  ND1 . HIS B 2 215 ? 4.650   10.359  22.881  1.00 38.07 ? 218  HIS B ND1 1 
ATOM   5740  C  CD2 . HIS B 2 215 ? 4.071   12.362  23.530  1.00 38.03 ? 218  HIS B CD2 1 
ATOM   5741  C  CE1 . HIS B 2 215 ? 5.755   10.993  23.231  1.00 38.21 ? 218  HIS B CE1 1 
ATOM   5742  N  NE2 . HIS B 2 215 ? 5.432   12.210  23.628  1.00 37.98 ? 218  HIS B NE2 1 
ATOM   5743  N  N   . THR B 2 216 ? 0.065   9.002   21.833  1.00 38.79 ? 219  THR B N   1 
ATOM   5744  C  CA  . THR B 2 216 ? -1.281  8.518   22.011  1.00 38.94 ? 219  THR B CA  1 
ATOM   5745  C  C   . THR B 2 216 ? -1.543  8.871   23.477  1.00 39.16 ? 219  THR B C   1 
ATOM   5746  O  O   . THR B 2 216 ? -0.664  8.704   24.330  1.00 38.97 ? 219  THR B O   1 
ATOM   5747  C  CB  . THR B 2 216 ? -1.348  6.992   21.852  1.00 38.97 ? 219  THR B CB  1 
ATOM   5748  O  OG1 . THR B 2 216 ? -1.051  6.641   20.496  1.00 38.83 ? 219  THR B OG1 1 
ATOM   5749  C  CG2 . THR B 2 216 ? -2.726  6.467   22.234  1.00 38.78 ? 219  THR B CG2 1 
ATOM   5750  N  N   . PHE B 2 217 ? -2.698  9.461   23.748  1.00 39.15 ? 220  PHE B N   1 
ATOM   5751  C  CA  . PHE B 2 217 ? -3.063  9.812   25.109  1.00 39.21 ? 220  PHE B CA  1 
ATOM   5752  C  C   . PHE B 2 217 ? -4.330  9.054   25.414  1.00 39.43 ? 220  PHE B C   1 
ATOM   5753  O  O   . PHE B 2 217 ? -4.897  8.400   24.537  1.00 39.37 ? 220  PHE B O   1 
ATOM   5754  C  CB  . PHE B 2 217 ? -3.320  11.310  25.242  1.00 38.92 ? 220  PHE B CB  1 
ATOM   5755  C  CG  . PHE B 2 217 ? -2.081  12.143  25.161  1.00 38.53 ? 220  PHE B CG  1 
ATOM   5756  C  CD1 . PHE B 2 217 ? -1.405  12.508  26.314  1.00 38.33 ? 220  PHE B CD1 1 
ATOM   5757  C  CD2 . PHE B 2 217 ? -1.584  12.556  23.932  1.00 38.26 ? 220  PHE B CD2 1 
ATOM   5758  C  CE1 . PHE B 2 217 ? -0.248  13.276  26.245  1.00 38.25 ? 220  PHE B CE1 1 
ATOM   5759  C  CE2 . PHE B 2 217 ? -0.431  13.322  23.854  1.00 38.03 ? 220  PHE B CE2 1 
ATOM   5760  C  CZ  . PHE B 2 217 ? 0.237   13.682  25.009  1.00 38.09 ? 220  PHE B CZ  1 
ATOM   5761  N  N   . LYS B 2 218 ? -4.777  9.136   26.656  1.00 39.64 ? 221  LYS B N   1 
ATOM   5762  C  CA  . LYS B 2 218 ? -5.989  8.445   27.038  1.00 40.02 ? 221  LYS B CA  1 
ATOM   5763  C  C   . LYS B 2 218 ? -7.025  9.438   27.518  1.00 40.33 ? 221  LYS B C   1 
ATOM   5764  O  O   . LYS B 2 218 ? -6.693  10.422  28.178  1.00 40.39 ? 221  LYS B O   1 
ATOM   5765  C  CB  . LYS B 2 218 ? -5.694  7.412   28.124  1.00 40.06 ? 221  LYS B CB  1 
ATOM   5766  C  CG  . LYS B 2 218 ? -6.899  6.582   28.516  1.00 40.42 ? 221  LYS B CG  1 
ATOM   5767  C  CD  . LYS B 2 218 ? -6.519  5.395   29.382  1.00 40.84 ? 221  LYS B CD  1 
ATOM   5768  C  CE  . LYS B 2 218 ? -5.917  5.831   30.702  1.00 41.33 ? 221  LYS B CE  1 
ATOM   5769  N  NZ  . LYS B 2 218 ? -5.646  4.671   31.603  1.00 41.65 ? 221  LYS B NZ  1 
ATOM   5770  N  N   . LEU B 2 219 ? -8.271  9.223   27.111  1.00 40.57 ? 222  LEU B N   1 
ATOM   5771  C  CA  . LEU B 2 219 ? -9.370  10.085  27.527  1.00 40.79 ? 222  LEU B CA  1 
ATOM   5772  C  C   . LEU B 2 219 ? -10.306 9.247   28.381  1.00 40.99 ? 222  LEU B C   1 
ATOM   5773  O  O   . LEU B 2 219 ? -10.513 8.063   28.105  1.00 40.95 ? 222  LEU B O   1 
ATOM   5774  C  CB  . LEU B 2 219 ? -10.122 10.646  26.318  1.00 40.78 ? 222  LEU B CB  1 
ATOM   5775  C  CG  . LEU B 2 219 ? -9.336  11.528  25.348  1.00 40.78 ? 222  LEU B CG  1 
ATOM   5776  C  CD1 . LEU B 2 219 ? -10.269 12.034  24.271  1.00 40.90 ? 222  LEU B CD1 1 
ATOM   5777  C  CD2 . LEU B 2 219 ? -8.698  12.692  26.080  1.00 40.82 ? 222  LEU B CD2 1 
ATOM   5778  N  N   . VAL B 2 220 ? -10.848 9.853   29.430  1.00 41.17 ? 223  VAL B N   1 
ATOM   5779  C  CA  . VAL B 2 220 ? -11.751 9.155   30.336  1.00 41.38 ? 223  VAL B CA  1 
ATOM   5780  C  C   . VAL B 2 220 ? -12.995 9.999   30.540  1.00 41.86 ? 223  VAL B C   1 
ATOM   5781  O  O   . VAL B 2 220 ? -12.886 11.187  30.838  1.00 41.89 ? 223  VAL B O   1 
ATOM   5782  C  CB  . VAL B 2 220 ? -11.079 8.928   31.700  1.00 41.23 ? 223  VAL B CB  1 
ATOM   5783  C  CG1 . VAL B 2 220 ? -12.011 8.197   32.631  1.00 41.04 ? 223  VAL B CG1 1 
ATOM   5784  C  CG2 . VAL B 2 220 ? -9.792  8.149   31.527  1.00 41.01 ? 223  VAL B CG2 1 
ATOM   5785  N  N   . ASN B 2 221 ? -14.173 9.403   30.363  1.00 42.33 ? 224  ASN B N   1 
ATOM   5786  C  CA  . ASN B 2 221 ? -15.413 10.154  30.547  1.00 42.86 ? 224  ASN B CA  1 
ATOM   5787  C  C   . ASN B 2 221 ? -16.014 9.993   31.943  1.00 43.24 ? 224  ASN B C   1 
ATOM   5788  O  O   . ASN B 2 221 ? -15.486 9.258   32.776  1.00 43.14 ? 224  ASN B O   1 
ATOM   5789  C  CB  . ASN B 2 221 ? -16.442 9.812   29.462  1.00 42.78 ? 224  ASN B CB  1 
ATOM   5790  C  CG  . ASN B 2 221 ? -16.975 8.402   29.571  1.00 42.90 ? 224  ASN B CG  1 
ATOM   5791  O  OD1 . ASN B 2 221 ? -16.963 7.790   30.639  1.00 42.99 ? 224  ASN B OD1 1 
ATOM   5792  N  ND2 . ASN B 2 221 ? -17.470 7.881   28.457  1.00 43.12 ? 224  ASN B ND2 1 
ATOM   5793  N  N   . ALA B 2 222 ? -17.125 10.684  32.184  1.00 43.70 ? 225  ALA B N   1 
ATOM   5794  C  CA  . ALA B 2 222 ? -17.815 10.649  33.471  1.00 44.15 ? 225  ALA B CA  1 
ATOM   5795  C  C   . ALA B 2 222 ? -18.149 9.233   33.948  1.00 44.54 ? 225  ALA B C   1 
ATOM   5796  O  O   . ALA B 2 222 ? -18.072 8.943   35.143  1.00 44.71 ? 225  ALA B O   1 
ATOM   5797  C  CB  . ALA B 2 222 ? -19.074 11.499  33.408  1.00 44.14 ? 225  ALA B CB  1 
ATOM   5798  N  N   . ASN B 2 223 ? -18.510 8.353   33.020  1.00 44.91 ? 226  ASN B N   1 
ATOM   5799  C  CA  . ASN B 2 223 ? -18.849 6.974   33.361  1.00 45.15 ? 226  ASN B CA  1 
ATOM   5800  C  C   . ASN B 2 223 ? -17.643 6.149   33.783  1.00 45.18 ? 226  ASN B C   1 
ATOM   5801  O  O   . ASN B 2 223 ? -17.795 5.071   34.348  1.00 45.25 ? 226  ASN B O   1 
ATOM   5802  C  CB  . ASN B 2 223 ? -19.525 6.293   32.174  1.00 45.56 ? 226  ASN B CB  1 
ATOM   5803  C  CG  . ASN B 2 223 ? -20.866 6.900   31.850  1.00 46.00 ? 226  ASN B CG  1 
ATOM   5804  O  OD1 . ASN B 2 223 ? -21.164 7.212   30.692  1.00 46.31 ? 226  ASN B OD1 1 
ATOM   5805  N  ND2 . ASN B 2 223 ? -21.690 7.078   32.878  1.00 46.23 ? 226  ASN B ND2 1 
ATOM   5806  N  N   . GLY B 2 224 ? -16.447 6.663   33.521  1.00 45.14 ? 227  GLY B N   1 
ATOM   5807  C  CA  . GLY B 2 224 ? -15.241 5.941   33.871  1.00 45.02 ? 227  GLY B CA  1 
ATOM   5808  C  C   . GLY B 2 224 ? -14.776 5.103   32.697  1.00 45.05 ? 227  GLY B C   1 
ATOM   5809  O  O   . GLY B 2 224 ? -13.962 4.194   32.860  1.00 45.05 ? 227  GLY B O   1 
ATOM   5810  N  N   . GLU B 2 225 ? -15.335 5.379   31.521  1.00 45.08 ? 228  GLU B N   1 
ATOM   5811  C  CA  . GLU B 2 225 ? -14.972 4.667   30.300  1.00 45.08 ? 228  GLU B CA  1 
ATOM   5812  C  C   . GLU B 2 225 ? -13.783 5.372   29.663  1.00 44.63 ? 228  GLU B C   1 
ATOM   5813  O  O   . GLU B 2 225 ? -13.678 6.600   29.709  1.00 44.49 ? 228  GLU B O   1 
ATOM   5814  C  CB  . GLU B 2 225 ? -16.152 4.644   29.328  1.00 45.91 ? 228  GLU B CB  1 
ATOM   5815  C  CG  . GLU B 2 225 ? -17.337 3.819   29.812  1.00 47.16 ? 228  GLU B CG  1 
ATOM   5816  C  CD  . GLU B 2 225 ? -18.659 4.210   29.147  1.00 48.06 ? 228  GLU B CD  1 
ATOM   5817  O  OE1 . GLU B 2 225 ? -18.658 4.749   28.011  1.00 48.48 ? 228  GLU B OE1 1 
ATOM   5818  O  OE2 . GLU B 2 225 ? -19.714 3.972   29.775  1.00 48.61 ? 228  GLU B OE2 1 
ATOM   5819  N  N   . ALA B 2 226 ? -12.897 4.601   29.047  1.00 44.03 ? 229  ALA B N   1 
ATOM   5820  C  CA  . ALA B 2 226 ? -11.717 5.187   28.437  1.00 43.51 ? 229  ALA B CA  1 
ATOM   5821  C  C   . ALA B 2 226 ? -11.481 4.777   27.004  1.00 43.10 ? 229  ALA B C   1 
ATOM   5822  O  O   . ALA B 2 226 ? -11.856 3.688   26.586  1.00 43.01 ? 229  ALA B O   1 
ATOM   5823  C  CB  . ALA B 2 226 ? -10.492 4.863   29.265  1.00 43.51 ? 229  ALA B CB  1 
ATOM   5824  N  N   . VAL B 2 227 ? -10.851 5.679   26.262  1.00 42.63 ? 230  VAL B N   1 
ATOM   5825  C  CA  . VAL B 2 227 ? -10.492 5.470   24.867  1.00 42.12 ? 230  VAL B CA  1 
ATOM   5826  C  C   . VAL B 2 227 ? -9.130  6.123   24.678  1.00 41.93 ? 230  VAL B C   1 
ATOM   5827  O  O   . VAL B 2 227 ? -8.699  6.926   25.507  1.00 41.76 ? 230  VAL B O   1 
ATOM   5828  C  CB  . VAL B 2 227 ? -11.494 6.142   23.882  1.00 42.17 ? 230  VAL B CB  1 
ATOM   5829  C  CG1 . VAL B 2 227 ? -12.862 5.493   23.982  1.00 42.03 ? 230  VAL B CG1 1 
ATOM   5830  C  CG2 . VAL B 2 227 ? -11.592 7.640   24.148  1.00 42.01 ? 230  VAL B CG2 1 
ATOM   5831  N  N   . TYR B 2 228 ? -8.433  5.744   23.614  1.00 41.69 ? 231  TYR B N   1 
ATOM   5832  C  CA  . TYR B 2 228 ? -7.134  6.331   23.319  1.00 41.37 ? 231  TYR B CA  1 
ATOM   5833  C  C   . TYR B 2 228 ? -7.349  7.411   22.276  1.00 41.26 ? 231  TYR B C   1 
ATOM   5834  O  O   . TYR B 2 228 ? -8.299  7.336   21.492  1.00 41.19 ? 231  TYR B O   1 
ATOM   5835  C  CB  . TYR B 2 228 ? -6.160  5.273   22.812  1.00 41.15 ? 231  TYR B CB  1 
ATOM   5836  C  CG  . TYR B 2 228 ? -5.661  4.343   23.897  1.00 41.00 ? 231  TYR B CG  1 
ATOM   5837  C  CD1 . TYR B 2 228 ? -4.982  4.837   25.011  1.00 40.95 ? 231  TYR B CD1 1 
ATOM   5838  C  CD2 . TYR B 2 228 ? -5.874  2.971   23.815  1.00 40.87 ? 231  TYR B CD2 1 
ATOM   5839  C  CE1 . TYR B 2 228 ? -4.529  3.977   26.018  1.00 40.96 ? 231  TYR B CE1 1 
ATOM   5840  C  CE2 . TYR B 2 228 ? -5.426  2.107   24.812  1.00 40.84 ? 231  TYR B CE2 1 
ATOM   5841  C  CZ  . TYR B 2 228 ? -4.757  2.613   25.907  1.00 40.91 ? 231  TYR B CZ  1 
ATOM   5842  O  OH  . TYR B 2 228 ? -4.315  1.749   26.882  1.00 41.03 ? 231  TYR B OH  1 
ATOM   5843  N  N   . CYS B 2 229 ? -6.488  8.424   22.272  1.00 40.96 ? 232  CYS B N   1 
ATOM   5844  C  CA  . CYS B 2 229 ? -6.635  9.507   21.315  1.00 40.84 ? 232  CYS B CA  1 
ATOM   5845  C  C   . CYS B 2 229 ? -5.324  10.138  20.869  1.00 40.80 ? 232  CYS B C   1 
ATOM   5846  O  O   . CYS B 2 229 ? -4.252  9.839   21.401  1.00 40.85 ? 232  CYS B O   1 
ATOM   5847  C  CB  . CYS B 2 229 ? -7.538  10.599  21.898  1.00 40.66 ? 232  CYS B CB  1 
ATOM   5848  S  SG  . CYS B 2 229 ? -6.741  11.626  23.159  1.00 40.95 ? 232  CYS B SG  1 
ATOM   5849  N  N   . LYS B 2 230 ? -5.438  10.994  19.859  1.00 40.66 ? 233  LYS B N   1 
ATOM   5850  C  CA  . LYS B 2 230 ? -4.324  11.751  19.299  1.00 40.45 ? 233  LYS B CA  1 
ATOM   5851  C  C   . LYS B 2 230 ? -4.819  13.189  19.258  1.00 40.48 ? 233  LYS B C   1 
ATOM   5852  O  O   . LYS B 2 230 ? -5.988  13.433  18.949  1.00 40.44 ? 233  LYS B O   1 
ATOM   5853  C  CB  . LYS B 2 230 ? -4.037  11.317  17.864  1.00 40.30 ? 233  LYS B CB  1 
ATOM   5854  C  CG  . LYS B 2 230 ? -3.437  9.948   17.707  1.00 40.06 ? 233  LYS B CG  1 
ATOM   5855  C  CD  . LYS B 2 230 ? -1.985  9.926   18.099  1.00 39.93 ? 233  LYS B CD  1 
ATOM   5856  C  CE  . LYS B 2 230 ? -1.361  8.596   17.734  1.00 39.68 ? 233  LYS B CE  1 
ATOM   5857  N  NZ  . LYS B 2 230 ? 0.063   8.559   18.143  1.00 39.82 ? 233  LYS B NZ  1 
ATOM   5858  N  N   . PHE B 2 231 ? -3.950  14.141  19.577  1.00 40.42 ? 234  PHE B N   1 
ATOM   5859  C  CA  . PHE B 2 231 ? -4.334  15.549  19.542  1.00 40.35 ? 234  PHE B CA  1 
ATOM   5860  C  C   . PHE B 2 231 ? -3.796  16.213  18.284  1.00 40.46 ? 234  PHE B C   1 
ATOM   5861  O  O   . PHE B 2 231 ? -2.623  16.045  17.952  1.00 40.43 ? 234  PHE B O   1 
ATOM   5862  C  CB  . PHE B 2 231 ? -3.820  16.276  20.781  1.00 40.04 ? 234  PHE B CB  1 
ATOM   5863  C  CG  . PHE B 2 231 ? -4.476  15.832  22.048  1.00 39.84 ? 234  PHE B CG  1 
ATOM   5864  C  CD1 . PHE B 2 231 ? -5.792  16.188  22.327  1.00 39.83 ? 234  PHE B CD1 1 
ATOM   5865  C  CD2 . PHE B 2 231 ? -3.787  15.058  22.967  1.00 39.68 ? 234  PHE B CD2 1 
ATOM   5866  C  CE1 . PHE B 2 231 ? -6.407  15.775  23.503  1.00 39.68 ? 234  PHE B CE1 1 
ATOM   5867  C  CE2 . PHE B 2 231 ? -4.395  14.643  24.145  1.00 39.57 ? 234  PHE B CE2 1 
ATOM   5868  C  CZ  . PHE B 2 231 ? -5.705  14.999  24.414  1.00 39.56 ? 234  PHE B CZ  1 
ATOM   5869  N  N   . HIS B 2 232 ? -4.665  16.934  17.573  1.00 40.54 ? 235  HIS B N   1 
ATOM   5870  C  CA  . HIS B 2 232 ? -4.286  17.634  16.342  1.00 40.56 ? 235  HIS B CA  1 
ATOM   5871  C  C   . HIS B 2 232 ? -4.821  19.060  16.326  1.00 40.62 ? 235  HIS B C   1 
ATOM   5872  O  O   . HIS B 2 232 ? -5.964  19.299  16.705  1.00 40.65 ? 235  HIS B O   1 
ATOM   5873  C  CB  . HIS B 2 232 ? -4.881  16.957  15.101  1.00 40.68 ? 235  HIS B CB  1 
ATOM   5874  C  CG  . HIS B 2 232 ? -4.504  15.519  14.930  1.00 41.04 ? 235  HIS B CG  1 
ATOM   5875  N  ND1 . HIS B 2 232 ? -3.513  15.110  14.063  1.00 41.04 ? 235  HIS B ND1 1 
ATOM   5876  C  CD2 . HIS B 2 232 ? -5.044  14.387  15.445  1.00 41.03 ? 235  HIS B CD2 1 
ATOM   5877  C  CE1 . HIS B 2 232 ? -3.464  13.789  14.047  1.00 41.15 ? 235  HIS B CE1 1 
ATOM   5878  N  NE2 . HIS B 2 232 ? -4.382  13.326  14.876  1.00 41.05 ? 235  HIS B NE2 1 
ATOM   5879  N  N   . TYR B 2 233 ? -3.991  20.004  15.896  1.00 40.64 ? 236  TYR B N   1 
ATOM   5880  C  CA  . TYR B 2 233 ? -4.415  21.395  15.756  1.00 40.80 ? 236  TYR B CA  1 
ATOM   5881  C  C   . TYR B 2 233 ? -3.891  21.925  14.420  1.00 41.21 ? 236  TYR B C   1 
ATOM   5882  O  O   . TYR B 2 233 ? -2.724  22.306  14.288  1.00 41.12 ? 236  TYR B O   1 
ATOM   5883  C  CB  . TYR B 2 233 ? -4.024  22.294  16.950  1.00 40.34 ? 236  TYR B CB  1 
ATOM   5884  C  CG  . TYR B 2 233 ? -2.786  21.930  17.755  1.00 39.99 ? 236  TYR B CG  1 
ATOM   5885  C  CD1 . TYR B 2 233 ? -1.726  22.825  17.876  1.00 39.75 ? 236  TYR B CD1 1 
ATOM   5886  C  CD2 . TYR B 2 233 ? -2.713  20.734  18.475  1.00 39.86 ? 236  TYR B CD2 1 
ATOM   5887  C  CE1 . TYR B 2 233 ? -0.629  22.545  18.697  1.00 39.64 ? 236  TYR B CE1 1 
ATOM   5888  C  CE2 . TYR B 2 233 ? -1.618  20.446  19.296  1.00 39.62 ? 236  TYR B CE2 1 
ATOM   5889  C  CZ  . TYR B 2 233 ? -0.583  21.357  19.401  1.00 39.60 ? 236  TYR B CZ  1 
ATOM   5890  O  OH  . TYR B 2 233 ? 0.496   21.082  20.206  1.00 39.27 ? 236  TYR B OH  1 
ATOM   5891  N  N   . LYS B 2 234 ? -4.758  21.868  13.410  1.00 41.50 ? 237  LYS B N   1 
ATOM   5892  C  CA  . LYS B 2 234 ? -4.420  22.293  12.055  1.00 41.80 ? 237  LYS B CA  1 
ATOM   5893  C  C   . LYS B 2 234 ? -4.403  23.795  11.898  1.00 41.59 ? 237  LYS B C   1 
ATOM   5894  O  O   . LYS B 2 234 ? -5.253  24.488  12.449  1.00 41.59 ? 237  LYS B O   1 
ATOM   5895  C  CB  . LYS B 2 234 ? -5.408  21.702  11.049  1.00 42.50 ? 237  LYS B CB  1 
ATOM   5896  C  CG  . LYS B 2 234 ? -5.484  20.180  11.031  1.00 43.53 ? 237  LYS B CG  1 
ATOM   5897  C  CD  . LYS B 2 234 ? -4.146  19.540  10.671  1.00 44.60 ? 237  LYS B CD  1 
ATOM   5898  C  CE  . LYS B 2 234 ? -4.327  18.107  10.137  1.00 45.25 ? 237  LYS B CE  1 
ATOM   5899  N  NZ  . LYS B 2 234 ? -5.101  18.098  8.837   1.00 45.60 ? 237  LYS B NZ  1 
ATOM   5900  N  N   . THR B 2 235 ? -3.454  24.289  11.108  1.00 41.35 ? 238  THR B N   1 
ATOM   5901  C  CA  . THR B 2 235 ? -3.331  25.720  10.873  1.00 41.08 ? 238  THR B CA  1 
ATOM   5902  C  C   . THR B 2 235 ? -4.428  26.301  9.987   1.00 41.18 ? 238  THR B C   1 
ATOM   5903  O  O   . THR B 2 235 ? -4.650  25.848  8.861   1.00 40.93 ? 238  THR B O   1 
ATOM   5904  C  CB  . THR B 2 235 ? -1.959  26.091  10.281  1.00 41.06 ? 238  THR B CB  1 
ATOM   5905  O  OG1 . THR B 2 235 ? -1.961  27.477  9.920   1.00 40.77 ? 238  THR B OG1 1 
ATOM   5906  C  CG2 . THR B 2 235 ? -1.635  25.235  9.060   1.00 40.91 ? 238  THR B CG2 1 
ATOM   5907  N  N   . ASP B 2 236 ? -5.107  27.316  10.513  1.00 41.13 ? 239  ASP B N   1 
ATOM   5908  C  CA  . ASP B 2 236 ? -6.171  27.987  9.785   1.00 41.12 ? 239  ASP B CA  1 
ATOM   5909  C  C   . ASP B 2 236 ? -5.587  28.975  8.776   1.00 41.24 ? 239  ASP B C   1 
ATOM   5910  O  O   . ASP B 2 236 ? -6.314  29.531  7.952   1.00 41.39 ? 239  ASP B O   1 
ATOM   5911  C  CB  . ASP B 2 236 ? -7.121  28.700  10.753  1.00 40.97 ? 239  ASP B CB  1 
ATOM   5912  C  CG  . ASP B 2 236 ? -7.937  27.733  11.600  1.00 40.92 ? 239  ASP B CG  1 
ATOM   5913  O  OD1 . ASP B 2 236 ? -8.444  28.156  12.661  1.00 40.91 ? 239  ASP B OD1 1 
ATOM   5914  O  OD2 . ASP B 2 236 ? -8.090  26.556  11.208  1.00 40.90 ? 239  ASP B OD2 1 
ATOM   5915  N  N   . GLN B 2 237 ? -4.278  29.215  8.862   1.00 41.18 ? 240  GLN B N   1 
ATOM   5916  C  CA  . GLN B 2 237 ? -3.600  30.117  7.933   1.00 41.06 ? 240  GLN B CA  1 
ATOM   5917  C  C   . GLN B 2 237 ? -3.086  29.303  6.752   1.00 41.14 ? 240  GLN B C   1 
ATOM   5918  O  O   . GLN B 2 237 ? -2.642  29.855  5.741   1.00 41.02 ? 240  GLN B O   1 
ATOM   5919  C  CB  . GLN B 2 237 ? -2.421  30.830  8.606   1.00 40.97 ? 240  GLN B CB  1 
ATOM   5920  C  CG  . GLN B 2 237 ? -2.791  31.872  9.646   1.00 40.68 ? 240  GLN B CG  1 
ATOM   5921  C  CD  . GLN B 2 237 ? -3.369  31.266  10.900  1.00 40.58 ? 240  GLN B CD  1 
ATOM   5922  O  OE1 . GLN B 2 237 ? -4.499  31.564  11.281  1.00 40.32 ? 240  GLN B OE1 1 
ATOM   5923  N  NE2 . GLN B 2 237 ? -2.598  30.403  11.548  1.00 40.48 ? 240  GLN B NE2 1 
ATOM   5924  N  N   . GLY B 2 238 ? -3.135  27.982  6.904   1.00 41.28 ? 241  GLY B N   1 
ATOM   5925  C  CA  . GLY B 2 238 ? -2.686  27.079  5.859   1.00 41.37 ? 241  GLY B CA  1 
ATOM   5926  C  C   . GLY B 2 238 ? -1.201  26.786  5.889   1.00 41.42 ? 241  GLY B C   1 
ATOM   5927  O  O   . GLY B 2 238 ? -0.407  27.619  6.324   1.00 41.37 ? 241  GLY B O   1 
ATOM   5928  N  N   . ILE B 2 239 ? -0.833  25.585  5.445   1.00 41.55 ? 242  ILE B N   1 
ATOM   5929  C  CA  . ILE B 2 239 ? 0.563   25.162  5.383   1.00 41.59 ? 242  ILE B CA  1 
ATOM   5930  C  C   . ILE B 2 239 ? 1.328   26.023  4.370   1.00 41.82 ? 242  ILE B C   1 
ATOM   5931  O  O   . ILE B 2 239 ? 0.845   26.281  3.262   1.00 41.87 ? 242  ILE B O   1 
ATOM   5932  C  CB  . ILE B 2 239 ? 0.670   23.675  4.975   1.00 41.42 ? 242  ILE B CB  1 
ATOM   5933  C  CG1 . ILE B 2 239 ? 0.157   22.784  6.102   1.00 41.32 ? 242  ILE B CG1 1 
ATOM   5934  C  CG2 . ILE B 2 239 ? 2.104   23.308  4.650   1.00 41.29 ? 242  ILE B CG2 1 
ATOM   5935  C  CD1 . ILE B 2 239 ? 0.981   22.865  7.356   1.00 41.35 ? 242  ILE B CD1 1 
ATOM   5936  N  N   . LYS B 2 240 ? 2.525   26.456  4.753   1.00 41.94 ? 243  LYS B N   1 
ATOM   5937  C  CA  . LYS B 2 240 ? 3.361   27.289  3.894   1.00 42.02 ? 243  LYS B CA  1 
ATOM   5938  C  C   . LYS B 2 240 ? 4.789   27.111  4.398   1.00 41.94 ? 243  LYS B C   1 
ATOM   5939  O  O   . LYS B 2 240 ? 5.038   27.224  5.595   1.00 42.01 ? 243  LYS B O   1 
ATOM   5940  C  CB  . LYS B 2 240 ? 2.907   28.742  4.021   1.00 42.36 ? 243  LYS B CB  1 
ATOM   5941  C  CG  . LYS B 2 240 ? 3.535   29.723  3.062   1.00 43.00 ? 243  LYS B CG  1 
ATOM   5942  C  CD  . LYS B 2 240 ? 2.987   31.116  3.358   1.00 43.79 ? 243  LYS B CD  1 
ATOM   5943  C  CE  . LYS B 2 240 ? 3.625   32.187  2.479   1.00 44.52 ? 243  LYS B CE  1 
ATOM   5944  N  NZ  . LYS B 2 240 ? 3.206   33.575  2.877   1.00 44.84 ? 243  LYS B NZ  1 
ATOM   5945  N  N   . ASN B 2 241 ? 5.714   26.793  3.498   1.00 41.64 ? 244  ASN B N   1 
ATOM   5946  C  CA  . ASN B 2 241 ? 7.107   26.566  3.882   1.00 41.39 ? 244  ASN B CA  1 
ATOM   5947  C  C   . ASN B 2 241 ? 8.088   27.498  3.172   1.00 41.41 ? 244  ASN B C   1 
ATOM   5948  O  O   . ASN B 2 241 ? 7.717   28.239  2.262   1.00 41.42 ? 244  ASN B O   1 
ATOM   5949  C  CB  . ASN B 2 241 ? 7.499   25.115  3.583   1.00 41.18 ? 244  ASN B CB  1 
ATOM   5950  C  CG  . ASN B 2 241 ? 6.499   24.111  4.121   1.00 40.99 ? 244  ASN B CG  1 
ATOM   5951  O  OD1 . ASN B 2 241 ? 6.201   24.094  5.314   1.00 40.93 ? 244  ASN B OD1 1 
ATOM   5952  N  ND2 . ASN B 2 241 ? 5.980   23.261  3.239   1.00 40.86 ? 244  ASN B ND2 1 
ATOM   5953  N  N   . LEU B 2 242 ? 9.344   27.462  3.602   1.00 41.26 ? 245  LEU B N   1 
ATOM   5954  C  CA  . LEU B 2 242 ? 10.383  28.284  2.996   1.00 41.18 ? 245  LEU B CA  1 
ATOM   5955  C  C   . LEU B 2 242 ? 11.326  27.405  2.195   1.00 41.20 ? 245  LEU B C   1 
ATOM   5956  O  O   . LEU B 2 242 ? 11.711  26.333  2.648   1.00 41.20 ? 245  LEU B O   1 
ATOM   5957  C  CB  . LEU B 2 242 ? 11.182  29.016  4.075   1.00 40.98 ? 245  LEU B CB  1 
ATOM   5958  C  CG  . LEU B 2 242 ? 10.486  30.164  4.796   1.00 40.78 ? 245  LEU B CG  1 
ATOM   5959  C  CD1 . LEU B 2 242 ? 11.376  30.662  5.907   1.00 40.69 ? 245  LEU B CD1 1 
ATOM   5960  C  CD2 . LEU B 2 242 ? 10.161  31.284  3.812   1.00 40.68 ? 245  LEU B CD2 1 
ATOM   5961  N  N   . SER B 2 243 ? 11.698  27.851  1.001   1.00 41.17 ? 246  SER B N   1 
ATOM   5962  C  CA  . SER B 2 243 ? 12.610  27.082  0.175   1.00 41.20 ? 246  SER B CA  1 
ATOM   5963  C  C   . SER B 2 243 ? 13.959  27.060  0.869   1.00 41.41 ? 246  SER B C   1 
ATOM   5964  O  O   . SER B 2 243 ? 14.230  27.886  1.737   1.00 41.27 ? 246  SER B O   1 
ATOM   5965  C  CB  . SER B 2 243 ? 12.752  27.720  -1.199  1.00 41.06 ? 246  SER B CB  1 
ATOM   5966  O  OG  . SER B 2 243 ? 13.403  28.970  -1.102  1.00 41.25 ? 246  SER B OG  1 
ATOM   5967  N  N   . VAL B 2 244 ? 14.802  26.113  0.483   1.00 41.73 ? 247  VAL B N   1 
ATOM   5968  C  CA  . VAL B 2 244 ? 16.123  25.991  1.071   1.00 42.01 ? 247  VAL B CA  1 
ATOM   5969  C  C   . VAL B 2 244 ? 16.928  27.274  0.865   1.00 42.43 ? 247  VAL B C   1 
ATOM   5970  O  O   . VAL B 2 244 ? 17.640  27.707  1.769   1.00 42.31 ? 247  VAL B O   1 
ATOM   5971  C  CB  . VAL B 2 244 ? 16.873  24.771  0.492   1.00 41.93 ? 247  VAL B CB  1 
ATOM   5972  C  CG1 . VAL B 2 244 ? 18.301  24.731  1.000   1.00 42.03 ? 247  VAL B CG1 1 
ATOM   5973  C  CG2 . VAL B 2 244 ? 16.164  23.498  0.888   1.00 41.75 ? 247  VAL B CG2 1 
ATOM   5974  N  N   . GLU B 2 245 ? 16.787  27.897  -0.305  1.00 42.87 ? 248  GLU B N   1 
ATOM   5975  C  CA  . GLU B 2 245 ? 17.509  29.132  -0.603  1.00 43.38 ? 248  GLU B CA  1 
ATOM   5976  C  C   . GLU B 2 245 ? 17.001  30.287  0.248   1.00 43.18 ? 248  GLU B C   1 
ATOM   5977  O  O   . GLU B 2 245 ? 17.792  31.054  0.792   1.00 43.13 ? 248  GLU B O   1 
ATOM   5978  C  CB  . GLU B 2 245 ? 17.382  29.512  -2.077  1.00 44.29 ? 248  GLU B CB  1 
ATOM   5979  C  CG  . GLU B 2 245 ? 17.677  28.388  -3.040  1.00 46.08 ? 248  GLU B CG  1 
ATOM   5980  C  CD  . GLU B 2 245 ? 16.465  27.482  -3.273  1.00 47.02 ? 248  GLU B CD  1 
ATOM   5981  O  OE1 . GLU B 2 245 ? 15.631  27.825  -4.152  1.00 47.57 ? 248  GLU B OE1 1 
ATOM   5982  O  OE2 . GLU B 2 245 ? 16.353  26.433  -2.588  1.00 47.32 ? 248  GLU B OE2 1 
ATOM   5983  N  N   . ASP B 2 246 ? 15.682  30.421  0.353   1.00 42.97 ? 249  ASP B N   1 
ATOM   5984  C  CA  . ASP B 2 246 ? 15.100  31.499  1.144   1.00 42.88 ? 249  ASP B CA  1 
ATOM   5985  C  C   . ASP B 2 246 ? 15.409  31.335  2.620   1.00 42.66 ? 249  ASP B C   1 
ATOM   5986  O  O   . ASP B 2 246 ? 15.752  32.304  3.295   1.00 42.57 ? 249  ASP B O   1 
ATOM   5987  C  CB  . ASP B 2 246 ? 13.588  31.589  0.931   1.00 43.20 ? 249  ASP B CB  1 
ATOM   5988  C  CG  . ASP B 2 246 ? 13.218  32.220  -0.404  1.00 43.67 ? 249  ASP B CG  1 
ATOM   5989  O  OD1 . ASP B 2 246 ? 12.056  32.055  -0.832  1.00 44.07 ? 249  ASP B OD1 1 
ATOM   5990  O  OD2 . ASP B 2 246 ? 14.073  32.890  -1.027  1.00 44.14 ? 249  ASP B OD2 1 
ATOM   5991  N  N   . ALA B 2 247 ? 15.296  30.106  3.113   1.00 42.45 ? 250  ALA B N   1 
ATOM   5992  C  CA  . ALA B 2 247 ? 15.573  29.815  4.514   1.00 42.29 ? 250  ALA B CA  1 
ATOM   5993  C  C   . ALA B 2 247 ? 17.021  30.164  4.852   1.00 42.30 ? 250  ALA B C   1 
ATOM   5994  O  O   . ALA B 2 247 ? 17.305  30.721  5.914   1.00 42.19 ? 250  ALA B O   1 
ATOM   5995  C  CB  . ALA B 2 247 ? 15.296  28.356  4.811   1.00 42.18 ? 250  ALA B CB  1 
ATOM   5996  N  N   . ALA B 2 248 ? 17.930  29.857  3.933   1.00 42.28 ? 251  ALA B N   1 
ATOM   5997  C  CA  . ALA B 2 248 ? 19.341  30.151  4.125   1.00 42.18 ? 251  ALA B CA  1 
ATOM   5998  C  C   . ALA B 2 248 ? 19.558  31.664  4.157   1.00 42.33 ? 251  ALA B C   1 
ATOM   5999  O  O   . ALA B 2 248 ? 20.208  32.187  5.060   1.00 42.37 ? 251  ALA B O   1 
ATOM   6000  C  CB  . ALA B 2 248 ? 20.160  29.526  3.014   1.00 42.01 ? 251  ALA B CB  1 
ATOM   6001  N  N   . ARG B 2 249 ? 18.982  32.364  3.186   1.00 42.35 ? 252  ARG B N   1 
ATOM   6002  C  CA  . ARG B 2 249 ? 19.114  33.809  3.093   1.00 42.39 ? 252  ARG B CA  1 
ATOM   6003  C  C   . ARG B 2 249 ? 18.573  34.481  4.342   1.00 42.24 ? 252  ARG B C   1 
ATOM   6004  O  O   . ARG B 2 249 ? 19.190  35.405  4.870   1.00 42.27 ? 252  ARG B O   1 
ATOM   6005  C  CB  . ARG B 2 249 ? 18.351  34.327  1.878   1.00 42.88 ? 252  ARG B CB  1 
ATOM   6006  C  CG  . ARG B 2 249 ? 18.719  35.738  1.466   1.00 43.58 ? 252  ARG B CG  1 
ATOM   6007  C  CD  . ARG B 2 249 ? 17.659  36.324  0.546   1.00 44.30 ? 252  ARG B CD  1 
ATOM   6008  N  NE  . ARG B 2 249 ? 16.419  36.606  1.274   1.00 45.07 ? 252  ARG B NE  1 
ATOM   6009  C  CZ  . ARG B 2 249 ? 15.243  36.037  1.017   1.00 45.31 ? 252  ARG B CZ  1 
ATOM   6010  N  NH1 . ARG B 2 249 ? 15.130  35.143  0.039   1.00 45.36 ? 252  ARG B NH1 1 
ATOM   6011  N  NH2 . ARG B 2 249 ? 14.180  36.366  1.741   1.00 45.33 ? 252  ARG B NH2 1 
ATOM   6012  N  N   . LEU B 2 250 ? 17.425  34.009  4.818   1.00 41.86 ? 253  LEU B N   1 
ATOM   6013  C  CA  . LEU B 2 250 ? 16.800  34.573  6.008   1.00 41.60 ? 253  LEU B CA  1 
ATOM   6014  C  C   . LEU B 2 250 ? 17.552  34.286  7.307   1.00 41.63 ? 253  LEU B C   1 
ATOM   6015  O  O   . LEU B 2 250 ? 17.476  35.072  8.246   1.00 41.58 ? 253  LEU B O   1 
ATOM   6016  C  CB  . LEU B 2 250 ? 15.349  34.110  6.128   1.00 41.30 ? 253  LEU B CB  1 
ATOM   6017  C  CG  . LEU B 2 250 ? 14.362  34.627  5.081   1.00 41.13 ? 253  LEU B CG  1 
ATOM   6018  C  CD1 . LEU B 2 250 ? 13.038  33.893  5.217   1.00 40.97 ? 253  LEU B CD1 1 
ATOM   6019  C  CD2 . LEU B 2 250 ? 14.169  36.125  5.232   1.00 40.95 ? 253  LEU B CD2 1 
ATOM   6020  N  N   . SER B 2 251 ? 18.274  33.171  7.372   1.00 41.69 ? 254  SER B N   1 
ATOM   6021  C  CA  . SER B 2 251 ? 19.030  32.837  8.577   1.00 41.86 ? 254  SER B CA  1 
ATOM   6022  C  C   . SER B 2 251 ? 20.146  33.861  8.773   1.00 42.05 ? 254  SER B C   1 
ATOM   6023  O  O   . SER B 2 251 ? 20.694  34.011  9.868   1.00 42.01 ? 254  SER B O   1 
ATOM   6024  C  CB  . SER B 2 251 ? 19.623  31.434  8.472   1.00 41.56 ? 254  SER B CB  1 
ATOM   6025  O  OG  . SER B 2 251 ? 20.699  31.408  7.557   1.00 41.67 ? 254  SER B OG  1 
ATOM   6026  N  N   . GLN B 2 252 ? 20.472  34.560  7.693   1.00 42.21 ? 255  GLN B N   1 
ATOM   6027  C  CA  . GLN B 2 252 ? 21.497  35.581  7.713   1.00 42.51 ? 255  GLN B CA  1 
ATOM   6028  C  C   . GLN B 2 252 ? 20.846  36.943  7.938   1.00 42.36 ? 255  GLN B C   1 
ATOM   6029  O  O   . GLN B 2 252 ? 21.207  37.656  8.867   1.00 42.43 ? 255  GLN B O   1 
ATOM   6030  C  CB  . GLN B 2 252 ? 22.258  35.569  6.386   1.00 43.05 ? 255  GLN B CB  1 
ATOM   6031  C  CG  . GLN B 2 252 ? 23.523  36.408  6.365   1.00 44.09 ? 255  GLN B CG  1 
ATOM   6032  C  CD  . GLN B 2 252 ? 23.270  37.909  6.230   1.00 44.87 ? 255  GLN B CD  1 
ATOM   6033  O  OE1 . GLN B 2 252 ? 23.755  38.716  7.045   1.00 45.39 ? 255  GLN B OE1 1 
ATOM   6034  N  NE2 . GLN B 2 252 ? 22.532  38.295  5.189   1.00 44.99 ? 255  GLN B NE2 1 
ATOM   6035  N  N   . GLU B 2 253 ? 19.869  37.288  7.104   1.00 42.19 ? 256  GLU B N   1 
ATOM   6036  C  CA  . GLU B 2 253 ? 19.186  38.576  7.197   1.00 42.07 ? 256  GLU B CA  1 
ATOM   6037  C  C   . GLU B 2 253 ? 18.429  38.819  8.493   1.00 41.86 ? 256  GLU B C   1 
ATOM   6038  O  O   . GLU B 2 253 ? 18.514  39.901  9.070   1.00 41.75 ? 256  GLU B O   1 
ATOM   6039  C  CB  . GLU B 2 253 ? 18.237  38.754  6.017   1.00 42.41 ? 256  GLU B CB  1 
ATOM   6040  C  CG  . GLU B 2 253 ? 18.939  38.759  4.679   1.00 43.04 ? 256  GLU B CG  1 
ATOM   6041  C  CD  . GLU B 2 253 ? 17.995  38.945  3.504   1.00 43.48 ? 256  GLU B CD  1 
ATOM   6042  O  OE1 . GLU B 2 253 ? 16.755  38.941  3.702   1.00 43.58 ? 256  GLU B OE1 1 
ATOM   6043  O  OE2 . GLU B 2 253 ? 18.508  39.092  2.370   1.00 43.87 ? 256  GLU B OE2 1 
ATOM   6044  N  N   . ASP B 2 254 ? 17.682  37.818  8.945   1.00 41.50 ? 257  ASP B N   1 
ATOM   6045  C  CA  . ASP B 2 254 ? 16.902  37.943  10.174  1.00 41.00 ? 257  ASP B CA  1 
ATOM   6046  C  C   . ASP B 2 254 ? 16.841  36.610  10.931  1.00 40.62 ? 257  ASP B C   1 
ATOM   6047  O  O   . ASP B 2 254 ? 15.940  35.798  10.706  1.00 40.66 ? 257  ASP B O   1 
ATOM   6048  C  CB  . ASP B 2 254 ? 15.483  38.429  9.836   1.00 41.17 ? 257  ASP B CB  1 
ATOM   6049  C  CG  . ASP B 2 254 ? 14.668  38.796  11.068  1.00 41.31 ? 257  ASP B CG  1 
ATOM   6050  O  OD1 . ASP B 2 254 ? 15.197  38.765  12.202  1.00 41.63 ? 257  ASP B OD1 1 
ATOM   6051  O  OD2 . ASP B 2 254 ? 13.482  39.128  10.896  1.00 41.63 ? 257  ASP B OD2 1 
ATOM   6052  N  N   . PRO B 2 255 ? 17.804  36.368  11.839  1.00 40.09 ? 258  PRO B N   1 
ATOM   6053  C  CA  . PRO B 2 255 ? 17.831  35.125  12.615  1.00 39.68 ? 258  PRO B CA  1 
ATOM   6054  C  C   . PRO B 2 255 ? 16.585  34.947  13.475  1.00 39.36 ? 258  PRO B C   1 
ATOM   6055  O  O   . PRO B 2 255 ? 16.297  33.843  13.929  1.00 39.33 ? 258  PRO B O   1 
ATOM   6056  C  CB  . PRO B 2 255 ? 19.071  35.301  13.490  1.00 39.62 ? 258  PRO B CB  1 
ATOM   6057  C  CG  . PRO B 2 255 ? 19.954  36.156  12.650  1.00 39.72 ? 258  PRO B CG  1 
ATOM   6058  C  CD  . PRO B 2 255 ? 18.995  37.185  12.129  1.00 39.90 ? 258  PRO B CD  1 
ATOM   6059  N  N   . ASP B 2 256 ? 15.839  36.033  13.673  1.00 39.01 ? 259  ASP B N   1 
ATOM   6060  C  CA  . ASP B 2 256 ? 14.637  36.010  14.498  1.00 38.84 ? 259  ASP B CA  1 
ATOM   6061  C  C   . ASP B 2 256 ? 13.360  36.212  13.686  1.00 38.71 ? 259  ASP B C   1 
ATOM   6062  O  O   . ASP B 2 256 ? 12.405  36.835  14.145  1.00 38.86 ? 259  ASP B O   1 
ATOM   6063  C  CB  . ASP B 2 256 ? 14.749  37.076  15.596  1.00 38.64 ? 259  ASP B CB  1 
ATOM   6064  C  CG  . ASP B 2 256 ? 16.036  36.956  16.400  1.00 38.58 ? 259  ASP B CG  1 
ATOM   6065  O  OD1 . ASP B 2 256 ? 16.391  35.826  16.810  1.00 38.59 ? 259  ASP B OD1 1 
ATOM   6066  O  OD2 . ASP B 2 256 ? 16.700  37.992  16.615  1.00 38.40 ? 259  ASP B OD2 1 
ATOM   6067  N  N   . TYR B 2 257 ? 13.346  35.646  12.487  1.00 38.68 ? 260  TYR B N   1 
ATOM   6068  C  CA  . TYR B 2 257 ? 12.215  35.734  11.570  1.00 38.41 ? 260  TYR B CA  1 
ATOM   6069  C  C   . TYR B 2 257 ? 10.911  35.280  12.211  1.00 38.19 ? 260  TYR B C   1 
ATOM   6070  O  O   . TYR B 2 257 ? 9.906   35.982  12.121  1.00 38.23 ? 260  TYR B O   1 
ATOM   6071  C  CB  . TYR B 2 257 ? 12.513  34.892  10.323  1.00 38.67 ? 260  TYR B CB  1 
ATOM   6072  C  CG  . TYR B 2 257 ? 11.448  34.895  9.246   1.00 38.78 ? 260  TYR B CG  1 
ATOM   6073  C  CD1 . TYR B 2 257 ? 10.557  33.828  9.115   1.00 38.72 ? 260  TYR B CD1 1 
ATOM   6074  C  CD2 . TYR B 2 257 ? 11.363  35.940  8.327   1.00 38.80 ? 260  TYR B CD2 1 
ATOM   6075  C  CE1 . TYR B 2 257 ? 9.610   33.803  8.093   1.00 38.95 ? 260  TYR B CE1 1 
ATOM   6076  C  CE2 . TYR B 2 257 ? 10.418  35.922  7.301   1.00 38.92 ? 260  TYR B CE2 1 
ATOM   6077  C  CZ  . TYR B 2 257 ? 9.550   34.854  7.191   1.00 38.99 ? 260  TYR B CZ  1 
ATOM   6078  O  OH  . TYR B 2 257 ? 8.633   34.835  6.173   1.00 38.97 ? 260  TYR B OH  1 
ATOM   6079  N  N   . GLY B 2 258 ? 10.929  34.113  12.854  1.00 37.91 ? 261  GLY B N   1 
ATOM   6080  C  CA  . GLY B 2 258 ? 9.730   33.584  13.495  1.00 37.63 ? 261  GLY B CA  1 
ATOM   6081  C  C   . GLY B 2 258 ? 9.178   34.443  14.623  1.00 37.50 ? 261  GLY B C   1 
ATOM   6082  O  O   . GLY B 2 258 ? 7.967   34.524  14.823  1.00 37.39 ? 261  GLY B O   1 
ATOM   6083  N  N   . ILE B 2 259 ? 10.070  35.065  15.385  1.00 37.36 ? 262  ILE B N   1 
ATOM   6084  C  CA  . ILE B 2 259 ? 9.669   35.925  16.485  1.00 37.09 ? 262  ILE B CA  1 
ATOM   6085  C  C   . ILE B 2 259 ? 8.983   37.166  15.916  1.00 37.32 ? 262  ILE B C   1 
ATOM   6086  O  O   . ILE B 2 259 ? 7.836   37.461  16.250  1.00 37.32 ? 262  ILE B O   1 
ATOM   6087  C  CB  . ILE B 2 259 ? 10.890  36.342  17.321  1.00 36.81 ? 262  ILE B CB  1 
ATOM   6088  C  CG1 . ILE B 2 259 ? 11.561  35.105  17.917  1.00 36.44 ? 262  ILE B CG1 1 
ATOM   6089  C  CG2 . ILE B 2 259 ? 10.479  37.318  18.413  1.00 36.72 ? 262  ILE B CG2 1 
ATOM   6090  C  CD1 . ILE B 2 259 ? 12.810  35.407  18.722  1.00 36.17 ? 262  ILE B CD1 1 
ATOM   6091  N  N   . ARG B 2 260 ? 9.681   37.860  15.021  1.00 37.46 ? 263  ARG B N   1 
ATOM   6092  C  CA  . ARG B 2 260 ? 9.167   39.072  14.387  1.00 37.70 ? 263  ARG B CA  1 
ATOM   6093  C  C   . ARG B 2 260 ? 7.818   38.819  13.727  1.00 37.87 ? 263  ARG B C   1 
ATOM   6094  O  O   . ARG B 2 260 ? 6.851   39.546  13.957  1.00 37.63 ? 263  ARG B O   1 
ATOM   6095  C  CB  . ARG B 2 260 ? 10.166  39.578  13.340  1.00 37.73 ? 263  ARG B CB  1 
ATOM   6096  C  CG  . ARG B 2 260 ? 9.794   40.913  12.715  1.00 37.74 ? 263  ARG B CG  1 
ATOM   6097  C  CD  . ARG B 2 260 ? 10.764  41.284  11.619  1.00 37.90 ? 263  ARG B CD  1 
ATOM   6098  N  NE  . ARG B 2 260 ? 12.140  41.189  12.089  1.00 38.34 ? 263  ARG B NE  1 
ATOM   6099  C  CZ  . ARG B 2 260 ? 12.756  42.119  12.814  1.00 38.64 ? 263  ARG B CZ  1 
ATOM   6100  N  NH1 . ARG B 2 260 ? 12.121  43.237  13.149  1.00 38.60 ? 263  ARG B NH1 1 
ATOM   6101  N  NH2 . ARG B 2 260 ? 13.995  41.908  13.244  1.00 38.70 ? 263  ARG B NH2 1 
ATOM   6102  N  N   . ASP B 2 261 ? 7.768   37.770  12.911  1.00 38.04 ? 264  ASP B N   1 
ATOM   6103  C  CA  . ASP B 2 261 ? 6.558   37.387  12.202  1.00 38.20 ? 264  ASP B CA  1 
ATOM   6104  C  C   . ASP B 2 261 ? 5.370   37.267  13.143  1.00 38.19 ? 264  ASP B C   1 
ATOM   6105  O  O   . ASP B 2 261 ? 4.337   37.886  12.915  1.00 38.28 ? 264  ASP B O   1 
ATOM   6106  C  CB  . ASP B 2 261 ? 6.779   36.061  11.464  1.00 38.44 ? 264  ASP B CB  1 
ATOM   6107  C  CG  . ASP B 2 261 ? 5.500   35.510  10.849  1.00 38.78 ? 264  ASP B CG  1 
ATOM   6108  O  OD1 . ASP B 2 261 ? 5.249   35.773  9.653   1.00 39.16 ? 264  ASP B OD1 1 
ATOM   6109  O  OD2 . ASP B 2 261 ? 4.745   34.808  11.561  1.00 38.86 ? 264  ASP B OD2 1 
ATOM   6110  N  N   . LEU B 2 262 ? 5.526   36.478  14.202  1.00 38.15 ? 265  LEU B N   1 
ATOM   6111  C  CA  . LEU B 2 262 ? 4.454   36.274  15.165  1.00 38.21 ? 265  LEU B CA  1 
ATOM   6112  C  C   . LEU B 2 262 ? 4.063   37.567  15.850  1.00 38.35 ? 265  LEU B C   1 
ATOM   6113  O  O   . LEU B 2 262 ? 2.882   37.911  15.909  1.00 38.10 ? 265  LEU B O   1 
ATOM   6114  C  CB  . LEU B 2 262 ? 4.869   35.243  16.215  1.00 38.21 ? 265  LEU B CB  1 
ATOM   6115  C  CG  . LEU B 2 262 ? 3.813   34.839  17.246  1.00 38.17 ? 265  LEU B CG  1 
ATOM   6116  C  CD1 . LEU B 2 262 ? 2.591   34.260  16.548  1.00 38.19 ? 265  LEU B CD1 1 
ATOM   6117  C  CD2 . LEU B 2 262 ? 4.403   33.820  18.211  1.00 38.09 ? 265  LEU B CD2 1 
ATOM   6118  N  N   . PHE B 2 263 ? 5.055   38.298  16.346  1.00 38.47 ? 266  PHE B N   1 
ATOM   6119  C  CA  . PHE B 2 263 ? 4.770   39.544  17.037  1.00 38.73 ? 266  PHE B CA  1 
ATOM   6120  C  C   . PHE B 2 263 ? 4.007   40.508  16.150  1.00 38.83 ? 266  PHE B C   1 
ATOM   6121  O  O   . PHE B 2 263 ? 2.951   40.999  16.532  1.00 38.85 ? 266  PHE B O   1 
ATOM   6122  C  CB  . PHE B 2 263 ? 6.054   40.207  17.537  1.00 38.75 ? 266  PHE B CB  1 
ATOM   6123  C  CG  . PHE B 2 263 ? 5.810   41.377  18.452  1.00 38.80 ? 266  PHE B CG  1 
ATOM   6124  C  CD1 . PHE B 2 263 ? 5.519   42.642  17.933  1.00 38.80 ? 266  PHE B CD1 1 
ATOM   6125  C  CD2 . PHE B 2 263 ? 5.853   41.213  19.832  1.00 38.65 ? 266  PHE B CD2 1 
ATOM   6126  C  CE1 . PHE B 2 263 ? 5.271   43.724  18.776  1.00 38.79 ? 266  PHE B CE1 1 
ATOM   6127  C  CE2 . PHE B 2 263 ? 5.607   42.288  20.685  1.00 38.74 ? 266  PHE B CE2 1 
ATOM   6128  C  CZ  . PHE B 2 263 ? 5.315   43.547  20.157  1.00 38.79 ? 266  PHE B CZ  1 
ATOM   6129  N  N   . ASN B 2 264 ? 4.532   40.766  14.959  1.00 39.01 ? 267  ASN B N   1 
ATOM   6130  C  CA  . ASN B 2 264 ? 3.881   41.690  14.041  1.00 39.30 ? 267  ASN B CA  1 
ATOM   6131  C  C   . ASN B 2 264 ? 2.480   41.280  13.626  1.00 39.58 ? 267  ASN B C   1 
ATOM   6132  O  O   . ASN B 2 264 ? 1.616   42.137  13.460  1.00 39.75 ? 267  ASN B O   1 
ATOM   6133  C  CB  . ASN B 2 264 ? 4.750   41.937  12.812  1.00 39.22 ? 267  ASN B CB  1 
ATOM   6134  C  CG  . ASN B 2 264 ? 5.890   42.894  13.092  1.00 39.18 ? 267  ASN B CG  1 
ATOM   6135  O  OD1 . ASN B 2 264 ? 5.799   43.754  13.970  1.00 39.15 ? 267  ASN B OD1 1 
ATOM   6136  N  ND2 . ASN B 2 264 ? 6.971   42.755  12.340  1.00 39.60 ? 267  ASN B ND2 1 
ATOM   6137  N  N   . ALA B 2 265 ? 2.244   39.981  13.478  1.00 39.72 ? 268  ALA B N   1 
ATOM   6138  C  CA  . ALA B 2 265 ? 0.926   39.492  13.089  1.00 39.93 ? 268  ALA B CA  1 
ATOM   6139  C  C   . ALA B 2 265 ? -0.108  39.838  14.150  1.00 40.12 ? 268  ALA B C   1 
ATOM   6140  O  O   . ALA B 2 265 ? -1.172  40.374  13.836  1.00 40.19 ? 268  ALA B O   1 
ATOM   6141  C  CB  . ALA B 2 265 ? 0.964   37.992  12.870  1.00 40.05 ? 268  ALA B CB  1 
ATOM   6142  N  N   . ILE B 2 266 ? 0.214   39.531  15.406  1.00 40.28 ? 269  ILE B N   1 
ATOM   6143  C  CA  . ILE B 2 266 ? -0.683  39.805  16.529  1.00 40.32 ? 269  ILE B CA  1 
ATOM   6144  C  C   . ILE B 2 266 ? -0.831  41.306  16.751  1.00 40.55 ? 269  ILE B C   1 
ATOM   6145  O  O   . ILE B 2 266 ? -1.923  41.799  17.027  1.00 40.67 ? 269  ILE B O   1 
ATOM   6146  C  CB  . ILE B 2 266 ? -0.169  39.139  17.828  1.00 40.15 ? 269  ILE B CB  1 
ATOM   6147  C  CG1 . ILE B 2 266 ? -0.243  37.615  17.697  1.00 39.88 ? 269  ILE B CG1 1 
ATOM   6148  C  CG2 . ILE B 2 266 ? -0.965  39.618  19.040  1.00 40.07 ? 269  ILE B CG2 1 
ATOM   6149  C  CD1 . ILE B 2 266 ? 0.329   36.858  18.886  1.00 39.52 ? 269  ILE B CD1 1 
ATOM   6150  N  N   . ALA B 2 267 ? 0.269   42.031  16.600  1.00 40.71 ? 270  ALA B N   1 
ATOM   6151  C  CA  . ALA B 2 267 ? 0.268   43.471  16.787  1.00 40.91 ? 270  ALA B CA  1 
ATOM   6152  C  C   . ALA B 2 267 ? -0.645  44.190  15.794  1.00 41.27 ? 270  ALA B C   1 
ATOM   6153  O  O   . ALA B 2 267 ? -1.173  45.254  16.097  1.00 41.39 ? 270  ALA B O   1 
ATOM   6154  C  CB  . ALA B 2 267 ? 1.683   44.003  16.685  1.00 40.84 ? 270  ALA B CB  1 
ATOM   6155  N  N   . THR B 2 268 ? -0.849  43.607  14.617  1.00 41.45 ? 271  THR B N   1 
ATOM   6156  C  CA  . THR B 2 268 ? -1.704  44.231  13.614  1.00 41.58 ? 271  THR B CA  1 
ATOM   6157  C  C   . THR B 2 268 ? -3.098  43.616  13.536  1.00 41.72 ? 271  THR B C   1 
ATOM   6158  O  O   . THR B 2 268 ? -3.820  43.838  12.568  1.00 41.98 ? 271  THR B O   1 
ATOM   6159  C  CB  . THR B 2 268 ? -1.056  44.207  12.214  1.00 41.69 ? 271  THR B CB  1 
ATOM   6160  O  OG1 . THR B 2 268 ? -0.745  42.857  11.846  1.00 41.75 ? 271  THR B OG1 1 
ATOM   6161  C  CG2 . THR B 2 268 ? 0.214   45.035  12.198  1.00 41.60 ? 271  THR B CG2 1 
ATOM   6162  N  N   . GLY B 2 269 ? -3.478  42.841  14.546  1.00 41.73 ? 272  GLY B N   1 
ATOM   6163  C  CA  . GLY B 2 269 ? -4.801  42.241  14.549  1.00 41.69 ? 272  GLY B CA  1 
ATOM   6164  C  C   . GLY B 2 269 ? -4.971  40.975  13.729  1.00 41.73 ? 272  GLY B C   1 
ATOM   6165  O  O   . GLY B 2 269 ? -6.064  40.422  13.662  1.00 41.66 ? 272  GLY B O   1 
ATOM   6166  N  N   . LYS B 2 270 ? -3.901  40.514  13.092  1.00 41.83 ? 273  LYS B N   1 
ATOM   6167  C  CA  . LYS B 2 270 ? -3.963  39.300  12.296  1.00 41.85 ? 273  LYS B CA  1 
ATOM   6168  C  C   . LYS B 2 270 ? -3.690  38.109  13.201  1.00 41.68 ? 273  LYS B C   1 
ATOM   6169  O  O   . LYS B 2 270 ? -2.676  37.432  13.072  1.00 41.64 ? 273  LYS B O   1 
ATOM   6170  C  CB  . LYS B 2 270 ? -2.948  39.388  11.165  1.00 42.30 ? 273  LYS B CB  1 
ATOM   6171  C  CG  . LYS B 2 270 ? -3.288  40.499  10.199  1.00 43.30 ? 273  LYS B CG  1 
ATOM   6172  C  CD  . LYS B 2 270 ? -2.094  40.947  9.366   1.00 44.42 ? 273  LYS B CD  1 
ATOM   6173  C  CE  . LYS B 2 270 ? -2.503  42.026  8.346   1.00 44.99 ? 273  LYS B CE  1 
ATOM   6174  N  NZ  . LYS B 2 270 ? -3.311  43.148  8.949   1.00 45.18 ? 273  LYS B NZ  1 
ATOM   6175  N  N   . TYR B 2 271 ? -4.621  37.862  14.116  1.00 41.63 ? 274  TYR B N   1 
ATOM   6176  C  CA  . TYR B 2 271 ? -4.510  36.778  15.088  1.00 41.64 ? 274  TYR B CA  1 
ATOM   6177  C  C   . TYR B 2 271 ? -4.582  35.383  14.474  1.00 41.47 ? 274  TYR B C   1 
ATOM   6178  O  O   . TYR B 2 271 ? -5.612  34.994  13.919  1.00 41.58 ? 274  TYR B O   1 
ATOM   6179  C  CB  . TYR B 2 271 ? -5.608  36.901  16.147  1.00 41.94 ? 274  TYR B CB  1 
ATOM   6180  C  CG  . TYR B 2 271 ? -5.713  38.258  16.806  1.00 42.31 ? 274  TYR B CG  1 
ATOM   6181  C  CD1 . TYR B 2 271 ? -6.956  38.800  17.119  1.00 42.56 ? 274  TYR B CD1 1 
ATOM   6182  C  CD2 . TYR B 2 271 ? -4.580  39.004  17.114  1.00 42.38 ? 274  TYR B CD2 1 
ATOM   6183  C  CE1 . TYR B 2 271 ? -7.071  40.056  17.721  1.00 42.76 ? 274  TYR B CE1 1 
ATOM   6184  C  CE2 . TYR B 2 271 ? -4.684  40.260  17.717  1.00 42.68 ? 274  TYR B CE2 1 
ATOM   6185  C  CZ  . TYR B 2 271 ? -5.933  40.780  18.016  1.00 42.82 ? 274  TYR B CZ  1 
ATOM   6186  O  OH  . TYR B 2 271 ? -6.048  42.023  18.593  1.00 42.95 ? 274  TYR B OH  1 
ATOM   6187  N  N   . PRO B 2 272 ? -3.500  34.593  14.606  1.00 41.17 ? 275  PRO B N   1 
ATOM   6188  C  CA  . PRO B 2 272 ? -3.465  33.237  14.059  1.00 40.75 ? 275  PRO B CA  1 
ATOM   6189  C  C   . PRO B 2 272 ? -4.304  32.286  14.899  1.00 40.44 ? 275  PRO B C   1 
ATOM   6190  O  O   . PRO B 2 272 ? -4.426  32.454  16.111  1.00 40.34 ? 275  PRO B O   1 
ATOM   6191  C  CB  . PRO B 2 272 ? -1.983  32.887  14.143  1.00 40.75 ? 275  PRO B CB  1 
ATOM   6192  C  CG  . PRO B 2 272 ? -1.565  33.562  15.404  1.00 40.79 ? 275  PRO B CG  1 
ATOM   6193  C  CD  . PRO B 2 272 ? -2.216  34.922  15.255  1.00 41.04 ? 275  PRO B CD  1 
ATOM   6194  N  N   . SER B 2 273 ? -4.903  31.301  14.245  1.00 40.07 ? 276  SER B N   1 
ATOM   6195  C  CA  . SER B 2 273 ? -5.717  30.324  14.944  1.00 39.66 ? 276  SER B CA  1 
ATOM   6196  C  C   . SER B 2 273 ? -5.499  28.939  14.356  1.00 39.41 ? 276  SER B C   1 
ATOM   6197  O  O   . SER B 2 273 ? -4.948  28.794  13.261  1.00 39.33 ? 276  SER B O   1 
ATOM   6198  C  CB  . SER B 2 273 ? -7.197  30.704  14.886  1.00 39.63 ? 276  SER B CB  1 
ATOM   6199  O  OG  . SER B 2 273 ? -7.694  30.650  13.562  1.00 39.88 ? 276  SER B OG  1 
ATOM   6200  N  N   . TRP B 2 274 ? -5.870  27.927  15.131  1.00 39.18 ? 277  TRP B N   1 
ATOM   6201  C  CA  . TRP B 2 274 ? -5.735  26.536  14.732  1.00 38.93 ? 277  TRP B CA  1 
ATOM   6202  C  C   . TRP B 2 274 ? -7.020  25.809  15.104  1.00 39.00 ? 277  TRP B C   1 
ATOM   6203  O  O   . TRP B 2 274 ? -7.652  26.125  16.112  1.00 38.90 ? 277  TRP B O   1 
ATOM   6204  C  CB  . TRP B 2 274 ? -4.556  25.879  15.466  1.00 38.77 ? 277  TRP B CB  1 
ATOM   6205  C  CG  . TRP B 2 274 ? -3.176  26.267  14.973  1.00 38.60 ? 277  TRP B CG  1 
ATOM   6206  C  CD1 . TRP B 2 274 ? -2.372  25.539  14.147  1.00 38.43 ? 277  TRP B CD1 1 
ATOM   6207  C  CD2 . TRP B 2 274 ? -2.448  27.470  15.277  1.00 38.59 ? 277  TRP B CD2 1 
ATOM   6208  N  NE1 . TRP B 2 274 ? -1.197  26.210  13.910  1.00 38.32 ? 277  TRP B NE1 1 
ATOM   6209  C  CE2 . TRP B 2 274 ? -1.217  27.399  14.590  1.00 38.42 ? 277  TRP B CE2 1 
ATOM   6210  C  CE3 . TRP B 2 274 ? -2.719  28.602  16.064  1.00 38.53 ? 277  TRP B CE3 1 
ATOM   6211  C  CZ2 . TRP B 2 274 ? -0.256  28.414  14.663  1.00 38.36 ? 277  TRP B CZ2 1 
ATOM   6212  C  CZ3 . TRP B 2 274 ? -1.760  29.613  16.135  1.00 38.42 ? 277  TRP B CZ3 1 
ATOM   6213  C  CH2 . TRP B 2 274 ? -0.544  29.508  15.436  1.00 38.25 ? 277  TRP B CH2 1 
ATOM   6214  N  N   . THR B 2 275 ? -7.433  24.863  14.267  1.00 39.08 ? 278  THR B N   1 
ATOM   6215  C  CA  . THR B 2 275 ? -8.636  24.088  14.550  1.00 38.97 ? 278  THR B CA  1 
ATOM   6216  C  C   . THR B 2 275 ? -8.192  22.838  15.294  1.00 38.96 ? 278  THR B C   1 
ATOM   6217  O  O   . THR B 2 275 ? -7.319  22.108  14.833  1.00 38.78 ? 278  THR B O   1 
ATOM   6218  C  CB  . THR B 2 275 ? -9.414  23.717  13.266  1.00 38.99 ? 278  THR B CB  1 
ATOM   6219  O  OG1 . THR B 2 275 ? -9.739  24.916  12.544  1.00 38.82 ? 278  THR B OG1 1 
ATOM   6220  C  CG2 . THR B 2 275 ? -10.715 22.999  13.624  1.00 38.82 ? 278  THR B CG2 1 
ATOM   6221  N  N   . PHE B 2 276 ? -8.767  22.641  16.476  1.00 38.94 ? 279  PHE B N   1 
ATOM   6222  C  CA  . PHE B 2 276 ? -8.444  21.517  17.343  1.00 38.96 ? 279  PHE B CA  1 
ATOM   6223  C  C   . PHE B 2 276 ? -9.294  20.277  17.041  1.00 39.10 ? 279  PHE B C   1 
ATOM   6224  O  O   . PHE B 2 276 ? -10.526 20.348  17.006  1.00 38.84 ? 279  PHE B O   1 
ATOM   6225  C  CB  . PHE B 2 276 ? -8.632  21.953  18.795  1.00 39.00 ? 279  PHE B CB  1 
ATOM   6226  C  CG  . PHE B 2 276 ? -7.757  21.227  19.769  1.00 38.92 ? 279  PHE B CG  1 
ATOM   6227  C  CD1 . PHE B 2 276 ? -6.437  21.613  19.956  1.00 38.89 ? 279  PHE B CD1 1 
ATOM   6228  C  CD2 . PHE B 2 276 ? -8.259  20.177  20.524  1.00 38.87 ? 279  PHE B CD2 1 
ATOM   6229  C  CE1 . PHE B 2 276 ? -5.628  20.964  20.884  1.00 38.79 ? 279  PHE B CE1 1 
ATOM   6230  C  CE2 . PHE B 2 276 ? -7.457  19.521  21.456  1.00 38.91 ? 279  PHE B CE2 1 
ATOM   6231  C  CZ  . PHE B 2 276 ? -6.140  19.917  21.635  1.00 38.79 ? 279  PHE B CZ  1 
ATOM   6232  N  N   . TYR B 2 277 ? -8.616  19.150  16.816  1.00 39.25 ? 280  TYR B N   1 
ATOM   6233  C  CA  . TYR B 2 277 ? -9.250  17.863  16.510  1.00 39.43 ? 280  TYR B CA  1 
ATOM   6234  C  C   . TYR B 2 277 ? -8.646  16.745  17.352  1.00 39.64 ? 280  TYR B C   1 
ATOM   6235  O  O   . TYR B 2 277 ? -7.596  16.909  17.972  1.00 39.65 ? 280  TYR B O   1 
ATOM   6236  C  CB  . TYR B 2 277 ? -8.989  17.441  15.058  1.00 39.19 ? 280  TYR B CB  1 
ATOM   6237  C  CG  . TYR B 2 277 ? -9.480  18.357  13.972  1.00 39.12 ? 280  TYR B CG  1 
ATOM   6238  C  CD1 . TYR B 2 277 ? -10.750 18.205  13.421  1.00 39.03 ? 280  TYR B CD1 1 
ATOM   6239  C  CD2 . TYR B 2 277 ? -8.647  19.332  13.439  1.00 39.11 ? 280  TYR B CD2 1 
ATOM   6240  C  CE1 . TYR B 2 277 ? -11.171 18.999  12.361  1.00 39.03 ? 280  TYR B CE1 1 
ATOM   6241  C  CE2 . TYR B 2 277 ? -9.058  20.128  12.383  1.00 39.13 ? 280  TYR B CE2 1 
ATOM   6242  C  CZ  . TYR B 2 277 ? -10.316 19.956  11.849  1.00 39.10 ? 280  TYR B CZ  1 
ATOM   6243  O  OH  . TYR B 2 277 ? -10.701 20.739  10.793  1.00 39.27 ? 280  TYR B OH  1 
ATOM   6244  N  N   . ILE B 2 278 ? -9.298  15.589  17.325  1.00 39.76 ? 281  ILE B N   1 
ATOM   6245  C  CA  . ILE B 2 278 ? -8.794  14.412  18.008  1.00 40.04 ? 281  ILE B CA  1 
ATOM   6246  C  C   . ILE B 2 278 ? -9.151  13.185  17.185  1.00 40.36 ? 281  ILE B C   1 
ATOM   6247  O  O   . ILE B 2 278 ? -10.103 13.194  16.398  1.00 40.37 ? 281  ILE B O   1 
ATOM   6248  C  CB  . ILE B 2 278 ? -9.377  14.188  19.429  1.00 39.97 ? 281  ILE B CB  1 
ATOM   6249  C  CG1 . ILE B 2 278 ? -10.883 13.956  19.363  1.00 39.98 ? 281  ILE B CG1 1 
ATOM   6250  C  CG2 . ILE B 2 278 ? -8.996  15.314  20.362  1.00 39.99 ? 281  ILE B CG2 1 
ATOM   6251  C  CD1 . ILE B 2 278 ? -11.472 13.461  20.662  1.00 40.08 ? 281  ILE B CD1 1 
ATOM   6252  N  N   . GLN B 2 279 ? -8.310  12.168  17.307  1.00 40.54 ? 282  GLN B N   1 
ATOM   6253  C  CA  . GLN B 2 279 ? -8.535  10.894  16.658  1.00 40.68 ? 282  GLN B CA  1 
ATOM   6254  C  C   . GLN B 2 279 ? -8.834  10.001  17.849  1.00 41.07 ? 282  GLN B C   1 
ATOM   6255  O  O   . GLN B 2 279 ? -8.207  10.138  18.903  1.00 40.88 ? 282  GLN B O   1 
ATOM   6256  C  CB  . GLN B 2 279 ? -7.280  10.403  15.953  1.00 40.52 ? 282  GLN B CB  1 
ATOM   6257  C  CG  . GLN B 2 279 ? -7.030  11.022  14.607  1.00 40.37 ? 282  GLN B CG  1 
ATOM   6258  C  CD  . GLN B 2 279 ? -5.840  10.387  13.929  1.00 40.44 ? 282  GLN B CD  1 
ATOM   6259  O  OE1 . GLN B 2 279 ? -5.984  9.574   13.013  1.00 40.28 ? 282  GLN B OE1 1 
ATOM   6260  N  NE2 . GLN B 2 279 ? -4.650  10.728  14.399  1.00 40.51 ? 282  GLN B NE2 1 
ATOM   6261  N  N   . VAL B 2 280 ? -9.820  9.125   17.705  1.00 41.36 ? 283  VAL B N   1 
ATOM   6262  C  CA  . VAL B 2 280 ? -10.191 8.232   18.793  1.00 41.62 ? 283  VAL B CA  1 
ATOM   6263  C  C   . VAL B 2 280 ? -10.021 6.775   18.398  1.00 41.99 ? 283  VAL B C   1 
ATOM   6264  O  O   . VAL B 2 280 ? -10.364 6.375   17.284  1.00 42.10 ? 283  VAL B O   1 
ATOM   6265  C  CB  . VAL B 2 280 ? -11.644 8.486   19.253  1.00 41.50 ? 283  VAL B CB  1 
ATOM   6266  C  CG1 . VAL B 2 280 ? -12.119 7.375   20.177  1.00 41.42 ? 283  VAL B CG1 1 
ATOM   6267  C  CG2 . VAL B 2 280 ? -11.737 9.832   19.959  1.00 41.30 ? 283  VAL B CG2 1 
ATOM   6268  N  N   . MET B 2 281 ? -9.450  5.997   19.312  1.00 42.26 ? 284  MET B N   1 
ATOM   6269  C  CA  . MET B 2 281 ? -9.239  4.581   19.092  1.00 42.56 ? 284  MET B CA  1 
ATOM   6270  C  C   . MET B 2 281 ? -9.670  3.879   20.360  1.00 43.05 ? 284  MET B C   1 
ATOM   6271  O  O   . MET B 2 281 ? -9.277  4.275   21.456  1.00 42.99 ? 284  MET B O   1 
ATOM   6272  C  CB  . MET B 2 281 ? -7.771  4.284   18.815  1.00 42.38 ? 284  MET B CB  1 
ATOM   6273  C  CG  . MET B 2 281 ? -7.495  2.821   18.544  1.00 42.44 ? 284  MET B CG  1 
ATOM   6274  S  SD  . MET B 2 281 ? -5.749  2.400   18.505  1.00 42.90 ? 284  MET B SD  1 
ATOM   6275  C  CE  . MET B 2 281 ? -5.344  2.702   16.796  1.00 42.46 ? 284  MET B CE  1 
ATOM   6276  N  N   . THR B 2 282 ? -10.509 2.859   20.210  1.00 43.57 ? 285  THR B N   1 
ATOM   6277  C  CA  . THR B 2 282 ? -10.992 2.107   21.358  1.00 44.11 ? 285  THR B CA  1 
ATOM   6278  C  C   . THR B 2 282 ? -9.935  1.113   21.789  1.00 44.60 ? 285  THR B C   1 
ATOM   6279  O  O   . THR B 2 282 ? -9.003  0.819   21.042  1.00 44.48 ? 285  THR B O   1 
ATOM   6280  C  CB  . THR B 2 282 ? -12.284 1.338   21.037  1.00 44.04 ? 285  THR B CB  1 
ATOM   6281  O  OG1 . THR B 2 282 ? -11.997 0.264   20.132  1.00 43.92 ? 285  THR B OG1 1 
ATOM   6282  C  CG2 . THR B 2 282 ? -13.302 2.266   20.407  1.00 43.93 ? 285  THR B CG2 1 
ATOM   6283  N  N   . PHE B 2 283 ? -10.082 0.595   23.000  1.00 45.36 ? 286  PHE B N   1 
ATOM   6284  C  CA  . PHE B 2 283 ? -9.137  -0.375  23.508  1.00 46.14 ? 286  PHE B CA  1 
ATOM   6285  C  C   . PHE B 2 283 ? -9.187  -1.630  22.667  1.00 46.83 ? 286  PHE B C   1 
ATOM   6286  O  O   . PHE B 2 283 ? -8.182  -2.326  22.549  1.00 46.97 ? 286  PHE B O   1 
ATOM   6287  C  CB  . PHE B 2 283 ? -9.431  -0.704  24.965  1.00 46.18 ? 286  PHE B CB  1 
ATOM   6288  C  CG  . PHE B 2 283 ? -8.906  0.315   25.934  1.00 46.29 ? 286  PHE B CG  1 
ATOM   6289  C  CD1 . PHE B 2 283 ? -9.032  1.670   25.678  1.00 46.35 ? 286  PHE B CD1 1 
ATOM   6290  C  CD2 . PHE B 2 283 ? -8.305  -0.085  27.120  1.00 46.43 ? 286  PHE B CD2 1 
ATOM   6291  C  CE1 . PHE B 2 283 ? -8.570  2.613   26.587  1.00 46.51 ? 286  PHE B CE1 1 
ATOM   6292  C  CE2 . PHE B 2 283 ? -7.841  0.850   28.036  1.00 46.49 ? 286  PHE B CE2 1 
ATOM   6293  C  CZ  . PHE B 2 283 ? -7.974  2.201   27.770  1.00 46.53 ? 286  PHE B CZ  1 
ATOM   6294  N  N   . ASN B 2 284 ? -10.347 -1.913  22.074  1.00 47.60 ? 287  ASN B N   1 
ATOM   6295  C  CA  . ASN B 2 284 ? -10.502 -3.094  21.222  1.00 48.37 ? 287  ASN B CA  1 
ATOM   6296  C  C   . ASN B 2 284 ? -9.719  -2.904  19.939  1.00 48.44 ? 287  ASN B C   1 
ATOM   6297  O  O   . ASN B 2 284 ? -9.049  -3.823  19.471  1.00 48.44 ? 287  ASN B O   1 
ATOM   6298  C  CB  . ASN B 2 284 ? -11.970 -3.354  20.883  1.00 49.16 ? 287  ASN B CB  1 
ATOM   6299  C  CG  . ASN B 2 284 ? -12.814 -3.606  22.112  1.00 50.08 ? 287  ASN B CG  1 
ATOM   6300  O  OD1 . ASN B 2 284 ? -13.289 -2.658  22.759  1.00 50.92 ? 287  ASN B OD1 1 
ATOM   6301  N  ND2 . ASN B 2 284 ? -12.993 -4.881  22.462  1.00 50.24 ? 287  ASN B ND2 1 
ATOM   6302  N  N   . GLN B 2 285 ? -9.812  -1.706  19.371  1.00 48.49 ? 288  GLN B N   1 
ATOM   6303  C  CA  . GLN B 2 285 ? -9.097  -1.386  18.145  1.00 48.67 ? 288  GLN B CA  1 
ATOM   6304  C  C   . GLN B 2 285 ? -7.587  -1.387  18.377  1.00 48.78 ? 288  GLN B C   1 
ATOM   6305  O  O   . GLN B 2 285 ? -6.815  -1.757  17.492  1.00 48.94 ? 288  GLN B O   1 
ATOM   6306  C  CB  . GLN B 2 285 ? -9.543  -0.025  17.620  1.00 48.71 ? 288  GLN B CB  1 
ATOM   6307  C  CG  . GLN B 2 285 ? -10.994 0.027   17.194  1.00 48.64 ? 288  GLN B CG  1 
ATOM   6308  C  CD  . GLN B 2 285 ? -11.400 1.401   16.714  1.00 48.78 ? 288  GLN B CD  1 
ATOM   6309  O  OE1 . GLN B 2 285 ? -11.547 2.328   17.510  1.00 48.83 ? 288  GLN B OE1 1 
ATOM   6310  N  NE2 . GLN B 2 285 ? -11.580 1.544   15.405  1.00 48.81 ? 288  GLN B NE2 1 
ATOM   6311  N  N   . ALA B 2 286 ? -7.175  -0.976  19.574  1.00 48.96 ? 289  ALA B N   1 
ATOM   6312  C  CA  . ALA B 2 286 ? -5.761  -0.939  19.948  1.00 49.15 ? 289  ALA B CA  1 
ATOM   6313  C  C   . ALA B 2 286 ? -5.171  -2.345  19.978  1.00 49.33 ? 289  ALA B C   1 
ATOM   6314  O  O   . ALA B 2 286 ? -3.957  -2.530  19.884  1.00 49.28 ? 289  ALA B O   1 
ATOM   6315  C  CB  . ALA B 2 286 ? -5.604  -0.289  21.313  1.00 49.05 ? 289  ALA B CB  1 
ATOM   6316  N  N   . GLU B 2 287 ? -6.044  -3.330  20.128  1.00 49.56 ? 290  GLU B N   1 
ATOM   6317  C  CA  . GLU B 2 287 ? -5.631  -4.717  20.183  1.00 49.86 ? 290  GLU B CA  1 
ATOM   6318  C  C   . GLU B 2 287 ? -5.461  -5.301  18.777  1.00 49.44 ? 290  GLU B C   1 
ATOM   6319  O  O   . GLU B 2 287 ? -4.708  -6.255  18.579  1.00 49.59 ? 290  GLU B O   1 
ATOM   6320  C  CB  . GLU B 2 287 ? -6.655  -5.521  20.997  1.00 50.85 ? 290  GLU B CB  1 
ATOM   6321  C  CG  . GLU B 2 287 ? -6.214  -6.942  21.375  1.00 52.54 ? 290  GLU B CG  1 
ATOM   6322  C  CD  . GLU B 2 287 ? -5.295  -7.008  22.609  1.00 53.56 ? 290  GLU B CD  1 
ATOM   6323  O  OE1 . GLU B 2 287 ? -4.471  -6.079  22.829  1.00 53.98 ? 290  GLU B OE1 1 
ATOM   6324  O  OE2 . GLU B 2 287 ? -5.399  -8.013  23.360  1.00 54.07 ? 290  GLU B OE2 1 
ATOM   6325  N  N   . THR B 2 288 ? -6.111  -4.695  17.789  1.00 48.85 ? 291  THR B N   1 
ATOM   6326  C  CA  . THR B 2 288 ? -6.024  -5.197  16.421  1.00 48.21 ? 291  THR B CA  1 
ATOM   6327  C  C   . THR B 2 288 ? -5.182  -4.351  15.474  1.00 47.68 ? 291  THR B C   1 
ATOM   6328  O  O   . THR B 2 288 ? -4.933  -4.756  14.335  1.00 47.62 ? 291  THR B O   1 
ATOM   6329  C  CB  . THR B 2 288 ? -7.420  -5.380  15.801  1.00 48.42 ? 291  THR B CB  1 
ATOM   6330  O  OG1 . THR B 2 288 ? -8.059  -4.103  15.659  1.00 48.62 ? 291  THR B OG1 1 
ATOM   6331  C  CG2 . THR B 2 288 ? -8.271  -6.275  16.686  1.00 48.47 ? 291  THR B CG2 1 
ATOM   6332  N  N   . PHE B 2 289 ? -4.757  -3.178  15.933  1.00 46.92 ? 292  PHE B N   1 
ATOM   6333  C  CA  . PHE B 2 289 ? -3.933  -2.285  15.121  1.00 46.07 ? 292  PHE B CA  1 
ATOM   6334  C  C   . PHE B 2 289 ? -2.691  -3.055  14.621  1.00 45.46 ? 292  PHE B C   1 
ATOM   6335  O  O   . PHE B 2 289 ? -2.041  -3.757  15.391  1.00 45.40 ? 292  PHE B O   1 
ATOM   6336  C  CB  . PHE B 2 289 ? -3.531  -1.070  15.959  1.00 45.87 ? 292  PHE B CB  1 
ATOM   6337  C  CG  . PHE B 2 289 ? -2.966  0.060   15.159  1.00 45.71 ? 292  PHE B CG  1 
ATOM   6338  C  CD1 . PHE B 2 289 ? -1.666  0.503   15.378  1.00 45.65 ? 292  PHE B CD1 1 
ATOM   6339  C  CD2 . PHE B 2 289 ? -3.726  0.683   14.179  1.00 45.71 ? 292  PHE B CD2 1 
ATOM   6340  C  CE1 . PHE B 2 289 ? -1.126  1.548   14.632  1.00 45.50 ? 292  PHE B CE1 1 
ATOM   6341  C  CE2 . PHE B 2 289 ? -3.195  1.730   13.426  1.00 45.70 ? 292  PHE B CE2 1 
ATOM   6342  C  CZ  . PHE B 2 289 ? -1.892  2.161   13.656  1.00 45.62 ? 292  PHE B CZ  1 
ATOM   6343  N  N   . PRO B 2 290 ? -2.378  -2.959  13.315  1.00 44.88 ? 293  PRO B N   1 
ATOM   6344  C  CA  . PRO B 2 290 ? -1.243  -3.626  12.665  1.00 44.26 ? 293  PRO B CA  1 
ATOM   6345  C  C   . PRO B 2 290 ? 0.126   -3.335  13.259  1.00 43.73 ? 293  PRO B C   1 
ATOM   6346  O  O   . PRO B 2 290 ? 1.074   -4.086  13.023  1.00 43.76 ? 293  PRO B O   1 
ATOM   6347  C  CB  . PRO B 2 290 ? -1.325  -3.118  11.227  1.00 44.46 ? 293  PRO B CB  1 
ATOM   6348  C  CG  . PRO B 2 290 ? -2.775  -2.878  11.036  1.00 44.70 ? 293  PRO B CG  1 
ATOM   6349  C  CD  . PRO B 2 290 ? -3.144  -2.185  12.321  1.00 44.85 ? 293  PRO B CD  1 
ATOM   6350  N  N   . PHE B 2 291 ? 0.245   -2.220  13.973  1.00 42.99 ? 294  PHE B N   1 
ATOM   6351  C  CA  . PHE B 2 291 ? 1.506   -1.842  14.605  1.00 42.23 ? 294  PHE B CA  1 
ATOM   6352  C  C   . PHE B 2 291 ? 1.218   -1.559  16.069  1.00 41.75 ? 294  PHE B C   1 
ATOM   6353  O  O   . PHE B 2 291 ? 0.094   -1.752  16.525  1.00 41.83 ? 294  PHE B O   1 
ATOM   6354  C  CB  . PHE B 2 291 ? 2.063   -0.564  13.983  1.00 42.26 ? 294  PHE B CB  1 
ATOM   6355  C  CG  . PHE B 2 291 ? 2.182   -0.606  12.492  1.00 42.38 ? 294  PHE B CG  1 
ATOM   6356  C  CD1 . PHE B 2 291 ? 3.221   -1.297  11.882  1.00 42.41 ? 294  PHE B CD1 1 
ATOM   6357  C  CD2 . PHE B 2 291 ? 1.278   0.089   11.697  1.00 42.32 ? 294  PHE B CD2 1 
ATOM   6358  C  CE1 . PHE B 2 291 ? 3.361   -1.294  10.501  1.00 42.49 ? 294  PHE B CE1 1 
ATOM   6359  C  CE2 . PHE B 2 291 ? 1.406   0.100   10.321  1.00 42.39 ? 294  PHE B CE2 1 
ATOM   6360  C  CZ  . PHE B 2 291 ? 2.451   -0.592  9.718   1.00 42.61 ? 294  PHE B CZ  1 
ATOM   6361  N  N   . ASN B 2 292 ? 2.232   -1.139  16.819  1.00 41.01 ? 295  ASN B N   1 
ATOM   6362  C  CA  . ASN B 2 292 ? 2.020   -0.797  18.219  1.00 40.24 ? 295  ASN B CA  1 
ATOM   6363  C  C   . ASN B 2 292 ? 1.366   0.586   18.182  1.00 40.10 ? 295  ASN B C   1 
ATOM   6364  O  O   . ASN B 2 292 ? 1.943   1.538   17.653  1.00 40.13 ? 295  ASN B O   1 
ATOM   6365  C  CB  . ASN B 2 292 ? 3.355   -0.743  18.978  1.00 39.92 ? 295  ASN B CB  1 
ATOM   6366  C  CG  . ASN B 2 292 ? 3.196   -0.296  20.435  1.00 39.59 ? 295  ASN B CG  1 
ATOM   6367  O  OD1 . ASN B 2 292 ? 4.180   -0.063  21.133  1.00 39.48 ? 295  ASN B OD1 1 
ATOM   6368  N  ND2 . ASN B 2 292 ? 1.960   -0.184  20.894  1.00 39.49 ? 295  ASN B ND2 1 
ATOM   6369  N  N   . PRO B 2 293 ? 0.134   0.709   18.703  1.00 39.72 ? 296  PRO B N   1 
ATOM   6370  C  CA  . PRO B 2 293 ? -0.545  2.007   18.695  1.00 39.39 ? 296  PRO B CA  1 
ATOM   6371  C  C   . PRO B 2 293 ? 0.142   3.066   19.556  1.00 39.27 ? 296  PRO B C   1 
ATOM   6372  O  O   . PRO B 2 293 ? -0.166  4.255   19.449  1.00 39.20 ? 296  PRO B O   1 
ATOM   6373  C  CB  . PRO B 2 293 ? -1.937  1.660   19.223  1.00 39.39 ? 296  PRO B CB  1 
ATOM   6374  C  CG  . PRO B 2 293 ? -1.678  0.496   20.121  1.00 39.39 ? 296  PRO B CG  1 
ATOM   6375  C  CD  . PRO B 2 293 ? -0.720  -0.327  19.309  1.00 39.56 ? 296  PRO B CD  1 
ATOM   6376  N  N   . PHE B 2 294 ? 1.092   2.633   20.384  1.00 39.08 ? 297  PHE B N   1 
ATOM   6377  C  CA  . PHE B 2 294 ? 1.819   3.540   21.271  1.00 38.78 ? 297  PHE B CA  1 
ATOM   6378  C  C   . PHE B 2 294 ? 3.247   3.805   20.794  1.00 38.59 ? 297  PHE B C   1 
ATOM   6379  O  O   . PHE B 2 294 ? 4.079   4.292   21.559  1.00 38.65 ? 297  PHE B O   1 
ATOM   6380  C  CB  . PHE B 2 294 ? 1.846   2.973   22.696  1.00 38.72 ? 297  PHE B CB  1 
ATOM   6381  C  CG  . PHE B 2 294 ? 0.508   2.456   23.177  1.00 38.61 ? 297  PHE B CG  1 
ATOM   6382  C  CD1 . PHE B 2 294 ? -0.580  3.307   23.311  1.00 38.52 ? 297  PHE B CD1 1 
ATOM   6383  C  CD2 . PHE B 2 294 ? 0.344   1.110   23.494  1.00 38.60 ? 297  PHE B CD2 1 
ATOM   6384  C  CE1 . PHE B 2 294 ? -1.810  2.826   23.750  1.00 38.44 ? 297  PHE B CE1 1 
ATOM   6385  C  CE2 . PHE B 2 294 ? -0.882  0.623   23.934  1.00 38.52 ? 297  PHE B CE2 1 
ATOM   6386  C  CZ  . PHE B 2 294 ? -1.960  1.484   24.061  1.00 38.47 ? 297  PHE B CZ  1 
ATOM   6387  N  N   . ASP B 2 295 ? 3.521   3.478   19.533  1.00 38.34 ? 298  ASP B N   1 
ATOM   6388  C  CA  . ASP B 2 295 ? 4.836   3.670   18.918  1.00 38.14 ? 298  ASP B CA  1 
ATOM   6389  C  C   . ASP B 2 295 ? 4.899   5.070   18.316  1.00 38.08 ? 298  ASP B C   1 
ATOM   6390  O  O   . ASP B 2 295 ? 4.216   5.356   17.333  1.00 38.05 ? 298  ASP B O   1 
ATOM   6391  C  CB  . ASP B 2 295 ? 5.035   2.612   17.823  1.00 38.30 ? 298  ASP B CB  1 
ATOM   6392  C  CG  . ASP B 2 295 ? 6.375   2.718   17.105  1.00 38.29 ? 298  ASP B CG  1 
ATOM   6393  O  OD1 . ASP B 2 295 ? 6.685   1.786   16.336  1.00 38.42 ? 298  ASP B OD1 1 
ATOM   6394  O  OD2 . ASP B 2 295 ? 7.113   3.707   17.283  1.00 38.56 ? 298  ASP B OD2 1 
ATOM   6395  N  N   . LEU B 2 296 ? 5.773   5.914   18.861  1.00 37.82 ? 299  LEU B N   1 
ATOM   6396  C  CA  . LEU B 2 296 ? 5.912   7.295   18.392  1.00 37.64 ? 299  LEU B CA  1 
ATOM   6397  C  C   . LEU B 2 296 ? 6.317   7.434   16.934  1.00 37.74 ? 299  LEU B C   1 
ATOM   6398  O  O   . LEU B 2 296 ? 6.208   8.517   16.362  1.00 37.74 ? 299  LEU B O   1 
ATOM   6399  C  CB  . LEU B 2 296 ? 6.915   8.065   19.251  1.00 37.17 ? 299  LEU B CB  1 
ATOM   6400  C  CG  . LEU B 2 296 ? 6.439   9.357   19.909  1.00 36.78 ? 299  LEU B CG  1 
ATOM   6401  C  CD1 . LEU B 2 296 ? 7.654   10.147  20.299  1.00 36.42 ? 299  LEU B CD1 1 
ATOM   6402  C  CD2 . LEU B 2 296 ? 5.558   10.178  18.985  1.00 36.65 ? 299  LEU B CD2 1 
ATOM   6403  N  N   . THR B 2 297 ? 6.813   6.358   16.337  1.00 37.75 ? 300  THR B N   1 
ATOM   6404  C  CA  . THR B 2 297 ? 7.221   6.423   14.946  1.00 37.83 ? 300  THR B CA  1 
ATOM   6405  C  C   . THR B 2 297 ? 6.101   6.031   13.999  1.00 38.10 ? 300  THR B C   1 
ATOM   6406  O  O   . THR B 2 297 ? 6.324   5.905   12.803  1.00 38.20 ? 300  THR B O   1 
ATOM   6407  C  CB  . THR B 2 297 ? 8.438   5.543   14.679  1.00 37.70 ? 300  THR B CB  1 
ATOM   6408  O  OG1 . THR B 2 297 ? 8.098   4.176   14.927  1.00 37.60 ? 300  THR B OG1 1 
ATOM   6409  C  CG2 . THR B 2 297 ? 9.586   5.951   15.588  1.00 37.54 ? 300  THR B CG2 1 
ATOM   6410  N  N   . LYS B 2 298 ? 4.895   5.861   14.532  1.00 38.28 ? 301  LYS B N   1 
ATOM   6411  C  CA  . LYS B 2 298 ? 3.739   5.485   13.722  1.00 38.47 ? 301  LYS B CA  1 
ATOM   6412  C  C   . LYS B 2 298 ? 2.599   6.495   13.853  1.00 38.88 ? 301  LYS B C   1 
ATOM   6413  O  O   . LYS B 2 298 ? 2.424   7.122   14.900  1.00 38.93 ? 301  LYS B O   1 
ATOM   6414  C  CB  . LYS B 2 298 ? 3.209   4.118   14.156  1.00 38.10 ? 301  LYS B CB  1 
ATOM   6415  C  CG  . LYS B 2 298 ? 4.199   2.985   14.111  1.00 37.63 ? 301  LYS B CG  1 
ATOM   6416  C  CD  . LYS B 2 298 ? 4.529   2.593   12.695  1.00 37.32 ? 301  LYS B CD  1 
ATOM   6417  C  CE  . LYS B 2 298 ? 5.426   1.377   12.693  1.00 37.09 ? 301  LYS B CE  1 
ATOM   6418  N  NZ  . LYS B 2 298 ? 6.627   1.586   13.544  1.00 36.99 ? 301  LYS B NZ  1 
ATOM   6419  N  N   . VAL B 2 299 ? 1.820   6.638   12.786  1.00 39.25 ? 302  VAL B N   1 
ATOM   6420  C  CA  . VAL B 2 299 ? 0.667   7.540   12.773  1.00 39.63 ? 302  VAL B CA  1 
ATOM   6421  C  C   . VAL B 2 299 ? -0.590  6.683   12.680  1.00 40.11 ? 302  VAL B C   1 
ATOM   6422  O  O   . VAL B 2 299 ? -0.506  5.502   12.341  1.00 40.23 ? 302  VAL B O   1 
ATOM   6423  C  CB  . VAL B 2 299 ? 0.681   8.459   11.530  1.00 39.52 ? 302  VAL B CB  1 
ATOM   6424  C  CG1 . VAL B 2 299 ? 1.941   9.292   11.495  1.00 39.34 ? 302  VAL B CG1 1 
ATOM   6425  C  CG2 . VAL B 2 299 ? 0.560   7.634   10.252  1.00 39.18 ? 302  VAL B CG2 1 
ATOM   6426  N  N   . TRP B 2 300 ? -1.745  7.251   13.018  1.00 40.62 ? 303  TRP B N   1 
ATOM   6427  C  CA  . TRP B 2 300 ? -3.011  6.522   12.894  1.00 41.18 ? 303  TRP B CA  1 
ATOM   6428  C  C   . TRP B 2 300 ? -3.627  7.003   11.581  1.00 42.05 ? 303  TRP B C   1 
ATOM   6429  O  O   . TRP B 2 300 ? -4.032  8.165   11.480  1.00 42.24 ? 303  TRP B O   1 
ATOM   6430  C  CB  . TRP B 2 300 ? -3.995  6.871   14.009  1.00 40.60 ? 303  TRP B CB  1 
ATOM   6431  C  CG  . TRP B 2 300 ? -3.685  6.366   15.377  1.00 39.95 ? 303  TRP B CG  1 
ATOM   6432  C  CD1 . TRP B 2 300 ? -2.619  5.610   15.764  1.00 39.82 ? 303  TRP B CD1 1 
ATOM   6433  C  CD2 . TRP B 2 300 ? -4.444  6.624   16.557  1.00 39.54 ? 303  TRP B CD2 1 
ATOM   6434  N  NE1 . TRP B 2 300 ? -2.663  5.387   17.120  1.00 39.50 ? 303  TRP B NE1 1 
ATOM   6435  C  CE2 . TRP B 2 300 ? -3.775  6.002   17.630  1.00 39.60 ? 303  TRP B CE2 1 
ATOM   6436  C  CE3 . TRP B 2 300 ? -5.625  7.331   16.814  1.00 39.34 ? 303  TRP B CE3 1 
ATOM   6437  C  CZ2 . TRP B 2 300 ? -4.247  6.067   18.942  1.00 39.48 ? 303  TRP B CZ2 1 
ATOM   6438  C  CZ3 . TRP B 2 300 ? -6.093  7.398   18.113  1.00 39.19 ? 303  TRP B CZ3 1 
ATOM   6439  C  CH2 . TRP B 2 300 ? -5.405  6.771   19.162  1.00 39.27 ? 303  TRP B CH2 1 
ATOM   6440  N  N   . PRO B 2 301 ? -3.728  6.119   10.566  1.00 42.84 ? 304  PRO B N   1 
ATOM   6441  C  CA  . PRO B 2 301 ? -4.305  6.490   9.268   1.00 43.57 ? 304  PRO B CA  1 
ATOM   6442  C  C   . PRO B 2 301 ? -5.635  7.212   9.423   1.00 44.48 ? 304  PRO B C   1 
ATOM   6443  O  O   . PRO B 2 301 ? -6.523  6.755   10.148  1.00 44.64 ? 304  PRO B O   1 
ATOM   6444  C  CB  . PRO B 2 301 ? -4.483  5.139   8.588   1.00 43.36 ? 304  PRO B CB  1 
ATOM   6445  C  CG  . PRO B 2 301 ? -3.328  4.365   9.106   1.00 43.07 ? 304  PRO B CG  1 
ATOM   6446  C  CD  . PRO B 2 301 ? -3.363  4.692   10.576  1.00 42.99 ? 304  PRO B CD  1 
ATOM   6447  N  N   . HIS B 2 302 ? -5.759  8.357   8.768   1.00 45.53 ? 305  HIS B N   1 
ATOM   6448  C  CA  . HIS B 2 302 ? -6.982  9.138   8.858   1.00 46.60 ? 305  HIS B CA  1 
ATOM   6449  C  C   . HIS B 2 302 ? -8.188  8.404   8.301   1.00 47.07 ? 305  HIS B C   1 
ATOM   6450  O  O   . HIS B 2 302 ? -9.301  8.573   8.795   1.00 47.19 ? 305  HIS B O   1 
ATOM   6451  C  CB  . HIS B 2 302 ? -6.802  10.486  8.171   1.00 47.11 ? 305  HIS B CB  1 
ATOM   6452  C  CG  . HIS B 2 302 ? -5.904  11.422  8.920   1.00 47.99 ? 305  HIS B CG  1 
ATOM   6453  N  ND1 . HIS B 2 302 ? -5.473  12.623  8.398   1.00 48.39 ? 305  HIS B ND1 1 
ATOM   6454  C  CD2 . HIS B 2 302 ? -5.365  11.339  10.161  1.00 48.27 ? 305  HIS B CD2 1 
ATOM   6455  C  CE1 . HIS B 2 302 ? -4.710  13.240  9.284   1.00 48.49 ? 305  HIS B CE1 1 
ATOM   6456  N  NE2 . HIS B 2 302 ? -4.628  12.482  10.361  1.00 48.54 ? 305  HIS B NE2 1 
ATOM   6457  N  N   . LYS B 2 303 ? -7.954  7.554   7.305   1.00 47.46 ? 306  LYS B N   1 
ATOM   6458  C  CA  . LYS B 2 303 ? -9.019  6.778   6.680   1.00 47.80 ? 306  LYS B CA  1 
ATOM   6459  C  C   . LYS B 2 303 ? -9.695  5.869   7.691   1.00 47.57 ? 306  LYS B C   1 
ATOM   6460  O  O   . LYS B 2 303 ? -10.908 5.661   7.639   1.00 47.63 ? 306  LYS B O   1 
ATOM   6461  C  CB  . LYS B 2 303 ? -8.445  5.918   5.556   1.00 48.67 ? 306  LYS B CB  1 
ATOM   6462  C  CG  . LYS B 2 303 ? -7.489  6.678   4.658   1.00 50.02 ? 306  LYS B CG  1 
ATOM   6463  C  CD  . LYS B 2 303 ? -7.360  6.039   3.273   1.00 51.07 ? 306  LYS B CD  1 
ATOM   6464  C  CE  . LYS B 2 303 ? -6.733  7.044   2.287   1.00 51.72 ? 306  LYS B CE  1 
ATOM   6465  N  NZ  . LYS B 2 303 ? -6.751  6.564   0.872   1.00 52.30 ? 306  LYS B NZ  1 
ATOM   6466  N  N   . ASP B 2 304 ? -8.895  5.325   8.603   1.00 47.33 ? 307  ASP B N   1 
ATOM   6467  C  CA  . ASP B 2 304 ? -9.386  4.419   9.631   1.00 46.99 ? 307  ASP B CA  1 
ATOM   6468  C  C   . ASP B 2 304 ? -9.711  5.127   10.941  1.00 46.53 ? 307  ASP B C   1 
ATOM   6469  O  O   . ASP B 2 304 ? -10.513 4.635   11.738  1.00 46.45 ? 307  ASP B O   1 
ATOM   6470  C  CB  . ASP B 2 304 ? -8.367  3.299   9.862   1.00 47.40 ? 307  ASP B CB  1 
ATOM   6471  C  CG  . ASP B 2 304 ? -8.056  2.515   8.584   1.00 47.83 ? 307  ASP B CG  1 
ATOM   6472  O  OD1 . ASP B 2 304 ? -6.869  2.424   8.210   1.00 48.04 ? 307  ASP B OD1 1 
ATOM   6473  O  OD2 . ASP B 2 304 ? -8.998  1.987   7.949   1.00 48.17 ? 307  ASP B OD2 1 
ATOM   6474  N  N   . TYR B 2 305 ? -9.090  6.285   11.157  1.00 45.90 ? 308  TYR B N   1 
ATOM   6475  C  CA  . TYR B 2 305 ? -9.311  7.070   12.368  1.00 45.28 ? 308  TYR B CA  1 
ATOM   6476  C  C   . TYR B 2 305 ? -9.474  8.528   11.984  1.00 44.89 ? 308  TYR B C   1 
ATOM   6477  O  O   . TYR B 2 305 ? -8.513  9.295   11.989  1.00 45.02 ? 308  TYR B O   1 
ATOM   6478  C  CB  . TYR B 2 305 ? -8.141  6.894   13.337  1.00 45.15 ? 308  TYR B CB  1 
ATOM   6479  C  CG  . TYR B 2 305 ? -7.947  5.455   13.723  1.00 45.00 ? 308  TYR B CG  1 
ATOM   6480  C  CD1 . TYR B 2 305 ? -8.705  4.882   14.740  1.00 44.85 ? 308  TYR B CD1 1 
ATOM   6481  C  CD2 . TYR B 2 305 ? -7.073  4.639   13.013  1.00 44.88 ? 308  TYR B CD2 1 
ATOM   6482  C  CE1 . TYR B 2 305 ? -8.606  3.526   15.038  1.00 44.90 ? 308  TYR B CE1 1 
ATOM   6483  C  CE2 . TYR B 2 305 ? -6.967  3.280   13.302  1.00 45.06 ? 308  TYR B CE2 1 
ATOM   6484  C  CZ  . TYR B 2 305 ? -7.740  2.728   14.316  1.00 44.96 ? 308  TYR B CZ  1 
ATOM   6485  O  OH  . TYR B 2 305 ? -7.663  1.380   14.589  1.00 44.84 ? 308  TYR B OH  1 
ATOM   6486  N  N   . PRO B 2 306 ? -10.702 8.922   11.620  1.00 44.42 ? 309  PRO B N   1 
ATOM   6487  C  CA  . PRO B 2 306 ? -11.061 10.280  11.208  1.00 44.14 ? 309  PRO B CA  1 
ATOM   6488  C  C   . PRO B 2 306 ? -10.867 11.360  12.269  1.00 43.85 ? 309  PRO B C   1 
ATOM   6489  O  O   . PRO B 2 306 ? -10.992 11.109  13.469  1.00 43.81 ? 309  PRO B O   1 
ATOM   6490  C  CB  . PRO B 2 306 ? -12.545 10.138  10.858  1.00 44.12 ? 309  PRO B CB  1 
ATOM   6491  C  CG  . PRO B 2 306 ? -12.673 8.709   10.468  1.00 44.13 ? 309  PRO B CG  1 
ATOM   6492  C  CD  . PRO B 2 306 ? -11.870 8.035   11.526  1.00 44.29 ? 309  PRO B CD  1 
ATOM   6493  N  N   . LEU B 2 307 ? -10.555 12.568  11.813  1.00 43.43 ? 310  LEU B N   1 
ATOM   6494  C  CA  . LEU B 2 307 ? -10.395 13.690  12.715  1.00 43.08 ? 310  LEU B CA  1 
ATOM   6495  C  C   . LEU B 2 307 ? -11.777 14.080  13.213  1.00 42.88 ? 310  LEU B C   1 
ATOM   6496  O  O   . LEU B 2 307 ? -12.738 14.121  12.446  1.00 43.00 ? 310  LEU B O   1 
ATOM   6497  C  CB  . LEU B 2 307 ? -9.774  14.880  11.996  1.00 42.97 ? 310  LEU B CB  1 
ATOM   6498  C  CG  . LEU B 2 307 ? -8.308  14.776  11.601  1.00 42.94 ? 310  LEU B CG  1 
ATOM   6499  C  CD1 . LEU B 2 307 ? -7.866  16.089  10.987  1.00 42.89 ? 310  LEU B CD1 1 
ATOM   6500  C  CD2 . LEU B 2 307 ? -7.476  14.464  12.820  1.00 43.01 ? 310  LEU B CD2 1 
ATOM   6501  N  N   . ILE B 2 308 ? -11.874 14.336  14.510  1.00 42.58 ? 311  ILE B N   1 
ATOM   6502  C  CA  . ILE B 2 308 ? -13.127 14.730  15.132  1.00 42.03 ? 311  ILE B CA  1 
ATOM   6503  C  C   . ILE B 2 308 ? -12.902 16.132  15.687  1.00 41.68 ? 311  ILE B C   1 
ATOM   6504  O  O   . ILE B 2 308 ? -12.085 16.322  16.582  1.00 41.68 ? 311  ILE B O   1 
ATOM   6505  C  CB  . ILE B 2 308 ? -13.481 13.776  16.289  1.00 42.03 ? 311  ILE B CB  1 
ATOM   6506  C  CG1 . ILE B 2 308 ? -13.483 12.326  15.792  1.00 42.09 ? 311  ILE B CG1 1 
ATOM   6507  C  CG2 . ILE B 2 308 ? -14.832 14.142  16.880  1.00 42.03 ? 311  ILE B CG2 1 
ATOM   6508  C  CD1 . ILE B 2 308 ? -13.558 11.278  16.906  1.00 41.96 ? 311  ILE B CD1 1 
ATOM   6509  N  N   . PRO B 2 309 ? -13.614 17.135  15.151  1.00 41.34 ? 312  PRO B N   1 
ATOM   6510  C  CA  . PRO B 2 309 ? -13.485 18.526  15.597  1.00 41.10 ? 312  PRO B CA  1 
ATOM   6511  C  C   . PRO B 2 309 ? -13.808 18.756  17.067  1.00 40.91 ? 312  PRO B C   1 
ATOM   6512  O  O   . PRO B 2 309 ? -14.789 18.226  17.581  1.00 40.79 ? 312  PRO B O   1 
ATOM   6513  C  CB  . PRO B 2 309 ? -14.463 19.268  14.683  1.00 41.22 ? 312  PRO B CB  1 
ATOM   6514  C  CG  . PRO B 2 309 ? -15.483 18.232  14.353  1.00 41.21 ? 312  PRO B CG  1 
ATOM   6515  C  CD  . PRO B 2 309 ? -14.622 17.026  14.083  1.00 41.32 ? 312  PRO B CD  1 
ATOM   6516  N  N   . VAL B 2 310 ? -12.981 19.565  17.729  1.00 40.75 ? 313  VAL B N   1 
ATOM   6517  C  CA  . VAL B 2 310 ? -13.163 19.881  19.146  1.00 40.51 ? 313  VAL B CA  1 
ATOM   6518  C  C   . VAL B 2 310 ? -13.291 21.382  19.415  1.00 40.42 ? 313  VAL B C   1 
ATOM   6519  O  O   . VAL B 2 310 ? -14.209 21.818  20.110  1.00 40.56 ? 313  VAL B O   1 
ATOM   6520  C  CB  . VAL B 2 310 ? -12.004 19.335  19.995  1.00 40.36 ? 313  VAL B CB  1 
ATOM   6521  C  CG1 . VAL B 2 310 ? -12.269 19.592  21.468  1.00 40.03 ? 313  VAL B CG1 1 
ATOM   6522  C  CG2 . VAL B 2 310 ? -11.819 17.843  19.734  1.00 40.32 ? 313  VAL B CG2 1 
ATOM   6523  N  N   . GLY B 2 311 ? -12.368 22.171  18.880  1.00 40.33 ? 314  GLY B N   1 
ATOM   6524  C  CA  . GLY B 2 311 ? -12.435 23.598  19.108  1.00 40.15 ? 314  GLY B CA  1 
ATOM   6525  C  C   . GLY B 2 311 ? -11.419 24.408  18.337  1.00 40.18 ? 314  GLY B C   1 
ATOM   6526  O  O   . GLY B 2 311 ? -10.915 23.973  17.303  1.00 40.10 ? 314  GLY B O   1 
ATOM   6527  N  N   . LYS B 2 312 ? -11.131 25.599  18.847  1.00 40.24 ? 315  LYS B N   1 
ATOM   6528  C  CA  . LYS B 2 312 ? -10.188 26.506  18.219  1.00 40.37 ? 315  LYS B CA  1 
ATOM   6529  C  C   . LYS B 2 312 ? -9.125  26.968  19.193  1.00 40.05 ? 315  LYS B C   1 
ATOM   6530  O  O   . LYS B 2 312 ? -9.364  27.096  20.391  1.00 39.95 ? 315  LYS B O   1 
ATOM   6531  C  CB  . LYS B 2 312 ? -10.909 27.756  17.710  1.00 41.07 ? 315  LYS B CB  1 
ATOM   6532  C  CG  . LYS B 2 312 ? -11.935 27.527  16.624  1.00 42.24 ? 315  LYS B CG  1 
ATOM   6533  C  CD  . LYS B 2 312 ? -11.294 27.360  15.247  1.00 43.03 ? 315  LYS B CD  1 
ATOM   6534  C  CE  . LYS B 2 312 ? -12.366 27.175  14.174  1.00 43.47 ? 315  LYS B CE  1 
ATOM   6535  N  NZ  . LYS B 2 312 ? -11.758 26.919  12.839  1.00 44.15 ? 315  LYS B NZ  1 
ATOM   6536  N  N   . LEU B 2 313 ? -7.958  27.258  18.645  1.00 39.69 ? 316  LEU B N   1 
ATOM   6537  C  CA  . LEU B 2 313 ? -6.837  27.764  19.410  1.00 39.37 ? 316  LEU B CA  1 
ATOM   6538  C  C   . LEU B 2 313 ? -6.594  29.136  18.778  1.00 39.17 ? 316  LEU B C   1 
ATOM   6539  O  O   . LEU B 2 313 ? -6.436  29.236  17.562  1.00 39.12 ? 316  LEU B O   1 
ATOM   6540  C  CB  . LEU B 2 313 ? -5.623  26.846  19.214  1.00 39.32 ? 316  LEU B CB  1 
ATOM   6541  C  CG  . LEU B 2 313 ? -4.986  26.126  20.412  1.00 39.38 ? 316  LEU B CG  1 
ATOM   6542  C  CD1 . LEU B 2 313 ? -6.026  25.472  21.306  1.00 39.20 ? 316  LEU B CD1 1 
ATOM   6543  C  CD2 . LEU B 2 313 ? -3.990  25.088  19.904  1.00 39.38 ? 316  LEU B CD2 1 
ATOM   6544  N  N   . VAL B 2 314 ? -6.652  30.196  19.578  1.00 38.80 ? 317  VAL B N   1 
ATOM   6545  C  CA  . VAL B 2 314 ? -6.441  31.553  19.066  1.00 38.45 ? 317  VAL B CA  1 
ATOM   6546  C  C   . VAL B 2 314 ? -5.387  32.295  19.881  1.00 38.47 ? 317  VAL B C   1 
ATOM   6547  O  O   . VAL B 2 314 ? -5.442  32.310  21.110  1.00 38.48 ? 317  VAL B O   1 
ATOM   6548  C  CB  . VAL B 2 314 ? -7.749  32.398  19.097  1.00 38.34 ? 317  VAL B CB  1 
ATOM   6549  C  CG1 . VAL B 2 314 ? -7.486  33.804  18.588  1.00 38.01 ? 317  VAL B CG1 1 
ATOM   6550  C  CG2 . VAL B 2 314 ? -8.836  31.741  18.266  1.00 38.29 ? 317  VAL B CG2 1 
ATOM   6551  N  N   . LEU B 2 315 ? -4.406  32.877  19.191  1.00 38.24 ? 318  LEU B N   1 
ATOM   6552  C  CA  . LEU B 2 315 ? -3.350  33.650  19.835  1.00 37.91 ? 318  LEU B CA  1 
ATOM   6553  C  C   . LEU B 2 315 ? -3.603  35.103  19.478  1.00 38.09 ? 318  LEU B C   1 
ATOM   6554  O  O   . LEU B 2 315 ? -3.498  35.490  18.312  1.00 38.03 ? 318  LEU B O   1 
ATOM   6555  C  CB  . LEU B 2 315 ? -1.971  33.216  19.345  1.00 37.48 ? 318  LEU B CB  1 
ATOM   6556  C  CG  . LEU B 2 315 ? -1.574  31.785  19.711  1.00 37.16 ? 318  LEU B CG  1 
ATOM   6557  C  CD1 . LEU B 2 315 ? -0.166  31.508  19.244  1.00 37.18 ? 318  LEU B CD1 1 
ATOM   6558  C  CD2 . LEU B 2 315 ? -1.672  31.587  21.201  1.00 37.00 ? 318  LEU B CD2 1 
ATOM   6559  N  N   . ASN B 2 316 ? -3.950  35.904  20.481  1.00 38.24 ? 319  ASN B N   1 
ATOM   6560  C  CA  . ASN B 2 316 ? -4.253  37.306  20.250  1.00 38.51 ? 319  ASN B CA  1 
ATOM   6561  C  C   . ASN B 2 316 ? -3.509  38.277  21.156  1.00 38.57 ? 319  ASN B C   1 
ATOM   6562  O  O   . ASN B 2 316 ? -3.859  39.459  21.214  1.00 38.73 ? 319  ASN B O   1 
ATOM   6563  C  CB  . ASN B 2 316 ? -5.759  37.532  20.388  1.00 38.61 ? 319  ASN B CB  1 
ATOM   6564  C  CG  . ASN B 2 316 ? -6.276  37.182  21.768  1.00 38.87 ? 319  ASN B CG  1 
ATOM   6565  O  OD1 . ASN B 2 316 ? -5.507  36.830  22.657  1.00 39.14 ? 319  ASN B OD1 1 
ATOM   6566  N  ND2 . ASN B 2 316 ? -7.587  37.282  21.955  1.00 39.19 ? 319  ASN B ND2 1 
ATOM   6567  N  N   . ARG B 2 317 ? -2.484  37.796  21.853  1.00 38.50 ? 320  ARG B N   1 
ATOM   6568  C  CA  . ARG B 2 317 ? -1.730  38.662  22.749  1.00 38.36 ? 320  ARG B CA  1 
ATOM   6569  C  C   . ARG B 2 317 ? -0.232  38.383  22.759  1.00 38.18 ? 320  ARG B C   1 
ATOM   6570  O  O   . ARG B 2 317 ? 0.203   37.246  22.932  1.00 38.19 ? 320  ARG B O   1 
ATOM   6571  C  CB  . ARG B 2 317 ? -2.275  38.557  24.170  1.00 38.43 ? 320  ARG B CB  1 
ATOM   6572  C  CG  . ARG B 2 317 ? -1.675  39.569  25.114  1.00 38.78 ? 320  ARG B CG  1 
ATOM   6573  C  CD  . ARG B 2 317 ? -2.289  39.468  26.494  1.00 39.37 ? 320  ARG B CD  1 
ATOM   6574  N  NE  . ARG B 2 317 ? -1.579  38.548  27.381  1.00 39.87 ? 320  ARG B NE  1 
ATOM   6575  C  CZ  . ARG B 2 317 ? -2.095  37.422  27.866  1.00 40.15 ? 320  ARG B CZ  1 
ATOM   6576  N  NH1 . ARG B 2 317 ? -3.325  37.056  27.535  1.00 40.13 ? 320  ARG B NH1 1 
ATOM   6577  N  NH2 . ARG B 2 317 ? -1.410  36.702  28.749  1.00 40.33 ? 320  ARG B NH2 1 
ATOM   6578  N  N   . ASN B 2 318 ? 0.552   39.435  22.556  1.00 37.79 ? 321  ASN B N   1 
ATOM   6579  C  CA  . ASN B 2 318 ? 2.000   39.325  22.557  1.00 37.44 ? 321  ASN B CA  1 
ATOM   6580  C  C   . ASN B 2 318 ? 2.509   39.422  23.977  1.00 37.24 ? 321  ASN B C   1 
ATOM   6581  O  O   . ASN B 2 318 ? 1.788   39.860  24.876  1.00 37.39 ? 321  ASN B O   1 
ATOM   6582  C  CB  . ASN B 2 318 ? 2.616   40.465  21.751  1.00 37.23 ? 321  ASN B CB  1 
ATOM   6583  C  CG  . ASN B 2 318 ? 2.566   40.218  20.277  1.00 37.23 ? 321  ASN B CG  1 
ATOM   6584  O  OD1 . ASN B 2 318 ? 2.889   39.129  19.819  1.00 37.59 ? 321  ASN B OD1 1 
ATOM   6585  N  ND2 . ASN B 2 318 ? 2.181   41.232  19.513  1.00 37.29 ? 321  ASN B ND2 1 
ATOM   6586  N  N   . PRO B 2 319 ? 3.747   38.966  24.216  1.00 36.95 ? 322  PRO B N   1 
ATOM   6587  C  CA  . PRO B 2 319 ? 4.315   39.041  25.564  1.00 36.62 ? 322  PRO B CA  1 
ATOM   6588  C  C   . PRO B 2 319 ? 4.612   40.509  25.831  1.00 36.37 ? 322  PRO B C   1 
ATOM   6589  O  O   . PRO B 2 319 ? 4.820   41.275  24.891  1.00 36.28 ? 322  PRO B O   1 
ATOM   6590  C  CB  . PRO B 2 319 ? 5.637   38.287  25.421  1.00 36.70 ? 322  PRO B CB  1 
ATOM   6591  C  CG  . PRO B 2 319 ? 5.417   37.392  24.257  1.00 36.83 ? 322  PRO B CG  1 
ATOM   6592  C  CD  . PRO B 2 319 ? 4.647   38.240  23.307  1.00 36.86 ? 322  PRO B CD  1 
ATOM   6593  N  N   . VAL B 2 320 ? 4.582   40.923  27.088  1.00 36.16 ? 323  VAL B N   1 
ATOM   6594  C  CA  . VAL B 2 320 ? 4.910   42.303  27.401  1.00 35.98 ? 323  VAL B CA  1 
ATOM   6595  C  C   . VAL B 2 320 ? 6.389   42.326  27.737  1.00 35.97 ? 323  VAL B C   1 
ATOM   6596  O  O   . VAL B 2 320 ? 7.083   43.296  27.449  1.00 35.83 ? 323  VAL B O   1 
ATOM   6597  C  CB  . VAL B 2 320 ? 4.081   42.854  28.559  1.00 36.00 ? 323  VAL B CB  1 
ATOM   6598  C  CG1 . VAL B 2 320 ? 4.578   44.236  28.930  1.00 35.77 ? 323  VAL B CG1 1 
ATOM   6599  C  CG2 . VAL B 2 320 ? 2.612   42.918  28.156  1.00 35.73 ? 323  VAL B CG2 1 
ATOM   6600  N  N   . ASN B 2 321 ? 6.865   41.225  28.315  1.00 35.89 ? 324  ASN B N   1 
ATOM   6601  C  CA  . ASN B 2 321 ? 8.270   41.055  28.665  1.00 35.87 ? 324  ASN B CA  1 
ATOM   6602  C  C   . ASN B 2 321 ? 8.656   39.614  28.337  1.00 35.91 ? 324  ASN B C   1 
ATOM   6603  O  O   . ASN B 2 321 ? 8.243   38.675  29.019  1.00 36.06 ? 324  ASN B O   1 
ATOM   6604  C  CB  . ASN B 2 321 ? 8.518   41.339  30.149  1.00 35.76 ? 324  ASN B CB  1 
ATOM   6605  C  CG  . ASN B 2 321 ? 9.991   41.261  30.512  1.00 35.68 ? 324  ASN B CG  1 
ATOM   6606  O  OD1 . ASN B 2 321 ? 10.521  40.184  30.775  1.00 35.58 ? 324  ASN B OD1 1 
ATOM   6607  N  ND2 . ASN B 2 321 ? 10.663  42.405  30.505  1.00 35.79 ? 324  ASN B ND2 1 
ATOM   6608  N  N   . TYR B 2 322 ? 9.462   39.448  27.295  1.00 35.79 ? 325  TYR B N   1 
ATOM   6609  C  CA  . TYR B 2 322 ? 9.896   38.130  26.848  1.00 35.66 ? 325  TYR B CA  1 
ATOM   6610  C  C   . TYR B 2 322 ? 10.506  37.223  27.928  1.00 35.66 ? 325  TYR B C   1 
ATOM   6611  O  O   . TYR B 2 322 ? 10.082  36.078  28.087  1.00 35.54 ? 325  TYR B O   1 
ATOM   6612  C  CB  . TYR B 2 322 ? 10.867  38.279  25.666  1.00 35.60 ? 325  TYR B CB  1 
ATOM   6613  C  CG  . TYR B 2 322 ? 11.272  36.975  25.005  1.00 35.69 ? 325  TYR B CG  1 
ATOM   6614  C  CD1 . TYR B 2 322 ? 10.668  36.555  23.822  1.00 35.66 ? 325  TYR B CD1 1 
ATOM   6615  C  CD2 . TYR B 2 322 ? 12.274  36.168  25.553  1.00 35.72 ? 325  TYR B CD2 1 
ATOM   6616  C  CE1 . TYR B 2 322 ? 11.053  35.363  23.196  1.00 35.81 ? 325  TYR B CE1 1 
ATOM   6617  C  CE2 . TYR B 2 322 ? 12.661  34.978  24.936  1.00 35.94 ? 325  TYR B CE2 1 
ATOM   6618  C  CZ  . TYR B 2 322 ? 12.048  34.583  23.759  1.00 35.87 ? 325  TYR B CZ  1 
ATOM   6619  O  OH  . TYR B 2 322 ? 12.435  33.415  23.148  1.00 35.93 ? 325  TYR B OH  1 
ATOM   6620  N  N   . PHE B 2 323 ? 11.498  37.713  28.662  1.00 35.54 ? 326  PHE B N   1 
ATOM   6621  C  CA  . PHE B 2 323 ? 12.132  36.878  29.676  1.00 35.47 ? 326  PHE B CA  1 
ATOM   6622  C  C   . PHE B 2 323 ? 11.139  36.318  30.679  1.00 35.53 ? 326  PHE B C   1 
ATOM   6623  O  O   . PHE B 2 323 ? 11.142  35.117  30.962  1.00 35.40 ? 326  PHE B O   1 
ATOM   6624  C  CB  . PHE B 2 323 ? 13.230  37.644  30.418  1.00 35.02 ? 326  PHE B CB  1 
ATOM   6625  C  CG  . PHE B 2 323 ? 13.999  36.796  31.395  1.00 34.73 ? 326  PHE B CG  1 
ATOM   6626  C  CD1 . PHE B 2 323 ? 13.662  36.783  32.747  1.00 34.56 ? 326  PHE B CD1 1 
ATOM   6627  C  CD2 . PHE B 2 323 ? 15.044  35.988  30.960  1.00 34.48 ? 326  PHE B CD2 1 
ATOM   6628  C  CE1 . PHE B 2 323 ? 14.351  35.976  33.644  1.00 34.50 ? 326  PHE B CE1 1 
ATOM   6629  C  CE2 . PHE B 2 323 ? 15.738  35.179  31.849  1.00 34.36 ? 326  PHE B CE2 1 
ATOM   6630  C  CZ  . PHE B 2 323 ? 15.394  35.172  33.192  1.00 34.46 ? 326  PHE B CZ  1 
ATOM   6631  N  N   . ALA B 2 324 ? 10.275  37.190  31.186  1.00 35.70 ? 327  ALA B N   1 
ATOM   6632  C  CA  . ALA B 2 324 ? 9.288   36.816  32.188  1.00 35.90 ? 327  ALA B CA  1 
ATOM   6633  C  C   . ALA B 2 324 ? 8.178   35.900  31.701  1.00 36.10 ? 327  ALA B C   1 
ATOM   6634  O  O   . ALA B 2 324 ? 7.819   34.940  32.387  1.00 36.14 ? 327  ALA B O   1 
ATOM   6635  C  CB  . ALA B 2 324 ? 8.687   38.067  32.811  1.00 35.83 ? 327  ALA B CB  1 
ATOM   6636  N  N   . GLU B 2 325 ? 7.670   36.164  30.502  1.00 36.13 ? 328  GLU B N   1 
ATOM   6637  C  CA  . GLU B 2 325 ? 6.563   35.385  29.964  1.00 36.28 ? 328  GLU B CA  1 
ATOM   6638  C  C   . GLU B 2 325 ? 6.900   34.276  28.983  1.00 36.26 ? 328  GLU B C   1 
ATOM   6639  O  O   . GLU B 2 325 ? 6.079   33.389  28.753  1.00 36.10 ? 328  GLU B O   1 
ATOM   6640  C  CB  . GLU B 2 325 ? 5.546   36.333  29.334  1.00 36.52 ? 328  GLU B CB  1 
ATOM   6641  C  CG  . GLU B 2 325 ? 5.046   37.387  30.301  1.00 37.11 ? 328  GLU B CG  1 
ATOM   6642  C  CD  . GLU B 2 325 ? 4.279   38.486  29.613  1.00 37.39 ? 328  GLU B CD  1 
ATOM   6643  O  OE1 . GLU B 2 325 ? 3.241   38.185  28.994  1.00 37.81 ? 328  GLU B OE1 1 
ATOM   6644  O  OE2 . GLU B 2 325 ? 4.704   39.655  29.697  1.00 37.63 ? 328  GLU B OE2 1 
ATOM   6645  N  N   . VAL B 2 326 ? 8.090   34.324  28.391  1.00 36.05 ? 329  VAL B N   1 
ATOM   6646  C  CA  . VAL B 2 326 ? 8.478   33.308  27.425  1.00 35.86 ? 329  VAL B CA  1 
ATOM   6647  C  C   . VAL B 2 326 ? 9.693   32.495  27.839  1.00 36.08 ? 329  VAL B C   1 
ATOM   6648  O  O   . VAL B 2 326 ? 9.630   31.271  27.887  1.00 36.04 ? 329  VAL B O   1 
ATOM   6649  C  CB  . VAL B 2 326 ? 8.727   33.908  26.019  1.00 35.75 ? 329  VAL B CB  1 
ATOM   6650  C  CG1 . VAL B 2 326 ? 9.088   32.806  25.031  1.00 35.37 ? 329  VAL B CG1 1 
ATOM   6651  C  CG2 . VAL B 2 326 ? 7.490   34.649  25.534  1.00 35.48 ? 329  VAL B CG2 1 
ATOM   6652  N  N   . GLU B 2 327 ? 10.802  33.159  28.133  1.00 36.18 ? 330  GLU B N   1 
ATOM   6653  C  CA  . GLU B 2 327 ? 12.003  32.435  28.515  1.00 36.29 ? 330  GLU B CA  1 
ATOM   6654  C  C   . GLU B 2 327 ? 11.779  31.588  29.757  1.00 36.43 ? 330  GLU B C   1 
ATOM   6655  O  O   . GLU B 2 327 ? 12.283  30.468  29.842  1.00 36.40 ? 330  GLU B O   1 
ATOM   6656  C  CB  . GLU B 2 327 ? 13.178  33.394  28.712  1.00 36.50 ? 330  GLU B CB  1 
ATOM   6657  C  CG  . GLU B 2 327 ? 14.531  32.703  28.906  1.00 36.88 ? 330  GLU B CG  1 
ATOM   6658  C  CD  . GLU B 2 327 ? 14.895  31.747  27.771  1.00 37.22 ? 330  GLU B CD  1 
ATOM   6659  O  OE1 . GLU B 2 327 ? 15.641  30.772  28.023  1.00 37.33 ? 330  GLU B OE1 1 
ATOM   6660  O  OE2 . GLU B 2 327 ? 14.449  31.968  26.623  1.00 37.42 ? 330  GLU B OE2 1 
ATOM   6661  N  N   . GLN B 2 328 ? 10.973  32.091  30.689  1.00 36.35 ? 331  GLN B N   1 
ATOM   6662  C  CA  . GLN B 2 328 ? 10.689  31.363  31.926  1.00 36.23 ? 331  GLN B CA  1 
ATOM   6663  C  C   . GLN B 2 328 ? 9.456   30.446  31.911  1.00 36.20 ? 331  GLN B C   1 
ATOM   6664  O  O   . GLN B 2 328 ? 9.152   29.812  32.928  1.00 36.27 ? 331  GLN B O   1 
ATOM   6665  C  CB  . GLN B 2 328 ? 10.576  32.325  33.114  1.00 36.23 ? 331  GLN B CB  1 
ATOM   6666  C  CG  . GLN B 2 328 ? 11.879  32.981  33.535  1.00 36.23 ? 331  GLN B CG  1 
ATOM   6667  C  CD  . GLN B 2 328 ? 11.742  33.717  34.852  1.00 36.40 ? 331  GLN B CD  1 
ATOM   6668  O  OE1 . GLN B 2 328 ? 12.596  33.608  35.728  1.00 36.60 ? 331  GLN B OE1 1 
ATOM   6669  N  NE2 . GLN B 2 328 ? 10.653  34.458  35.006  1.00 36.42 ? 331  GLN B NE2 1 
ATOM   6670  N  N   . ILE B 2 329 ? 8.729   30.375  30.796  1.00 35.90 ? 332  ILE B N   1 
ATOM   6671  C  CA  . ILE B 2 329 ? 7.550   29.511  30.761  1.00 35.68 ? 332  ILE B CA  1 
ATOM   6672  C  C   . ILE B 2 329 ? 7.995   28.049  30.785  1.00 35.76 ? 332  ILE B C   1 
ATOM   6673  O  O   . ILE B 2 329 ? 9.014   27.689  30.184  1.00 35.72 ? 332  ILE B O   1 
ATOM   6674  C  CB  . ILE B 2 329 ? 6.640   29.802  29.539  1.00 35.45 ? 332  ILE B CB  1 
ATOM   6675  C  CG1 . ILE B 2 329 ? 5.240   29.227  29.776  1.00 35.34 ? 332  ILE B CG1 1 
ATOM   6676  C  CG2 . ILE B 2 329 ? 7.236   29.209  28.277  1.00 35.56 ? 332  ILE B CG2 1 
ATOM   6677  C  CD1 . ILE B 2 329 ? 4.214   29.610  28.723  1.00 34.77 ? 332  ILE B CD1 1 
ATOM   6678  N  N   . ALA B 2 330 ? 7.254   27.224  31.518  1.00 35.45 ? 333  ALA B N   1 
ATOM   6679  C  CA  . ALA B 2 330 ? 7.574   25.814  31.645  1.00 35.20 ? 333  ALA B CA  1 
ATOM   6680  C  C   . ALA B 2 330 ? 6.363   24.928  31.386  1.00 35.29 ? 333  ALA B C   1 
ATOM   6681  O  O   . ALA B 2 330 ? 5.329   25.079  32.036  1.00 35.15 ? 333  ALA B O   1 
ATOM   6682  C  CB  . ALA B 2 330 ? 8.123   25.551  33.021  1.00 35.23 ? 333  ALA B CB  1 
ATOM   6683  N  N   . PHE B 2 331 ? 6.499   23.998  30.442  1.00 35.33 ? 334  PHE B N   1 
ATOM   6684  C  CA  . PHE B 2 331 ? 5.421   23.078  30.093  1.00 35.35 ? 334  PHE B CA  1 
ATOM   6685  C  C   . PHE B 2 331 ? 5.774   21.676  30.571  1.00 35.49 ? 334  PHE B C   1 
ATOM   6686  O  O   . PHE B 2 331 ? 6.869   21.189  30.291  1.00 35.65 ? 334  PHE B O   1 
ATOM   6687  C  CB  . PHE B 2 331 ? 5.223   23.029  28.576  1.00 35.34 ? 334  PHE B CB  1 
ATOM   6688  C  CG  . PHE B 2 331 ? 4.968   24.368  27.935  1.00 35.45 ? 334  PHE B CG  1 
ATOM   6689  C  CD1 . PHE B 2 331 ? 3.668   24.839  27.760  1.00 35.49 ? 334  PHE B CD1 1 
ATOM   6690  C  CD2 . PHE B 2 331 ? 6.023   25.128  27.441  1.00 35.39 ? 334  PHE B CD2 1 
ATOM   6691  C  CE1 . PHE B 2 331 ? 3.428   26.043  27.098  1.00 35.46 ? 334  PHE B CE1 1 
ATOM   6692  C  CE2 . PHE B 2 331 ? 5.791   26.328  26.780  1.00 35.36 ? 334  PHE B CE2 1 
ATOM   6693  C  CZ  . PHE B 2 331 ? 4.494   26.786  26.607  1.00 35.42 ? 334  PHE B CZ  1 
ATOM   6694  N  N   . ASP B 2 332 ? 4.852   21.023  31.276  1.00 35.60 ? 335  ASP B N   1 
ATOM   6695  C  CA  . ASP B 2 332 ? 5.079   19.667  31.772  1.00 35.57 ? 335  ASP B CA  1 
ATOM   6696  C  C   . ASP B 2 332 ? 4.008   18.751  31.209  1.00 35.81 ? 335  ASP B C   1 
ATOM   6697  O  O   . ASP B 2 332 ? 2.823   18.965  31.456  1.00 36.02 ? 335  ASP B O   1 
ATOM   6698  C  CB  . ASP B 2 332 ? 4.988   19.615  33.300  1.00 35.38 ? 335  ASP B CB  1 
ATOM   6699  C  CG  . ASP B 2 332 ? 6.015   20.490  33.984  1.00 35.32 ? 335  ASP B CG  1 
ATOM   6700  O  OD1 . ASP B 2 332 ? 5.640   21.232  34.914  1.00 35.35 ? 335  ASP B OD1 1 
ATOM   6701  O  OD2 . ASP B 2 332 ? 7.201   20.426  33.611  1.00 35.36 ? 335  ASP B OD2 1 
ATOM   6702  N  N   . PRO B 2 333 ? 4.402   17.736  30.417  1.00 35.94 ? 336  PRO B N   1 
ATOM   6703  C  CA  . PRO B 2 333 ? 3.428   16.800  29.837  1.00 35.98 ? 336  PRO B CA  1 
ATOM   6704  C  C   . PRO B 2 333 ? 2.627   16.092  30.930  1.00 35.95 ? 336  PRO B C   1 
ATOM   6705  O  O   . PRO B 2 333 ? 1.492   15.676  30.724  1.00 35.76 ? 336  PRO B O   1 
ATOM   6706  C  CB  . PRO B 2 333 ? 4.319   15.820  29.066  1.00 35.98 ? 336  PRO B CB  1 
ATOM   6707  C  CG  . PRO B 2 333 ? 5.435   16.687  28.602  1.00 35.81 ? 336  PRO B CG  1 
ATOM   6708  C  CD  . PRO B 2 333 ? 5.742   17.509  29.845  1.00 35.99 ? 336  PRO B CD  1 
ATOM   6709  N  N   . SER B 2 334 ? 3.233   15.977  32.101  1.00 36.09 ? 337  SER B N   1 
ATOM   6710  C  CA  . SER B 2 334 ? 2.593   15.340  33.233  1.00 36.39 ? 337  SER B CA  1 
ATOM   6711  C  C   . SER B 2 334 ? 1.477   16.206  33.813  1.00 36.47 ? 337  SER B C   1 
ATOM   6712  O  O   . SER B 2 334 ? 0.737   15.768  34.691  1.00 36.55 ? 337  SER B O   1 
ATOM   6713  C  CB  . SER B 2 334 ? 3.638   15.020  34.301  1.00 36.32 ? 337  SER B CB  1 
ATOM   6714  O  OG  . SER B 2 334 ? 4.446   16.151  34.579  1.00 36.55 ? 337  SER B OG  1 
ATOM   6715  N  N   . ASN B 2 335 ? 1.383   17.450  33.357  1.00 36.92 ? 338  ASN B N   1 
ATOM   6716  C  CA  . ASN B 2 335 ? 0.328   18.336  33.828  1.00 37.35 ? 338  ASN B CA  1 
ATOM   6717  C  C   . ASN B 2 335 ? -0.928  18.004  33.047  1.00 37.64 ? 338  ASN B C   1 
ATOM   6718  O  O   . ASN B 2 335 ? -1.131  18.502  31.933  1.00 37.63 ? 338  ASN B O   1 
ATOM   6719  C  CB  . ASN B 2 335 ? 0.695   19.804  33.621  1.00 37.32 ? 338  ASN B CB  1 
ATOM   6720  C  CG  . ASN B 2 335 ? 1.666   20.316  34.666  1.00 37.59 ? 338  ASN B CG  1 
ATOM   6721  O  OD1 . ASN B 2 335 ? 2.231   21.398  34.517  1.00 37.81 ? 338  ASN B OD1 1 
ATOM   6722  N  ND2 . ASN B 2 335 ? 1.856   19.551  35.736  1.00 37.55 ? 338  ASN B ND2 1 
ATOM   6723  N  N   . MET B 2 336 ? -1.726  17.100  33.609  1.00 38.01 ? 339  MET B N   1 
ATOM   6724  C  CA  . MET B 2 336 ? -2.976  16.668  32.997  1.00 38.34 ? 339  MET B CA  1 
ATOM   6725  C  C   . MET B 2 336 ? -4.099  16.678  34.036  1.00 38.45 ? 339  MET B C   1 
ATOM   6726  O  O   . MET B 2 336 ? -3.936  16.172  35.145  1.00 38.51 ? 339  MET B O   1 
ATOM   6727  C  CB  . MET B 2 336 ? -2.828  15.262  32.399  1.00 38.48 ? 339  MET B CB  1 
ATOM   6728  C  CG  . MET B 2 336 ? -1.801  15.156  31.276  1.00 38.80 ? 339  MET B CG  1 
ATOM   6729  S  SD  . MET B 2 336 ? -1.600  13.485  30.610  1.00 39.37 ? 339  MET B SD  1 
ATOM   6730  C  CE  . MET B 2 336 ? -1.310  12.591  32.089  1.00 38.89 ? 339  MET B CE  1 
ATOM   6731  N  N   . PRO B 2 337 ? -5.239  17.300  33.703  1.00 38.38 ? 340  PRO B N   1 
ATOM   6732  C  CA  . PRO B 2 337 ? -6.406  17.395  34.582  1.00 38.68 ? 340  PRO B CA  1 
ATOM   6733  C  C   . PRO B 2 337 ? -7.229  16.119  34.464  1.00 38.63 ? 340  PRO B C   1 
ATOM   6734  O  O   . PRO B 2 337 ? -7.058  15.359  33.516  1.00 38.58 ? 340  PRO B O   1 
ATOM   6735  C  CB  . PRO B 2 337 ? -7.154  18.576  33.989  1.00 38.62 ? 340  PRO B CB  1 
ATOM   6736  C  CG  . PRO B 2 337 ? -6.960  18.350  32.533  1.00 38.58 ? 340  PRO B CG  1 
ATOM   6737  C  CD  . PRO B 2 337 ? -5.477  18.040  32.452  1.00 38.59 ? 340  PRO B CD  1 
ATOM   6738  N  N   . PRO B 2 338 ? -8.158  15.880  35.402  1.00 38.69 ? 341  PRO B N   1 
ATOM   6739  C  CA  . PRO B 2 338 ? -8.966  14.659  35.314  1.00 39.07 ? 341  PRO B CA  1 
ATOM   6740  C  C   . PRO B 2 338 ? -9.669  14.593  33.968  1.00 39.09 ? 341  PRO B C   1 
ATOM   6741  O  O   . PRO B 2 338 ? -10.142 15.611  33.461  1.00 39.15 ? 341  PRO B O   1 
ATOM   6742  C  CB  . PRO B 2 338 ? -9.971  14.831  36.450  1.00 39.00 ? 341  PRO B CB  1 
ATOM   6743  C  CG  . PRO B 2 338 ? -9.217  15.641  37.447  1.00 39.04 ? 341  PRO B CG  1 
ATOM   6744  C  CD  . PRO B 2 338 ? -8.540  16.676  36.577  1.00 38.96 ? 341  PRO B CD  1 
ATOM   6745  N  N   . GLY B 2 339 ? -9.689  13.400  33.379  1.00 39.26 ? 342  GLY B N   1 
ATOM   6746  C  CA  . GLY B 2 339 ? -10.327 13.207  32.091  1.00 39.44 ? 342  GLY B CA  1 
ATOM   6747  C  C   . GLY B 2 339 ? -9.317  13.051  30.974  1.00 39.57 ? 342  GLY B C   1 
ATOM   6748  O  O   . GLY B 2 339 ? -9.676  12.655  29.861  1.00 39.66 ? 342  GLY B O   1 
ATOM   6749  N  N   . ILE B 2 340 ? -8.061  13.396  31.261  1.00 39.56 ? 343  ILE B N   1 
ATOM   6750  C  CA  . ILE B 2 340 ? -6.965  13.297  30.294  1.00 39.53 ? 343  ILE B CA  1 
ATOM   6751  C  C   . ILE B 2 340 ? -5.821  12.593  31.005  1.00 39.80 ? 343  ILE B C   1 
ATOM   6752  O  O   . ILE B 2 340 ? -5.379  13.034  32.065  1.00 39.75 ? 343  ILE B O   1 
ATOM   6753  C  CB  . ILE B 2 340 ? -6.486  14.694  29.816  1.00 39.39 ? 343  ILE B CB  1 
ATOM   6754  C  CG1 . ILE B 2 340 ? -7.634  15.437  29.134  1.00 39.13 ? 343  ILE B CG1 1 
ATOM   6755  C  CG2 . ILE B 2 340 ? -5.308  14.557  28.854  1.00 39.06 ? 343  ILE B CG2 1 
ATOM   6756  C  CD1 . ILE B 2 340 ? -7.273  16.824  28.683  1.00 38.96 ? 343  ILE B CD1 1 
ATOM   6757  N  N   . GLU B 2 341 ? -5.355  11.491  30.425  1.00 39.97 ? 344  GLU B N   1 
ATOM   6758  C  CA  . GLU B 2 341 ? -4.285  10.705  31.022  1.00 40.07 ? 344  GLU B CA  1 
ATOM   6759  C  C   . GLU B 2 341 ? -3.282  10.247  29.980  1.00 40.12 ? 344  GLU B C   1 
ATOM   6760  O  O   . GLU B 2 341 ? -3.501  10.403  28.782  1.00 40.16 ? 344  GLU B O   1 
ATOM   6761  C  CB  . GLU B 2 341 ? -4.878  9.496   31.752  1.00 40.19 ? 344  GLU B CB  1 
ATOM   6762  C  CG  . GLU B 2 341 ? -5.850  9.874   32.869  1.00 40.56 ? 344  GLU B CG  1 
ATOM   6763  C  CD  . GLU B 2 341 ? -6.409  8.684   33.630  1.00 40.86 ? 344  GLU B CD  1 
ATOM   6764  O  OE1 . GLU B 2 341 ? -7.519  8.800   34.192  1.00 41.11 ? 344  GLU B OE1 1 
ATOM   6765  O  OE2 . GLU B 2 341 ? -5.744  7.632   33.687  1.00 41.09 ? 344  GLU B OE2 1 
ATOM   6766  N  N   . ALA B 2 342 ? -2.164  9.706   30.447  1.00 39.99 ? 345  ALA B N   1 
ATOM   6767  C  CA  . ALA B 2 342 ? -1.124  9.223   29.556  1.00 39.89 ? 345  ALA B CA  1 
ATOM   6768  C  C   . ALA B 2 342 ? -1.435  7.809   29.086  1.00 39.85 ? 345  ALA B C   1 
ATOM   6769  O  O   . ALA B 2 342 ? -2.295  7.127   29.656  1.00 40.09 ? 345  ALA B O   1 
ATOM   6770  C  CB  . ALA B 2 342 ? 0.222   9.243   30.272  1.00 40.00 ? 345  ALA B CB  1 
ATOM   6771  N  N   . SER B 2 343 ? -0.763  7.392   28.017  1.00 39.54 ? 346  SER B N   1 
ATOM   6772  C  CA  . SER B 2 343 ? -0.914  6.039   27.484  1.00 39.09 ? 346  SER B CA  1 
ATOM   6773  C  C   . SER B 2 343 ? 0.422   5.361   27.770  1.00 38.75 ? 346  SER B C   1 
ATOM   6774  O  O   . SER B 2 343 ? 1.355   6.010   28.235  1.00 38.77 ? 346  SER B O   1 
ATOM   6775  C  CB  . SER B 2 343 ? -1.148  6.077   25.979  1.00 39.03 ? 346  SER B CB  1 
ATOM   6776  O  OG  . SER B 2 343 ? 0.040   6.468   25.311  1.00 39.17 ? 346  SER B OG  1 
ATOM   6777  N  N   . PRO B 2 344 ? 0.532   4.049   27.525  1.00 38.49 ? 347  PRO B N   1 
ATOM   6778  C  CA  . PRO B 2 344 ? 1.821   3.409   27.805  1.00 38.19 ? 347  PRO B CA  1 
ATOM   6779  C  C   . PRO B 2 344 ? 2.954   3.645   26.800  1.00 37.93 ? 347  PRO B C   1 
ATOM   6780  O  O   . PRO B 2 344 ? 3.930   2.897   26.795  1.00 38.01 ? 347  PRO B O   1 
ATOM   6781  C  CB  . PRO B 2 344 ? 1.451   1.930   27.952  1.00 38.27 ? 347  PRO B CB  1 
ATOM   6782  C  CG  . PRO B 2 344 ? 0.270   1.786   27.077  1.00 38.40 ? 347  PRO B CG  1 
ATOM   6783  C  CD  . PRO B 2 344 ? -0.527  3.040   27.350  1.00 38.43 ? 347  PRO B CD  1 
ATOM   6784  N  N   . ASP B 2 345 ? 2.831   4.672   25.955  1.00 37.43 ? 348  ASP B N   1 
ATOM   6785  C  CA  . ASP B 2 345 ? 3.883   5.020   24.988  1.00 36.89 ? 348  ASP B CA  1 
ATOM   6786  C  C   . ASP B 2 345 ? 5.156   5.232   25.806  1.00 36.63 ? 348  ASP B C   1 
ATOM   6787  O  O   . ASP B 2 345 ? 5.210   6.135   26.638  1.00 36.63 ? 348  ASP B O   1 
ATOM   6788  C  CB  . ASP B 2 345 ? 3.513   6.332   24.277  1.00 36.78 ? 348  ASP B CB  1 
ATOM   6789  C  CG  . ASP B 2 345 ? 4.568   6.803   23.263  1.00 36.68 ? 348  ASP B CG  1 
ATOM   6790  O  OD1 . ASP B 2 345 ? 5.772   6.508   23.412  1.00 36.71 ? 348  ASP B OD1 1 
ATOM   6791  O  OD2 . ASP B 2 345 ? 4.188   7.511   22.308  1.00 36.56 ? 348  ASP B OD2 1 
ATOM   6792  N  N   . LYS B 2 346 ? 6.180   4.421   25.558  1.00 36.22 ? 349  LYS B N   1 
ATOM   6793  C  CA  . LYS B 2 346 ? 7.440   4.525   26.298  1.00 35.87 ? 349  LYS B CA  1 
ATOM   6794  C  C   . LYS B 2 346 ? 8.017   5.940   26.297  1.00 35.77 ? 349  LYS B C   1 
ATOM   6795  O  O   . LYS B 2 346 ? 8.545   6.405   27.314  1.00 35.73 ? 349  LYS B O   1 
ATOM   6796  C  CB  . LYS B 2 346 ? 8.477   3.537   25.752  1.00 35.63 ? 349  LYS B CB  1 
ATOM   6797  C  CG  . LYS B 2 346 ? 8.044   2.079   25.814  1.00 35.35 ? 349  LYS B CG  1 
ATOM   6798  C  CD  . LYS B 2 346 ? 9.170   1.117   25.414  1.00 35.12 ? 349  LYS B CD  1 
ATOM   6799  C  CE  . LYS B 2 346 ? 8.680   -0.336  25.384  1.00 34.83 ? 349  LYS B CE  1 
ATOM   6800  N  NZ  . LYS B 2 346 ? 9.783   -1.330  25.212  1.00 34.38 ? 349  LYS B NZ  1 
ATOM   6801  N  N   . MET B 2 347 ? 7.902   6.623   25.159  1.00 35.51 ? 350  MET B N   1 
ATOM   6802  C  CA  . MET B 2 347 ? 8.405   7.983   25.023  1.00 35.27 ? 350  MET B CA  1 
ATOM   6803  C  C   . MET B 2 347 ? 7.645   8.955   25.914  1.00 35.22 ? 350  MET B C   1 
ATOM   6804  O  O   . MET B 2 347 ? 8.261   9.747   26.623  1.00 35.28 ? 350  MET B O   1 
ATOM   6805  C  CB  . MET B 2 347 ? 8.346   8.437   23.568  1.00 35.00 ? 350  MET B CB  1 
ATOM   6806  C  CG  . MET B 2 347 ? 9.287   7.689   22.637  1.00 34.75 ? 350  MET B CG  1 
ATOM   6807  S  SD  . MET B 2 347 ? 11.006  8.185   22.768  1.00 34.63 ? 350  MET B SD  1 
ATOM   6808  C  CE  . MET B 2 347 ? 10.959  9.752   21.949  1.00 34.36 ? 350  MET B CE  1 
ATOM   6809  N  N   . LEU B 2 348 ? 6.315   8.889   25.899  1.00 34.97 ? 351  LEU B N   1 
ATOM   6810  C  CA  . LEU B 2 348 ? 5.507   9.769   26.737  1.00 34.93 ? 351  LEU B CA  1 
ATOM   6811  C  C   . LEU B 2 348 ? 5.840   9.535   28.203  1.00 34.96 ? 351  LEU B C   1 
ATOM   6812  O  O   . LEU B 2 348 ? 6.041   10.482  28.969  1.00 34.79 ? 351  LEU B O   1 
ATOM   6813  C  CB  . LEU B 2 348 ? 4.012   9.521   26.511  1.00 34.82 ? 351  LEU B CB  1 
ATOM   6814  C  CG  . LEU B 2 348 ? 3.054   10.291  27.427  1.00 34.71 ? 351  LEU B CG  1 
ATOM   6815  C  CD1 . LEU B 2 348 ? 3.376   11.783  27.434  1.00 34.47 ? 351  LEU B CD1 1 
ATOM   6816  C  CD2 . LEU B 2 348 ? 1.627   10.045  26.982  1.00 34.51 ? 351  LEU B CD2 1 
ATOM   6817  N  N   . GLN B 2 349 ? 5.899   8.260   28.574  1.00 34.96 ? 352  GLN B N   1 
ATOM   6818  C  CA  . GLN B 2 349 ? 6.206   7.843   29.934  1.00 34.94 ? 352  GLN B CA  1 
ATOM   6819  C  C   . GLN B 2 349 ? 7.475   8.514   30.430  1.00 34.90 ? 352  GLN B C   1 
ATOM   6820  O  O   . GLN B 2 349 ? 7.506   9.061   31.528  1.00 34.83 ? 352  GLN B O   1 
ATOM   6821  C  CB  . GLN B 2 349 ? 6.353   6.323   29.976  1.00 34.83 ? 352  GLN B CB  1 
ATOM   6822  C  CG  . GLN B 2 349 ? 5.052   5.575   29.730  1.00 34.71 ? 352  GLN B CG  1 
ATOM   6823  C  CD  . GLN B 2 349 ? 4.195   5.499   30.970  1.00 34.67 ? 352  GLN B CD  1 
ATOM   6824  O  OE1 . GLN B 2 349 ? 4.675   5.125   32.036  1.00 34.66 ? 352  GLN B OE1 1 
ATOM   6825  N  NE2 . GLN B 2 349 ? 2.918   5.840   30.837  1.00 34.65 ? 352  GLN B NE2 1 
ATOM   6826  N  N   . GLY B 2 350 ? 8.509   8.503   29.595  1.00 34.94 ? 353  GLY B N   1 
ATOM   6827  C  CA  . GLY B 2 350 ? 9.766   9.131   29.964  1.00 34.94 ? 353  GLY B CA  1 
ATOM   6828  C  C   . GLY B 2 350 ? 9.631   10.626  30.185  1.00 34.88 ? 353  GLY B C   1 
ATOM   6829  O  O   . GLY B 2 350 ? 10.229  11.167  31.111  1.00 34.87 ? 353  GLY B O   1 
ATOM   6830  N  N   . ARG B 2 351 ? 8.833   11.285  29.345  1.00 34.91 ? 354  ARG B N   1 
ATOM   6831  C  CA  . ARG B 2 351 ? 8.604   12.725  29.441  1.00 34.79 ? 354  ARG B CA  1 
ATOM   6832  C  C   . ARG B 2 351 ? 7.857   13.115  30.712  1.00 34.86 ? 354  ARG B C   1 
ATOM   6833  O  O   . ARG B 2 351 ? 7.964   14.250  31.184  1.00 34.91 ? 354  ARG B O   1 
ATOM   6834  C  CB  . ARG B 2 351 ? 7.841   13.220  28.217  1.00 34.70 ? 354  ARG B CB  1 
ATOM   6835  C  CG  . ARG B 2 351 ? 8.593   13.000  26.919  1.00 34.41 ? 354  ARG B CG  1 
ATOM   6836  C  CD  . ARG B 2 351 ? 7.788   13.459  25.716  1.00 34.19 ? 354  ARG B CD  1 
ATOM   6837  N  NE  . ARG B 2 351 ? 7.694   14.913  25.626  1.00 34.02 ? 354  ARG B NE  1 
ATOM   6838  C  CZ  . ARG B 2 351 ? 6.688   15.555  25.046  1.00 33.88 ? 354  ARG B CZ  1 
ATOM   6839  N  NH1 . ARG B 2 351 ? 5.689   14.869  24.515  1.00 33.90 ? 354  ARG B NH1 1 
ATOM   6840  N  NH2 . ARG B 2 351 ? 6.690   16.878  24.974  1.00 33.56 ? 354  ARG B NH2 1 
ATOM   6841  N  N   . LEU B 2 352 ? 7.098   12.175  31.261  1.00 34.72 ? 355  LEU B N   1 
ATOM   6842  C  CA  . LEU B 2 352 ? 6.351   12.409  32.488  1.00 34.69 ? 355  LEU B CA  1 
ATOM   6843  C  C   . LEU B 2 352 ? 7.339   12.811  33.580  1.00 34.85 ? 355  LEU B C   1 
ATOM   6844  O  O   . LEU B 2 352 ? 7.034   13.643  34.437  1.00 34.72 ? 355  LEU B O   1 
ATOM   6845  C  CB  . LEU B 2 352 ? 5.632   11.125  32.890  1.00 34.47 ? 355  LEU B CB  1 
ATOM   6846  C  CG  . LEU B 2 352 ? 4.134   10.967  32.636  1.00 34.42 ? 355  LEU B CG  1 
ATOM   6847  C  CD1 . LEU B 2 352 ? 3.654   11.832  31.495  1.00 34.32 ? 355  LEU B CD1 1 
ATOM   6848  C  CD2 . LEU B 2 352 ? 3.827   9.502   32.400  1.00 34.25 ? 355  LEU B CD2 1 
ATOM   6849  N  N   . PHE B 2 353 ? 8.544   12.249  33.505  1.00 34.80 ? 356  PHE B N   1 
ATOM   6850  C  CA  . PHE B 2 353 ? 9.596   12.523  34.471  1.00 34.82 ? 356  PHE B CA  1 
ATOM   6851  C  C   . PHE B 2 353 ? 10.509  13.699  34.129  1.00 34.76 ? 356  PHE B C   1 
ATOM   6852  O  O   . PHE B 2 353 ? 10.765  14.563  34.964  1.00 34.73 ? 356  PHE B O   1 
ATOM   6853  C  CB  . PHE B 2 353 ? 10.469  11.277  34.652  1.00 35.00 ? 356  PHE B CB  1 
ATOM   6854  C  CG  . PHE B 2 353 ? 11.800  11.568  35.285  1.00 35.21 ? 356  PHE B CG  1 
ATOM   6855  C  CD1 . PHE B 2 353 ? 11.898  11.808  36.649  1.00 35.28 ? 356  PHE B CD1 1 
ATOM   6856  C  CD2 . PHE B 2 353 ? 12.947  11.669  34.507  1.00 35.25 ? 356  PHE B CD2 1 
ATOM   6857  C  CE1 . PHE B 2 353 ? 13.118  12.154  37.229  1.00 35.26 ? 356  PHE B CE1 1 
ATOM   6858  C  CE2 . PHE B 2 353 ? 14.173  12.014  35.080  1.00 35.26 ? 356  PHE B CE2 1 
ATOM   6859  C  CZ  . PHE B 2 353 ? 14.255  12.257  36.439  1.00 35.35 ? 356  PHE B CZ  1 
ATOM   6860  N  N   . ALA B 2 354 ? 11.031  13.692  32.912  1.00 34.77 ? 357  ALA B N   1 
ATOM   6861  C  CA  . ALA B 2 354 ? 11.982  14.694  32.443  1.00 34.79 ? 357  ALA B CA  1 
ATOM   6862  C  C   . ALA B 2 354 ? 11.694  16.184  32.590  1.00 34.74 ? 357  ALA B C   1 
ATOM   6863  O  O   . ALA B 2 354 ? 12.549  16.931  33.074  1.00 34.77 ? 357  ALA B O   1 
ATOM   6864  C  CB  . ALA B 2 354 ? 12.372  14.384  31.008  1.00 34.81 ? 357  ALA B CB  1 
ATOM   6865  N  N   . TYR B 2 355 ? 10.517  16.626  32.157  1.00 34.67 ? 358  TYR B N   1 
ATOM   6866  C  CA  . TYR B 2 355 ? 10.172  18.046  32.204  1.00 34.49 ? 358  TYR B CA  1 
ATOM   6867  C  C   . TYR B 2 355 ? 10.172  18.705  33.576  1.00 34.60 ? 358  TYR B C   1 
ATOM   6868  O  O   . TYR B 2 355 ? 10.865  19.706  33.778  1.00 34.77 ? 358  TYR B O   1 
ATOM   6869  C  CB  . TYR B 2 355 ? 8.869   18.318  31.454  1.00 34.09 ? 358  TYR B CB  1 
ATOM   6870  C  CG  . TYR B 2 355 ? 8.992   18.074  29.976  1.00 33.46 ? 358  TYR B CG  1 
ATOM   6871  C  CD1 . TYR B 2 355 ? 8.921   19.122  29.073  1.00 33.31 ? 358  TYR B CD1 1 
ATOM   6872  C  CD2 . TYR B 2 355 ? 9.183   16.793  29.479  1.00 33.26 ? 358  TYR B CD2 1 
ATOM   6873  C  CE1 . TYR B 2 355 ? 9.035   18.902  27.703  1.00 33.15 ? 358  TYR B CE1 1 
ATOM   6874  C  CE2 . TYR B 2 355 ? 9.297   16.563  28.120  1.00 33.25 ? 358  TYR B CE2 1 
ATOM   6875  C  CZ  . TYR B 2 355 ? 9.220   17.620  27.234  1.00 33.19 ? 358  TYR B CZ  1 
ATOM   6876  O  OH  . TYR B 2 355 ? 9.322   17.390  25.879  1.00 32.99 ? 358  TYR B OH  1 
ATOM   6877  N  N   . PRO B 2 356 ? 9.388   18.181  34.535  1.00 34.65 ? 359  PRO B N   1 
ATOM   6878  C  CA  . PRO B 2 356 ? 9.395   18.811  35.861  1.00 34.55 ? 359  PRO B CA  1 
ATOM   6879  C  C   . PRO B 2 356 ? 10.815  18.789  36.422  1.00 34.66 ? 359  PRO B C   1 
ATOM   6880  O  O   . PRO B 2 356 ? 11.259  19.752  37.048  1.00 34.58 ? 359  PRO B O   1 
ATOM   6881  C  CB  . PRO B 2 356 ? 8.469   17.905  36.671  1.00 34.66 ? 359  PRO B CB  1 
ATOM   6882  C  CG  . PRO B 2 356 ? 7.510   17.377  35.633  1.00 34.56 ? 359  PRO B CG  1 
ATOM   6883  C  CD  . PRO B 2 356 ? 8.442   17.048  34.494  1.00 34.63 ? 359  PRO B CD  1 
ATOM   6884  N  N   . ASP B 2 357 ? 11.534  17.704  36.133  1.00 34.64 ? 360  ASP B N   1 
ATOM   6885  C  CA  . ASP B 2 357 ? 12.909  17.516  36.577  1.00 34.67 ? 360  ASP B CA  1 
ATOM   6886  C  C   . ASP B 2 357 ? 13.837  18.598  36.033  1.00 34.80 ? 360  ASP B C   1 
ATOM   6887  O  O   . ASP B 2 357 ? 14.582  19.221  36.794  1.00 34.83 ? 360  ASP B O   1 
ATOM   6888  C  CB  . ASP B 2 357 ? 13.419  16.142  36.134  1.00 34.84 ? 360  ASP B CB  1 
ATOM   6889  C  CG  . ASP B 2 357 ? 14.829  15.853  36.625  1.00 35.17 ? 360  ASP B CG  1 
ATOM   6890  O  OD1 . ASP B 2 357 ? 15.057  15.908  37.850  1.00 35.54 ? 360  ASP B OD1 1 
ATOM   6891  O  OD2 . ASP B 2 357 ? 15.715  15.563  35.794  1.00 35.38 ? 360  ASP B OD2 1 
ATOM   6892  N  N   . THR B 2 358 ? 13.805  18.816  34.721  1.00 34.61 ? 361  THR B N   1 
ATOM   6893  C  CA  . THR B 2 358 ? 14.666  19.822  34.121  1.00 34.50 ? 361  THR B CA  1 
ATOM   6894  C  C   . THR B 2 358 ? 14.256  21.218  34.549  1.00 34.66 ? 361  THR B C   1 
ATOM   6895  O  O   . THR B 2 358 ? 15.094  22.114  34.636  1.00 34.83 ? 361  THR B O   1 
ATOM   6896  C  CB  . THR B 2 358 ? 14.682  19.734  32.583  1.00 34.46 ? 361  THR B CB  1 
ATOM   6897  O  OG1 . THR B 2 358 ? 15.804  20.469  32.073  1.00 34.19 ? 361  THR B OG1 1 
ATOM   6898  C  CG2 . THR B 2 358 ? 13.405  20.303  31.998  1.00 34.33 ? 361  THR B CG2 1 
ATOM   6899  N  N   . HIS B 2 359 ? 12.972  21.405  34.835  1.00 34.56 ? 362  HIS B N   1 
ATOM   6900  C  CA  . HIS B 2 359 ? 12.481  22.709  35.254  1.00 34.62 ? 362  HIS B CA  1 
ATOM   6901  C  C   . HIS B 2 359 ? 12.949  23.103  36.632  1.00 34.82 ? 362  HIS B C   1 
ATOM   6902  O  O   . HIS B 2 359 ? 13.153  24.286  36.912  1.00 34.71 ? 362  HIS B O   1 
ATOM   6903  C  CB  . HIS B 2 359 ? 10.966  22.758  35.176  1.00 34.59 ? 362  HIS B CB  1 
ATOM   6904  C  CG  . HIS B 2 359 ? 10.457  22.782  33.774  1.00 34.76 ? 362  HIS B CG  1 
ATOM   6905  N  ND1 . HIS B 2 359 ? 9.297   22.150  33.388  1.00 34.80 ? 362  HIS B ND1 1 
ATOM   6906  C  CD2 . HIS B 2 359 ? 10.988  23.316  32.650  1.00 34.56 ? 362  HIS B CD2 1 
ATOM   6907  C  CE1 . HIS B 2 359 ? 9.139   22.287  32.084  1.00 34.82 ? 362  HIS B CE1 1 
ATOM   6908  N  NE2 . HIS B 2 359 ? 10.152  22.990  31.613  1.00 34.78 ? 362  HIS B NE2 1 
ATOM   6909  N  N   . ARG B 2 360 ? 13.111  22.109  37.496  1.00 34.88 ? 363  ARG B N   1 
ATOM   6910  C  CA  . ARG B 2 360 ? 13.575  22.352  38.852  1.00 34.98 ? 363  ARG B CA  1 
ATOM   6911  C  C   . ARG B 2 360 ? 15.038  22.786  38.800  1.00 35.10 ? 363  ARG B C   1 
ATOM   6912  O  O   . ARG B 2 360 ? 15.528  23.468  39.703  1.00 35.22 ? 363  ARG B O   1 
ATOM   6913  C  CB  . ARG B 2 360 ? 13.374  21.098  39.710  1.00 34.90 ? 363  ARG B CB  1 
ATOM   6914  C  CG  . ARG B 2 360 ? 11.889  20.744  39.892  1.00 34.91 ? 363  ARG B CG  1 
ATOM   6915  C  CD  . ARG B 2 360 ? 11.667  19.400  40.571  1.00 35.02 ? 363  ARG B CD  1 
ATOM   6916  N  NE  . ARG B 2 360 ? 10.247  19.065  40.630  1.00 35.09 ? 363  ARG B NE  1 
ATOM   6917  C  CZ  . ARG B 2 360 ? 9.702   17.973  40.096  1.00 35.37 ? 363  ARG B CZ  1 
ATOM   6918  N  NH1 . ARG B 2 360 ? 10.453  17.084  39.458  1.00 35.19 ? 363  ARG B NH1 1 
ATOM   6919  N  NH2 . ARG B 2 360 ? 8.394   17.770  40.192  1.00 35.35 ? 363  ARG B NH2 1 
ATOM   6920  N  N   . HIS B 2 361 ? 15.718  22.441  37.710  1.00 34.94 ? 364  HIS B N   1 
ATOM   6921  C  CA  . HIS B 2 361 ? 17.115  22.815  37.525  1.00 34.93 ? 364  HIS B CA  1 
ATOM   6922  C  C   . HIS B 2 361 ? 17.231  24.151  36.807  1.00 34.92 ? 364  HIS B C   1 
ATOM   6923  O  O   . HIS B 2 361 ? 17.915  25.055  37.281  1.00 34.71 ? 364  HIS B O   1 
ATOM   6924  C  CB  . HIS B 2 361 ? 17.847  21.741  36.722  1.00 34.83 ? 364  HIS B CB  1 
ATOM   6925  C  CG  . HIS B 2 361 ? 19.153  22.198  36.151  1.00 34.84 ? 364  HIS B CG  1 
ATOM   6926  N  ND1 . HIS B 2 361 ? 19.309  22.519  34.822  1.00 34.84 ? 364  HIS B ND1 1 
ATOM   6927  C  CD2 . HIS B 2 361 ? 20.359  22.398  36.731  1.00 34.80 ? 364  HIS B CD2 1 
ATOM   6928  C  CE1 . HIS B 2 361 ? 20.555  22.900  34.606  1.00 34.75 ? 364  HIS B CE1 1 
ATOM   6929  N  NE2 . HIS B 2 361 ? 21.213  22.836  35.748  1.00 34.90 ? 364  HIS B NE2 1 
ATOM   6930  N  N   . ARG B 2 362 ? 16.552  24.266  35.665  1.00 34.92 ? 365  ARG B N   1 
ATOM   6931  C  CA  . ARG B 2 362 ? 16.584  25.476  34.845  1.00 34.91 ? 365  ARG B CA  1 
ATOM   6932  C  C   . ARG B 2 362 ? 15.970  26.713  35.483  1.00 34.81 ? 365  ARG B C   1 
ATOM   6933  O  O   . ARG B 2 362 ? 16.530  27.805  35.380  1.00 34.70 ? 365  ARG B O   1 
ATOM   6934  C  CB  . ARG B 2 362 ? 15.924  25.226  33.484  1.00 34.93 ? 365  ARG B CB  1 
ATOM   6935  C  CG  . ARG B 2 362 ? 15.826  26.490  32.619  1.00 34.98 ? 365  ARG B CG  1 
ATOM   6936  C  CD  . ARG B 2 362 ? 15.369  26.207  31.198  1.00 34.90 ? 365  ARG B CD  1 
ATOM   6937  N  NE  . ARG B 2 362 ? 13.941  25.908  31.072  1.00 34.99 ? 365  ARG B NE  1 
ATOM   6938  C  CZ  . ARG B 2 362 ? 13.010  26.817  30.798  1.00 35.00 ? 365  ARG B CZ  1 
ATOM   6939  N  NH1 . ARG B 2 362 ? 11.736  26.457  30.683  1.00 34.68 ? 365  ARG B NH1 1 
ATOM   6940  N  NH2 . ARG B 2 362 ? 13.351  28.091  30.660  1.00 34.91 ? 365  ARG B NH2 1 
ATOM   6941  N  N   . LEU B 2 363 ? 14.797  26.553  36.084  1.00 34.75 ? 366  LEU B N   1 
ATOM   6942  C  CA  . LEU B 2 363 ? 14.112  27.666  36.724  1.00 34.78 ? 366  LEU B CA  1 
ATOM   6943  C  C   . LEU B 2 363 ? 14.321  27.655  38.225  1.00 34.86 ? 366  LEU B C   1 
ATOM   6944  O  O   . LEU B 2 363 ? 14.733  28.654  38.807  1.00 35.06 ? 366  LEU B O   1 
ATOM   6945  C  CB  . LEU B 2 363 ? 12.614  27.625  36.425  1.00 34.62 ? 366  LEU B CB  1 
ATOM   6946  C  CG  . LEU B 2 363 ? 12.055  28.178  35.113  1.00 34.51 ? 366  LEU B CG  1 
ATOM   6947  C  CD1 . LEU B 2 363 ? 13.129  28.833  34.286  1.00 34.51 ? 366  LEU B CD1 1 
ATOM   6948  C  CD2 . LEU B 2 363 ? 11.379  27.075  34.348  1.00 34.40 ? 366  LEU B CD2 1 
ATOM   6949  N  N   . GLY B 2 364 ? 14.017  26.524  38.850  1.00 34.83 ? 367  GLY B N   1 
ATOM   6950  C  CA  . GLY B 2 364 ? 14.176  26.409  40.282  1.00 34.54 ? 367  GLY B CA  1 
ATOM   6951  C  C   . GLY B 2 364 ? 13.092  25.533  40.871  1.00 34.71 ? 367  GLY B C   1 
ATOM   6952  O  O   . GLY B 2 364 ? 12.083  25.261  40.219  1.00 34.63 ? 367  GLY B O   1 
ATOM   6953  N  N   . PRO B 2 365 ? 13.268  25.083  42.116  1.00 34.73 ? 368  PRO B N   1 
ATOM   6954  C  CA  . PRO B 2 365 ? 12.305  24.228  42.811  1.00 34.84 ? 368  PRO B CA  1 
ATOM   6955  C  C   . PRO B 2 365 ? 10.876  24.767  42.781  1.00 35.06 ? 368  PRO B C   1 
ATOM   6956  O  O   . PRO B 2 365 ? 9.922   24.010  42.599  1.00 35.05 ? 368  PRO B O   1 
ATOM   6957  C  CB  . PRO B 2 365 ? 12.863  24.196  44.230  1.00 34.84 ? 368  PRO B CB  1 
ATOM   6958  C  CG  . PRO B 2 365 ? 14.333  24.228  43.987  1.00 34.74 ? 368  PRO B CG  1 
ATOM   6959  C  CD  . PRO B 2 365 ? 14.459  25.315  42.951  1.00 34.78 ? 368  PRO B CD  1 
ATOM   6960  N  N   . ASN B 2 366 ? 10.737  26.077  42.948  1.00 35.17 ? 369  ASN B N   1 
ATOM   6961  C  CA  . ASN B 2 366 ? 9.430   26.711  42.954  1.00 35.25 ? 369  ASN B CA  1 
ATOM   6962  C  C   . ASN B 2 366 ? 9.106   27.395  41.636  1.00 35.40 ? 369  ASN B C   1 
ATOM   6963  O  O   . ASN B 2 366 ? 8.495   28.458  41.617  1.00 35.51 ? 369  ASN B O   1 
ATOM   6964  C  CB  . ASN B 2 366 ? 9.339   27.710  44.115  1.00 34.87 ? 369  ASN B CB  1 
ATOM   6965  C  CG  . ASN B 2 366 ? 9.173   27.025  45.457  1.00 34.69 ? 369  ASN B CG  1 
ATOM   6966  O  OD1 . ASN B 2 366 ? 8.385   26.091  45.592  1.00 34.59 ? 369  ASN B OD1 1 
ATOM   6967  N  ND2 . ASN B 2 366 ? 9.914   27.485  46.456  1.00 34.67 ? 369  ASN B ND2 1 
ATOM   6968  N  N   . TYR B 2 367 ? 9.467   26.767  40.525  1.00 35.67 ? 370  TYR B N   1 
ATOM   6969  C  CA  . TYR B 2 367 ? 9.196   27.370  39.230  1.00 35.87 ? 370  TYR B CA  1 
ATOM   6970  C  C   . TYR B 2 367 ? 7.699   27.552  38.971  1.00 36.18 ? 370  TYR B C   1 
ATOM   6971  O  O   . TYR B 2 367 ? 7.303   28.391  38.164  1.00 36.05 ? 370  TYR B O   1 
ATOM   6972  C  CB  . TYR B 2 367 ? 9.865   26.576  38.110  1.00 35.60 ? 370  TYR B CB  1 
ATOM   6973  C  CG  . TYR B 2 367 ? 9.218   25.256  37.807  1.00 35.53 ? 370  TYR B CG  1 
ATOM   6974  C  CD1 . TYR B 2 367 ? 8.340   25.129  36.736  1.00 35.53 ? 370  TYR B CD1 1 
ATOM   6975  C  CD2 . TYR B 2 367 ? 9.483   24.130  38.578  1.00 35.41 ? 370  TYR B CD2 1 
ATOM   6976  C  CE1 . TYR B 2 367 ? 7.737   23.910  36.436  1.00 35.56 ? 370  TYR B CE1 1 
ATOM   6977  C  CE2 . TYR B 2 367 ? 8.884   22.907  38.285  1.00 35.52 ? 370  TYR B CE2 1 
ATOM   6978  C  CZ  . TYR B 2 367 ? 8.013   22.808  37.210  1.00 35.48 ? 370  TYR B CZ  1 
ATOM   6979  O  OH  . TYR B 2 367 ? 7.422   21.613  36.897  1.00 35.58 ? 370  TYR B OH  1 
ATOM   6980  N  N   . LEU B 2 368 ? 6.865   26.781  39.662  1.00 36.58 ? 371  LEU B N   1 
ATOM   6981  C  CA  . LEU B 2 368 ? 5.420   26.910  39.494  1.00 37.21 ? 371  LEU B CA  1 
ATOM   6982  C  C   . LEU B 2 368 ? 4.909   28.192  40.134  1.00 37.63 ? 371  LEU B C   1 
ATOM   6983  O  O   . LEU B 2 368 ? 3.742   28.540  39.980  1.00 37.74 ? 371  LEU B O   1 
ATOM   6984  C  CB  . LEU B 2 368 ? 4.685   25.712  40.087  1.00 37.15 ? 371  LEU B CB  1 
ATOM   6985  C  CG  . LEU B 2 368 ? 4.891   24.387  39.359  1.00 37.31 ? 371  LEU B CG  1 
ATOM   6986  C  CD1 . LEU B 2 368 ? 4.187   23.287  40.118  1.00 37.27 ? 371  LEU B CD1 1 
ATOM   6987  C  CD2 . LEU B 2 368 ? 4.375   24.474  37.932  1.00 37.44 ? 371  LEU B CD2 1 
ATOM   6988  N  N   . HIS B 2 369 ? 5.776   28.874  40.879  1.00 38.04 ? 372  HIS B N   1 
ATOM   6989  C  CA  . HIS B 2 369 ? 5.419   30.133  41.528  1.00 38.40 ? 372  HIS B CA  1 
ATOM   6990  C  C   . HIS B 2 369 ? 5.612   31.314  40.579  1.00 38.44 ? 372  HIS B C   1 
ATOM   6991  O  O   . HIS B 2 369 ? 5.182   32.432  40.879  1.00 38.59 ? 372  HIS B O   1 
ATOM   6992  C  CB  . HIS B 2 369 ? 6.258   30.362  42.786  1.00 38.86 ? 372  HIS B CB  1 
ATOM   6993  C  CG  . HIS B 2 369 ? 5.933   29.432  43.912  1.00 39.48 ? 372  HIS B CG  1 
ATOM   6994  N  ND1 . HIS B 2 369 ? 6.392   29.636  45.197  1.00 39.67 ? 372  HIS B ND1 1 
ATOM   6995  C  CD2 . HIS B 2 369 ? 5.204   28.291  43.948  1.00 39.57 ? 372  HIS B CD2 1 
ATOM   6996  C  CE1 . HIS B 2 369 ? 5.960   28.659  45.975  1.00 39.90 ? 372  HIS B CE1 1 
ATOM   6997  N  NE2 . HIS B 2 369 ? 5.238   27.830  45.241  1.00 39.97 ? 372  HIS B NE2 1 
ATOM   6998  N  N   . ILE B 2 370 ? 6.315   31.084  39.471  1.00 38.34 ? 373  ILE B N   1 
ATOM   6999  C  CA  . ILE B 2 370 ? 6.540   32.133  38.480  1.00 38.28 ? 373  ILE B CA  1 
ATOM   7000  C  C   . ILE B 2 370 ? 5.185   32.396  37.823  1.00 38.43 ? 373  ILE B C   1 
ATOM   7001  O  O   . ILE B 2 370 ? 4.557   31.478  37.295  1.00 38.37 ? 373  ILE B O   1 
ATOM   7002  C  CB  . ILE B 2 370 ? 7.569   31.687  37.427  1.00 38.00 ? 373  ILE B CB  1 
ATOM   7003  C  CG1 . ILE B 2 370 ? 8.909   31.394  38.103  1.00 37.76 ? 373  ILE B CG1 1 
ATOM   7004  C  CG2 . ILE B 2 370 ? 7.734   32.758  36.367  1.00 38.01 ? 373  ILE B CG2 1 
ATOM   7005  C  CD1 . ILE B 2 370 ? 9.946   30.812  37.183  1.00 37.43 ? 373  ILE B CD1 1 
ATOM   7006  N  N   . PRO B 2 371 ? 4.721   33.660  37.842  1.00 38.56 ? 374  PRO B N   1 
ATOM   7007  C  CA  . PRO B 2 371 ? 3.435   34.065  37.265  1.00 38.66 ? 374  PRO B CA  1 
ATOM   7008  C  C   . PRO B 2 371 ? 2.926   33.293  36.050  1.00 38.70 ? 374  PRO B C   1 
ATOM   7009  O  O   . PRO B 2 371 ? 1.837   32.717  36.096  1.00 38.66 ? 374  PRO B O   1 
ATOM   7010  C  CB  . PRO B 2 371 ? 3.664   35.538  36.957  1.00 38.59 ? 374  PRO B CB  1 
ATOM   7011  C  CG  . PRO B 2 371 ? 4.471   35.966  38.132  1.00 38.60 ? 374  PRO B CG  1 
ATOM   7012  C  CD  . PRO B 2 371 ? 5.494   34.848  38.255  1.00 38.64 ? 374  PRO B CD  1 
ATOM   7013  N  N   . VAL B 2 372 ? 3.721   33.238  34.988  1.00 38.79 ? 375  VAL B N   1 
ATOM   7014  C  CA  . VAL B 2 372 ? 3.313   32.553  33.764  1.00 38.82 ? 375  VAL B CA  1 
ATOM   7015  C  C   . VAL B 2 372 ? 3.118   31.038  33.921  1.00 39.13 ? 375  VAL B C   1 
ATOM   7016  O  O   . VAL B 2 372 ? 2.427   30.407  33.115  1.00 38.98 ? 375  VAL B O   1 
ATOM   7017  C  CB  . VAL B 2 372 ? 4.289   32.882  32.601  1.00 38.52 ? 375  VAL B CB  1 
ATOM   7018  C  CG1 . VAL B 2 372 ? 5.578   32.086  32.729  1.00 38.17 ? 375  VAL B CG1 1 
ATOM   7019  C  CG2 . VAL B 2 372 ? 3.618   32.670  31.266  1.00 38.11 ? 375  VAL B CG2 1 
ATOM   7020  N  N   . ASN B 2 373 ? 3.694   30.466  34.977  1.00 39.52 ? 376  ASN B N   1 
ATOM   7021  C  CA  . ASN B 2 373 ? 3.576   29.029  35.239  1.00 39.99 ? 376  ASN B CA  1 
ATOM   7022  C  C   . ASN B 2 373 ? 2.504   28.694  36.284  1.00 40.47 ? 376  ASN B C   1 
ATOM   7023  O  O   . ASN B 2 373 ? 2.057   27.556  36.384  1.00 40.44 ? 376  ASN B O   1 
ATOM   7024  C  CB  . ASN B 2 373 ? 4.926   28.462  35.692  1.00 39.96 ? 376  ASN B CB  1 
ATOM   7025  C  CG  . ASN B 2 373 ? 6.006   28.606  34.634  1.00 40.08 ? 376  ASN B CG  1 
ATOM   7026  O  OD1 . ASN B 2 373 ? 5.733   28.526  33.435  1.00 40.31 ? 376  ASN B OD1 1 
ATOM   7027  N  ND2 . ASN B 2 373 ? 7.241   28.822  35.072  1.00 40.09 ? 376  ASN B ND2 1 
ATOM   7028  N  N   . CYS B 2 374 ? 2.088   29.700  37.046  1.00 41.18 ? 377  CYS B N   1 
ATOM   7029  C  CA  . CYS B 2 374 ? 1.088   29.557  38.103  1.00 41.95 ? 377  CYS B CA  1 
ATOM   7030  C  C   . CYS B 2 374 ? -0.283  29.158  37.535  1.00 42.18 ? 377  CYS B C   1 
ATOM   7031  O  O   . CYS B 2 374 ? -0.731  29.730  36.540  1.00 42.15 ? 377  CYS B O   1 
ATOM   7032  C  CB  . CYS B 2 374 ? 0.988   30.899  38.861  1.00 42.34 ? 377  CYS B CB  1 
ATOM   7033  S  SG  . CYS B 2 374 ? 0.207   30.902  40.510  1.00 44.62 ? 377  CYS B SG  1 
ATOM   7034  N  N   . PRO B 2 375 ? -0.916  28.095  38.090  1.00 42.38 ? 378  PRO B N   1 
ATOM   7035  C  CA  . PRO B 2 375 ? -2.239  27.671  37.606  1.00 42.52 ? 378  PRO B CA  1 
ATOM   7036  C  C   . PRO B 2 375 ? -3.240  28.634  38.241  1.00 42.69 ? 378  PRO B C   1 
ATOM   7037  O  O   . PRO B 2 375 ? -3.952  28.283  39.173  1.00 42.68 ? 378  PRO B O   1 
ATOM   7038  C  CB  . PRO B 2 375 ? -2.369  26.253  38.170  1.00 42.26 ? 378  PRO B CB  1 
ATOM   7039  C  CG  . PRO B 2 375 ? -1.626  26.332  39.450  1.00 42.24 ? 378  PRO B CG  1 
ATOM   7040  C  CD  . PRO B 2 375 ? -0.393  27.138  39.084  1.00 42.32 ? 378  PRO B CD  1 
ATOM   7041  N  N   . TYR B 2 376 ? -3.270  29.857  37.723  1.00 43.11 ? 379  TYR B N   1 
ATOM   7042  C  CA  . TYR B 2 376 ? -4.110  30.920  38.257  1.00 43.64 ? 379  TYR B CA  1 
ATOM   7043  C  C   . TYR B 2 376 ? -5.621  30.766  38.193  1.00 43.94 ? 379  TYR B C   1 
ATOM   7044  O  O   . TYR B 2 376 ? -6.351  31.555  38.799  1.00 44.04 ? 379  TYR B O   1 
ATOM   7045  C  CB  . TYR B 2 376 ? -3.687  32.269  37.675  1.00 43.64 ? 379  TYR B CB  1 
ATOM   7046  C  CG  . TYR B 2 376 ? -4.110  32.506  36.244  1.00 43.78 ? 379  TYR B CG  1 
ATOM   7047  C  CD1 . TYR B 2 376 ? -3.276  32.168  35.183  1.00 43.70 ? 379  TYR B CD1 1 
ATOM   7048  C  CD2 . TYR B 2 376 ? -5.327  33.122  35.956  1.00 43.80 ? 379  TYR B CD2 1 
ATOM   7049  C  CE1 . TYR B 2 376 ? -3.643  32.447  33.868  1.00 44.00 ? 379  TYR B CE1 1 
ATOM   7050  C  CE2 . TYR B 2 376 ? -5.701  33.404  34.651  1.00 44.01 ? 379  TYR B CE2 1 
ATOM   7051  C  CZ  . TYR B 2 376 ? -4.856  33.071  33.612  1.00 44.03 ? 379  TYR B CZ  1 
ATOM   7052  O  OH  . TYR B 2 376 ? -5.212  33.406  32.327  1.00 44.32 ? 379  TYR B OH  1 
ATOM   7053  N  N   . ARG B 2 377 ? -6.103  29.777  37.452  1.00 44.31 ? 380  ARG B N   1 
ATOM   7054  C  CA  . ARG B 2 377 ? -7.539  29.565  37.374  1.00 44.64 ? 380  ARG B CA  1 
ATOM   7055  C  C   . ARG B 2 377 ? -7.972  28.378  38.231  1.00 44.58 ? 380  ARG B C   1 
ATOM   7056  O  O   . ARG B 2 377 ? -9.090  27.878  38.119  1.00 44.60 ? 380  ARG B O   1 
ATOM   7057  C  CB  . ARG B 2 377 ? -7.978  29.419  35.922  1.00 45.12 ? 380  ARG B CB  1 
ATOM   7058  C  CG  . ARG B 2 377 ? -7.778  30.699  35.108  1.00 46.01 ? 380  ARG B CG  1 
ATOM   7059  C  CD  . ARG B 2 377 ? -9.007  31.024  34.301  1.00 46.82 ? 380  ARG B CD  1 
ATOM   7060  N  NE  . ARG B 2 377 ? -9.495  29.815  33.648  1.00 48.01 ? 380  ARG B NE  1 
ATOM   7061  C  CZ  . ARG B 2 377 ? -10.655 29.721  33.013  1.00 48.55 ? 380  ARG B CZ  1 
ATOM   7062  N  NH1 . ARG B 2 377 ? -11.456 30.781  32.943  1.00 48.79 ? 380  ARG B NH1 1 
ATOM   7063  N  NH2 . ARG B 2 377 ? -11.008 28.567  32.448  1.00 48.85 ? 380  ARG B NH2 1 
ATOM   7064  N  N   . ALA B 2 378 ? -7.072  27.970  39.121  1.00 44.60 ? 381  ALA B N   1 
ATOM   7065  C  CA  . ALA B 2 378 ? -7.296  26.870  40.051  1.00 44.60 ? 381  ALA B CA  1 
ATOM   7066  C  C   . ALA B 2 378 ? -6.720  27.260  41.413  1.00 44.65 ? 381  ALA B C   1 
ATOM   7067  O  O   . ALA B 2 378 ? -5.848  28.129  41.518  1.00 44.61 ? 381  ALA B O   1 
ATOM   7068  C  CB  . ALA B 2 378 ? -6.641  25.596  39.544  1.00 44.42 ? 381  ALA B CB  1 
ATOM   7069  N  N   . ARG B 2 379 ? -7.234  26.639  42.464  1.00 44.62 ? 382  ARG B N   1 
ATOM   7070  C  CA  . ARG B 2 379 ? -6.775  26.926  43.814  1.00 44.65 ? 382  ARG B CA  1 
ATOM   7071  C  C   . ARG B 2 379 ? -5.765  25.862  44.250  1.00 44.06 ? 382  ARG B C   1 
ATOM   7072  O  O   . ARG B 2 379 ? -6.112  24.685  44.383  1.00 44.12 ? 382  ARG B O   1 
ATOM   7073  C  CB  . ARG B 2 379 ? -7.981  26.951  44.753  1.00 45.56 ? 382  ARG B CB  1 
ATOM   7074  C  CG  . ARG B 2 379 ? -7.671  27.287  46.190  1.00 46.90 ? 382  ARG B CG  1 
ATOM   7075  C  CD  . ARG B 2 379 ? -8.960  27.404  46.989  1.00 48.30 ? 382  ARG B CD  1 
ATOM   7076  N  NE  . ARG B 2 379 ? -8.690  27.740  48.384  1.00 49.74 ? 382  ARG B NE  1 
ATOM   7077  C  CZ  . ARG B 2 379 ? -8.472  28.974  48.831  1.00 50.40 ? 382  ARG B CZ  1 
ATOM   7078  N  NH1 . ARG B 2 379 ? -8.505  30.005  47.986  1.00 50.71 ? 382  ARG B NH1 1 
ATOM   7079  N  NH2 . ARG B 2 379 ? -8.171  29.173  50.116  1.00 50.61 ? 382  ARG B NH2 1 
ATOM   7080  N  N   . VAL B 2 380 ? -4.507  26.265  44.425  1.00 43.19 ? 383  VAL B N   1 
ATOM   7081  C  CA  . VAL B 2 380 ? -3.464  25.328  44.841  1.00 42.04 ? 383  VAL B CA  1 
ATOM   7082  C  C   . VAL B 2 380 ? -3.479  25.153  46.354  1.00 41.53 ? 383  VAL B C   1 
ATOM   7083  O  O   . VAL B 2 380 ? -3.204  26.086  47.109  1.00 41.48 ? 383  VAL B O   1 
ATOM   7084  C  CB  . VAL B 2 380 ? -2.060  25.783  44.381  1.00 41.90 ? 383  VAL B CB  1 
ATOM   7085  C  CG1 . VAL B 2 380 ? -1.005  24.788  44.834  1.00 41.62 ? 383  VAL B CG1 1 
ATOM   7086  C  CG2 . VAL B 2 380 ? -2.023  25.912  42.874  1.00 41.64 ? 383  VAL B CG2 1 
ATOM   7087  N  N   . ALA B 2 381 ? -3.809  23.948  46.793  1.00 40.74 ? 384  ALA B N   1 
ATOM   7088  C  CA  . ALA B 2 381 ? -3.868  23.653  48.211  1.00 39.86 ? 384  ALA B CA  1 
ATOM   7089  C  C   . ALA B 2 381 ? -3.353  22.244  48.438  1.00 39.35 ? 384  ALA B C   1 
ATOM   7090  O  O   . ALA B 2 381 ? -3.950  21.282  47.968  1.00 39.26 ? 384  ALA B O   1 
ATOM   7091  C  CB  . ALA B 2 381 ? -5.294  23.782  48.694  1.00 39.81 ? 384  ALA B CB  1 
ATOM   7092  N  N   . ASN B 2 382 ? -2.231  22.128  49.139  1.00 38.79 ? 385  ASN B N   1 
ATOM   7093  C  CA  . ASN B 2 382 ? -1.633  20.828  49.416  1.00 38.28 ? 385  ASN B CA  1 
ATOM   7094  C  C   . ASN B 2 382 ? -0.747  20.883  50.651  1.00 38.12 ? 385  ASN B C   1 
ATOM   7095  O  O   . ASN B 2 382 ? -0.866  21.799  51.467  1.00 38.22 ? 385  ASN B O   1 
ATOM   7096  C  CB  . ASN B 2 382 ? -0.834  20.323  48.206  1.00 37.92 ? 385  ASN B CB  1 
ATOM   7097  C  CG  . ASN B 2 382 ? 0.149   21.353  47.674  1.00 37.75 ? 385  ASN B CG  1 
ATOM   7098  O  OD1 . ASN B 2 382 ? 0.281   21.535  46.463  1.00 37.77 ? 385  ASN B OD1 1 
ATOM   7099  N  ND2 . ASN B 2 382 ? 0.850   22.024  48.575  1.00 37.50 ? 385  ASN B ND2 1 
ATOM   7100  N  N   . TYR B 2 383 ? 0.164   19.921  50.763  1.00 37.79 ? 386  TYR B N   1 
ATOM   7101  C  CA  . TYR B 2 383 ? 1.065   19.836  51.902  1.00 37.43 ? 386  TYR B CA  1 
ATOM   7102  C  C   . TYR B 2 383 ? 2.523   20.068  51.536  1.00 37.34 ? 386  TYR B C   1 
ATOM   7103  O  O   . TYR B 2 383 ? 3.433   19.648  52.254  1.00 37.20 ? 386  TYR B O   1 
ATOM   7104  C  CB  . TYR B 2 383 ? 0.868   18.490  52.592  1.00 37.25 ? 386  TYR B CB  1 
ATOM   7105  C  CG  . TYR B 2 383 ? -0.552  18.336  53.063  1.00 37.31 ? 386  TYR B CG  1 
ATOM   7106  C  CD1 . TYR B 2 383 ? -1.531  17.789  52.233  1.00 37.06 ? 386  TYR B CD1 1 
ATOM   7107  C  CD2 . TYR B 2 383 ? -0.940  18.815  54.309  1.00 37.30 ? 386  TYR B CD2 1 
ATOM   7108  C  CE1 . TYR B 2 383 ? -2.858  17.733  52.634  1.00 37.18 ? 386  TYR B CE1 1 
ATOM   7109  C  CE2 . TYR B 2 383 ? -2.263  18.760  54.719  1.00 37.42 ? 386  TYR B CE2 1 
ATOM   7110  C  CZ  . TYR B 2 383 ? -3.216  18.219  53.882  1.00 37.40 ? 386  TYR B CZ  1 
ATOM   7111  O  OH  . TYR B 2 383 ? -4.522  18.158  54.309  1.00 37.67 ? 386  TYR B OH  1 
ATOM   7112  N  N   . GLN B 2 384 ? 2.736   20.736  50.408  1.00 37.24 ? 387  GLN B N   1 
ATOM   7113  C  CA  . GLN B 2 384 ? 4.078   21.062  49.935  1.00 37.24 ? 387  GLN B CA  1 
ATOM   7114  C  C   . GLN B 2 384 ? 4.434   22.419  50.539  1.00 37.47 ? 387  GLN B C   1 
ATOM   7115  O  O   . GLN B 2 384 ? 3.595   23.319  50.582  1.00 37.32 ? 387  GLN B O   1 
ATOM   7116  C  CB  . GLN B 2 384 ? 4.097   21.107  48.409  1.00 36.93 ? 387  GLN B CB  1 
ATOM   7117  C  CG  . GLN B 2 384 ? 3.679   19.785  47.774  1.00 36.61 ? 387  GLN B CG  1 
ATOM   7118  C  CD  . GLN B 2 384 ? 3.722   19.808  46.256  1.00 36.54 ? 387  GLN B CD  1 
ATOM   7119  O  OE1 . GLN B 2 384 ? 4.519   20.529  45.658  1.00 36.42 ? 387  GLN B OE1 1 
ATOM   7120  N  NE2 . GLN B 2 384 ? 2.868   19.008  45.625  1.00 36.21 ? 387  GLN B NE2 1 
ATOM   7121  N  N   . ARG B 2 385 ? 5.658   22.547  51.048  1.00 37.53 ? 388  ARG B N   1 
ATOM   7122  C  CA  . ARG B 2 385 ? 6.087   23.784  51.690  1.00 37.70 ? 388  ARG B CA  1 
ATOM   7123  C  C   . ARG B 2 385 ? 7.541   24.126  51.421  1.00 37.98 ? 388  ARG B C   1 
ATOM   7124  O  O   . ARG B 2 385 ? 8.328   23.277  50.998  1.00 38.15 ? 388  ARG B O   1 
ATOM   7125  C  CB  . ARG B 2 385 ? 5.955   23.658  53.211  1.00 37.33 ? 388  ARG B CB  1 
ATOM   7126  C  CG  . ARG B 2 385 ? 4.562   23.438  53.746  1.00 37.24 ? 388  ARG B CG  1 
ATOM   7127  C  CD  . ARG B 2 385 ? 3.711   24.678  53.617  1.00 37.06 ? 388  ARG B CD  1 
ATOM   7128  N  NE  . ARG B 2 385 ? 2.427   24.505  54.285  1.00 37.07 ? 388  ARG B NE  1 
ATOM   7129  C  CZ  . ARG B 2 385 ? 1.419   23.787  53.799  1.00 37.10 ? 388  ARG B CZ  1 
ATOM   7130  N  NH1 . ARG B 2 385 ? 1.542   23.172  52.628  1.00 36.88 ? 388  ARG B NH1 1 
ATOM   7131  N  NH2 . ARG B 2 385 ? 0.294   23.672  54.493  1.00 36.87 ? 388  ARG B NH2 1 
ATOM   7132  N  N   . ASP B 2 386 ? 7.885   25.381  51.697  1.00 38.24 ? 389  ASP B N   1 
ATOM   7133  C  CA  . ASP B 2 386 ? 9.248   25.872  51.594  1.00 38.58 ? 389  ASP B CA  1 
ATOM   7134  C  C   . ASP B 2 386 ? 9.937   25.782  50.238  1.00 39.08 ? 389  ASP B C   1 
ATOM   7135  O  O   . ASP B 2 386 ? 9.292   25.882  49.196  1.00 39.09 ? 389  ASP B O   1 
ATOM   7136  C  CB  . ASP B 2 386 ? 10.108  25.195  52.670  1.00 38.28 ? 389  ASP B CB  1 
ATOM   7137  C  CG  . ASP B 2 386 ? 9.468   25.239  54.052  1.00 38.12 ? 389  ASP B CG  1 
ATOM   7138  O  OD1 . ASP B 2 386 ? 8.466   25.963  54.237  1.00 38.11 ? 389  ASP B OD1 1 
ATOM   7139  O  OD2 . ASP B 2 386 ? 9.964   24.546  54.962  1.00 38.05 ? 389  ASP B OD2 1 
ATOM   7140  N  N   . GLY B 2 387 ? 11.255  25.590  50.269  1.00 39.65 ? 390  GLY B N   1 
ATOM   7141  C  CA  . GLY B 2 387 ? 12.038  25.527  49.047  1.00 40.45 ? 390  GLY B CA  1 
ATOM   7142  C  C   . GLY B 2 387 ? 12.525  26.920  48.675  1.00 41.13 ? 390  GLY B C   1 
ATOM   7143  O  O   . GLY B 2 387 ? 11.866  27.907  49.007  1.00 41.13 ? 390  GLY B O   1 
ATOM   7144  N  N   . PRO B 2 388 ? 13.664  27.047  47.976  1.00 41.69 ? 391  PRO B N   1 
ATOM   7145  C  CA  . PRO B 2 388 ? 14.176  28.369  47.595  1.00 42.20 ? 391  PRO B CA  1 
ATOM   7146  C  C   . PRO B 2 388 ? 13.201  29.266  46.830  1.00 42.91 ? 391  PRO B C   1 
ATOM   7147  O  O   . PRO B 2 388 ? 12.343  28.786  46.086  1.00 42.95 ? 391  PRO B O   1 
ATOM   7148  C  CB  . PRO B 2 388 ? 15.415  28.033  46.762  1.00 42.05 ? 391  PRO B CB  1 
ATOM   7149  C  CG  . PRO B 2 388 ? 15.162  26.650  46.281  1.00 41.93 ? 391  PRO B CG  1 
ATOM   7150  C  CD  . PRO B 2 388 ? 14.546  25.982  47.473  1.00 41.77 ? 391  PRO B CD  1 
ATOM   7151  N  N   . MET B 2 389 ? 13.332  30.572  47.055  1.00 43.67 ? 392  MET B N   1 
ATOM   7152  C  CA  . MET B 2 389 ? 12.509  31.590  46.409  1.00 44.39 ? 392  MET B CA  1 
ATOM   7153  C  C   . MET B 2 389 ? 11.014  31.352  46.524  1.00 45.15 ? 392  MET B C   1 
ATOM   7154  O  O   . MET B 2 389 ? 10.280  31.497  45.543  1.00 45.28 ? 392  MET B O   1 
ATOM   7155  C  CB  . MET B 2 389 ? 12.898  31.736  44.938  1.00 44.07 ? 392  MET B CB  1 
ATOM   7156  C  CG  . MET B 2 389 ? 14.313  32.212  44.725  1.00 43.86 ? 392  MET B CG  1 
ATOM   7157  S  SD  . MET B 2 389 ? 14.588  33.782  45.514  1.00 43.96 ? 392  MET B SD  1 
ATOM   7158  C  CE  . MET B 2 389 ? 13.714  34.834  44.458  1.00 43.69 ? 392  MET B CE  1 
ATOM   7159  N  N   . CYS B 2 390 ? 10.576  30.965  47.718  1.00 46.03 ? 393  CYS B N   1 
ATOM   7160  C  CA  . CYS B 2 390 ? 9.164   30.720  47.997  1.00 47.02 ? 393  CYS B CA  1 
ATOM   7161  C  C   . CYS B 2 390 ? 8.464   32.081  47.939  1.00 47.66 ? 393  CYS B C   1 
ATOM   7162  O  O   . CYS B 2 390 ? 8.494   32.840  48.907  1.00 47.69 ? 393  CYS B O   1 
ATOM   7163  C  CB  . CYS B 2 390 ? 9.038   30.102  49.389  1.00 47.06 ? 393  CYS B CB  1 
ATOM   7164  S  SG  . CYS B 2 390 ? 7.369   29.708  49.891  1.00 47.87 ? 393  CYS B SG  1 
ATOM   7165  N  N   . MET B 2 391 ? 7.855   32.391  46.793  1.00 48.57 ? 394  MET B N   1 
ATOM   7166  C  CA  . MET B 2 391 ? 7.205   33.689  46.589  1.00 49.39 ? 394  MET B CA  1 
ATOM   7167  C  C   . MET B 2 391 ? 5.736   33.861  46.899  1.00 49.48 ? 394  MET B C   1 
ATOM   7168  O  O   . MET B 2 391 ? 5.083   34.720  46.309  1.00 49.77 ? 394  MET B O   1 
ATOM   7169  C  CB  . MET B 2 391 ? 7.428   34.191  45.170  1.00 50.01 ? 394  MET B CB  1 
ATOM   7170  C  CG  . MET B 2 391 ? 8.303   35.400  45.111  1.00 51.05 ? 394  MET B CG  1 
ATOM   7171  S  SD  . MET B 2 391 ? 9.995   34.846  45.124  1.00 53.16 ? 394  MET B SD  1 
ATOM   7172  C  CE  . MET B 2 391 ? 10.631  35.692  43.634  1.00 52.66 ? 394  MET B CE  1 
ATOM   7173  N  N   . GLN B 2 392 ? 5.202   33.087  47.825  1.00 49.32 ? 395  GLN B N   1 
ATOM   7174  C  CA  . GLN B 2 392 ? 3.795   33.245  48.140  1.00 49.16 ? 395  GLN B CA  1 
ATOM   7175  C  C   . GLN B 2 392 ? 3.671   33.265  49.647  1.00 48.51 ? 395  GLN B C   1 
ATOM   7176  O  O   . GLN B 2 392 ? 4.636   33.600  50.331  1.00 48.69 ? 395  GLN B O   1 
ATOM   7177  C  CB  . GLN B 2 392 ? 2.999   32.100  47.501  1.00 50.01 ? 395  GLN B CB  1 
ATOM   7178  C  CG  . GLN B 2 392 ? 3.073   32.095  45.956  1.00 50.77 ? 395  GLN B CG  1 
ATOM   7179  C  CD  . GLN B 2 392 ? 2.624   30.775  45.325  1.00 51.33 ? 395  GLN B CD  1 
ATOM   7180  O  OE1 . GLN B 2 392 ? 2.682   29.713  45.958  1.00 51.58 ? 395  GLN B OE1 1 
ATOM   7181  N  NE2 . GLN B 2 392 ? 2.196   30.837  44.062  1.00 51.44 ? 395  GLN B NE2 1 
ATOM   7182  N  N   . ASP B 2 393 ? 2.487   32.977  50.173  1.00 47.32 ? 396  ASP B N   1 
ATOM   7183  C  CA  . ASP B 2 393 ? 2.324   32.948  51.621  1.00 45.97 ? 396  ASP B CA  1 
ATOM   7184  C  C   . ASP B 2 393 ? 2.787   31.592  52.155  1.00 44.76 ? 396  ASP B C   1 
ATOM   7185  O  O   . ASP B 2 393 ? 2.735   31.348  53.360  1.00 44.53 ? 396  ASP B O   1 
ATOM   7186  C  CB  . ASP B 2 393 ? 0.867   33.207  52.014  1.00 46.49 ? 396  ASP B CB  1 
ATOM   7187  C  CG  . ASP B 2 393 ? -0.086  32.129  51.509  1.00 46.83 ? 396  ASP B CG  1 
ATOM   7188  O  OD1 . ASP B 2 393 ? 0.206   31.455  50.495  1.00 47.02 ? 396  ASP B OD1 1 
ATOM   7189  O  OD2 . ASP B 2 393 ? -1.150  31.963  52.137  1.00 47.41 ? 396  ASP B OD2 1 
ATOM   7190  N  N   . ASN B 2 394 ? 3.236   30.726  51.243  1.00 43.33 ? 397  ASN B N   1 
ATOM   7191  C  CA  . ASN B 2 394 ? 3.712   29.384  51.567  1.00 42.06 ? 397  ASN B CA  1 
ATOM   7192  C  C   . ASN B 2 394 ? 2.601   28.623  52.289  1.00 41.43 ? 397  ASN B C   1 
ATOM   7193  O  O   . ASN B 2 394 ? 2.858   27.764  53.134  1.00 41.33 ? 397  ASN B O   1 
ATOM   7194  C  CB  . ASN B 2 394 ? 4.980   29.472  52.428  1.00 41.72 ? 397  ASN B CB  1 
ATOM   7195  C  CG  . ASN B 2 394 ? 5.756   28.163  52.483  1.00 41.39 ? 397  ASN B CG  1 
ATOM   7196  O  OD1 . ASN B 2 394 ? 6.553   27.948  53.392  1.00 41.29 ? 397  ASN B OD1 1 
ATOM   7197  N  ND2 . ASN B 2 394 ? 5.543   27.298  51.502  1.00 41.17 ? 397  ASN B ND2 1 
ATOM   7198  N  N   . GLN B 2 395 ? 1.361   28.950  51.927  1.00 40.68 ? 398  GLN B N   1 
ATOM   7199  C  CA  . GLN B 2 395 ? 0.154   28.356  52.501  1.00 39.85 ? 398  GLN B CA  1 
ATOM   7200  C  C   . GLN B 2 395 ? -0.058  28.659  53.980  1.00 39.44 ? 398  GLN B C   1 
ATOM   7201  O  O   . GLN B 2 395 ? -0.806  27.973  54.673  1.00 39.30 ? 398  GLN B O   1 
ATOM   7202  C  CB  . GLN B 2 395 ? 0.057   26.864  52.176  1.00 39.61 ? 398  GLN B CB  1 
ATOM   7203  C  CG  . GLN B 2 395 ? -0.289  26.650  50.708  1.00 39.47 ? 398  GLN B CG  1 
ATOM   7204  C  CD  . GLN B 2 395 ? -0.332  25.201  50.278  1.00 39.37 ? 398  GLN B CD  1 
ATOM   7205  O  OE1 . GLN B 2 395 ? 0.638   24.680  49.733  1.00 39.29 ? 398  GLN B OE1 1 
ATOM   7206  N  NE2 . GLN B 2 395 ? -1.474  24.558  50.470  1.00 39.38 ? 398  GLN B NE2 1 
ATOM   7207  N  N   . GLY B 2 396 ? 0.584   29.732  54.432  1.00 39.11 ? 399  GLY B N   1 
ATOM   7208  C  CA  . GLY B 2 396 ? 0.452   30.199  55.799  1.00 38.54 ? 399  GLY B CA  1 
ATOM   7209  C  C   . GLY B 2 396 ? 0.607   29.170  56.886  1.00 38.21 ? 399  GLY B C   1 
ATOM   7210  O  O   . GLY B 2 396 ? 1.487   28.315  56.822  1.00 38.25 ? 399  GLY B O   1 
ATOM   7211  N  N   . GLY B 2 397 ? -0.274  29.247  57.876  1.00 37.94 ? 400  GLY B N   1 
ATOM   7212  C  CA  . GLY B 2 397 ? -0.224  28.335  59.000  1.00 37.70 ? 400  GLY B CA  1 
ATOM   7213  C  C   . GLY B 2 397 ? -1.061  27.079  58.887  1.00 37.58 ? 400  GLY B C   1 
ATOM   7214  O  O   . GLY B 2 397 ? -1.327  26.422  59.894  1.00 37.66 ? 400  GLY B O   1 
ATOM   7215  N  N   . ALA B 2 398 ? -1.472  26.724  57.677  1.00 37.39 ? 401  ALA B N   1 
ATOM   7216  C  CA  . ALA B 2 398 ? -2.277  25.523  57.480  1.00 37.16 ? 401  ALA B CA  1 
ATOM   7217  C  C   . ALA B 2 398 ? -1.486  24.269  57.823  1.00 37.17 ? 401  ALA B C   1 
ATOM   7218  O  O   . ALA B 2 398 ? -0.301  24.185  57.508  1.00 37.12 ? 401  ALA B O   1 
ATOM   7219  C  CB  . ALA B 2 398 ? -2.743  25.449  56.046  1.00 37.18 ? 401  ALA B CB  1 
ATOM   7220  N  N   . PRO B 2 399 ? -2.131  23.279  58.475  1.00 37.23 ? 402  PRO B N   1 
ATOM   7221  C  CA  . PRO B 2 399 ? -1.525  22.000  58.874  1.00 37.19 ? 402  PRO B CA  1 
ATOM   7222  C  C   . PRO B 2 399 ? -0.751  21.409  57.695  1.00 37.18 ? 402  PRO B C   1 
ATOM   7223  O  O   . PRO B 2 399 ? -1.312  21.208  56.618  1.00 37.17 ? 402  PRO B O   1 
ATOM   7224  C  CB  . PRO B 2 399 ? -2.746  21.156  59.220  1.00 37.21 ? 402  PRO B CB  1 
ATOM   7225  C  CG  . PRO B 2 399 ? -3.636  22.153  59.862  1.00 37.19 ? 402  PRO B CG  1 
ATOM   7226  C  CD  . PRO B 2 399 ? -3.530  23.349  58.931  1.00 37.22 ? 402  PRO B CD  1 
ATOM   7227  N  N   . ASN B 2 400 ? 0.527   21.115  57.901  1.00 37.05 ? 403  ASN B N   1 
ATOM   7228  C  CA  . ASN B 2 400 ? 1.358   20.622  56.814  1.00 37.02 ? 403  ASN B CA  1 
ATOM   7229  C  C   . ASN B 2 400 ? 1.481   19.131  56.622  1.00 37.00 ? 403  ASN B C   1 
ATOM   7230  O  O   . ASN B 2 400 ? 2.386   18.686  55.925  1.00 37.10 ? 403  ASN B O   1 
ATOM   7231  C  CB  . ASN B 2 400 ? 2.760   21.217  56.922  1.00 36.95 ? 403  ASN B CB  1 
ATOM   7232  C  CG  . ASN B 2 400 ? 3.515   20.715  58.136  1.00 36.80 ? 403  ASN B CG  1 
ATOM   7233  O  OD1 . ASN B 2 400 ? 4.677   21.065  58.342  1.00 37.00 ? 403  ASN B OD1 1 
ATOM   7234  N  ND2 . ASN B 2 400 ? 2.863   19.897  58.944  1.00 36.85 ? 403  ASN B ND2 1 
ATOM   7235  N  N   . TYR B 2 401 ? 0.589   18.353  57.217  1.00 37.07 ? 404  TYR B N   1 
ATOM   7236  C  CA  . TYR B 2 401 ? 0.672   16.904  57.063  1.00 37.11 ? 404  TYR B CA  1 
ATOM   7237  C  C   . TYR B 2 401 ? -0.690  16.290  56.751  1.00 37.04 ? 404  TYR B C   1 
ATOM   7238  O  O   . TYR B 2 401 ? -1.731  16.808  57.164  1.00 36.97 ? 404  TYR B O   1 
ATOM   7239  C  CB  . TYR B 2 401 ? 1.265   16.272  58.327  1.00 36.98 ? 404  TYR B CB  1 
ATOM   7240  C  CG  . TYR B 2 401 ? 0.424   16.521  59.552  1.00 37.11 ? 404  TYR B CG  1 
ATOM   7241  C  CD1 . TYR B 2 401 ? -0.436  15.536  60.043  1.00 37.06 ? 404  TYR B CD1 1 
ATOM   7242  C  CD2 . TYR B 2 401 ? 0.442   17.760  60.193  1.00 36.90 ? 404  TYR B CD2 1 
ATOM   7243  C  CE1 . TYR B 2 401 ? -1.254  15.782  61.134  1.00 37.12 ? 404  TYR B CE1 1 
ATOM   7244  C  CE2 . TYR B 2 401 ? -0.374  18.012  61.280  1.00 37.05 ? 404  TYR B CE2 1 
ATOM   7245  C  CZ  . TYR B 2 401 ? -1.219  17.020  61.746  1.00 37.10 ? 404  TYR B CZ  1 
ATOM   7246  O  OH  . TYR B 2 401 ? -2.034  17.271  62.820  1.00 37.26 ? 404  TYR B OH  1 
ATOM   7247  N  N   . TYR B 2 402 ? -0.669  15.169  56.042  1.00 37.02 ? 405  TYR B N   1 
ATOM   7248  C  CA  . TYR B 2 402 ? -1.886  14.470  55.656  1.00 37.02 ? 405  TYR B CA  1 
ATOM   7249  C  C   . TYR B 2 402 ? -1.747  12.980  55.980  1.00 36.97 ? 405  TYR B C   1 
ATOM   7250  O  O   . TYR B 2 402 ? -0.745  12.352  55.630  1.00 36.80 ? 405  TYR B O   1 
ATOM   7251  C  CB  . TYR B 2 402 ? -2.108  14.653  54.159  1.00 37.16 ? 405  TYR B CB  1 
ATOM   7252  C  CG  . TYR B 2 402 ? -3.483  14.295  53.666  1.00 37.28 ? 405  TYR B CG  1 
ATOM   7253  C  CD1 . TYR B 2 402 ? -4.616  14.919  54.180  1.00 37.46 ? 405  TYR B CD1 1 
ATOM   7254  C  CD2 . TYR B 2 402 ? -3.650  13.377  52.640  1.00 37.36 ? 405  TYR B CD2 1 
ATOM   7255  C  CE1 . TYR B 2 402 ? -5.882  14.637  53.673  1.00 37.70 ? 405  TYR B CE1 1 
ATOM   7256  C  CE2 . TYR B 2 402 ? -4.908  13.091  52.126  1.00 37.66 ? 405  TYR B CE2 1 
ATOM   7257  C  CZ  . TYR B 2 402 ? -6.017  13.725  52.643  1.00 37.70 ? 405  TYR B CZ  1 
ATOM   7258  O  OH  . TYR B 2 402 ? -7.253  13.459  52.107  1.00 37.96 ? 405  TYR B OH  1 
ATOM   7259  N  N   . PRO B 2 403 ? -2.752  12.395  56.655  1.00 36.86 ? 406  PRO B N   1 
ATOM   7260  C  CA  . PRO B 2 403 ? -3.990  13.023  57.128  1.00 36.72 ? 406  PRO B CA  1 
ATOM   7261  C  C   . PRO B 2 403 ? -3.822  13.850  58.403  1.00 36.82 ? 406  PRO B C   1 
ATOM   7262  O  O   . PRO B 2 403 ? -2.831  13.720  59.125  1.00 36.61 ? 406  PRO B O   1 
ATOM   7263  C  CB  . PRO B 2 403 ? -4.886  11.821  57.374  1.00 36.73 ? 406  PRO B CB  1 
ATOM   7264  C  CG  . PRO B 2 403 ? -3.925  10.823  57.912  1.00 36.68 ? 406  PRO B CG  1 
ATOM   7265  C  CD  . PRO B 2 403 ? -2.766  10.950  56.948  1.00 36.76 ? 406  PRO B CD  1 
ATOM   7266  N  N   . ASN B 2 404 ? -4.814  14.690  58.676  1.00 37.00 ? 407  ASN B N   1 
ATOM   7267  C  CA  . ASN B 2 404 ? -4.813  15.540  59.854  1.00 37.25 ? 407  ASN B CA  1 
ATOM   7268  C  C   . ASN B 2 404 ? -6.249  15.771  60.308  1.00 37.41 ? 407  ASN B C   1 
ATOM   7269  O  O   . ASN B 2 404 ? -7.177  15.642  59.514  1.00 37.55 ? 407  ASN B O   1 
ATOM   7270  C  CB  . ASN B 2 404 ? -4.149  16.873  59.530  1.00 37.25 ? 407  ASN B CB  1 
ATOM   7271  C  CG  . ASN B 2 404 ? -4.837  17.598  58.404  1.00 37.36 ? 407  ASN B CG  1 
ATOM   7272  O  OD1 . ASN B 2 404 ? -4.458  17.461  57.240  1.00 37.80 ? 407  ASN B OD1 1 
ATOM   7273  N  ND2 . ASN B 2 404 ? -5.863  18.370  58.739  1.00 37.35 ? 407  ASN B ND2 1 
ATOM   7274  N  N   . SER B 2 405 ? -6.431  16.120  61.578  1.00 37.59 ? 408  SER B N   1 
ATOM   7275  C  CA  . SER B 2 405 ? -7.767  16.363  62.133  1.00 37.82 ? 408  SER B CA  1 
ATOM   7276  C  C   . SER B 2 405 ? -8.041  17.849  62.261  1.00 38.00 ? 408  SER B C   1 
ATOM   7277  O  O   . SER B 2 405 ? -8.923  18.248  63.019  1.00 38.18 ? 408  SER B O   1 
ATOM   7278  C  CB  . SER B 2 405 ? -7.876  15.748  63.530  1.00 37.47 ? 408  SER B CB  1 
ATOM   7279  O  OG  . SER B 2 405 ? -7.490  14.387  63.534  1.00 37.53 ? 408  SER B OG  1 
ATOM   7280  N  N   . PHE B 2 406 ? -7.321  18.667  61.499  1.00 38.27 ? 409  PHE B N   1 
ATOM   7281  C  CA  . PHE B 2 406 ? -7.471  20.112  61.615  1.00 38.42 ? 409  PHE B CA  1 
ATOM   7282  C  C   . PHE B 2 406 ? -8.004  20.921  60.437  1.00 38.73 ? 409  PHE B C   1 
ATOM   7283  O  O   . PHE B 2 406 ? -7.779  22.127  60.368  1.00 38.70 ? 409  PHE B O   1 
ATOM   7284  C  CB  . PHE B 2 406 ? -6.174  20.713  62.164  1.00 38.16 ? 409  PHE B CB  1 
ATOM   7285  C  CG  . PHE B 2 406 ? -5.780  20.151  63.508  1.00 38.02 ? 409  PHE B CG  1 
ATOM   7286  C  CD1 . PHE B 2 406 ? -5.034  18.977  63.598  1.00 37.81 ? 409  PHE B CD1 1 
ATOM   7287  C  CD2 . PHE B 2 406 ? -6.203  20.760  64.683  1.00 37.83 ? 409  PHE B CD2 1 
ATOM   7288  C  CE1 . PHE B 2 406 ? -4.722  18.423  64.834  1.00 37.77 ? 409  PHE B CE1 1 
ATOM   7289  C  CE2 . PHE B 2 406 ? -5.893  20.210  65.927  1.00 37.81 ? 409  PHE B CE2 1 
ATOM   7290  C  CZ  . PHE B 2 406 ? -5.154  19.041  66.002  1.00 37.84 ? 409  PHE B CZ  1 
ATOM   7291  N  N   . GLY B 2 407 ? -8.720  20.264  59.525  1.00 39.11 ? 410  GLY B N   1 
ATOM   7292  C  CA  . GLY B 2 407 ? -9.324  20.962  58.397  1.00 39.47 ? 410  GLY B CA  1 
ATOM   7293  C  C   . GLY B 2 407 ? -8.516  21.298  57.156  1.00 39.80 ? 410  GLY B C   1 
ATOM   7294  O  O   . GLY B 2 407 ? -8.986  22.079  56.311  1.00 39.82 ? 410  GLY B O   1 
ATOM   7295  N  N   . ALA B 2 408 ? -7.316  20.732  57.038  1.00 39.86 ? 411  ALA B N   1 
ATOM   7296  C  CA  . ALA B 2 408 ? -6.460  20.971  55.879  1.00 39.89 ? 411  ALA B CA  1 
ATOM   7297  C  C   . ALA B 2 408 ? -7.063  20.279  54.639  1.00 39.91 ? 411  ALA B C   1 
ATOM   7298  O  O   . ALA B 2 408 ? -7.980  19.467  54.766  1.00 39.94 ? 411  ALA B O   1 
ATOM   7299  C  CB  . ALA B 2 408 ? -5.052  20.469  56.170  1.00 39.87 ? 411  ALA B CB  1 
ATOM   7300  N  N   . PRO B 2 409 ? -6.554  20.586  53.431  1.00 39.91 ? 412  PRO B N   1 
ATOM   7301  C  CA  . PRO B 2 409 ? -7.044  20.007  52.176  1.00 40.00 ? 412  PRO B CA  1 
ATOM   7302  C  C   . PRO B 2 409 ? -7.248  18.504  52.152  1.00 40.31 ? 412  PRO B C   1 
ATOM   7303  O  O   . PRO B 2 409 ? -6.469  17.752  52.737  1.00 40.22 ? 412  PRO B O   1 
ATOM   7304  C  CB  . PRO B 2 409 ? -5.982  20.441  51.180  1.00 39.88 ? 412  PRO B CB  1 
ATOM   7305  C  CG  . PRO B 2 409 ? -5.609  21.775  51.688  1.00 39.73 ? 412  PRO B CG  1 
ATOM   7306  C  CD  . PRO B 2 409 ? -5.448  21.517  53.157  1.00 39.81 ? 412  PRO B CD  1 
ATOM   7307  N  N   . GLU B 2 410 ? -8.299  18.080  51.451  1.00 40.68 ? 413  GLU B N   1 
ATOM   7308  C  CA  . GLU B 2 410 ? -8.650  16.669  51.321  1.00 41.21 ? 413  GLU B CA  1 
ATOM   7309  C  C   . GLU B 2 410 ? -8.632  16.201  49.869  1.00 41.64 ? 413  GLU B C   1 
ATOM   7310  O  O   . GLU B 2 410 ? -8.936  16.970  48.959  1.00 41.66 ? 413  GLU B O   1 
ATOM   7311  C  CB  . GLU B 2 410 ? -10.047 16.426  51.890  1.00 41.23 ? 413  GLU B CB  1 
ATOM   7312  C  CG  . GLU B 2 410 ? -10.150 16.531  53.397  1.00 41.46 ? 413  GLU B CG  1 
ATOM   7313  C  CD  . GLU B 2 410 ? -9.465  15.383  54.119  1.00 41.67 ? 413  GLU B CD  1 
ATOM   7314  O  OE1 . GLU B 2 410 ? -8.985  15.609  55.251  1.00 41.73 ? 413  GLU B OE1 1 
ATOM   7315  O  OE2 . GLU B 2 410 ? -9.415  14.256  53.569  1.00 41.65 ? 413  GLU B OE2 1 
ATOM   7316  N  N   . GLN B 2 411 ? -8.292  14.931  49.656  1.00 42.20 ? 414  GLN B N   1 
ATOM   7317  C  CA  . GLN B 2 411 ? -8.258  14.353  48.313  1.00 42.75 ? 414  GLN B CA  1 
ATOM   7318  C  C   . GLN B 2 411 ? -9.676  14.277  47.759  1.00 43.42 ? 414  GLN B C   1 
ATOM   7319  O  O   . GLN B 2 411 ? -10.638 14.170  48.517  1.00 43.57 ? 414  GLN B O   1 
ATOM   7320  C  CB  . GLN B 2 411 ? -7.647  12.957  48.366  1.00 42.35 ? 414  GLN B CB  1 
ATOM   7321  C  CG  . GLN B 2 411 ? -8.305  12.063  49.390  1.00 42.13 ? 414  GLN B CG  1 
ATOM   7322  C  CD  . GLN B 2 411 ? -7.443  10.891  49.780  1.00 41.96 ? 414  GLN B CD  1 
ATOM   7323  O  OE1 . GLN B 2 411 ? -6.220  10.984  49.815  1.00 41.99 ? 414  GLN B OE1 1 
ATOM   7324  N  NE2 . GLN B 2 411 ? -8.078  9.780   50.091  1.00 42.01 ? 414  GLN B NE2 1 
ATOM   7325  N  N   . GLN B 2 412 ? -9.804  14.354  46.442  1.00 44.15 ? 415  GLN B N   1 
ATOM   7326  C  CA  . GLN B 2 412 ? -11.105 14.306  45.792  1.00 44.93 ? 415  GLN B CA  1 
ATOM   7327  C  C   . GLN B 2 412 ? -11.195 13.031  44.962  1.00 45.36 ? 415  GLN B C   1 
ATOM   7328  O  O   . GLN B 2 412 ? -10.688 12.965  43.847  1.00 45.31 ? 415  GLN B O   1 
ATOM   7329  C  CB  . GLN B 2 412 ? -11.273 15.547  44.918  1.00 45.32 ? 415  GLN B CB  1 
ATOM   7330  C  CG  . GLN B 2 412 ? -12.593 15.656  44.186  1.00 46.11 ? 415  GLN B CG  1 
ATOM   7331  C  CD  . GLN B 2 412 ? -12.695 16.948  43.389  1.00 46.54 ? 415  GLN B CD  1 
ATOM   7332  O  OE1 . GLN B 2 412 ? -12.211 17.040  42.254  1.00 46.83 ? 415  GLN B OE1 1 
ATOM   7333  N  NE2 . GLN B 2 412 ? -13.311 17.960  43.988  1.00 46.79 ? 415  GLN B NE2 1 
ATOM   7334  N  N   . PRO B 2 413 ? -11.845 11.994  45.511  1.00 45.82 ? 416  PRO B N   1 
ATOM   7335  C  CA  . PRO B 2 413 ? -12.046 10.678  44.902  1.00 46.23 ? 416  PRO B CA  1 
ATOM   7336  C  C   . PRO B 2 413 ? -12.426 10.672  43.429  1.00 46.67 ? 416  PRO B C   1 
ATOM   7337  O  O   . PRO B 2 413 ? -11.988 9.795   42.687  1.00 46.74 ? 416  PRO B O   1 
ATOM   7338  C  CB  . PRO B 2 413 ? -13.144 10.078  45.770  1.00 46.24 ? 416  PRO B CB  1 
ATOM   7339  C  CG  . PRO B 2 413 ? -12.783 10.589  47.113  1.00 46.02 ? 416  PRO B CG  1 
ATOM   7340  C  CD  . PRO B 2 413 ? -12.521 12.054  46.818  1.00 45.98 ? 416  PRO B CD  1 
ATOM   7341  N  N   . SER B 2 414 ? -13.230 11.642  43.002  1.00 47.18 ? 417  SER B N   1 
ATOM   7342  C  CA  . SER B 2 414 ? -13.640 11.715  41.601  1.00 47.72 ? 417  SER B CA  1 
ATOM   7343  C  C   . SER B 2 414 ? -12.460 11.947  40.650  1.00 48.15 ? 417  SER B C   1 
ATOM   7344  O  O   . SER B 2 414 ? -12.564 11.687  39.449  1.00 48.20 ? 417  SER B O   1 
ATOM   7345  C  CB  . SER B 2 414 ? -14.674 12.823  41.407  1.00 47.63 ? 417  SER B CB  1 
ATOM   7346  O  OG  . SER B 2 414 ? -14.107 14.101  41.635  1.00 47.73 ? 417  SER B OG  1 
ATOM   7347  N  N   . ALA B 2 415 ? -11.346 12.438  41.191  1.00 48.59 ? 418  ALA B N   1 
ATOM   7348  C  CA  . ALA B 2 415 ? -10.148 12.715  40.399  1.00 49.02 ? 418  ALA B CA  1 
ATOM   7349  C  C   . ALA B 2 415 ? -9.231  11.502  40.209  1.00 49.45 ? 418  ALA B C   1 
ATOM   7350  O  O   . ALA B 2 415 ? -8.257  11.566  39.452  1.00 49.56 ? 418  ALA B O   1 
ATOM   7351  C  CB  . ALA B 2 415 ? -9.371  13.865  41.018  1.00 48.93 ? 418  ALA B CB  1 
ATOM   7352  N  N   . LEU B 2 416 ? -9.546  10.403  40.890  1.00 49.82 ? 419  LEU B N   1 
ATOM   7353  C  CA  . LEU B 2 416 ? -8.769  9.167   40.803  1.00 50.13 ? 419  LEU B CA  1 
ATOM   7354  C  C   . LEU B 2 416 ? -8.586  8.709   39.348  1.00 50.58 ? 419  LEU B C   1 
ATOM   7355  O  O   . LEU B 2 416 ? -9.521  8.779   38.546  1.00 50.71 ? 419  LEU B O   1 
ATOM   7356  C  CB  . LEU B 2 416 ? -9.476  8.085   41.605  1.00 49.84 ? 419  LEU B CB  1 
ATOM   7357  C  CG  . LEU B 2 416 ? -8.630  6.898   42.029  1.00 49.79 ? 419  LEU B CG  1 
ATOM   7358  C  CD1 . LEU B 2 416 ? -7.448  7.377   42.857  1.00 49.78 ? 419  LEU B CD1 1 
ATOM   7359  C  CD2 . LEU B 2 416 ? -9.494  5.952   42.836  1.00 49.87 ? 419  LEU B CD2 1 
ATOM   7360  N  N   . GLU B 2 417 ? -7.381  8.246   39.013  1.00 51.01 ? 420  GLU B N   1 
ATOM   7361  C  CA  . GLU B 2 417 ? -7.068  7.799   37.651  1.00 51.40 ? 420  GLU B CA  1 
ATOM   7362  C  C   . GLU B 2 417 ? -7.750  6.498   37.218  1.00 51.69 ? 420  GLU B C   1 
ATOM   7363  O  O   . GLU B 2 417 ? -8.219  5.718   38.046  1.00 51.72 ? 420  GLU B O   1 
ATOM   7364  C  CB  . GLU B 2 417 ? -5.557  7.649   37.465  1.00 51.45 ? 420  GLU B CB  1 
ATOM   7365  C  CG  . GLU B 2 417 ? -4.722  8.845   37.902  1.00 51.74 ? 420  GLU B CG  1 
ATOM   7366  C  CD  . GLU B 2 417 ? -4.227  8.740   39.343  1.00 52.03 ? 420  GLU B CD  1 
ATOM   7367  O  OE1 . GLU B 2 417 ? -4.656  7.821   40.082  1.00 51.93 ? 420  GLU B OE1 1 
ATOM   7368  O  OE2 . GLU B 2 417 ? -3.394  9.585   39.738  1.00 52.15 ? 420  GLU B OE2 1 
ATOM   7369  N  N   . HIS B 2 418 ? -7.800  6.288   35.905  1.00 51.99 ? 421  HIS B N   1 
ATOM   7370  C  CA  . HIS B 2 418 ? -8.392  5.098   35.301  1.00 52.37 ? 421  HIS B CA  1 
ATOM   7371  C  C   . HIS B 2 418 ? -7.442  3.910   35.479  1.00 52.61 ? 421  HIS B C   1 
ATOM   7372  O  O   . HIS B 2 418 ? -6.240  4.035   35.235  1.00 52.47 ? 421  HIS B O   1 
ATOM   7373  C  CB  . HIS B 2 418 ? -8.639  5.373   33.810  1.00 52.46 ? 421  HIS B CB  1 
ATOM   7374  C  CG  . HIS B 2 418 ? -9.035  4.166   33.017  1.00 52.57 ? 421  HIS B CG  1 
ATOM   7375  N  ND1 . HIS B 2 418 ? -10.344 3.757   32.886  1.00 52.66 ? 421  HIS B ND1 1 
ATOM   7376  C  CD2 . HIS B 2 418 ? -8.292  3.282   32.310  1.00 52.63 ? 421  HIS B CD2 1 
ATOM   7377  C  CE1 . HIS B 2 418 ? -10.391 2.669   32.136  1.00 52.78 ? 421  HIS B CE1 1 
ATOM   7378  N  NE2 . HIS B 2 418 ? -9.159  2.360   31.773  1.00 52.79 ? 421  HIS B NE2 1 
ATOM   7379  N  N   . SER B 2 419 ? -7.977  2.759   35.882  1.00 53.02 ? 422  SER B N   1 
ATOM   7380  C  CA  . SER B 2 419 ? -7.136  1.579   36.087  1.00 53.64 ? 422  SER B CA  1 
ATOM   7381  C  C   . SER B 2 419 ? -7.239  0.466   35.040  1.00 53.99 ? 422  SER B C   1 
ATOM   7382  O  O   . SER B 2 419 ? -8.327  -0.009  34.709  1.00 53.88 ? 422  SER B O   1 
ATOM   7383  C  CB  . SER B 2 419 ? -7.327  1.005   37.498  1.00 53.69 ? 422  SER B CB  1 
ATOM   7384  O  OG  . SER B 2 419 ? -8.643  0.531   37.715  1.00 54.00 ? 422  SER B OG  1 
ATOM   7385  N  N   . ILE B 2 420 ? -6.075  0.062   34.535  1.00 54.52 ? 423  ILE B N   1 
ATOM   7386  C  CA  . ILE B 2 420 ? -5.951  -0.990  33.526  1.00 55.05 ? 423  ILE B CA  1 
ATOM   7387  C  C   . ILE B 2 420 ? -5.098  -2.121  34.095  1.00 55.47 ? 423  ILE B C   1 
ATOM   7388  O  O   . ILE B 2 420 ? -4.208  -1.891  34.910  1.00 55.52 ? 423  ILE B O   1 
ATOM   7389  C  CB  . ILE B 2 420 ? -5.233  -0.471  32.242  1.00 55.08 ? 423  ILE B CB  1 
ATOM   7390  C  CG1 . ILE B 2 420 ? -5.933  0.771   31.686  1.00 55.16 ? 423  ILE B CG1 1 
ATOM   7391  C  CG2 . ILE B 2 420 ? -5.198  -1.558  31.168  1.00 55.06 ? 423  ILE B CG2 1 
ATOM   7392  C  CD1 . ILE B 2 420 ? -5.239  1.383   30.466  1.00 55.08 ? 423  ILE B CD1 1 
ATOM   7393  N  N   . GLN B 2 421 ? -5.366  -3.342  33.651  1.00 56.01 ? 424  GLN B N   1 
ATOM   7394  C  CA  . GLN B 2 421 ? -4.615  -4.510  34.094  1.00 56.47 ? 424  GLN B CA  1 
ATOM   7395  C  C   . GLN B 2 421 ? -3.653  -4.899  32.957  1.00 56.44 ? 424  GLN B C   1 
ATOM   7396  O  O   . GLN B 2 421 ? -4.086  -5.179  31.839  1.00 56.42 ? 424  GLN B O   1 
ATOM   7397  C  CB  . GLN B 2 421 ? -5.592  -5.650  34.409  1.00 57.07 ? 424  GLN B CB  1 
ATOM   7398  C  CG  . GLN B 2 421 ? -5.086  -6.709  35.395  1.00 58.18 ? 424  GLN B CG  1 
ATOM   7399  C  CD  . GLN B 2 421 ? -3.965  -7.577  34.831  1.00 58.92 ? 424  GLN B CD  1 
ATOM   7400  O  OE1 . GLN B 2 421 ? -3.968  -7.923  33.643  1.00 59.39 ? 424  GLN B OE1 1 
ATOM   7401  N  NE2 . GLN B 2 421 ? -3.005  -7.944  35.684  1.00 59.12 ? 424  GLN B NE2 1 
ATOM   7402  N  N   . TYR B 2 422 ? -2.350  -4.834  33.217  1.00 56.39 ? 425  TYR B N   1 
ATOM   7403  C  CA  . TYR B 2 422 ? -1.357  -5.198  32.204  1.00 56.40 ? 425  TYR B CA  1 
ATOM   7404  C  C   . TYR B 2 422 ? -0.736  -6.543  32.555  1.00 56.54 ? 425  TYR B C   1 
ATOM   7405  O  O   . TYR B 2 422 ? -0.701  -6.931  33.731  1.00 56.75 ? 425  TYR B O   1 
ATOM   7406  C  CB  . TYR B 2 422 ? -0.230  -4.164  32.120  1.00 56.19 ? 425  TYR B CB  1 
ATOM   7407  C  CG  . TYR B 2 422 ? -0.657  -2.775  31.721  1.00 56.14 ? 425  TYR B CG  1 
ATOM   7408  C  CD1 . TYR B 2 422 ? -0.581  -2.351  30.394  1.00 56.02 ? 425  TYR B CD1 1 
ATOM   7409  C  CD2 . TYR B 2 422 ? -1.102  -1.867  32.677  1.00 56.10 ? 425  TYR B CD2 1 
ATOM   7410  C  CE1 . TYR B 2 422 ? -0.936  -1.049  30.033  1.00 56.02 ? 425  TYR B CE1 1 
ATOM   7411  C  CE2 . TYR B 2 422 ? -1.457  -0.568  32.328  1.00 56.13 ? 425  TYR B CE2 1 
ATOM   7412  C  CZ  . TYR B 2 422 ? -1.371  -0.165  31.009  1.00 56.11 ? 425  TYR B CZ  1 
ATOM   7413  O  OH  . TYR B 2 422 ? -1.702  1.129   30.680  1.00 56.22 ? 425  TYR B OH  1 
ATOM   7414  N  N   . SER B 2 423 ? -0.227  -7.240  31.540  1.00 56.40 ? 426  SER B N   1 
ATOM   7415  C  CA  . SER B 2 423 ? 0.406   -8.535  31.764  1.00 56.21 ? 426  SER B CA  1 
ATOM   7416  C  C   . SER B 2 423 ? 1.707   -8.710  31.006  1.00 55.74 ? 426  SER B C   1 
ATOM   7417  O  O   . SER B 2 423 ? 1.913   -8.137  29.930  1.00 55.72 ? 426  SER B O   1 
ATOM   7418  C  CB  . SER B 2 423 ? -0.551  -9.691  31.447  1.00 56.63 ? 426  SER B CB  1 
ATOM   7419  O  OG  . SER B 2 423 ? -1.384  -9.977  32.563  1.00 57.12 ? 426  SER B OG  1 
ATOM   7420  N  N   . GLY B 2 424 ? 2.571   -9.533  31.587  1.00 55.17 ? 427  GLY B N   1 
ATOM   7421  C  CA  . GLY B 2 424 ? 3.869   -9.802  31.006  1.00 54.31 ? 427  GLY B CA  1 
ATOM   7422  C  C   . GLY B 2 424 ? 4.915   -9.556  32.071  1.00 53.62 ? 427  GLY B C   1 
ATOM   7423  O  O   . GLY B 2 424 ? 4.598   -9.096  33.167  1.00 53.59 ? 427  GLY B O   1 
ATOM   7424  N  N   . GLU B 2 425 ? 6.161   -9.888  31.765  1.00 52.90 ? 428  GLU B N   1 
ATOM   7425  C  CA  . GLU B 2 425 ? 7.241   -9.684  32.710  1.00 52.04 ? 428  GLU B CA  1 
ATOM   7426  C  C   . GLU B 2 425 ? 7.637   -8.221  32.796  1.00 51.19 ? 428  GLU B C   1 
ATOM   7427  O  O   . GLU B 2 425 ? 7.353   -7.418  31.899  1.00 50.95 ? 428  GLU B O   1 
ATOM   7428  C  CB  . GLU B 2 425 ? 8.469   -10.476 32.295  1.00 52.58 ? 428  GLU B CB  1 
ATOM   7429  C  CG  . GLU B 2 425 ? 8.284   -11.960 32.247  1.00 53.45 ? 428  GLU B CG  1 
ATOM   7430  C  CD  . GLU B 2 425 ? 9.582   -12.658 31.920  1.00 54.10 ? 428  GLU B CD  1 
ATOM   7431  O  OE1 . GLU B 2 425 ? 10.106  -12.424 30.803  1.00 54.30 ? 428  GLU B OE1 1 
ATOM   7432  O  OE2 . GLU B 2 425 ? 10.083  -13.419 32.786  1.00 54.49 ? 428  GLU B OE2 1 
ATOM   7433  N  N   . VAL B 2 426 ? 8.290   -7.887  33.900  1.00 50.11 ? 429  VAL B N   1 
ATOM   7434  C  CA  . VAL B 2 426 ? 8.787   -6.546  34.131  1.00 48.89 ? 429  VAL B CA  1 
ATOM   7435  C  C   . VAL B 2 426 ? 10.252  -6.607  33.746  1.00 48.17 ? 429  VAL B C   1 
ATOM   7436  O  O   . VAL B 2 426 ? 11.082  -7.121  34.497  1.00 48.19 ? 429  VAL B O   1 
ATOM   7437  C  CB  . VAL B 2 426 ? 8.627   -6.143  35.606  1.00 48.93 ? 429  VAL B CB  1 
ATOM   7438  C  CG1 . VAL B 2 426 ? 9.657   -5.099  35.992  1.00 48.68 ? 429  VAL B CG1 1 
ATOM   7439  C  CG2 . VAL B 2 426 ? 7.225   -5.607  35.836  1.00 48.74 ? 429  VAL B CG2 1 
ATOM   7440  N  N   . ARG B 2 427 ? 10.545  -6.155  32.532  1.00 47.17 ? 430  ARG B N   1 
ATOM   7441  C  CA  . ARG B 2 427 ? 11.906  -6.150  32.012  1.00 46.09 ? 430  ARG B CA  1 
ATOM   7442  C  C   . ARG B 2 427 ? 12.036  -5.170  30.856  1.00 45.31 ? 430  ARG B C   1 
ATOM   7443  O  O   . ARG B 2 427 ? 11.113  -4.408  30.570  1.00 45.24 ? 430  ARG B O   1 
ATOM   7444  C  CB  . ARG B 2 427 ? 12.308  -7.551  31.550  1.00 46.16 ? 430  ARG B CB  1 
ATOM   7445  C  CG  . ARG B 2 427 ? 11.512  -8.108  30.380  1.00 46.09 ? 430  ARG B CG  1 
ATOM   7446  C  CD  . ARG B 2 427 ? 12.101  -9.440  29.961  1.00 46.38 ? 430  ARG B CD  1 
ATOM   7447  N  NE  . ARG B 2 427 ? 11.411  -10.060 28.834  1.00 46.83 ? 430  ARG B NE  1 
ATOM   7448  C  CZ  . ARG B 2 427 ? 11.704  -9.834  27.553  1.00 47.10 ? 430  ARG B CZ  1 
ATOM   7449  N  NH1 . ARG B 2 427 ? 12.671  -8.985  27.220  1.00 47.12 ? 430  ARG B NH1 1 
ATOM   7450  N  NH2 . ARG B 2 427 ? 11.065  -10.501 26.599  1.00 47.12 ? 430  ARG B NH2 1 
ATOM   7451  N  N   . ARG B 2 428 ? 13.196  -5.164  30.212  1.00 44.30 ? 431  ARG B N   1 
ATOM   7452  C  CA  . ARG B 2 428 ? 13.419  -4.275  29.088  1.00 43.38 ? 431  ARG B CA  1 
ATOM   7453  C  C   . ARG B 2 428 ? 13.088  -5.016  27.802  1.00 43.10 ? 431  ARG B C   1 
ATOM   7454  O  O   . ARG B 2 428 ? 13.744  -5.994  27.452  1.00 43.17 ? 431  ARG B O   1 
ATOM   7455  C  CB  . ARG B 2 428 ? 14.864  -3.793  29.077  1.00 42.87 ? 431  ARG B CB  1 
ATOM   7456  C  CG  . ARG B 2 428 ? 15.262  -3.070  30.335  1.00 42.17 ? 431  ARG B CG  1 
ATOM   7457  C  CD  . ARG B 2 428 ? 16.746  -2.776  30.362  1.00 41.85 ? 431  ARG B CD  1 
ATOM   7458  N  NE  . ARG B 2 428 ? 17.159  -2.265  31.663  1.00 41.55 ? 431  ARG B NE  1 
ATOM   7459  C  CZ  . ARG B 2 428 ? 17.003  -1.007  32.066  1.00 41.35 ? 431  ARG B CZ  1 
ATOM   7460  N  NH1 . ARG B 2 428 ? 16.449  -0.105  31.270  1.00 41.14 ? 431  ARG B NH1 1 
ATOM   7461  N  NH2 . ARG B 2 428 ? 17.358  -0.659  33.291  1.00 41.35 ? 431  ARG B NH2 1 
ATOM   7462  N  N   . PHE B 2 429 ? 12.029  -4.581  27.133  1.00 42.63 ? 432  PHE B N   1 
ATOM   7463  C  CA  . PHE B 2 429 ? 11.609  -5.200  25.884  1.00 42.21 ? 432  PHE B CA  1 
ATOM   7464  C  C   . PHE B 2 429 ? 12.195  -4.427  24.710  1.00 42.12 ? 432  PHE B C   1 
ATOM   7465  O  O   . PHE B 2 429 ? 11.995  -3.213  24.592  1.00 42.13 ? 432  PHE B O   1 
ATOM   7466  C  CB  . PHE B 2 429 ? 10.081  -5.239  25.794  1.00 41.87 ? 432  PHE B CB  1 
ATOM   7467  C  CG  . PHE B 2 429 ? 9.442   -6.117  26.826  1.00 41.67 ? 432  PHE B CG  1 
ATOM   7468  C  CD1 . PHE B 2 429 ? 9.254   -7.471  26.583  1.00 41.56 ? 432  PHE B CD1 1 
ATOM   7469  C  CD2 . PHE B 2 429 ? 9.056   -5.602  28.058  1.00 41.56 ? 432  PHE B CD2 1 
ATOM   7470  C  CE1 . PHE B 2 429 ? 8.695   -8.298  27.555  1.00 41.33 ? 432  PHE B CE1 1 
ATOM   7471  C  CE2 . PHE B 2 429 ? 8.497   -6.425  29.036  1.00 41.31 ? 432  PHE B CE2 1 
ATOM   7472  C  CZ  . PHE B 2 429 ? 8.318   -7.773  28.781  1.00 41.31 ? 432  PHE B CZ  1 
ATOM   7473  N  N   . ASN B 2 430 ? 12.926  -5.139  23.854  1.00 41.81 ? 433  ASN B N   1 
ATOM   7474  C  CA  . ASN B 2 430 ? 13.567  -4.550  22.684  1.00 41.62 ? 433  ASN B CA  1 
ATOM   7475  C  C   . ASN B 2 430 ? 12.553  -4.183  21.606  1.00 41.55 ? 433  ASN B C   1 
ATOM   7476  O  O   . ASN B 2 430 ? 11.738  -5.011  21.198  1.00 41.39 ? 433  ASN B O   1 
ATOM   7477  C  CB  . ASN B 2 430 ? 14.611  -5.522  22.118  1.00 41.60 ? 433  ASN B CB  1 
ATOM   7478  C  CG  . ASN B 2 430 ? 15.474  -4.892  21.046  1.00 41.68 ? 433  ASN B CG  1 
ATOM   7479  O  OD1 . ASN B 2 430 ? 15.704  -3.683  21.049  1.00 41.71 ? 433  ASN B OD1 1 
ATOM   7480  N  ND2 . ASN B 2 430 ? 15.960  -5.711  20.122  1.00 41.89 ? 433  ASN B ND2 1 
ATOM   7481  N  N   . THR B 2 431 ? 12.599  -2.932  21.161  1.00 41.43 ? 434  THR B N   1 
ATOM   7482  C  CA  . THR B 2 431 ? 11.688  -2.450  20.126  1.00 41.26 ? 434  THR B CA  1 
ATOM   7483  C  C   . THR B 2 431 ? 12.471  -1.937  18.927  1.00 41.37 ? 434  THR B C   1 
ATOM   7484  O  O   . THR B 2 431 ? 11.915  -1.297  18.032  1.00 41.14 ? 434  THR B O   1 
ATOM   7485  C  CB  . THR B 2 431 ? 10.757  -1.314  20.646  1.00 41.13 ? 434  THR B CB  1 
ATOM   7486  O  OG1 . THR B 2 431 ? 11.544  -0.218  21.124  1.00 40.68 ? 434  THR B OG1 1 
ATOM   7487  C  CG2 . THR B 2 431 ? 9.856   -1.813  21.759  1.00 40.78 ? 434  THR B CG2 1 
ATOM   7488  N  N   . ALA B 2 432 ? 13.766  -2.227  18.908  1.00 41.52 ? 435  ALA B N   1 
ATOM   7489  C  CA  . ALA B 2 432 ? 14.617  -1.785  17.816  1.00 41.88 ? 435  ALA B CA  1 
ATOM   7490  C  C   . ALA B 2 432 ? 14.159  -2.401  16.501  1.00 42.26 ? 435  ALA B C   1 
ATOM   7491  O  O   . ALA B 2 432 ? 14.211  -1.764  15.447  1.00 42.18 ? 435  ALA B O   1 
ATOM   7492  C  CB  . ALA B 2 432 ? 16.058  -2.164  18.096  1.00 41.62 ? 435  ALA B CB  1 
ATOM   7493  N  N   . ASN B 2 433 ? 13.650  -3.626  16.584  1.00 42.79 ? 436  ASN B N   1 
ATOM   7494  C  CA  . ASN B 2 433 ? 13.221  -4.347  15.403  1.00 43.21 ? 436  ASN B CA  1 
ATOM   7495  C  C   . ASN B 2 433 ? 11.757  -4.254  15.019  1.00 43.38 ? 436  ASN B C   1 
ATOM   7496  O  O   . ASN B 2 433 ? 11.291  -5.013  14.170  1.00 43.67 ? 436  ASN B O   1 
ATOM   7497  C  CB  . ASN B 2 433 ? 13.677  -5.795  15.495  1.00 43.43 ? 436  ASN B CB  1 
ATOM   7498  C  CG  . ASN B 2 433 ? 15.176  -5.906  15.659  1.00 43.72 ? 436  ASN B CG  1 
ATOM   7499  O  OD1 . ASN B 2 433 ? 15.939  -5.290  14.909  1.00 43.67 ? 436  ASN B OD1 1 
ATOM   7500  N  ND2 . ASN B 2 433 ? 15.609  -6.655  16.671  1.00 44.00 ? 436  ASN B ND2 1 
ATOM   7501  N  N   . ASP B 2 434 ? 11.024  -3.320  15.619  1.00 43.38 ? 437  ASP B N   1 
ATOM   7502  C  CA  . ASP B 2 434 ? 9.627   -3.142  15.244  1.00 43.29 ? 437  ASP B CA  1 
ATOM   7503  C  C   . ASP B 2 434 ? 9.674   -2.611  13.814  1.00 43.06 ? 437  ASP B C   1 
ATOM   7504  O  O   . ASP B 2 434 ? 10.741  -2.239  13.325  1.00 43.20 ? 437  ASP B O   1 
ATOM   7505  C  CB  . ASP B 2 434 ? 8.927   -2.141  16.172  1.00 43.65 ? 437  ASP B CB  1 
ATOM   7506  C  CG  . ASP B 2 434 ? 8.666   -2.707  17.566  1.00 44.00 ? 437  ASP B CG  1 
ATOM   7507  O  OD1 . ASP B 2 434 ? 7.849   -2.114  18.305  1.00 44.17 ? 437  ASP B OD1 1 
ATOM   7508  O  OD2 . ASP B 2 434 ? 9.270   -3.747  17.925  1.00 44.34 ? 437  ASP B OD2 1 
ATOM   7509  N  N   . ASP B 2 435 ? 8.534   -2.595  13.136  1.00 42.63 ? 438  ASP B N   1 
ATOM   7510  C  CA  . ASP B 2 435 ? 8.470   -2.130  11.756  1.00 42.07 ? 438  ASP B CA  1 
ATOM   7511  C  C   . ASP B 2 435 ? 9.061   -0.736  11.578  1.00 41.86 ? 438  ASP B C   1 
ATOM   7512  O  O   . ASP B 2 435 ? 8.509   0.244   12.065  1.00 41.84 ? 438  ASP B O   1 
ATOM   7513  C  CB  . ASP B 2 435 ? 7.025   -2.138  11.283  1.00 42.07 ? 438  ASP B CB  1 
ATOM   7514  C  CG  . ASP B 2 435 ? 6.905   -1.926  9.805   1.00 42.10 ? 438  ASP B CG  1 
ATOM   7515  O  OD1 . ASP B 2 435 ? 6.459   -2.849  9.103   1.00 42.25 ? 438  ASP B OD1 1 
ATOM   7516  O  OD2 . ASP B 2 435 ? 7.258   -0.832  9.336   1.00 42.54 ? 438  ASP B OD2 1 
ATOM   7517  N  N   . ASN B 2 436 ? 10.157  -0.643  10.833  1.00 41.41 ? 439  ASN B N   1 
ATOM   7518  C  CA  . ASN B 2 436 ? 10.797  0.645   10.613  1.00 41.06 ? 439  ASN B CA  1 
ATOM   7519  C  C   . ASN B 2 436 ? 10.628  1.218   9.212   1.00 40.95 ? 439  ASN B C   1 
ATOM   7520  O  O   . ASN B 2 436 ? 11.023  2.356   8.966   1.00 40.96 ? 439  ASN B O   1 
ATOM   7521  C  CB  . ASN B 2 436 ? 12.291  0.546   10.917  1.00 41.11 ? 439  ASN B CB  1 
ATOM   7522  C  CG  . ASN B 2 436 ? 12.575  0.150   12.351  1.00 41.30 ? 439  ASN B CG  1 
ATOM   7523  O  OD1 . ASN B 2 436 ? 13.511  -0.604  12.620  1.00 41.52 ? 439  ASN B OD1 1 
ATOM   7524  N  ND2 . ASN B 2 436 ? 11.777  0.661   13.283  1.00 41.22 ? 439  ASN B ND2 1 
ATOM   7525  N  N   . VAL B 2 437 ? 9.995   0.476   8.308   1.00 40.67 ? 440  VAL B N   1 
ATOM   7526  C  CA  . VAL B 2 437 ? 9.870   0.951   6.933   1.00 40.43 ? 440  VAL B CA  1 
ATOM   7527  C  C   . VAL B 2 437 ? 8.486   1.125   6.313   1.00 40.41 ? 440  VAL B C   1 
ATOM   7528  O  O   . VAL B 2 437 ? 8.293   2.009   5.484   1.00 40.34 ? 440  VAL B O   1 
ATOM   7529  C  CB  . VAL B 2 437 ? 10.687  0.048   5.983   1.00 40.39 ? 440  VAL B CB  1 
ATOM   7530  C  CG1 . VAL B 2 437 ? 12.164  0.096   6.338   1.00 40.07 ? 440  VAL B CG1 1 
ATOM   7531  C  CG2 . VAL B 2 437 ? 10.178  -1.380  6.062   1.00 40.25 ? 440  VAL B CG2 1 
ATOM   7532  N  N   . THR B 2 438 ? 7.536   0.282   6.697   1.00 40.35 ? 441  THR B N   1 
ATOM   7533  C  CA  . THR B 2 438 ? 6.188   0.314   6.129   1.00 40.26 ? 441  THR B CA  1 
ATOM   7534  C  C   . THR B 2 438 ? 5.501   1.670   5.973   1.00 40.29 ? 441  THR B C   1 
ATOM   7535  O  O   . THR B 2 438 ? 5.179   2.067   4.856   1.00 40.31 ? 441  THR B O   1 
ATOM   7536  C  CB  . THR B 2 438 ? 5.260   -0.677  6.851   1.00 40.31 ? 441  THR B CB  1 
ATOM   7537  O  OG1 . THR B 2 438 ? 5.831   -1.989  6.780   1.00 40.06 ? 441  THR B OG1 1 
ATOM   7538  C  CG2 . THR B 2 438 ? 3.891   -0.708  6.197   1.00 40.24 ? 441  THR B CG2 1 
ATOM   7539  N  N   . GLN B 2 439 ? 5.255   2.380   7.065   1.00 40.11 ? 442  GLN B N   1 
ATOM   7540  C  CA  . GLN B 2 439 ? 4.604   3.680   6.944   1.00 40.04 ? 442  GLN B CA  1 
ATOM   7541  C  C   . GLN B 2 439 ? 5.460   4.706   6.208   1.00 40.08 ? 442  GLN B C   1 
ATOM   7542  O  O   . GLN B 2 439 ? 4.931   5.635   5.607   1.00 40.04 ? 442  GLN B O   1 
ATOM   7543  C  CB  . GLN B 2 439 ? 4.219   4.233   8.311   1.00 40.07 ? 442  GLN B CB  1 
ATOM   7544  C  CG  . GLN B 2 439 ? 3.158   3.438   9.021   1.00 40.07 ? 442  GLN B CG  1 
ATOM   7545  C  CD  . GLN B 2 439 ? 2.482   4.246   10.096  1.00 40.25 ? 442  GLN B CD  1 
ATOM   7546  O  OE1 . GLN B 2 439 ? 3.020   5.246   10.567  1.00 40.37 ? 442  GLN B OE1 1 
ATOM   7547  N  NE2 . GLN B 2 439 ? 1.282   3.834   10.478  1.00 40.51 ? 442  GLN B NE2 1 
ATOM   7548  N  N   . VAL B 2 440 ? 6.777   4.534   6.254   1.00 40.00 ? 443  VAL B N   1 
ATOM   7549  C  CA  . VAL B 2 440 ? 7.696   5.453   5.591   1.00 39.95 ? 443  VAL B CA  1 
ATOM   7550  C  C   . VAL B 2 440 ? 7.573   5.314   4.086   1.00 40.21 ? 443  VAL B C   1 
ATOM   7551  O  O   . VAL B 2 440 ? 7.630   6.302   3.352   1.00 40.23 ? 443  VAL B O   1 
ATOM   7552  C  CB  . VAL B 2 440 ? 9.153   5.179   5.979   1.00 39.79 ? 443  VAL B CB  1 
ATOM   7553  C  CG1 . VAL B 2 440 ? 10.049  6.295   5.475   1.00 39.41 ? 443  VAL B CG1 1 
ATOM   7554  C  CG2 . VAL B 2 440 ? 9.272   5.024   7.473   1.00 39.59 ? 443  VAL B CG2 1 
ATOM   7555  N  N   . ARG B 2 441 ? 7.439   4.076   3.631   1.00 40.33 ? 444  ARG B N   1 
ATOM   7556  C  CA  . ARG B 2 441 ? 7.292   3.796   2.214   1.00 40.63 ? 444  ARG B CA  1 
ATOM   7557  C  C   . ARG B 2 441 ? 6.019   4.476   1.711   1.00 40.85 ? 444  ARG B C   1 
ATOM   7558  O  O   . ARG B 2 441 ? 6.026   5.129   0.667   1.00 40.91 ? 444  ARG B O   1 
ATOM   7559  C  CB  . ARG B 2 441 ? 7.210   2.288   1.989   1.00 40.71 ? 444  ARG B CB  1 
ATOM   7560  C  CG  . ARG B 2 441 ? 7.105   1.864   0.537   1.00 40.80 ? 444  ARG B CG  1 
ATOM   7561  C  CD  . ARG B 2 441 ? 7.040   0.348   0.422   1.00 41.07 ? 444  ARG B CD  1 
ATOM   7562  N  NE  . ARG B 2 441 ? 8.262   -0.292  0.916   1.00 41.38 ? 444  ARG B NE  1 
ATOM   7563  C  CZ  . ARG B 2 441 ? 8.298   -1.259  1.831   1.00 41.38 ? 444  ARG B CZ  1 
ATOM   7564  N  NH1 . ARG B 2 441 ? 9.463   -1.761  2.209   1.00 41.28 ? 444  ARG B NH1 1 
ATOM   7565  N  NH2 . ARG B 2 441 ? 7.177   -1.720  2.375   1.00 41.44 ? 444  ARG B NH2 1 
ATOM   7566  N  N   . ALA B 2 442 ? 4.938   4.355   2.478   1.00 40.90 ? 445  ALA B N   1 
ATOM   7567  C  CA  . ALA B 2 442 ? 3.670   4.963   2.105   1.00 40.97 ? 445  ALA B CA  1 
ATOM   7568  C  C   . ALA B 2 442 ? 3.831   6.473   2.046   1.00 41.11 ? 445  ALA B C   1 
ATOM   7569  O  O   . ALA B 2 442 ? 3.281   7.130   1.169   1.00 41.22 ? 445  ALA B O   1 
ATOM   7570  C  CB  . ALA B 2 442 ? 2.580   4.579   3.101   1.00 40.91 ? 445  ALA B CB  1 
ATOM   7571  N  N   . PHE B 2 443 ? 4.594   7.025   2.979   1.00 41.13 ? 446  PHE B N   1 
ATOM   7572  C  CA  . PHE B 2 443 ? 4.825   8.458   2.999   1.00 41.19 ? 446  PHE B CA  1 
ATOM   7573  C  C   . PHE B 2 443 ? 5.542   8.863   1.719   1.00 41.34 ? 446  PHE B C   1 
ATOM   7574  O  O   . PHE B 2 443 ? 5.094   9.762   1.008   1.00 41.22 ? 446  PHE B O   1 
ATOM   7575  C  CB  . PHE B 2 443 ? 5.670   8.842   4.215   1.00 41.17 ? 446  PHE B CB  1 
ATOM   7576  C  CG  . PHE B 2 443 ? 6.130   10.273  4.205   1.00 41.13 ? 446  PHE B CG  1 
ATOM   7577  C  CD1 . PHE B 2 443 ? 5.263   11.298  4.549   1.00 41.05 ? 446  PHE B CD1 1 
ATOM   7578  C  CD2 . PHE B 2 443 ? 7.429   10.596  3.827   1.00 41.06 ? 446  PHE B CD2 1 
ATOM   7579  C  CE1 . PHE B 2 443 ? 5.685   12.624  4.512   1.00 41.11 ? 446  PHE B CE1 1 
ATOM   7580  C  CE2 . PHE B 2 443 ? 7.855   11.914  3.790   1.00 40.87 ? 446  PHE B CE2 1 
ATOM   7581  C  CZ  . PHE B 2 443 ? 6.984   12.928  4.131   1.00 41.06 ? 446  PHE B CZ  1 
ATOM   7582  N  N   . TYR B 2 444 ? 6.643   8.177   1.426   1.00 41.53 ? 447  TYR B N   1 
ATOM   7583  C  CA  . TYR B 2 444 ? 7.447   8.451   0.240   1.00 41.74 ? 447  TYR B CA  1 
ATOM   7584  C  C   . TYR B 2 444 ? 6.663   8.295   -1.065  1.00 42.00 ? 447  TYR B C   1 
ATOM   7585  O  O   . TYR B 2 444 ? 6.812   9.094   -1.989  1.00 41.74 ? 447  TYR B O   1 
ATOM   7586  C  CB  . TYR B 2 444 ? 8.673   7.526   0.218   1.00 41.68 ? 447  TYR B CB  1 
ATOM   7587  C  CG  . TYR B 2 444 ? 9.609   7.768   -0.949  1.00 41.79 ? 447  TYR B CG  1 
ATOM   7588  C  CD1 . TYR B 2 444 ? 9.592   6.937   -2.068  1.00 41.82 ? 447  TYR B CD1 1 
ATOM   7589  C  CD2 . TYR B 2 444 ? 10.492  8.843   -0.946  1.00 41.77 ? 447  TYR B CD2 1 
ATOM   7590  C  CE1 . TYR B 2 444 ? 10.430  7.176   -3.155  1.00 42.00 ? 447  TYR B CE1 1 
ATOM   7591  C  CE2 . TYR B 2 444 ? 11.332  9.090   -2.024  1.00 41.91 ? 447  TYR B CE2 1 
ATOM   7592  C  CZ  . TYR B 2 444 ? 11.298  8.257   -3.126  1.00 42.14 ? 447  TYR B CZ  1 
ATOM   7593  O  OH  . TYR B 2 444 ? 12.125  8.507   -4.202  1.00 42.26 ? 447  TYR B OH  1 
ATOM   7594  N  N   . VAL B 2 445 ? 5.807   7.283   -1.119  1.00 42.36 ? 448  VAL B N   1 
ATOM   7595  C  CA  . VAL B 2 445 ? 5.027   7.005   -2.316  1.00 42.84 ? 448  VAL B CA  1 
ATOM   7596  C  C   . VAL B 2 445 ? 3.722   7.786   -2.475  1.00 43.38 ? 448  VAL B C   1 
ATOM   7597  O  O   . VAL B 2 445 ? 3.481   8.387   -3.520  1.00 43.38 ? 448  VAL B O   1 
ATOM   7598  C  CB  . VAL B 2 445 ? 4.732   5.497   -2.433  1.00 42.72 ? 448  VAL B CB  1 
ATOM   7599  C  CG1 . VAL B 2 445 ? 3.959   5.206   -3.704  1.00 42.71 ? 448  VAL B CG1 1 
ATOM   7600  C  CG2 . VAL B 2 445 ? 6.030   4.716   -2.424  1.00 42.75 ? 448  VAL B CG2 1 
ATOM   7601  N  N   . ASN B 2 446 ? 2.889   7.791   -1.441  1.00 43.89 ? 449  ASN B N   1 
ATOM   7602  C  CA  . ASN B 2 446 ? 1.600   8.470   -1.513  1.00 44.39 ? 449  ASN B CA  1 
ATOM   7603  C  C   . ASN B 2 446 ? 1.551   9.891   -1.003  1.00 44.46 ? 449  ASN B C   1 
ATOM   7604  O  O   . ASN B 2 446 ? 0.942   10.749  -1.639  1.00 44.57 ? 449  ASN B O   1 
ATOM   7605  C  CB  . ASN B 2 446 ? 0.529   7.651   -0.798  1.00 45.20 ? 449  ASN B CB  1 
ATOM   7606  C  CG  . ASN B 2 446 ? 0.513   6.210   -1.253  1.00 46.08 ? 449  ASN B CG  1 
ATOM   7607  O  OD1 . ASN B 2 446 ? 0.674   5.284   -0.445  1.00 46.79 ? 449  ASN B OD1 1 
ATOM   7608  N  ND2 . ASN B 2 446 ? 0.357   6.005   -2.562  1.00 46.53 ? 449  ASN B ND2 1 
ATOM   7609  N  N   . VAL B 2 447 ? 2.161   10.144  0.148   1.00 44.23 ? 450  VAL B N   1 
ATOM   7610  C  CA  . VAL B 2 447 ? 2.127   11.482  0.713   1.00 44.10 ? 450  VAL B CA  1 
ATOM   7611  C  C   . VAL B 2 447 ? 2.892   12.501  -0.121  1.00 44.15 ? 450  VAL B C   1 
ATOM   7612  O  O   . VAL B 2 447 ? 2.554   13.685  -0.136  1.00 44.16 ? 450  VAL B O   1 
ATOM   7613  C  CB  . VAL B 2 447 ? 2.614   11.494  2.168   1.00 44.10 ? 450  VAL B CB  1 
ATOM   7614  C  CG1 . VAL B 2 447 ? 2.555   12.905  2.727   1.00 43.86 ? 450  VAL B CG1 1 
ATOM   7615  C  CG2 . VAL B 2 447 ? 1.755   10.554  3.011   1.00 43.88 ? 450  VAL B CG2 1 
ATOM   7616  N  N   . LEU B 2 448 ? 3.909   12.039  -0.833  1.00 44.10 ? 451  LEU B N   1 
ATOM   7617  C  CA  . LEU B 2 448 ? 4.691   12.928  -1.676  1.00 44.13 ? 451  LEU B CA  1 
ATOM   7618  C  C   . LEU B 2 448 ? 4.444   12.658  -3.159  1.00 44.33 ? 451  LEU B C   1 
ATOM   7619  O  O   . LEU B 2 448 ? 3.946   11.595  -3.541  1.00 44.25 ? 451  LEU B O   1 
ATOM   7620  C  CB  . LEU B 2 448 ? 6.181   12.761  -1.383  1.00 43.82 ? 451  LEU B CB  1 
ATOM   7621  C  CG  . LEU B 2 448 ? 6.667   12.974  0.047   1.00 43.67 ? 451  LEU B CG  1 
ATOM   7622  C  CD1 . LEU B 2 448 ? 8.174   12.776  0.094   1.00 43.52 ? 451  LEU B CD1 1 
ATOM   7623  C  CD2 . LEU B 2 448 ? 6.291   14.361  0.531   1.00 43.47 ? 451  LEU B CD2 1 
ATOM   7624  N  N   . ASN B 2 449 ? 4.740   13.655  -3.986  1.00 44.60 ? 452  ASN B N   1 
ATOM   7625  C  CA  . ASN B 2 449 ? 4.615   13.519  -5.428  1.00 44.85 ? 452  ASN B CA  1 
ATOM   7626  C  C   . ASN B 2 449 ? 6.037   13.491  -5.988  1.00 45.31 ? 452  ASN B C   1 
ATOM   7627  O  O   . ASN B 2 449 ? 6.997   13.688  -5.241  1.00 45.37 ? 452  ASN B O   1 
ATOM   7628  C  CB  . ASN B 2 449 ? 3.785   14.656  -6.035  1.00 44.42 ? 452  ASN B CB  1 
ATOM   7629  C  CG  . ASN B 2 449 ? 4.342   16.032  -5.732  1.00 44.21 ? 452  ASN B CG  1 
ATOM   7630  O  OD1 . ASN B 2 449 ? 5.554   16.239  -5.700  1.00 44.21 ? 452  ASN B OD1 1 
ATOM   7631  N  ND2 . ASN B 2 449 ? 3.450   16.995  -5.542  1.00 44.16 ? 452  ASN B ND2 1 
ATOM   7632  N  N   . GLU B 2 450 ? 6.177   13.259  -7.287  1.00 45.88 ? 453  GLU B N   1 
ATOM   7633  C  CA  . GLU B 2 450 ? 7.494   13.182  -7.912  1.00 46.51 ? 453  GLU B CA  1 
ATOM   7634  C  C   . GLU B 2 450 ? 8.388   14.375  -7.610  1.00 46.40 ? 453  GLU B C   1 
ATOM   7635  O  O   . GLU B 2 450 ? 9.579   14.223  -7.357  1.00 46.48 ? 453  GLU B O   1 
ATOM   7636  C  CB  . GLU B 2 450 ? 7.352   13.030  -9.417  1.00 47.42 ? 453  GLU B CB  1 
ATOM   7637  C  CG  . GLU B 2 450 ? 8.580   12.432  -10.079 1.00 49.11 ? 453  GLU B CG  1 
ATOM   7638  C  CD  . GLU B 2 450 ? 8.523   12.518  -11.600 1.00 50.23 ? 453  GLU B CD  1 
ATOM   7639  O  OE1 . GLU B 2 450 ? 7.515   12.054  -12.193 1.00 50.86 ? 453  GLU B OE1 1 
ATOM   7640  O  OE2 . GLU B 2 450 ? 9.484   13.061  -12.205 1.00 50.76 ? 453  GLU B OE2 1 
ATOM   7641  N  N   . GLU B 2 451 ? 7.800   15.560  -7.645  1.00 46.26 ? 454  GLU B N   1 
ATOM   7642  C  CA  . GLU B 2 451 ? 8.502   16.811  -7.383  1.00 46.12 ? 454  GLU B CA  1 
ATOM   7643  C  C   . GLU B 2 451 ? 9.023   16.895  -5.940  1.00 45.67 ? 454  GLU B C   1 
ATOM   7644  O  O   . GLU B 2 451 ? 10.140  17.359  -5.695  1.00 45.48 ? 454  GLU B O   1 
ATOM   7645  C  CB  . GLU B 2 451 ? 7.525   17.941  -7.662  1.00 46.77 ? 454  GLU B CB  1 
ATOM   7646  C  CG  . GLU B 2 451 ? 8.040   19.328  -7.458  1.00 47.69 ? 454  GLU B CG  1 
ATOM   7647  C  CD  . GLU B 2 451 ? 6.908   20.332  -7.410  1.00 48.31 ? 454  GLU B CD  1 
ATOM   7648  O  OE1 . GLU B 2 451 ? 7.135   21.451  -6.895  1.00 48.68 ? 454  GLU B OE1 1 
ATOM   7649  O  OE2 . GLU B 2 451 ? 5.787   19.997  -7.872  1.00 48.69 ? 454  GLU B OE2 1 
ATOM   7650  N  N   . GLN B 2 452 ? 8.206   16.443  -4.993  1.00 45.17 ? 455  GLN B N   1 
ATOM   7651  C  CA  . GLN B 2 452 ? 8.573   16.454  -3.583  1.00 44.80 ? 455  GLN B CA  1 
ATOM   7652  C  C   . GLN B 2 452 ? 9.634   15.419  -3.242  1.00 44.63 ? 455  GLN B C   1 
ATOM   7653  O  O   . GLN B 2 452 ? 10.492  15.673  -2.399  1.00 44.60 ? 455  GLN B O   1 
ATOM   7654  C  CB  . GLN B 2 452 ? 7.337   16.247  -2.715  1.00 44.63 ? 455  GLN B CB  1 
ATOM   7655  C  CG  . GLN B 2 452 ? 6.369   17.405  -2.793  1.00 44.72 ? 455  GLN B CG  1 
ATOM   7656  C  CD  . GLN B 2 452 ? 5.053   17.124  -2.106  1.00 44.81 ? 455  GLN B CD  1 
ATOM   7657  O  OE1 . GLN B 2 452 ? 4.518   16.017  -2.180  1.00 44.86 ? 455  GLN B OE1 1 
ATOM   7658  N  NE2 . GLN B 2 452 ? 4.515   18.132  -1.439  1.00 44.98 ? 455  GLN B NE2 1 
ATOM   7659  N  N   . ARG B 2 453 ? 9.573   14.252  -3.883  1.00 44.37 ? 456  ARG B N   1 
ATOM   7660  C  CA  . ARG B 2 453 ? 10.558  13.195  -3.648  1.00 44.15 ? 456  ARG B CA  1 
ATOM   7661  C  C   . ARG B 2 453 ? 11.921  13.637  -4.148  1.00 43.96 ? 456  ARG B C   1 
ATOM   7662  O  O   . ARG B 2 453 ? 12.951  13.244  -3.603  1.00 43.94 ? 456  ARG B O   1 
ATOM   7663  C  CB  . ARG B 2 453 ? 10.173  11.909  -4.369  1.00 44.28 ? 456  ARG B CB  1 
ATOM   7664  C  CG  . ARG B 2 453 ? 8.880   11.300  -3.917  1.00 44.64 ? 456  ARG B CG  1 
ATOM   7665  C  CD  . ARG B 2 453 ? 8.533   10.118  -4.794  1.00 45.21 ? 456  ARG B CD  1 
ATOM   7666  N  NE  . ARG B 2 453 ? 7.112   9.803   -4.715  1.00 45.88 ? 456  ARG B NE  1 
ATOM   7667  C  CZ  . ARG B 2 453 ? 6.293   9.794   -5.758  1.00 46.12 ? 456  ARG B CZ  1 
ATOM   7668  N  NH1 . ARG B 2 453 ? 6.753   10.081  -6.967  1.00 46.37 ? 456  ARG B NH1 1 
ATOM   7669  N  NH2 . ARG B 2 453 ? 5.010   9.510   -5.593  1.00 46.54 ? 456  ARG B NH2 1 
ATOM   7670  N  N   . LYS B 2 454 ? 11.924  14.440  -5.205  1.00 43.76 ? 457  LYS B N   1 
ATOM   7671  C  CA  . LYS B 2 454 ? 13.164  14.937  -5.766  1.00 43.58 ? 457  LYS B CA  1 
ATOM   7672  C  C   . LYS B 2 454 ? 13.858  15.848  -4.765  1.00 43.05 ? 457  LYS B C   1 
ATOM   7673  O  O   . LYS B 2 454 ? 15.046  15.691  -4.510  1.00 43.00 ? 457  LYS B O   1 
ATOM   7674  C  CB  . LYS B 2 454 ? 12.905  15.683  -7.071  1.00 44.15 ? 457  LYS B CB  1 
ATOM   7675  C  CG  . LYS B 2 454 ? 14.162  16.252  -7.715  1.00 44.96 ? 457  LYS B CG  1 
ATOM   7676  C  CD  . LYS B 2 454 ? 13.858  16.806  -9.099  1.00 45.88 ? 457  LYS B CD  1 
ATOM   7677  C  CE  . LYS B 2 454 ? 15.121  17.295  -9.806  1.00 46.40 ? 457  LYS B CE  1 
ATOM   7678  N  NZ  . LYS B 2 454 ? 15.696  18.530  -9.179  1.00 47.02 ? 457  LYS B NZ  1 
ATOM   7679  N  N   . ARG B 2 455 ? 13.120  16.797  -4.195  1.00 42.41 ? 458  ARG B N   1 
ATOM   7680  C  CA  . ARG B 2 455 ? 13.696  17.712  -3.215  1.00 41.86 ? 458  ARG B CA  1 
ATOM   7681  C  C   . ARG B 2 455 ? 14.139  16.975  -1.955  1.00 41.64 ? 458  ARG B C   1 
ATOM   7682  O  O   . ARG B 2 455 ? 15.214  17.233  -1.418  1.00 41.52 ? 458  ARG B O   1 
ATOM   7683  C  CB  . ARG B 2 455 ? 12.705  18.815  -2.860  1.00 41.76 ? 458  ARG B CB  1 
ATOM   7684  C  CG  . ARG B 2 455 ? 12.630  19.926  -3.893  1.00 41.56 ? 458  ARG B CG  1 
ATOM   7685  C  CD  . ARG B 2 455 ? 11.797  21.080  -3.381  1.00 41.38 ? 458  ARG B CD  1 
ATOM   7686  N  NE  . ARG B 2 455 ? 10.425  20.658  -3.145  1.00 41.60 ? 458  ARG B NE  1 
ATOM   7687  C  CZ  . ARG B 2 455 ? 9.411   20.956  -3.945  1.00 41.61 ? 458  ARG B CZ  1 
ATOM   7688  N  NH1 . ARG B 2 455 ? 9.617   21.689  -5.027  1.00 41.96 ? 458  ARG B NH1 1 
ATOM   7689  N  NH2 . ARG B 2 455 ? 8.200   20.484  -3.690  1.00 41.45 ? 458  ARG B NH2 1 
ATOM   7690  N  N   . LEU B 2 456 ? 13.310  16.038  -1.505  1.00 41.33 ? 459  LEU B N   1 
ATOM   7691  C  CA  . LEU B 2 456 ? 13.603  15.234  -0.328  1.00 40.95 ? 459  LEU B CA  1 
ATOM   7692  C  C   . LEU B 2 456 ? 14.981  14.595  -0.453  1.00 40.97 ? 459  LEU B C   1 
ATOM   7693  O  O   . LEU B 2 456 ? 15.827  14.758  0.425   1.00 41.08 ? 459  LEU B O   1 
ATOM   7694  C  CB  . LEU B 2 456 ? 12.538  14.153  -0.162  1.00 40.34 ? 459  LEU B CB  1 
ATOM   7695  C  CG  . LEU B 2 456 ? 12.830  13.051  0.847   1.00 40.08 ? 459  LEU B CG  1 
ATOM   7696  C  CD1 . LEU B 2 456 ? 13.002  13.627  2.231   1.00 39.90 ? 459  LEU B CD1 1 
ATOM   7697  C  CD2 . LEU B 2 456 ? 11.703  12.043  0.825   1.00 40.10 ? 459  LEU B CD2 1 
ATOM   7698  N  N   . CYS B 2 457 ? 15.216  13.905  -1.564  1.00 40.91 ? 460  CYS B N   1 
ATOM   7699  C  CA  . CYS B 2 457 ? 16.493  13.248  -1.803  1.00 40.93 ? 460  CYS B CA  1 
ATOM   7700  C  C   . CYS B 2 457 ? 17.666  14.221  -1.864  1.00 40.88 ? 460  CYS B C   1 
ATOM   7701  O  O   . CYS B 2 457 ? 18.746  13.925  -1.352  1.00 40.92 ? 460  CYS B O   1 
ATOM   7702  C  CB  . CYS B 2 457 ? 16.431  12.420  -3.084  1.00 41.04 ? 460  CYS B CB  1 
ATOM   7703  S  SG  . CYS B 2 457 ? 15.360  10.975  -2.963  1.00 41.93 ? 460  CYS B SG  1 
ATOM   7704  N  N   . GLU B 2 458 ? 17.454  15.382  -2.477  1.00 40.80 ? 461  GLU B N   1 
ATOM   7705  C  CA  . GLU B 2 458 ? 18.508  16.394  -2.581  1.00 40.73 ? 461  GLU B CA  1 
ATOM   7706  C  C   . GLU B 2 458 ? 18.887  16.965  -1.216  1.00 40.47 ? 461  GLU B C   1 
ATOM   7707  O  O   . GLU B 2 458 ? 20.070  17.146  -0.912  1.00 40.31 ? 461  GLU B O   1 
ATOM   7708  C  CB  . GLU B 2 458 ? 18.075  17.512  -3.528  1.00 40.95 ? 461  GLU B CB  1 
ATOM   7709  C  CG  . GLU B 2 458 ? 18.033  17.055  -4.970  1.00 41.47 ? 461  GLU B CG  1 
ATOM   7710  C  CD  . GLU B 2 458 ? 17.209  17.954  -5.867  1.00 41.98 ? 461  GLU B CD  1 
ATOM   7711  O  OE1 . GLU B 2 458 ? 16.425  18.777  -5.350  1.00 42.09 ? 461  GLU B OE1 1 
ATOM   7712  O  OE2 . GLU B 2 458 ? 17.332  17.819  -7.106  1.00 42.50 ? 461  GLU B OE2 1 
ATOM   7713  N  N   . ASN B 2 459 ? 17.874  17.215  -0.389  1.00 40.05 ? 462  ASN B N   1 
ATOM   7714  C  CA  . ASN B 2 459 ? 18.080  17.746  0.955   1.00 39.61 ? 462  ASN B CA  1 
ATOM   7715  C  C   . ASN B 2 459 ? 18.854  16.749  1.807   1.00 39.53 ? 462  ASN B C   1 
ATOM   7716  O  O   . ASN B 2 459 ? 19.776  17.119  2.528   1.00 39.37 ? 462  ASN B O   1 
ATOM   7717  C  CB  . ASN B 2 459 ? 16.734  18.070  1.608   1.00 39.31 ? 462  ASN B CB  1 
ATOM   7718  C  CG  . ASN B 2 459 ? 15.971  19.144  0.860   1.00 39.06 ? 462  ASN B CG  1 
ATOM   7719  O  OD1 . ASN B 2 459 ? 16.562  19.980  0.176   1.00 39.05 ? 462  ASN B OD1 1 
ATOM   7720  N  ND2 . ASN B 2 459 ? 14.650  19.120  0.975   1.00 39.00 ? 462  ASN B ND2 1 
ATOM   7721  N  N   . ILE B 2 460 ? 18.486  15.476  1.702   1.00 39.16 ? 463  ILE B N   1 
ATOM   7722  C  CA  . ILE B 2 460 ? 19.160  14.430  2.452   1.00 38.86 ? 463  ILE B CA  1 
ATOM   7723  C  C   . ILE B 2 460 ? 20.594  14.254  1.966   1.00 39.10 ? 463  ILE B C   1 
ATOM   7724  O  O   . ILE B 2 460 ? 21.524  14.178  2.771   1.00 39.12 ? 463  ILE B O   1 
ATOM   7725  C  CB  . ILE B 2 460 ? 18.436  13.094  2.311   1.00 38.47 ? 463  ILE B CB  1 
ATOM   7726  C  CG1 . ILE B 2 460 ? 17.056  13.179  2.950   1.00 38.19 ? 463  ILE B CG1 1 
ATOM   7727  C  CG2 . ILE B 2 460 ? 19.247  11.990  2.951   1.00 38.28 ? 463  ILE B CG2 1 
ATOM   7728  C  CD1 . ILE B 2 460 ? 16.215  11.948  2.744   1.00 38.08 ? 463  ILE B CD1 1 
ATOM   7729  N  N   . ALA B 2 461 ? 20.771  14.184  0.649   1.00 39.20 ? 464  ALA B N   1 
ATOM   7730  C  CA  . ALA B 2 461 ? 22.099  14.008  0.077   1.00 39.21 ? 464  ALA B CA  1 
ATOM   7731  C  C   . ALA B 2 461 ? 22.956  15.230  0.348   1.00 39.33 ? 464  ALA B C   1 
ATOM   7732  O  O   . ALA B 2 461 ? 24.160  15.112  0.578   1.00 39.29 ? 464  ALA B O   1 
ATOM   7733  C  CB  . ALA B 2 461 ? 22.002  13.757  -1.419  1.00 39.32 ? 464  ALA B CB  1 
ATOM   7734  N  N   . GLY B 2 462 ? 22.323  16.401  0.341   1.00 39.36 ? 465  GLY B N   1 
ATOM   7735  C  CA  . GLY B 2 462 ? 23.036  17.642  0.581   1.00 39.37 ? 465  GLY B CA  1 
ATOM   7736  C  C   . GLY B 2 462 ? 23.737  17.702  1.923   1.00 39.44 ? 465  GLY B C   1 
ATOM   7737  O  O   . GLY B 2 462 ? 24.804  18.300  2.038   1.00 39.57 ? 465  GLY B O   1 
ATOM   7738  N  N   . HIS B 2 463 ? 23.139  17.081  2.936   1.00 39.36 ? 466  HIS B N   1 
ATOM   7739  C  CA  . HIS B 2 463 ? 23.709  17.064  4.274   1.00 39.14 ? 466  HIS B CA  1 
ATOM   7740  C  C   . HIS B 2 463 ? 24.514  15.793  4.519   1.00 39.15 ? 466  HIS B C   1 
ATOM   7741  O  O   . HIS B 2 463 ? 25.599  15.838  5.100   1.00 39.15 ? 466  HIS B O   1 
ATOM   7742  C  CB  . HIS B 2 463 ? 22.597  17.189  5.315   1.00 39.11 ? 466  HIS B CB  1 
ATOM   7743  C  CG  . HIS B 2 463 ? 23.096  17.293  6.722   1.00 39.33 ? 466  HIS B CG  1 
ATOM   7744  N  ND1 . HIS B 2 463 ? 23.196  16.203  7.560   1.00 39.30 ? 466  HIS B ND1 1 
ATOM   7745  C  CD2 . HIS B 2 463 ? 23.550  18.355  7.430   1.00 39.31 ? 466  HIS B CD2 1 
ATOM   7746  C  CE1 . HIS B 2 463 ? 23.695  16.588  8.722   1.00 39.23 ? 466  HIS B CE1 1 
ATOM   7747  N  NE2 . HIS B 2 463 ? 23.918  17.888  8.669   1.00 39.30 ? 466  HIS B NE2 1 
ATOM   7748  N  N   . LEU B 2 464 ? 23.987  14.664  4.056   1.00 39.10 ? 467  LEU B N   1 
ATOM   7749  C  CA  . LEU B 2 464 ? 24.633  13.366  4.229   1.00 39.00 ? 467  LEU B CA  1 
ATOM   7750  C  C   . LEU B 2 464 ? 25.979  13.223  3.519   1.00 39.21 ? 467  LEU B C   1 
ATOM   7751  O  O   . LEU B 2 464 ? 26.795  12.389  3.908   1.00 39.19 ? 467  LEU B O   1 
ATOM   7752  C  CB  . LEU B 2 464 ? 23.687  12.255  3.771   1.00 38.65 ? 467  LEU B CB  1 
ATOM   7753  C  CG  . LEU B 2 464 ? 24.202  10.815  3.776   1.00 38.47 ? 467  LEU B CG  1 
ATOM   7754  C  CD1 . LEU B 2 464 ? 24.634  10.384  5.164   1.00 38.24 ? 467  LEU B CD1 1 
ATOM   7755  C  CD2 . LEU B 2 464 ? 23.115  9.903   3.247   1.00 38.30 ? 467  LEU B CD2 1 
ATOM   7756  N  N   . LYS B 2 465 ? 26.216  14.042  2.499   1.00 39.26 ? 468  LYS B N   1 
ATOM   7757  C  CA  . LYS B 2 465 ? 27.460  13.980  1.740   1.00 39.43 ? 468  LYS B CA  1 
ATOM   7758  C  C   . LYS B 2 465 ? 28.715  14.180  2.573   1.00 39.57 ? 468  LYS B C   1 
ATOM   7759  O  O   . LYS B 2 465 ? 29.781  13.669  2.223   1.00 39.53 ? 468  LYS B O   1 
ATOM   7760  C  CB  . LYS B 2 465 ? 27.450  15.005  0.613   1.00 39.43 ? 468  LYS B CB  1 
ATOM   7761  C  CG  . LYS B 2 465 ? 27.358  16.432  1.077   1.00 39.58 ? 468  LYS B CG  1 
ATOM   7762  C  CD  . LYS B 2 465 ? 27.951  17.339  0.031   1.00 40.18 ? 468  LYS B CD  1 
ATOM   7763  C  CE  . LYS B 2 465 ? 27.556  18.787  0.238   1.00 40.64 ? 468  LYS B CE  1 
ATOM   7764  N  NZ  . LYS B 2 465 ? 27.985  19.296  1.561   1.00 41.02 ? 468  LYS B NZ  1 
ATOM   7765  N  N   . ASP B 2 466 ? 28.589  14.922  3.673   1.00 39.72 ? 469  ASP B N   1 
ATOM   7766  C  CA  . ASP B 2 466 ? 29.726  15.200  4.549   1.00 39.81 ? 469  ASP B CA  1 
ATOM   7767  C  C   . ASP B 2 466 ? 30.039  14.156  5.611   1.00 39.85 ? 469  ASP B C   1 
ATOM   7768  O  O   . ASP B 2 466 ? 30.946  14.341  6.426   1.00 39.96 ? 469  ASP B O   1 
ATOM   7769  C  CB  . ASP B 2 466 ? 29.589  16.575  5.178   1.00 39.60 ? 469  ASP B CB  1 
ATOM   7770  C  CG  . ASP B 2 466 ? 29.739  17.668  4.173   1.00 39.50 ? 469  ASP B CG  1 
ATOM   7771  O  OD1 . ASP B 2 466 ? 28.847  18.531  4.107   1.00 39.61 ? 469  ASP B OD1 1 
ATOM   7772  O  OD2 . ASP B 2 466 ? 30.746  17.649  3.433   1.00 39.54 ? 469  ASP B OD2 1 
ATOM   7773  N  N   . ALA B 2 467 ? 29.267  13.077  5.627   1.00 39.90 ? 470  ALA B N   1 
ATOM   7774  C  CA  . ALA B 2 467 ? 29.511  11.990  6.559   1.00 40.06 ? 470  ALA B CA  1 
ATOM   7775  C  C   . ALA B 2 467 ? 30.469  11.040  5.837   1.00 40.31 ? 470  ALA B C   1 
ATOM   7776  O  O   . ALA B 2 467 ? 30.595  11.096  4.610   1.00 40.17 ? 470  ALA B O   1 
ATOM   7777  C  CB  . ALA B 2 467 ? 28.210  11.284  6.894   1.00 39.80 ? 470  ALA B CB  1 
ATOM   7778  N  N   . GLN B 2 468 ? 31.179  10.200  6.586   1.00 40.57 ? 471  GLN B N   1 
ATOM   7779  C  CA  . GLN B 2 468 ? 32.106  9.254   5.964   1.00 40.84 ? 471  GLN B CA  1 
ATOM   7780  C  C   . GLN B 2 468 ? 31.346  8.277   5.089   1.00 40.89 ? 471  GLN B C   1 
ATOM   7781  O  O   . GLN B 2 468 ? 30.176  7.990   5.340   1.00 40.83 ? 471  GLN B O   1 
ATOM   7782  C  CB  . GLN B 2 468 ? 32.891  8.473   7.012   1.00 40.92 ? 471  GLN B CB  1 
ATOM   7783  C  CG  . GLN B 2 468 ? 33.879  9.300   7.792   1.00 41.11 ? 471  GLN B CG  1 
ATOM   7784  C  CD  . GLN B 2 468 ? 34.689  8.457   8.750   1.00 41.25 ? 471  GLN B CD  1 
ATOM   7785  O  OE1 . GLN B 2 468 ? 35.439  7.576   8.333   1.00 41.36 ? 471  GLN B OE1 1 
ATOM   7786  N  NE2 . GLN B 2 468 ? 34.534  8.713   10.042  1.00 41.29 ? 471  GLN B NE2 1 
ATOM   7787  N  N   . ILE B 2 469 ? 32.031  7.734   4.091   1.00 40.95 ? 472  ILE B N   1 
ATOM   7788  C  CA  . ILE B 2 469 ? 31.421  6.793   3.166   1.00 41.02 ? 472  ILE B CA  1 
ATOM   7789  C  C   . ILE B 2 469 ? 30.740  5.590   3.829   1.00 41.11 ? 472  ILE B C   1 
ATOM   7790  O  O   . ILE B 2 469 ? 29.623  5.228   3.441   1.00 41.13 ? 472  ILE B O   1 
ATOM   7791  C  CB  . ILE B 2 469 ? 32.436  6.314   2.104   1.00 41.07 ? 472  ILE B CB  1 
ATOM   7792  C  CG1 . ILE B 2 469 ? 32.897  7.499   1.259   1.00 40.97 ? 472  ILE B CG1 1 
ATOM   7793  C  CG2 . ILE B 2 469 ? 31.804  5.278   1.188   1.00 41.09 ? 472  ILE B CG2 1 
ATOM   7794  C  CD1 . ILE B 2 469 ? 31.786  8.142   0.475   1.00 41.01 ? 472  ILE B CD1 1 
ATOM   7795  N  N   . PHE B 2 470 ? 31.379  4.981   4.828   1.00 40.96 ? 473  PHE B N   1 
ATOM   7796  C  CA  . PHE B 2 470 ? 30.759  3.830   5.480   1.00 40.89 ? 473  PHE B CA  1 
ATOM   7797  C  C   . PHE B 2 470 ? 29.397  4.195   6.078   1.00 41.04 ? 473  PHE B C   1 
ATOM   7798  O  O   . PHE B 2 470 ? 28.471  3.385   6.066   1.00 40.97 ? 473  PHE B O   1 
ATOM   7799  C  CB  . PHE B 2 470 ? 31.700  3.180   6.515   1.00 40.75 ? 473  PHE B CB  1 
ATOM   7800  C  CG  . PHE B 2 470 ? 31.673  3.815   7.886   1.00 40.60 ? 473  PHE B CG  1 
ATOM   7801  C  CD1 . PHE B 2 470 ? 30.739  3.412   8.835   1.00 40.51 ? 473  PHE B CD1 1 
ATOM   7802  C  CD2 . PHE B 2 470 ? 32.620  4.763   8.249   1.00 40.51 ? 473  PHE B CD2 1 
ATOM   7803  C  CE1 . PHE B 2 470 ? 30.750  3.934   10.116  1.00 40.28 ? 473  PHE B CE1 1 
ATOM   7804  C  CE2 . PHE B 2 470 ? 32.638  5.291   9.530   1.00 40.30 ? 473  PHE B CE2 1 
ATOM   7805  C  CZ  . PHE B 2 470 ? 31.701  4.874   10.464  1.00 40.43 ? 473  PHE B CZ  1 
ATOM   7806  N  N   . ILE B 2 471 ? 29.269  5.437   6.541   1.00 41.08 ? 474  ILE B N   1 
ATOM   7807  C  CA  . ILE B 2 471 ? 28.028  5.931   7.121   1.00 41.08 ? 474  ILE B CA  1 
ATOM   7808  C  C   . ILE B 2 471 ? 27.027  6.206   6.011   1.00 41.37 ? 474  ILE B C   1 
ATOM   7809  O  O   . ILE B 2 471 ? 25.830  5.966   6.172   1.00 41.22 ? 474  ILE B O   1 
ATOM   7810  C  CB  . ILE B 2 471 ? 28.269  7.211   7.935   1.00 40.98 ? 474  ILE B CB  1 
ATOM   7811  C  CG1 . ILE B 2 471 ? 29.156  6.891   9.139   1.00 40.86 ? 474  ILE B CG1 1 
ATOM   7812  C  CG2 . ILE B 2 471 ? 26.954  7.796   8.398   1.00 40.89 ? 474  ILE B CG2 1 
ATOM   7813  C  CD1 . ILE B 2 471 ? 29.588  8.094   9.929   1.00 40.71 ? 474  ILE B CD1 1 
ATOM   7814  N  N   . GLN B 2 472 ? 27.524  6.711   4.885   1.00 41.77 ? 475  GLN B N   1 
ATOM   7815  C  CA  . GLN B 2 472 ? 26.674  6.998   3.733   1.00 42.24 ? 475  GLN B CA  1 
ATOM   7816  C  C   . GLN B 2 472 ? 26.042  5.698   3.243   1.00 42.79 ? 475  GLN B C   1 
ATOM   7817  O  O   . GLN B 2 472 ? 24.848  5.657   2.935   1.00 42.78 ? 475  GLN B O   1 
ATOM   7818  C  CB  . GLN B 2 472 ? 27.482  7.632   2.595   1.00 41.98 ? 475  GLN B CB  1 
ATOM   7819  C  CG  . GLN B 2 472 ? 27.917  9.068   2.838   1.00 41.68 ? 475  GLN B CG  1 
ATOM   7820  C  CD  . GLN B 2 472 ? 28.692  9.667   1.667   1.00 41.56 ? 475  GLN B CD  1 
ATOM   7821  O  OE1 . GLN B 2 472 ? 29.358  10.698  1.809   1.00 41.46 ? 475  GLN B OE1 1 
ATOM   7822  N  NE2 . GLN B 2 472 ? 28.606  9.029   0.506   1.00 41.34 ? 475  GLN B NE2 1 
ATOM   7823  N  N   . LYS B 2 473 ? 26.847  4.637   3.196   1.00 43.26 ? 476  LYS B N   1 
ATOM   7824  C  CA  . LYS B 2 473 ? 26.375  3.335   2.745   1.00 43.82 ? 476  LYS B CA  1 
ATOM   7825  C  C   . LYS B 2 473 ? 25.294  2.788   3.650   1.00 43.88 ? 476  LYS B C   1 
ATOM   7826  O  O   . LYS B 2 473 ? 24.229  2.405   3.177   1.00 43.93 ? 476  LYS B O   1 
ATOM   7827  C  CB  . LYS B 2 473 ? 27.531  2.336   2.654   1.00 44.33 ? 476  LYS B CB  1 
ATOM   7828  C  CG  . LYS B 2 473 ? 28.552  2.684   1.588   1.00 45.29 ? 476  LYS B CG  1 
ATOM   7829  C  CD  . LYS B 2 473 ? 27.894  2.773   0.204   1.00 46.10 ? 476  LYS B CD  1 
ATOM   7830  C  CE  . LYS B 2 473 ? 28.887  3.228   -0.875  1.00 46.50 ? 476  LYS B CE  1 
ATOM   7831  N  NZ  . LYS B 2 473 ? 30.105  2.349   -0.945  1.00 46.69 ? 476  LYS B NZ  1 
ATOM   7832  N  N   . LYS B 2 474 ? 25.559  2.773   4.953   1.00 44.00 ? 477  LYS B N   1 
ATOM   7833  C  CA  . LYS B 2 474 ? 24.591  2.268   5.919   1.00 44.11 ? 477  LYS B CA  1 
ATOM   7834  C  C   . LYS B 2 474 ? 23.279  3.051   5.848   1.00 43.94 ? 477  LYS B C   1 
ATOM   7835  O  O   . LYS B 2 474 ? 22.202  2.462   5.941   1.00 43.95 ? 477  LYS B O   1 
ATOM   7836  C  CB  . LYS B 2 474 ? 25.159  2.334   7.337   1.00 44.51 ? 477  LYS B CB  1 
ATOM   7837  C  CG  . LYS B 2 474 ? 24.326  1.609   8.380   1.00 45.04 ? 477  LYS B CG  1 
ATOM   7838  C  CD  . LYS B 2 474 ? 24.622  0.121   8.384   1.00 45.98 ? 477  LYS B CD  1 
ATOM   7839  C  CE  . LYS B 2 474 ? 23.649  -0.643  9.284   1.00 46.60 ? 477  LYS B CE  1 
ATOM   7840  N  NZ  . LYS B 2 474 ? 22.244  -0.604  8.744   1.00 47.14 ? 477  LYS B NZ  1 
ATOM   7841  N  N   . ALA B 2 475 ? 23.370  4.368   5.664   1.00 43.66 ? 478  ALA B N   1 
ATOM   7842  C  CA  . ALA B 2 475 ? 22.183  5.215   5.584   1.00 43.50 ? 478  ALA B CA  1 
ATOM   7843  C  C   . ALA B 2 475 ? 21.390  4.902   4.326   1.00 43.55 ? 478  ALA B C   1 
ATOM   7844  O  O   . ALA B 2 475 ? 20.162  4.779   4.370   1.00 43.49 ? 478  ALA B O   1 
ATOM   7845  C  CB  . ALA B 2 475 ? 22.570  6.684   5.608   1.00 43.23 ? 478  ALA B CB  1 
ATOM   7846  N  N   . VAL B 2 476 ? 22.094  4.767   3.207   1.00 43.55 ? 479  VAL B N   1 
ATOM   7847  C  CA  . VAL B 2 476 ? 21.439  4.468   1.942   1.00 43.69 ? 479  VAL B CA  1 
ATOM   7848  C  C   . VAL B 2 476 ? 20.807  3.079   1.970   1.00 43.92 ? 479  VAL B C   1 
ATOM   7849  O  O   . VAL B 2 476 ? 19.737  2.865   1.406   1.00 43.83 ? 479  VAL B O   1 
ATOM   7850  C  CB  . VAL B 2 476 ? 22.416  4.615   0.761   1.00 43.59 ? 479  VAL B CB  1 
ATOM   7851  C  CG1 . VAL B 2 476 ? 21.820  4.023   -0.506  1.00 43.44 ? 479  VAL B CG1 1 
ATOM   7852  C  CG2 . VAL B 2 476 ? 22.733  6.085   0.545   1.00 43.28 ? 479  VAL B CG2 1 
ATOM   7853  N  N   . LYS B 2 477 ? 21.449  2.149   2.669   1.00 44.13 ? 480  LYS B N   1 
ATOM   7854  C  CA  . LYS B 2 477 ? 20.932  0.793   2.788   1.00 44.43 ? 480  LYS B CA  1 
ATOM   7855  C  C   . LYS B 2 477 ? 19.544  0.850   3.419   1.00 44.37 ? 480  LYS B C   1 
ATOM   7856  O  O   . LYS B 2 477 ? 18.629  0.161   2.979   1.00 44.28 ? 480  LYS B O   1 
ATOM   7857  C  CB  . LYS B 2 477 ? 21.854  -0.048  3.665   1.00 44.97 ? 480  LYS B CB  1 
ATOM   7858  C  CG  . LYS B 2 477 ? 21.736  -1.534  3.415   1.00 45.95 ? 480  LYS B CG  1 
ATOM   7859  C  CD  . LYS B 2 477 ? 22.472  -2.347  4.472   1.00 46.93 ? 480  LYS B CD  1 
ATOM   7860  C  CE  . LYS B 2 477 ? 21.705  -2.348  5.796   1.00 47.67 ? 480  LYS B CE  1 
ATOM   7861  N  NZ  . LYS B 2 477 ? 20.336  -2.948  5.640   1.00 48.19 ? 480  LYS B NZ  1 
ATOM   7862  N  N   . ASN B 2 478 ? 19.394  1.692   4.440   1.00 44.31 ? 481  ASN B N   1 
ATOM   7863  C  CA  . ASN B 2 478 ? 18.121  1.855   5.131   1.00 44.16 ? 481  ASN B CA  1 
ATOM   7864  C  C   . ASN B 2 478 ? 17.095  2.515   4.225   1.00 44.10 ? 481  ASN B C   1 
ATOM   7865  O  O   . ASN B 2 478 ? 15.932  2.127   4.218   1.00 44.00 ? 481  ASN B O   1 
ATOM   7866  C  CB  . ASN B 2 478 ? 18.290  2.704   6.392   1.00 44.23 ? 481  ASN B CB  1 
ATOM   7867  C  CG  . ASN B 2 478 ? 19.184  2.054   7.428   1.00 44.23 ? 481  ASN B CG  1 
ATOM   7868  O  OD1 . ASN B 2 478 ? 19.381  0.837   7.437   1.00 44.28 ? 481  ASN B OD1 1 
ATOM   7869  N  ND2 . ASN B 2 478 ? 19.721  2.874   8.325   1.00 44.28 ? 481  ASN B ND2 1 
ATOM   7870  N  N   . PHE B 2 479 ? 17.515  3.535   3.487   1.00 44.10 ? 482  PHE B N   1 
ATOM   7871  C  CA  . PHE B 2 479 ? 16.601  4.220   2.582   1.00 44.36 ? 482  PHE B CA  1 
ATOM   7872  C  C   . PHE B 2 479 ? 16.116  3.281   1.485   1.00 44.57 ? 482  PHE B C   1 
ATOM   7873  O  O   . PHE B 2 479 ? 14.949  3.320   1.092   1.00 44.33 ? 482  PHE B O   1 
ATOM   7874  C  CB  . PHE B 2 479 ? 17.260  5.452   1.968   1.00 44.23 ? 482  PHE B CB  1 
ATOM   7875  C  CG  . PHE B 2 479 ? 17.377  6.604   2.917   1.00 44.40 ? 482  PHE B CG  1 
ATOM   7876  C  CD1 . PHE B 2 479 ? 16.241  7.151   3.506   1.00 44.27 ? 482  PHE B CD1 1 
ATOM   7877  C  CD2 . PHE B 2 479 ? 18.619  7.141   3.236   1.00 44.43 ? 482  PHE B CD2 1 
ATOM   7878  C  CE1 . PHE B 2 479 ? 16.341  8.214   4.399   1.00 44.24 ? 482  PHE B CE1 1 
ATOM   7879  C  CE2 . PHE B 2 479 ? 18.727  8.208   4.131   1.00 44.38 ? 482  PHE B CE2 1 
ATOM   7880  C  CZ  . PHE B 2 479 ? 17.584  8.742   4.713   1.00 44.20 ? 482  PHE B CZ  1 
ATOM   7881  N  N   . THR B 2 480 ? 17.020  2.425   1.018   1.00 44.81 ? 483  THR B N   1 
ATOM   7882  C  CA  . THR B 2 480 ? 16.714  1.454   -0.023  1.00 45.08 ? 483  THR B CA  1 
ATOM   7883  C  C   . THR B 2 480 ? 15.671  0.463   0.478   1.00 45.44 ? 483  THR B C   1 
ATOM   7884  O  O   . THR B 2 480 ? 14.783  0.054   -0.263  1.00 45.43 ? 483  THR B O   1 
ATOM   7885  C  CB  . THR B 2 480 ? 17.984  0.703   -0.446  1.00 44.92 ? 483  THR B CB  1 
ATOM   7886  O  OG1 . THR B 2 480 ? 18.859  1.606   -1.127  1.00 44.79 ? 483  THR B OG1 1 
ATOM   7887  C  CG2 . THR B 2 480 ? 17.650  -0.459  -1.361  1.00 44.86 ? 483  THR B CG2 1 
ATOM   7888  N  N   . GLU B 2 481 ? 15.776  0.107   1.751   1.00 45.80 ? 484  GLU B N   1 
ATOM   7889  C  CA  . GLU B 2 481 ? 14.857  -0.822  2.386   1.00 46.30 ? 484  GLU B CA  1 
ATOM   7890  C  C   . GLU B 2 481 ? 13.453  -0.230  2.372   1.00 46.25 ? 484  GLU B C   1 
ATOM   7891  O  O   . GLU B 2 481 ? 12.467  -0.962  2.355   1.00 46.27 ? 484  GLU B O   1 
ATOM   7892  C  CB  . GLU B 2 481 ? 15.300  -1.054  3.821   1.00 47.24 ? 484  GLU B CB  1 
ATOM   7893  C  CG  . GLU B 2 481 ? 15.131  -2.461  4.334   1.00 48.72 ? 484  GLU B CG  1 
ATOM   7894  C  CD  . GLU B 2 481 ? 15.665  -2.602  5.759   1.00 49.79 ? 484  GLU B CD  1 
ATOM   7895  O  OE1 . GLU B 2 481 ? 16.899  -2.436  5.955   1.00 50.28 ? 484  GLU B OE1 1 
ATOM   7896  O  OE2 . GLU B 2 481 ? 14.849  -2.856  6.684   1.00 50.37 ? 484  GLU B OE2 1 
ATOM   7897  N  N   . VAL B 2 482 ? 13.370  1.099   2.406   1.00 46.19 ? 485  VAL B N   1 
ATOM   7898  C  CA  . VAL B 2 482 ? 12.086  1.800   2.377   1.00 46.12 ? 485  VAL B CA  1 
ATOM   7899  C  C   . VAL B 2 482 ? 11.509  1.743   0.966   1.00 46.17 ? 485  VAL B C   1 
ATOM   7900  O  O   . VAL B 2 482 ? 10.318  1.517   0.776   1.00 46.13 ? 485  VAL B O   1 
ATOM   7901  C  CB  . VAL B 2 482 ? 12.237  3.283   2.798   1.00 45.93 ? 485  VAL B CB  1 
ATOM   7902  C  CG1 . VAL B 2 482 ? 10.931  4.034   2.585   1.00 45.66 ? 485  VAL B CG1 1 
ATOM   7903  C  CG2 . VAL B 2 482 ? 12.664  3.372   4.251   1.00 45.69 ? 485  VAL B CG2 1 
ATOM   7904  N  N   . HIS B 2 483 ? 12.371  1.968   -0.016  1.00 46.23 ? 486  HIS B N   1 
ATOM   7905  C  CA  . HIS B 2 483 ? 11.988  1.936   -1.416  1.00 46.27 ? 486  HIS B CA  1 
ATOM   7906  C  C   . HIS B 2 483 ? 13.263  2.062   -2.229  1.00 46.45 ? 486  HIS B C   1 
ATOM   7907  O  O   . HIS B 2 483 ? 14.098  2.923   -1.954  1.00 46.48 ? 486  HIS B O   1 
ATOM   7908  C  CB  . HIS B 2 483 ? 11.038  3.082   -1.744  1.00 46.33 ? 486  HIS B CB  1 
ATOM   7909  C  CG  . HIS B 2 483 ? 10.352  2.925   -3.062  1.00 46.44 ? 486  HIS B CG  1 
ATOM   7910  N  ND1 . HIS B 2 483 ? 9.004   2.664   -3.170  1.00 46.46 ? 486  HIS B ND1 1 
ATOM   7911  C  CD2 . HIS B 2 483 ? 10.832  2.966   -4.326  1.00 46.31 ? 486  HIS B CD2 1 
ATOM   7912  C  CE1 . HIS B 2 483 ? 8.683   2.547   -4.445  1.00 46.46 ? 486  HIS B CE1 1 
ATOM   7913  N  NE2 . HIS B 2 483 ? 9.775   2.726   -5.167  1.00 46.48 ? 486  HIS B NE2 1 
ATOM   7914  N  N   . PRO B 2 484 ? 13.431  1.203   -3.244  1.00 46.54 ? 487  PRO B N   1 
ATOM   7915  C  CA  . PRO B 2 484 ? 14.610  1.195   -4.112  1.00 46.72 ? 487  PRO B CA  1 
ATOM   7916  C  C   . PRO B 2 484 ? 14.933  2.549   -4.720  1.00 46.94 ? 487  PRO B C   1 
ATOM   7917  O  O   . PRO B 2 484 ? 16.088  2.973   -4.726  1.00 46.86 ? 487  PRO B O   1 
ATOM   7918  C  CB  . PRO B 2 484 ? 14.224  0.186   -5.189  1.00 46.76 ? 487  PRO B CB  1 
ATOM   7919  C  CG  . PRO B 2 484 ? 13.356  -0.770  -4.449  1.00 46.71 ? 487  PRO B CG  1 
ATOM   7920  C  CD  . PRO B 2 484 ? 12.480  0.157   -3.655  1.00 46.61 ? 487  PRO B CD  1 
ATOM   7921  N  N   . ASP B 2 485 ? 13.902  3.212   -5.233  1.00 47.29 ? 488  ASP B N   1 
ATOM   7922  C  CA  . ASP B 2 485 ? 14.037  4.516   -5.870  1.00 47.58 ? 488  ASP B CA  1 
ATOM   7923  C  C   . ASP B 2 485 ? 14.559  5.559   -4.866  1.00 47.09 ? 488  ASP B C   1 
ATOM   7924  O  O   . ASP B 2 485 ? 15.434  6.367   -5.189  1.00 46.86 ? 488  ASP B O   1 
ATOM   7925  C  CB  . ASP B 2 485 ? 12.681  4.906   -6.477  1.00 48.71 ? 488  ASP B CB  1 
ATOM   7926  C  CG  . ASP B 2 485 ? 12.704  6.257   -7.175  1.00 50.02 ? 488  ASP B CG  1 
ATOM   7927  O  OD1 . ASP B 2 485 ? 13.448  6.394   -8.178  1.00 50.93 ? 488  ASP B OD1 1 
ATOM   7928  O  OD2 . ASP B 2 485 ? 11.963  7.179   -6.730  1.00 50.64 ? 488  ASP B OD2 1 
ATOM   7929  N  N   . TYR B 2 486 ? 14.072  5.475   -3.629  1.00 46.67 ? 489  TYR B N   1 
ATOM   7930  C  CA  . TYR B 2 486 ? 14.476  6.377   -2.547  1.00 46.19 ? 489  TYR B CA  1 
ATOM   7931  C  C   . TYR B 2 486 ? 15.991  6.272   -2.363  1.00 46.02 ? 489  TYR B C   1 
ATOM   7932  O  O   . TYR B 2 486 ? 16.706  7.266   -2.481  1.00 46.03 ? 489  TYR B O   1 
ATOM   7933  C  CB  . TYR B 2 486 ? 13.769  5.951   -1.258  1.00 45.85 ? 489  TYR B CB  1 
ATOM   7934  C  CG  . TYR B 2 486 ? 13.706  6.966   -0.128  1.00 45.49 ? 489  TYR B CG  1 
ATOM   7935  C  CD1 . TYR B 2 486 ? 12.953  6.692   1.013   1.00 45.26 ? 489  TYR B CD1 1 
ATOM   7936  C  CD2 . TYR B 2 486 ? 14.370  8.190   -0.194  1.00 45.32 ? 489  TYR B CD2 1 
ATOM   7937  C  CE1 . TYR B 2 486 ? 12.858  7.597   2.053   1.00 45.12 ? 489  TYR B CE1 1 
ATOM   7938  C  CE2 . TYR B 2 486 ? 14.281  9.111   0.855   1.00 45.16 ? 489  TYR B CE2 1 
ATOM   7939  C  CZ  . TYR B 2 486 ? 13.520  8.799   1.973   1.00 45.14 ? 489  TYR B CZ  1 
ATOM   7940  O  OH  . TYR B 2 486 ? 13.410  9.671   3.026   1.00 45.18 ? 489  TYR B OH  1 
ATOM   7941  N  N   . GLY B 2 487 ? 16.468  5.052   -2.123  1.00 45.75 ? 490  GLY B N   1 
ATOM   7942  C  CA  . GLY B 2 487 ? 17.887  4.815   -1.924  1.00 45.50 ? 490  GLY B CA  1 
ATOM   7943  C  C   . GLY B 2 487 ? 18.788  5.100   -3.113  1.00 45.47 ? 490  GLY B C   1 
ATOM   7944  O  O   . GLY B 2 487 ? 19.827  5.736   -2.952  1.00 45.40 ? 490  GLY B O   1 
ATOM   7945  N  N   . SER B 2 488 ? 18.410  4.632   -4.302  1.00 45.43 ? 491  SER B N   1 
ATOM   7946  C  CA  . SER B 2 488 ? 19.218  4.857   -5.502  1.00 45.31 ? 491  SER B CA  1 
ATOM   7947  C  C   . SER B 2 488 ? 19.317  6.335   -5.900  1.00 45.35 ? 491  SER B C   1 
ATOM   7948  O  O   . SER B 2 488 ? 20.336  6.758   -6.446  1.00 45.42 ? 491  SER B O   1 
ATOM   7949  C  CB  . SER B 2 488 ? 18.703  4.016   -6.681  1.00 45.21 ? 491  SER B CB  1 
ATOM   7950  O  OG  . SER B 2 488 ? 17.397  4.403   -7.084  1.00 45.18 ? 491  SER B OG  1 
ATOM   7951  N  N   . HIS B 2 489 ? 18.272  7.119   -5.626  1.00 45.34 ? 492  HIS B N   1 
ATOM   7952  C  CA  . HIS B 2 489 ? 18.279  8.547   -5.963  1.00 45.34 ? 492  HIS B CA  1 
ATOM   7953  C  C   . HIS B 2 489 ? 19.241  9.309   -5.043  1.00 45.04 ? 492  HIS B C   1 
ATOM   7954  O  O   . HIS B 2 489 ? 19.944  10.217  -5.479  1.00 44.87 ? 492  HIS B O   1 
ATOM   7955  C  CB  . HIS B 2 489 ? 16.862  9.139   -5.883  1.00 45.83 ? 492  HIS B CB  1 
ATOM   7956  C  CG  . HIS B 2 489 ? 16.727  10.501  -6.507  1.00 46.53 ? 492  HIS B CG  1 
ATOM   7957  N  ND1 . HIS B 2 489 ? 15.514  11.147  -6.628  1.00 46.75 ? 492  HIS B ND1 1 
ATOM   7958  C  CD2 . HIS B 2 489 ? 17.652  11.343  -7.032  1.00 46.78 ? 492  HIS B CD2 1 
ATOM   7959  C  CE1 . HIS B 2 489 ? 15.698  12.326  -7.197  1.00 46.80 ? 492  HIS B CE1 1 
ATOM   7960  N  NE2 . HIS B 2 489 ? 16.986  12.471  -7.451  1.00 46.81 ? 492  HIS B NE2 1 
ATOM   7961  N  N   . ILE B 2 490 ? 19.266  8.936   -3.770  1.00 44.73 ? 493  ILE B N   1 
ATOM   7962  C  CA  . ILE B 2 490 ? 20.163  9.570   -2.816  1.00 44.40 ? 493  ILE B CA  1 
ATOM   7963  C  C   . ILE B 2 490 ? 21.598  9.173   -3.158  1.00 44.41 ? 493  ILE B C   1 
ATOM   7964  O  O   . ILE B 2 490 ? 22.496  10.017  -3.165  1.00 44.43 ? 493  ILE B O   1 
ATOM   7965  C  CB  . ILE B 2 490 ? 19.825  9.162   -1.358  1.00 44.27 ? 493  ILE B CB  1 
ATOM   7966  C  CG1 . ILE B 2 490 ? 18.471  9.750   -0.961  1.00 44.02 ? 493  ILE B CG1 1 
ATOM   7967  C  CG2 . ILE B 2 490 ? 20.905  9.644   -0.391  1.00 44.02 ? 493  ILE B CG2 1 
ATOM   7968  C  CD1 . ILE B 2 490 ? 17.981  9.291   0.374   1.00 43.80 ? 493  ILE B CD1 1 
ATOM   7969  N  N   . GLN B 2 491 ? 21.804  7.900   -3.487  1.00 44.30 ? 494  GLN B N   1 
ATOM   7970  C  CA  . GLN B 2 491 ? 23.141  7.425   -3.837  1.00 44.27 ? 494  GLN B CA  1 
ATOM   7971  C  C   . GLN B 2 491 ? 23.666  8.129   -5.085  1.00 44.36 ? 494  GLN B C   1 
ATOM   7972  O  O   . GLN B 2 491 ? 24.840  8.487   -5.149  1.00 44.26 ? 494  GLN B O   1 
ATOM   7973  C  CB  . GLN B 2 491 ? 23.151  5.907   -4.044  1.00 44.00 ? 494  GLN B CB  1 
ATOM   7974  C  CG  . GLN B 2 491 ? 24.544  5.310   -4.212  1.00 43.58 ? 494  GLN B CG  1 
ATOM   7975  C  CD  . GLN B 2 491 ? 25.413  5.493   -2.984  1.00 43.33 ? 494  GLN B CD  1 
ATOM   7976  O  OE1 . GLN B 2 491 ? 25.145  4.921   -1.937  1.00 43.40 ? 494  GLN B OE1 1 
ATOM   7977  N  NE2 . GLN B 2 491 ? 26.462  6.290   -3.112  1.00 43.25 ? 494  GLN B NE2 1 
ATOM   7978  N  N   . ALA B 2 492 ? 22.783  8.356   -6.056  1.00 44.57 ? 495  ALA B N   1 
ATOM   7979  C  CA  . ALA B 2 492 ? 23.156  9.023   -7.301  1.00 44.91 ? 495  ALA B CA  1 
ATOM   7980  C  C   . ALA B 2 492 ? 23.642  10.440  -7.028  1.00 45.16 ? 495  ALA B C   1 
ATOM   7981  O  O   . ALA B 2 492 ? 24.635  10.885  -7.601  1.00 45.27 ? 495  ALA B O   1 
ATOM   7982  C  CB  . ALA B 2 492 ? 21.976  9.045   -8.270  1.00 44.76 ? 495  ALA B CB  1 
ATOM   7983  N  N   . LEU B 2 493 ? 22.931  11.148  -6.158  1.00 45.43 ? 496  LEU B N   1 
ATOM   7984  C  CA  . LEU B 2 493 ? 23.305  12.508  -5.807  1.00 45.75 ? 496  LEU B CA  1 
ATOM   7985  C  C   . LEU B 2 493 ? 24.588  12.475  -5.002  1.00 46.09 ? 496  LEU B C   1 
ATOM   7986  O  O   . LEU B 2 493 ? 25.482  13.288  -5.226  1.00 46.16 ? 496  LEU B O   1 
ATOM   7987  C  CB  . LEU B 2 493 ? 22.195  13.177  -5.002  1.00 45.66 ? 496  LEU B CB  1 
ATOM   7988  C  CG  . LEU B 2 493 ? 20.900  13.363  -5.788  1.00 45.58 ? 496  LEU B CG  1 
ATOM   7989  C  CD1 . LEU B 2 493 ? 19.765  13.699  -4.854  1.00 45.58 ? 496  LEU B CD1 1 
ATOM   7990  C  CD2 . LEU B 2 493 ? 21.091  14.444  -6.834  1.00 45.79 ? 496  LEU B CD2 1 
ATOM   7991  N  N   . LEU B 2 494 ? 24.689  11.515  -4.084  1.00 46.46 ? 497  LEU B N   1 
ATOM   7992  C  CA  . LEU B 2 494 ? 25.882  11.378  -3.255  1.00 46.94 ? 497  LEU B CA  1 
ATOM   7993  C  C   . LEU B 2 494 ? 27.110  11.143  -4.110  1.00 47.51 ? 497  LEU B C   1 
ATOM   7994  O  O   . LEU B 2 494 ? 28.188  11.645  -3.802  1.00 47.57 ? 497  LEU B O   1 
ATOM   7995  C  CB  . LEU B 2 494 ? 25.736  10.229  -2.264  1.00 46.59 ? 497  LEU B CB  1 
ATOM   7996  C  CG  . LEU B 2 494 ? 24.829  10.435  -1.052  1.00 46.39 ? 497  LEU B CG  1 
ATOM   7997  C  CD1 . LEU B 2 494 ? 24.815  9.161   -0.232  1.00 46.17 ? 497  LEU B CD1 1 
ATOM   7998  C  CD2 . LEU B 2 494 ? 25.310  11.616  -0.217  1.00 46.17 ? 497  LEU B CD2 1 
ATOM   7999  N  N   . ASP B 2 495 ? 26.940  10.388  -5.191  1.00 48.30 ? 498  ASP B N   1 
ATOM   8000  C  CA  . ASP B 2 495 ? 28.041  10.091  -6.097  1.00 49.17 ? 498  ASP B CA  1 
ATOM   8001  C  C   . ASP B 2 495 ? 28.645  11.339  -6.745  1.00 49.92 ? 498  ASP B C   1 
ATOM   8002  O  O   . ASP B 2 495 ? 29.869  11.437  -6.871  1.00 49.92 ? 498  ASP B O   1 
ATOM   8003  C  CB  . ASP B 2 495 ? 27.603  9.090   -7.173  1.00 49.05 ? 498  ASP B CB  1 
ATOM   8004  C  CG  . ASP B 2 495 ? 27.447  7.673   -6.635  1.00 49.02 ? 498  ASP B CG  1 
ATOM   8005  O  OD1 . ASP B 2 495 ? 28.027  7.355   -5.578  1.00 49.02 ? 498  ASP B OD1 1 
ATOM   8006  O  OD2 . ASP B 2 495 ? 26.749  6.867   -7.283  1.00 49.16 ? 498  ASP B OD2 1 
ATOM   8007  N  N   . LYS B 2 496 ? 27.800  12.292  -7.142  1.00 50.80 ? 499  LYS B N   1 
ATOM   8008  C  CA  . LYS B 2 496 ? 28.296  13.516  -7.762  1.00 51.73 ? 499  LYS B CA  1 
ATOM   8009  C  C   . LYS B 2 496 ? 29.010  14.378  -6.721  1.00 52.07 ? 499  LYS B C   1 
ATOM   8010  O  O   . LYS B 2 496 ? 30.068  14.942  -7.003  1.00 52.17 ? 499  LYS B O   1 
ATOM   8011  C  CB  . LYS B 2 496 ? 27.165  14.307  -8.437  1.00 52.25 ? 499  LYS B CB  1 
ATOM   8012  C  CG  . LYS B 2 496 ? 26.250  15.032  -7.462  1.00 53.39 ? 499  LYS B CG  1 
ATOM   8013  C  CD  . LYS B 2 496 ? 25.269  15.998  -8.137  1.00 54.16 ? 499  LYS B CD  1 
ATOM   8014  C  CE  . LYS B 2 496 ? 24.544  16.839  -7.063  1.00 54.54 ? 499  LYS B CE  1 
ATOM   8015  N  NZ  . LYS B 2 496 ? 23.534  17.800  -7.605  1.00 54.79 ? 499  LYS B NZ  1 
ATOM   8016  N  N   . TYR B 2 497 ? 28.446  14.452  -5.514  1.00 52.50 ? 500  TYR B N   1 
ATOM   8017  C  CA  . TYR B 2 497 ? 29.035  15.237  -4.426  1.00 52.97 ? 500  TYR B CA  1 
ATOM   8018  C  C   . TYR B 2 497 ? 30.416  14.727  -4.073  1.00 53.11 ? 500  TYR B C   1 
ATOM   8019  O  O   . TYR B 2 497 ? 31.342  15.512  -3.893  1.00 53.26 ? 500  TYR B O   1 
ATOM   8020  C  CB  . TYR B 2 497 ? 28.166  15.187  -3.176  1.00 53.24 ? 500  TYR B CB  1 
ATOM   8021  C  CG  . TYR B 2 497 ? 26.950  16.084  -3.207  1.00 53.69 ? 500  TYR B CG  1 
ATOM   8022  C  CD1 . TYR B 2 497 ? 27.079  17.471  -3.240  1.00 53.91 ? 500  TYR B CD1 1 
ATOM   8023  C  CD2 . TYR B 2 497 ? 25.665  15.546  -3.148  1.00 53.85 ? 500  TYR B CD2 1 
ATOM   8024  C  CE1 . TYR B 2 497 ? 25.952  18.301  -3.204  1.00 54.17 ? 500  TYR B CE1 1 
ATOM   8025  C  CE2 . TYR B 2 497 ? 24.537  16.359  -3.116  1.00 54.03 ? 500  TYR B CE2 1 
ATOM   8026  C  CZ  . TYR B 2 497 ? 24.687  17.734  -3.141  1.00 54.23 ? 500  TYR B CZ  1 
ATOM   8027  O  OH  . TYR B 2 497 ? 23.571  18.538  -3.091  1.00 54.55 ? 500  TYR B OH  1 
ATOM   8028  N  N   . ASN B 2 498 ? 30.544  13.407  -3.965  1.00 53.27 ? 501  ASN B N   1 
ATOM   8029  C  CA  . ASN B 2 498 ? 31.822  12.775  -3.640  1.00 53.44 ? 501  ASN B CA  1 
ATOM   8030  C  C   . ASN B 2 498 ? 32.830  12.857  -4.797  1.00 53.66 ? 501  ASN B C   1 
ATOM   8031  O  O   . ASN B 2 498 ? 34.040  12.781  -4.498  1.00 53.79 ? 501  ASN B O   1 
ATOM   8032  C  CB  . ASN B 2 498 ? 31.617  11.306  -3.241  1.00 53.21 ? 501  ASN B CB  1 
ATOM   8033  C  CG  . ASN B 2 498 ? 30.771  11.143  -1.985  1.00 53.11 ? 501  ASN B CG  1 
ATOM   8034  O  OD1 . ASN B 2 498 ? 30.191  10.081  -1.758  1.00 53.06 ? 501  ASN B OD1 1 
ATOM   8035  N  ND2 . ASN B 2 498 ? 30.707  12.184  -1.160  1.00 53.07 ? 501  ASN B ND2 1 
ATOM   8036  O  OXT . ASN B 2 498 ? 32.420  12.996  -5.980  1.00 53.92 ? 501  ASN B OXT 1 
ATOM   8037  N  N   . SER C 1 1   ? 47.707  17.338  77.777  1.00 56.34 ? 4    SER C N   1 
ATOM   8038  C  CA  . SER C 1 1   ? 46.839  16.714  76.722  1.00 56.21 ? 4    SER C CA  1 
ATOM   8039  C  C   . SER C 1 1   ? 45.524  16.092  77.254  1.00 55.85 ? 4    SER C C   1 
ATOM   8040  O  O   . SER C 1 1   ? 45.523  15.294  78.217  1.00 56.04 ? 4    SER C O   1 
ATOM   8041  C  CB  . SER C 1 1   ? 47.637  15.667  75.921  1.00 56.51 ? 4    SER C CB  1 
ATOM   8042  O  OG  . SER C 1 1   ? 48.062  14.577  76.734  1.00 56.94 ? 4    SER C OG  1 
ATOM   8043  N  N   . ARG C 1 2   ? 44.411  16.481  76.623  1.00 55.02 ? 5    ARG C N   1 
ATOM   8044  C  CA  . ARG C 1 2   ? 43.076  15.988  76.973  1.00 53.84 ? 5    ARG C CA  1 
ATOM   8045  C  C   . ARG C 1 2   ? 42.726  14.867  75.977  1.00 53.32 ? 5    ARG C C   1 
ATOM   8046  O  O   . ARG C 1 2   ? 43.607  14.103  75.560  1.00 53.42 ? 5    ARG C O   1 
ATOM   8047  C  CB  . ARG C 1 2   ? 42.035  17.121  76.883  1.00 53.40 ? 5    ARG C CB  1 
ATOM   8048  C  CG  . ARG C 1 2   ? 42.549  18.552  77.127  1.00 52.55 ? 5    ARG C CG  1 
ATOM   8049  C  CD  . ARG C 1 2   ? 43.183  19.154  75.866  1.00 52.02 ? 5    ARG C CD  1 
ATOM   8050  N  NE  . ARG C 1 2   ? 42.974  20.598  75.775  1.00 51.41 ? 5    ARG C NE  1 
ATOM   8051  C  CZ  . ARG C 1 2   ? 43.270  21.353  74.719  1.00 50.89 ? 5    ARG C CZ  1 
ATOM   8052  N  NH1 . ARG C 1 2   ? 43.802  20.826  73.629  1.00 50.54 ? 5    ARG C NH1 1 
ATOM   8053  N  NH2 . ARG C 1 2   ? 43.023  22.652  74.753  1.00 50.66 ? 5    ARG C NH2 1 
ATOM   8054  N  N   . ASP C 1 3   ? 41.453  14.765  75.593  1.00 52.45 ? 6    ASP C N   1 
ATOM   8055  C  CA  . ASP C 1 3   ? 41.034  13.740  74.635  1.00 51.31 ? 6    ASP C CA  1 
ATOM   8056  C  C   . ASP C 1 3   ? 41.607  14.084  73.261  1.00 50.28 ? 6    ASP C C   1 
ATOM   8057  O  O   . ASP C 1 3   ? 41.937  15.241  72.998  1.00 50.19 ? 6    ASP C O   1 
ATOM   8058  C  CB  . ASP C 1 3   ? 39.500  13.613  74.586  1.00 51.82 ? 6    ASP C CB  1 
ATOM   8059  C  CG  . ASP C 1 3   ? 38.801  14.929  74.275  1.00 52.37 ? 6    ASP C CG  1 
ATOM   8060  O  OD1 . ASP C 1 3   ? 39.005  15.897  75.032  1.00 53.07 ? 6    ASP C OD1 1 
ATOM   8061  O  OD2 . ASP C 1 3   ? 38.022  14.996  73.298  1.00 52.49 ? 6    ASP C OD2 1 
ATOM   8062  N  N   . PRO C 1 4   ? 41.783  13.073  72.389  1.00 49.17 ? 7    PRO C N   1 
ATOM   8063  C  CA  . PRO C 1 4   ? 42.327  13.272  71.041  1.00 48.26 ? 7    PRO C CA  1 
ATOM   8064  C  C   . PRO C 1 4   ? 41.580  14.309  70.211  1.00 47.43 ? 7    PRO C C   1 
ATOM   8065  O  O   . PRO C 1 4   ? 42.199  15.083  69.481  1.00 47.23 ? 7    PRO C O   1 
ATOM   8066  C  CB  . PRO C 1 4   ? 42.223  11.880  70.430  1.00 48.39 ? 7    PRO C CB  1 
ATOM   8067  C  CG  . PRO C 1 4   ? 42.451  11.002  71.603  1.00 48.62 ? 7    PRO C CG  1 
ATOM   8068  C  CD  . PRO C 1 4   ? 41.574  11.639  72.649  1.00 48.93 ? 7    PRO C CD  1 
ATOM   8069  N  N   . ALA C 1 5   ? 40.255  14.327  70.324  1.00 46.55 ? 8    ALA C N   1 
ATOM   8070  C  CA  . ALA C 1 5   ? 39.451  15.286  69.582  1.00 45.80 ? 8    ALA C CA  1 
ATOM   8071  C  C   . ALA C 1 5   ? 39.849  16.716  69.959  1.00 45.28 ? 8    ALA C C   1 
ATOM   8072  O  O   . ALA C 1 5   ? 40.004  17.573  69.091  1.00 45.31 ? 8    ALA C O   1 
ATOM   8073  C  CB  . ALA C 1 5   ? 37.974  15.050  69.847  1.00 45.64 ? 8    ALA C CB  1 
ATOM   8074  N  N   . SER C 1 6   ? 40.051  16.958  71.250  1.00 44.62 ? 9    SER C N   1 
ATOM   8075  C  CA  . SER C 1 6   ? 40.441  18.277  71.738  1.00 43.97 ? 9    SER C CA  1 
ATOM   8076  C  C   . SER C 1 6   ? 41.802  18.724  71.228  1.00 43.61 ? 9    SER C C   1 
ATOM   8077  O  O   . SER C 1 6   ? 42.017  19.911  70.980  1.00 43.61 ? 9    SER C O   1 
ATOM   8078  C  CB  . SER C 1 6   ? 40.465  18.284  73.260  1.00 43.79 ? 9    SER C CB  1 
ATOM   8079  O  OG  . SER C 1 6   ? 39.166  18.080  73.765  1.00 43.96 ? 9    SER C OG  1 
ATOM   8080  N  N   . ASP C 1 7   ? 42.719  17.772  71.074  1.00 43.20 ? 10   ASP C N   1 
ATOM   8081  C  CA  . ASP C 1 7   ? 44.071  18.073  70.618  1.00 42.83 ? 10   ASP C CA  1 
ATOM   8082  C  C   . ASP C 1 7   ? 44.277  18.124  69.107  1.00 42.54 ? 10   ASP C C   1 
ATOM   8083  O  O   . ASP C 1 7   ? 45.413  18.176  68.641  1.00 42.42 ? 10   ASP C O   1 
ATOM   8084  C  CB  . ASP C 1 7   ? 45.067  17.093  71.240  1.00 42.88 ? 10   ASP C CB  1 
ATOM   8085  C  CG  . ASP C 1 7   ? 45.220  17.279  72.738  1.00 42.85 ? 10   ASP C CG  1 
ATOM   8086  O  OD1 . ASP C 1 7   ? 44.999  18.401  73.237  1.00 42.88 ? 10   ASP C OD1 1 
ATOM   8087  O  OD2 . ASP C 1 7   ? 45.584  16.298  73.418  1.00 42.99 ? 10   ASP C OD2 1 
ATOM   8088  N  N   . GLN C 1 8   ? 43.182  18.164  68.353  1.00 42.18 ? 11   GLN C N   1 
ATOM   8089  C  CA  . GLN C 1 8   ? 43.241  18.216  66.890  1.00 41.90 ? 11   GLN C CA  1 
ATOM   8090  C  C   . GLN C 1 8   ? 44.262  19.235  66.355  1.00 41.97 ? 11   GLN C C   1 
ATOM   8091  O  O   . GLN C 1 8   ? 45.152  18.867  65.582  1.00 41.97 ? 11   GLN C O   1 
ATOM   8092  C  CB  . GLN C 1 8   ? 41.845  18.503  66.315  1.00 41.45 ? 11   GLN C CB  1 
ATOM   8093  C  CG  . GLN C 1 8   ? 41.702  18.291  64.806  1.00 40.75 ? 11   GLN C CG  1 
ATOM   8094  C  CD  . GLN C 1 8   ? 42.236  19.445  63.964  1.00 40.45 ? 11   GLN C CD  1 
ATOM   8095  O  OE1 . GLN C 1 8   ? 42.282  20.593  64.409  1.00 40.01 ? 11   GLN C OE1 1 
ATOM   8096  N  NE2 . GLN C 1 8   ? 42.625  19.143  62.731  1.00 40.16 ? 11   GLN C NE2 1 
ATOM   8097  N  N   . MET C 1 9   ? 44.146  20.497  66.766  1.00 41.86 ? 12   MET C N   1 
ATOM   8098  C  CA  . MET C 1 9   ? 45.074  21.522  66.299  1.00 41.95 ? 12   MET C CA  1 
ATOM   8099  C  C   . MET C 1 9   ? 46.500  21.328  66.789  1.00 42.25 ? 12   MET C C   1 
ATOM   8100  O  O   . MET C 1 9   ? 47.444  21.604  66.052  1.00 42.55 ? 12   MET C O   1 
ATOM   8101  C  CB  . MET C 1 9   ? 44.588  22.925  66.648  1.00 41.47 ? 12   MET C CB  1 
ATOM   8102  C  CG  . MET C 1 9   ? 43.404  23.374  65.837  1.00 41.10 ? 12   MET C CG  1 
ATOM   8103  S  SD  . MET C 1 9   ? 43.130  25.131  65.994  1.00 41.06 ? 12   MET C SD  1 
ATOM   8104  C  CE  . MET C 1 9   ? 42.999  25.276  67.765  1.00 40.68 ? 12   MET C CE  1 
ATOM   8105  N  N   . GLN C 1 10  ? 46.669  20.876  68.028  1.00 42.42 ? 13   GLN C N   1 
ATOM   8106  C  CA  . GLN C 1 10  ? 48.011  20.655  68.559  1.00 42.55 ? 13   GLN C CA  1 
ATOM   8107  C  C   . GLN C 1 10  ? 48.723  19.611  67.732  1.00 42.72 ? 13   GLN C C   1 
ATOM   8108  O  O   . GLN C 1 10  ? 49.873  19.802  67.340  1.00 42.90 ? 13   GLN C O   1 
ATOM   8109  C  CB  . GLN C 1 10  ? 47.971  20.162  70.001  1.00 42.55 ? 13   GLN C CB  1 
ATOM   8110  C  CG  . GLN C 1 10  ? 48.498  21.145  71.013  1.00 42.47 ? 13   GLN C CG  1 
ATOM   8111  C  CD  . GLN C 1 10  ? 49.856  21.706  70.668  1.00 42.23 ? 13   GLN C CD  1 
ATOM   8112  O  OE1 . GLN C 1 10  ? 50.036  22.917  70.633  1.00 42.49 ? 13   GLN C OE1 1 
ATOM   8113  N  NE2 . GLN C 1 10  ? 50.826  20.832  70.442  1.00 42.05 ? 13   GLN C NE2 1 
ATOM   8114  N  N   . HIS C 1 11  ? 48.034  18.502  67.477  1.00 42.77 ? 14   HIS C N   1 
ATOM   8115  C  CA  . HIS C 1 11  ? 48.600  17.415  66.698  1.00 42.92 ? 14   HIS C CA  1 
ATOM   8116  C  C   . HIS C 1 11  ? 48.914  17.861  65.281  1.00 42.95 ? 14   HIS C C   1 
ATOM   8117  O  O   . HIS C 1 11  ? 49.959  17.513  64.741  1.00 43.01 ? 14   HIS C O   1 
ATOM   8118  C  CB  . HIS C 1 11  ? 47.651  16.217  66.689  1.00 43.11 ? 14   HIS C CB  1 
ATOM   8119  C  CG  . HIS C 1 11  ? 47.469  15.580  68.035  1.00 43.49 ? 14   HIS C CG  1 
ATOM   8120  N  ND1 . HIS C 1 11  ? 48.371  15.741  69.066  1.00 43.55 ? 14   HIS C ND1 1 
ATOM   8121  C  CD2 . HIS C 1 11  ? 46.500  14.760  68.509  1.00 43.43 ? 14   HIS C CD2 1 
ATOM   8122  C  CE1 . HIS C 1 11  ? 47.968  15.047  70.115  1.00 43.52 ? 14   HIS C CE1 1 
ATOM   8123  N  NE2 . HIS C 1 11  ? 46.835  14.443  69.804  1.00 43.56 ? 14   HIS C NE2 1 
ATOM   8124  N  N   . TRP C 1 12  ? 48.023  18.648  64.687  1.00 43.01 ? 15   TRP C N   1 
ATOM   8125  C  CA  . TRP C 1 12  ? 48.245  19.145  63.335  1.00 43.27 ? 15   TRP C CA  1 
ATOM   8126  C  C   . TRP C 1 12  ? 49.538  19.952  63.325  1.00 43.97 ? 15   TRP C C   1 
ATOM   8127  O  O   . TRP C 1 12  ? 50.398  19.759  62.460  1.00 44.01 ? 15   TRP C O   1 
ATOM   8128  C  CB  . TRP C 1 12  ? 47.080  20.026  62.883  1.00 42.35 ? 15   TRP C CB  1 
ATOM   8129  C  CG  . TRP C 1 12  ? 47.161  20.409  61.440  1.00 41.52 ? 15   TRP C CG  1 
ATOM   8130  C  CD1 . TRP C 1 12  ? 46.627  19.730  60.380  1.00 41.22 ? 15   TRP C CD1 1 
ATOM   8131  C  CD2 . TRP C 1 12  ? 47.838  21.543  60.888  1.00 41.11 ? 15   TRP C CD2 1 
ATOM   8132  N  NE1 . TRP C 1 12  ? 46.932  20.367  59.205  1.00 40.90 ? 15   TRP C NE1 1 
ATOM   8133  C  CE2 . TRP C 1 12  ? 47.675  21.483  59.486  1.00 40.98 ? 15   TRP C CE2 1 
ATOM   8134  C  CE3 . TRP C 1 12  ? 48.566  22.603  61.441  1.00 40.90 ? 15   TRP C CE3 1 
ATOM   8135  C  CZ2 . TRP C 1 12  ? 48.217  22.443  58.629  1.00 40.81 ? 15   TRP C CZ2 1 
ATOM   8136  C  CZ3 . TRP C 1 12  ? 49.103  23.558  60.589  1.00 40.86 ? 15   TRP C CZ3 1 
ATOM   8137  C  CH2 . TRP C 1 12  ? 48.924  23.470  59.196  1.00 40.82 ? 15   TRP C CH2 1 
ATOM   8138  N  N   . LYS C 1 13  ? 49.667  20.840  64.309  1.00 44.82 ? 16   LYS C N   1 
ATOM   8139  C  CA  . LYS C 1 13  ? 50.841  21.690  64.466  1.00 45.79 ? 16   LYS C CA  1 
ATOM   8140  C  C   . LYS C 1 13  ? 52.107  20.854  64.613  1.00 46.63 ? 16   LYS C C   1 
ATOM   8141  O  O   . LYS C 1 13  ? 53.110  21.109  63.949  1.00 46.66 ? 16   LYS C O   1 
ATOM   8142  C  CB  . LYS C 1 13  ? 50.688  22.587  65.700  1.00 45.61 ? 16   LYS C CB  1 
ATOM   8143  C  CG  . LYS C 1 13  ? 51.915  23.439  65.979  1.00 45.47 ? 16   LYS C CG  1 
ATOM   8144  C  CD  . LYS C 1 13  ? 51.754  24.314  67.202  1.00 45.37 ? 16   LYS C CD  1 
ATOM   8145  C  CE  . LYS C 1 13  ? 52.901  25.312  67.283  1.00 45.33 ? 16   LYS C CE  1 
ATOM   8146  N  NZ  . LYS C 1 13  ? 52.673  26.347  68.325  1.00 45.53 ? 16   LYS C NZ  1 
ATOM   8147  N  N   . GLU C 1 14  ? 52.047  19.847  65.476  1.00 47.60 ? 17   GLU C N   1 
ATOM   8148  C  CA  . GLU C 1 14  ? 53.187  18.983  65.719  1.00 48.78 ? 17   GLU C CA  1 
ATOM   8149  C  C   . GLU C 1 14  ? 53.634  18.187  64.503  1.00 49.81 ? 17   GLU C C   1 
ATOM   8150  O  O   . GLU C 1 14  ? 54.830  18.059  64.263  1.00 49.83 ? 17   GLU C O   1 
ATOM   8151  C  CB  . GLU C 1 14  ? 52.899  18.064  66.893  1.00 48.61 ? 17   GLU C CB  1 
ATOM   8152  C  CG  . GLU C 1 14  ? 52.769  18.818  68.199  1.00 48.54 ? 17   GLU C CG  1 
ATOM   8153  C  CD  . GLU C 1 14  ? 52.295  17.947  69.340  1.00 48.67 ? 17   GLU C CD  1 
ATOM   8154  O  OE1 . GLU C 1 14  ? 52.313  18.436  70.490  1.00 48.69 ? 17   GLU C OE1 1 
ATOM   8155  O  OE2 . GLU C 1 14  ? 51.899  16.782  69.096  1.00 48.70 ? 17   GLU C OE2 1 
ATOM   8156  N  N   . GLN C 1 15  ? 52.684  17.685  63.720  1.00 51.18 ? 18   GLN C N   1 
ATOM   8157  C  CA  . GLN C 1 15  ? 53.006  16.911  62.518  1.00 52.76 ? 18   GLN C CA  1 
ATOM   8158  C  C   . GLN C 1 15  ? 53.816  17.719  61.519  1.00 53.48 ? 18   GLN C C   1 
ATOM   8159  O  O   . GLN C 1 15  ? 54.411  17.172  60.597  1.00 53.56 ? 18   GLN C O   1 
ATOM   8160  C  CB  . GLN C 1 15  ? 51.732  16.431  61.829  1.00 53.36 ? 18   GLN C CB  1 
ATOM   8161  C  CG  . GLN C 1 15  ? 51.006  15.317  62.559  1.00 54.74 ? 18   GLN C CG  1 
ATOM   8162  C  CD  . GLN C 1 15  ? 49.699  14.926  61.875  1.00 55.60 ? 18   GLN C CD  1 
ATOM   8163  O  OE1 . GLN C 1 15  ? 48.656  14.774  62.533  1.00 56.11 ? 18   GLN C OE1 1 
ATOM   8164  N  NE2 . GLN C 1 15  ? 49.746  14.761  60.549  1.00 55.86 ? 18   GLN C NE2 1 
ATOM   8165  N  N   . ARG C 1 16  ? 53.815  19.031  61.699  1.00 54.47 ? 19   ARG C N   1 
ATOM   8166  C  CA  . ARG C 1 16  ? 54.533  19.930  60.815  1.00 55.58 ? 19   ARG C CA  1 
ATOM   8167  C  C   . ARG C 1 16  ? 55.787  20.516  61.454  1.00 56.16 ? 19   ARG C C   1 
ATOM   8168  O  O   . ARG C 1 16  ? 56.055  21.708  61.318  1.00 56.22 ? 19   ARG C O   1 
ATOM   8169  C  CB  . ARG C 1 16  ? 53.598  21.049  60.371  1.00 55.83 ? 19   ARG C CB  1 
ATOM   8170  C  CG  . ARG C 1 16  ? 52.549  20.604  59.362  1.00 56.31 ? 19   ARG C CG  1 
ATOM   8171  C  CD  . ARG C 1 16  ? 51.761  21.789  58.838  1.00 56.71 ? 19   ARG C CD  1 
ATOM   8172  N  NE  . ARG C 1 16  ? 52.503  23.044  58.970  1.00 57.16 ? 19   ARG C NE  1 
ATOM   8173  C  CZ  . ARG C 1 16  ? 53.188  23.636  57.992  1.00 57.36 ? 19   ARG C CZ  1 
ATOM   8174  N  NH1 . ARG C 1 16  ? 53.233  23.100  56.774  1.00 57.20 ? 19   ARG C NH1 1 
ATOM   8175  N  NH2 . ARG C 1 16  ? 53.864  24.751  58.249  1.00 57.53 ? 19   ARG C NH2 1 
ATOM   8176  N  N   . ALA C 1 17  ? 56.553  19.664  62.132  1.00 56.95 ? 20   ALA C N   1 
ATOM   8177  C  CA  . ALA C 1 17  ? 57.792  20.048  62.814  1.00 57.60 ? 20   ALA C CA  1 
ATOM   8178  C  C   . ALA C 1 17  ? 58.577  21.152  62.101  1.00 57.96 ? 20   ALA C C   1 
ATOM   8179  O  O   . ALA C 1 17  ? 58.861  22.193  62.706  1.00 58.00 ? 20   ALA C O   1 
ATOM   8180  C  CB  . ALA C 1 17  ? 58.675  18.816  63.023  1.00 57.75 ? 20   ALA C CB  1 
ATOM   8181  N  N   . ALA C 1 18  ? 58.942  20.910  60.835  1.00 58.37 ? 21   ALA C N   1 
ATOM   8182  C  CA  . ALA C 1 18  ? 59.664  21.893  60.008  1.00 58.68 ? 21   ALA C CA  1 
ATOM   8183  C  C   . ALA C 1 18  ? 58.657  23.010  59.711  1.00 58.82 ? 21   ALA C C   1 
ATOM   8184  O  O   . ALA C 1 18  ? 58.136  23.162  58.592  1.00 58.62 ? 21   ALA C O   1 
ATOM   8185  C  CB  . ALA C 1 18  ? 60.166  21.244  58.711  1.00 58.75 ? 21   ALA C CB  1 
ATOM   8186  N  N   . GLN C 1 19  ? 58.399  23.769  60.774  1.00 59.00 ? 22   GLN C N   1 
ATOM   8187  C  CA  . GLN C 1 19  ? 57.442  24.867  60.830  1.00 58.92 ? 22   GLN C CA  1 
ATOM   8188  C  C   . GLN C 1 19  ? 57.441  25.910  59.727  1.00 58.21 ? 22   GLN C C   1 
ATOM   8189  O  O   . GLN C 1 19  ? 56.999  27.044  59.964  1.00 58.72 ? 22   GLN C O   1 
ATOM   8190  C  CB  . GLN C 1 19  ? 57.538  25.573  62.201  1.00 59.74 ? 22   GLN C CB  1 
ATOM   8191  C  CG  . GLN C 1 19  ? 57.087  24.722  63.406  1.00 60.91 ? 22   GLN C CG  1 
ATOM   8192  C  CD  . GLN C 1 19  ? 55.611  24.298  63.333  1.00 61.63 ? 22   GLN C CD  1 
ATOM   8193  O  OE1 . GLN C 1 19  ? 54.754  25.048  62.834  1.00 61.94 ? 22   GLN C OE1 1 
ATOM   8194  N  NE2 . GLN C 1 19  ? 55.312  23.094  63.837  1.00 61.75 ? 22   GLN C NE2 1 
ATOM   8195  N  N   . LYS C 1 20  ? 57.920  25.572  58.534  1.00 56.83 ? 23   LYS C N   1 
ATOM   8196  C  CA  . LYS C 1 20  ? 57.894  26.571  57.485  1.00 55.42 ? 23   LYS C CA  1 
ATOM   8197  C  C   . LYS C 1 20  ? 56.458  26.643  57.000  1.00 54.12 ? 23   LYS C C   1 
ATOM   8198  O  O   . LYS C 1 20  ? 56.030  25.836  56.174  1.00 54.01 ? 23   LYS C O   1 
ATOM   8199  C  CB  . LYS C 1 20  ? 58.846  26.219  56.353  1.00 55.94 ? 23   LYS C CB  1 
ATOM   8200  C  CG  . LYS C 1 20  ? 59.048  27.378  55.389  1.00 56.43 ? 23   LYS C CG  1 
ATOM   8201  C  CD  . LYS C 1 20  ? 59.350  28.666  56.149  1.00 56.74 ? 23   LYS C CD  1 
ATOM   8202  C  CE  . LYS C 1 20  ? 59.579  29.825  55.192  1.00 57.03 ? 23   LYS C CE  1 
ATOM   8203  N  NZ  . LYS C 1 20  ? 59.720  31.121  55.918  1.00 57.24 ? 23   LYS C NZ  1 
ATOM   8204  N  N   . ALA C 1 21  ? 55.698  27.565  57.585  1.00 52.46 ? 24   ALA C N   1 
ATOM   8205  C  CA  . ALA C 1 21  ? 54.294  27.739  57.240  1.00 50.85 ? 24   ALA C CA  1 
ATOM   8206  C  C   . ALA C 1 21  ? 54.115  28.134  55.783  1.00 49.69 ? 24   ALA C C   1 
ATOM   8207  O  O   . ALA C 1 21  ? 54.954  28.827  55.206  1.00 49.63 ? 24   ALA C O   1 
ATOM   8208  C  CB  . ALA C 1 21  ? 53.647  28.768  58.151  1.00 50.74 ? 24   ALA C CB  1 
ATOM   8209  N  N   . ASP C 1 22  ? 53.038  27.648  55.182  1.00 48.26 ? 25   ASP C N   1 
ATOM   8210  C  CA  . ASP C 1 22  ? 52.738  27.954  53.797  1.00 46.86 ? 25   ASP C CA  1 
ATOM   8211  C  C   . ASP C 1 22  ? 52.438  29.425  53.619  1.00 45.76 ? 25   ASP C C   1 
ATOM   8212  O  O   . ASP C 1 22  ? 52.118  30.129  54.574  1.00 45.51 ? 25   ASP C O   1 
ATOM   8213  C  CB  . ASP C 1 22  ? 51.535  27.147  53.312  1.00 47.16 ? 25   ASP C CB  1 
ATOM   8214  C  CG  . ASP C 1 22  ? 51.908  25.754  52.869  1.00 47.41 ? 25   ASP C CG  1 
ATOM   8215  O  OD1 . ASP C 1 22  ? 51.467  24.783  53.516  1.00 47.49 ? 25   ASP C OD1 1 
ATOM   8216  O  OD2 . ASP C 1 22  ? 52.634  25.629  51.860  1.00 47.86 ? 25   ASP C OD2 1 
ATOM   8217  N  N   . VAL C 1 23  ? 52.557  29.880  52.380  1.00 44.46 ? 26   VAL C N   1 
ATOM   8218  C  CA  . VAL C 1 23  ? 52.283  31.257  52.037  1.00 43.21 ? 26   VAL C CA  1 
ATOM   8219  C  C   . VAL C 1 23  ? 50.774  31.421  51.901  1.00 42.41 ? 26   VAL C C   1 
ATOM   8220  O  O   . VAL C 1 23  ? 50.120  30.639  51.221  1.00 42.17 ? 26   VAL C O   1 
ATOM   8221  C  CB  . VAL C 1 23  ? 52.980  31.630  50.719  1.00 43.22 ? 26   VAL C CB  1 
ATOM   8222  C  CG1 . VAL C 1 23  ? 52.560  33.014  50.262  1.00 43.15 ? 26   VAL C CG1 1 
ATOM   8223  C  CG2 . VAL C 1 23  ? 54.484  31.577  50.903  1.00 43.10 ? 26   VAL C CG2 1 
ATOM   8224  N  N   . LEU C 1 24  ? 50.218  32.394  52.611  1.00 41.42 ? 27   LEU C N   1 
ATOM   8225  C  CA  . LEU C 1 24  ? 48.790  32.669  52.563  1.00 40.52 ? 27   LEU C CA  1 
ATOM   8226  C  C   . LEU C 1 24  ? 48.467  33.297  51.213  1.00 40.16 ? 27   LEU C C   1 
ATOM   8227  O  O   . LEU C 1 24  ? 49.069  34.299  50.826  1.00 39.80 ? 27   LEU C O   1 
ATOM   8228  C  CB  . LEU C 1 24  ? 48.406  33.593  53.721  1.00 40.45 ? 27   LEU C CB  1 
ATOM   8229  C  CG  . LEU C 1 24  ? 47.046  34.289  53.796  1.00 40.39 ? 27   LEU C CG  1 
ATOM   8230  C  CD1 . LEU C 1 24  ? 45.928  33.357  53.453  1.00 40.38 ? 27   LEU C CD1 1 
ATOM   8231  C  CD2 . LEU C 1 24  ? 46.847  34.854  55.190  1.00 40.40 ? 27   LEU C CD2 1 
ATOM   8232  N  N   . THR C 1 25  ? 47.523  32.695  50.493  1.00 39.63 ? 28   THR C N   1 
ATOM   8233  C  CA  . THR C 1 25  ? 47.153  33.184  49.168  1.00 39.14 ? 28   THR C CA  1 
ATOM   8234  C  C   . THR C 1 25  ? 45.663  33.432  48.976  1.00 39.05 ? 28   THR C C   1 
ATOM   8235  O  O   . THR C 1 25  ? 44.842  33.068  49.818  1.00 38.96 ? 28   THR C O   1 
ATOM   8236  C  CB  . THR C 1 25  ? 47.545  32.171  48.073  1.00 39.04 ? 28   THR C CB  1 
ATOM   8237  O  OG1 . THR C 1 25  ? 46.750  30.992  48.221  1.00 38.79 ? 28   THR C OG1 1 
ATOM   8238  C  CG2 . THR C 1 25  ? 49.011  31.796  48.161  1.00 38.86 ? 28   THR C CG2 1 
ATOM   8239  N  N   . THR C 1 26  ? 45.330  34.063  47.851  1.00 38.79 ? 29   THR C N   1 
ATOM   8240  C  CA  . THR C 1 26  ? 43.943  34.316  47.471  1.00 38.38 ? 29   THR C CA  1 
ATOM   8241  C  C   . THR C 1 26  ? 43.493  33.015  46.801  1.00 38.39 ? 29   THR C C   1 
ATOM   8242  O  O   . THR C 1 26  ? 44.297  32.092  46.618  1.00 38.47 ? 29   THR C O   1 
ATOM   8243  C  CB  . THR C 1 26  ? 43.815  35.457  46.429  1.00 38.19 ? 29   THR C CB  1 
ATOM   8244  O  OG1 . THR C 1 26  ? 44.486  35.084  45.220  1.00 37.79 ? 29   THR C OG1 1 
ATOM   8245  C  CG2 . THR C 1 26  ? 44.411  36.750  46.955  1.00 37.87 ? 29   THR C CG2 1 
ATOM   8246  N  N   . GLY C 1 27  ? 42.221  32.938  46.428  1.00 38.31 ? 30   GLY C N   1 
ATOM   8247  C  CA  . GLY C 1 27  ? 41.719  31.742  45.777  1.00 38.14 ? 30   GLY C CA  1 
ATOM   8248  C  C   . GLY C 1 27  ? 42.458  31.401  44.493  1.00 38.03 ? 30   GLY C C   1 
ATOM   8249  O  O   . GLY C 1 27  ? 42.594  30.229  44.148  1.00 38.00 ? 30   GLY C O   1 
ATOM   8250  N  N   . ALA C 1 28  ? 42.940  32.421  43.787  1.00 38.10 ? 31   ALA C N   1 
ATOM   8251  C  CA  . ALA C 1 28  ? 43.667  32.222  42.535  1.00 37.80 ? 31   ALA C CA  1 
ATOM   8252  C  C   . ALA C 1 28  ? 45.172  32.014  42.728  1.00 37.91 ? 31   ALA C C   1 
ATOM   8253  O  O   . ALA C 1 28  ? 45.940  32.090  41.766  1.00 37.83 ? 31   ALA C O   1 
ATOM   8254  C  CB  . ALA C 1 28  ? 43.410  33.387  41.586  1.00 37.84 ? 31   ALA C CB  1 
ATOM   8255  N  N   . GLY C 1 29  ? 45.589  31.777  43.970  1.00 37.95 ? 32   GLY C N   1 
ATOM   8256  C  CA  . GLY C 1 29  ? 46.994  31.532  44.260  1.00 38.06 ? 32   GLY C CA  1 
ATOM   8257  C  C   . GLY C 1 29  ? 47.922  32.723  44.436  1.00 38.12 ? 32   GLY C C   1 
ATOM   8258  O  O   . GLY C 1 29  ? 49.120  32.546  44.668  1.00 38.02 ? 32   GLY C O   1 
ATOM   8259  N  N   . ASN C 1 30  ? 47.391  33.935  44.321  1.00 38.38 ? 33   ASN C N   1 
ATOM   8260  C  CA  . ASN C 1 30  ? 48.210  35.132  44.483  1.00 38.45 ? 33   ASN C CA  1 
ATOM   8261  C  C   . ASN C 1 30  ? 48.587  35.295  45.948  1.00 38.52 ? 33   ASN C C   1 
ATOM   8262  O  O   . ASN C 1 30  ? 47.748  35.146  46.829  1.00 38.64 ? 33   ASN C O   1 
ATOM   8263  C  CB  . ASN C 1 30  ? 47.447  36.362  44.008  1.00 38.54 ? 33   ASN C CB  1 
ATOM   8264  C  CG  . ASN C 1 30  ? 46.906  36.202  42.608  1.00 38.71 ? 33   ASN C CG  1 
ATOM   8265  O  OD1 . ASN C 1 30  ? 45.730  36.440  42.359  1.00 38.97 ? 33   ASN C OD1 1 
ATOM   8266  N  ND2 . ASN C 1 30  ? 47.762  35.792  41.684  1.00 38.87 ? 33   ASN C ND2 1 
ATOM   8267  N  N   . PRO C 1 31  ? 49.865  35.588  46.231  1.00 38.58 ? 34   PRO C N   1 
ATOM   8268  C  CA  . PRO C 1 31  ? 50.323  35.763  47.615  1.00 38.42 ? 34   PRO C CA  1 
ATOM   8269  C  C   . PRO C 1 31  ? 49.699  36.997  48.247  1.00 38.30 ? 34   PRO C C   1 
ATOM   8270  O  O   . PRO C 1 31  ? 49.526  38.023  47.590  1.00 38.27 ? 34   PRO C O   1 
ATOM   8271  C  CB  . PRO C 1 31  ? 51.832  35.947  47.457  1.00 38.55 ? 34   PRO C CB  1 
ATOM   8272  C  CG  . PRO C 1 31  ? 52.139  35.283  46.151  1.00 38.75 ? 34   PRO C CG  1 
ATOM   8273  C  CD  . PRO C 1 31  ? 50.989  35.706  45.290  1.00 38.69 ? 34   PRO C CD  1 
ATOM   8274  N  N   . VAL C 1 32  ? 49.368  36.893  49.526  1.00 38.22 ? 35   VAL C N   1 
ATOM   8275  C  CA  . VAL C 1 32  ? 48.765  38.003  50.246  1.00 38.00 ? 35   VAL C CA  1 
ATOM   8276  C  C   . VAL C 1 32  ? 49.803  38.677  51.146  1.00 37.97 ? 35   VAL C C   1 
ATOM   8277  O  O   . VAL C 1 32  ? 50.492  38.010  51.925  1.00 37.91 ? 35   VAL C O   1 
ATOM   8278  C  CB  . VAL C 1 32  ? 47.564  37.526  51.097  1.00 37.84 ? 35   VAL C CB  1 
ATOM   8279  C  CG1 . VAL C 1 32  ? 46.952  38.694  51.842  1.00 37.84 ? 35   VAL C CG1 1 
ATOM   8280  C  CG2 . VAL C 1 32  ? 46.524  36.875  50.211  1.00 37.65 ? 35   VAL C CG2 1 
ATOM   8281  N  N   . GLY C 1 33  ? 49.900  40.002  51.037  1.00 37.94 ? 36   GLY C N   1 
ATOM   8282  C  CA  . GLY C 1 33  ? 50.851  40.752  51.841  1.00 37.65 ? 36   GLY C CA  1 
ATOM   8283  C  C   . GLY C 1 33  ? 50.410  41.008  53.268  1.00 37.58 ? 36   GLY C C   1 
ATOM   8284  O  O   . GLY C 1 33  ? 51.221  40.954  54.195  1.00 37.47 ? 36   GLY C O   1 
ATOM   8285  N  N   . ASP C 1 34  ? 49.130  41.309  53.447  1.00 37.42 ? 37   ASP C N   1 
ATOM   8286  C  CA  . ASP C 1 34  ? 48.578  41.575  54.767  1.00 37.41 ? 37   ASP C CA  1 
ATOM   8287  C  C   . ASP C 1 34  ? 47.102  41.228  54.736  1.00 37.13 ? 37   ASP C C   1 
ATOM   8288  O  O   . ASP C 1 34  ? 46.322  41.899  54.068  1.00 37.08 ? 37   ASP C O   1 
ATOM   8289  C  CB  . ASP C 1 34  ? 48.760  43.059  55.128  1.00 37.86 ? 37   ASP C CB  1 
ATOM   8290  C  CG  . ASP C 1 34  ? 48.218  43.409  56.514  1.00 38.40 ? 37   ASP C CG  1 
ATOM   8291  O  OD1 . ASP C 1 34  ? 47.912  42.493  57.308  1.00 38.98 ? 37   ASP C OD1 1 
ATOM   8292  O  OD2 . ASP C 1 34  ? 48.108  44.615  56.826  1.00 38.76 ? 37   ASP C OD2 1 
ATOM   8293  N  N   . LYS C 1 35  ? 46.726  40.161  55.429  1.00 36.75 ? 38   LYS C N   1 
ATOM   8294  C  CA  . LYS C 1 35  ? 45.331  39.767  55.462  1.00 36.49 ? 38   LYS C CA  1 
ATOM   8295  C  C   . LYS C 1 35  ? 44.728  40.079  56.818  1.00 36.48 ? 38   LYS C C   1 
ATOM   8296  O  O   . LYS C 1 35  ? 43.771  39.435  57.243  1.00 36.36 ? 38   LYS C O   1 
ATOM   8297  C  CB  . LYS C 1 35  ? 45.172  38.287  55.155  1.00 36.30 ? 38   LYS C CB  1 
ATOM   8298  C  CG  . LYS C 1 35  ? 43.844  37.975  54.506  1.00 36.13 ? 38   LYS C CG  1 
ATOM   8299  C  CD  . LYS C 1 35  ? 43.425  36.547  54.733  1.00 36.10 ? 38   LYS C CD  1 
ATOM   8300  C  CE  . LYS C 1 35  ? 43.053  36.321  56.187  1.00 35.97 ? 38   LYS C CE  1 
ATOM   8301  N  NZ  . LYS C 1 35  ? 41.986  37.260  56.642  1.00 35.88 ? 38   LYS C NZ  1 
ATOM   8302  N  N   . LEU C 1 36  ? 45.288  41.083  57.487  1.00 36.35 ? 39   LEU C N   1 
ATOM   8303  C  CA  . LEU C 1 36  ? 44.806  41.502  58.798  1.00 36.23 ? 39   LEU C CA  1 
ATOM   8304  C  C   . LEU C 1 36  ? 44.275  42.930  58.791  1.00 36.33 ? 39   LEU C C   1 
ATOM   8305  O  O   . LEU C 1 36  ? 43.758  43.407  59.800  1.00 36.42 ? 39   LEU C O   1 
ATOM   8306  C  CB  . LEU C 1 36  ? 45.905  41.355  59.841  1.00 35.93 ? 39   LEU C CB  1 
ATOM   8307  C  CG  . LEU C 1 36  ? 46.288  39.906  60.118  1.00 35.71 ? 39   LEU C CG  1 
ATOM   8308  C  CD1 . LEU C 1 36  ? 47.435  39.836  61.104  1.00 35.78 ? 39   LEU C CD1 1 
ATOM   8309  C  CD2 . LEU C 1 36  ? 45.087  39.174  60.656  1.00 35.69 ? 39   LEU C CD2 1 
ATOM   8310  N  N   . ASN C 1 37  ? 44.412  43.610  57.656  1.00 36.38 ? 40   ASN C N   1 
ATOM   8311  C  CA  . ASN C 1 37  ? 43.923  44.978  57.501  1.00 36.50 ? 40   ASN C CA  1 
ATOM   8312  C  C   . ASN C 1 37  ? 43.413  45.186  56.090  1.00 36.62 ? 40   ASN C C   1 
ATOM   8313  O  O   . ASN C 1 37  ? 43.999  44.723  55.114  1.00 36.61 ? 40   ASN C O   1 
ATOM   8314  C  CB  . ASN C 1 37  ? 45.001  46.015  57.801  1.00 36.37 ? 40   ASN C CB  1 
ATOM   8315  C  CG  . ASN C 1 37  ? 45.519  45.918  59.205  1.00 36.47 ? 40   ASN C CG  1 
ATOM   8316  O  OD1 . ASN C 1 37  ? 46.586  45.352  59.442  1.00 36.81 ? 40   ASN C OD1 1 
ATOM   8317  N  ND2 . ASN C 1 37  ? 44.767  46.452  60.151  1.00 36.40 ? 40   ASN C ND2 1 
ATOM   8318  N  N   . VAL C 1 38  ? 42.330  45.931  56.001  1.00 36.62 ? 41   VAL C N   1 
ATOM   8319  C  CA  . VAL C 1 38  ? 41.674  46.226  54.751  1.00 36.66 ? 41   VAL C CA  1 
ATOM   8320  C  C   . VAL C 1 38  ? 42.284  47.502  54.138  1.00 36.63 ? 41   VAL C C   1 
ATOM   8321  O  O   . VAL C 1 38  ? 42.994  48.243  54.824  1.00 36.62 ? 41   VAL C O   1 
ATOM   8322  C  CB  . VAL C 1 38  ? 40.159  46.338  55.051  1.00 36.76 ? 41   VAL C CB  1 
ATOM   8323  C  CG1 . VAL C 1 38  ? 39.667  47.760  54.970  1.00 36.83 ? 41   VAL C CG1 1 
ATOM   8324  C  CG2 . VAL C 1 38  ? 39.379  45.384  54.203  1.00 36.88 ? 41   VAL C CG2 1 
ATOM   8325  N  N   . ILE C 1 39  ? 42.058  47.732  52.845  1.00 36.46 ? 42   ILE C N   1 
ATOM   8326  C  CA  . ILE C 1 39  ? 42.594  48.920  52.173  1.00 36.49 ? 42   ILE C CA  1 
ATOM   8327  C  C   . ILE C 1 39  ? 41.677  50.138  52.294  1.00 36.65 ? 42   ILE C C   1 
ATOM   8328  O  O   . ILE C 1 39  ? 40.534  50.113  51.839  1.00 36.72 ? 42   ILE C O   1 
ATOM   8329  C  CB  . ILE C 1 39  ? 42.852  48.673  50.660  1.00 36.34 ? 42   ILE C CB  1 
ATOM   8330  C  CG1 . ILE C 1 39  ? 43.831  47.518  50.454  1.00 36.23 ? 42   ILE C CG1 1 
ATOM   8331  C  CG2 . ILE C 1 39  ? 43.417  49.931  50.014  1.00 36.17 ? 42   ILE C CG2 1 
ATOM   8332  C  CD1 . ILE C 1 39  ? 44.249  47.324  49.006  1.00 36.21 ? 42   ILE C CD1 1 
ATOM   8333  N  N   . THR C 1 40  ? 42.182  51.212  52.890  1.00 36.59 ? 43   THR C N   1 
ATOM   8334  C  CA  . THR C 1 40  ? 41.391  52.430  53.034  1.00 36.71 ? 43   THR C CA  1 
ATOM   8335  C  C   . THR C 1 40  ? 42.185  53.620  52.510  1.00 36.77 ? 43   THR C C   1 
ATOM   8336  O  O   . THR C 1 40  ? 43.391  53.517  52.298  1.00 36.80 ? 43   THR C O   1 
ATOM   8337  C  CB  . THR C 1 40  ? 41.018  52.697  54.499  1.00 36.67 ? 43   THR C CB  1 
ATOM   8338  O  OG1 . THR C 1 40  ? 42.209  52.832  55.280  1.00 36.60 ? 43   THR C OG1 1 
ATOM   8339  C  CG2 . THR C 1 40  ? 40.193  51.564  55.055  1.00 36.46 ? 43   THR C CG2 1 
ATOM   8340  N  N   . VAL C 1 41  ? 41.503  54.728  52.235  1.00 36.79 ? 44   VAL C N   1 
ATOM   8341  C  CA  . VAL C 1 41  ? 42.192  55.921  51.757  1.00 36.69 ? 44   VAL C CA  1 
ATOM   8342  C  C   . VAL C 1 41  ? 42.542  56.758  52.983  1.00 36.67 ? 44   VAL C C   1 
ATOM   8343  O  O   . VAL C 1 41  ? 41.737  57.550  53.480  1.00 36.66 ? 44   VAL C O   1 
ATOM   8344  C  CB  . VAL C 1 41  ? 41.349  56.711  50.729  1.00 36.71 ? 44   VAL C CB  1 
ATOM   8345  C  CG1 . VAL C 1 41  ? 39.956  56.960  51.248  1.00 36.60 ? 44   VAL C CG1 1 
ATOM   8346  C  CG2 . VAL C 1 41  ? 42.044  58.012  50.375  1.00 36.57 ? 44   VAL C CG2 1 
ATOM   8347  N  N   . GLY C 1 42  ? 43.761  56.567  53.471  1.00 36.42 ? 45   GLY C N   1 
ATOM   8348  C  CA  . GLY C 1 42  ? 44.177  57.266  54.667  1.00 35.95 ? 45   GLY C CA  1 
ATOM   8349  C  C   . GLY C 1 42  ? 43.712  56.406  55.826  1.00 35.74 ? 45   GLY C C   1 
ATOM   8350  O  O   . GLY C 1 42  ? 42.848  55.550  55.639  1.00 35.66 ? 45   GLY C O   1 
ATOM   8351  N  N   . PRO C 1 43  ? 44.273  56.586  57.028  1.00 35.49 ? 46   PRO C N   1 
ATOM   8352  C  CA  . PRO C 1 43  ? 43.926  55.829  58.231  1.00 35.39 ? 46   PRO C CA  1 
ATOM   8353  C  C   . PRO C 1 43  ? 42.440  55.761  58.561  1.00 35.41 ? 46   PRO C C   1 
ATOM   8354  O  O   . PRO C 1 43  ? 41.942  54.700  58.933  1.00 35.58 ? 46   PRO C O   1 
ATOM   8355  C  CB  . PRO C 1 43  ? 44.703  56.558  59.316  1.00 35.36 ? 46   PRO C CB  1 
ATOM   8356  C  CG  . PRO C 1 43  ? 45.931  56.957  58.608  1.00 35.33 ? 46   PRO C CG  1 
ATOM   8357  C  CD  . PRO C 1 43  ? 45.383  57.509  57.312  1.00 35.49 ? 46   PRO C CD  1 
ATOM   8358  N  N   . ARG C 1 44  ? 41.724  56.876  58.446  1.00 35.34 ? 47   ARG C N   1 
ATOM   8359  C  CA  . ARG C 1 44  ? 40.300  56.861  58.766  1.00 35.16 ? 47   ARG C CA  1 
ATOM   8360  C  C   . ARG C 1 44  ? 39.403  57.091  57.563  1.00 35.24 ? 47   ARG C C   1 
ATOM   8361  O  O   . ARG C 1 44  ? 38.361  57.733  57.666  1.00 35.27 ? 47   ARG C O   1 
ATOM   8362  C  CB  . ARG C 1 44  ? 39.989  57.855  59.889  1.00 34.87 ? 47   ARG C CB  1 
ATOM   8363  C  CG  . ARG C 1 44  ? 40.675  57.486  61.186  1.00 34.59 ? 47   ARG C CG  1 
ATOM   8364  C  CD  . ARG C 1 44  ? 40.269  58.355  62.354  1.00 34.49 ? 47   ARG C CD  1 
ATOM   8365  N  NE  . ARG C 1 44  ? 41.059  57.989  63.529  1.00 34.93 ? 47   ARG C NE  1 
ATOM   8366  C  CZ  . ARG C 1 44  ? 41.030  58.621  64.701  1.00 35.17 ? 47   ARG C CZ  1 
ATOM   8367  N  NH1 . ARG C 1 44  ? 41.799  58.199  65.697  1.00 35.24 ? 47   ARG C NH1 1 
ATOM   8368  N  NH2 . ARG C 1 44  ? 40.230  59.664  64.889  1.00 35.38 ? 47   ARG C NH2 1 
ATOM   8369  N  N   . GLY C 1 45  ? 39.793  56.517  56.432  1.00 35.42 ? 48   GLY C N   1 
ATOM   8370  C  CA  . GLY C 1 45  ? 39.017  56.673  55.218  1.00 35.40 ? 48   GLY C CA  1 
ATOM   8371  C  C   . GLY C 1 45  ? 38.206  55.445  54.861  1.00 35.47 ? 48   GLY C C   1 
ATOM   8372  O  O   . GLY C 1 45  ? 38.338  54.406  55.502  1.00 35.43 ? 48   GLY C O   1 
ATOM   8373  N  N   . PRO C 1 46  ? 37.369  55.532  53.815  1.00 35.55 ? 49   PRO C N   1 
ATOM   8374  C  CA  . PRO C 1 46  ? 36.503  54.455  53.325  1.00 35.47 ? 49   PRO C CA  1 
ATOM   8375  C  C   . PRO C 1 46  ? 37.251  53.299  52.675  1.00 35.49 ? 49   PRO C C   1 
ATOM   8376  O  O   . PRO C 1 46  ? 38.401  53.441  52.258  1.00 35.27 ? 49   PRO C O   1 
ATOM   8377  C  CB  . PRO C 1 46  ? 35.628  55.162  52.292  1.00 35.59 ? 49   PRO C CB  1 
ATOM   8378  C  CG  . PRO C 1 46  ? 35.676  56.595  52.700  1.00 35.72 ? 49   PRO C CG  1 
ATOM   8379  C  CD  . PRO C 1 46  ? 37.104  56.777  53.080  1.00 35.56 ? 49   PRO C CD  1 
ATOM   8380  N  N   . LEU C 1 47  ? 36.561  52.166  52.571  1.00 35.46 ? 50   LEU C N   1 
ATOM   8381  C  CA  . LEU C 1 47  ? 37.092  50.945  51.969  1.00 35.47 ? 50   LEU C CA  1 
ATOM   8382  C  C   . LEU C 1 47  ? 37.036  51.004  50.439  1.00 35.69 ? 50   LEU C C   1 
ATOM   8383  O  O   . LEU C 1 47  ? 36.056  51.476  49.852  1.00 35.76 ? 50   LEU C O   1 
ATOM   8384  C  CB  . LEU C 1 47  ? 36.293  49.746  52.480  1.00 35.05 ? 50   LEU C CB  1 
ATOM   8385  C  CG  . LEU C 1 47  ? 36.483  48.371  51.839  1.00 34.80 ? 50   LEU C CG  1 
ATOM   8386  C  CD1 . LEU C 1 47  ? 37.914  47.898  51.946  1.00 34.70 ? 50   LEU C CD1 1 
ATOM   8387  C  CD2 . LEU C 1 47  ? 35.569  47.392  52.530  1.00 34.73 ? 50   LEU C CD2 1 
ATOM   8388  N  N   . LEU C 1 48  ? 38.086  50.515  49.791  1.00 35.96 ? 51   LEU C N   1 
ATOM   8389  C  CA  . LEU C 1 48  ? 38.150  50.525  48.331  1.00 36.16 ? 51   LEU C CA  1 
ATOM   8390  C  C   . LEU C 1 48  ? 37.871  49.177  47.681  1.00 36.23 ? 51   LEU C C   1 
ATOM   8391  O  O   . LEU C 1 48  ? 38.287  48.130  48.189  1.00 36.20 ? 51   LEU C O   1 
ATOM   8392  C  CB  . LEU C 1 48  ? 39.513  51.034  47.860  1.00 36.28 ? 51   LEU C CB  1 
ATOM   8393  C  CG  . LEU C 1 48  ? 39.812  52.499  48.156  1.00 36.51 ? 51   LEU C CG  1 
ATOM   8394  C  CD1 . LEU C 1 48  ? 40.317  52.674  49.574  1.00 36.68 ? 51   LEU C CD1 1 
ATOM   8395  C  CD2 . LEU C 1 48  ? 40.859  52.955  47.214  1.00 37.01 ? 51   LEU C CD2 1 
ATOM   8396  N  N   . VAL C 1 49  ? 37.182  49.214  46.542  1.00 36.15 ? 52   VAL C N   1 
ATOM   8397  C  CA  . VAL C 1 49  ? 36.857  48.009  45.782  1.00 36.22 ? 52   VAL C CA  1 
ATOM   8398  C  C   . VAL C 1 49  ? 38.156  47.307  45.365  1.00 36.52 ? 52   VAL C C   1 
ATOM   8399  O  O   . VAL C 1 49  ? 38.187  46.095  45.164  1.00 36.32 ? 52   VAL C O   1 
ATOM   8400  C  CB  . VAL C 1 49  ? 36.008  48.369  44.540  1.00 36.08 ? 52   VAL C CB  1 
ATOM   8401  C  CG1 . VAL C 1 49  ? 35.901  47.196  43.587  1.00 35.97 ? 52   VAL C CG1 1 
ATOM   8402  C  CG2 . VAL C 1 49  ? 34.631  48.804  44.974  1.00 35.83 ? 52   VAL C CG2 1 
ATOM   8403  N  N   . GLN C 1 50  ? 39.231  48.088  45.307  1.00 36.75 ? 53   GLN C N   1 
ATOM   8404  C  CA  . GLN C 1 50  ? 40.574  47.639  44.944  1.00 36.97 ? 53   GLN C CA  1 
ATOM   8405  C  C   . GLN C 1 50  ? 41.103  46.545  45.863  1.00 36.88 ? 53   GLN C C   1 
ATOM   8406  O  O   . GLN C 1 50  ? 42.067  45.852  45.530  1.00 36.81 ? 53   GLN C O   1 
ATOM   8407  C  CB  . GLN C 1 50  ? 41.513  48.828  45.032  1.00 37.64 ? 53   GLN C CB  1 
ATOM   8408  C  CG  . GLN C 1 50  ? 42.522  48.914  43.950  1.00 38.46 ? 53   GLN C CG  1 
ATOM   8409  C  CD  . GLN C 1 50  ? 43.188  50.254  43.968  1.00 38.83 ? 53   GLN C CD  1 
ATOM   8410  O  OE1 . GLN C 1 50  ? 44.076  50.511  44.787  1.00 39.17 ? 53   GLN C OE1 1 
ATOM   8411  N  NE2 . GLN C 1 50  ? 42.730  51.144  43.101  1.00 39.12 ? 53   GLN C NE2 1 
ATOM   8412  N  N   . ASP C 1 51  ? 40.533  46.450  47.057  1.00 36.57 ? 54   ASP C N   1 
ATOM   8413  C  CA  . ASP C 1 51  ? 40.948  45.423  47.987  1.00 36.45 ? 54   ASP C CA  1 
ATOM   8414  C  C   . ASP C 1 51  ? 40.277  44.124  47.573  1.00 36.39 ? 54   ASP C C   1 
ATOM   8415  O  O   . ASP C 1 51  ? 39.209  43.767  48.082  1.00 36.19 ? 54   ASP C O   1 
ATOM   8416  C  CB  . ASP C 1 51  ? 40.550  45.784  49.414  1.00 36.56 ? 54   ASP C CB  1 
ATOM   8417  C  CG  . ASP C 1 51  ? 41.150  44.840  50.445  1.00 36.61 ? 54   ASP C CG  1 
ATOM   8418  O  OD1 . ASP C 1 51  ? 41.100  45.169  51.643  1.00 36.95 ? 54   ASP C OD1 1 
ATOM   8419  O  OD2 . ASP C 1 51  ? 41.676  43.771  50.073  1.00 36.76 ? 54   ASP C OD2 1 
ATOM   8420  N  N   . VAL C 1 52  ? 40.911  43.423  46.640  1.00 36.23 ? 55   VAL C N   1 
ATOM   8421  C  CA  . VAL C 1 52  ? 40.390  42.159  46.149  1.00 36.17 ? 55   VAL C CA  1 
ATOM   8422  C  C   . VAL C 1 52  ? 40.686  41.024  47.117  1.00 36.17 ? 55   VAL C C   1 
ATOM   8423  O  O   . VAL C 1 52  ? 39.970  40.023  47.144  1.00 36.16 ? 55   VAL C O   1 
ATOM   8424  C  CB  . VAL C 1 52  ? 40.937  41.835  44.752  1.00 36.19 ? 55   VAL C CB  1 
ATOM   8425  C  CG1 . VAL C 1 52  ? 40.513  42.928  43.774  1.00 35.99 ? 55   VAL C CG1 1 
ATOM   8426  C  CG2 . VAL C 1 52  ? 42.449  41.707  44.796  1.00 36.32 ? 55   VAL C CG2 1 
ATOM   8427  N  N   . VAL C 1 53  ? 41.737  41.178  47.918  1.00 35.96 ? 56   VAL C N   1 
ATOM   8428  C  CA  . VAL C 1 53  ? 42.068  40.160  48.905  1.00 35.78 ? 56   VAL C CA  1 
ATOM   8429  C  C   . VAL C 1 53  ? 40.868  40.025  49.837  1.00 35.66 ? 56   VAL C C   1 
ATOM   8430  O  O   . VAL C 1 53  ? 40.439  38.914  50.152  1.00 35.58 ? 56   VAL C O   1 
ATOM   8431  C  CB  . VAL C 1 53  ? 43.305  40.545  49.739  1.00 35.93 ? 56   VAL C CB  1 
ATOM   8432  C  CG1 . VAL C 1 53  ? 43.564  39.494  50.802  1.00 36.02 ? 56   VAL C CG1 1 
ATOM   8433  C  CG2 . VAL C 1 53  ? 44.524  40.679  48.844  1.00 36.07 ? 56   VAL C CG2 1 
ATOM   8434  N  N   . PHE C 1 54  ? 40.315  41.164  50.246  1.00 35.29 ? 57   PHE C N   1 
ATOM   8435  C  CA  . PHE C 1 54  ? 39.156  41.189  51.126  1.00 34.99 ? 57   PHE C CA  1 
ATOM   8436  C  C   . PHE C 1 54  ? 37.943  40.539  50.470  1.00 35.01 ? 57   PHE C C   1 
ATOM   8437  O  O   . PHE C 1 54  ? 37.387  39.574  51.000  1.00 34.81 ? 57   PHE C O   1 
ATOM   8438  C  CB  . PHE C 1 54  ? 38.819  42.629  51.520  1.00 34.91 ? 57   PHE C CB  1 
ATOM   8439  C  CG  . PHE C 1 54  ? 37.495  42.767  52.217  1.00 34.96 ? 57   PHE C CG  1 
ATOM   8440  C  CD1 . PHE C 1 54  ? 37.317  42.281  53.509  1.00 34.92 ? 57   PHE C CD1 1 
ATOM   8441  C  CD2 . PHE C 1 54  ? 36.410  43.337  51.565  1.00 34.75 ? 57   PHE C CD2 1 
ATOM   8442  C  CE1 . PHE C 1 54  ? 36.076  42.355  54.134  1.00 34.81 ? 57   PHE C CE1 1 
ATOM   8443  C  CE2 . PHE C 1 54  ? 35.172  43.414  52.184  1.00 34.81 ? 57   PHE C CE2 1 
ATOM   8444  C  CZ  . PHE C 1 54  ? 35.006  42.921  53.471  1.00 34.89 ? 57   PHE C CZ  1 
ATOM   8445  N  N   . THR C 1 55  ? 37.549  41.061  49.309  1.00 34.91 ? 58   THR C N   1 
ATOM   8446  C  CA  . THR C 1 55  ? 36.388  40.551  48.583  1.00 34.80 ? 58   THR C CA  1 
ATOM   8447  C  C   . THR C 1 55  ? 36.479  39.060  48.294  1.00 34.89 ? 58   THR C C   1 
ATOM   8448  O  O   . THR C 1 55  ? 35.521  38.317  48.510  1.00 34.77 ? 58   THR C O   1 
ATOM   8449  C  CB  . THR C 1 55  ? 36.182  41.302  47.264  1.00 34.76 ? 58   THR C CB  1 
ATOM   8450  O  OG1 . THR C 1 55  ? 36.130  42.707  47.526  1.00 34.77 ? 58   THR C OG1 1 
ATOM   8451  C  CG2 . THR C 1 55  ? 34.881  40.885  46.610  1.00 34.58 ? 58   THR C CG2 1 
ATOM   8452  N  N   . ASP C 1 56  ? 37.641  38.628  47.826  1.00 34.73 ? 59   ASP C N   1 
ATOM   8453  C  CA  . ASP C 1 56  ? 37.870  37.231  47.508  1.00 34.84 ? 59   ASP C CA  1 
ATOM   8454  C  C   . ASP C 1 56  ? 37.574  36.308  48.695  1.00 34.91 ? 59   ASP C C   1 
ATOM   8455  O  O   . ASP C 1 56  ? 36.920  35.274  48.540  1.00 34.72 ? 59   ASP C O   1 
ATOM   8456  C  CB  . ASP C 1 56  ? 39.313  37.050  47.047  1.00 34.76 ? 59   ASP C CB  1 
ATOM   8457  C  CG  . ASP C 1 56  ? 39.678  35.604  46.839  1.00 35.14 ? 59   ASP C CG  1 
ATOM   8458  O  OD1 . ASP C 1 56  ? 40.528  35.082  47.603  1.00 35.11 ? 59   ASP C OD1 1 
ATOM   8459  O  OD2 . ASP C 1 56  ? 39.102  34.987  45.915  1.00 35.62 ? 59   ASP C OD2 1 
ATOM   8460  N  N   . GLU C 1 57  ? 38.053  36.691  49.876  1.00 34.92 ? 60   GLU C N   1 
ATOM   8461  C  CA  . GLU C 1 57  ? 37.853  35.892  51.078  1.00 35.03 ? 60   GLU C CA  1 
ATOM   8462  C  C   . GLU C 1 57  ? 36.430  36.007  51.618  1.00 35.28 ? 60   GLU C C   1 
ATOM   8463  O  O   . GLU C 1 57  ? 35.823  34.999  51.994  1.00 35.35 ? 60   GLU C O   1 
ATOM   8464  C  CB  . GLU C 1 57  ? 38.852  36.296  52.161  1.00 34.82 ? 60   GLU C CB  1 
ATOM   8465  C  CG  . GLU C 1 57  ? 38.732  35.475  53.431  1.00 34.85 ? 60   GLU C CG  1 
ATOM   8466  C  CD  . GLU C 1 57  ? 39.640  35.959  54.557  1.00 35.03 ? 60   GLU C CD  1 
ATOM   8467  O  OE1 . GLU C 1 57  ? 40.077  35.113  55.360  1.00 35.10 ? 60   GLU C OE1 1 
ATOM   8468  O  OE2 . GLU C 1 57  ? 39.906  37.177  54.665  1.00 34.95 ? 60   GLU C OE2 1 
ATOM   8469  N  N   . MET C 1 58  ? 35.893  37.229  51.636  1.00 35.28 ? 61   MET C N   1 
ATOM   8470  C  CA  . MET C 1 58  ? 34.543  37.480  52.148  1.00 35.32 ? 61   MET C CA  1 
ATOM   8471  C  C   . MET C 1 58  ? 33.458  36.833  51.294  1.00 35.25 ? 61   MET C C   1 
ATOM   8472  O  O   . MET C 1 58  ? 32.487  36.285  51.818  1.00 35.11 ? 61   MET C O   1 
ATOM   8473  C  CB  . MET C 1 58  ? 34.285  38.982  52.281  1.00 35.24 ? 61   MET C CB  1 
ATOM   8474  C  CG  . MET C 1 58  ? 32.969  39.337  52.965  1.00 35.36 ? 61   MET C CG  1 
ATOM   8475  S  SD  . MET C 1 58  ? 32.806  38.663  54.635  1.00 35.61 ? 61   MET C SD  1 
ATOM   8476  C  CE  . MET C 1 58  ? 33.994  39.671  55.525  1.00 35.37 ? 61   MET C CE  1 
ATOM   8477  N  N   . ALA C 1 59  ? 33.633  36.895  49.979  1.00 35.08 ? 62   ALA C N   1 
ATOM   8478  C  CA  . ALA C 1 59  ? 32.684  36.301  49.047  1.00 34.95 ? 62   ALA C CA  1 
ATOM   8479  C  C   . ALA C 1 59  ? 32.587  34.800  49.262  1.00 34.85 ? 62   ALA C C   1 
ATOM   8480  O  O   . ALA C 1 59  ? 31.529  34.207  49.083  1.00 34.69 ? 62   ALA C O   1 
ATOM   8481  C  CB  . ALA C 1 59  ? 33.100  36.597  47.617  1.00 34.82 ? 62   ALA C CB  1 
ATOM   8482  N  N   . HIS C 1 60  ? 33.697  34.186  49.650  1.00 34.91 ? 63   HIS C N   1 
ATOM   8483  C  CA  . HIS C 1 60  ? 33.698  32.754  49.884  1.00 35.05 ? 63   HIS C CA  1 
ATOM   8484  C  C   . HIS C 1 60  ? 33.050  32.426  51.206  1.00 35.03 ? 63   HIS C C   1 
ATOM   8485  O  O   . HIS C 1 60  ? 32.357  31.420  51.328  1.00 34.89 ? 63   HIS C O   1 
ATOM   8486  C  CB  . HIS C 1 60  ? 35.107  32.181  49.870  1.00 35.28 ? 63   HIS C CB  1 
ATOM   8487  C  CG  . HIS C 1 60  ? 35.121  30.693  49.785  1.00 35.67 ? 63   HIS C CG  1 
ATOM   8488  N  ND1 . HIS C 1 60  ? 35.144  30.023  48.581  1.00 35.73 ? 63   HIS C ND1 1 
ATOM   8489  C  CD2 . HIS C 1 60  ? 34.991  29.745  50.741  1.00 35.67 ? 63   HIS C CD2 1 
ATOM   8490  C  CE1 . HIS C 1 60  ? 35.015  28.728  48.799  1.00 35.78 ? 63   HIS C CE1 1 
ATOM   8491  N  NE2 . HIS C 1 60  ? 34.921  28.533  50.101  1.00 36.01 ? 63   HIS C NE2 1 
ATOM   8492  N  N   . PHE C 1 61  ? 33.343  33.241  52.214  1.00 34.95 ? 64   PHE C N   1 
ATOM   8493  C  CA  . PHE C 1 61  ? 32.768  33.059  53.542  1.00 34.98 ? 64   PHE C CA  1 
ATOM   8494  C  C   . PHE C 1 61  ? 31.246  33.164  53.400  1.00 34.92 ? 64   PHE C C   1 
ATOM   8495  O  O   . PHE C 1 61  ? 30.500  32.352  53.959  1.00 34.70 ? 64   PHE C O   1 
ATOM   8496  C  CB  . PHE C 1 61  ? 33.314  34.133  54.497  1.00 34.96 ? 64   PHE C CB  1 
ATOM   8497  C  CG  . PHE C 1 61  ? 32.584  34.220  55.811  1.00 35.02 ? 64   PHE C CG  1 
ATOM   8498  C  CD1 . PHE C 1 61  ? 32.836  33.308  56.827  1.00 35.04 ? 64   PHE C CD1 1 
ATOM   8499  C  CD2 . PHE C 1 61  ? 31.637  35.218  56.027  1.00 35.04 ? 64   PHE C CD2 1 
ATOM   8500  C  CE1 . PHE C 1 61  ? 32.153  33.385  58.040  1.00 35.07 ? 64   PHE C CE1 1 
ATOM   8501  C  CE2 . PHE C 1 61  ? 30.948  35.304  57.233  1.00 35.14 ? 64   PHE C CE2 1 
ATOM   8502  C  CZ  . PHE C 1 61  ? 31.207  34.384  58.243  1.00 35.11 ? 64   PHE C CZ  1 
ATOM   8503  N  N   . ASP C 1 62  ? 30.804  34.127  52.589  1.00 34.70 ? 65   ASP C N   1 
ATOM   8504  C  CA  . ASP C 1 62  ? 29.382  34.359  52.336  1.00 34.67 ? 65   ASP C CA  1 
ATOM   8505  C  C   . ASP C 1 62  ? 28.684  33.170  51.671  1.00 34.76 ? 65   ASP C C   1 
ATOM   8506  O  O   . ASP C 1 62  ? 27.449  33.084  51.678  1.00 34.65 ? 65   ASP C O   1 
ATOM   8507  C  CB  . ASP C 1 62  ? 29.199  35.597  51.448  1.00 34.49 ? 65   ASP C CB  1 
ATOM   8508  C  CG  . ASP C 1 62  ? 29.672  36.871  52.112  1.00 34.41 ? 65   ASP C CG  1 
ATOM   8509  O  OD1 . ASP C 1 62  ? 29.923  37.854  51.389  1.00 34.43 ? 65   ASP C OD1 1 
ATOM   8510  O  OD2 . ASP C 1 62  ? 29.793  36.902  53.353  1.00 34.33 ? 65   ASP C OD2 1 
ATOM   8511  N  N   . ARG C 1 63  ? 29.480  32.255  51.115  1.00 34.48 ? 66   ARG C N   1 
ATOM   8512  C  CA  . ARG C 1 63  ? 28.959  31.086  50.413  1.00 34.17 ? 66   ARG C CA  1 
ATOM   8513  C  C   . ARG C 1 63  ? 29.345  29.743  51.025  1.00 33.98 ? 66   ARG C C   1 
ATOM   8514  O  O   . ARG C 1 63  ? 29.231  28.714  50.365  1.00 33.99 ? 66   ARG C O   1 
ATOM   8515  C  CB  . ARG C 1 63  ? 29.424  31.133  48.956  1.00 34.15 ? 66   ARG C CB  1 
ATOM   8516  C  CG  . ARG C 1 63  ? 28.886  32.332  48.219  1.00 34.34 ? 66   ARG C CG  1 
ATOM   8517  C  CD  . ARG C 1 63  ? 29.501  32.532  46.854  1.00 34.50 ? 66   ARG C CD  1 
ATOM   8518  N  NE  . ARG C 1 63  ? 28.785  33.588  46.139  1.00 34.66 ? 66   ARG C NE  1 
ATOM   8519  C  CZ  . ARG C 1 63  ? 28.823  34.883  46.460  1.00 34.84 ? 66   ARG C CZ  1 
ATOM   8520  N  NH1 . ARG C 1 63  ? 29.558  35.305  47.483  1.00 34.72 ? 66   ARG C NH1 1 
ATOM   8521  N  NH2 . ARG C 1 63  ? 28.073  35.753  45.793  1.00 34.68 ? 66   ARG C NH2 1 
ATOM   8522  N  N   . GLU C 1 64  ? 29.763  29.735  52.285  1.00 33.64 ? 67   GLU C N   1 
ATOM   8523  C  CA  . GLU C 1 64  ? 30.173  28.494  52.924  1.00 33.37 ? 67   GLU C CA  1 
ATOM   8524  C  C   . GLU C 1 64  ? 29.087  27.456  53.114  1.00 33.33 ? 67   GLU C C   1 
ATOM   8525  O  O   . GLU C 1 64  ? 29.338  26.260  52.976  1.00 33.24 ? 67   GLU C O   1 
ATOM   8526  C  CB  . GLU C 1 64  ? 30.811  28.778  54.274  1.00 33.27 ? 67   GLU C CB  1 
ATOM   8527  C  CG  . GLU C 1 64  ? 32.170  29.412  54.174  1.00 33.50 ? 67   GLU C CG  1 
ATOM   8528  C  CD  . GLU C 1 64  ? 32.851  29.559  55.514  1.00 33.60 ? 67   GLU C CD  1 
ATOM   8529  O  OE1 . GLU C 1 64  ? 32.335  29.028  56.523  1.00 33.68 ? 67   GLU C OE1 1 
ATOM   8530  O  OE2 . GLU C 1 64  ? 33.911  30.210  55.561  1.00 33.57 ? 67   GLU C OE2 1 
ATOM   8531  N  N   . ARG C 1 65  ? 27.879  27.907  53.424  1.00 33.23 ? 68   ARG C N   1 
ATOM   8532  C  CA  . ARG C 1 65  ? 26.773  26.994  53.693  1.00 33.13 ? 68   ARG C CA  1 
ATOM   8533  C  C   . ARG C 1 65  ? 26.009  26.436  52.508  1.00 33.18 ? 68   ARG C C   1 
ATOM   8534  O  O   . ARG C 1 65  ? 25.734  27.142  51.543  1.00 33.21 ? 68   ARG C O   1 
ATOM   8535  C  CB  . ARG C 1 65  ? 25.767  27.657  54.636  1.00 32.82 ? 68   ARG C CB  1 
ATOM   8536  C  CG  . ARG C 1 65  ? 26.372  28.331  55.856  1.00 32.33 ? 68   ARG C CG  1 
ATOM   8537  C  CD  . ARG C 1 65  ? 26.882  27.344  56.889  1.00 31.92 ? 68   ARG C CD  1 
ATOM   8538  N  NE  . ARG C 1 65  ? 27.443  28.085  58.005  1.00 31.80 ? 68   ARG C NE  1 
ATOM   8539  C  CZ  . ARG C 1 65  ? 28.738  28.306  58.182  1.00 31.84 ? 68   ARG C CZ  1 
ATOM   8540  N  NH1 . ARG C 1 65  ? 29.620  27.814  57.328  1.00 31.69 ? 68   ARG C NH1 1 
ATOM   8541  N  NH2 . ARG C 1 65  ? 29.136  29.138  59.135  1.00 31.75 ? 68   ARG C NH2 1 
ATOM   8542  N  N   . ILE C 1 66  ? 25.658  25.157  52.610  1.00 33.36 ? 69   ILE C N   1 
ATOM   8543  C  CA  . ILE C 1 66  ? 24.858  24.463  51.605  1.00 33.47 ? 69   ILE C CA  1 
ATOM   8544  C  C   . ILE C 1 66  ? 23.640  23.948  52.378  1.00 33.54 ? 69   ILE C C   1 
ATOM   8545  O  O   . ILE C 1 66  ? 23.666  23.878  53.610  1.00 33.56 ? 69   ILE C O   1 
ATOM   8546  C  CB  . ILE C 1 66  ? 25.605  23.276  50.950  1.00 33.31 ? 69   ILE C CB  1 
ATOM   8547  C  CG1 . ILE C 1 66  ? 25.937  22.200  51.974  1.00 33.27 ? 69   ILE C CG1 1 
ATOM   8548  C  CG2 . ILE C 1 66  ? 26.877  23.754  50.293  1.00 33.61 ? 69   ILE C CG2 1 
ATOM   8549  C  CD1 . ILE C 1 66  ? 26.464  20.916  51.343  1.00 33.20 ? 69   ILE C CD1 1 
ATOM   8550  N  N   . PRO C 1 67  ? 22.548  23.602  51.681  1.00 33.72 ? 70   PRO C N   1 
ATOM   8551  C  CA  . PRO C 1 67  ? 21.383  23.111  52.421  1.00 33.86 ? 70   PRO C CA  1 
ATOM   8552  C  C   . PRO C 1 67  ? 21.708  21.854  53.210  1.00 33.94 ? 70   PRO C C   1 
ATOM   8553  O  O   . PRO C 1 67  ? 22.485  21.010  52.758  1.00 33.82 ? 70   PRO C O   1 
ATOM   8554  C  CB  . PRO C 1 67  ? 20.381  22.797  51.308  1.00 33.85 ? 70   PRO C CB  1 
ATOM   8555  C  CG  . PRO C 1 67  ? 20.777  23.726  50.208  1.00 33.87 ? 70   PRO C CG  1 
ATOM   8556  C  CD  . PRO C 1 67  ? 22.273  23.623  50.233  1.00 33.88 ? 70   PRO C CD  1 
ATOM   8557  N  N   . GLU C 1 68  ? 21.153  21.749  54.410  1.00 34.09 ? 71   GLU C N   1 
ATOM   8558  C  CA  . GLU C 1 68  ? 21.374  20.555  55.207  1.00 34.24 ? 71   GLU C CA  1 
ATOM   8559  C  C   . GLU C 1 68  ? 20.415  19.494  54.675  1.00 34.09 ? 71   GLU C C   1 
ATOM   8560  O  O   . GLU C 1 68  ? 19.478  19.812  53.938  1.00 34.08 ? 71   GLU C O   1 
ATOM   8561  C  CB  . GLU C 1 68  ? 21.101  20.828  56.684  1.00 34.26 ? 71   GLU C CB  1 
ATOM   8562  C  CG  . GLU C 1 68  ? 19.658  21.156  57.004  1.00 34.86 ? 71   GLU C CG  1 
ATOM   8563  C  CD  . GLU C 1 68  ? 19.401  21.260  58.489  1.00 35.14 ? 71   GLU C CD  1 
ATOM   8564  O  OE1 . GLU C 1 68  ? 20.277  21.754  59.230  1.00 35.35 ? 71   GLU C OE1 1 
ATOM   8565  O  OE2 . GLU C 1 68  ? 18.313  20.843  58.922  1.00 35.48 ? 71   GLU C OE2 1 
ATOM   8566  N  N   . ARG C 1 69  ? 20.679  18.234  54.999  1.00 33.88 ? 72   ARG C N   1 
ATOM   8567  C  CA  . ARG C 1 69  ? 19.827  17.139  54.560  1.00 33.84 ? 72   ARG C CA  1 
ATOM   8568  C  C   . ARG C 1 69  ? 18.403  17.448  55.008  1.00 34.15 ? 72   ARG C C   1 
ATOM   8569  O  O   . ARG C 1 69  ? 18.207  18.013  56.085  1.00 34.29 ? 72   ARG C O   1 
ATOM   8570  C  CB  . ARG C 1 69  ? 20.317  15.835  55.183  1.00 33.36 ? 72   ARG C CB  1 
ATOM   8571  C  CG  . ARG C 1 69  ? 21.711  15.441  54.723  1.00 32.86 ? 72   ARG C CG  1 
ATOM   8572  C  CD  . ARG C 1 69  ? 22.313  14.322  55.561  1.00 32.46 ? 72   ARG C CD  1 
ATOM   8573  N  NE  . ARG C 1 69  ? 23.566  13.829  54.991  1.00 32.26 ? 72   ARG C NE  1 
ATOM   8574  C  CZ  . ARG C 1 69  ? 24.698  14.526  54.921  1.00 32.32 ? 72   ARG C CZ  1 
ATOM   8575  N  NH1 . ARG C 1 69  ? 24.759  15.763  55.396  1.00 31.98 ? 72   ARG C NH1 1 
ATOM   8576  N  NH2 . ARG C 1 69  ? 25.768  13.994  54.341  1.00 32.17 ? 72   ARG C NH2 1 
ATOM   8577  N  N   . VAL C 1 70  ? 17.411  17.142  54.175  1.00 34.28 ? 73   VAL C N   1 
ATOM   8578  C  CA  . VAL C 1 70  ? 16.027  17.426  54.552  1.00 34.30 ? 73   VAL C CA  1 
ATOM   8579  C  C   . VAL C 1 70  ? 15.654  16.641  55.813  1.00 34.63 ? 73   VAL C C   1 
ATOM   8580  O  O   . VAL C 1 70  ? 14.858  17.105  56.623  1.00 34.62 ? 73   VAL C O   1 
ATOM   8581  C  CB  . VAL C 1 70  ? 15.049  17.194  53.376  1.00 34.20 ? 73   VAL C CB  1 
ATOM   8582  C  CG1 . VAL C 1 70  ? 14.945  15.718  53.049  1.00 34.13 ? 73   VAL C CG1 1 
ATOM   8583  C  CG2 . VAL C 1 70  ? 13.697  17.814  53.676  1.00 33.83 ? 73   VAL C CG2 1 
ATOM   8584  N  N   . VAL C 1 71  ? 16.262  15.469  55.987  1.00 34.69 ? 74   VAL C N   1 
ATOM   8585  C  CA  . VAL C 1 71  ? 16.084  14.633  57.180  1.00 34.86 ? 74   VAL C CA  1 
ATOM   8586  C  C   . VAL C 1 71  ? 17.450  14.031  57.470  1.00 34.99 ? 74   VAL C C   1 
ATOM   8587  O  O   . VAL C 1 71  ? 18.269  13.893  56.560  1.00 35.01 ? 74   VAL C O   1 
ATOM   8588  C  CB  . VAL C 1 71  ? 15.059  13.486  57.008  1.00 34.98 ? 74   VAL C CB  1 
ATOM   8589  C  CG1 . VAL C 1 71  ? 13.657  14.025  57.081  1.00 34.99 ? 74   VAL C CG1 1 
ATOM   8590  C  CG2 . VAL C 1 71  ? 15.276  12.759  55.704  1.00 34.93 ? 74   VAL C CG2 1 
ATOM   8591  N  N   . HIS C 1 72  ? 17.712  13.704  58.732  1.00 34.85 ? 75   HIS C N   1 
ATOM   8592  C  CA  . HIS C 1 72  ? 19.003  13.135  59.127  1.00 34.87 ? 75   HIS C CA  1 
ATOM   8593  C  C   . HIS C 1 72  ? 20.139  14.163  58.993  1.00 34.79 ? 75   HIS C C   1 
ATOM   8594  O  O   . HIS C 1 72  ? 21.281  13.811  58.687  1.00 34.78 ? 75   HIS C O   1 
ATOM   8595  C  CB  . HIS C 1 72  ? 19.331  11.889  58.288  1.00 34.92 ? 75   HIS C CB  1 
ATOM   8596  C  CG  . HIS C 1 72  ? 18.413  10.729  58.521  1.00 35.19 ? 75   HIS C CG  1 
ATOM   8597  N  ND1 . HIS C 1 72  ? 18.765  9.648   59.303  1.00 35.23 ? 75   HIS C ND1 1 
ATOM   8598  C  CD2 . HIS C 1 72  ? 17.181  10.450  58.030  1.00 35.10 ? 75   HIS C CD2 1 
ATOM   8599  C  CE1 . HIS C 1 72  ? 17.793  8.753   59.280  1.00 35.34 ? 75   HIS C CE1 1 
ATOM   8600  N  NE2 . HIS C 1 72  ? 16.820  9.215   58.514  1.00 35.23 ? 75   HIS C NE2 1 
ATOM   8601  N  N   . ALA C 1 73  ? 19.824  15.426  59.258  1.00 34.70 ? 76   ALA C N   1 
ATOM   8602  C  CA  . ALA C 1 73  ? 20.791  16.518  59.163  1.00 34.62 ? 76   ALA C CA  1 
ATOM   8603  C  C   . ALA C 1 73  ? 21.986  16.450  60.112  1.00 34.51 ? 76   ALA C C   1 
ATOM   8604  O  O   . ALA C 1 73  ? 23.101  16.783  59.726  1.00 34.54 ? 76   ALA C O   1 
ATOM   8605  C  CB  . ALA C 1 73  ? 20.080  17.846  59.347  1.00 34.77 ? 76   ALA C CB  1 
ATOM   8606  N  N   . LYS C 1 74  ? 21.740  16.075  61.363  1.00 34.35 ? 77   LYS C N   1 
ATOM   8607  C  CA  . LYS C 1 74  ? 22.790  15.994  62.371  1.00 34.29 ? 77   LYS C CA  1 
ATOM   8608  C  C   . LYS C 1 74  ? 23.456  14.623  62.385  1.00 34.29 ? 77   LYS C C   1 
ATOM   8609  O  O   . LYS C 1 74  ? 22.830  13.640  62.776  1.00 34.56 ? 77   LYS C O   1 
ATOM   8610  C  CB  . LYS C 1 74  ? 22.194  16.286  63.749  1.00 34.01 ? 77   LYS C CB  1 
ATOM   8611  C  CG  . LYS C 1 74  ? 23.206  16.326  64.875  1.00 33.82 ? 77   LYS C CG  1 
ATOM   8612  C  CD  . LYS C 1 74  ? 24.110  17.541  64.750  1.00 33.64 ? 77   LYS C CD  1 
ATOM   8613  C  CE  . LYS C 1 74  ? 25.302  17.434  65.677  1.00 33.52 ? 77   LYS C CE  1 
ATOM   8614  N  NZ  . LYS C 1 74  ? 24.894  17.319  67.098  1.00 33.45 ? 77   LYS C NZ  1 
ATOM   8615  N  N   . GLY C 1 75  ? 24.733  14.553  62.010  1.00 34.22 ? 78   GLY C N   1 
ATOM   8616  C  CA  . GLY C 1 75  ? 25.393  13.259  62.003  1.00 33.99 ? 78   GLY C CA  1 
ATOM   8617  C  C   . GLY C 1 75  ? 26.893  13.212  62.200  1.00 33.98 ? 78   GLY C C   1 
ATOM   8618  O  O   . GLY C 1 75  ? 27.546  14.234  62.383  1.00 34.03 ? 78   GLY C O   1 
ATOM   8619  N  N   . ALA C 1 76  ? 27.433  11.998  62.192  1.00 34.04 ? 79   ALA C N   1 
ATOM   8620  C  CA  . ALA C 1 76  ? 28.865  11.766  62.348  1.00 33.81 ? 79   ALA C CA  1 
ATOM   8621  C  C   . ALA C 1 76  ? 29.287  10.798  61.263  1.00 33.81 ? 79   ALA C C   1 
ATOM   8622  O  O   . ALA C 1 76  ? 28.480  9.995   60.799  1.00 33.73 ? 79   ALA C O   1 
ATOM   8623  C  CB  . ALA C 1 76  ? 29.168  11.176  63.718  1.00 33.69 ? 79   ALA C CB  1 
ATOM   8624  N  N   . GLY C 1 77  ? 30.548  10.873  60.858  1.00 33.91 ? 80   GLY C N   1 
ATOM   8625  C  CA  . GLY C 1 77  ? 31.035  9.994   59.819  1.00 33.92 ? 80   GLY C CA  1 
ATOM   8626  C  C   . GLY C 1 77  ? 32.391  9.404   60.123  1.00 34.28 ? 80   GLY C C   1 
ATOM   8627  O  O   . GLY C 1 77  ? 33.163  9.947   60.913  1.00 34.31 ? 80   GLY C O   1 
ATOM   8628  N  N   . ALA C 1 78  ? 32.674  8.275   59.488  1.00 34.52 ? 81   ALA C N   1 
ATOM   8629  C  CA  . ALA C 1 78  ? 33.940  7.576   59.656  1.00 34.76 ? 81   ALA C CA  1 
ATOM   8630  C  C   . ALA C 1 78  ? 34.160  6.703   58.433  1.00 34.90 ? 81   ALA C C   1 
ATOM   8631  O  O   . ALA C 1 78  ? 33.273  6.576   57.587  1.00 35.01 ? 81   ALA C O   1 
ATOM   8632  C  CB  . ALA C 1 78  ? 33.914  6.733   60.911  1.00 34.69 ? 81   ALA C CB  1 
ATOM   8633  N  N   . PHE C 1 79  ? 35.346  6.118   58.324  1.00 35.17 ? 82   PHE C N   1 
ATOM   8634  C  CA  . PHE C 1 79  ? 35.677  5.275   57.183  1.00 35.31 ? 82   PHE C CA  1 
ATOM   8635  C  C   . PHE C 1 79  ? 36.382  4.004   57.622  1.00 35.45 ? 82   PHE C C   1 
ATOM   8636  O  O   . PHE C 1 79  ? 36.984  3.957   58.696  1.00 35.45 ? 82   PHE C O   1 
ATOM   8637  C  CB  . PHE C 1 79  ? 36.558  6.053   56.207  1.00 35.54 ? 82   PHE C CB  1 
ATOM   8638  C  CG  . PHE C 1 79  ? 35.946  7.340   55.754  1.00 35.73 ? 82   PHE C CG  1 
ATOM   8639  C  CD1 . PHE C 1 79  ? 35.961  8.457   56.579  1.00 35.72 ? 82   PHE C CD1 1 
ATOM   8640  C  CD2 . PHE C 1 79  ? 35.278  7.414   54.540  1.00 35.73 ? 82   PHE C CD2 1 
ATOM   8641  C  CE1 . PHE C 1 79  ? 35.310  9.626   56.203  1.00 35.88 ? 82   PHE C CE1 1 
ATOM   8642  C  CE2 . PHE C 1 79  ? 34.623  8.583   54.155  1.00 35.82 ? 82   PHE C CE2 1 
ATOM   8643  C  CZ  . PHE C 1 79  ? 34.637  9.687   54.988  1.00 35.79 ? 82   PHE C CZ  1 
ATOM   8644  N  N   . GLY C 1 80  ? 36.302  2.972   56.792  1.00 35.50 ? 83   GLY C N   1 
ATOM   8645  C  CA  . GLY C 1 80  ? 36.941  1.714   57.126  1.00 35.64 ? 83   GLY C CA  1 
ATOM   8646  C  C   . GLY C 1 80  ? 36.802  0.724   55.999  1.00 35.76 ? 83   GLY C C   1 
ATOM   8647  O  O   . GLY C 1 80  ? 37.002  1.076   54.840  1.00 35.88 ? 83   GLY C O   1 
ATOM   8648  N  N   . TYR C 1 81  ? 36.423  -0.506  56.321  1.00 35.78 ? 84   TYR C N   1 
ATOM   8649  C  CA  . TYR C 1 81  ? 36.268  -1.517  55.285  1.00 35.79 ? 84   TYR C CA  1 
ATOM   8650  C  C   . TYR C 1 81  ? 35.248  -2.589  55.633  1.00 35.82 ? 84   TYR C C   1 
ATOM   8651  O  O   . TYR C 1 81  ? 34.781  -2.689  56.770  1.00 35.88 ? 84   TYR C O   1 
ATOM   8652  C  CB  . TYR C 1 81  ? 37.615  -2.186  54.983  1.00 35.73 ? 84   TYR C CB  1 
ATOM   8653  C  CG  . TYR C 1 81  ? 38.197  -2.934  56.156  1.00 35.76 ? 84   TYR C CG  1 
ATOM   8654  C  CD1 . TYR C 1 81  ? 37.908  -4.280  56.364  1.00 35.93 ? 84   TYR C CD1 1 
ATOM   8655  C  CD2 . TYR C 1 81  ? 39.009  -2.290  57.076  1.00 35.82 ? 84   TYR C CD2 1 
ATOM   8656  C  CE1 . TYR C 1 81  ? 38.413  -4.964  57.468  1.00 36.16 ? 84   TYR C CE1 1 
ATOM   8657  C  CE2 . TYR C 1 81  ? 39.520  -2.962  58.181  1.00 36.12 ? 84   TYR C CE2 1 
ATOM   8658  C  CZ  . TYR C 1 81  ? 39.220  -4.295  58.376  1.00 36.21 ? 84   TYR C CZ  1 
ATOM   8659  O  OH  . TYR C 1 81  ? 39.724  -4.944  59.486  1.00 36.39 ? 84   TYR C OH  1 
ATOM   8660  N  N   . PHE C 1 82  ? 34.873  -3.355  54.616  1.00 35.70 ? 85   PHE C N   1 
ATOM   8661  C  CA  . PHE C 1 82  ? 33.954  -4.461  54.766  1.00 35.49 ? 85   PHE C CA  1 
ATOM   8662  C  C   . PHE C 1 82  ? 34.777  -5.671  54.371  1.00 35.64 ? 85   PHE C C   1 
ATOM   8663  O  O   . PHE C 1 82  ? 35.467  -5.650  53.357  1.00 35.64 ? 85   PHE C O   1 
ATOM   8664  C  CB  . PHE C 1 82  ? 32.767  -4.316  53.821  1.00 35.05 ? 85   PHE C CB  1 
ATOM   8665  C  CG  . PHE C 1 82  ? 31.958  -5.574  53.669  1.00 34.59 ? 85   PHE C CG  1 
ATOM   8666  C  CD1 . PHE C 1 82  ? 31.228  -6.083  54.733  1.00 34.35 ? 85   PHE C CD1 1 
ATOM   8667  C  CD2 . PHE C 1 82  ? 31.943  -6.261  52.462  1.00 34.20 ? 85   PHE C CD2 1 
ATOM   8668  C  CE1 . PHE C 1 82  ? 30.500  -7.257  54.596  1.00 34.17 ? 85   PHE C CE1 1 
ATOM   8669  C  CE2 . PHE C 1 82  ? 31.219  -7.431  52.318  1.00 34.08 ? 85   PHE C CE2 1 
ATOM   8670  C  CZ  . PHE C 1 82  ? 30.496  -7.930  53.386  1.00 34.17 ? 85   PHE C CZ  1 
ATOM   8671  N  N   . GLU C 1 83  ? 34.722  -6.718  55.180  1.00 35.74 ? 86   GLU C N   1 
ATOM   8672  C  CA  . GLU C 1 83  ? 35.475  -7.926  54.893  1.00 35.85 ? 86   GLU C CA  1 
ATOM   8673  C  C   . GLU C 1 83  ? 34.539  -9.121  54.875  1.00 35.90 ? 86   GLU C C   1 
ATOM   8674  O  O   . GLU C 1 83  ? 33.752  -9.306  55.798  1.00 35.79 ? 86   GLU C O   1 
ATOM   8675  C  CB  . GLU C 1 83  ? 36.553  -8.120  55.956  1.00 36.05 ? 86   GLU C CB  1 
ATOM   8676  C  CG  . GLU C 1 83  ? 37.472  -9.306  55.722  1.00 36.39 ? 86   GLU C CG  1 
ATOM   8677  C  CD  . GLU C 1 83  ? 38.520  -9.459  56.810  1.00 36.67 ? 86   GLU C CD  1 
ATOM   8678  O  OE1 . GLU C 1 83  ? 39.596  -10.016 56.521  1.00 36.96 ? 86   GLU C OE1 1 
ATOM   8679  O  OE2 . GLU C 1 83  ? 38.275  -9.031  57.958  1.00 36.87 ? 86   GLU C OE2 1 
ATOM   8680  N  N   . VAL C 1 84  ? 34.611  -9.915  53.811  1.00 35.97 ? 87   VAL C N   1 
ATOM   8681  C  CA  . VAL C 1 84  ? 33.776  -11.103 53.669  1.00 36.11 ? 87   VAL C CA  1 
ATOM   8682  C  C   . VAL C 1 84  ? 34.311  -12.197 54.581  1.00 36.34 ? 87   VAL C C   1 
ATOM   8683  O  O   . VAL C 1 84  ? 35.509  -12.484 54.573  1.00 36.23 ? 87   VAL C O   1 
ATOM   8684  C  CB  . VAL C 1 84  ? 33.794  -11.643 52.224  1.00 36.19 ? 87   VAL C CB  1 
ATOM   8685  C  CG1 . VAL C 1 84  ? 32.812  -12.798 52.082  1.00 36.05 ? 87   VAL C CG1 1 
ATOM   8686  C  CG2 . VAL C 1 84  ? 33.476  -10.537 51.234  1.00 36.16 ? 87   VAL C CG2 1 
ATOM   8687  N  N   . THR C 1 85  ? 33.423  -12.826 55.340  1.00 36.33 ? 88   THR C N   1 
ATOM   8688  C  CA  . THR C 1 85  ? 33.834  -13.880 56.249  1.00 36.53 ? 88   THR C CA  1 
ATOM   8689  C  C   . THR C 1 85  ? 33.181  -15.213 55.913  1.00 36.77 ? 88   THR C C   1 
ATOM   8690  O  O   . THR C 1 85  ? 33.643  -16.268 56.351  1.00 36.69 ? 88   THR C O   1 
ATOM   8691  C  CB  . THR C 1 85  ? 33.523  -13.515 57.703  1.00 36.61 ? 88   THR C CB  1 
ATOM   8692  O  OG1 . THR C 1 85  ? 32.120  -13.280 57.845  1.00 36.70 ? 88   THR C OG1 1 
ATOM   8693  C  CG2 . THR C 1 85  ? 34.267  -12.265 58.107  1.00 36.65 ? 88   THR C CG2 1 
ATOM   8694  N  N   . HIS C 1 86  ? 32.105  -15.168 55.135  1.00 36.82 ? 89   HIS C N   1 
ATOM   8695  C  CA  . HIS C 1 86  ? 31.402  -16.381 54.743  1.00 36.98 ? 89   HIS C CA  1 
ATOM   8696  C  C   . HIS C 1 86  ? 31.032  -16.340 53.270  1.00 37.20 ? 89   HIS C C   1 
ATOM   8697  O  O   . HIS C 1 86  ? 31.017  -15.280 52.655  1.00 37.34 ? 89   HIS C O   1 
ATOM   8698  C  CB  . HIS C 1 86  ? 30.157  -16.592 55.604  1.00 36.86 ? 89   HIS C CB  1 
ATOM   8699  C  CG  . HIS C 1 86  ? 30.457  -16.862 57.048  1.00 36.85 ? 89   HIS C CG  1 
ATOM   8700  N  ND1 . HIS C 1 86  ? 30.925  -15.892 57.908  1.00 36.75 ? 89   HIS C ND1 1 
ATOM   8701  C  CD2 . HIS C 1 86  ? 30.334  -17.989 57.788  1.00 36.80 ? 89   HIS C CD2 1 
ATOM   8702  C  CE1 . HIS C 1 86  ? 31.075  -16.408 59.115  1.00 36.71 ? 89   HIS C CE1 1 
ATOM   8703  N  NE2 . HIS C 1 86  ? 30.723  -17.680 59.069  1.00 36.85 ? 89   HIS C NE2 1 
ATOM   8704  N  N   . ASP C 1 87  ? 30.737  -17.505 52.709  1.00 37.43 ? 90   ASP C N   1 
ATOM   8705  C  CA  . ASP C 1 87  ? 30.403  -17.631 51.296  1.00 37.67 ? 90   ASP C CA  1 
ATOM   8706  C  C   . ASP C 1 87  ? 28.907  -17.605 51.029  1.00 37.77 ? 90   ASP C C   1 
ATOM   8707  O  O   . ASP C 1 87  ? 28.209  -18.567 51.346  1.00 37.83 ? 90   ASP C O   1 
ATOM   8708  C  CB  . ASP C 1 87  ? 30.991  -18.947 50.762  1.00 38.03 ? 90   ASP C CB  1 
ATOM   8709  C  CG  . ASP C 1 87  ? 30.918  -19.074 49.242  1.00 38.32 ? 90   ASP C CG  1 
ATOM   8710  O  OD1 . ASP C 1 87  ? 30.008  -18.504 48.606  1.00 38.54 ? 90   ASP C OD1 1 
ATOM   8711  O  OD2 . ASP C 1 87  ? 31.780  -19.781 48.681  1.00 38.74 ? 90   ASP C OD2 1 
ATOM   8712  N  N   . ILE C 1 88  ? 28.423  -16.519 50.426  1.00 37.60 ? 91   ILE C N   1 
ATOM   8713  C  CA  . ILE C 1 88  ? 27.009  -16.409 50.077  1.00 37.40 ? 91   ILE C CA  1 
ATOM   8714  C  C   . ILE C 1 88  ? 26.834  -16.267 48.563  1.00 37.61 ? 91   ILE C C   1 
ATOM   8715  O  O   . ILE C 1 88  ? 25.793  -15.798 48.085  1.00 37.56 ? 91   ILE C O   1 
ATOM   8716  C  CB  . ILE C 1 88  ? 26.287  -15.242 50.796  1.00 37.12 ? 91   ILE C CB  1 
ATOM   8717  C  CG1 . ILE C 1 88  ? 26.905  -13.898 50.418  1.00 36.95 ? 91   ILE C CG1 1 
ATOM   8718  C  CG2 . ILE C 1 88  ? 26.304  -15.454 52.288  1.00 36.82 ? 91   ILE C CG2 1 
ATOM   8719  C  CD1 . ILE C 1 88  ? 26.046  -12.717 50.801  1.00 36.46 ? 91   ILE C CD1 1 
ATOM   8720  N  N   . THR C 1 89  ? 27.837  -16.710 47.808  1.00 37.72 ? 92   THR C N   1 
ATOM   8721  C  CA  . THR C 1 89  ? 27.773  -16.633 46.356  1.00 38.10 ? 92   THR C CA  1 
ATOM   8722  C  C   . THR C 1 89  ? 26.660  -17.504 45.773  1.00 38.62 ? 92   THR C C   1 
ATOM   8723  O  O   . THR C 1 89  ? 26.361  -17.417 44.584  1.00 38.62 ? 92   THR C O   1 
ATOM   8724  C  CB  . THR C 1 89  ? 29.106  -17.002 45.695  1.00 37.92 ? 92   THR C CB  1 
ATOM   8725  O  OG1 . THR C 1 89  ? 29.399  -18.378 45.942  1.00 37.63 ? 92   THR C OG1 1 
ATOM   8726  C  CG2 . THR C 1 89  ? 30.214  -16.153 46.247  1.00 37.74 ? 92   THR C CG2 1 
ATOM   8727  N  N   . LYS C 1 90  ? 26.066  -18.365 46.594  1.00 39.16 ? 93   LYS C N   1 
ATOM   8728  C  CA  . LYS C 1 90  ? 24.962  -19.202 46.127  1.00 39.64 ? 93   LYS C CA  1 
ATOM   8729  C  C   . LYS C 1 90  ? 23.707  -18.329 46.041  1.00 39.70 ? 93   LYS C C   1 
ATOM   8730  O  O   . LYS C 1 90  ? 22.729  -18.694 45.384  1.00 39.81 ? 93   LYS C O   1 
ATOM   8731  C  CB  . LYS C 1 90  ? 24.715  -20.380 47.077  1.00 40.06 ? 93   LYS C CB  1 
ATOM   8732  C  CG  . LYS C 1 90  ? 24.461  -19.972 48.516  1.00 41.02 ? 93   LYS C CG  1 
ATOM   8733  C  CD  . LYS C 1 90  ? 24.399  -21.177 49.447  1.00 41.86 ? 93   LYS C CD  1 
ATOM   8734  C  CE  . LYS C 1 90  ? 22.971  -21.717 49.589  1.00 42.58 ? 93   LYS C CE  1 
ATOM   8735  N  NZ  . LYS C 1 90  ? 22.288  -22.041 48.295  1.00 42.93 ? 93   LYS C NZ  1 
ATOM   8736  N  N   . TYR C 1 91  ? 23.758  -17.163 46.684  1.00 39.45 ? 94   TYR C N   1 
ATOM   8737  C  CA  . TYR C 1 91  ? 22.641  -16.229 46.690  1.00 39.17 ? 94   TYR C CA  1 
ATOM   8738  C  C   . TYR C 1 91  ? 22.893  -15.004 45.816  1.00 38.93 ? 94   TYR C C   1 
ATOM   8739  O  O   . TYR C 1 91  ? 22.004  -14.530 45.104  1.00 38.75 ? 94   TYR C O   1 
ATOM   8740  C  CB  . TYR C 1 91  ? 22.366  -15.768 48.116  1.00 39.36 ? 94   TYR C CB  1 
ATOM   8741  C  CG  . TYR C 1 91  ? 22.028  -16.886 49.068  1.00 39.54 ? 94   TYR C CG  1 
ATOM   8742  C  CD1 . TYR C 1 91  ? 22.742  -17.053 50.249  1.00 39.59 ? 94   TYR C CD1 1 
ATOM   8743  C  CD2 . TYR C 1 91  ? 20.977  -17.763 48.803  1.00 39.56 ? 94   TYR C CD2 1 
ATOM   8744  C  CE1 . TYR C 1 91  ? 22.415  -18.064 51.147  1.00 39.75 ? 94   TYR C CE1 1 
ATOM   8745  C  CE2 . TYR C 1 91  ? 20.641  -18.778 49.700  1.00 39.54 ? 94   TYR C CE2 1 
ATOM   8746  C  CZ  . TYR C 1 91  ? 21.364  -18.917 50.868  1.00 39.73 ? 94   TYR C CZ  1 
ATOM   8747  O  OH  . TYR C 1 91  ? 21.021  -19.887 51.778  1.00 40.14 ? 94   TYR C OH  1 
ATOM   8748  N  N   . SER C 1 92  ? 24.113  -14.493 45.865  1.00 38.62 ? 95   SER C N   1 
ATOM   8749  C  CA  . SER C 1 92  ? 24.434  -13.306 45.101  1.00 38.46 ? 95   SER C CA  1 
ATOM   8750  C  C   . SER C 1 92  ? 25.766  -13.369 44.380  1.00 38.38 ? 95   SER C C   1 
ATOM   8751  O  O   . SER C 1 92  ? 26.769  -13.812 44.939  1.00 38.54 ? 95   SER C O   1 
ATOM   8752  C  CB  . SER C 1 92  ? 24.423  -12.101 46.031  1.00 38.25 ? 95   SER C CB  1 
ATOM   8753  O  OG  . SER C 1 92  ? 24.780  -10.928 45.331  1.00 38.38 ? 95   SER C OG  1 
ATOM   8754  N  N   . LYS C 1 93  ? 25.774  -12.875 43.150  1.00 38.15 ? 96   LYS C N   1 
ATOM   8755  C  CA  . LYS C 1 93  ? 26.973  -12.846 42.332  1.00 38.00 ? 96   LYS C CA  1 
ATOM   8756  C  C   . LYS C 1 93  ? 27.766  -11.553 42.503  1.00 37.96 ? 96   LYS C C   1 
ATOM   8757  O  O   . LYS C 1 93  ? 28.792  -11.374 41.854  1.00 37.85 ? 96   LYS C O   1 
ATOM   8758  C  CB  . LYS C 1 93  ? 26.591  -12.976 40.869  1.00 38.04 ? 96   LYS C CB  1 
ATOM   8759  C  CG  . LYS C 1 93  ? 25.713  -11.845 40.392  1.00 38.12 ? 96   LYS C CG  1 
ATOM   8760  C  CD  . LYS C 1 93  ? 25.498  -11.915 38.903  1.00 38.31 ? 96   LYS C CD  1 
ATOM   8761  C  CE  . LYS C 1 93  ? 24.492  -10.873 38.471  1.00 38.48 ? 96   LYS C CE  1 
ATOM   8762  N  NZ  . LYS C 1 93  ? 24.213  -10.955 37.009  1.00 38.82 ? 96   LYS C NZ  1 
ATOM   8763  N  N   . ALA C 1 94  ? 27.278  -10.640 43.341  1.00 37.99 ? 97   ALA C N   1 
ATOM   8764  C  CA  . ALA C 1 94  ? 27.949  -9.359  43.569  1.00 37.98 ? 97   ALA C CA  1 
ATOM   8765  C  C   . ALA C 1 94  ? 29.414  -9.552  43.932  1.00 38.13 ? 97   ALA C C   1 
ATOM   8766  O  O   . ALA C 1 94  ? 29.756  -10.362 44.793  1.00 37.96 ? 97   ALA C O   1 
ATOM   8767  C  CB  . ALA C 1 94  ? 27.237  -8.565  44.644  1.00 37.74 ? 97   ALA C CB  1 
ATOM   8768  N  N   . LYS C 1 95  ? 30.275  -8.811  43.245  1.00 38.26 ? 98   LYS C N   1 
ATOM   8769  C  CA  . LYS C 1 95  ? 31.712  -8.891  43.460  1.00 38.39 ? 98   LYS C CA  1 
ATOM   8770  C  C   . LYS C 1 95  ? 32.140  -8.585  44.884  1.00 38.27 ? 98   LYS C C   1 
ATOM   8771  O  O   . LYS C 1 95  ? 33.105  -9.156  45.373  1.00 38.20 ? 98   LYS C O   1 
ATOM   8772  C  CB  . LYS C 1 95  ? 32.439  -7.992  42.469  1.00 38.65 ? 98   LYS C CB  1 
ATOM   8773  C  CG  . LYS C 1 95  ? 32.295  -8.467  41.047  1.00 39.24 ? 98   LYS C CG  1 
ATOM   8774  C  CD  . LYS C 1 95  ? 33.133  -7.625  40.137  1.00 40.24 ? 98   LYS C CD  1 
ATOM   8775  C  CE  . LYS C 1 95  ? 33.082  -8.145  38.717  1.00 41.00 ? 98   LYS C CE  1 
ATOM   8776  N  NZ  . LYS C 1 95  ? 33.879  -7.253  37.830  1.00 41.71 ? 98   LYS C NZ  1 
ATOM   8777  N  N   . VAL C 1 96  ? 31.408  -7.708  45.553  1.00 38.15 ? 99   VAL C N   1 
ATOM   8778  C  CA  . VAL C 1 96  ? 31.717  -7.360  46.927  1.00 38.28 ? 99   VAL C CA  1 
ATOM   8779  C  C   . VAL C 1 96  ? 31.680  -8.600  47.833  1.00 38.59 ? 99   VAL C C   1 
ATOM   8780  O  O   . VAL C 1 96  ? 32.282  -8.608  48.904  1.00 38.57 ? 99   VAL C O   1 
ATOM   8781  C  CB  . VAL C 1 96  ? 30.734  -6.290  47.451  1.00 38.22 ? 99   VAL C CB  1 
ATOM   8782  C  CG1 . VAL C 1 96  ? 29.314  -6.844  47.509  1.00 37.90 ? 99   VAL C CG1 1 
ATOM   8783  C  CG2 . VAL C 1 96  ? 31.180  -5.776  48.802  1.00 38.09 ? 99   VAL C CG2 1 
ATOM   8784  N  N   . PHE C 1 97  ? 30.995  -9.652  47.389  1.00 38.88 ? 100  PHE C N   1 
ATOM   8785  C  CA  . PHE C 1 97  ? 30.885  -10.891 48.164  1.00 39.15 ? 100  PHE C CA  1 
ATOM   8786  C  C   . PHE C 1 97  ? 31.645  -12.060 47.535  1.00 39.56 ? 100  PHE C C   1 
ATOM   8787  O  O   . PHE C 1 97  ? 31.692  -13.137 48.131  1.00 39.60 ? 100  PHE C O   1 
ATOM   8788  C  CB  . PHE C 1 97  ? 29.421  -11.367 48.258  1.00 39.00 ? 100  PHE C CB  1 
ATOM   8789  C  CG  . PHE C 1 97  ? 28.459  -10.359 48.824  1.00 39.02 ? 100  PHE C CG  1 
ATOM   8790  C  CD1 . PHE C 1 97  ? 28.700  -9.738  50.043  1.00 38.95 ? 100  PHE C CD1 1 
ATOM   8791  C  CD2 . PHE C 1 97  ? 27.276  -10.067 48.151  1.00 38.96 ? 100  PHE C CD2 1 
ATOM   8792  C  CE1 . PHE C 1 97  ? 27.774  -8.843  50.582  1.00 38.91 ? 100  PHE C CE1 1 
ATOM   8793  C  CE2 . PHE C 1 97  ? 26.347  -9.172  48.683  1.00 38.86 ? 100  PHE C CE2 1 
ATOM   8794  C  CZ  . PHE C 1 97  ? 26.598  -8.563  49.899  1.00 38.86 ? 100  PHE C CZ  1 
ATOM   8795  N  N   . GLU C 1 98  ? 32.261  -11.861 46.369  1.00 39.74 ? 101  GLU C N   1 
ATOM   8796  C  CA  . GLU C 1 98  ? 32.905  -12.971 45.665  1.00 40.09 ? 101  GLU C CA  1 
ATOM   8797  C  C   . GLU C 1 98  ? 33.865  -13.916 46.363  1.00 40.05 ? 101  GLU C C   1 
ATOM   8798  O  O   . GLU C 1 98  ? 33.899  -15.097 46.031  1.00 40.06 ? 101  GLU C O   1 
ATOM   8799  C  CB  . GLU C 1 98  ? 33.478  -12.529 44.324  1.00 40.45 ? 101  GLU C CB  1 
ATOM   8800  C  CG  . GLU C 1 98  ? 34.786  -11.805 44.390  1.00 41.26 ? 101  GLU C CG  1 
ATOM   8801  C  CD  . GLU C 1 98  ? 35.319  -11.484 43.006  1.00 41.81 ? 101  GLU C CD  1 
ATOM   8802  O  OE1 . GLU C 1 98  ? 36.017  -10.455 42.870  1.00 42.35 ? 101  GLU C OE1 1 
ATOM   8803  O  OE2 . GLU C 1 98  ? 35.051  -12.259 42.055  1.00 42.01 ? 101  GLU C OE2 1 
ATOM   8804  N  N   . HIS C 1 99  ? 34.642  -13.429 47.319  1.00 40.04 ? 102  HIS C N   1 
ATOM   8805  C  CA  . HIS C 1 99  ? 35.569  -14.308 48.025  1.00 40.02 ? 102  HIS C CA  1 
ATOM   8806  C  C   . HIS C 1 99  ? 35.669  -13.987 49.499  1.00 39.84 ? 102  HIS C C   1 
ATOM   8807  O  O   . HIS C 1 99  ? 35.579  -12.826 49.897  1.00 39.83 ? 102  HIS C O   1 
ATOM   8808  C  CB  . HIS C 1 99  ? 36.968  -14.241 47.409  1.00 40.35 ? 102  HIS C CB  1 
ATOM   8809  C  CG  . HIS C 1 99  ? 37.133  -15.094 46.195  1.00 40.83 ? 102  HIS C CG  1 
ATOM   8810  N  ND1 . HIS C 1 99  ? 37.518  -14.583 44.975  1.00 41.19 ? 102  HIS C ND1 1 
ATOM   8811  C  CD2 . HIS C 1 99  ? 36.947  -16.422 46.007  1.00 40.93 ? 102  HIS C CD2 1 
ATOM   8812  C  CE1 . HIS C 1 99  ? 37.559  -15.559 44.084  1.00 41.26 ? 102  HIS C CE1 1 
ATOM   8813  N  NE2 . HIS C 1 99  ? 37.217  -16.685 44.685  1.00 41.28 ? 102  HIS C NE2 1 
ATOM   8814  N  N   . ILE C 1 100 ? 35.841  -15.022 50.313  1.00 39.37 ? 103  ILE C N   1 
ATOM   8815  C  CA  . ILE C 1 100 ? 35.990  -14.824 51.743  1.00 38.86 ? 103  ILE C CA  1 
ATOM   8816  C  C   . ILE C 1 100 ? 37.352  -14.173 51.939  1.00 38.69 ? 103  ILE C C   1 
ATOM   8817  O  O   . ILE C 1 100 ? 38.346  -14.613 51.356  1.00 38.57 ? 103  ILE C O   1 
ATOM   8818  C  CB  . ILE C 1 100 ? 35.945  -16.156 52.499  1.00 38.91 ? 103  ILE C CB  1 
ATOM   8819  C  CG1 . ILE C 1 100 ? 34.590  -16.828 52.285  1.00 38.73 ? 103  ILE C CG1 1 
ATOM   8820  C  CG2 . ILE C 1 100 ? 36.201  -15.930 53.981  1.00 38.69 ? 103  ILE C CG2 1 
ATOM   8821  C  CD1 . ILE C 1 100 ? 34.467  -18.185 52.950  1.00 38.75 ? 103  ILE C CD1 1 
ATOM   8822  N  N   . GLY C 1 101 ? 37.380  -13.086 52.704  1.00 38.40 ? 104  GLY C N   1 
ATOM   8823  C  CA  . GLY C 1 101 ? 38.629  -12.386 52.947  1.00 38.09 ? 104  GLY C CA  1 
ATOM   8824  C  C   . GLY C 1 101 ? 38.802  -11.145 52.091  1.00 37.85 ? 104  GLY C C   1 
ATOM   8825  O  O   . GLY C 1 101 ? 39.731  -10.368 52.302  1.00 37.84 ? 104  GLY C O   1 
ATOM   8826  N  N   . LYS C 1 102 ? 37.921  -10.966 51.113  1.00 37.68 ? 105  LYS C N   1 
ATOM   8827  C  CA  . LYS C 1 102 ? 37.969  -9.811  50.222  1.00 37.54 ? 105  LYS C CA  1 
ATOM   8828  C  C   . LYS C 1 102 ? 37.507  -8.549  50.951  1.00 37.39 ? 105  LYS C C   1 
ATOM   8829  O  O   . LYS C 1 102 ? 36.416  -8.516  51.519  1.00 37.28 ? 105  LYS C O   1 
ATOM   8830  C  CB  . LYS C 1 102 ? 37.076  -10.066 49.004  1.00 37.52 ? 105  LYS C CB  1 
ATOM   8831  C  CG  . LYS C 1 102 ? 37.026  -8.933  47.989  1.00 37.55 ? 105  LYS C CG  1 
ATOM   8832  C  CD  . LYS C 1 102 ? 36.093  -9.280  46.842  1.00 37.72 ? 105  LYS C CD  1 
ATOM   8833  C  CE  . LYS C 1 102 ? 35.985  -8.142  45.834  1.00 37.87 ? 105  LYS C CE  1 
ATOM   8834  N  NZ  . LYS C 1 102 ? 37.278  -7.822  45.171  1.00 38.05 ? 105  LYS C NZ  1 
ATOM   8835  N  N   . LYS C 1 103 ? 38.344  -7.517  50.953  1.00 37.34 ? 106  LYS C N   1 
ATOM   8836  C  CA  . LYS C 1 103 ? 37.989  -6.268  51.611  1.00 37.30 ? 106  LYS C CA  1 
ATOM   8837  C  C   . LYS C 1 103 ? 37.571  -5.196  50.615  1.00 37.13 ? 106  LYS C C   1 
ATOM   8838  O  O   . LYS C 1 103 ? 38.168  -5.065  49.545  1.00 37.18 ? 106  LYS C O   1 
ATOM   8839  C  CB  . LYS C 1 103 ? 39.154  -5.743  52.441  1.00 37.39 ? 106  LYS C CB  1 
ATOM   8840  C  CG  . LYS C 1 103 ? 39.614  -6.693  53.498  1.00 37.90 ? 106  LYS C CG  1 
ATOM   8841  C  CD  . LYS C 1 103 ? 40.716  -6.090  54.342  1.00 38.33 ? 106  LYS C CD  1 
ATOM   8842  C  CE  . LYS C 1 103 ? 41.249  -7.144  55.293  1.00 38.77 ? 106  LYS C CE  1 
ATOM   8843  N  NZ  . LYS C 1 103 ? 42.309  -6.613  56.162  1.00 39.38 ? 106  LYS C NZ  1 
ATOM   8844  N  N   . THR C 1 104 ? 36.540  -4.435  50.981  1.00 36.90 ? 107  THR C N   1 
ATOM   8845  C  CA  . THR C 1 104 ? 36.023  -3.338  50.162  1.00 36.39 ? 107  THR C CA  1 
ATOM   8846  C  C   . THR C 1 104 ? 35.945  -2.104  51.057  1.00 36.16 ? 107  THR C C   1 
ATOM   8847  O  O   . THR C 1 104 ? 35.377  -2.149  52.150  1.00 36.15 ? 107  THR C O   1 
ATOM   8848  C  CB  . THR C 1 104 ? 34.613  -3.648  49.611  1.00 36.17 ? 107  THR C CB  1 
ATOM   8849  O  OG1 . THR C 1 104 ? 34.666  -4.819  48.790  1.00 35.88 ? 107  THR C OG1 1 
ATOM   8850  C  CG2 . THR C 1 104 ? 34.095  -2.493  48.780  1.00 35.88 ? 107  THR C CG2 1 
ATOM   8851  N  N   . PRO C 1 105 ? 36.552  -0.993  50.623  1.00 35.99 ? 108  PRO C N   1 
ATOM   8852  C  CA  . PRO C 1 105 ? 36.534  0.244   51.407  1.00 35.77 ? 108  PRO C CA  1 
ATOM   8853  C  C   . PRO C 1 105 ? 35.113  0.715   51.630  1.00 35.45 ? 108  PRO C C   1 
ATOM   8854  O  O   . PRO C 1 105 ? 34.264  0.567   50.753  1.00 35.59 ? 108  PRO C O   1 
ATOM   8855  C  CB  . PRO C 1 105 ? 37.283  1.227   50.508  1.00 35.84 ? 108  PRO C CB  1 
ATOM   8856  C  CG  . PRO C 1 105 ? 38.218  0.347   49.755  1.00 36.03 ? 108  PRO C CG  1 
ATOM   8857  C  CD  . PRO C 1 105 ? 37.351  -0.828  49.399  1.00 35.99 ? 108  PRO C CD  1 
ATOM   8858  N  N   . ILE C 1 106 ? 34.841  1.249   52.813  1.00 35.17 ? 109  ILE C N   1 
ATOM   8859  C  CA  . ILE C 1 106 ? 33.509  1.753   53.108  1.00 34.90 ? 109  ILE C CA  1 
ATOM   8860  C  C   . ILE C 1 106 ? 33.546  3.140   53.724  1.00 34.81 ? 109  ILE C C   1 
ATOM   8861  O  O   . ILE C 1 106 ? 34.554  3.564   54.294  1.00 34.71 ? 109  ILE C O   1 
ATOM   8862  C  CB  . ILE C 1 106 ? 32.713  0.840   54.067  1.00 34.53 ? 109  ILE C CB  1 
ATOM   8863  C  CG1 . ILE C 1 106 ? 33.403  0.768   55.430  1.00 34.35 ? 109  ILE C CG1 1 
ATOM   8864  C  CG2 . ILE C 1 106 ? 32.505  -0.523  53.452  1.00 34.52 ? 109  ILE C CG2 1 
ATOM   8865  C  CD1 . ILE C 1 106 ? 32.640  -0.011  56.470  1.00 34.00 ? 109  ILE C CD1 1 
ATOM   8866  N  N   . ALA C 1 107 ? 32.431  3.842   53.577  1.00 34.60 ? 110  ALA C N   1 
ATOM   8867  C  CA  . ALA C 1 107 ? 32.252  5.170   54.134  1.00 34.51 ? 110  ALA C CA  1 
ATOM   8868  C  C   . ALA C 1 107 ? 30.952  5.039   54.912  1.00 34.58 ? 110  ALA C C   1 
ATOM   8869  O  O   . ALA C 1 107 ? 30.012  4.385   54.452  1.00 34.46 ? 110  ALA C O   1 
ATOM   8870  C  CB  . ALA C 1 107 ? 32.113  6.189   53.029  1.00 34.53 ? 110  ALA C CB  1 
ATOM   8871  N  N   . VAL C 1 108 ? 30.910  5.621   56.104  1.00 34.52 ? 111  VAL C N   1 
ATOM   8872  C  CA  . VAL C 1 108 ? 29.726  5.525   56.948  1.00 34.47 ? 111  VAL C CA  1 
ATOM   8873  C  C   . VAL C 1 108 ? 29.325  6.852   57.577  1.00 34.38 ? 111  VAL C C   1 
ATOM   8874  O  O   . VAL C 1 108 ? 30.167  7.693   57.874  1.00 34.26 ? 111  VAL C O   1 
ATOM   8875  C  CB  . VAL C 1 108 ? 29.955  4.475   58.091  1.00 34.56 ? 111  VAL C CB  1 
ATOM   8876  C  CG1 . VAL C 1 108 ? 28.838  4.527   59.118  1.00 34.55 ? 111  VAL C CG1 1 
ATOM   8877  C  CG2 . VAL C 1 108 ? 30.045  3.071   57.517  1.00 34.41 ? 111  VAL C CG2 1 
ATOM   8878  N  N   . ARG C 1 109 ? 28.024  7.057   57.721  1.00 34.15 ? 112  ARG C N   1 
ATOM   8879  C  CA  . ARG C 1 109 ? 27.523  8.248   58.378  1.00 34.18 ? 112  ARG C CA  1 
ATOM   8880  C  C   . ARG C 1 109 ? 26.355  7.849   59.265  1.00 34.49 ? 112  ARG C C   1 
ATOM   8881  O  O   . ARG C 1 109 ? 25.434  7.160   58.821  1.00 34.33 ? 112  ARG C O   1 
ATOM   8882  C  CB  . ARG C 1 109 ? 27.094  9.325   57.384  1.00 33.91 ? 112  ARG C CB  1 
ATOM   8883  C  CG  . ARG C 1 109 ? 26.728  10.649  58.057  1.00 33.19 ? 112  ARG C CG  1 
ATOM   8884  C  CD  . ARG C 1 109 ? 26.446  11.743  57.039  1.00 32.97 ? 112  ARG C CD  1 
ATOM   8885  N  NE  . ARG C 1 109 ? 25.985  12.979  57.670  1.00 32.68 ? 112  ARG C NE  1 
ATOM   8886  C  CZ  . ARG C 1 109 ? 24.731  13.210  58.050  1.00 32.63 ? 112  ARG C CZ  1 
ATOM   8887  N  NH1 . ARG C 1 109 ? 23.788  12.300  57.869  1.00 32.47 ? 112  ARG C NH1 1 
ATOM   8888  N  NH2 . ARG C 1 109 ? 24.418  14.356  58.628  1.00 32.56 ? 112  ARG C NH2 1 
ATOM   8889  N  N   . PHE C 1 110 ? 26.461  8.206   60.544  1.00 34.65 ? 113  PHE C N   1 
ATOM   8890  C  CA  . PHE C 1 110 ? 25.428  7.934   61.543  1.00 34.92 ? 113  PHE C CA  1 
ATOM   8891  C  C   . PHE C 1 110 ? 24.687  9.245   61.742  1.00 35.10 ? 113  PHE C C   1 
ATOM   8892  O  O   . PHE C 1 110 ? 25.276  10.314  61.569  1.00 35.06 ? 113  PHE C O   1 
ATOM   8893  C  CB  . PHE C 1 110 ? 26.058  7.536   62.871  1.00 34.74 ? 113  PHE C CB  1 
ATOM   8894  C  CG  . PHE C 1 110 ? 26.937  6.338   62.792  1.00 34.71 ? 113  PHE C CG  1 
ATOM   8895  C  CD1 . PHE C 1 110 ? 28.313  6.478   62.795  1.00 34.87 ? 113  PHE C CD1 1 
ATOM   8896  C  CD2 . PHE C 1 110 ? 26.394  5.066   62.769  1.00 34.82 ? 113  PHE C CD2 1 
ATOM   8897  C  CE1 . PHE C 1 110 ? 29.145  5.358   62.783  1.00 35.12 ? 113  PHE C CE1 1 
ATOM   8898  C  CE2 . PHE C 1 110 ? 27.210  3.940   62.757  1.00 34.93 ? 113  PHE C CE2 1 
ATOM   8899  C  CZ  . PHE C 1 110 ? 28.587  4.082   62.764  1.00 34.97 ? 113  PHE C CZ  1 
ATOM   8900  N  N   . SER C 1 111 ? 23.428  9.184   62.166  1.00 35.25 ? 114  SER C N   1 
ATOM   8901  C  CA  . SER C 1 111 ? 22.659  10.412  62.346  1.00 35.50 ? 114  SER C CA  1 
ATOM   8902  C  C   . SER C 1 111 ? 21.350  10.222  63.092  1.00 35.72 ? 114  SER C C   1 
ATOM   8903  O  O   . SER C 1 111 ? 20.910  9.096   63.295  1.00 35.63 ? 114  SER C O   1 
ATOM   8904  C  CB  . SER C 1 111 ? 22.328  10.993  60.966  1.00 35.56 ? 114  SER C CB  1 
ATOM   8905  O  OG  . SER C 1 111 ? 21.613  10.048  60.177  1.00 35.52 ? 114  SER C OG  1 
ATOM   8906  N  N   . THR C 1 112 ? 20.760  11.335  63.537  1.00 35.78 ? 115  THR C N   1 
ATOM   8907  C  CA  . THR C 1 112 ? 19.447  11.313  64.184  1.00 35.74 ? 115  THR C CA  1 
ATOM   8908  C  C   . THR C 1 112 ? 18.493  11.591  63.019  1.00 35.86 ? 115  THR C C   1 
ATOM   8909  O  O   . THR C 1 112 ? 18.912  11.528  61.862  1.00 35.82 ? 115  THR C O   1 
ATOM   8910  C  CB  . THR C 1 112 ? 19.294  12.392  65.265  1.00 35.71 ? 115  THR C CB  1 
ATOM   8911  O  OG1 . THR C 1 112 ? 19.571  13.678  64.706  1.00 35.68 ? 115  THR C OG1 1 
ATOM   8912  C  CG2 . THR C 1 112 ? 20.235  12.126  66.421  1.00 35.56 ? 115  THR C CG2 1 
ATOM   8913  N  N   . VAL C 1 113 ? 17.236  11.921  63.279  1.00 35.74 ? 116  VAL C N   1 
ATOM   8914  C  CA  . VAL C 1 113 ? 16.334  12.153  62.156  1.00 35.80 ? 116  VAL C CA  1 
ATOM   8915  C  C   . VAL C 1 113 ? 15.708  13.539  62.016  1.00 36.07 ? 116  VAL C C   1 
ATOM   8916  O  O   . VAL C 1 113 ? 15.917  14.212  61.007  1.00 36.04 ? 116  VAL C O   1 
ATOM   8917  C  CB  . VAL C 1 113 ? 15.220  11.089  62.107  1.00 35.79 ? 116  VAL C CB  1 
ATOM   8918  C  CG1 . VAL C 1 113 ? 14.265  11.378  60.963  1.00 35.58 ? 116  VAL C CG1 1 
ATOM   8919  C  CG2 . VAL C 1 113 ? 15.820  9.713   61.939  1.00 35.53 ? 116  VAL C CG2 1 
ATOM   8920  N  N   . ALA C 1 114 ? 14.937  13.954  63.018  1.00 36.31 ? 117  ALA C N   1 
ATOM   8921  C  CA  . ALA C 1 114 ? 14.237  15.239  62.999  1.00 36.29 ? 117  ALA C CA  1 
ATOM   8922  C  C   . ALA C 1 114 ? 15.072  16.504  63.200  1.00 36.47 ? 117  ALA C C   1 
ATOM   8923  O  O   . ALA C 1 114 ? 14.867  17.501  62.502  1.00 36.54 ? 117  ALA C O   1 
ATOM   8924  C  CB  . ALA C 1 114 ? 13.085  15.211  64.007  1.00 36.26 ? 117  ALA C CB  1 
ATOM   8925  N  N   . GLY C 1 115 ? 16.001  16.468  64.149  1.00 36.39 ? 118  GLY C N   1 
ATOM   8926  C  CA  . GLY C 1 115 ? 16.821  17.633  64.442  1.00 36.50 ? 118  GLY C CA  1 
ATOM   8927  C  C   . GLY C 1 115 ? 17.665  18.199  63.319  1.00 36.67 ? 118  GLY C C   1 
ATOM   8928  O  O   . GLY C 1 115 ? 18.149  17.460  62.459  1.00 36.71 ? 118  GLY C O   1 
ATOM   8929  N  N   . GLU C 1 116 ? 17.825  19.522  63.324  1.00 36.74 ? 119  GLU C N   1 
ATOM   8930  C  CA  . GLU C 1 116 ? 18.618  20.225  62.319  1.00 36.66 ? 119  GLU C CA  1 
ATOM   8931  C  C   . GLU C 1 116 ? 20.095  20.160  62.682  1.00 36.63 ? 119  GLU C C   1 
ATOM   8932  O  O   . GLU C 1 116 ? 20.468  19.557  63.685  1.00 36.58 ? 119  GLU C O   1 
ATOM   8933  C  CB  . GLU C 1 116 ? 18.196  21.695  62.231  1.00 36.81 ? 119  GLU C CB  1 
ATOM   8934  C  CG  . GLU C 1 116 ? 16.761  21.937  61.805  1.00 37.14 ? 119  GLU C CG  1 
ATOM   8935  C  CD  . GLU C 1 116 ? 15.757  21.775  62.933  1.00 37.52 ? 119  GLU C CD  1 
ATOM   8936  O  OE1 . GLU C 1 116 ? 14.545  21.807  62.638  1.00 37.85 ? 119  GLU C OE1 1 
ATOM   8937  O  OE2 . GLU C 1 116 ? 16.159  21.633  64.110  1.00 37.60 ? 119  GLU C OE2 1 
ATOM   8938  N  N   A SER C 1 117 ? 20.931  20.803  61.872  0.50 36.67 ? 120  SER C N   1 
ATOM   8939  N  N   B SER C 1 117 ? 20.927  20.783  61.851  0.50 36.69 ? 120  SER C N   1 
ATOM   8940  C  CA  A SER C 1 117 ? 22.380  20.808  62.064  0.50 36.68 ? 120  SER C CA  1 
ATOM   8941  C  CA  B SER C 1 117 ? 22.354  20.845  62.118  0.50 36.75 ? 120  SER C CA  1 
ATOM   8942  C  C   A SER C 1 117 ? 22.927  21.145  63.450  0.50 36.77 ? 120  SER C C   1 
ATOM   8943  C  C   B SER C 1 117 ? 22.443  21.788  63.307  0.50 36.86 ? 120  SER C C   1 
ATOM   8944  O  O   A SER C 1 117 ? 23.937  20.583  63.865  0.50 36.73 ? 120  SER C O   1 
ATOM   8945  O  O   B SER C 1 117 ? 21.933  22.908  63.259  0.50 36.88 ? 120  SER C O   1 
ATOM   8946  C  CB  A SER C 1 117 ? 23.042  21.710  61.024  0.50 36.58 ? 120  SER C CB  1 
ATOM   8947  C  CB  B SER C 1 117 ? 23.107  21.433  60.923  0.50 36.66 ? 120  SER C CB  1 
ATOM   8948  O  OG  A SER C 1 117 ? 22.895  21.168  59.723  0.50 36.51 ? 120  SER C OG  1 
ATOM   8949  O  OG  B SER C 1 117 ? 23.007  20.595  59.785  0.50 36.53 ? 120  SER C OG  1 
ATOM   8950  N  N   A GLY C 1 118 ? 22.283  22.061  64.163  0.50 36.86 ? 121  GLY C N   1 
ATOM   8951  N  N   B GLY C 1 118 ? 23.041  21.315  64.391  0.50 36.95 ? 121  GLY C N   1 
ATOM   8952  C  CA  A GLY C 1 118 ? 22.779  22.417  65.482  0.50 36.93 ? 121  GLY C CA  1 
ATOM   8953  C  CA  B GLY C 1 118 ? 23.139  22.136  65.580  0.50 36.98 ? 121  GLY C CA  1 
ATOM   8954  C  C   A GLY C 1 118 ? 22.052  21.756  66.638  0.50 36.89 ? 121  GLY C C   1 
ATOM   8955  C  C   B GLY C 1 118 ? 22.377  21.489  66.719  0.50 36.92 ? 121  GLY C C   1 
ATOM   8956  O  O   A GLY C 1 118 ? 22.078  22.268  67.756  0.50 36.98 ? 121  GLY C O   1 
ATOM   8957  O  O   B GLY C 1 118 ? 22.604  21.820  67.883  0.50 37.03 ? 121  GLY C O   1 
ATOM   8958  N  N   . SER C 1 119 ? 21.435  20.604  66.386  1.00 36.98 ? 122  SER C N   1 
ATOM   8959  C  CA  . SER C 1 119 ? 20.675  19.897  67.412  1.00 36.49 ? 122  SER C CA  1 
ATOM   8960  C  C   . SER C 1 119 ? 21.542  18.873  68.126  1.00 36.67 ? 122  SER C C   1 
ATOM   8961  O  O   . SER C 1 119 ? 22.646  18.557  67.674  1.00 36.62 ? 122  SER C O   1 
ATOM   8962  C  CB  . SER C 1 119 ? 19.426  19.241  66.819  1.00 36.22 ? 122  SER C CB  1 
ATOM   8963  O  OG  . SER C 1 119 ? 19.756  18.270  65.847  1.00 36.01 ? 122  SER C OG  1 
ATOM   8964  N  N   . ALA C 1 120 ? 21.033  18.366  69.246  1.00 36.86 ? 123  ALA C N   1 
ATOM   8965  C  CA  . ALA C 1 120 ? 21.748  17.396  70.073  1.00 36.88 ? 123  ALA C CA  1 
ATOM   8966  C  C   . ALA C 1 120 ? 21.697  15.950  69.591  1.00 36.95 ? 123  ALA C C   1 
ATOM   8967  O  O   . ALA C 1 120 ? 20.711  15.502  68.998  1.00 36.88 ? 123  ALA C O   1 
ATOM   8968  C  CB  . ALA C 1 120 ? 21.269  17.486  71.510  1.00 36.80 ? 123  ALA C CB  1 
ATOM   8969  N  N   . ASP C 1 121 ? 22.770  15.222  69.887  1.00 36.92 ? 124  ASP C N   1 
ATOM   8970  C  CA  . ASP C 1 121 ? 22.911  13.830  69.503  1.00 36.80 ? 124  ASP C CA  1 
ATOM   8971  C  C   . ASP C 1 121 ? 22.100  12.893  70.376  1.00 36.84 ? 124  ASP C C   1 
ATOM   8972  O  O   . ASP C 1 121 ? 21.444  11.984  69.874  1.00 36.93 ? 124  ASP C O   1 
ATOM   8973  C  CB  . ASP C 1 121 ? 24.386  13.418  69.582  1.00 36.81 ? 124  ASP C CB  1 
ATOM   8974  C  CG  . ASP C 1 121 ? 25.207  13.929  68.416  1.00 36.72 ? 124  ASP C CG  1 
ATOM   8975  O  OD1 . ASP C 1 121 ? 24.637  14.548  67.497  1.00 36.77 ? 124  ASP C OD1 1 
ATOM   8976  O  OD2 . ASP C 1 121 ? 26.431  13.694  68.409  1.00 36.66 ? 124  ASP C OD2 1 
ATOM   8977  N  N   . THR C 1 122 ? 22.147  13.122  71.684  1.00 36.74 ? 125  THR C N   1 
ATOM   8978  C  CA  . THR C 1 122 ? 21.462  12.263  72.645  1.00 36.60 ? 125  THR C CA  1 
ATOM   8979  C  C   . THR C 1 122 ? 19.978  12.527  72.870  1.00 36.56 ? 125  THR C C   1 
ATOM   8980  O  O   . THR C 1 122 ? 19.556  12.830  73.988  1.00 36.48 ? 125  THR C O   1 
ATOM   8981  C  CB  . THR C 1 122 ? 22.212  12.253  74.004  1.00 36.65 ? 125  THR C CB  1 
ATOM   8982  O  OG1 . THR C 1 122 ? 22.241  13.575  74.554  1.00 36.54 ? 125  THR C OG1 1 
ATOM   8983  C  CG2 . THR C 1 122 ? 23.644  11.787  73.809  1.00 36.51 ? 125  THR C CG2 1 
ATOM   8984  N  N   . VAL C 1 123 ? 19.185  12.376  71.814  1.00 36.37 ? 126  VAL C N   1 
ATOM   8985  C  CA  . VAL C 1 123 ? 17.739  12.586  71.895  1.00 36.22 ? 126  VAL C CA  1 
ATOM   8986  C  C   . VAL C 1 123 ? 17.028  11.373  71.323  1.00 36.26 ? 126  VAL C C   1 
ATOM   8987  O  O   . VAL C 1 123 ? 17.604  10.641  70.515  1.00 36.08 ? 126  VAL C O   1 
ATOM   8988  C  CB  . VAL C 1 123 ? 17.283  13.818  71.085  1.00 36.11 ? 126  VAL C CB  1 
ATOM   8989  C  CG1 . VAL C 1 123 ? 17.854  15.091  71.675  1.00 35.76 ? 126  VAL C CG1 1 
ATOM   8990  C  CG2 . VAL C 1 123 ? 17.696  13.667  69.634  1.00 35.96 ? 126  VAL C CG2 1 
ATOM   8991  N  N   . ARG C 1 124 ? 15.783  11.156  71.745  1.00 36.33 ? 127  ARG C N   1 
ATOM   8992  C  CA  . ARG C 1 124 ? 15.006  10.024  71.249  1.00 36.42 ? 127  ARG C CA  1 
ATOM   8993  C  C   . ARG C 1 124 ? 14.686  10.293  69.795  1.00 36.58 ? 127  ARG C C   1 
ATOM   8994  O  O   . ARG C 1 124 ? 14.121  11.335  69.453  1.00 36.64 ? 127  ARG C O   1 
ATOM   8995  C  CB  . ARG C 1 124 ? 13.715  9.839   72.036  1.00 36.26 ? 127  ARG C CB  1 
ATOM   8996  C  CG  . ARG C 1 124 ? 12.939  8.579   71.643  1.00 36.15 ? 127  ARG C CG  1 
ATOM   8997  C  CD  . ARG C 1 124 ? 11.661  8.429   72.460  1.00 36.15 ? 127  ARG C CD  1 
ATOM   8998  N  NE  . ARG C 1 124 ? 11.919  8.549   73.894  1.00 36.17 ? 127  ARG C NE  1 
ATOM   8999  C  CZ  . ARG C 1 124 ? 12.543  7.633   74.628  1.00 36.33 ? 127  ARG C CZ  1 
ATOM   9000  N  NH1 . ARG C 1 124 ? 12.735  7.840   75.923  1.00 36.18 ? 127  ARG C NH1 1 
ATOM   9001  N  NH2 . ARG C 1 124 ? 12.951  6.495   74.078  1.00 36.53 ? 127  ARG C NH2 1 
ATOM   9002  N  N   . ASP C 1 125 ? 15.025  9.330   68.948  1.00 36.76 ? 128  ASP C N   1 
ATOM   9003  C  CA  . ASP C 1 125 ? 14.831  9.461   67.516  1.00 36.71 ? 128  ASP C CA  1 
ATOM   9004  C  C   . ASP C 1 125 ? 15.501  8.239   66.928  1.00 36.68 ? 128  ASP C C   1 
ATOM   9005  O  O   . ASP C 1 125 ? 16.352  7.630   67.575  1.00 36.72 ? 128  ASP C O   1 
ATOM   9006  C  CB  . ASP C 1 125 ? 15.629  10.684  67.038  1.00 36.69 ? 128  ASP C CB  1 
ATOM   9007  C  CG  . ASP C 1 125 ? 14.885  11.535  66.035  1.00 36.86 ? 128  ASP C CG  1 
ATOM   9008  O  OD1 . ASP C 1 125 ? 15.517  12.442  65.459  1.00 36.82 ? 128  ASP C OD1 1 
ATOM   9009  O  OD2 . ASP C 1 125 ? 13.675  11.331  65.829  1.00 37.41 ? 128  ASP C OD2 1 
ATOM   9010  N  N   . PRO C 1 126 ? 15.043  7.776   65.762  1.00 36.67 ? 129  PRO C N   1 
ATOM   9011  C  CA  . PRO C 1 126 ? 15.745  6.611   65.219  1.00 36.71 ? 129  PRO C CA  1 
ATOM   9012  C  C   . PRO C 1 126 ? 17.140  7.096   64.803  1.00 36.75 ? 129  PRO C C   1 
ATOM   9013  O  O   . PRO C 1 126 ? 17.423  8.293   64.869  1.00 36.79 ? 129  PRO C O   1 
ATOM   9014  C  CB  . PRO C 1 126 ? 14.886  6.213   64.012  1.00 36.66 ? 129  PRO C CB  1 
ATOM   9015  C  CG  . PRO C 1 126 ? 14.023  7.406   63.746  1.00 36.58 ? 129  PRO C CG  1 
ATOM   9016  C  CD  . PRO C 1 126 ? 13.746  7.961   65.101  1.00 36.56 ? 129  PRO C CD  1 
ATOM   9017  N  N   . ARG C 1 127 ? 18.030  6.184   64.440  1.00 36.87 ? 130  ARG C N   1 
ATOM   9018  C  CA  . ARG C 1 127 ? 19.370  6.593   64.045  1.00 36.87 ? 130  ARG C CA  1 
ATOM   9019  C  C   . ARG C 1 127 ? 19.691  6.109   62.647  1.00 36.91 ? 130  ARG C C   1 
ATOM   9020  O  O   . ARG C 1 127 ? 19.347  4.989   62.278  1.00 37.12 ? 130  ARG C O   1 
ATOM   9021  C  CB  . ARG C 1 127 ? 20.422  6.043   65.014  1.00 36.83 ? 130  ARG C CB  1 
ATOM   9022  C  CG  . ARG C 1 127 ? 20.345  6.559   66.442  1.00 36.65 ? 130  ARG C CG  1 
ATOM   9023  C  CD  . ARG C 1 127 ? 20.833  7.979   66.540  1.00 36.81 ? 130  ARG C CD  1 
ATOM   9024  N  NE  . ARG C 1 127 ? 20.900  8.427   67.926  1.00 37.40 ? 130  ARG C NE  1 
ATOM   9025  C  CZ  . ARG C 1 127 ? 19.870  8.904   68.623  1.00 37.71 ? 130  ARG C CZ  1 
ATOM   9026  N  NH1 . ARG C 1 127 ? 18.669  9.005   68.066  1.00 37.92 ? 130  ARG C NH1 1 
ATOM   9027  N  NH2 . ARG C 1 127 ? 20.033  9.265   69.890  1.00 37.78 ? 130  ARG C NH2 1 
ATOM   9028  N  N   . GLY C 1 128 ? 20.330  6.970   61.863  1.00 36.95 ? 131  GLY C N   1 
ATOM   9029  C  CA  . GLY C 1 128 ? 20.719  6.600   60.516  1.00 36.69 ? 131  GLY C CA  1 
ATOM   9030  C  C   . GLY C 1 128 ? 22.038  5.853   60.579  1.00 36.62 ? 131  GLY C C   1 
ATOM   9031  O  O   . GLY C 1 128 ? 22.896  6.165   61.404  1.00 36.52 ? 131  GLY C O   1 
ATOM   9032  N  N   . PHE C 1 129 ? 22.195  4.858   59.715  1.00 36.51 ? 132  PHE C N   1 
ATOM   9033  C  CA  . PHE C 1 129 ? 23.406  4.054   59.668  1.00 36.29 ? 132  PHE C CA  1 
ATOM   9034  C  C   . PHE C 1 129 ? 23.618  3.696   58.198  1.00 36.16 ? 132  PHE C C   1 
ATOM   9035  O  O   . PHE C 1 129 ? 23.318  2.585   57.754  1.00 36.11 ? 132  PHE C O   1 
ATOM   9036  C  CB  . PHE C 1 129 ? 23.208  2.805   60.532  1.00 36.33 ? 132  PHE C CB  1 
ATOM   9037  C  CG  . PHE C 1 129 ? 24.473  2.055   60.836  1.00 36.48 ? 132  PHE C CG  1 
ATOM   9038  C  CD1 . PHE C 1 129 ? 25.621  2.233   60.072  1.00 36.56 ? 132  PHE C CD1 1 
ATOM   9039  C  CD2 . PHE C 1 129 ? 24.505  1.144   61.879  1.00 36.50 ? 132  PHE C CD2 1 
ATOM   9040  C  CE1 . PHE C 1 129 ? 26.780  1.507   60.346  1.00 36.57 ? 132  PHE C CE1 1 
ATOM   9041  C  CE2 . PHE C 1 129 ? 25.660  0.414   62.158  1.00 36.56 ? 132  PHE C CE2 1 
ATOM   9042  C  CZ  . PHE C 1 129 ? 26.796  0.596   61.391  1.00 36.60 ? 132  PHE C CZ  1 
ATOM   9043  N  N   . ALA C 1 130 ? 24.127  4.663   57.443  1.00 35.94 ? 133  ALA C N   1 
ATOM   9044  C  CA  . ALA C 1 130 ? 24.349  4.491   56.016  1.00 35.90 ? 133  ALA C CA  1 
ATOM   9045  C  C   . ALA C 1 130 ? 25.745  3.991   55.708  1.00 35.96 ? 133  ALA C C   1 
ATOM   9046  O  O   . ALA C 1 130 ? 26.719  4.496   56.264  1.00 35.97 ? 133  ALA C O   1 
ATOM   9047  C  CB  . ALA C 1 130 ? 24.091  5.800   55.303  1.00 35.81 ? 133  ALA C CB  1 
ATOM   9048  N  N   . VAL C 1 131 ? 25.841  3.007   54.815  1.00 35.79 ? 134  VAL C N   1 
ATOM   9049  C  CA  . VAL C 1 131 ? 27.134  2.438   54.430  1.00 35.68 ? 134  VAL C CA  1 
ATOM   9050  C  C   . VAL C 1 131 ? 27.387  2.525   52.926  1.00 35.69 ? 134  VAL C C   1 
ATOM   9051  O  O   . VAL C 1 131 ? 26.559  2.106   52.113  1.00 35.67 ? 134  VAL C O   1 
ATOM   9052  C  CB  . VAL C 1 131 ? 27.262  0.951   54.851  1.00 35.62 ? 134  VAL C CB  1 
ATOM   9053  C  CG1 . VAL C 1 131 ? 28.686  0.467   54.625  1.00 35.35 ? 134  VAL C CG1 1 
ATOM   9054  C  CG2 . VAL C 1 131 ? 26.862  0.767   56.310  1.00 35.47 ? 134  VAL C CG2 1 
ATOM   9055  N  N   . LYS C 1 132 ? 28.538  3.073   52.559  1.00 35.63 ? 135  LYS C N   1 
ATOM   9056  C  CA  . LYS C 1 132 ? 28.915  3.193   51.159  1.00 35.56 ? 135  LYS C CA  1 
ATOM   9057  C  C   . LYS C 1 132 ? 30.033  2.201   50.864  1.00 35.66 ? 135  LYS C C   1 
ATOM   9058  O  O   . LYS C 1 132 ? 31.101  2.269   51.462  1.00 35.48 ? 135  LYS C O   1 
ATOM   9059  C  CB  . LYS C 1 132 ? 29.380  4.618   50.853  1.00 35.29 ? 135  LYS C CB  1 
ATOM   9060  C  CG  . LYS C 1 132 ? 29.844  4.832   49.427  1.00 35.18 ? 135  LYS C CG  1 
ATOM   9061  C  CD  . LYS C 1 132 ? 30.168  6.298   49.148  1.00 35.11 ? 135  LYS C CD  1 
ATOM   9062  C  CE  . LYS C 1 132 ? 28.939  7.196   49.255  1.00 35.03 ? 135  LYS C CE  1 
ATOM   9063  N  NZ  . LYS C 1 132 ? 27.889  6.866   48.253  1.00 34.78 ? 135  LYS C NZ  1 
ATOM   9064  N  N   . PHE C 1 133 ? 29.763  1.250   49.976  1.00 35.76 ? 136  PHE C N   1 
ATOM   9065  C  CA  . PHE C 1 133 ? 30.752  0.248   49.594  1.00 35.90 ? 136  PHE C CA  1 
ATOM   9066  C  C   . PHE C 1 133 ? 31.334  0.620   48.249  1.00 36.02 ? 136  PHE C C   1 
ATOM   9067  O  O   . PHE C 1 133 ? 30.637  0.568   47.237  1.00 35.94 ? 136  PHE C O   1 
ATOM   9068  C  CB  . PHE C 1 133 ? 30.114  -1.133  49.432  1.00 35.83 ? 136  PHE C CB  1 
ATOM   9069  C  CG  . PHE C 1 133 ? 29.444  -1.653  50.662  1.00 35.81 ? 136  PHE C CG  1 
ATOM   9070  C  CD1 . PHE C 1 133 ? 28.206  -1.162  51.056  1.00 35.82 ? 136  PHE C CD1 1 
ATOM   9071  C  CD2 . PHE C 1 133 ? 30.021  -2.680  51.393  1.00 35.71 ? 136  PHE C CD2 1 
ATOM   9072  C  CE1 . PHE C 1 133 ? 27.549  -1.689  52.154  1.00 35.85 ? 136  PHE C CE1 1 
ATOM   9073  C  CE2 . PHE C 1 133 ? 29.374  -3.213  52.492  1.00 35.77 ? 136  PHE C CE2 1 
ATOM   9074  C  CZ  . PHE C 1 133 ? 28.134  -2.718  52.874  1.00 35.89 ? 136  PHE C CZ  1 
ATOM   9075  N  N   . TYR C 1 134 ? 32.611  0.971   48.226  1.00 36.08 ? 137  TYR C N   1 
ATOM   9076  C  CA  . TYR C 1 134 ? 33.269  1.321   46.975  1.00 36.37 ? 137  TYR C CA  1 
ATOM   9077  C  C   . TYR C 1 134 ? 33.702  0.034   46.263  1.00 36.88 ? 137  TYR C C   1 
ATOM   9078  O  O   . TYR C 1 134 ? 34.861  -0.378  46.369  1.00 36.94 ? 137  TYR C O   1 
ATOM   9079  C  CB  . TYR C 1 134 ? 34.495  2.187   47.262  1.00 36.18 ? 137  TYR C CB  1 
ATOM   9080  C  CG  . TYR C 1 134 ? 34.195  3.480   47.993  1.00 36.13 ? 137  TYR C CG  1 
ATOM   9081  C  CD1 . TYR C 1 134 ? 33.746  4.610   47.305  1.00 36.07 ? 137  TYR C CD1 1 
ATOM   9082  C  CD2 . TYR C 1 134 ? 34.385  3.587   49.365  1.00 36.11 ? 137  TYR C CD2 1 
ATOM   9083  C  CE1 . TYR C 1 134 ? 33.499  5.813   47.966  1.00 36.01 ? 137  TYR C CE1 1 
ATOM   9084  C  CE2 . TYR C 1 134 ? 34.137  4.790   50.036  1.00 36.19 ? 137  TYR C CE2 1 
ATOM   9085  C  CZ  . TYR C 1 134 ? 33.697  5.892   49.328  1.00 36.18 ? 137  TYR C CZ  1 
ATOM   9086  O  OH  . TYR C 1 134 ? 33.459  7.077   49.978  1.00 36.27 ? 137  TYR C OH  1 
ATOM   9087  N  N   . THR C 1 135 ? 32.790  -0.606  45.535  1.00 37.06 ? 138  THR C N   1 
ATOM   9088  C  CA  . THR C 1 135 ? 33.139  -1.850  44.850  1.00 37.34 ? 138  THR C CA  1 
ATOM   9089  C  C   . THR C 1 135 ? 33.676  -1.638  43.428  1.00 37.72 ? 138  THR C C   1 
ATOM   9090  O  O   . THR C 1 135 ? 33.658  -0.525  42.909  1.00 37.70 ? 138  THR C O   1 
ATOM   9091  C  CB  . THR C 1 135 ? 31.942  -2.842  44.812  1.00 37.29 ? 138  THR C CB  1 
ATOM   9092  O  OG1 . THR C 1 135 ? 31.168  -2.621  43.630  1.00 37.19 ? 138  THR C OG1 1 
ATOM   9093  C  CG2 . THR C 1 135 ? 31.038  -2.655  46.032  1.00 37.07 ? 138  THR C CG2 1 
ATOM   9094  N  N   . GLU C 1 136 ? 34.165  -2.714  42.809  1.00 38.05 ? 139  GLU C N   1 
ATOM   9095  C  CA  . GLU C 1 136 ? 34.697  -2.669  41.443  1.00 38.30 ? 139  GLU C CA  1 
ATOM   9096  C  C   . GLU C 1 136 ? 33.559  -2.515  40.438  1.00 37.89 ? 139  GLU C C   1 
ATOM   9097  O  O   . GLU C 1 136 ? 33.782  -2.153  39.284  1.00 37.76 ? 139  GLU C O   1 
ATOM   9098  C  CB  . GLU C 1 136 ? 35.472  -3.947  41.115  1.00 39.11 ? 139  GLU C CB  1 
ATOM   9099  C  CG  . GLU C 1 136 ? 36.367  -4.437  42.225  1.00 40.59 ? 139  GLU C CG  1 
ATOM   9100  C  CD  . GLU C 1 136 ? 35.713  -5.537  43.043  1.00 41.59 ? 139  GLU C CD  1 
ATOM   9101  O  OE1 . GLU C 1 136 ? 34.787  -5.237  43.853  1.00 41.43 ? 139  GLU C OE1 1 
ATOM   9102  O  OE2 . GLU C 1 136 ? 36.133  -6.711  42.854  1.00 42.23 ? 139  GLU C OE2 1 
ATOM   9103  N  N   . ASP C 1 137 ? 32.353  -2.876  40.867  1.00 37.47 ? 140  ASP C N   1 
ATOM   9104  C  CA  . ASP C 1 137 ? 31.164  -2.758  40.037  1.00 36.97 ? 140  ASP C CA  1 
ATOM   9105  C  C   . ASP C 1 137 ? 30.406  -1.503  40.419  1.00 36.65 ? 140  ASP C C   1 
ATOM   9106  O  O   . ASP C 1 137 ? 29.181  -1.440  40.296  1.00 36.69 ? 140  ASP C O   1 
ATOM   9107  C  CB  . ASP C 1 137 ? 30.261  -3.980  40.189  1.00 36.81 ? 140  ASP C CB  1 
ATOM   9108  C  CG  . ASP C 1 137 ? 30.577  -5.061  39.185  1.00 36.74 ? 140  ASP C CG  1 
ATOM   9109  O  OD1 . ASP C 1 137 ? 29.995  -6.154  39.298  1.00 36.84 ? 140  ASP C OD1 1 
ATOM   9110  O  OD2 . ASP C 1 137 ? 31.398  -4.822  38.272  1.00 37.11 ? 140  ASP C OD2 1 
ATOM   9111  N  N   . GLY C 1 138 ? 31.150  -0.499  40.872  1.00 36.25 ? 141  GLY C N   1 
ATOM   9112  C  CA  . GLY C 1 138 ? 30.543  0.758   41.260  1.00 35.79 ? 141  GLY C CA  1 
ATOM   9113  C  C   . GLY C 1 138 ? 30.154  0.782   42.717  1.00 35.49 ? 141  GLY C C   1 
ATOM   9114  O  O   . GLY C 1 138 ? 30.300  -0.213  43.429  1.00 35.36 ? 141  GLY C O   1 
ATOM   9115  N  N   . ASN C 1 139 ? 29.631  1.915   43.160  1.00 35.14 ? 142  ASN C N   1 
ATOM   9116  C  CA  . ASN C 1 139 ? 29.241  2.049   44.545  1.00 34.92 ? 142  ASN C CA  1 
ATOM   9117  C  C   . ASN C 1 139 ? 27.948  1.357   44.903  1.00 34.95 ? 142  ASN C C   1 
ATOM   9118  O  O   . ASN C 1 139 ? 27.007  1.307   44.109  1.00 35.02 ? 142  ASN C O   1 
ATOM   9119  C  CB  . ASN C 1 139 ? 29.162  3.520   44.936  1.00 34.64 ? 142  ASN C CB  1 
ATOM   9120  C  CG  . ASN C 1 139 ? 30.520  4.166   45.012  1.00 34.45 ? 142  ASN C CG  1 
ATOM   9121  O  OD1 . ASN C 1 139 ? 31.536  3.478   45.039  1.00 34.44 ? 142  ASN C OD1 1 
ATOM   9122  N  ND2 . ASN C 1 139 ? 30.552  5.494   45.048  1.00 34.44 ? 142  ASN C ND2 1 
ATOM   9123  N  N   . TRP C 1 140 ? 27.949  0.761   46.088  1.00 34.96 ? 143  TRP C N   1 
ATOM   9124  C  CA  . TRP C 1 140 ? 26.780  0.102   46.634  1.00 35.07 ? 143  TRP C CA  1 
ATOM   9125  C  C   . TRP C 1 140 ? 26.476  0.857   47.922  1.00 35.22 ? 143  TRP C C   1 
ATOM   9126  O  O   . TRP C 1 140 ? 27.303  0.915   48.834  1.00 35.11 ? 143  TRP C O   1 
ATOM   9127  C  CB  . TRP C 1 140 ? 27.056  -1.376  46.940  1.00 34.82 ? 143  TRP C CB  1 
ATOM   9128  C  CG  . TRP C 1 140 ? 25.928  -2.045  47.683  1.00 34.65 ? 143  TRP C CG  1 
ATOM   9129  C  CD1 . TRP C 1 140 ? 24.596  -1.752  47.590  1.00 34.60 ? 143  TRP C CD1 1 
ATOM   9130  C  CD2 . TRP C 1 140 ? 26.038  -3.092  48.657  1.00 34.64 ? 143  TRP C CD2 1 
ATOM   9131  N  NE1 . TRP C 1 140 ? 23.873  -2.542  48.450  1.00 34.48 ? 143  TRP C NE1 1 
ATOM   9132  C  CE2 . TRP C 1 140 ? 24.732  -3.375  49.116  1.00 34.63 ? 143  TRP C CE2 1 
ATOM   9133  C  CE3 . TRP C 1 140 ? 27.114  -3.818  49.188  1.00 34.58 ? 143  TRP C CE3 1 
ATOM   9134  C  CZ2 . TRP C 1 140 ? 24.473  -4.354  50.083  1.00 34.45 ? 143  TRP C CZ2 1 
ATOM   9135  C  CZ3 . TRP C 1 140 ? 26.857  -4.790  50.149  1.00 34.41 ? 143  TRP C CZ3 1 
ATOM   9136  C  CH2 . TRP C 1 140 ? 25.544  -5.048  50.586  1.00 34.33 ? 143  TRP C CH2 1 
ATOM   9137  N  N   . ASP C 1 141 ? 25.309  1.482   47.973  1.00 35.34 ? 144  ASP C N   1 
ATOM   9138  C  CA  . ASP C 1 141 ? 24.914  2.225   49.153  1.00 35.51 ? 144  ASP C CA  1 
ATOM   9139  C  C   . ASP C 1 141 ? 23.813  1.517   49.902  1.00 35.61 ? 144  ASP C C   1 
ATOM   9140  O  O   . ASP C 1 141 ? 22.708  1.376   49.385  1.00 35.65 ? 144  ASP C O   1 
ATOM   9141  C  CB  . ASP C 1 141 ? 24.414  3.619   48.772  1.00 35.64 ? 144  ASP C CB  1 
ATOM   9142  C  CG  . ASP C 1 141 ? 25.527  4.556   48.350  1.00 35.67 ? 144  ASP C CG  1 
ATOM   9143  O  OD1 . ASP C 1 141 ? 25.235  5.489   47.576  1.00 35.86 ? 144  ASP C OD1 1 
ATOM   9144  O  OD2 . ASP C 1 141 ? 26.680  4.386   48.800  1.00 35.76 ? 144  ASP C OD2 1 
ATOM   9145  N  N   . LEU C 1 142 ? 24.126  1.044   51.103  1.00 35.61 ? 145  LEU C N   1 
ATOM   9146  C  CA  . LEU C 1 142 ? 23.137  0.393   51.954  1.00 35.74 ? 145  LEU C CA  1 
ATOM   9147  C  C   . LEU C 1 142 ? 22.771  1.459   52.981  1.00 36.13 ? 145  LEU C C   1 
ATOM   9148  O  O   . LEU C 1 142 ? 23.504  1.691   53.944  1.00 36.05 ? 145  LEU C O   1 
ATOM   9149  C  CB  . LEU C 1 142 ? 23.727  -0.844  52.640  1.00 35.40 ? 145  LEU C CB  1 
ATOM   9150  C  CG  . LEU C 1 142 ? 22.809  -1.631  53.584  1.00 35.04 ? 145  LEU C CG  1 
ATOM   9151  C  CD1 . LEU C 1 142 ? 21.567  -2.090  52.860  1.00 35.04 ? 145  LEU C CD1 1 
ATOM   9152  C  CD2 . LEU C 1 142 ? 23.540  -2.817  54.146  1.00 34.81 ? 145  LEU C CD2 1 
ATOM   9153  N  N   . VAL C 1 143 ? 21.655  2.141   52.741  1.00 36.54 ? 146  VAL C N   1 
ATOM   9154  C  CA  . VAL C 1 143 ? 21.207  3.223   53.616  1.00 36.83 ? 146  VAL C CA  1 
ATOM   9155  C  C   . VAL C 1 143 ? 20.262  2.726   54.700  1.00 37.09 ? 146  VAL C C   1 
ATOM   9156  O  O   . VAL C 1 143 ? 19.040  2.808   54.564  1.00 37.03 ? 146  VAL C O   1 
ATOM   9157  C  CB  . VAL C 1 143 ? 20.534  4.351   52.788  1.00 36.87 ? 146  VAL C CB  1 
ATOM   9158  C  CG1 . VAL C 1 143 ? 20.347  5.602   53.638  1.00 36.75 ? 146  VAL C CG1 1 
ATOM   9159  C  CG2 . VAL C 1 143 ? 21.372  4.661   51.539  1.00 36.62 ? 146  VAL C CG2 1 
ATOM   9160  N  N   . GLY C 1 144 ? 20.838  2.262   55.802  1.00 37.35 ? 147  GLY C N   1 
ATOM   9161  C  CA  . GLY C 1 144 ? 20.026  1.731   56.875  1.00 37.77 ? 147  GLY C CA  1 
ATOM   9162  C  C   . GLY C 1 144 ? 19.763  2.595   58.088  1.00 38.08 ? 147  GLY C C   1 
ATOM   9163  O  O   . GLY C 1 144 ? 20.251  3.719   58.206  1.00 38.14 ? 147  GLY C O   1 
ATOM   9164  N  N   . ASN C 1 145 ? 18.920  2.059   58.966  1.00 38.42 ? 148  ASN C N   1 
ATOM   9165  C  CA  . ASN C 1 145 ? 18.538  2.692   60.221  1.00 38.80 ? 148  ASN C CA  1 
ATOM   9166  C  C   . ASN C 1 145 ? 18.914  1.718   61.325  1.00 38.70 ? 148  ASN C C   1 
ATOM   9167  O  O   . ASN C 1 145 ? 19.333  0.591   61.044  1.00 38.88 ? 148  ASN C O   1 
ATOM   9168  C  CB  . ASN C 1 145 ? 17.029  2.966   60.261  1.00 39.29 ? 148  ASN C CB  1 
ATOM   9169  C  CG  . ASN C 1 145 ? 16.669  4.387   59.810  1.00 39.90 ? 148  ASN C CG  1 
ATOM   9170  O  OD1 . ASN C 1 145 ? 17.508  5.300   59.828  1.00 40.28 ? 148  ASN C OD1 1 
ATOM   9171  N  ND2 . ASN C 1 145 ? 15.406  4.583   59.425  1.00 40.11 ? 148  ASN C ND2 1 
ATOM   9172  N  N   . ASN C 1 146 ? 18.780  2.146   62.575  1.00 38.47 ? 149  ASN C N   1 
ATOM   9173  C  CA  . ASN C 1 146 ? 19.114  1.290   63.706  1.00 38.20 ? 149  ASN C CA  1 
ATOM   9174  C  C   . ASN C 1 146 ? 17.911  0.455   64.103  1.00 38.11 ? 149  ASN C C   1 
ATOM   9175  O  O   . ASN C 1 146 ? 17.817  -0.022  65.231  1.00 38.09 ? 149  ASN C O   1 
ATOM   9176  C  CB  . ASN C 1 146 ? 19.553  2.137   64.888  1.00 38.21 ? 149  ASN C CB  1 
ATOM   9177  C  CG  . ASN C 1 146 ? 18.425  2.975   65.463  1.00 38.15 ? 149  ASN C CG  1 
ATOM   9178  O  OD1 . ASN C 1 146 ? 18.423  3.275   66.657  1.00 38.66 ? 149  ASN C OD1 1 
ATOM   9179  N  ND2 . ASN C 1 146 ? 17.472  3.364   64.625  1.00 37.75 ? 149  ASN C ND2 1 
ATOM   9180  N  N   . THR C 1 147 ? 16.983  0.301   63.169  1.00 37.99 ? 150  THR C N   1 
ATOM   9181  C  CA  . THR C 1 147 ? 15.767  -0.466  63.395  1.00 37.73 ? 150  THR C CA  1 
ATOM   9182  C  C   . THR C 1 147 ? 15.498  -1.253  62.126  1.00 37.33 ? 150  THR C C   1 
ATOM   9183  O  O   . THR C 1 147 ? 15.917  -0.842  61.045  1.00 37.38 ? 150  THR C O   1 
ATOM   9184  C  CB  . THR C 1 147 ? 14.571  0.465   63.679  1.00 37.81 ? 150  THR C CB  1 
ATOM   9185  O  OG1 . THR C 1 147 ? 13.357  -0.293  63.635  1.00 37.73 ? 150  THR C OG1 1 
ATOM   9186  C  CG2 . THR C 1 147 ? 14.508  1.599   62.644  1.00 37.76 ? 150  THR C CG2 1 
ATOM   9187  N  N   . PRO C 1 148 ? 14.847  -2.422  62.245  1.00 37.04 ? 151  PRO C N   1 
ATOM   9188  C  CA  . PRO C 1 148 ? 14.542  -3.251  61.074  1.00 36.79 ? 151  PRO C CA  1 
ATOM   9189  C  C   . PRO C 1 148 ? 13.274  -2.826  60.344  1.00 36.46 ? 151  PRO C C   1 
ATOM   9190  O  O   . PRO C 1 148 ? 12.978  -3.324  59.261  1.00 36.50 ? 151  PRO C O   1 
ATOM   9191  C  CB  . PRO C 1 148 ? 14.374  -4.639  61.691  1.00 36.85 ? 151  PRO C CB  1 
ATOM   9192  C  CG  . PRO C 1 148 ? 13.750  -4.329  63.008  1.00 36.80 ? 151  PRO C CG  1 
ATOM   9193  C  CD  . PRO C 1 148 ? 14.564  -3.156  63.493  1.00 36.93 ? 151  PRO C CD  1 
ATOM   9194  N  N   . ILE C 1 149 ? 12.550  -1.878  60.921  1.00 36.09 ? 152  ILE C N   1 
ATOM   9195  C  CA  . ILE C 1 149 ? 11.293  -1.425  60.347  1.00 35.73 ? 152  ILE C CA  1 
ATOM   9196  C  C   . ILE C 1 149 ? 11.186  0.091   60.281  1.00 35.62 ? 152  ILE C C   1 
ATOM   9197  O  O   . ILE C 1 149 ? 12.153  0.807   60.542  1.00 35.75 ? 152  ILE C O   1 
ATOM   9198  C  CB  . ILE C 1 149 ? 10.143  -1.927  61.210  1.00 35.57 ? 152  ILE C CB  1 
ATOM   9199  C  CG1 . ILE C 1 149 ? 10.400  -1.527  62.663  1.00 35.40 ? 152  ILE C CG1 1 
ATOM   9200  C  CG2 . ILE C 1 149 ? 10.024  -3.435  61.104  1.00 35.51 ? 152  ILE C CG2 1 
ATOM   9201  C  CD1 . ILE C 1 149 ? 9.235   -1.715  63.562  1.00 35.21 ? 152  ILE C CD1 1 
ATOM   9202  N  N   . PHE C 1 150 ? 10.002  0.573   59.920  1.00 35.35 ? 153  PHE C N   1 
ATOM   9203  C  CA  . PHE C 1 150 ? 9.747   2.005   59.852  1.00 35.06 ? 153  PHE C CA  1 
ATOM   9204  C  C   . PHE C 1 150 ? 8.301   2.315   60.242  1.00 34.89 ? 153  PHE C C   1 
ATOM   9205  O  O   . PHE C 1 150 ? 7.480   1.407   60.409  1.00 34.73 ? 153  PHE C O   1 
ATOM   9206  C  CB  . PHE C 1 150 ? 10.066  2.558   58.468  1.00 35.22 ? 153  PHE C CB  1 
ATOM   9207  C  CG  . PHE C 1 150 ? 10.394  4.017   58.472  1.00 35.31 ? 153  PHE C CG  1 
ATOM   9208  C  CD1 . PHE C 1 150 ? 9.535   4.939   57.894  1.00 35.46 ? 153  PHE C CD1 1 
ATOM   9209  C  CD2 . PHE C 1 150 ? 11.559  4.472   59.074  1.00 35.46 ? 153  PHE C CD2 1 
ATOM   9210  C  CE1 . PHE C 1 150 ? 9.830   6.304   57.917  1.00 35.58 ? 153  PHE C CE1 1 
ATOM   9211  C  CE2 . PHE C 1 150 ? 11.864  5.831   59.102  1.00 35.66 ? 153  PHE C CE2 1 
ATOM   9212  C  CZ  . PHE C 1 150 ? 10.997  6.748   58.523  1.00 35.62 ? 153  PHE C CZ  1 
ATOM   9213  N  N   . PHE C 1 151 ? 8.000   3.602   60.384  1.00 34.58 ? 154  PHE C N   1 
ATOM   9214  C  CA  . PHE C 1 151 ? 6.680   4.063   60.792  1.00 34.38 ? 154  PHE C CA  1 
ATOM   9215  C  C   . PHE C 1 151 ? 5.555   3.882   59.779  1.00 34.45 ? 154  PHE C C   1 
ATOM   9216  O  O   . PHE C 1 151 ? 4.407   3.658   60.165  1.00 34.41 ? 154  PHE C O   1 
ATOM   9217  C  CB  . PHE C 1 151 ? 6.750   5.530   61.179  1.00 34.24 ? 154  PHE C CB  1 
ATOM   9218  C  CG  . PHE C 1 151 ? 7.775   5.836   62.224  1.00 34.17 ? 154  PHE C CG  1 
ATOM   9219  C  CD1 . PHE C 1 151 ? 9.068   6.176   61.860  1.00 34.06 ? 154  PHE C CD1 1 
ATOM   9220  C  CD2 . PHE C 1 151 ? 7.439   5.834   63.571  1.00 34.19 ? 154  PHE C CD2 1 
ATOM   9221  C  CE1 . PHE C 1 151 ? 10.011  6.514   62.820  1.00 34.07 ? 154  PHE C CE1 1 
ATOM   9222  C  CE2 . PHE C 1 151 ? 8.379   6.172   64.539  1.00 34.17 ? 154  PHE C CE2 1 
ATOM   9223  C  CZ  . PHE C 1 151 ? 9.667   6.512   64.159  1.00 34.03 ? 154  PHE C CZ  1 
ATOM   9224  N  N   . ILE C 1 152 ? 5.870   4.010   58.494  1.00 34.29 ? 155  ILE C N   1 
ATOM   9225  C  CA  . ILE C 1 152 ? 4.865   3.883   57.441  1.00 34.17 ? 155  ILE C CA  1 
ATOM   9226  C  C   . ILE C 1 152 ? 5.235   2.826   56.402  1.00 34.19 ? 155  ILE C C   1 
ATOM   9227  O  O   . ILE C 1 152 ? 6.369   2.348   56.366  1.00 34.11 ? 155  ILE C O   1 
ATOM   9228  C  CB  . ILE C 1 152 ? 4.630   5.230   56.736  1.00 34.03 ? 155  ILE C CB  1 
ATOM   9229  C  CG1 . ILE C 1 152 ? 5.962   5.857   56.361  1.00 33.97 ? 155  ILE C CG1 1 
ATOM   9230  C  CG2 . ILE C 1 152 ? 3.854   6.180   57.637  1.00 34.07 ? 155  ILE C CG2 1 
ATOM   9231  C  CD1 . ILE C 1 152 ? 5.816   7.133   55.576  1.00 34.13 ? 155  ILE C CD1 1 
ATOM   9232  N  N   . ARG C 1 153 ? 4.278   2.461   55.554  1.00 34.18 ? 156  ARG C N   1 
ATOM   9233  C  CA  . ARG C 1 153 ? 4.529   1.444   54.546  1.00 34.27 ? 156  ARG C CA  1 
ATOM   9234  C  C   . ARG C 1 153 ? 4.291   1.899   53.115  1.00 34.52 ? 156  ARG C C   1 
ATOM   9235  O  O   . ARG C 1 153 ? 4.398   1.104   52.178  1.00 34.64 ? 156  ARG C O   1 
ATOM   9236  C  CB  . ARG C 1 153 ? 3.732   0.174   54.854  1.00 34.13 ? 156  ARG C CB  1 
ATOM   9237  C  CG  . ARG C 1 153 ? 2.237   0.380   54.999  1.00 33.91 ? 156  ARG C CG  1 
ATOM   9238  C  CD  . ARG C 1 153 ? 1.529   -0.955  55.175  1.00 33.70 ? 156  ARG C CD  1 
ATOM   9239  N  NE  . ARG C 1 153 ? 1.818   -1.574  56.465  1.00 33.74 ? 156  ARG C NE  1 
ATOM   9240  C  CZ  . ARG C 1 153 ? 0.964   -1.605  57.482  1.00 33.81 ? 156  ARG C CZ  1 
ATOM   9241  N  NH1 . ARG C 1 153 ? -0.238  -1.055  57.356  1.00 33.64 ? 156  ARG C NH1 1 
ATOM   9242  N  NH2 . ARG C 1 153 ? 1.317   -2.167  58.634  1.00 33.65 ? 156  ARG C NH2 1 
ATOM   9243  N  N   . ASP C 1 154 ? 3.972   3.178   52.943  1.00 34.62 ? 157  ASP C N   1 
ATOM   9244  C  CA  . ASP C 1 154 ? 3.763   3.751   51.618  1.00 34.64 ? 157  ASP C CA  1 
ATOM   9245  C  C   . ASP C 1 154 ? 4.524   5.074   51.613  1.00 34.70 ? 157  ASP C C   1 
ATOM   9246  O  O   . ASP C 1 154 ? 4.306   5.939   52.470  1.00 34.69 ? 157  ASP C O   1 
ATOM   9247  C  CB  . ASP C 1 154 ? 2.282   3.969   51.322  1.00 34.61 ? 157  ASP C CB  1 
ATOM   9248  C  CG  . ASP C 1 154 ? 2.036   4.372   49.886  1.00 34.74 ? 157  ASP C CG  1 
ATOM   9249  O  OD1 . ASP C 1 154 ? 1.414   3.593   49.144  1.00 35.07 ? 157  ASP C OD1 1 
ATOM   9250  O  OD2 . ASP C 1 154 ? 2.468   5.469   49.485  1.00 35.06 ? 157  ASP C OD2 1 
ATOM   9251  N  N   . PRO C 1 155 ? 5.403   5.264   50.619  1.00 34.71 ? 158  PRO C N   1 
ATOM   9252  C  CA  . PRO C 1 155 ? 6.230   6.461   50.465  1.00 34.74 ? 158  PRO C CA  1 
ATOM   9253  C  C   . PRO C 1 155 ? 5.537   7.816   50.301  1.00 34.87 ? 158  PRO C C   1 
ATOM   9254  O  O   . PRO C 1 155 ? 6.111   8.848   50.661  1.00 34.80 ? 158  PRO C O   1 
ATOM   9255  C  CB  . PRO C 1 155 ? 7.094   6.110   49.255  1.00 34.69 ? 158  PRO C CB  1 
ATOM   9256  C  CG  . PRO C 1 155 ? 6.179   5.284   48.434  1.00 34.65 ? 158  PRO C CG  1 
ATOM   9257  C  CD  . PRO C 1 155 ? 5.564   4.371   49.458  1.00 34.61 ? 158  PRO C CD  1 
ATOM   9258  N  N   . ILE C 1 156 ? 4.312   7.826   49.782  1.00 34.90 ? 159  ILE C N   1 
ATOM   9259  C  CA  . ILE C 1 156 ? 3.603   9.084   49.571  1.00 35.05 ? 159  ILE C CA  1 
ATOM   9260  C  C   . ILE C 1 156 ? 3.196   9.764   50.886  1.00 35.10 ? 159  ILE C C   1 
ATOM   9261  O  O   . ILE C 1 156 ? 2.775   10.929  50.903  1.00 35.06 ? 159  ILE C O   1 
ATOM   9262  C  CB  . ILE C 1 156 ? 2.399   8.886   48.624  1.00 35.05 ? 159  ILE C CB  1 
ATOM   9263  C  CG1 . ILE C 1 156 ? 2.035   10.208  47.953  1.00 34.90 ? 159  ILE C CG1 1 
ATOM   9264  C  CG2 . ILE C 1 156 ? 1.213   8.306   49.383  1.00 35.09 ? 159  ILE C CG2 1 
ATOM   9265  C  CD1 . ILE C 1 156 ? 1.058   10.048  46.823  1.00 35.02 ? 159  ILE C CD1 1 
ATOM   9266  N  N   . LEU C 1 157 ? 3.366   9.041   51.990  1.00 35.17 ? 160  LEU C N   1 
ATOM   9267  C  CA  . LEU C 1 157 ? 3.052   9.568   53.310  1.00 35.05 ? 160  LEU C CA  1 
ATOM   9268  C  C   . LEU C 1 157 ? 4.301   10.063  54.010  1.00 34.85 ? 160  LEU C C   1 
ATOM   9269  O  O   . LEU C 1 157 ? 4.212   10.701  55.057  1.00 34.76 ? 160  LEU C O   1 
ATOM   9270  C  CB  . LEU C 1 157 ? 2.391   8.495   54.172  1.00 35.51 ? 160  LEU C CB  1 
ATOM   9271  C  CG  . LEU C 1 157 ? 0.916   8.237   53.867  1.00 35.84 ? 160  LEU C CG  1 
ATOM   9272  C  CD1 . LEU C 1 157 ? 0.687   6.770   53.562  1.00 36.10 ? 160  LEU C CD1 1 
ATOM   9273  C  CD2 . LEU C 1 157 ? 0.088   8.691   55.049  1.00 36.05 ? 160  LEU C CD2 1 
ATOM   9274  N  N   . PHE C 1 158 ? 5.464   9.784   53.426  1.00 34.74 ? 161  PHE C N   1 
ATOM   9275  C  CA  . PHE C 1 158 ? 6.729   10.189  54.028  1.00 34.59 ? 161  PHE C CA  1 
ATOM   9276  C  C   . PHE C 1 158 ? 6.887   11.691  54.252  1.00 34.75 ? 161  PHE C C   1 
ATOM   9277  O  O   . PHE C 1 158 ? 7.312   12.112  55.332  1.00 34.72 ? 161  PHE C O   1 
ATOM   9278  C  CB  . PHE C 1 158 ? 7.913   9.646   53.238  1.00 34.51 ? 161  PHE C CB  1 
ATOM   9279  C  CG  . PHE C 1 158 ? 9.219   9.783   53.954  1.00 34.53 ? 161  PHE C CG  1 
ATOM   9280  C  CD1 . PHE C 1 158 ? 10.109  10.795  53.623  1.00 34.68 ? 161  PHE C CD1 1 
ATOM   9281  C  CD2 . PHE C 1 158 ? 9.565   8.897   54.961  1.00 34.55 ? 161  PHE C CD2 1 
ATOM   9282  C  CE1 . PHE C 1 158 ? 11.334  10.920  54.289  1.00 34.64 ? 161  PHE C CE1 1 
ATOM   9283  C  CE2 . PHE C 1 158 ? 10.783  9.015   55.628  1.00 34.62 ? 161  PHE C CE2 1 
ATOM   9284  C  CZ  . PHE C 1 158 ? 11.669  10.030  55.289  1.00 34.54 ? 161  PHE C CZ  1 
ATOM   9285  N  N   . PRO C 1 159 ? 6.592   12.521  53.234  1.00 34.84 ? 162  PRO C N   1 
ATOM   9286  C  CA  . PRO C 1 159 ? 6.744   13.958  53.469  1.00 34.76 ? 162  PRO C CA  1 
ATOM   9287  C  C   . PRO C 1 159 ? 5.875   14.410  54.642  1.00 34.78 ? 162  PRO C C   1 
ATOM   9288  O  O   . PRO C 1 159 ? 6.346   15.153  55.506  1.00 34.88 ? 162  PRO C O   1 
ATOM   9289  C  CB  . PRO C 1 159 ? 6.285   14.566  52.149  1.00 34.94 ? 162  PRO C CB  1 
ATOM   9290  C  CG  . PRO C 1 159 ? 6.711   13.544  51.151  1.00 34.84 ? 162  PRO C CG  1 
ATOM   9291  C  CD  . PRO C 1 159 ? 6.263   12.261  51.819  1.00 34.93 ? 162  PRO C CD  1 
ATOM   9292  N  N   . SER C 1 160 ? 4.633   13.921  54.701  1.00 34.70 ? 163  SER C N   1 
ATOM   9293  C  CA  . SER C 1 160 ? 3.722   14.275  55.791  1.00 34.48 ? 163  SER C CA  1 
ATOM   9294  C  C   . SER C 1 160 ? 4.252   13.811  57.136  1.00 34.45 ? 163  SER C C   1 
ATOM   9295  O  O   . SER C 1 160 ? 4.201   14.555  58.116  1.00 34.50 ? 163  SER C O   1 
ATOM   9296  C  CB  . SER C 1 160 ? 2.343   13.673  55.568  1.00 34.17 ? 163  SER C CB  1 
ATOM   9297  O  OG  . SER C 1 160 ? 1.692   14.306  54.487  1.00 34.44 ? 163  SER C OG  1 
ATOM   9298  N  N   . PHE C 1 161 ? 4.756   12.581  57.191  1.00 34.35 ? 164  PHE C N   1 
ATOM   9299  C  CA  . PHE C 1 161 ? 5.294   12.062  58.439  1.00 34.23 ? 164  PHE C CA  1 
ATOM   9300  C  C   . PHE C 1 161 ? 6.426   12.940  58.929  1.00 34.33 ? 164  PHE C C   1 
ATOM   9301  O  O   . PHE C 1 161 ? 6.465   13.322  60.097  1.00 34.14 ? 164  PHE C O   1 
ATOM   9302  C  CB  . PHE C 1 161 ? 5.814   10.639  58.276  1.00 34.23 ? 164  PHE C CB  1 
ATOM   9303  C  CG  . PHE C 1 161 ? 6.620   10.159  59.450  1.00 34.30 ? 164  PHE C CG  1 
ATOM   9304  C  CD1 . PHE C 1 161 ? 7.928   9.718   59.279  1.00 34.35 ? 164  PHE C CD1 1 
ATOM   9305  C  CD2 . PHE C 1 161 ? 6.087   10.189  60.735  1.00 34.32 ? 164  PHE C CD2 1 
ATOM   9306  C  CE1 . PHE C 1 161 ? 8.693   9.319   60.368  1.00 34.25 ? 164  PHE C CE1 1 
ATOM   9307  C  CE2 . PHE C 1 161 ? 6.844   9.793   61.829  1.00 34.23 ? 164  PHE C CE2 1 
ATOM   9308  C  CZ  . PHE C 1 161 ? 8.148   9.359   61.644  1.00 34.38 ? 164  PHE C CZ  1 
ATOM   9309  N  N   . ILE C 1 162 ? 7.369   13.230  58.041  1.00 34.30 ? 165  ILE C N   1 
ATOM   9310  C  CA  . ILE C 1 162 ? 8.495   14.062  58.415  1.00 34.35 ? 165  ILE C CA  1 
ATOM   9311  C  C   . ILE C 1 162 ? 8.026   15.442  58.824  1.00 34.68 ? 165  ILE C C   1 
ATOM   9312  O  O   . ILE C 1 162 ? 8.539   16.007  59.786  1.00 34.85 ? 165  ILE C O   1 
ATOM   9313  C  CB  . ILE C 1 162 ? 9.532   14.149  57.299  1.00 34.33 ? 165  ILE C CB  1 
ATOM   9314  C  CG1 . ILE C 1 162 ? 10.180  12.775  57.109  1.00 34.32 ? 165  ILE C CG1 1 
ATOM   9315  C  CG2 . ILE C 1 162 ? 10.586  15.192  57.633  1.00 34.29 ? 165  ILE C CG2 1 
ATOM   9316  C  CD1 . ILE C 1 162 ? 10.775  12.190  58.389  1.00 34.19 ? 165  ILE C CD1 1 
ATOM   9317  N  N   . HIS C 1 163 ? 7.025   15.973  58.131  1.00 34.58 ? 166  HIS C N   1 
ATOM   9318  C  CA  . HIS C 1 163 ? 6.509   17.284  58.489  1.00 34.70 ? 166  HIS C CA  1 
ATOM   9319  C  C   . HIS C 1 163 ? 5.991   17.263  59.926  1.00 34.83 ? 166  HIS C C   1 
ATOM   9320  O  O   . HIS C 1 163 ? 6.329   18.136  60.730  1.00 34.71 ? 166  HIS C O   1 
ATOM   9321  C  CB  . HIS C 1 163 ? 5.389   17.711  57.540  1.00 34.76 ? 166  HIS C CB  1 
ATOM   9322  C  CG  . HIS C 1 163 ? 5.872   18.259  56.230  1.00 34.89 ? 166  HIS C CG  1 
ATOM   9323  N  ND1 . HIS C 1 163 ? 5.011   18.675  55.235  1.00 34.76 ? 166  HIS C ND1 1 
ATOM   9324  C  CD2 . HIS C 1 163 ? 7.124   18.448  55.747  1.00 34.83 ? 166  HIS C CD2 1 
ATOM   9325  C  CE1 . HIS C 1 163 ? 5.712   19.093  54.196  1.00 34.78 ? 166  HIS C CE1 1 
ATOM   9326  N  NE2 . HIS C 1 163 ? 6.996   18.966  54.481  1.00 34.73 ? 166  HIS C NE2 1 
ATOM   9327  N  N   . SER C 1 164 ? 5.212   16.236  60.260  1.00 34.97 ? 167  SER C N   1 
ATOM   9328  C  CA  . SER C 1 164 ? 4.647   16.112  61.596  1.00 35.06 ? 167  SER C CA  1 
ATOM   9329  C  C   . SER C 1 164 ? 5.719   15.935  62.669  1.00 35.26 ? 167  SER C C   1 
ATOM   9330  O  O   . SER C 1 164 ? 5.498   16.267  63.835  1.00 35.29 ? 167  SER C O   1 
ATOM   9331  C  CB  . SER C 1 164 ? 3.641   14.962  61.648  1.00 34.97 ? 167  SER C CB  1 
ATOM   9332  O  OG  . SER C 1 164 ? 4.285   13.701  61.593  1.00 35.38 ? 167  SER C OG  1 
ATOM   9333  N  N   . GLN C 1 165 ? 6.880   15.415  62.278  1.00 35.33 ? 168  GLN C N   1 
ATOM   9334  C  CA  . GLN C 1 165 ? 7.979   15.208  63.215  1.00 35.46 ? 168  GLN C CA  1 
ATOM   9335  C  C   . GLN C 1 165 ? 8.825   16.469  63.401  1.00 35.67 ? 168  GLN C C   1 
ATOM   9336  O  O   . GLN C 1 165 ? 9.560   16.599  64.382  1.00 35.62 ? 168  GLN C O   1 
ATOM   9337  C  CB  . GLN C 1 165 ? 8.871   14.058  62.749  1.00 35.24 ? 168  GLN C CB  1 
ATOM   9338  C  CG  . GLN C 1 165 ? 8.259   12.678  62.909  1.00 35.23 ? 168  GLN C CG  1 
ATOM   9339  C  CD  . GLN C 1 165 ? 8.247   12.195  64.347  1.00 35.16 ? 168  GLN C CD  1 
ATOM   9340  O  OE1 . GLN C 1 165 ? 7.193   11.894  64.907  1.00 35.08 ? 168  GLN C OE1 1 
ATOM   9341  N  NE2 . GLN C 1 165 ? 9.424   12.106  64.948  1.00 35.03 ? 168  GLN C NE2 1 
ATOM   9342  N  N   . LYS C 1 166 ? 8.714   17.412  62.477  1.00 35.72 ? 169  LYS C N   1 
ATOM   9343  C  CA  . LYS C 1 166 ? 9.511   18.624  62.592  1.00 35.86 ? 169  LYS C CA  1 
ATOM   9344  C  C   . LYS C 1 166 ? 8.813   19.813  63.247  1.00 36.01 ? 169  LYS C C   1 
ATOM   9345  O  O   . LYS C 1 166 ? 8.040   19.638  64.192  1.00 36.16 ? 169  LYS C O   1 
ATOM   9346  C  CB  . LYS C 1 166 ? 10.141  18.971  61.242  1.00 35.72 ? 169  LYS C CB  1 
ATOM   9347  C  CG  . LYS C 1 166 ? 11.292  18.029  60.892  1.00 35.32 ? 169  LYS C CG  1 
ATOM   9348  C  CD  . LYS C 1 166 ? 11.726  18.173  59.459  1.00 35.21 ? 169  LYS C CD  1 
ATOM   9349  C  CE  . LYS C 1 166 ? 12.995  17.388  59.204  1.00 34.95 ? 169  LYS C CE  1 
ATOM   9350  N  NZ  . LYS C 1 166 ? 14.150  18.012  59.897  1.00 34.88 ? 169  LYS C NZ  1 
ATOM   9351  N  N   . ARG C 1 167 ? 9.079   21.020  62.761  1.00 35.94 ? 170  ARG C N   1 
ATOM   9352  C  CA  . ARG C 1 167 ? 8.495   22.218  63.365  1.00 35.85 ? 170  ARG C CA  1 
ATOM   9353  C  C   . ARG C 1 167 ? 7.157   22.702  62.817  1.00 35.74 ? 170  ARG C C   1 
ATOM   9354  O  O   . ARG C 1 167 ? 6.843   22.503  61.642  1.00 35.79 ? 170  ARG C O   1 
ATOM   9355  C  CB  . ARG C 1 167 ? 9.517   23.349  63.314  1.00 35.70 ? 170  ARG C CB  1 
ATOM   9356  C  CG  . ARG C 1 167 ? 10.806  22.997  64.009  1.00 35.75 ? 170  ARG C CG  1 
ATOM   9357  C  CD  . ARG C 1 167 ? 11.901  23.950  63.627  1.00 36.01 ? 170  ARG C CD  1 
ATOM   9358  N  NE  . ARG C 1 167 ? 13.164  23.598  64.265  1.00 36.52 ? 170  ARG C NE  1 
ATOM   9359  C  CZ  . ARG C 1 167 ? 13.542  24.023  65.466  1.00 36.89 ? 170  ARG C CZ  1 
ATOM   9360  N  NH1 . ARG C 1 167 ? 12.759  24.826  66.176  1.00 37.14 ? 170  ARG C NH1 1 
ATOM   9361  N  NH2 . ARG C 1 167 ? 14.700  23.626  65.968  1.00 37.15 ? 170  ARG C NH2 1 
ATOM   9362  N  N   . ASN C 1 168 ? 6.368   23.330  63.686  1.00 35.56 ? 171  ASN C N   1 
ATOM   9363  C  CA  . ASN C 1 168 ? 5.078   23.881  63.294  1.00 35.46 ? 171  ASN C CA  1 
ATOM   9364  C  C   . ASN C 1 168 ? 5.377   24.938  62.222  1.00 35.46 ? 171  ASN C C   1 
ATOM   9365  O  O   . ASN C 1 168 ? 6.294   25.743  62.380  1.00 35.55 ? 171  ASN C O   1 
ATOM   9366  C  CB  . ASN C 1 168 ? 4.397   24.518  64.506  1.00 35.43 ? 171  ASN C CB  1 
ATOM   9367  C  CG  . ASN C 1 168 ? 3.043   25.115  64.172  1.00 35.37 ? 171  ASN C CG  1 
ATOM   9368  O  OD1 . ASN C 1 168 ? 2.007   24.495  64.402  1.00 35.89 ? 171  ASN C OD1 1 
ATOM   9369  N  ND2 . ASN C 1 168 ? 3.044   26.326  63.641  1.00 35.35 ? 171  ASN C ND2 1 
ATOM   9370  N  N   . PRO C 1 169 ? 4.612   24.946  61.116  1.00 35.31 ? 172  PRO C N   1 
ATOM   9371  C  CA  . PRO C 1 169 ? 4.831   25.910  60.038  1.00 35.21 ? 172  PRO C CA  1 
ATOM   9372  C  C   . PRO C 1 169 ? 4.710   27.376  60.428  1.00 35.35 ? 172  PRO C C   1 
ATOM   9373  O  O   . PRO C 1 169 ? 5.275   28.243  59.757  1.00 35.29 ? 172  PRO C O   1 
ATOM   9374  C  CB  . PRO C 1 169 ? 3.785   25.499  59.007  1.00 35.22 ? 172  PRO C CB  1 
ATOM   9375  C  CG  . PRO C 1 169 ? 2.698   24.931  59.835  1.00 35.01 ? 172  PRO C CG  1 
ATOM   9376  C  CD  . PRO C 1 169 ? 3.462   24.083  60.801  1.00 35.20 ? 172  PRO C CD  1 
ATOM   9377  N  N   . GLN C 1 170 ? 3.989   27.659  61.507  1.00 35.37 ? 173  GLN C N   1 
ATOM   9378  C  CA  . GLN C 1 170 ? 3.830   29.038  61.948  1.00 35.53 ? 173  GLN C CA  1 
ATOM   9379  C  C   . GLN C 1 170 ? 4.721   29.419  63.125  1.00 35.66 ? 173  GLN C C   1 
ATOM   9380  O  O   . GLN C 1 170 ? 5.410   30.437  63.082  1.00 35.41 ? 173  GLN C O   1 
ATOM   9381  C  CB  . GLN C 1 170 ? 2.370   29.330  62.292  1.00 35.63 ? 173  GLN C CB  1 
ATOM   9382  C  CG  . GLN C 1 170 ? 2.177   30.670  62.984  1.00 35.84 ? 173  GLN C CG  1 
ATOM   9383  C  CD  . GLN C 1 170 ? 0.746   31.126  62.972  1.00 36.10 ? 173  GLN C CD  1 
ATOM   9384  O  OE1 . GLN C 1 170 ? -0.172  30.327  62.778  1.00 36.35 ? 173  GLN C OE1 1 
ATOM   9385  N  NE2 . GLN C 1 170 ? 0.539   32.424  63.167  1.00 36.09 ? 173  GLN C NE2 1 
ATOM   9386  N  N   . THR C 1 171 ? 4.709   28.591  64.166  1.00 35.68 ? 174  THR C N   1 
ATOM   9387  C  CA  . THR C 1 171 ? 5.486   28.843  65.370  1.00 35.73 ? 174  THR C CA  1 
ATOM   9388  C  C   . THR C 1 171 ? 6.932   28.368  65.322  1.00 35.89 ? 174  THR C C   1 
ATOM   9389  O  O   . THR C 1 171 ? 7.755   28.803  66.122  1.00 35.93 ? 174  THR C O   1 
ATOM   9390  C  CB  . THR C 1 171 ? 4.827   28.189  66.581  1.00 35.91 ? 174  THR C CB  1 
ATOM   9391  O  OG1 . THR C 1 171 ? 4.793   26.774  66.385  1.00 35.94 ? 174  THR C OG1 1 
ATOM   9392  C  CG2 . THR C 1 171 ? 3.412   28.696  66.760  1.00 35.91 ? 174  THR C CG2 1 
ATOM   9393  N  N   . HIS C 1 172 ? 7.239   27.464  64.403  1.00 35.93 ? 175  HIS C N   1 
ATOM   9394  C  CA  . HIS C 1 172 ? 8.585   26.922  64.283  1.00 36.22 ? 175  HIS C CA  1 
ATOM   9395  C  C   . HIS C 1 172 ? 8.956   26.146  65.539  1.00 36.63 ? 175  HIS C C   1 
ATOM   9396  O  O   . HIS C 1 172 ? 10.132  25.999  65.863  1.00 36.67 ? 175  HIS C O   1 
ATOM   9397  C  CB  . HIS C 1 172 ? 9.605   28.033  64.042  1.00 35.89 ? 175  HIS C CB  1 
ATOM   9398  C  CG  . HIS C 1 172 ? 10.837  27.572  63.327  1.00 36.08 ? 175  HIS C CG  1 
ATOM   9399  N  ND1 . HIS C 1 172 ? 10.800  27.013  62.069  1.00 36.07 ? 175  HIS C ND1 1 
ATOM   9400  C  CD2 . HIS C 1 172 ? 12.141  27.591  63.691  1.00 36.18 ? 175  HIS C CD2 1 
ATOM   9401  C  CE1 . HIS C 1 172 ? 12.028  26.709  61.687  1.00 36.07 ? 175  HIS C CE1 1 
ATOM   9402  N  NE2 . HIS C 1 172 ? 12.861  27.049  62.652  1.00 36.01 ? 175  HIS C NE2 1 
ATOM   9403  N  N   . LEU C 1 173 ? 7.946   25.647  66.241  1.00 36.74 ? 176  LEU C N   1 
ATOM   9404  C  CA  . LEU C 1 173 ? 8.161   24.881  67.462  1.00 37.08 ? 176  LEU C CA  1 
ATOM   9405  C  C   . LEU C 1 173 ? 7.737   23.434  67.258  1.00 37.53 ? 176  LEU C C   1 
ATOM   9406  O  O   . LEU C 1 173 ? 6.836   23.165  66.463  1.00 37.56 ? 176  LEU C O   1 
ATOM   9407  C  CB  . LEU C 1 173 ? 7.333   25.477  68.597  1.00 36.70 ? 176  LEU C CB  1 
ATOM   9408  C  CG  . LEU C 1 173 ? 7.581   26.936  68.953  1.00 36.33 ? 176  LEU C CG  1 
ATOM   9409  C  CD1 . LEU C 1 173 ? 6.541   27.402  69.935  1.00 36.33 ? 176  LEU C CD1 1 
ATOM   9410  C  CD2 . LEU C 1 173 ? 8.956   27.085  69.538  1.00 36.36 ? 176  LEU C CD2 1 
ATOM   9411  N  N   . LYS C 1 174 ? 8.403   22.502  67.942  1.00 38.16 ? 177  LYS C N   1 
ATOM   9412  C  CA  . LYS C 1 174 ? 8.035   21.088  67.854  1.00 38.79 ? 177  LYS C CA  1 
ATOM   9413  C  C   . LYS C 1 174 ? 6.584   21.057  68.313  1.00 38.90 ? 177  LYS C C   1 
ATOM   9414  O  O   . LYS C 1 174 ? 6.218   21.753  69.257  1.00 39.06 ? 177  LYS C O   1 
ATOM   9415  C  CB  . LYS C 1 174 ? 8.908   20.225  68.771  1.00 39.33 ? 177  LYS C CB  1 
ATOM   9416  C  CG  . LYS C 1 174 ? 10.382  20.186  68.375  1.00 40.25 ? 177  LYS C CG  1 
ATOM   9417  C  CD  . LYS C 1 174 ? 10.558  19.676  66.936  1.00 41.23 ? 177  LYS C CD  1 
ATOM   9418  C  CE  . LYS C 1 174 ? 11.996  19.845  66.417  1.00 41.75 ? 177  LYS C CE  1 
ATOM   9419  N  NZ  . LYS C 1 174 ? 12.958  18.797  66.895  1.00 42.10 ? 177  LYS C NZ  1 
ATOM   9420  N  N   . ASP C 1 175 ? 5.757   20.260  67.651  1.00 38.95 ? 178  ASP C N   1 
ATOM   9421  C  CA  . ASP C 1 175 ? 4.343   20.237  67.968  1.00 38.88 ? 178  ASP C CA  1 
ATOM   9422  C  C   . ASP C 1 175 ? 3.817   18.829  68.206  1.00 38.92 ? 178  ASP C C   1 
ATOM   9423  O  O   . ASP C 1 175 ? 3.626   18.071  67.260  1.00 39.12 ? 178  ASP C O   1 
ATOM   9424  C  CB  . ASP C 1 175 ? 3.600   20.888  66.795  1.00 38.89 ? 178  ASP C CB  1 
ATOM   9425  C  CG  . ASP C 1 175 ? 2.189   21.306  67.135  1.00 38.84 ? 178  ASP C CG  1 
ATOM   9426  O  OD1 . ASP C 1 175 ? 1.519   20.603  67.908  1.00 39.05 ? 178  ASP C OD1 1 
ATOM   9427  O  OD2 . ASP C 1 175 ? 1.734   22.335  66.600  1.00 38.93 ? 178  ASP C OD2 1 
ATOM   9428  N  N   . PRO C 1 176 ? 3.579   18.456  69.476  1.00 38.86 ? 179  PRO C N   1 
ATOM   9429  C  CA  . PRO C 1 176 ? 3.065   17.116  69.799  1.00 38.78 ? 179  PRO C CA  1 
ATOM   9430  C  C   . PRO C 1 176 ? 1.690   16.784  69.214  1.00 38.67 ? 179  PRO C C   1 
ATOM   9431  O  O   . PRO C 1 176 ? 1.359   15.608  69.047  1.00 38.53 ? 179  PRO C O   1 
ATOM   9432  C  CB  . PRO C 1 176 ? 3.083   17.081  71.336  1.00 38.83 ? 179  PRO C CB  1 
ATOM   9433  C  CG  . PRO C 1 176 ? 3.115   18.515  71.736  1.00 39.02 ? 179  PRO C CG  1 
ATOM   9434  C  CD  . PRO C 1 176 ? 3.999   19.156  70.700  1.00 38.96 ? 179  PRO C CD  1 
ATOM   9435  N  N   . ASP C 1 177 ? 0.884   17.809  68.927  1.00 38.53 ? 180  ASP C N   1 
ATOM   9436  C  CA  . ASP C 1 177 ? -0.431  17.589  68.317  1.00 38.23 ? 180  ASP C CA  1 
ATOM   9437  C  C   . ASP C 1 177 ? -0.157  17.038  66.927  1.00 37.95 ? 180  ASP C C   1 
ATOM   9438  O  O   . ASP C 1 177 ? -0.809  16.095  66.490  1.00 37.92 ? 180  ASP C O   1 
ATOM   9439  C  CB  . ASP C 1 177 ? -1.233  18.895  68.197  1.00 38.39 ? 180  ASP C CB  1 
ATOM   9440  C  CG  . ASP C 1 177 ? -2.164  19.145  69.388  1.00 38.61 ? 180  ASP C CG  1 
ATOM   9441  O  OD1 . ASP C 1 177 ? -3.071  20.000  69.259  1.00 38.76 ? 180  ASP C OD1 1 
ATOM   9442  O  OD2 . ASP C 1 177 ? -1.996  18.508  70.450  1.00 38.78 ? 180  ASP C OD2 1 
ATOM   9443  N  N   . MET C 1 178 ? 0.837   17.619  66.255  1.00 37.56 ? 181  MET C N   1 
ATOM   9444  C  CA  . MET C 1 178 ? 1.234   17.184  64.920  1.00 37.14 ? 181  MET C CA  1 
ATOM   9445  C  C   . MET C 1 178 ? 1.798   15.777  64.990  1.00 36.92 ? 181  MET C C   1 
ATOM   9446  O  O   . MET C 1 178 ? 1.414   14.905  64.213  1.00 36.89 ? 181  MET C O   1 
ATOM   9447  C  CB  . MET C 1 178 ? 2.291   18.123  64.343  1.00 37.22 ? 181  MET C CB  1 
ATOM   9448  C  CG  . MET C 1 178 ? 1.741   19.447  63.865  1.00 37.58 ? 181  MET C CG  1 
ATOM   9449  S  SD  . MET C 1 178 ? 3.006   20.624  63.380  1.00 38.19 ? 181  MET C SD  1 
ATOM   9450  C  CE  . MET C 1 178 ? 3.882   19.707  62.165  1.00 38.02 ? 181  MET C CE  1 
ATOM   9451  N  N   . VAL C 1 179 ? 2.697   15.558  65.944  1.00 36.49 ? 182  VAL C N   1 
ATOM   9452  C  CA  . VAL C 1 179 ? 3.331   14.263  66.120  1.00 35.98 ? 182  VAL C CA  1 
ATOM   9453  C  C   . VAL C 1 179 ? 2.309   13.168  66.327  1.00 36.16 ? 182  VAL C C   1 
ATOM   9454  O  O   . VAL C 1 179 ? 2.280   12.193  65.583  1.00 35.96 ? 182  VAL C O   1 
ATOM   9455  C  CB  . VAL C 1 179 ? 4.286   14.268  67.321  1.00 35.70 ? 182  VAL C CB  1 
ATOM   9456  C  CG1 . VAL C 1 179 ? 4.852   12.892  67.545  1.00 35.18 ? 182  VAL C CG1 1 
ATOM   9457  C  CG2 . VAL C 1 179 ? 5.405   15.253  67.091  1.00 35.41 ? 182  VAL C CG2 1 
ATOM   9458  N  N   . TRP C 1 180 ? 1.435   13.368  67.306  1.00 36.13 ? 183  TRP C N   1 
ATOM   9459  C  CA  . TRP C 1 180 ? 0.424   12.377  67.648  1.00 36.20 ? 183  TRP C CA  1 
ATOM   9460  C  C   . TRP C 1 180 ? -0.849  12.326  66.809  1.00 36.30 ? 183  TRP C C   1 
ATOM   9461  O  O   . TRP C 1 180 ? -1.519  11.289  66.764  1.00 36.22 ? 183  TRP C O   1 
ATOM   9462  C  CB  . TRP C 1 180 ? 0.125   12.437  69.146  1.00 36.22 ? 183  TRP C CB  1 
ATOM   9463  C  CG  . TRP C 1 180 ? 1.281   11.922  69.958  1.00 36.21 ? 183  TRP C CG  1 
ATOM   9464  C  CD1 . TRP C 1 180 ? 2.196   12.662  70.656  1.00 36.09 ? 183  TRP C CD1 1 
ATOM   9465  C  CD2 . TRP C 1 180 ? 1.686   10.555  70.090  1.00 36.13 ? 183  TRP C CD2 1 
ATOM   9466  N  NE1 . TRP C 1 180 ? 3.150   11.841  71.204  1.00 35.92 ? 183  TRP C NE1 1 
ATOM   9467  C  CE2 . TRP C 1 180 ? 2.861   10.540  70.874  1.00 36.23 ? 183  TRP C CE2 1 
ATOM   9468  C  CE3 . TRP C 1 180 ? 1.172   9.338   69.618  1.00 36.07 ? 183  TRP C CE3 1 
ATOM   9469  C  CZ2 . TRP C 1 180 ? 3.530   9.356   71.199  1.00 36.08 ? 183  TRP C CZ2 1 
ATOM   9470  C  CZ3 . TRP C 1 180 ? 1.836   8.160   69.941  1.00 36.08 ? 183  TRP C CZ3 1 
ATOM   9471  C  CH2 . TRP C 1 180 ? 3.003   8.180   70.725  1.00 35.99 ? 183  TRP C CH2 1 
ATOM   9472  N  N   . ASP C 1 181 ? -1.189  13.420  66.136  1.00 36.26 ? 184  ASP C N   1 
ATOM   9473  C  CA  . ASP C 1 181 ? -2.369  13.405  65.283  1.00 36.27 ? 184  ASP C CA  1 
ATOM   9474  C  C   . ASP C 1 181 ? -2.061  12.472  64.130  1.00 36.08 ? 184  ASP C C   1 
ATOM   9475  O  O   . ASP C 1 181 ? -2.885  11.647  63.756  1.00 36.07 ? 184  ASP C O   1 
ATOM   9476  C  CB  . ASP C 1 181 ? -2.690  14.793  64.730  1.00 36.68 ? 184  ASP C CB  1 
ATOM   9477  C  CG  . ASP C 1 181 ? -3.989  14.817  63.939  1.00 37.21 ? 184  ASP C CG  1 
ATOM   9478  O  OD1 . ASP C 1 181 ? -4.876  13.974  64.208  1.00 37.55 ? 184  ASP C OD1 1 
ATOM   9479  O  OD2 . ASP C 1 181 ? -4.134  15.683  63.051  1.00 37.71 ? 184  ASP C OD2 1 
ATOM   9480  N  N   . PHE C 1 182 ? -0.862  12.603  63.573  1.00 35.75 ? 185  PHE C N   1 
ATOM   9481  C  CA  . PHE C 1 182 ? -0.447  11.752  62.475  1.00 35.56 ? 185  PHE C CA  1 
ATOM   9482  C  C   . PHE C 1 182 ? -0.332  10.301  62.937  1.00 35.64 ? 185  PHE C C   1 
ATOM   9483  O  O   . PHE C 1 182 ? -0.890  9.407   62.308  1.00 35.64 ? 185  PHE C O   1 
ATOM   9484  C  CB  . PHE C 1 182 ? 0.893   12.226  61.902  1.00 35.27 ? 185  PHE C CB  1 
ATOM   9485  C  CG  . PHE C 1 182 ? 1.364   11.420  60.723  1.00 34.84 ? 185  PHE C CG  1 
ATOM   9486  C  CD1 . PHE C 1 182 ? 2.246   10.359  60.892  1.00 34.49 ? 185  PHE C CD1 1 
ATOM   9487  C  CD2 . PHE C 1 182 ? 0.907   11.706  59.446  1.00 34.64 ? 185  PHE C CD2 1 
ATOM   9488  C  CE1 . PHE C 1 182 ? 2.658   9.602   59.814  1.00 34.19 ? 185  PHE C CE1 1 
ATOM   9489  C  CE2 . PHE C 1 182 ? 1.317   10.950  58.363  1.00 34.32 ? 185  PHE C CE2 1 
ATOM   9490  C  CZ  . PHE C 1 182 ? 2.194   9.898   58.550  1.00 34.20 ? 185  PHE C CZ  1 
ATOM   9491  N  N   . TRP C 1 183 ? 0.377   10.066  64.038  1.00 35.69 ? 186  TRP C N   1 
ATOM   9492  C  CA  . TRP C 1 183 ? 0.557   8.705   64.551  1.00 35.74 ? 186  TRP C CA  1 
ATOM   9493  C  C   . TRP C 1 183 ? -0.739  7.998   64.921  1.00 35.88 ? 186  TRP C C   1 
ATOM   9494  O  O   . TRP C 1 183 ? -0.882  6.814   64.650  1.00 35.80 ? 186  TRP C O   1 
ATOM   9495  C  CB  . TRP C 1 183 ? 1.523   8.684   65.744  1.00 35.54 ? 186  TRP C CB  1 
ATOM   9496  C  CG  . TRP C 1 183 ? 2.970   8.584   65.367  1.00 35.33 ? 186  TRP C CG  1 
ATOM   9497  C  CD1 . TRP C 1 183 ? 3.472   8.206   64.161  1.00 35.33 ? 186  TRP C CD1 1 
ATOM   9498  C  CD2 . TRP C 1 183 ? 4.101   8.885   66.196  1.00 35.18 ? 186  TRP C CD2 1 
ATOM   9499  N  NE1 . TRP C 1 183 ? 4.846   8.258   64.180  1.00 35.32 ? 186  TRP C NE1 1 
ATOM   9500  C  CE2 . TRP C 1 183 ? 5.258   8.673   65.418  1.00 35.35 ? 186  TRP C CE2 1 
ATOM   9501  C  CE3 . TRP C 1 183 ? 4.248   9.314   67.520  1.00 35.17 ? 186  TRP C CE3 1 
ATOM   9502  C  CZ2 . TRP C 1 183 ? 6.547   8.878   65.918  1.00 35.26 ? 186  TRP C CZ2 1 
ATOM   9503  C  CZ3 . TRP C 1 183 ? 5.525   9.517   68.017  1.00 35.22 ? 186  TRP C CZ3 1 
ATOM   9504  C  CH2 . TRP C 1 183 ? 6.661   9.299   67.215  1.00 35.29 ? 186  TRP C CH2 1 
ATOM   9505  N  N   . SER C 1 184 ? -1.677  8.715   65.539  1.00 36.01 ? 187  SER C N   1 
ATOM   9506  C  CA  . SER C 1 184 ? -2.953  8.119   65.939  1.00 36.37 ? 187  SER C CA  1 
ATOM   9507  C  C   . SER C 1 184 ? -3.849  7.838   64.742  1.00 36.60 ? 187  SER C C   1 
ATOM   9508  O  O   . SER C 1 184 ? -4.666  6.913   64.762  1.00 36.56 ? 187  SER C O   1 
ATOM   9509  C  CB  . SER C 1 184 ? -3.688  9.019   66.938  1.00 36.28 ? 187  SER C CB  1 
ATOM   9510  O  OG  . SER C 1 184 ? -4.016  10.274  66.369  1.00 36.62 ? 187  SER C OG  1 
ATOM   9511  N  N   . LEU C 1 185 ? -3.700  8.654   63.705  1.00 36.89 ? 188  LEU C N   1 
ATOM   9512  C  CA  . LEU C 1 185 ? -4.480  8.508   62.481  1.00 37.16 ? 188  LEU C CA  1 
ATOM   9513  C  C   . LEU C 1 185 ? -3.896  7.396   61.617  1.00 37.35 ? 188  LEU C C   1 
ATOM   9514  O  O   . LEU C 1 185 ? -4.603  6.766   60.826  1.00 37.38 ? 188  LEU C O   1 
ATOM   9515  C  CB  . LEU C 1 185 ? -4.463  9.825   61.707  1.00 36.89 ? 188  LEU C CB  1 
ATOM   9516  C  CG  . LEU C 1 185 ? -5.705  10.710  61.711  1.00 36.78 ? 188  LEU C CG  1 
ATOM   9517  C  CD1 . LEU C 1 185 ? -6.485  10.589  63.005  1.00 36.87 ? 188  LEU C CD1 1 
ATOM   9518  C  CD2 . LEU C 1 185 ? -5.275  12.136  61.456  1.00 36.67 ? 188  LEU C CD2 1 
ATOM   9519  N  N   . ARG C 1 186 ? -2.596  7.162   61.779  1.00 37.59 ? 189  ARG C N   1 
ATOM   9520  C  CA  . ARG C 1 186 ? -1.887  6.141   61.022  1.00 37.52 ? 189  ARG C CA  1 
ATOM   9521  C  C   . ARG C 1 186 ? -1.276  5.082   61.944  1.00 37.84 ? 189  ARG C C   1 
ATOM   9522  O  O   . ARG C 1 186 ? -0.068  5.063   62.175  1.00 37.96 ? 189  ARG C O   1 
ATOM   9523  C  CB  . ARG C 1 186 ? -0.789  6.784   60.168  1.00 37.06 ? 189  ARG C CB  1 
ATOM   9524  C  CG  . ARG C 1 186 ? -1.291  7.814   59.170  1.00 36.45 ? 189  ARG C CG  1 
ATOM   9525  C  CD  . ARG C 1 186 ? -2.355  7.238   58.244  1.00 36.04 ? 189  ARG C CD  1 
ATOM   9526  N  NE  . ARG C 1 186 ? -1.858  6.132   57.435  1.00 35.54 ? 189  ARG C NE  1 
ATOM   9527  C  CZ  . ARG C 1 186 ? -2.427  5.717   56.310  1.00 35.37 ? 189  ARG C CZ  1 
ATOM   9528  N  NH1 . ARG C 1 186 ? -3.518  6.316   55.852  1.00 35.11 ? 189  ARG C NH1 1 
ATOM   9529  N  NH2 . ARG C 1 186 ? -1.906  4.697   55.643  1.00 35.26 ? 189  ARG C NH2 1 
ATOM   9530  N  N   . PRO C 1 187 ? -2.102  4.149   62.436  1.00 38.15 ? 190  PRO C N   1 
ATOM   9531  C  CA  . PRO C 1 187 ? -1.634  3.089   63.328  1.00 38.38 ? 190  PRO C CA  1 
ATOM   9532  C  C   . PRO C 1 187 ? -0.585  2.113   62.786  1.00 38.71 ? 190  PRO C C   1 
ATOM   9533  O  O   . PRO C 1 187 ? -0.163  1.224   63.522  1.00 38.78 ? 190  PRO C O   1 
ATOM   9534  C  CB  . PRO C 1 187 ? -2.933  2.381   63.727  1.00 38.44 ? 190  PRO C CB  1 
ATOM   9535  C  CG  . PRO C 1 187 ? -3.824  2.609   62.550  1.00 38.40 ? 190  PRO C CG  1 
ATOM   9536  C  CD  . PRO C 1 187 ? -3.557  4.053   62.229  1.00 38.24 ? 190  PRO C CD  1 
ATOM   9537  N  N   . GLU C 1 188 ? -0.162  2.248   61.525  1.00 39.08 ? 191  GLU C N   1 
ATOM   9538  C  CA  . GLU C 1 188 ? 0.872   1.347   60.995  1.00 39.48 ? 191  GLU C CA  1 
ATOM   9539  C  C   . GLU C 1 188 ? 2.137   1.618   61.786  1.00 39.65 ? 191  GLU C C   1 
ATOM   9540  O  O   . GLU C 1 188 ? 3.018   0.762   61.889  1.00 39.95 ? 191  GLU C O   1 
ATOM   9541  C  CB  . GLU C 1 188 ? 1.236   1.638   59.538  1.00 39.66 ? 191  GLU C CB  1 
ATOM   9542  C  CG  . GLU C 1 188 ? 0.122   2.004   58.622  1.00 40.18 ? 191  GLU C CG  1 
ATOM   9543  C  CD  . GLU C 1 188 ? -0.172  3.478   58.640  1.00 40.21 ? 191  GLU C CD  1 
ATOM   9544  O  OE1 . GLU C 1 188 ? 0.512   4.250   57.934  1.00 40.26 ? 191  GLU C OE1 1 
ATOM   9545  O  OE2 . GLU C 1 188 ? -1.113  3.855   59.351  1.00 40.36 ? 191  GLU C OE2 1 
ATOM   9546  N  N   . SER C 1 189 ? 2.238   2.847   62.284  1.00 39.56 ? 192  SER C N   1 
ATOM   9547  C  CA  . SER C 1 189 ? 3.383   3.304   63.054  1.00 39.49 ? 192  SER C CA  1 
ATOM   9548  C  C   . SER C 1 189 ? 3.565   2.626   64.403  1.00 39.32 ? 192  SER C C   1 
ATOM   9549  O  O   . SER C 1 189 ? 4.621   2.769   65.016  1.00 39.49 ? 192  SER C O   1 
ATOM   9550  C  CB  . SER C 1 189 ? 3.290   4.813   63.266  1.00 39.40 ? 192  SER C CB  1 
ATOM   9551  O  OG  . SER C 1 189 ? 2.082   5.150   63.924  1.00 39.52 ? 192  SER C OG  1 
ATOM   9552  N  N   . LEU C 1 190 ? 2.557   1.885   64.856  1.00 38.98 ? 193  LEU C N   1 
ATOM   9553  C  CA  . LEU C 1 190 ? 2.615   1.213   66.148  1.00 38.81 ? 193  LEU C CA  1 
ATOM   9554  C  C   . LEU C 1 190 ? 3.854   0.376   66.405  1.00 38.75 ? 193  LEU C C   1 
ATOM   9555  O  O   . LEU C 1 190 ? 4.388   0.384   67.515  1.00 38.71 ? 193  LEU C O   1 
ATOM   9556  C  CB  . LEU C 1 190 ? 1.375   0.354   66.362  1.00 38.72 ? 193  LEU C CB  1 
ATOM   9557  C  CG  . LEU C 1 190 ? 0.097   1.140   66.638  1.00 38.72 ? 193  LEU C CG  1 
ATOM   9558  C  CD1 . LEU C 1 190 ? -1.120  0.226   66.514  1.00 38.70 ? 193  LEU C CD1 1 
ATOM   9559  C  CD2 . LEU C 1 190 ? 0.181   1.797   68.013  1.00 38.55 ? 193  LEU C CD2 1 
ATOM   9560  N  N   . HIS C 1 191 ? 4.325   -0.336  65.388  1.00 38.61 ? 194  HIS C N   1 
ATOM   9561  C  CA  . HIS C 1 191 ? 5.503   -1.173  65.563  1.00 38.62 ? 194  HIS C CA  1 
ATOM   9562  C  C   . HIS C 1 191 ? 6.763   -0.359  65.864  1.00 38.75 ? 194  HIS C C   1 
ATOM   9563  O  O   . HIS C 1 191 ? 7.410   -0.559  66.897  1.00 38.64 ? 194  HIS C O   1 
ATOM   9564  C  CB  . HIS C 1 191 ? 5.723   -2.061  64.342  1.00 38.45 ? 194  HIS C CB  1 
ATOM   9565  C  CG  . HIS C 1 191 ? 6.488   -3.311  64.644  1.00 38.53 ? 194  HIS C CG  1 
ATOM   9566  N  ND1 . HIS C 1 191 ? 6.668   -4.318  63.720  1.00 38.57 ? 194  HIS C ND1 1 
ATOM   9567  C  CD2 . HIS C 1 191 ? 7.110   -3.722  65.774  1.00 38.45 ? 194  HIS C CD2 1 
ATOM   9568  C  CE1 . HIS C 1 191 ? 7.369   -5.295  64.268  1.00 38.66 ? 194  HIS C CE1 1 
ATOM   9569  N  NE2 . HIS C 1 191 ? 7.650   -4.958  65.514  1.00 38.59 ? 194  HIS C NE2 1 
ATOM   9570  N  N   . GLN C 1 192 ? 7.093   0.570   64.971  1.00 38.77 ? 195  GLN C N   1 
ATOM   9571  C  CA  . GLN C 1 192 ? 8.271   1.418   65.126  1.00 38.77 ? 195  GLN C CA  1 
ATOM   9572  C  C   . GLN C 1 192 ? 8.143   2.389   66.308  1.00 39.00 ? 195  GLN C C   1 
ATOM   9573  O  O   . GLN C 1 192 ? 9.133   2.678   66.988  1.00 39.04 ? 195  GLN C O   1 
ATOM   9574  C  CB  . GLN C 1 192 ? 8.567   2.149   63.809  1.00 38.63 ? 195  GLN C CB  1 
ATOM   9575  C  CG  . GLN C 1 192 ? 9.723   3.143   63.841  1.00 38.64 ? 195  GLN C CG  1 
ATOM   9576  C  CD  . GLN C 1 192 ? 11.066  2.528   64.185  1.00 38.68 ? 195  GLN C CD  1 
ATOM   9577  O  OE1 . GLN C 1 192 ? 11.250  1.315   64.108  1.00 38.87 ? 195  GLN C OE1 1 
ATOM   9578  N  NE2 . GLN C 1 192 ? 12.017  3.372   64.564  1.00 38.63 ? 195  GLN C NE2 1 
ATOM   9579  N  N   . VAL C 1 193 ? 6.930   2.870   66.579  1.00 39.04 ? 196  VAL C N   1 
ATOM   9580  C  CA  . VAL C 1 193 ? 6.719   3.769   67.715  1.00 39.05 ? 196  VAL C CA  1 
ATOM   9581  C  C   . VAL C 1 193 ? 7.128   3.032   68.981  1.00 39.27 ? 196  VAL C C   1 
ATOM   9582  O  O   . VAL C 1 193 ? 7.765   3.600   69.861  1.00 39.33 ? 196  VAL C O   1 
ATOM   9583  C  CB  . VAL C 1 193 ? 5.242   4.220   67.827  1.00 39.03 ? 196  VAL C CB  1 
ATOM   9584  C  CG1 . VAL C 1 193 ? 4.956   4.810   69.203  1.00 38.83 ? 196  VAL C CG1 1 
ATOM   9585  C  CG2 . VAL C 1 193 ? 4.942   5.258   66.763  1.00 38.93 ? 196  VAL C CG2 1 
ATOM   9586  N  N   . SER C 1 194 ? 6.782   1.750   69.042  1.00 39.48 ? 197  SER C N   1 
ATOM   9587  C  CA  . SER C 1 194 ? 7.114   0.902   70.180  1.00 39.75 ? 197  SER C CA  1 
ATOM   9588  C  C   . SER C 1 194 ? 8.631   0.734   70.335  1.00 40.03 ? 197  SER C C   1 
ATOM   9589  O  O   . SER C 1 194 ? 9.148   0.732   71.454  1.00 40.08 ? 197  SER C O   1 
ATOM   9590  C  CB  . SER C 1 194 ? 6.434   -0.457  70.027  1.00 39.62 ? 197  SER C CB  1 
ATOM   9591  O  OG  . SER C 1 194 ? 5.031   -0.298  69.910  1.00 39.68 ? 197  SER C OG  1 
ATOM   9592  N  N   . PHE C 1 195 ? 9.337   0.569   69.219  1.00 40.10 ? 198  PHE C N   1 
ATOM   9593  C  CA  . PHE C 1 195 ? 10.791  0.435   69.253  1.00 40.23 ? 198  PHE C CA  1 
ATOM   9594  C  C   . PHE C 1 195 ? 11.388  1.755   69.719  1.00 39.95 ? 198  PHE C C   1 
ATOM   9595  O  O   . PHE C 1 195 ? 12.245  1.792   70.599  1.00 39.77 ? 198  PHE C O   1 
ATOM   9596  C  CB  . PHE C 1 195 ? 11.331  0.145   67.853  1.00 40.96 ? 198  PHE C CB  1 
ATOM   9597  C  CG  . PHE C 1 195 ? 11.233  -1.295  67.437  1.00 41.81 ? 198  PHE C CG  1 
ATOM   9598  C  CD1 . PHE C 1 195 ? 11.999  -1.771  66.376  1.00 42.18 ? 198  PHE C CD1 1 
ATOM   9599  C  CD2 . PHE C 1 195 ? 10.385  -2.181  68.091  1.00 42.26 ? 198  PHE C CD2 1 
ATOM   9600  C  CE1 . PHE C 1 195 ? 11.925  -3.115  65.967  1.00 42.34 ? 198  PHE C CE1 1 
ATOM   9601  C  CE2 . PHE C 1 195 ? 10.306  -3.532  67.685  1.00 42.57 ? 198  PHE C CE2 1 
ATOM   9602  C  CZ  . PHE C 1 195 ? 11.078  -3.992  66.623  1.00 42.34 ? 198  PHE C CZ  1 
ATOM   9603  N  N   . LEU C 1 196 ? 10.908  2.838   69.116  1.00 39.71 ? 199  LEU C N   1 
ATOM   9604  C  CA  . LEU C 1 196 ? 11.370  4.188   69.406  1.00 39.51 ? 199  LEU C CA  1 
ATOM   9605  C  C   . LEU C 1 196 ? 11.281  4.593   70.876  1.00 39.62 ? 199  LEU C C   1 
ATOM   9606  O  O   . LEU C 1 196 ? 12.234  5.147   71.433  1.00 39.52 ? 199  LEU C O   1 
ATOM   9607  C  CB  . LEU C 1 196 ? 10.599  5.183   68.545  1.00 39.26 ? 199  LEU C CB  1 
ATOM   9608  C  CG  . LEU C 1 196 ? 10.982  6.650   68.710  1.00 39.27 ? 199  LEU C CG  1 
ATOM   9609  C  CD1 . LEU C 1 196 ? 12.385  6.896   68.193  1.00 39.21 ? 199  LEU C CD1 1 
ATOM   9610  C  CD2 . LEU C 1 196 ? 9.986   7.506   67.969  1.00 39.39 ? 199  LEU C CD2 1 
ATOM   9611  N  N   . PHE C 1 197 ? 10.137  4.332   71.501  1.00 39.57 ? 200  PHE C N   1 
ATOM   9612  C  CA  . PHE C 1 197 ? 9.953   4.692   72.900  1.00 39.68 ? 200  PHE C CA  1 
ATOM   9613  C  C   . PHE C 1 197 ? 10.493  3.695   73.914  1.00 39.86 ? 200  PHE C C   1 
ATOM   9614  O  O   . PHE C 1 197 ? 10.299  3.862   75.118  1.00 39.82 ? 200  PHE C O   1 
ATOM   9615  C  CB  . PHE C 1 197 ? 8.493   5.030   73.184  1.00 39.56 ? 200  PHE C CB  1 
ATOM   9616  C  CG  . PHE C 1 197 ? 8.083   6.364   72.651  1.00 39.43 ? 200  PHE C CG  1 
ATOM   9617  C  CD1 . PHE C 1 197 ? 7.558   6.484   71.371  1.00 39.40 ? 200  PHE C CD1 1 
ATOM   9618  C  CD2 . PHE C 1 197 ? 8.256   7.514   73.415  1.00 39.37 ? 200  PHE C CD2 1 
ATOM   9619  C  CE1 . PHE C 1 197 ? 7.212   7.737   70.857  1.00 39.37 ? 200  PHE C CE1 1 
ATOM   9620  C  CE2 . PHE C 1 197 ? 7.914   8.768   72.910  1.00 39.23 ? 200  PHE C CE2 1 
ATOM   9621  C  CZ  . PHE C 1 197 ? 7.392   8.879   71.629  1.00 39.25 ? 200  PHE C CZ  1 
ATOM   9622  N  N   . SER C 1 198 ? 11.170  2.659   73.425  1.00 40.08 ? 201  SER C N   1 
ATOM   9623  C  CA  . SER C 1 198 ? 11.768  1.659   74.301  1.00 40.27 ? 201  SER C CA  1 
ATOM   9624  C  C   . SER C 1 198 ? 13.150  2.167   74.688  1.00 40.45 ? 201  SER C C   1 
ATOM   9625  O  O   . SER C 1 198 ? 13.525  3.296   74.355  1.00 40.46 ? 201  SER C O   1 
ATOM   9626  C  CB  . SER C 1 198 ? 11.907  0.321   73.581  1.00 40.05 ? 201  SER C CB  1 
ATOM   9627  O  OG  . SER C 1 198 ? 12.918  0.392   72.593  1.00 40.22 ? 201  SER C OG  1 
ATOM   9628  N  N   . ASP C 1 199 ? 13.923  1.315   75.348  1.00 40.61 ? 202  ASP C N   1 
ATOM   9629  C  CA  . ASP C 1 199 ? 15.262  1.684   75.780  1.00 40.84 ? 202  ASP C CA  1 
ATOM   9630  C  C   . ASP C 1 199 ? 16.201  2.021   74.640  1.00 40.91 ? 202  ASP C C   1 
ATOM   9631  O  O   . ASP C 1 199 ? 17.080  2.865   74.787  1.00 40.92 ? 202  ASP C O   1 
ATOM   9632  C  CB  . ASP C 1 199 ? 15.878  0.569   76.613  1.00 40.92 ? 202  ASP C CB  1 
ATOM   9633  C  CG  . ASP C 1 199 ? 15.143  0.337   77.909  1.00 41.26 ? 202  ASP C CG  1 
ATOM   9634  O  OD1 . ASP C 1 199 ? 14.310  1.185   78.305  1.00 41.40 ? 202  ASP C OD1 1 
ATOM   9635  O  OD2 . ASP C 1 199 ? 15.413  -0.706  78.539  1.00 41.67 ? 202  ASP C OD2 1 
ATOM   9636  N  N   . ARG C 1 200 ? 16.022  1.367   73.501  1.00 40.93 ? 203  ARG C N   1 
ATOM   9637  C  CA  . ARG C 1 200 ? 16.897  1.628   72.374  1.00 40.97 ? 203  ARG C CA  1 
ATOM   9638  C  C   . ARG C 1 200 ? 16.564  2.893   71.611  1.00 40.78 ? 203  ARG C C   1 
ATOM   9639  O  O   . ARG C 1 200 ? 17.164  3.172   70.567  1.00 40.83 ? 203  ARG C O   1 
ATOM   9640  C  CB  . ARG C 1 200 ? 16.938  0.426   71.452  1.00 41.38 ? 203  ARG C CB  1 
ATOM   9641  C  CG  . ARG C 1 200 ? 17.419  -0.790  72.182  1.00 41.94 ? 203  ARG C CG  1 
ATOM   9642  C  CD  . ARG C 1 200 ? 17.696  -1.933  71.258  1.00 42.46 ? 203  ARG C CD  1 
ATOM   9643  N  NE  . ARG C 1 200 ? 18.028  -3.121  72.036  1.00 43.04 ? 203  ARG C NE  1 
ATOM   9644  C  CZ  . ARG C 1 200 ? 18.302  -4.308  71.510  1.00 43.21 ? 203  ARG C CZ  1 
ATOM   9645  N  NH1 . ARG C 1 200 ? 18.589  -5.333  72.305  1.00 43.19 ? 203  ARG C NH1 1 
ATOM   9646  N  NH2 . ARG C 1 200 ? 18.294  -4.468  70.192  1.00 43.25 ? 203  ARG C NH2 1 
ATOM   9647  N  N   . GLY C 1 201 ? 15.635  3.674   72.159  1.00 40.48 ? 204  GLY C N   1 
ATOM   9648  C  CA  . GLY C 1 201 ? 15.247  4.922   71.533  1.00 39.94 ? 204  GLY C CA  1 
ATOM   9649  C  C   . GLY C 1 201 ? 16.382  5.923   71.593  1.00 39.58 ? 204  GLY C C   1 
ATOM   9650  O  O   . GLY C 1 201 ? 16.442  6.848   70.785  1.00 39.49 ? 204  GLY C O   1 
ATOM   9651  N  N   . ILE C 1 202 ? 17.291  5.736   72.547  1.00 39.31 ? 205  ILE C N   1 
ATOM   9652  C  CA  . ILE C 1 202 ? 18.436  6.627   72.708  1.00 39.01 ? 205  ILE C CA  1 
ATOM   9653  C  C   . ILE C 1 202 ? 19.700  5.815   72.971  1.00 38.84 ? 205  ILE C C   1 
ATOM   9654  O  O   . ILE C 1 202 ? 20.061  5.561   74.121  1.00 38.74 ? 205  ILE C O   1 
ATOM   9655  C  CB  . ILE C 1 202 ? 18.253  7.594   73.892  1.00 39.10 ? 205  ILE C CB  1 
ATOM   9656  C  CG1 . ILE C 1 202 ? 16.850  8.197   73.890  1.00 39.07 ? 205  ILE C CG1 1 
ATOM   9657  C  CG2 . ILE C 1 202 ? 19.285  8.704   73.820  1.00 39.09 ? 205  ILE C CG2 1 
ATOM   9658  C  CD1 . ILE C 1 202 ? 16.567  9.034   75.108  1.00 39.08 ? 205  ILE C CD1 1 
ATOM   9659  N  N   . PRO C 1 203 ? 20.380  5.376   71.905  1.00 38.67 ? 206  PRO C N   1 
ATOM   9660  C  CA  . PRO C 1 203 ? 21.609  4.590   72.022  1.00 38.61 ? 206  PRO C CA  1 
ATOM   9661  C  C   . PRO C 1 203 ? 22.720  5.385   72.695  1.00 38.55 ? 206  PRO C C   1 
ATOM   9662  O  O   . PRO C 1 203 ? 22.722  6.619   72.663  1.00 38.56 ? 206  PRO C O   1 
ATOM   9663  C  CB  . PRO C 1 203 ? 21.971  4.318   70.565  1.00 38.64 ? 206  PRO C CB  1 
ATOM   9664  C  CG  . PRO C 1 203 ? 20.655  4.328   69.881  1.00 38.83 ? 206  PRO C CG  1 
ATOM   9665  C  CD  . PRO C 1 203 ? 19.987  5.513   70.495  1.00 38.78 ? 206  PRO C CD  1 
ATOM   9666  N  N   . ASP C 1 204 ? 23.655  4.677   73.317  1.00 38.50 ? 207  ASP C N   1 
ATOM   9667  C  CA  . ASP C 1 204 ? 24.782  5.327   73.962  1.00 38.34 ? 207  ASP C CA  1 
ATOM   9668  C  C   . ASP C 1 204 ? 25.847  5.497   72.882  1.00 38.25 ? 207  ASP C C   1 
ATOM   9669  O  O   . ASP C 1 204 ? 26.815  4.737   72.812  1.00 38.36 ? 207  ASP C O   1 
ATOM   9670  C  CB  . ASP C 1 204 ? 25.311  4.469   75.115  1.00 38.35 ? 207  ASP C CB  1 
ATOM   9671  C  CG  . ASP C 1 204 ? 26.369  5.177   75.934  1.00 38.41 ? 207  ASP C CG  1 
ATOM   9672  O  OD1 . ASP C 1 204 ? 26.747  4.652   76.999  1.00 38.83 ? 207  ASP C OD1 1 
ATOM   9673  O  OD2 . ASP C 1 204 ? 26.832  6.258   75.522  1.00 38.49 ? 207  ASP C OD2 1 
ATOM   9674  N  N   . GLY C 1 205 ? 25.661  6.506   72.040  1.00 38.12 ? 208  GLY C N   1 
ATOM   9675  C  CA  . GLY C 1 205 ? 26.606  6.749   70.969  1.00 37.83 ? 208  GLY C CA  1 
ATOM   9676  C  C   . GLY C 1 205 ? 26.268  5.908   69.756  1.00 37.59 ? 208  GLY C C   1 
ATOM   9677  O  O   . GLY C 1 205 ? 25.292  5.158   69.763  1.00 37.69 ? 208  GLY C O   1 
ATOM   9678  N  N   . HIS C 1 206 ? 27.097  5.992   68.726  1.00 37.53 ? 209  HIS C N   1 
ATOM   9679  C  CA  . HIS C 1 206 ? 26.846  5.246   67.502  1.00 37.42 ? 209  HIS C CA  1 
ATOM   9680  C  C   . HIS C 1 206 ? 27.419  3.826   67.487  1.00 37.57 ? 209  HIS C C   1 
ATOM   9681  O  O   . HIS C 1 206 ? 26.961  2.983   66.714  1.00 37.58 ? 209  HIS C O   1 
ATOM   9682  C  CB  . HIS C 1 206 ? 27.401  6.016   66.305  1.00 36.88 ? 209  HIS C CB  1 
ATOM   9683  C  CG  . HIS C 1 206 ? 26.871  7.407   66.175  1.00 36.38 ? 209  HIS C CG  1 
ATOM   9684  N  ND1 . HIS C 1 206 ? 25.526  7.695   66.189  1.00 36.09 ? 209  HIS C ND1 1 
ATOM   9685  C  CD2 . HIS C 1 206 ? 27.508  8.590   66.007  1.00 36.17 ? 209  HIS C CD2 1 
ATOM   9686  C  CE1 . HIS C 1 206 ? 25.355  8.995   66.034  1.00 36.03 ? 209  HIS C CE1 1 
ATOM   9687  N  NE2 . HIS C 1 206 ? 26.543  9.561   65.921  1.00 36.04 ? 209  HIS C NE2 1 
ATOM   9688  N  N   . ARG C 1 207 ? 28.412  3.562   68.336  1.00 37.58 ? 210  ARG C N   1 
ATOM   9689  C  CA  . ARG C 1 207 ? 29.077  2.258   68.388  1.00 37.52 ? 210  ARG C CA  1 
ATOM   9690  C  C   . ARG C 1 207 ? 28.306  1.144   69.079  1.00 37.65 ? 210  ARG C C   1 
ATOM   9691  O  O   . ARG C 1 207 ? 28.609  -0.037  68.890  1.00 37.62 ? 210  ARG C O   1 
ATOM   9692  C  CB  . ARG C 1 207 ? 30.447  2.415   69.048  1.00 37.41 ? 210  ARG C CB  1 
ATOM   9693  C  CG  . ARG C 1 207 ? 31.303  3.493   68.393  1.00 37.48 ? 210  ARG C CG  1 
ATOM   9694  C  CD  . ARG C 1 207 ? 32.661  3.649   69.052  1.00 37.40 ? 210  ARG C CD  1 
ATOM   9695  N  NE  . ARG C 1 207 ? 32.561  4.257   70.373  1.00 37.52 ? 210  ARG C NE  1 
ATOM   9696  C  CZ  . ARG C 1 207 ? 32.848  3.632   71.510  1.00 37.52 ? 210  ARG C CZ  1 
ATOM   9697  N  NH1 . ARG C 1 207 ? 33.257  2.371   71.498  1.00 37.51 ? 210  ARG C NH1 1 
ATOM   9698  N  NH2 . ARG C 1 207 ? 32.727  4.274   72.662  1.00 37.39 ? 210  ARG C NH2 1 
ATOM   9699  N  N   . HIS C 1 208 ? 27.297  1.519   69.858  1.00 37.75 ? 211  HIS C N   1 
ATOM   9700  C  CA  . HIS C 1 208 ? 26.502  0.559   70.609  1.00 37.95 ? 211  HIS C CA  1 
ATOM   9701  C  C   . HIS C 1 208 ? 25.075  0.360   70.112  1.00 38.05 ? 211  HIS C C   1 
ATOM   9702  O  O   . HIS C 1 208 ? 24.136  0.222   70.908  1.00 38.01 ? 211  HIS C O   1 
ATOM   9703  C  CB  . HIS C 1 208 ? 26.500  0.946   72.087  1.00 38.03 ? 211  HIS C CB  1 
ATOM   9704  C  CG  . HIS C 1 208 ? 27.847  0.851   72.729  1.00 38.21 ? 211  HIS C CG  1 
ATOM   9705  N  ND1 . HIS C 1 208 ? 28.649  1.952   72.939  1.00 38.39 ? 211  HIS C ND1 1 
ATOM   9706  C  CD2 . HIS C 1 208 ? 28.541  -0.214  73.190  1.00 38.23 ? 211  HIS C CD2 1 
ATOM   9707  C  CE1 . HIS C 1 208 ? 29.780  1.568   73.503  1.00 38.48 ? 211  HIS C CE1 1 
ATOM   9708  N  NE2 . HIS C 1 208 ? 29.740  0.258   73.667  1.00 38.53 ? 211  HIS C NE2 1 
ATOM   9709  N  N   . MET C 1 209 ? 24.921  0.305   68.793  1.00 37.90 ? 212  MET C N   1 
ATOM   9710  C  CA  . MET C 1 209 ? 23.608  0.101   68.194  1.00 37.74 ? 212  MET C CA  1 
ATOM   9711  C  C   . MET C 1 209 ? 23.743  -0.763  66.962  1.00 37.49 ? 212  MET C C   1 
ATOM   9712  O  O   . MET C 1 209 ? 24.808  -0.815  66.358  1.00 37.50 ? 212  MET C O   1 
ATOM   9713  C  CB  . MET C 1 209 ? 22.966  1.438   67.816  1.00 37.90 ? 212  MET C CB  1 
ATOM   9714  C  CG  . MET C 1 209 ? 23.646  2.174   66.674  1.00 38.08 ? 212  MET C CG  1 
ATOM   9715  S  SD  . MET C 1 209 ? 22.913  3.798   66.394  1.00 38.81 ? 212  MET C SD  1 
ATOM   9716  C  CE  . MET C 1 209 ? 23.841  4.354   64.979  1.00 38.54 ? 212  MET C CE  1 
ATOM   9717  N  N   . ASN C 1 210 ? 22.670  -1.465  66.613  1.00 37.16 ? 213  ASN C N   1 
ATOM   9718  C  CA  . ASN C 1 210 ? 22.664  -2.318  65.433  1.00 36.90 ? 213  ASN C CA  1 
ATOM   9719  C  C   . ASN C 1 210 ? 22.336  -1.491  64.203  1.00 36.89 ? 213  ASN C C   1 
ATOM   9720  O  O   . ASN C 1 210 ? 21.909  -0.338  64.308  1.00 36.90 ? 213  ASN C O   1 
ATOM   9721  C  CB  . ASN C 1 210 ? 21.609  -3.415  65.559  1.00 36.63 ? 213  ASN C CB  1 
ATOM   9722  C  CG  . ASN C 1 210 ? 21.948  -4.430  66.608  1.00 36.19 ? 213  ASN C CG  1 
ATOM   9723  O  OD1 . ASN C 1 210 ? 23.111  -4.610  66.953  1.00 36.18 ? 213  ASN C OD1 1 
ATOM   9724  N  ND2 . ASN C 1 210 ? 20.933  -5.117  67.116  1.00 36.08 ? 213  ASN C ND2 1 
ATOM   9725  N  N   . GLY C 1 211 ? 22.520  -2.105  63.038  1.00 36.92 ? 214  GLY C N   1 
ATOM   9726  C  CA  . GLY C 1 211 ? 22.215  -1.454  61.782  1.00 36.80 ? 214  GLY C CA  1 
ATOM   9727  C  C   . GLY C 1 211 ? 21.411  -2.435  60.965  1.00 36.79 ? 214  GLY C C   1 
ATOM   9728  O  O   . GLY C 1 211 ? 21.647  -3.644  61.048  1.00 36.92 ? 214  GLY C O   1 
ATOM   9729  N  N   . TYR C 1 212 ? 20.431  -1.937  60.219  1.00 36.80 ? 215  TYR C N   1 
ATOM   9730  C  CA  . TYR C 1 212 ? 19.588  -2.797  59.395  1.00 36.75 ? 215  TYR C CA  1 
ATOM   9731  C  C   . TYR C 1 212 ? 19.282  -2.140  58.065  1.00 36.78 ? 215  TYR C C   1 
ATOM   9732  O  O   . TYR C 1 212 ? 19.200  -0.920  57.974  1.00 36.95 ? 215  TYR C O   1 
ATOM   9733  C  CB  . TYR C 1 212 ? 18.246  -3.063  60.079  1.00 36.70 ? 215  TYR C CB  1 
ATOM   9734  C  CG  . TYR C 1 212 ? 18.318  -3.565  61.500  1.00 36.76 ? 215  TYR C CG  1 
ATOM   9735  C  CD1 . TYR C 1 212 ? 18.201  -4.921  61.786  1.00 36.80 ? 215  TYR C CD1 1 
ATOM   9736  C  CD2 . TYR C 1 212 ? 18.437  -2.677  62.565  1.00 36.70 ? 215  TYR C CD2 1 
ATOM   9737  C  CE1 . TYR C 1 212 ? 18.192  -5.377  63.098  1.00 37.07 ? 215  TYR C CE1 1 
ATOM   9738  C  CE2 . TYR C 1 212 ? 18.428  -3.121  63.876  1.00 36.84 ? 215  TYR C CE2 1 
ATOM   9739  C  CZ  . TYR C 1 212 ? 18.301  -4.470  64.138  1.00 37.06 ? 215  TYR C CZ  1 
ATOM   9740  O  OH  . TYR C 1 212 ? 18.246  -4.908  65.444  1.00 37.45 ? 215  TYR C OH  1 
ATOM   9741  N  N   . GLY C 1 213 ? 19.108  -2.950  57.030  1.00 36.86 ? 216  GLY C N   1 
ATOM   9742  C  CA  . GLY C 1 213 ? 18.751  -2.404  55.737  1.00 36.84 ? 216  GLY C CA  1 
ATOM   9743  C  C   . GLY C 1 213 ? 17.258  -2.114  55.776  1.00 36.75 ? 216  GLY C C   1 
ATOM   9744  O  O   . GLY C 1 213 ? 16.755  -1.300  55.004  1.00 36.89 ? 216  GLY C O   1 
ATOM   9745  N  N   . SER C 1 214 ? 16.564  -2.771  56.706  1.00 36.67 ? 217  SER C N   1 
ATOM   9746  C  CA  . SER C 1 214 ? 15.124  -2.639  56.905  1.00 36.51 ? 217  SER C CA  1 
ATOM   9747  C  C   . SER C 1 214 ? 14.313  -3.260  55.780  1.00 36.58 ? 217  SER C C   1 
ATOM   9748  O  O   . SER C 1 214 ? 13.574  -4.223  55.993  1.00 36.71 ? 217  SER C O   1 
ATOM   9749  C  CB  . SER C 1 214 ? 14.726  -1.175  57.079  1.00 36.35 ? 217  SER C CB  1 
ATOM   9750  O  OG  . SER C 1 214 ? 15.365  -0.603  58.200  1.00 36.35 ? 217  SER C OG  1 
ATOM   9751  N  N   . HIS C 1 215 ? 14.448  -2.703  54.584  1.00 36.51 ? 218  HIS C N   1 
ATOM   9752  C  CA  . HIS C 1 215 ? 13.726  -3.197  53.420  1.00 36.41 ? 218  HIS C CA  1 
ATOM   9753  C  C   . HIS C 1 215 ? 14.087  -4.621  53.073  1.00 36.58 ? 218  HIS C C   1 
ATOM   9754  O  O   . HIS C 1 215 ? 15.096  -5.157  53.524  1.00 36.63 ? 218  HIS C O   1 
ATOM   9755  C  CB  . HIS C 1 215 ? 14.060  -2.368  52.177  1.00 36.17 ? 218  HIS C CB  1 
ATOM   9756  C  CG  . HIS C 1 215 ? 13.686  -0.930  52.281  1.00 35.92 ? 218  HIS C CG  1 
ATOM   9757  N  ND1 . HIS C 1 215 ? 12.380  -0.504  52.353  1.00 35.84 ? 218  HIS C ND1 1 
ATOM   9758  C  CD2 . HIS C 1 215 ? 14.450  0.182   52.323  1.00 35.87 ? 218  HIS C CD2 1 
ATOM   9759  C  CE1 . HIS C 1 215 ? 12.355  0.813   52.438  1.00 35.96 ? 218  HIS C CE1 1 
ATOM   9760  N  NE2 . HIS C 1 215 ? 13.599  1.254   52.422  1.00 35.99 ? 218  HIS C NE2 1 
ATOM   9761  N  N   . THR C 1 216 ? 13.238  -5.220  52.253  1.00 36.71 ? 219  THR C N   1 
ATOM   9762  C  CA  . THR C 1 216 ? 13.475  -6.549  51.734  1.00 36.80 ? 219  THR C CA  1 
ATOM   9763  C  C   . THR C 1 216 ? 14.154  -6.220  50.410  1.00 37.02 ? 219  THR C C   1 
ATOM   9764  O  O   . THR C 1 216 ? 13.727  -5.308  49.708  1.00 36.85 ? 219  THR C O   1 
ATOM   9765  C  CB  . THR C 1 216 ? 12.159  -7.302  51.450  1.00 36.76 ? 219  THR C CB  1 
ATOM   9766  O  OG1 . THR C 1 216 ? 11.509  -7.628  52.685  1.00 36.77 ? 219  THR C OG1 1 
ATOM   9767  C  CG2 . THR C 1 216 ? 12.433  -8.574  50.681  1.00 36.64 ? 219  THR C CG2 1 
ATOM   9768  N  N   . PHE C 1 217 ? 15.255  -6.896  50.113  1.00 37.11 ? 220  PHE C N   1 
ATOM   9769  C  CA  . PHE C 1 217 ? 15.982  -6.674  48.870  1.00 37.21 ? 220  PHE C CA  1 
ATOM   9770  C  C   . PHE C 1 217 ? 16.017  -7.983  48.093  1.00 37.37 ? 220  PHE C C   1 
ATOM   9771  O  O   . PHE C 1 217 ? 15.532  -9.009  48.568  1.00 37.39 ? 220  PHE C O   1 
ATOM   9772  C  CB  . PHE C 1 217 ? 17.410  -6.201  49.163  1.00 37.20 ? 220  PHE C CB  1 
ATOM   9773  C  CG  . PHE C 1 217 ? 17.489  -4.813  49.740  1.00 37.14 ? 220  PHE C CG  1 
ATOM   9774  C  CD1 . PHE C 1 217 ? 17.580  -3.705  48.903  1.00 37.00 ? 220  PHE C CD1 1 
ATOM   9775  C  CD2 . PHE C 1 217 ? 17.484  -4.614  51.115  1.00 37.03 ? 220  PHE C CD2 1 
ATOM   9776  C  CE1 . PHE C 1 217 ? 17.664  -2.416  49.432  1.00 37.01 ? 220  PHE C CE1 1 
ATOM   9777  C  CE2 . PHE C 1 217 ? 17.568  -3.327  51.653  1.00 37.00 ? 220  PHE C CE2 1 
ATOM   9778  C  CZ  . PHE C 1 217 ? 17.658  -2.228  50.810  1.00 36.99 ? 220  PHE C CZ  1 
ATOM   9779  N  N   . LYS C 1 218 ? 16.576  -7.950  46.892  1.00 37.50 ? 221  LYS C N   1 
ATOM   9780  C  CA  . LYS C 1 218 ? 16.660  -9.153  46.086  1.00 37.87 ? 221  LYS C CA  1 
ATOM   9781  C  C   . LYS C 1 218 ? 18.111  -9.482  45.757  1.00 37.98 ? 221  LYS C C   1 
ATOM   9782  O  O   . LYS C 1 218 ? 18.900  -8.592  45.433  1.00 38.03 ? 221  LYS C O   1 
ATOM   9783  C  CB  . LYS C 1 218 ? 15.844  -8.992  44.801  1.00 38.04 ? 221  LYS C CB  1 
ATOM   9784  C  CG  . LYS C 1 218 ? 15.879  -10.222 43.899  1.00 38.84 ? 221  LYS C CG  1 
ATOM   9785  C  CD  . LYS C 1 218 ? 14.857  -10.150 42.767  1.00 39.47 ? 221  LYS C CD  1 
ATOM   9786  C  CE  . LYS C 1 218 ? 15.190  -9.048  41.786  1.00 40.04 ? 221  LYS C CE  1 
ATOM   9787  N  NZ  . LYS C 1 218 ? 14.203  -8.961  40.675  1.00 40.59 ? 221  LYS C NZ  1 
ATOM   9788  N  N   . LEU C 1 219 ? 18.473  -10.754 45.896  1.00 37.89 ? 222  LEU C N   1 
ATOM   9789  C  CA  . LEU C 1 219 ? 19.827  -11.201 45.583  1.00 37.77 ? 222  LEU C CA  1 
ATOM   9790  C  C   . LEU C 1 219 ? 19.780  -12.114 44.363  1.00 37.90 ? 222  LEU C C   1 
ATOM   9791  O  O   . LEU C 1 219 ? 18.923  -12.980 44.269  1.00 37.89 ? 222  LEU C O   1 
ATOM   9792  C  CB  . LEU C 1 219 ? 20.447  -11.934 46.776  1.00 37.60 ? 222  LEU C CB  1 
ATOM   9793  C  CG  . LEU C 1 219 ? 20.663  -11.131 48.066  1.00 37.41 ? 222  LEU C CG  1 
ATOM   9794  C  CD1 . LEU C 1 219 ? 21.360  -11.984 49.104  1.00 37.23 ? 222  LEU C CD1 1 
ATOM   9795  C  CD2 . LEU C 1 219 ? 21.492  -9.906  47.777  1.00 37.22 ? 222  LEU C CD2 1 
ATOM   9796  N  N   . VAL C 1 220 ? 20.690  -11.904 43.419  1.00 38.01 ? 223  VAL C N   1 
ATOM   9797  C  CA  . VAL C 1 220 ? 20.735  -12.712 42.204  1.00 38.06 ? 223  VAL C CA  1 
ATOM   9798  C  C   . VAL C 1 220 ? 22.081  -13.408 42.072  1.00 38.35 ? 223  VAL C C   1 
ATOM   9799  O  O   . VAL C 1 220 ? 23.126  -12.782 42.226  1.00 38.37 ? 223  VAL C O   1 
ATOM   9800  C  CB  . VAL C 1 220 ? 20.509  -11.840 40.952  1.00 37.98 ? 223  VAL C CB  1 
ATOM   9801  C  CG1 . VAL C 1 220 ? 20.464  -12.702 39.714  1.00 37.87 ? 223  VAL C CG1 1 
ATOM   9802  C  CG2 . VAL C 1 220 ? 19.226  -11.048 41.084  1.00 37.84 ? 223  VAL C CG2 1 
ATOM   9803  N  N   . ASN C 1 221 ? 22.069  -14.709 41.812  1.00 38.60 ? 224  ASN C N   1 
ATOM   9804  C  CA  . ASN C 1 221 ? 23.329  -15.412 41.664  1.00 39.03 ? 224  ASN C CA  1 
ATOM   9805  C  C   . ASN C 1 221 ? 23.718  -15.525 40.198  1.00 39.63 ? 224  ASN C C   1 
ATOM   9806  O  O   . ASN C 1 221 ? 22.970  -15.112 39.312  1.00 39.65 ? 224  ASN C O   1 
ATOM   9807  C  CB  . ASN C 1 221 ? 23.290  -16.788 42.334  1.00 38.77 ? 224  ASN C CB  1 
ATOM   9808  C  CG  . ASN C 1 221 ? 22.359  -17.760 41.646  1.00 38.68 ? 224  ASN C CG  1 
ATOM   9809  O  OD1 . ASN C 1 221 ? 22.068  -17.629 40.464  1.00 38.76 ? 224  ASN C OD1 1 
ATOM   9810  N  ND2 . ASN C 1 221 ? 21.905  -18.763 42.384  1.00 38.83 ? 224  ASN C ND2 1 
ATOM   9811  N  N   . ALA C 1 222 ? 24.874  -16.125 39.949  1.00 40.24 ? 225  ALA C N   1 
ATOM   9812  C  CA  . ALA C 1 222 ? 25.387  -16.297 38.598  1.00 40.90 ? 225  ALA C CA  1 
ATOM   9813  C  C   . ALA C 1 222 ? 24.466  -17.068 37.641  1.00 41.45 ? 225  ALA C C   1 
ATOM   9814  O  O   . ALA C 1 222 ? 24.502  -16.839 36.433  1.00 41.61 ? 225  ALA C O   1 
ATOM   9815  C  CB  . ALA C 1 222 ? 26.761  -16.942 38.650  1.00 40.80 ? 225  ALA C CB  1 
ATOM   9816  N  N   . ASN C 1 223 ? 23.653  -17.984 38.165  1.00 42.05 ? 226  ASN C N   1 
ATOM   9817  C  CA  . ASN C 1 223 ? 22.732  -18.760 37.322  1.00 42.65 ? 226  ASN C CA  1 
ATOM   9818  C  C   . ASN C 1 223 ? 21.441  -17.996 37.030  1.00 42.70 ? 226  ASN C C   1 
ATOM   9819  O  O   . ASN C 1 223 ? 20.544  -18.521 36.374  1.00 42.87 ? 226  ASN C O   1 
ATOM   9820  C  CB  . ASN C 1 223 ? 22.362  -20.100 37.979  1.00 43.21 ? 226  ASN C CB  1 
ATOM   9821  C  CG  . ASN C 1 223 ? 23.564  -21.006 38.203  1.00 43.85 ? 226  ASN C CG  1 
ATOM   9822  O  OD1 . ASN C 1 223 ? 23.630  -21.731 39.206  1.00 44.43 ? 226  ASN C OD1 1 
ATOM   9823  N  ND2 . ASN C 1 223 ? 24.517  -20.977 37.271  1.00 44.04 ? 226  ASN C ND2 1 
ATOM   9824  N  N   . GLY C 1 224 ? 21.333  -16.773 37.540  1.00 42.70 ? 227  GLY C N   1 
ATOM   9825  C  CA  . GLY C 1 224 ? 20.135  -15.992 37.311  1.00 42.65 ? 227  GLY C CA  1 
ATOM   9826  C  C   . GLY C 1 224 ? 19.018  -16.314 38.284  1.00 42.56 ? 227  GLY C C   1 
ATOM   9827  O  O   . GLY C 1 224 ? 17.887  -15.874 38.096  1.00 42.62 ? 227  GLY C O   1 
ATOM   9828  N  N   . GLU C 1 225 ? 19.316  -17.107 39.306  1.00 42.58 ? 228  GLU C N   1 
ATOM   9829  C  CA  . GLU C 1 225 ? 18.314  -17.463 40.308  1.00 42.59 ? 228  GLU C CA  1 
ATOM   9830  C  C   . GLU C 1 225 ? 18.288  -16.358 41.349  1.00 42.22 ? 228  GLU C C   1 
ATOM   9831  O  O   . GLU C 1 225 ? 19.335  -15.814 41.704  1.00 42.20 ? 228  GLU C O   1 
ATOM   9832  C  CB  . GLU C 1 225 ? 18.651  -18.808 40.950  1.00 43.22 ? 228  GLU C CB  1 
ATOM   9833  C  CG  . GLU C 1 225 ? 18.701  -19.948 39.937  1.00 44.29 ? 228  GLU C CG  1 
ATOM   9834  C  CD  . GLU C 1 225 ? 19.511  -21.147 40.405  1.00 45.01 ? 228  GLU C CD  1 
ATOM   9835  O  OE1 . GLU C 1 225 ? 20.321  -21.010 41.357  1.00 45.42 ? 228  GLU C OE1 1 
ATOM   9836  O  OE2 . GLU C 1 225 ? 19.346  -22.230 39.795  1.00 45.47 ? 228  GLU C OE2 1 
ATOM   9837  N  N   . ALA C 1 226 ? 17.093  -16.037 41.837  1.00 41.62 ? 229  ALA C N   1 
ATOM   9838  C  CA  . ALA C 1 226 ? 16.922  -14.967 42.811  1.00 41.12 ? 229  ALA C CA  1 
ATOM   9839  C  C   . ALA C 1 226 ? 16.177  -15.337 44.087  1.00 40.86 ? 229  ALA C C   1 
ATOM   9840  O  O   . ALA C 1 226 ? 15.319  -16.221 44.095  1.00 41.03 ? 229  ALA C O   1 
ATOM   9841  C  CB  . ALA C 1 226 ? 16.233  -13.786 42.149  1.00 41.13 ? 229  ALA C CB  1 
ATOM   9842  N  N   . VAL C 1 227 ? 16.518  -14.639 45.166  1.00 40.28 ? 230  VAL C N   1 
ATOM   9843  C  CA  . VAL C 1 227 ? 15.886  -14.821 46.473  1.00 39.54 ? 230  VAL C CA  1 
ATOM   9844  C  C   . VAL C 1 227 ? 15.738  -13.428 47.068  1.00 39.41 ? 230  VAL C C   1 
ATOM   9845  O  O   . VAL C 1 227 ? 16.338  -12.470 46.576  1.00 39.32 ? 230  VAL C O   1 
ATOM   9846  C  CB  . VAL C 1 227 ? 16.737  -15.696 47.451  1.00 39.27 ? 230  VAL C CB  1 
ATOM   9847  C  CG1 . VAL C 1 227 ? 16.845  -17.117 46.948  1.00 38.97 ? 230  VAL C CG1 1 
ATOM   9848  C  CG2 . VAL C 1 227 ? 18.115  -15.104 47.647  1.00 38.99 ? 230  VAL C CG2 1 
ATOM   9849  N  N   . TYR C 1 228 ? 14.871  -13.295 48.062  1.00 39.07 ? 231  TYR C N   1 
ATOM   9850  C  CA  . TYR C 1 228 ? 14.688  -12.016 48.725  1.00 38.91 ? 231  TYR C CA  1 
ATOM   9851  C  C   . TYR C 1 228 ? 15.541  -12.075 49.970  1.00 38.79 ? 231  TYR C C   1 
ATOM   9852  O  O   . TYR C 1 228 ? 15.819  -13.162 50.460  1.00 38.86 ? 231  TYR C O   1 
ATOM   9853  C  CB  . TYR C 1 228 ? 13.229  -11.805 49.091  1.00 38.90 ? 231  TYR C CB  1 
ATOM   9854  C  CG  . TYR C 1 228 ? 12.378  -11.473 47.900  1.00 39.09 ? 231  TYR C CG  1 
ATOM   9855  C  CD1 . TYR C 1 228 ? 12.619  -10.327 47.154  1.00 39.05 ? 231  TYR C CD1 1 
ATOM   9856  C  CD2 . TYR C 1 228 ? 11.328  -12.300 47.517  1.00 39.21 ? 231  TYR C CD2 1 
ATOM   9857  C  CE1 . TYR C 1 228 ? 11.836  -10.008 46.058  1.00 39.35 ? 231  TYR C CE1 1 
ATOM   9858  C  CE2 . TYR C 1 228 ? 10.533  -11.991 46.419  1.00 39.35 ? 231  TYR C CE2 1 
ATOM   9859  C  CZ  . TYR C 1 228 ? 10.793  -10.842 45.693  1.00 39.43 ? 231  TYR C CZ  1 
ATOM   9860  O  OH  . TYR C 1 228 ? 10.010  -10.519 44.610  1.00 39.53 ? 231  TYR C OH  1 
ATOM   9861  N  N   . CYS C 1 229 ? 15.980  -10.931 50.478  1.00 38.60 ? 232  CYS C N   1 
ATOM   9862  C  CA  . CYS C 1 229 ? 16.813  -10.938 51.675  1.00 38.39 ? 232  CYS C CA  1 
ATOM   9863  C  C   . CYS C 1 229 ? 16.625  -9.727  52.549  1.00 38.21 ? 232  CYS C C   1 
ATOM   9864  O  O   . CYS C 1 229 ? 15.868  -8.820  52.222  1.00 38.20 ? 232  CYS C O   1 
ATOM   9865  C  CB  . CYS C 1 229 ? 18.295  -11.038 51.304  1.00 38.44 ? 232  CYS C CB  1 
ATOM   9866  S  SG  . CYS C 1 229 ? 19.020  -9.522  50.618  1.00 39.31 ? 232  CYS C SG  1 
ATOM   9867  N  N   . LYS C 1 230 ? 17.299  -9.757  53.691  1.00 37.97 ? 233  LYS C N   1 
ATOM   9868  C  CA  . LYS C 1 230 ? 17.297  -8.667  54.650  1.00 37.94 ? 233  LYS C CA  1 
ATOM   9869  C  C   . LYS C 1 230 ? 18.753  -8.539  55.062  1.00 38.04 ? 233  LYS C C   1 
ATOM   9870  O  O   . LYS C 1 230 ? 19.476  -9.534  55.104  1.00 38.05 ? 233  LYS C O   1 
ATOM   9871  C  CB  . LYS C 1 230 ? 16.470  -9.012  55.889  1.00 37.68 ? 233  LYS C CB  1 
ATOM   9872  C  CG  . LYS C 1 230 ? 14.974  -9.104  55.678  1.00 37.40 ? 233  LYS C CG  1 
ATOM   9873  C  CD  . LYS C 1 230 ? 14.331  -7.753  55.430  1.00 37.08 ? 233  LYS C CD  1 
ATOM   9874  C  CE  . LYS C 1 230 ? 12.810  -7.839  55.605  1.00 36.72 ? 233  LYS C CE  1 
ATOM   9875  N  NZ  . LYS C 1 230 ? 12.129  -6.537  55.386  1.00 36.19 ? 233  LYS C NZ  1 
ATOM   9876  N  N   . PHE C 1 231 ? 19.193  -7.317  55.333  1.00 38.10 ? 234  PHE C N   1 
ATOM   9877  C  CA  . PHE C 1 231 ? 20.568  -7.079  55.760  1.00 38.01 ? 234  PHE C CA  1 
ATOM   9878  C  C   . PHE C 1 231 ? 20.575  -6.680  57.221  1.00 37.93 ? 234  PHE C C   1 
ATOM   9879  O  O   . PHE C 1 231 ? 19.794  -5.834  57.638  1.00 38.00 ? 234  PHE C O   1 
ATOM   9880  C  CB  . PHE C 1 231 ? 21.203  -5.959  54.941  1.00 37.67 ? 234  PHE C CB  1 
ATOM   9881  C  CG  . PHE C 1 231 ? 21.368  -6.289  53.495  1.00 37.56 ? 234  PHE C CG  1 
ATOM   9882  C  CD1 . PHE C 1 231 ? 22.327  -7.202  53.085  1.00 37.45 ? 234  PHE C CD1 1 
ATOM   9883  C  CD2 . PHE C 1 231 ? 20.590  -5.662  52.534  1.00 37.51 ? 234  PHE C CD2 1 
ATOM   9884  C  CE1 . PHE C 1 231 ? 22.510  -7.481  51.738  1.00 37.37 ? 234  PHE C CE1 1 
ATOM   9885  C  CE2 . PHE C 1 231 ? 20.766  -5.934  51.185  1.00 37.34 ? 234  PHE C CE2 1 
ATOM   9886  C  CZ  . PHE C 1 231 ? 21.726  -6.842  50.787  1.00 37.39 ? 234  PHE C CZ  1 
ATOM   9887  N  N   . HIS C 1 232 ? 21.444  -7.306  58.001  1.00 37.93 ? 235  HIS C N   1 
ATOM   9888  C  CA  . HIS C 1 232 ? 21.556  -6.992  59.420  1.00 38.07 ? 235  HIS C CA  1 
ATOM   9889  C  C   . HIS C 1 232 ? 23.023  -6.802  59.778  1.00 38.24 ? 235  HIS C C   1 
ATOM   9890  O  O   . HIS C 1 232 ? 23.884  -7.522  59.277  1.00 38.24 ? 235  HIS C O   1 
ATOM   9891  C  CB  . HIS C 1 232 ? 21.036  -8.148  60.288  1.00 37.98 ? 235  HIS C CB  1 
ATOM   9892  C  CG  . HIS C 1 232 ? 19.602  -8.508  60.058  1.00 37.91 ? 235  HIS C CG  1 
ATOM   9893  N  ND1 . HIS C 1 232 ? 18.644  -8.398  61.043  1.00 37.87 ? 235  HIS C ND1 1 
ATOM   9894  C  CD2 . HIS C 1 232 ? 18.974  -9.034  58.981  1.00 37.82 ? 235  HIS C CD2 1 
ATOM   9895  C  CE1 . HIS C 1 232 ? 17.489  -8.843  60.584  1.00 37.81 ? 235  HIS C CE1 1 
ATOM   9896  N  NE2 . HIS C 1 232 ? 17.662  -9.234  59.334  1.00 37.80 ? 235  HIS C NE2 1 
ATOM   9897  N  N   . TYR C 1 233 ? 23.322  -5.803  60.597  1.00 38.32 ? 236  TYR C N   1 
ATOM   9898  C  CA  . TYR C 1 233 ? 24.693  -5.619  61.054  1.00 38.47 ? 236  TYR C CA  1 
ATOM   9899  C  C   . TYR C 1 233 ? 24.697  -5.321  62.547  1.00 38.68 ? 236  TYR C C   1 
ATOM   9900  O  O   . TYR C 1 233 ? 24.368  -4.218  62.982  1.00 38.50 ? 236  TYR C O   1 
ATOM   9901  C  CB  . TYR C 1 233 ? 25.504  -4.598  60.236  1.00 38.34 ? 236  TYR C CB  1 
ATOM   9902  C  CG  . TYR C 1 233 ? 24.762  -3.484  59.522  1.00 38.33 ? 236  TYR C CG  1 
ATOM   9903  C  CD1 . TYR C 1 233 ? 24.995  -2.152  59.849  1.00 38.22 ? 236  TYR C CD1 1 
ATOM   9904  C  CD2 . TYR C 1 233 ? 23.918  -3.751  58.446  1.00 38.29 ? 236  TYR C CD2 1 
ATOM   9905  C  CE1 . TYR C 1 233 ? 24.415  -1.119  59.117  1.00 38.33 ? 236  TYR C CE1 1 
ATOM   9906  C  CE2 . TYR C 1 233 ? 23.331  -2.719  57.707  1.00 38.24 ? 236  TYR C CE2 1 
ATOM   9907  C  CZ  . TYR C 1 233 ? 23.588  -1.410  58.049  1.00 38.34 ? 236  TYR C CZ  1 
ATOM   9908  O  OH  . TYR C 1 233 ? 23.025  -0.384  57.324  1.00 38.40 ? 236  TYR C OH  1 
ATOM   9909  N  N   . LYS C 1 234 ? 25.006  -6.362  63.320  1.00 38.89 ? 237  LYS C N   1 
ATOM   9910  C  CA  . LYS C 1 234 ? 25.027  -6.306  64.776  1.00 39.03 ? 237  LYS C CA  1 
ATOM   9911  C  C   . LYS C 1 234 ? 26.304  -5.712  65.334  1.00 39.04 ? 237  LYS C C   1 
ATOM   9912  O  O   . LYS C 1 234 ? 27.396  -6.068  64.894  1.00 38.94 ? 237  LYS C O   1 
ATOM   9913  C  CB  . LYS C 1 234 ? 24.854  -7.710  65.342  1.00 39.42 ? 237  LYS C CB  1 
ATOM   9914  C  CG  . LYS C 1 234 ? 23.650  -8.476  64.814  1.00 40.09 ? 237  LYS C CG  1 
ATOM   9915  C  CD  . LYS C 1 234 ? 22.347  -7.757  65.118  1.00 40.74 ? 237  LYS C CD  1 
ATOM   9916  C  CE  . LYS C 1 234 ? 21.204  -8.739  65.332  1.00 41.03 ? 237  LYS C CE  1 
ATOM   9917  N  NZ  . LYS C 1 234 ? 21.366  -9.494  66.610  1.00 41.20 ? 237  LYS C NZ  1 
ATOM   9918  N  N   . THR C 1 235 ? 26.163  -4.843  66.335  1.00 38.86 ? 238  THR C N   1 
ATOM   9919  C  CA  . THR C 1 235 ? 27.311  -4.194  66.965  1.00 38.84 ? 238  THR C CA  1 
ATOM   9920  C  C   . THR C 1 235 ? 28.152  -5.146  67.786  1.00 38.92 ? 238  THR C C   1 
ATOM   9921  O  O   . THR C 1 235 ? 27.640  -5.832  68.671  1.00 38.84 ? 238  THR C O   1 
ATOM   9922  C  CB  . THR C 1 235 ? 26.901  -3.014  67.881  1.00 38.72 ? 238  THR C CB  1 
ATOM   9923  O  OG1 . THR C 1 235 ? 28.035  -2.590  68.649  1.00 38.31 ? 238  THR C OG1 1 
ATOM   9924  C  CG2 . THR C 1 235 ? 25.763  -3.408  68.821  1.00 38.58 ? 238  THR C CG2 1 
ATOM   9925  N  N   . ASP C 1 236 ? 29.450  -5.166  67.499  1.00 38.88 ? 239  ASP C N   1 
ATOM   9926  C  CA  . ASP C 1 236 ? 30.371  -6.025  68.226  1.00 38.85 ? 239  ASP C CA  1 
ATOM   9927  C  C   . ASP C 1 236 ? 30.712  -5.415  69.577  1.00 39.04 ? 239  ASP C C   1 
ATOM   9928  O  O   . ASP C 1 236 ? 31.361  -6.058  70.401  1.00 39.03 ? 239  ASP C O   1 
ATOM   9929  C  CB  . ASP C 1 236 ? 31.643  -6.263  67.413  1.00 38.68 ? 239  ASP C CB  1 
ATOM   9930  C  CG  . ASP C 1 236 ? 31.395  -7.093  66.166  1.00 38.56 ? 239  ASP C CG  1 
ATOM   9931  O  OD1 . ASP C 1 236 ? 32.251  -7.075  65.263  1.00 38.74 ? 239  ASP C OD1 1 
ATOM   9932  O  OD2 . ASP C 1 236 ? 30.354  -7.773  66.079  1.00 38.41 ? 239  ASP C OD2 1 
ATOM   9933  N  N   . GLN C 1 237 ? 30.286  -4.169  69.790  1.00 39.18 ? 240  GLN C N   1 
ATOM   9934  C  CA  . GLN C 1 237 ? 30.522  -3.465  71.050  1.00 39.18 ? 240  GLN C CA  1 
ATOM   9935  C  C   . GLN C 1 237 ? 29.374  -3.715  72.013  1.00 39.37 ? 240  GLN C C   1 
ATOM   9936  O  O   . GLN C 1 237 ? 29.420  -3.290  73.165  1.00 39.52 ? 240  GLN C O   1 
ATOM   9937  C  CB  . GLN C 1 237 ? 30.656  -1.961  70.828  1.00 39.12 ? 240  GLN C CB  1 
ATOM   9938  C  CG  . GLN C 1 237 ? 31.891  -1.547  70.077  1.00 39.28 ? 240  GLN C CG  1 
ATOM   9939  C  CD  . GLN C 1 237 ? 31.883  -2.039  68.652  1.00 39.41 ? 240  GLN C CD  1 
ATOM   9940  O  OE1 . GLN C 1 237 ? 32.801  -2.734  68.221  1.00 39.52 ? 240  GLN C OE1 1 
ATOM   9941  N  NE2 . GLN C 1 237 ? 30.835  -1.699  67.913  1.00 39.20 ? 240  GLN C NE2 1 
ATOM   9942  N  N   . GLY C 1 238 ? 28.338  -4.390  71.528  1.00 39.40 ? 241  GLY C N   1 
ATOM   9943  C  CA  . GLY C 1 238 ? 27.187  -4.686  72.359  1.00 39.51 ? 241  GLY C CA  1 
ATOM   9944  C  C   . GLY C 1 238 ? 26.248  -3.510  72.472  1.00 39.53 ? 241  GLY C C   1 
ATOM   9945  O  O   . GLY C 1 238 ? 26.675  -2.359  72.399  1.00 39.59 ? 241  GLY C O   1 
ATOM   9946  N  N   . ILE C 1 239 ? 24.960  -3.799  72.606  1.00 39.76 ? 242  ILE C N   1 
ATOM   9947  C  CA  . ILE C 1 239 ? 23.953  -2.754  72.739  1.00 39.95 ? 242  ILE C CA  1 
ATOM   9948  C  C   . ILE C 1 239 ? 24.090  -2.063  74.079  1.00 40.10 ? 242  ILE C C   1 
ATOM   9949  O  O   . ILE C 1 239 ? 24.219  -2.708  75.118  1.00 40.18 ? 242  ILE C O   1 
ATOM   9950  C  CB  . ILE C 1 239 ? 22.537  -3.314  72.559  1.00 39.96 ? 242  ILE C CB  1 
ATOM   9951  C  CG1 . ILE C 1 239 ? 22.212  -3.352  71.073  1.00 39.89 ? 242  ILE C CG1 1 
ATOM   9952  C  CG2 . ILE C 1 239 ? 21.508  -2.473  73.315  1.00 39.82 ? 242  ILE C CG2 1 
ATOM   9953  C  CD1 . ILE C 1 239 ? 21.595  -4.628  70.665  1.00 40.51 ? 242  ILE C CD1 1 
ATOM   9954  N  N   . LYS C 1 240 ? 24.034  -0.742  74.044  1.00 40.22 ? 243  LYS C N   1 
ATOM   9955  C  CA  . LYS C 1 240 ? 24.187  0.060   75.237  1.00 40.36 ? 243  LYS C CA  1 
ATOM   9956  C  C   . LYS C 1 240 ? 23.400  1.334   74.976  1.00 40.22 ? 243  LYS C C   1 
ATOM   9957  O  O   . LYS C 1 240 ? 23.598  1.995   73.959  1.00 40.19 ? 243  LYS C O   1 
ATOM   9958  C  CB  . LYS C 1 240 ? 25.672  0.350   75.420  1.00 40.90 ? 243  LYS C CB  1 
ATOM   9959  C  CG  . LYS C 1 240 ? 26.102  0.869   76.766  1.00 41.73 ? 243  LYS C CG  1 
ATOM   9960  C  CD  . LYS C 1 240 ? 27.612  1.079   76.735  1.00 42.44 ? 243  LYS C CD  1 
ATOM   9961  C  CE  . LYS C 1 240 ? 28.117  1.828   77.954  1.00 43.12 ? 243  LYS C CE  1 
ATOM   9962  N  NZ  . LYS C 1 240 ? 29.588  2.079   77.846  1.00 43.54 ? 243  LYS C NZ  1 
ATOM   9963  N  N   . ASN C 1 241 ? 22.482  1.649   75.885  1.00 39.96 ? 244  ASN C N   1 
ATOM   9964  C  CA  . ASN C 1 241 ? 21.621  2.817   75.760  1.00 39.56 ? 244  ASN C CA  1 
ATOM   9965  C  C   . ASN C 1 241 ? 21.855  3.828   76.858  1.00 39.35 ? 244  ASN C C   1 
ATOM   9966  O  O   . ASN C 1 241 ? 22.528  3.548   77.847  1.00 39.22 ? 244  ASN C O   1 
ATOM   9967  C  CB  . ASN C 1 241 ? 20.153  2.388   75.806  1.00 39.47 ? 244  ASN C CB  1 
ATOM   9968  C  CG  . ASN C 1 241 ? 19.833  1.293   74.814  1.00 39.45 ? 244  ASN C CG  1 
ATOM   9969  O  OD1 . ASN C 1 241 ? 19.933  1.493   73.606  1.00 39.55 ? 244  ASN C OD1 1 
ATOM   9970  N  ND2 . ASN C 1 241 ? 19.441  0.127   75.318  1.00 39.39 ? 244  ASN C ND2 1 
ATOM   9971  N  N   . LEU C 1 242 ? 21.274  5.008   76.671  1.00 39.17 ? 245  LEU C N   1 
ATOM   9972  C  CA  . LEU C 1 242 ? 21.367  6.091   77.636  1.00 39.13 ? 245  LEU C CA  1 
ATOM   9973  C  C   . LEU C 1 242 ? 20.007  6.254   78.273  1.00 39.38 ? 245  LEU C C   1 
ATOM   9974  O  O   . LEU C 1 242 ? 18.988  6.140   77.592  1.00 39.42 ? 245  LEU C O   1 
ATOM   9975  C  CB  . LEU C 1 242 ? 21.729  7.393   76.940  1.00 38.73 ? 245  LEU C CB  1 
ATOM   9976  C  CG  . LEU C 1 242 ? 23.138  7.515   76.385  1.00 38.47 ? 245  LEU C CG  1 
ATOM   9977  C  CD1 . LEU C 1 242 ? 23.216  8.743   75.496  1.00 38.44 ? 245  LEU C CD1 1 
ATOM   9978  C  CD2 . LEU C 1 242 ? 24.129  7.596   77.529  1.00 38.33 ? 245  LEU C CD2 1 
ATOM   9979  N  N   . SER C 1 243 ? 19.983  6.507   79.578  1.00 39.57 ? 246  SER C N   1 
ATOM   9980  C  CA  . SER C 1 243 ? 18.718  6.696   80.278  1.00 39.78 ? 246  SER C CA  1 
ATOM   9981  C  C   . SER C 1 243 ? 18.132  8.034   79.861  1.00 40.04 ? 246  SER C C   1 
ATOM   9982  O  O   . SER C 1 243 ? 18.854  8.923   79.405  1.00 39.82 ? 246  SER C O   1 
ATOM   9983  C  CB  . SER C 1 243 ? 18.917  6.675   81.794  1.00 39.49 ? 246  SER C CB  1 
ATOM   9984  O  OG  . SER C 1 243 ? 19.613  7.829   82.235  1.00 39.72 ? 246  SER C OG  1 
ATOM   9985  N  N   . VAL C 1 244 ? 16.826  8.181   80.032  1.00 40.43 ? 247  VAL C N   1 
ATOM   9986  C  CA  . VAL C 1 244 ? 16.170  9.417   79.672  1.00 40.90 ? 247  VAL C CA  1 
ATOM   9987  C  C   . VAL C 1 244 ? 16.827  10.578  80.386  1.00 41.51 ? 247  VAL C C   1 
ATOM   9988  O  O   . VAL C 1 244 ? 17.068  11.618  79.784  1.00 41.44 ? 247  VAL C O   1 
ATOM   9989  C  CB  . VAL C 1 244 ? 14.684  9.374   80.014  1.00 40.86 ? 247  VAL C CB  1 
ATOM   9990  C  CG1 . VAL C 1 244 ? 14.055  10.727  79.774  1.00 40.73 ? 247  VAL C CG1 1 
ATOM   9991  C  CG2 . VAL C 1 244 ? 13.995  8.327   79.166  1.00 40.68 ? 247  VAL C CG2 1 
ATOM   9992  N  N   . GLU C 1 245 ? 17.171  10.383  81.653  1.00 42.22 ? 248  GLU C N   1 
ATOM   9993  C  CA  . GLU C 1 245 ? 17.797  11.449  82.417  1.00 43.00 ? 248  GLU C CA  1 
ATOM   9994  C  C   . GLU C 1 245 ? 19.201  11.796  81.937  1.00 42.89 ? 248  GLU C C   1 
ATOM   9995  O  O   . GLU C 1 245 ? 19.542  12.970  81.815  1.00 42.70 ? 248  GLU C O   1 
ATOM   9996  C  CB  . GLU C 1 245 ? 17.829  11.106  83.898  1.00 44.05 ? 248  GLU C CB  1 
ATOM   9997  C  CG  . GLU C 1 245 ? 18.371  12.252  84.736  1.00 45.81 ? 248  GLU C CG  1 
ATOM   9998  C  CD  . GLU C 1 245 ? 18.380  11.947  86.216  1.00 46.96 ? 248  GLU C CD  1 
ATOM   9999  O  OE1 . GLU C 1 245 ? 17.312  11.555  86.747  1.00 47.77 ? 248  GLU C OE1 1 
ATOM   10000 O  OE2 . GLU C 1 245 ? 19.452  12.107  86.849  1.00 47.50 ? 248  GLU C OE2 1 
ATOM   10001 N  N   . ASP C 1 246 ? 20.024  10.783  81.690  1.00 42.89 ? 249  ASP C N   1 
ATOM   10002 C  CA  . ASP C 1 246 ? 21.387  11.026  81.219  1.00 42.99 ? 249  ASP C CA  1 
ATOM   10003 C  C   . ASP C 1 246 ? 21.381  11.645  79.825  1.00 42.72 ? 249  ASP C C   1 
ATOM   10004 O  O   . ASP C 1 246 ? 22.182  12.537  79.531  1.00 42.67 ? 249  ASP C O   1 
ATOM   10005 C  CB  . ASP C 1 246 ? 22.219  9.736   81.215  1.00 43.40 ? 249  ASP C CB  1 
ATOM   10006 C  CG  . ASP C 1 246 ? 22.693  9.330   82.606  1.00 43.82 ? 249  ASP C CG  1 
ATOM   10007 O  OD1 . ASP C 1 246 ? 23.099  8.160   82.775  1.00 44.20 ? 249  ASP C OD1 1 
ATOM   10008 O  OD2 . ASP C 1 246 ? 22.671  10.171  83.531  1.00 44.20 ? 249  ASP C OD2 1 
ATOM   10009 N  N   . ALA C 1 247 ? 20.468  11.179  78.977  1.00 42.38 ? 250  ALA C N   1 
ATOM   10010 C  CA  . ALA C 1 247 ? 20.355  11.697  77.622  1.00 42.16 ? 250  ALA C CA  1 
ATOM   10011 C  C   . ALA C 1 247 ? 20.023  13.183  77.673  1.00 41.97 ? 250  ALA C C   1 
ATOM   10012 O  O   . ALA C 1 247 ? 20.584  13.975  76.919  1.00 41.84 ? 250  ALA C O   1 
ATOM   10013 C  CB  . ALA C 1 247 ? 19.279  10.940  76.855  1.00 42.23 ? 250  ALA C CB  1 
ATOM   10014 N  N   . ALA C 1 248 ? 19.129  13.551  78.587  1.00 41.83 ? 251  ALA C N   1 
ATOM   10015 C  CA  . ALA C 1 248 ? 18.719  14.938  78.763  1.00 41.79 ? 251  ALA C CA  1 
ATOM   10016 C  C   . ALA C 1 248 ? 19.901  15.783  79.212  1.00 41.90 ? 251  ALA C C   1 
ATOM   10017 O  O   . ALA C 1 248 ? 20.153  16.856  78.669  1.00 41.95 ? 251  ALA C O   1 
ATOM   10018 C  CB  . ALA C 1 248 ? 17.599  15.028  79.782  1.00 41.60 ? 251  ALA C CB  1 
ATOM   10019 N  N   . ARG C 1 249 ? 20.653  15.277  80.180  1.00 42.11 ? 252  ARG C N   1 
ATOM   10020 C  CA  . ARG C 1 249 ? 21.800  16.005  80.697  1.00 42.34 ? 252  ARG C CA  1 
ATOM   10021 C  C   . ARG C 1 249 ? 22.867  16.204  79.627  1.00 42.25 ? 252  ARG C C   1 
ATOM   10022 O  O   . ARG C 1 249 ? 23.405  17.304  79.463  1.00 42.21 ? 252  ARG C O   1 
ATOM   10023 C  CB  . ARG C 1 249 ? 22.396  15.275  81.895  1.00 42.61 ? 252  ARG C CB  1 
ATOM   10024 C  CG  . ARG C 1 249 ? 23.322  16.145  82.709  1.00 43.13 ? 252  ARG C CG  1 
ATOM   10025 C  CD  . ARG C 1 249 ? 24.111  15.327  83.689  1.00 43.66 ? 252  ARG C CD  1 
ATOM   10026 N  NE  . ARG C 1 249 ? 25.003  14.400  83.001  1.00 44.18 ? 252  ARG C NE  1 
ATOM   10027 C  CZ  . ARG C 1 249 ? 24.803  13.090  82.944  1.00 44.39 ? 252  ARG C CZ  1 
ATOM   10028 N  NH1 . ARG C 1 249 ? 23.738  12.564  83.537  1.00 44.63 ? 252  ARG C NH1 1 
ATOM   10029 N  NH2 . ARG C 1 249 ? 25.671  12.311  82.312  1.00 44.29 ? 252  ARG C NH2 1 
ATOM   10030 N  N   . LEU C 1 250 ? 23.160  15.137  78.892  1.00 42.05 ? 253  LEU C N   1 
ATOM   10031 C  CA  . LEU C 1 250 ? 24.165  15.190  77.837  1.00 42.01 ? 253  LEU C CA  1 
ATOM   10032 C  C   . LEU C 1 250 ? 23.806  16.123  76.678  1.00 42.09 ? 253  LEU C C   1 
ATOM   10033 O  O   . LEU C 1 250 ? 24.680  16.797  76.130  1.00 42.04 ? 253  LEU C O   1 
ATOM   10034 C  CB  . LEU C 1 250 ? 24.438  13.786  77.305  1.00 41.78 ? 253  LEU C CB  1 
ATOM   10035 C  CG  . LEU C 1 250 ? 25.109  12.825  78.280  1.00 41.54 ? 253  LEU C CG  1 
ATOM   10036 C  CD1 . LEU C 1 250 ? 25.170  11.448  77.664  1.00 41.33 ? 253  LEU C CD1 1 
ATOM   10037 C  CD2 . LEU C 1 250 ? 26.500  13.324  78.621  1.00 41.50 ? 253  LEU C CD2 1 
ATOM   10038 N  N   . SER C 1 251 ? 22.523  16.175  76.314  1.00 42.13 ? 254  SER C N   1 
ATOM   10039 C  CA  . SER C 1 251 ? 22.071  17.028  75.216  1.00 42.06 ? 254  SER C CA  1 
ATOM   10040 C  C   . SER C 1 251 ? 22.382  18.488  75.517  1.00 42.17 ? 254  SER C C   1 
ATOM   10041 O  O   . SER C 1 251 ? 22.371  19.338  74.629  1.00 42.23 ? 254  SER C O   1 
ATOM   10042 C  CB  . SER C 1 251 ? 20.575  16.837  74.963  1.00 41.87 ? 254  SER C CB  1 
ATOM   10043 O  OG  . SER C 1 251 ? 19.809  17.360  76.026  1.00 41.99 ? 254  SER C OG  1 
ATOM   10044 N  N   . GLN C 1 252 ? 22.648  18.773  76.783  1.00 42.13 ? 255  GLN C N   1 
ATOM   10045 C  CA  . GLN C 1 252 ? 22.989  20.116  77.189  1.00 42.22 ? 255  GLN C CA  1 
ATOM   10046 C  C   . GLN C 1 252 ? 24.495  20.217  77.382  1.00 42.02 ? 255  GLN C C   1 
ATOM   10047 O  O   . GLN C 1 252 ? 25.125  21.151  76.893  1.00 42.06 ? 255  GLN C O   1 
ATOM   10048 C  CB  . GLN C 1 252 ? 22.247  20.485  78.473  1.00 42.80 ? 255  GLN C CB  1 
ATOM   10049 C  CG  . GLN C 1 252 ? 22.778  21.724  79.181  1.00 43.57 ? 255  GLN C CG  1 
ATOM   10050 C  CD  . GLN C 1 252 ? 23.668  21.376  80.360  1.00 44.07 ? 255  GLN C CD  1 
ATOM   10051 O  OE1 . GLN C 1 252 ? 24.857  21.704  80.380  1.00 44.25 ? 255  GLN C OE1 1 
ATOM   10052 N  NE2 . GLN C 1 252 ? 23.094  20.699  81.352  1.00 44.44 ? 255  GLN C NE2 1 
ATOM   10053 N  N   . GLU C 1 253 ? 25.078  19.238  78.063  1.00 41.75 ? 256  GLU C N   1 
ATOM   10054 C  CA  . GLU C 1 253 ? 26.514  19.242  78.319  1.00 41.51 ? 256  GLU C CA  1 
ATOM   10055 C  C   . GLU C 1 253 ? 27.371  19.037  77.076  1.00 41.02 ? 256  GLU C C   1 
ATOM   10056 O  O   . GLU C 1 253 ? 28.408  19.678  76.922  1.00 40.84 ? 256  GLU C O   1 
ATOM   10057 C  CB  . GLU C 1 253 ? 26.859  18.215  79.393  1.00 41.98 ? 256  GLU C CB  1 
ATOM   10058 C  CG  . GLU C 1 253 ? 26.228  18.537  80.744  1.00 42.62 ? 256  GLU C CG  1 
ATOM   10059 C  CD  . GLU C 1 253 ? 26.634  17.568  81.843  1.00 43.05 ? 256  GLU C CD  1 
ATOM   10060 O  OE1 . GLU C 1 253 ? 27.040  16.418  81.529  1.00 42.92 ? 256  GLU C OE1 1 
ATOM   10061 O  OE2 . GLU C 1 253 ? 26.533  17.968  83.028  1.00 43.43 ? 256  GLU C OE2 1 
ATOM   10062 N  N   . ASP C 1 254 ? 26.936  18.145  76.191  1.00 40.57 ? 257  ASP C N   1 
ATOM   10063 C  CA  . ASP C 1 254 ? 27.659  17.875  74.951  1.00 39.95 ? 257  ASP C CA  1 
ATOM   10064 C  C   . ASP C 1 254 ? 26.712  17.443  73.840  1.00 39.48 ? 257  ASP C C   1 
ATOM   10065 O  O   . ASP C 1 254 ? 26.496  16.250  73.611  1.00 39.35 ? 257  ASP C O   1 
ATOM   10066 C  CB  . ASP C 1 254 ? 28.739  16.808  75.148  1.00 39.89 ? 257  ASP C CB  1 
ATOM   10067 C  CG  . ASP C 1 254 ? 29.629  16.636  73.919  1.00 39.85 ? 257  ASP C CG  1 
ATOM   10068 O  OD1 . ASP C 1 254 ? 29.549  17.443  72.967  1.00 40.02 ? 257  ASP C OD1 1 
ATOM   10069 O  OD2 . ASP C 1 254 ? 30.426  15.686  73.904  1.00 39.86 ? 257  ASP C OD2 1 
ATOM   10070 N  N   . PRO C 1 255 ? 26.146  18.422  73.119  1.00 39.13 ? 258  PRO C N   1 
ATOM   10071 C  CA  . PRO C 1 255 ? 25.218  18.169  72.016  1.00 38.80 ? 258  PRO C CA  1 
ATOM   10072 C  C   . PRO C 1 255 ? 25.852  17.306  70.930  1.00 38.61 ? 258  PRO C C   1 
ATOM   10073 O  O   . PRO C 1 255 ? 25.148  16.689  70.135  1.00 38.69 ? 258  PRO C O   1 
ATOM   10074 C  CB  . PRO C 1 255 ? 24.925  19.577  71.498  1.00 38.77 ? 258  PRO C CB  1 
ATOM   10075 C  CG  . PRO C 1 255 ? 25.044  20.414  72.722  1.00 38.82 ? 258  PRO C CG  1 
ATOM   10076 C  CD  . PRO C 1 255 ? 26.285  19.868  73.363  1.00 38.97 ? 258  PRO C CD  1 
ATOM   10077 N  N   . ASP C 1 256 ? 27.182  17.243  70.917  1.00 38.40 ? 259  ASP C N   1 
ATOM   10078 C  CA  . ASP C 1 256 ? 27.910  16.463  69.913  1.00 38.11 ? 259  ASP C CA  1 
ATOM   10079 C  C   . ASP C 1 256 ? 28.542  15.199  70.489  1.00 37.84 ? 259  ASP C C   1 
ATOM   10080 O  O   . ASP C 1 256 ? 29.588  14.735  70.032  1.00 37.76 ? 259  ASP C O   1 
ATOM   10081 C  CB  . ASP C 1 256 ? 28.968  17.341  69.251  1.00 37.87 ? 259  ASP C CB  1 
ATOM   10082 C  CG  . ASP C 1 256 ? 28.381  18.603  68.660  1.00 37.78 ? 259  ASP C CG  1 
ATOM   10083 O  OD1 . ASP C 1 256 ? 27.285  18.536  68.068  1.00 37.87 ? 259  ASP C OD1 1 
ATOM   10084 O  OD2 . ASP C 1 256 ? 29.011  19.669  68.786  1.00 38.04 ? 259  ASP C OD2 1 
ATOM   10085 N  N   . TYR C 1 257 ? 27.866  14.639  71.480  1.00 37.57 ? 260  TYR C N   1 
ATOM   10086 C  CA  . TYR C 1 257 ? 28.299  13.430  72.158  1.00 37.26 ? 260  TYR C CA  1 
ATOM   10087 C  C   . TYR C 1 257 ? 28.629  12.295  71.201  1.00 37.01 ? 260  TYR C C   1 
ATOM   10088 O  O   . TYR C 1 257 ? 29.633  11.606  71.373  1.00 37.03 ? 260  TYR C O   1 
ATOM   10089 C  CB  . TYR C 1 257 ? 27.194  12.984  73.103  1.00 37.43 ? 260  TYR C CB  1 
ATOM   10090 C  CG  . TYR C 1 257 ? 27.512  11.754  73.900  1.00 37.35 ? 260  TYR C CG  1 
ATOM   10091 C  CD1 . TYR C 1 257 ? 26.951  10.524  73.565  1.00 37.23 ? 260  TYR C CD1 1 
ATOM   10092 C  CD2 . TYR C 1 257 ? 28.341  11.822  75.015  1.00 37.30 ? 260  TYR C CD2 1 
ATOM   10093 C  CE1 . TYR C 1 257 ? 27.201  9.394   74.323  1.00 37.29 ? 260  TYR C CE1 1 
ATOM   10094 C  CE2 . TYR C 1 257 ? 28.600  10.691  75.780  1.00 37.39 ? 260  TYR C CE2 1 
ATOM   10095 C  CZ  . TYR C 1 257 ? 28.023  9.482   75.429  1.00 37.33 ? 260  TYR C CZ  1 
ATOM   10096 O  OH  . TYR C 1 257 ? 28.255  8.366   76.195  1.00 37.20 ? 260  TYR C OH  1 
ATOM   10097 N  N   . GLY C 1 258 ? 27.763  12.087  70.214  1.00 36.69 ? 261  GLY C N   1 
ATOM   10098 C  CA  . GLY C 1 258 ? 27.972  11.026  69.247  1.00 36.28 ? 261  GLY C CA  1 
ATOM   10099 C  C   . GLY C 1 258 ? 29.189  11.241  68.375  1.00 36.02 ? 261  GLY C C   1 
ATOM   10100 O  O   . GLY C 1 258 ? 29.922  10.302  68.094  1.00 35.92 ? 261  GLY C O   1 
ATOM   10101 N  N   . ILE C 1 259 ? 29.403  12.475  67.935  1.00 35.87 ? 262  ILE C N   1 
ATOM   10102 C  CA  . ILE C 1 259 ? 30.550  12.794  67.092  1.00 35.75 ? 262  ILE C CA  1 
ATOM   10103 C  C   . ILE C 1 259 ? 31.842  12.600  67.863  1.00 36.02 ? 262  ILE C C   1 
ATOM   10104 O  O   . ILE C 1 259 ? 32.770  11.948  67.384  1.00 36.00 ? 262  ILE C O   1 
ATOM   10105 C  CB  . ILE C 1 259 ? 30.497  14.245  66.606  1.00 35.53 ? 262  ILE C CB  1 
ATOM   10106 C  CG1 . ILE C 1 259 ? 29.281  14.452  65.710  1.00 35.24 ? 262  ILE C CG1 1 
ATOM   10107 C  CG2 . ILE C 1 259 ? 31.759  14.599  65.856  1.00 35.38 ? 262  ILE C CG2 1 
ATOM   10108 C  CD1 . ILE C 1 259 ? 29.057  15.899  65.339  1.00 35.02 ? 262  ILE C CD1 1 
ATOM   10109 N  N   . ARG C 1 260 ? 31.894  13.172  69.061  1.00 36.12 ? 263  ARG C N   1 
ATOM   10110 C  CA  . ARG C 1 260 ? 33.072  13.076  69.910  1.00 36.29 ? 263  ARG C CA  1 
ATOM   10111 C  C   . ARG C 1 260 ? 33.423  11.626  70.230  1.00 36.45 ? 263  ARG C C   1 
ATOM   10112 O  O   . ARG C 1 260 ? 34.568  11.202  70.066  1.00 36.33 ? 263  ARG C O   1 
ATOM   10113 C  CB  . ARG C 1 260 ? 32.835  13.837  71.209  1.00 36.37 ? 263  ARG C CB  1 
ATOM   10114 C  CG  . ARG C 1 260 ? 34.057  13.938  72.081  1.00 36.56 ? 263  ARG C CG  1 
ATOM   10115 C  CD  . ARG C 1 260 ? 33.709  14.565  73.398  1.00 36.90 ? 263  ARG C CD  1 
ATOM   10116 N  NE  . ARG C 1 260 ? 33.006  15.821  73.200  1.00 37.39 ? 263  ARG C NE  1 
ATOM   10117 C  CZ  . ARG C 1 260 ? 33.605  16.980  72.972  1.00 37.85 ? 263  ARG C CZ  1 
ATOM   10118 N  NH1 . ARG C 1 260 ? 34.931  17.045  72.924  1.00 37.83 ? 263  ARG C NH1 1 
ATOM   10119 N  NH2 . ARG C 1 260 ? 32.870  18.063  72.734  1.00 38.20 ? 263  ARG C NH2 1 
ATOM   10120 N  N   . ASP C 1 261 ? 32.422  10.871  70.672  1.00 36.54 ? 264  ASP C N   1 
ATOM   10121 C  CA  . ASP C 1 261 ? 32.602  9.468   71.023  1.00 36.71 ? 264  ASP C CA  1 
ATOM   10122 C  C   . ASP C 1 261 ? 33.249  8.666   69.901  1.00 36.81 ? 264  ASP C C   1 
ATOM   10123 O  O   . ASP C 1 261 ? 34.222  7.944   70.129  1.00 36.73 ? 264  ASP C O   1 
ATOM   10124 C  CB  . ASP C 1 261 ? 31.255  8.848   71.392  1.00 36.84 ? 264  ASP C CB  1 
ATOM   10125 C  CG  . ASP C 1 261 ? 31.338  7.352   71.583  1.00 37.04 ? 264  ASP C CG  1 
ATOM   10126 O  OD1 . ASP C 1 261 ? 31.730  6.914   72.684  1.00 37.38 ? 264  ASP C OD1 1 
ATOM   10127 O  OD2 . ASP C 1 261 ? 31.026  6.611   70.627  1.00 37.28 ? 264  ASP C OD2 1 
ATOM   10128 N  N   . LEU C 1 262 ? 32.704  8.801   68.695  1.00 36.72 ? 265  LEU C N   1 
ATOM   10129 C  CA  . LEU C 1 262 ? 33.210  8.090   67.527  1.00 36.66 ? 265  LEU C CA  1 
ATOM   10130 C  C   . LEU C 1 262 ? 34.619  8.520   67.150  1.00 36.75 ? 265  LEU C C   1 
ATOM   10131 O  O   . LEU C 1 262 ? 35.471  7.679   66.871  1.00 36.71 ? 265  LEU C O   1 
ATOM   10132 C  CB  . LEU C 1 262 ? 32.276  8.286   66.332  1.00 36.58 ? 265  LEU C CB  1 
ATOM   10133 C  CG  . LEU C 1 262 ? 32.638  7.492   65.075  1.00 36.52 ? 265  LEU C CG  1 
ATOM   10134 C  CD1 . LEU C 1 262 ? 32.640  6.005   65.381  1.00 36.63 ? 265  LEU C CD1 1 
ATOM   10135 C  CD2 . LEU C 1 262 ? 31.653  7.796   63.962  1.00 36.58 ? 265  LEU C CD2 1 
ATOM   10136 N  N   . PHE C 1 263 ? 34.876  9.822   67.152  1.00 36.80 ? 266  PHE C N   1 
ATOM   10137 C  CA  . PHE C 1 263 ? 36.197  10.300  66.792  1.00 37.10 ? 266  PHE C CA  1 
ATOM   10138 C  C   . PHE C 1 263 ? 37.258  9.776   67.754  1.00 37.34 ? 266  PHE C C   1 
ATOM   10139 O  O   . PHE C 1 263 ? 38.291  9.257   67.326  1.00 37.32 ? 266  PHE C O   1 
ATOM   10140 C  CB  . PHE C 1 263 ? 36.224  11.823  66.758  1.00 37.08 ? 266  PHE C CB  1 
ATOM   10141 C  CG  . PHE C 1 263 ? 37.475  12.387  66.153  1.00 37.14 ? 266  PHE C CG  1 
ATOM   10142 C  CD1 . PHE C 1 263 ? 38.637  12.499  66.902  1.00 37.21 ? 266  PHE C CD1 1 
ATOM   10143 C  CD2 . PHE C 1 263 ? 37.499  12.779  64.825  1.00 37.21 ? 266  PHE C CD2 1 
ATOM   10144 C  CE1 . PHE C 1 263 ? 39.810  12.992  66.331  1.00 37.24 ? 266  PHE C CE1 1 
ATOM   10145 C  CE2 . PHE C 1 263 ? 38.669  13.274  64.248  1.00 37.29 ? 266  PHE C CE2 1 
ATOM   10146 C  CZ  . PHE C 1 263 ? 39.823  13.379  65.004  1.00 37.17 ? 266  PHE C CZ  1 
ATOM   10147 N  N   . ASN C 1 264 ? 37.002  9.908   69.053  1.00 37.43 ? 267  ASN C N   1 
ATOM   10148 C  CA  . ASN C 1 264 ? 37.940  9.449   70.075  1.00 37.51 ? 267  ASN C CA  1 
ATOM   10149 C  C   . ASN C 1 264 ? 38.135  7.944   70.077  1.00 37.53 ? 267  ASN C C   1 
ATOM   10150 O  O   . ASN C 1 264 ? 39.247  7.465   70.294  1.00 37.77 ? 267  ASN C O   1 
ATOM   10151 C  CB  . ASN C 1 264 ? 37.503  9.918   71.461  1.00 37.64 ? 267  ASN C CB  1 
ATOM   10152 C  CG  . ASN C 1 264 ? 37.761  11.394  71.681  1.00 37.75 ? 267  ASN C CG  1 
ATOM   10153 O  OD1 . ASN C 1 264 ? 38.688  11.964  71.105  1.00 37.92 ? 267  ASN C OD1 1 
ATOM   10154 N  ND2 . ASN C 1 264 ? 36.944  12.021  72.518  1.00 37.93 ? 267  ASN C ND2 1 
ATOM   10155 N  N   . ALA C 1 265 ? 37.062  7.193   69.845  1.00 37.37 ? 268  ALA C N   1 
ATOM   10156 C  CA  . ALA C 1 265 ? 37.162  5.739   69.806  1.00 37.25 ? 268  ALA C CA  1 
ATOM   10157 C  C   . ALA C 1 265 ? 38.187  5.350   68.743  1.00 37.25 ? 268  ALA C C   1 
ATOM   10158 O  O   . ALA C 1 265 ? 39.151  4.636   69.022  1.00 37.11 ? 268  ALA C O   1 
ATOM   10159 C  CB  . ALA C 1 265 ? 35.811  5.123   69.489  1.00 37.09 ? 268  ALA C CB  1 
ATOM   10160 N  N   . ILE C 1 266 ? 38.007  5.894   67.544  1.00 37.10 ? 269  ILE C N   1 
ATOM   10161 C  CA  . ILE C 1 266 ? 38.889  5.627   66.420  1.00 37.00 ? 269  ILE C CA  1 
ATOM   10162 C  C   . ILE C 1 266 ? 40.290  6.177   66.634  1.00 37.32 ? 269  ILE C C   1 
ATOM   10163 O  O   . ILE C 1 266 ? 41.276  5.506   66.337  1.00 37.27 ? 269  ILE C O   1 
ATOM   10164 C  CB  . ILE C 1 266 ? 38.299  6.205   65.124  1.00 36.80 ? 269  ILE C CB  1 
ATOM   10165 C  CG1 . ILE C 1 266 ? 37.002  5.473   64.780  1.00 36.67 ? 269  ILE C CG1 1 
ATOM   10166 C  CG2 . ILE C 1 266 ? 39.285  6.082   63.978  1.00 36.62 ? 269  ILE C CG2 1 
ATOM   10167 C  CD1 . ILE C 1 266 ? 36.262  6.060   63.604  1.00 36.55 ? 269  ILE C CD1 1 
ATOM   10168 N  N   . ALA C 1 267 ? 40.376  7.393   67.159  1.00 37.63 ? 270  ALA C N   1 
ATOM   10169 C  CA  . ALA C 1 267 ? 41.663  8.036   67.402  1.00 37.99 ? 270  ALA C CA  1 
ATOM   10170 C  C   . ALA C 1 267 ? 42.563  7.254   68.362  1.00 38.32 ? 270  ALA C C   1 
ATOM   10171 O  O   . ALA C 1 267 ? 43.785  7.234   68.204  1.00 38.16 ? 270  ALA C O   1 
ATOM   10172 C  CB  . ALA C 1 267 ? 41.448  9.460   67.915  1.00 37.85 ? 270  ALA C CB  1 
ATOM   10173 N  N   . THR C 1 268 ? 41.956  6.586   69.334  1.00 38.71 ? 271  THR C N   1 
ATOM   10174 C  CA  . THR C 1 268 ? 42.713  5.826   70.322  1.00 39.13 ? 271  THR C CA  1 
ATOM   10175 C  C   . THR C 1 268 ? 42.835  4.345   70.000  1.00 39.44 ? 271  THR C C   1 
ATOM   10176 O  O   . THR C 1 268 ? 43.228  3.550   70.855  1.00 39.68 ? 271  THR C O   1 
ATOM   10177 C  CB  . THR C 1 268 ? 42.101  5.980   71.717  1.00 39.14 ? 271  THR C CB  1 
ATOM   10178 O  OG1 . THR C 1 268 ? 40.762  5.469   71.712  1.00 39.17 ? 271  THR C OG1 1 
ATOM   10179 C  CG2 . THR C 1 268 ? 42.064  7.439   72.107  1.00 39.17 ? 271  THR C CG2 1 
ATOM   10180 N  N   . GLY C 1 269 ? 42.463  3.967   68.784  1.00 39.57 ? 272  GLY C N   1 
ATOM   10181 C  CA  . GLY C 1 269 ? 42.567  2.578   68.386  1.00 39.64 ? 272  GLY C CA  1 
ATOM   10182 C  C   . GLY C 1 269 ? 41.402  1.655   68.683  1.00 39.80 ? 272  GLY C C   1 
ATOM   10183 O  O   . GLY C 1 269 ? 41.489  0.474   68.351  1.00 39.92 ? 272  GLY C O   1 
ATOM   10184 N  N   . LYS C 1 270 ? 40.338  2.139   69.326  1.00 40.04 ? 273  LYS C N   1 
ATOM   10185 C  CA  . LYS C 1 270 ? 39.179  1.276   69.608  1.00 40.13 ? 273  LYS C CA  1 
ATOM   10186 C  C   . LYS C 1 270 ? 38.216  1.265   68.412  1.00 39.84 ? 273  LYS C C   1 
ATOM   10187 O  O   . LYS C 1 270 ? 37.086  1.746   68.511  1.00 39.88 ? 273  LYS C O   1 
ATOM   10188 C  CB  . LYS C 1 270 ? 38.422  1.749   70.851  1.00 40.59 ? 273  LYS C CB  1 
ATOM   10189 C  CG  . LYS C 1 270 ? 39.241  1.881   72.111  1.00 41.50 ? 273  LYS C CG  1 
ATOM   10190 C  CD  . LYS C 1 270 ? 38.322  2.303   73.253  1.00 42.57 ? 273  LYS C CD  1 
ATOM   10191 C  CE  . LYS C 1 270 ? 39.091  2.960   74.402  1.00 43.21 ? 273  LYS C CE  1 
ATOM   10192 N  NZ  . LYS C 1 270 ? 39.630  4.310   74.042  1.00 43.50 ? 273  LYS C NZ  1 
ATOM   10193 N  N   . TYR C 1 271 ? 38.661  0.695   67.294  1.00 39.49 ? 274  TYR C N   1 
ATOM   10194 C  CA  . TYR C 1 271 ? 37.875  0.634   66.056  1.00 39.05 ? 274  TYR C CA  1 
ATOM   10195 C  C   . TYR C 1 271 ? 36.608  -0.204  66.195  1.00 38.66 ? 274  TYR C C   1 
ATOM   10196 O  O   . TYR C 1 271 ? 36.682  -1.417  66.353  1.00 38.78 ? 274  TYR C O   1 
ATOM   10197 C  CB  . TYR C 1 271 ? 38.737  0.060   64.932  1.00 39.06 ? 274  TYR C CB  1 
ATOM   10198 C  CG  . TYR C 1 271 ? 40.105  0.693   64.812  1.00 39.30 ? 274  TYR C CG  1 
ATOM   10199 C  CD1 . TYR C 1 271 ? 41.239  -0.093  64.632  1.00 39.48 ? 274  TYR C CD1 1 
ATOM   10200 C  CD2 . TYR C 1 271 ? 40.265  2.075   64.857  1.00 39.25 ? 274  TYR C CD2 1 
ATOM   10201 C  CE1 . TYR C 1 271 ? 42.501  0.482   64.497  1.00 39.75 ? 274  TYR C CE1 1 
ATOM   10202 C  CE2 . TYR C 1 271 ? 41.521  2.658   64.720  1.00 39.57 ? 274  TYR C CE2 1 
ATOM   10203 C  CZ  . TYR C 1 271 ? 42.634  1.854   64.540  1.00 39.74 ? 274  TYR C CZ  1 
ATOM   10204 O  OH  . TYR C 1 271 ? 43.881  2.416   64.391  1.00 39.96 ? 274  TYR C OH  1 
ATOM   10205 N  N   . PRO C 1 272 ? 35.426  0.426   66.085  1.00 38.27 ? 275  PRO C N   1 
ATOM   10206 C  CA  . PRO C 1 272 ? 34.152  -0.291  66.208  1.00 37.93 ? 275  PRO C CA  1 
ATOM   10207 C  C   . PRO C 1 272 ? 33.872  -1.219  65.035  1.00 37.72 ? 275  PRO C C   1 
ATOM   10208 O  O   . PRO C 1 272 ? 34.246  -0.927  63.900  1.00 37.74 ? 275  PRO C O   1 
ATOM   10209 C  CB  . PRO C 1 272 ? 33.137  0.841   66.287  1.00 37.86 ? 275  PRO C CB  1 
ATOM   10210 C  CG  . PRO C 1 272 ? 33.732  1.872   65.415  1.00 37.96 ? 275  PRO C CG  1 
ATOM   10211 C  CD  . PRO C 1 272 ? 35.198  1.851   65.798  1.00 38.16 ? 275  PRO C CD  1 
ATOM   10212 N  N   . SER C 1 273 ? 33.215  -2.341  65.313  1.00 37.38 ? 276  SER C N   1 
ATOM   10213 C  CA  . SER C 1 273 ? 32.901  -3.308  64.272  1.00 37.03 ? 276  SER C CA  1 
ATOM   10214 C  C   . SER C 1 273 ? 31.499  -3.872  64.404  1.00 36.73 ? 276  SER C C   1 
ATOM   10215 O  O   . SER C 1 273 ? 30.909  -3.865  65.485  1.00 36.65 ? 276  SER C O   1 
ATOM   10216 C  CB  . SER C 1 273 ? 33.919  -4.448  64.275  1.00 36.93 ? 276  SER C CB  1 
ATOM   10217 O  OG  . SER C 1 273 ? 33.927  -5.117  65.522  1.00 37.30 ? 276  SER C OG  1 
ATOM   10218 N  N   . TRP C 1 274 ? 30.969  -4.331  63.276  1.00 36.36 ? 277  TRP C N   1 
ATOM   10219 C  CA  . TRP C 1 274 ? 29.640  -4.910  63.210  1.00 36.11 ? 277  TRP C CA  1 
ATOM   10220 C  C   . TRP C 1 274 ? 29.717  -6.206  62.437  1.00 36.15 ? 277  TRP C C   1 
ATOM   10221 O  O   . TRP C 1 274 ? 30.445  -6.294  61.453  1.00 36.14 ? 277  TRP C O   1 
ATOM   10222 C  CB  . TRP C 1 274 ? 28.682  -3.959  62.486  1.00 35.87 ? 277  TRP C CB  1 
ATOM   10223 C  CG  . TRP C 1 274 ? 28.260  -2.773  63.298  1.00 35.56 ? 277  TRP C CG  1 
ATOM   10224 C  CD1 . TRP C 1 274 ? 27.090  -2.629  63.976  1.00 35.43 ? 277  TRP C CD1 1 
ATOM   10225 C  CD2 . TRP C 1 274 ? 29.019  -1.586  63.552  1.00 35.40 ? 277  TRP C CD2 1 
ATOM   10226 N  NE1 . TRP C 1 274 ? 27.071  -1.434  64.647  1.00 35.27 ? 277  TRP C NE1 1 
ATOM   10227 C  CE2 . TRP C 1 274 ? 28.245  -0.772  64.406  1.00 35.35 ? 277  TRP C CE2 1 
ATOM   10228 C  CE3 . TRP C 1 274 ? 30.280  -1.132  63.144  1.00 35.28 ? 277  TRP C CE3 1 
ATOM   10229 C  CZ2 . TRP C 1 274 ? 28.686  0.469   64.864  1.00 35.28 ? 277  TRP C CZ2 1 
ATOM   10230 C  CZ3 . TRP C 1 274 ? 30.719  0.104   63.599  1.00 35.33 ? 277  TRP C CZ3 1 
ATOM   10231 C  CH2 . TRP C 1 274 ? 29.923  0.890   64.451  1.00 35.23 ? 277  TRP C CH2 1 
ATOM   10232 N  N   . THR C 1 275 ? 28.994  -7.222  62.895  1.00 36.30 ? 278  THR C N   1 
ATOM   10233 C  CA  . THR C 1 275 ? 28.977  -8.505  62.196  1.00 36.47 ? 278  THR C CA  1 
ATOM   10234 C  C   . THR C 1 275 ? 27.828  -8.429  61.204  1.00 36.71 ? 278  THR C C   1 
ATOM   10235 O  O   . THR C 1 275 ? 26.691  -8.161  61.580  1.00 36.60 ? 278  THR C O   1 
ATOM   10236 C  CB  . THR C 1 275 ? 28.796  -9.685  63.157  1.00 36.39 ? 278  THR C CB  1 
ATOM   10237 O  OG1 . THR C 1 275 ? 29.766  -9.587  64.200  1.00 36.41 ? 278  THR C OG1 1 
ATOM   10238 C  CG2 . THR C 1 275 ? 29.032  -10.989 62.436  1.00 36.31 ? 278  THR C CG2 1 
ATOM   10239 N  N   . PHE C 1 276 ? 28.149  -8.634  59.932  1.00 36.87 ? 279  PHE C N   1 
ATOM   10240 C  CA  . PHE C 1 276 ? 27.192  -8.539  58.839  1.00 37.08 ? 279  PHE C CA  1 
ATOM   10241 C  C   . PHE C 1 276 ? 26.477  -9.843  58.502  1.00 37.49 ? 279  PHE C C   1 
ATOM   10242 O  O   . PHE C 1 276 ? 27.120  -10.840 58.179  1.00 37.48 ? 279  PHE C O   1 
ATOM   10243 C  CB  . PHE C 1 276 ? 27.925  -8.017  57.607  1.00 37.07 ? 279  PHE C CB  1 
ATOM   10244 C  CG  . PHE C 1 276 ? 27.042  -7.327  56.628  1.00 37.07 ? 279  PHE C CG  1 
ATOM   10245 C  CD1 . PHE C 1 276 ? 26.680  -6.004  56.820  1.00 37.11 ? 279  PHE C CD1 1 
ATOM   10246 C  CD2 . PHE C 1 276 ? 26.572  -7.994  55.512  1.00 37.05 ? 279  PHE C CD2 1 
ATOM   10247 C  CE1 . PHE C 1 276 ? 25.857  -5.351  55.911  1.00 37.15 ? 279  PHE C CE1 1 
ATOM   10248 C  CE2 . PHE C 1 276 ? 25.748  -7.350  54.594  1.00 37.17 ? 279  PHE C CE2 1 
ATOM   10249 C  CZ  . PHE C 1 276 ? 25.390  -6.023  54.797  1.00 37.13 ? 279  PHE C CZ  1 
ATOM   10250 N  N   . TYR C 1 277 ? 25.143  -9.803  58.508  1.00 37.70 ? 280  TYR C N   1 
ATOM   10251 C  CA  . TYR C 1 277 ? 24.306  -10.970 58.213  1.00 37.93 ? 280  TYR C CA  1 
ATOM   10252 C  C   . TYR C 1 277 ? 23.261  -10.682 57.150  1.00 38.04 ? 280  TYR C C   1 
ATOM   10253 O  O   . TYR C 1 277 ? 23.058  -9.542  56.751  1.00 38.08 ? 280  TYR C O   1 
ATOM   10254 C  CB  . TYR C 1 277 ? 23.491  -11.384 59.440  1.00 37.99 ? 280  TYR C CB  1 
ATOM   10255 C  CG  . TYR C 1 277 ? 24.261  -11.720 60.677  1.00 38.14 ? 280  TYR C CG  1 
ATOM   10256 C  CD1 . TYR C 1 277 ? 24.653  -13.030 60.946  1.00 38.18 ? 280  TYR C CD1 1 
ATOM   10257 C  CD2 . TYR C 1 277 ? 24.548  -10.740 61.615  1.00 38.21 ? 280  TYR C CD2 1 
ATOM   10258 C  CE1 . TYR C 1 277 ? 25.311  -13.353 62.128  1.00 38.31 ? 280  TYR C CE1 1 
ATOM   10259 C  CE2 . TYR C 1 277 ? 25.206  -11.053 62.799  1.00 38.52 ? 280  TYR C CE2 1 
ATOM   10260 C  CZ  . TYR C 1 277 ? 25.583  -12.358 63.049  1.00 38.41 ? 280  TYR C CZ  1 
ATOM   10261 O  OH  . TYR C 1 277 ? 26.243  -12.648 64.217  1.00 38.50 ? 280  TYR C OH  1 
ATOM   10262 N  N   . ILE C 1 278 ? 22.547  -11.734 56.761  1.00 38.15 ? 281  ILE C N   1 
ATOM   10263 C  CA  . ILE C 1 278 ? 21.444  -11.640 55.813  1.00 38.21 ? 281  ILE C CA  1 
ATOM   10264 C  C   . ILE C 1 278 ? 20.426  -12.704 56.173  1.00 38.43 ? 281  ILE C C   1 
ATOM   10265 O  O   . ILE C 1 278 ? 20.757  -13.723 56.772  1.00 38.35 ? 281  ILE C O   1 
ATOM   10266 C  CB  . ILE C 1 278 ? 21.837  -11.904 54.331  1.00 38.08 ? 281  ILE C CB  1 
ATOM   10267 C  CG1 . ILE C 1 278 ? 22.441  -13.299 54.175  1.00 37.93 ? 281  ILE C CG1 1 
ATOM   10268 C  CG2 . ILE C 1 278 ? 22.738  -10.808 53.800  1.00 38.11 ? 281  ILE C CG2 1 
ATOM   10269 C  CD1 . ILE C 1 278 ? 22.621  -13.727 52.736  1.00 37.83 ? 281  ILE C CD1 1 
ATOM   10270 N  N   . GLN C 1 279 ? 19.169  -12.415 55.884  1.00 38.63 ? 282  GLN C N   1 
ATOM   10271 C  CA  . GLN C 1 279 ? 18.102  -13.376 56.087  1.00 38.78 ? 282  GLN C CA  1 
ATOM   10272 C  C   . GLN C 1 279 ? 17.708  -13.666 54.653  1.00 38.97 ? 282  GLN C C   1 
ATOM   10273 O  O   . GLN C 1 279 ? 17.791  -12.783 53.806  1.00 38.83 ? 282  GLN C O   1 
ATOM   10274 C  CB  . GLN C 1 279 ? 16.924  -12.763 56.834  1.00 38.68 ? 282  GLN C CB  1 
ATOM   10275 C  CG  . GLN C 1 279 ? 17.130  -12.633 58.323  1.00 38.69 ? 282  GLN C CG  1 
ATOM   10276 C  CD  . GLN C 1 279 ? 15.893  -12.114 59.021  1.00 38.83 ? 282  GLN C CD  1 
ATOM   10277 O  OE1 . GLN C 1 279 ? 15.316  -12.794 59.871  1.00 38.95 ? 282  GLN C OE1 1 
ATOM   10278 N  NE2 . GLN C 1 279 ? 15.464  -10.908 58.653  1.00 38.63 ? 282  GLN C NE2 1 
ATOM   10279 N  N   . VAL C 1 280 ? 17.346  -14.907 54.361  1.00 39.24 ? 283  VAL C N   1 
ATOM   10280 C  CA  . VAL C 1 280 ? 16.960  -15.267 53.007  1.00 39.52 ? 283  VAL C CA  1 
ATOM   10281 C  C   . VAL C 1 280 ? 15.566  -15.859 52.968  1.00 40.20 ? 283  VAL C C   1 
ATOM   10282 O  O   . VAL C 1 280 ? 15.188  -16.646 53.835  1.00 40.44 ? 283  VAL C O   1 
ATOM   10283 C  CB  . VAL C 1 280 ? 17.951  -16.270 52.382  1.00 39.18 ? 283  VAL C CB  1 
ATOM   10284 C  CG1 . VAL C 1 280 ? 17.473  -16.702 51.012  1.00 38.80 ? 283  VAL C CG1 1 
ATOM   10285 C  CG2 . VAL C 1 280 ? 19.328  -15.647 52.275  1.00 38.92 ? 283  VAL C CG2 1 
ATOM   10286 N  N   . MET C 1 281 ? 14.793  -15.438 51.976  1.00 40.78 ? 284  MET C N   1 
ATOM   10287 C  CA  . MET C 1 281 ? 13.444  -15.932 51.785  1.00 41.45 ? 284  MET C CA  1 
ATOM   10288 C  C   . MET C 1 281 ? 13.280  -16.189 50.306  1.00 42.20 ? 284  MET C C   1 
ATOM   10289 O  O   . MET C 1 281 ? 13.410  -15.273 49.495  1.00 42.23 ? 284  MET C O   1 
ATOM   10290 C  CB  . MET C 1 281 ? 12.420  -14.901 52.239  1.00 41.34 ? 284  MET C CB  1 
ATOM   10291 C  CG  . MET C 1 281 ? 10.982  -15.347 52.063  1.00 41.23 ? 284  MET C CG  1 
ATOM   10292 S  SD  . MET C 1 281 ? 9.845   -14.012 52.407  1.00 41.46 ? 284  MET C SD  1 
ATOM   10293 C  CE  . MET C 1 281 ? 9.822   -14.031 54.161  1.00 40.94 ? 284  MET C CE  1 
ATOM   10294 N  N   . THR C 1 282 ? 13.031  -17.444 49.950  1.00 42.96 ? 285  THR C N   1 
ATOM   10295 C  CA  . THR C 1 282 ? 12.852  -17.799 48.550  1.00 43.77 ? 285  THR C CA  1 
ATOM   10296 C  C   . THR C 1 282 ? 11.526  -17.238 48.046  1.00 44.52 ? 285  THR C C   1 
ATOM   10297 O  O   . THR C 1 282 ? 10.683  -16.818 48.839  1.00 44.39 ? 285  THR C O   1 
ATOM   10298 C  CB  . THR C 1 282 ? 12.861  -19.320 48.357  1.00 43.78 ? 285  THR C CB  1 
ATOM   10299 O  OG1 . THR C 1 282 ? 11.730  -19.885 49.028  1.00 43.91 ? 285  THR C OG1 1 
ATOM   10300 C  CG2 . THR C 1 282 ? 14.136  -19.926 48.934  1.00 43.61 ? 285  THR C CG2 1 
ATOM   10301 N  N   . PHE C 1 283 ? 11.355  -17.217 46.728  1.00 45.45 ? 286  PHE C N   1 
ATOM   10302 C  CA  . PHE C 1 283 ? 10.131  -16.715 46.119  1.00 46.52 ? 286  PHE C CA  1 
ATOM   10303 C  C   . PHE C 1 283 ? 8.947   -17.583 46.507  1.00 47.31 ? 286  PHE C C   1 
ATOM   10304 O  O   . PHE C 1 283 ? 7.814   -17.112 46.588  1.00 47.57 ? 286  PHE C O   1 
ATOM   10305 C  CB  . PHE C 1 283 ? 10.275  -16.653 44.602  1.00 46.44 ? 286  PHE C CB  1 
ATOM   10306 C  CG  . PHE C 1 283 ? 10.973  -15.414 44.111  1.00 46.73 ? 286  PHE C CG  1 
ATOM   10307 C  CD1 . PHE C 1 283 ? 12.055  -14.883 44.805  1.00 46.79 ? 286  PHE C CD1 1 
ATOM   10308 C  CD2 . PHE C 1 283 ? 10.543  -14.770 42.960  1.00 46.80 ? 286  PHE C CD2 1 
ATOM   10309 C  CE1 . PHE C 1 283 ? 12.692  -13.736 44.360  1.00 46.69 ? 286  PHE C CE1 1 
ATOM   10310 C  CE2 . PHE C 1 283 ? 11.176  -13.621 42.508  1.00 46.81 ? 286  PHE C CE2 1 
ATOM   10311 C  CZ  . PHE C 1 283 ? 12.252  -13.106 43.212  1.00 46.78 ? 286  PHE C CZ  1 
ATOM   10312 N  N   . ASN C 1 284 ? 9.229   -18.850 46.774  1.00 48.17 ? 287  ASN C N   1 
ATOM   10313 C  CA  . ASN C 1 284 ? 8.213   -19.800 47.179  1.00 49.00 ? 287  ASN C CA  1 
ATOM   10314 C  C   . ASN C 1 284 ? 7.771   -19.481 48.613  1.00 49.06 ? 287  ASN C C   1 
ATOM   10315 O  O   . ASN C 1 284 ? 6.578   -19.515 48.923  1.00 49.02 ? 287  ASN C O   1 
ATOM   10316 C  CB  . ASN C 1 284 ? 8.791   -21.210 47.081  1.00 50.15 ? 287  ASN C CB  1 
ATOM   10317 C  CG  . ASN C 1 284 ? 7.804   -22.284 47.490  1.00 51.40 ? 287  ASN C CG  1 
ATOM   10318 O  OD1 . ASN C 1 284 ? 6.794   -22.013 48.157  1.00 52.35 ? 287  ASN C OD1 1 
ATOM   10319 N  ND2 . ASN C 1 284 ? 8.099   -23.525 47.109  1.00 52.00 ? 287  ASN C ND2 1 
ATOM   10320 N  N   . GLN C 1 285 ? 8.737   -19.185 49.482  1.00 49.00 ? 288  GLN C N   1 
ATOM   10321 C  CA  . GLN C 1 285 ? 8.453   -18.841 50.871  1.00 49.01 ? 288  GLN C CA  1 
ATOM   10322 C  C   . GLN C 1 285 ? 7.738   -17.501 50.974  1.00 49.30 ? 288  GLN C C   1 
ATOM   10323 O  O   . GLN C 1 285 ? 7.022   -17.252 51.943  1.00 49.39 ? 288  GLN C O   1 
ATOM   10324 C  CB  . GLN C 1 285 ? 9.739   -18.758 51.686  1.00 48.80 ? 288  GLN C CB  1 
ATOM   10325 C  CG  . GLN C 1 285 ? 10.423  -20.070 51.939  1.00 48.42 ? 288  GLN C CG  1 
ATOM   10326 C  CD  . GLN C 1 285 ? 11.690  -19.891 52.734  1.00 48.32 ? 288  GLN C CD  1 
ATOM   10327 O  OE1 . GLN C 1 285 ? 12.604  -19.184 52.316  1.00 48.17 ? 288  GLN C OE1 1 
ATOM   10328 N  NE2 . GLN C 1 285 ? 11.748  -20.519 53.898  1.00 48.36 ? 288  GLN C NE2 1 
ATOM   10329 N  N   . ALA C 1 286 ? 7.977   -16.620 50.006  1.00 49.55 ? 289  ALA C N   1 
ATOM   10330 C  CA  . ALA C 1 286 ? 7.344   -15.310 49.999  1.00 50.00 ? 289  ALA C CA  1 
ATOM   10331 C  C   . ALA C 1 286 ? 5.840   -15.446 49.770  1.00 50.40 ? 289  ALA C C   1 
ATOM   10332 O  O   . ALA C 1 286 ? 5.056   -14.603 50.201  1.00 50.45 ? 289  ALA C O   1 
ATOM   10333 C  CB  . ALA C 1 286 ? 7.968   -14.428 48.935  1.00 49.77 ? 289  ALA C CB  1 
ATOM   10334 N  N   . GLU C 1 287 ? 5.444   -16.521 49.099  1.00 50.85 ? 290  GLU C N   1 
ATOM   10335 C  CA  . GLU C 1 287 ? 4.034   -16.778 48.823  1.00 51.34 ? 290  GLU C CA  1 
ATOM   10336 C  C   . GLU C 1 287 ? 3.265   -17.239 50.056  1.00 51.27 ? 290  GLU C C   1 
ATOM   10337 O  O   . GLU C 1 287 ? 2.069   -16.981 50.177  1.00 51.55 ? 290  GLU C O   1 
ATOM   10338 C  CB  . GLU C 1 287 ? 3.888   -17.850 47.741  1.00 51.99 ? 290  GLU C CB  1 
ATOM   10339 C  CG  . GLU C 1 287 ? 4.392   -17.437 46.379  1.00 53.10 ? 290  GLU C CG  1 
ATOM   10340 C  CD  . GLU C 1 287 ? 3.694   -16.194 45.861  1.00 53.82 ? 290  GLU C CD  1 
ATOM   10341 O  OE1 . GLU C 1 287 ? 2.446   -16.117 45.979  1.00 54.29 ? 290  GLU C OE1 1 
ATOM   10342 O  OE2 . GLU C 1 287 ? 4.392   -15.291 45.339  1.00 54.36 ? 290  GLU C OE2 1 
ATOM   10343 N  N   . THR C 1 288 ? 3.957   -17.911 50.973  1.00 51.02 ? 291  THR C N   1 
ATOM   10344 C  CA  . THR C 1 288 ? 3.328   -18.454 52.175  1.00 50.57 ? 291  THR C CA  1 
ATOM   10345 C  C   . THR C 1 288 ? 3.440   -17.585 53.418  1.00 50.26 ? 291  THR C C   1 
ATOM   10346 O  O   . THR C 1 288 ? 2.782   -17.853 54.429  1.00 50.39 ? 291  THR C O   1 
ATOM   10347 C  CB  . THR C 1 288 ? 3.921   -19.833 52.519  1.00 50.73 ? 291  THR C CB  1 
ATOM   10348 O  OG1 . THR C 1 288 ? 5.220   -19.663 53.109  1.00 50.54 ? 291  THR C OG1 1 
ATOM   10349 C  CG2 . THR C 1 288 ? 4.038   -20.692 51.250  1.00 50.62 ? 291  THR C CG2 1 
ATOM   10350 N  N   . PHE C 1 289 ? 4.291   -16.567 53.356  1.00 49.65 ? 292  PHE C N   1 
ATOM   10351 C  CA  . PHE C 1 289 ? 4.498   -15.679 54.492  1.00 48.93 ? 292  PHE C CA  1 
ATOM   10352 C  C   . PHE C 1 289 ? 3.161   -15.122 55.002  1.00 48.51 ? 292  PHE C C   1 
ATOM   10353 O  O   . PHE C 1 289 ? 2.322   -14.671 54.221  1.00 48.57 ? 292  PHE C O   1 
ATOM   10354 C  CB  . PHE C 1 289 ? 5.462   -14.553 54.099  1.00 48.70 ? 292  PHE C CB  1 
ATOM   10355 C  CG  . PHE C 1 289 ? 6.095   -13.857 55.269  1.00 48.49 ? 292  PHE C CG  1 
ATOM   10356 C  CD1 . PHE C 1 289 ? 5.903   -12.499 55.474  1.00 48.45 ? 292  PHE C CD1 1 
ATOM   10357 C  CD2 . PHE C 1 289 ? 6.896   -14.555 56.161  1.00 48.40 ? 292  PHE C CD2 1 
ATOM   10358 C  CE1 . PHE C 1 289 ? 6.504   -11.846 56.554  1.00 48.42 ? 292  PHE C CE1 1 
ATOM   10359 C  CE2 . PHE C 1 289 ? 7.498   -13.908 57.242  1.00 48.23 ? 292  PHE C CE2 1 
ATOM   10360 C  CZ  . PHE C 1 289 ? 7.301   -12.554 57.436  1.00 48.21 ? 292  PHE C CZ  1 
ATOM   10361 N  N   . PRO C 1 290 ? 2.916   -15.229 56.316  1.00 48.09 ? 293  PRO C N   1 
ATOM   10362 C  CA  . PRO C 1 290 ? 1.688   -14.748 56.963  1.00 47.57 ? 293  PRO C CA  1 
ATOM   10363 C  C   . PRO C 1 290 ? 1.423   -13.251 56.828  1.00 46.93 ? 293  PRO C C   1 
ATOM   10364 O  O   . PRO C 1 290 ? 0.352   -12.778 57.206  1.00 46.99 ? 293  PRO C O   1 
ATOM   10365 C  CB  . PRO C 1 290 ? 1.894   -15.149 58.421  1.00 47.85 ? 293  PRO C CB  1 
ATOM   10366 C  CG  . PRO C 1 290 ? 2.681   -16.421 58.296  1.00 48.16 ? 293  PRO C CG  1 
ATOM   10367 C  CD  . PRO C 1 290 ? 3.714   -16.033 57.258  1.00 48.20 ? 293  PRO C CD  1 
ATOM   10368 N  N   . PHE C 1 291 ? 2.410   -12.498 56.353  1.00 46.12 ? 294  PHE C N   1 
ATOM   10369 C  CA  . PHE C 1 291 ? 2.244   -11.058 56.145  1.00 45.23 ? 294  PHE C CA  1 
ATOM   10370 C  C   . PHE C 1 291 ? 2.847   -10.734 54.795  1.00 44.31 ? 294  PHE C C   1 
ATOM   10371 O  O   . PHE C 1 291 ? 3.343   -11.615 54.098  1.00 44.20 ? 294  PHE C O   1 
ATOM   10372 C  CB  . PHE C 1 291 ? 3.002   -10.236 57.192  1.00 45.74 ? 294  PHE C CB  1 
ATOM   10373 C  CG  . PHE C 1 291 ? 2.664   -10.580 58.612  1.00 46.16 ? 294  PHE C CG  1 
ATOM   10374 C  CD1 . PHE C 1 291 ? 1.571   -9.995  59.241  1.00 46.32 ? 294  PHE C CD1 1 
ATOM   10375 C  CD2 . PHE C 1 291 ? 3.450   -11.481 59.326  1.00 46.25 ? 294  PHE C CD2 1 
ATOM   10376 C  CE1 . PHE C 1 291 ? 1.261   -10.304 60.564  1.00 46.43 ? 294  PHE C CE1 1 
ATOM   10377 C  CE2 . PHE C 1 291 ? 3.150   -11.797 60.648  1.00 46.33 ? 294  PHE C CE2 1 
ATOM   10378 C  CZ  . PHE C 1 291 ? 2.055   -11.208 61.267  1.00 46.40 ? 294  PHE C CZ  1 
ATOM   10379 N  N   . ASN C 1 292 ? 2.792   -9.469  54.415  1.00 43.21 ? 295  ASN C N   1 
ATOM   10380 C  CA  . ASN C 1 292 ? 3.393   -9.051  53.164  1.00 42.16 ? 295  ASN C CA  1 
ATOM   10381 C  C   . ASN C 1 292 ? 4.903   -8.972  53.441  1.00 41.61 ? 295  ASN C C   1 
ATOM   10382 O  O   . ASN C 1 292 ? 5.344   -8.201  54.287  1.00 41.62 ? 295  ASN C O   1 
ATOM   10383 C  CB  . ASN C 1 292 ? 2.841   -7.686  52.771  1.00 41.99 ? 295  ASN C CB  1 
ATOM   10384 C  CG  . ASN C 1 292 ? 3.483   -7.129  51.525  1.00 41.86 ? 295  ASN C CG  1 
ATOM   10385 O  OD1 . ASN C 1 292 ? 3.119   -6.049  51.069  1.00 42.07 ? 295  ASN C OD1 1 
ATOM   10386 N  ND2 . ASN C 1 292 ? 4.438   -7.855  50.965  1.00 41.69 ? 295  ASN C ND2 1 
ATOM   10387 N  N   . PRO C 1 293 ? 5.715   -9.790  52.750  1.00 40.99 ? 296  PRO C N   1 
ATOM   10388 C  CA  . PRO C 1 293 ? 7.160   -9.751  52.983  1.00 40.43 ? 296  PRO C CA  1 
ATOM   10389 C  C   . PRO C 1 293 ? 7.812   -8.443  52.568  1.00 40.07 ? 296  PRO C C   1 
ATOM   10390 O  O   . PRO C 1 293 ? 8.990   -8.219  52.843  1.00 40.04 ? 296  PRO C O   1 
ATOM   10391 C  CB  . PRO C 1 293 ? 7.670   -10.922 52.144  1.00 40.51 ? 296  PRO C CB  1 
ATOM   10392 C  CG  . PRO C 1 293 ? 6.703   -10.995 51.034  1.00 40.52 ? 296  PRO C CG  1 
ATOM   10393 C  CD  . PRO C 1 293 ? 5.386   -10.812 51.742  1.00 40.88 ? 296  PRO C CD  1 
ATOM   10394 N  N   . PHE C 1 294 ? 7.040   -7.578  51.918  1.00 39.66 ? 297  PHE C N   1 
ATOM   10395 C  CA  . PHE C 1 294 ? 7.546   -6.291  51.460  1.00 39.19 ? 297  PHE C CA  1 
ATOM   10396 C  C   . PHE C 1 294 ? 6.962   -5.127  52.247  1.00 38.84 ? 297  PHE C C   1 
ATOM   10397 O  O   . PHE C 1 294 ? 7.104   -3.976  51.848  1.00 38.82 ? 297  PHE C O   1 
ATOM   10398 C  CB  . PHE C 1 294 ? 7.260   -6.118  49.974  1.00 39.06 ? 297  PHE C CB  1 
ATOM   10399 C  CG  . PHE C 1 294 ? 7.598   -7.323  49.159  1.00 39.10 ? 297  PHE C CG  1 
ATOM   10400 C  CD1 . PHE C 1 294 ? 8.900   -7.800  49.107  1.00 39.09 ? 297  PHE C CD1 1 
ATOM   10401 C  CD2 . PHE C 1 294 ? 6.610   -7.997  48.454  1.00 39.12 ? 297  PHE C CD2 1 
ATOM   10402 C  CE1 . PHE C 1 294 ? 9.216   -8.938  48.359  1.00 39.07 ? 297  PHE C CE1 1 
ATOM   10403 C  CE2 . PHE C 1 294 ? 6.916   -9.134  47.704  1.00 39.14 ? 297  PHE C CE2 1 
ATOM   10404 C  CZ  . PHE C 1 294 ? 8.222   -9.603  47.659  1.00 39.06 ? 297  PHE C CZ  1 
ATOM   10405 N  N   . ASP C 1 295 ? 6.273   -5.442  53.340  1.00 38.47 ? 298  ASP C N   1 
ATOM   10406 C  CA  . ASP C 1 295 ? 5.676   -4.443  54.223  1.00 38.22 ? 298  ASP C CA  1 
ATOM   10407 C  C   . ASP C 1 295 ? 6.806   -3.988  55.148  1.00 38.14 ? 298  ASP C C   1 
ATOM   10408 O  O   . ASP C 1 295 ? 7.336   -4.792  55.923  1.00 38.30 ? 298  ASP C O   1 
ATOM   10409 C  CB  . ASP C 1 295 ? 4.547   -5.098  55.032  1.00 38.34 ? 298  ASP C CB  1 
ATOM   10410 C  CG  . ASP C 1 295 ? 3.840   -4.137  55.986  1.00 38.43 ? 298  ASP C CG  1 
ATOM   10411 O  OD1 . ASP C 1 295 ? 2.795   -4.536  56.539  1.00 38.60 ? 298  ASP C OD1 1 
ATOM   10412 O  OD2 . ASP C 1 295 ? 4.312   -3.000  56.205  1.00 38.76 ? 298  ASP C OD2 1 
ATOM   10413 N  N   . LEU C 1 296 ? 7.171   -2.709  55.085  1.00 37.76 ? 299  LEU C N   1 
ATOM   10414 C  CA  . LEU C 1 296 ? 8.262   -2.203  55.912  1.00 37.42 ? 299  LEU C CA  1 
ATOM   10415 C  C   . LEU C 1 296 ? 7.969   -2.147  57.405  1.00 37.50 ? 299  LEU C C   1 
ATOM   10416 O  O   . LEU C 1 296 ? 8.870   -1.893  58.198  1.00 37.32 ? 299  LEU C O   1 
ATOM   10417 C  CB  . LEU C 1 296 ? 8.735   -0.844  55.409  1.00 37.07 ? 299  LEU C CB  1 
ATOM   10418 C  CG  . LEU C 1 296 ? 10.053  -0.325  55.986  1.00 36.76 ? 299  LEU C CG  1 
ATOM   10419 C  CD1 . LEU C 1 296 ? 11.181  -1.310  55.721  1.00 36.60 ? 299  LEU C CD1 1 
ATOM   10420 C  CD2 . LEU C 1 296 ? 10.370  1.020   55.371  1.00 36.66 ? 299  LEU C CD2 1 
ATOM   10421 N  N   . THR C 1 297 ? 6.720   -2.393  57.794  1.00 37.58 ? 300  THR C N   1 
ATOM   10422 C  CA  . THR C 1 297 ? 6.352   -2.385  59.210  1.00 37.80 ? 300  THR C CA  1 
ATOM   10423 C  C   . THR C 1 297 ? 6.413   -3.796  59.813  1.00 38.17 ? 300  THR C C   1 
ATOM   10424 O  O   . THR C 1 297 ? 6.029   -4.009  60.970  1.00 38.17 ? 300  THR C O   1 
ATOM   10425 C  CB  . THR C 1 297 ? 4.940   -1.807  59.431  1.00 37.60 ? 300  THR C CB  1 
ATOM   10426 O  OG1 . THR C 1 297 ? 3.965   -2.658  58.815  1.00 37.37 ? 300  THR C OG1 1 
ATOM   10427 C  CG2 . THR C 1 297 ? 4.839   -0.420  58.836  1.00 37.25 ? 300  THR C CG2 1 
ATOM   10428 N  N   . LYS C 1 298 ? 6.925   -4.744  59.030  1.00 38.40 ? 301  LYS C N   1 
ATOM   10429 C  CA  . LYS C 1 298 ? 7.043   -6.139  59.446  1.00 38.61 ? 301  LYS C CA  1 
ATOM   10430 C  C   . LYS C 1 298 ? 8.483   -6.645  59.397  1.00 38.88 ? 301  LYS C C   1 
ATOM   10431 O  O   . LYS C 1 298 ? 9.264   -6.237  58.541  1.00 38.91 ? 301  LYS C O   1 
ATOM   10432 C  CB  . LYS C 1 298 ? 6.204   -7.033  58.523  1.00 38.45 ? 301  LYS C CB  1 
ATOM   10433 C  CG  . LYS C 1 298 ? 4.741   -6.659  58.402  1.00 38.33 ? 301  LYS C CG  1 
ATOM   10434 C  CD  . LYS C 1 298 ? 3.986   -6.857  59.702  1.00 38.14 ? 301  LYS C CD  1 
ATOM   10435 C  CE  . LYS C 1 298 ? 2.503   -6.561  59.523  1.00 38.05 ? 301  LYS C CE  1 
ATOM   10436 N  NZ  . LYS C 1 298 ? 2.243   -5.142  59.149  1.00 37.86 ? 301  LYS C NZ  1 
ATOM   10437 N  N   . VAL C 1 299 ? 8.820   -7.549  60.313  1.00 39.05 ? 302  VAL C N   1 
ATOM   10438 C  CA  . VAL C 1 299 ? 10.146  -8.162  60.363  1.00 39.15 ? 302  VAL C CA  1 
ATOM   10439 C  C   . VAL C 1 299 ? 9.957   -9.623  59.998  1.00 39.44 ? 302  VAL C C   1 
ATOM   10440 O  O   . VAL C 1 299 ? 8.827   -10.110 59.975  1.00 39.49 ? 302  VAL C O   1 
ATOM   10441 C  CB  . VAL C 1 299 ? 10.760  -8.130  61.786  1.00 39.10 ? 302  VAL C CB  1 
ATOM   10442 C  CG1 . VAL C 1 299 ? 10.971  -6.713  62.245  1.00 38.98 ? 302  VAL C CG1 1 
ATOM   10443 C  CG2 . VAL C 1 299 ? 9.871   -8.876  62.775  1.00 38.89 ? 302  VAL C CG2 1 
ATOM   10444 N  N   . TRP C 1 300 ? 11.049  -10.306 59.668  1.00 39.74 ? 303  TRP C N   1 
ATOM   10445 C  CA  . TRP C 1 300 ? 10.988  -11.733 59.354  1.00 40.03 ? 303  TRP C CA  1 
ATOM   10446 C  C   . TRP C 1 300 ? 11.498  -12.413 60.610  1.00 40.57 ? 303  TRP C C   1 
ATOM   10447 O  O   . TRP C 1 300 ? 12.678  -12.285 60.947  1.00 40.75 ? 303  TRP C O   1 
ATOM   10448 C  CB  . TRP C 1 300 ? 11.922  -12.102 58.203  1.00 39.58 ? 303  TRP C CB  1 
ATOM   10449 C  CG  . TRP C 1 300 ? 11.549  -11.574 56.861  1.00 39.17 ? 303  TRP C CG  1 
ATOM   10450 C  CD1 . TRP C 1 300 ? 10.426  -10.873 56.522  1.00 38.96 ? 303  TRP C CD1 1 
ATOM   10451 C  CD2 . TRP C 1 300 ? 12.320  -11.698 55.667  1.00 38.95 ? 303  TRP C CD2 1 
ATOM   10452 N  NE1 . TRP C 1 300 ? 10.455  -10.551 55.187  1.00 38.82 ? 303  TRP C NE1 1 
ATOM   10453 C  CE2 . TRP C 1 300 ? 11.609  -11.046 54.638  1.00 38.99 ? 303  TRP C CE2 1 
ATOM   10454 C  CE3 . TRP C 1 300 ? 13.550  -12.297 55.365  1.00 38.91 ? 303  TRP C CE3 1 
ATOM   10455 C  CZ2 . TRP C 1 300 ? 12.086  -10.976 53.328  1.00 38.96 ? 303  TRP C CZ2 1 
ATOM   10456 C  CZ3 . TRP C 1 300 ? 14.026  -12.227 54.060  1.00 38.82 ? 303  TRP C CZ3 1 
ATOM   10457 C  CH2 . TRP C 1 300 ? 13.294  -11.570 53.059  1.00 38.79 ? 303  TRP C CH2 1 
ATOM   10458 N  N   . PRO C 1 301 ? 10.624  -13.136 61.330  1.00 41.06 ? 304  PRO C N   1 
ATOM   10459 C  CA  . PRO C 1 301 ? 11.042  -13.818 62.560  1.00 41.32 ? 304  PRO C CA  1 
ATOM   10460 C  C   . PRO C 1 301 ? 12.308  -14.655 62.376  1.00 41.72 ? 304  PRO C C   1 
ATOM   10461 O  O   . PRO C 1 301 ? 12.426  -15.428 61.426  1.00 41.70 ? 304  PRO C O   1 
ATOM   10462 C  CB  . PRO C 1 301 ? 9.825   -14.673 62.891  1.00 41.33 ? 304  PRO C CB  1 
ATOM   10463 C  CG  . PRO C 1 301 ? 8.689   -13.818 62.407  1.00 41.14 ? 304  PRO C CG  1 
ATOM   10464 C  CD  . PRO C 1 301 ? 9.198   -13.388 61.055  1.00 41.10 ? 304  PRO C CD  1 
ATOM   10465 N  N   . HIS C 1 302 ? 13.270  -14.444 63.267  1.00 42.24 ? 305  HIS C N   1 
ATOM   10466 C  CA  . HIS C 1 302 ? 14.543  -15.151 63.234  1.00 42.95 ? 305  HIS C CA  1 
ATOM   10467 C  C   . HIS C 1 302 ? 14.367  -16.659 63.279  1.00 43.37 ? 305  HIS C C   1 
ATOM   10468 O  O   . HIS C 1 302 ? 15.176  -17.410 62.730  1.00 43.32 ? 305  HIS C O   1 
ATOM   10469 C  CB  . HIS C 1 302 ? 15.401  -14.735 64.424  1.00 42.96 ? 305  HIS C CB  1 
ATOM   10470 C  CG  . HIS C 1 302 ? 15.879  -13.319 64.367  1.00 43.16 ? 305  HIS C CG  1 
ATOM   10471 N  ND1 . HIS C 1 302 ? 15.849  -12.483 65.462  1.00 43.24 ? 305  HIS C ND1 1 
ATOM   10472 C  CD2 . HIS C 1 302 ? 16.452  -12.610 63.367  1.00 43.21 ? 305  HIS C CD2 1 
ATOM   10473 C  CE1 . HIS C 1 302 ? 16.390  -11.321 65.141  1.00 43.33 ? 305  HIS C CE1 1 
ATOM   10474 N  NE2 . HIS C 1 302 ? 16.764  -11.372 63.876  1.00 43.36 ? 305  HIS C NE2 1 
ATOM   10475 N  N   . LYS C 1 303 ? 13.330  -17.100 63.981  1.00 43.89 ? 306  LYS C N   1 
ATOM   10476 C  CA  . LYS C 1 303 ? 13.053  -18.515 64.104  1.00 44.37 ? 306  LYS C CA  1 
ATOM   10477 C  C   . LYS C 1 303 ? 12.899  -19.133 62.729  1.00 44.10 ? 306  LYS C C   1 
ATOM   10478 O  O   . LYS C 1 303 ? 13.555  -20.116 62.396  1.00 44.08 ? 306  LYS C O   1 
ATOM   10479 C  CB  . LYS C 1 303 ? 11.771  -18.741 64.900  1.00 45.42 ? 306  LYS C CB  1 
ATOM   10480 C  CG  . LYS C 1 303 ? 11.433  -20.227 65.056  1.00 46.98 ? 306  LYS C CG  1 
ATOM   10481 C  CD  . LYS C 1 303 ? 10.128  -20.477 65.820  1.00 48.21 ? 306  LYS C CD  1 
ATOM   10482 C  CE  . LYS C 1 303 ? 9.894   -21.987 66.023  1.00 48.96 ? 306  LYS C CE  1 
ATOM   10483 N  NZ  . LYS C 1 303 ? 8.678   -22.284 66.860  1.00 49.75 ? 306  LYS C NZ  1 
ATOM   10484 N  N   . ASP C 1 304 ? 12.051  -18.515 61.920  1.00 43.93 ? 307  ASP C N   1 
ATOM   10485 C  CA  . ASP C 1 304 ? 11.763  -18.992 60.575  1.00 43.62 ? 307  ASP C CA  1 
ATOM   10486 C  C   . ASP C 1 304 ? 12.799  -18.587 59.533  1.00 43.05 ? 307  ASP C C   1 
ATOM   10487 O  O   . ASP C 1 304 ? 12.995  -19.295 58.547  1.00 42.88 ? 307  ASP C O   1 
ATOM   10488 C  CB  . ASP C 1 304 ? 10.371  -18.510 60.169  1.00 44.19 ? 307  ASP C CB  1 
ATOM   10489 C  CG  . ASP C 1 304 ? 9.331   -18.813 61.232  1.00 44.70 ? 307  ASP C CG  1 
ATOM   10490 O  OD1 . ASP C 1 304 ? 8.849   -17.867 61.896  1.00 45.04 ? 307  ASP C OD1 1 
ATOM   10491 O  OD2 . ASP C 1 304 ? 9.023   -20.008 61.427  1.00 45.13 ? 307  ASP C OD2 1 
ATOM   10492 N  N   . TYR C 1 305 ? 13.463  -17.454 59.764  1.00 42.39 ? 308  TYR C N   1 
ATOM   10493 C  CA  . TYR C 1 305 ? 14.486  -16.934 58.858  1.00 41.57 ? 308  TYR C CA  1 
ATOM   10494 C  C   . TYR C 1 305 ? 15.722  -16.539 59.656  1.00 41.16 ? 308  TYR C C   1 
ATOM   10495 O  O   . TYR C 1 305 ? 15.914  -15.375 60.012  1.00 41.13 ? 308  TYR C O   1 
ATOM   10496 C  CB  . TYR C 1 305 ? 13.932  -15.743 58.087  1.00 41.36 ? 308  TYR C CB  1 
ATOM   10497 C  CG  . TYR C 1 305 ? 12.718  -16.125 57.299  1.00 41.28 ? 308  TYR C CG  1 
ATOM   10498 C  CD1 . TYR C 1 305 ? 12.840  -16.668 56.025  1.00 41.22 ? 308  TYR C CD1 1 
ATOM   10499 C  CD2 . TYR C 1 305 ? 11.450  -16.031 57.856  1.00 41.28 ? 308  TYR C CD2 1 
ATOM   10500 C  CE1 . TYR C 1 305 ? 11.734  -17.116 55.329  1.00 41.20 ? 308  TYR C CE1 1 
ATOM   10501 C  CE2 . TYR C 1 305 ? 10.336  -16.478 57.168  1.00 41.38 ? 308  TYR C CE2 1 
ATOM   10502 C  CZ  . TYR C 1 305 ? 10.486  -17.021 55.906  1.00 41.35 ? 308  TYR C CZ  1 
ATOM   10503 O  OH  . TYR C 1 305 ? 9.384   -17.478 55.225  1.00 41.63 ? 308  TYR C OH  1 
ATOM   10504 N  N   . PRO C 1 306 ? 16.584  -17.522 59.939  1.00 40.75 ? 309  PRO C N   1 
ATOM   10505 C  CA  . PRO C 1 306 ? 17.831  -17.402 60.695  1.00 40.39 ? 309  PRO C CA  1 
ATOM   10506 C  C   . PRO C 1 306 ? 18.823  -16.444 60.079  1.00 39.97 ? 309  PRO C C   1 
ATOM   10507 O  O   . PRO C 1 306 ? 18.902  -16.329 58.860  1.00 40.01 ? 309  PRO C O   1 
ATOM   10508 C  CB  . PRO C 1 306 ? 18.389  -18.823 60.647  1.00 40.50 ? 309  PRO C CB  1 
ATOM   10509 C  CG  . PRO C 1 306 ? 17.178  -19.670 60.466  1.00 40.63 ? 309  PRO C CG  1 
ATOM   10510 C  CD  . PRO C 1 306 ? 16.419  -18.897 59.444  1.00 40.70 ? 309  PRO C CD  1 
ATOM   10511 N  N   . LEU C 1 307 ? 19.590  -15.765 60.923  1.00 39.61 ? 310  LEU C N   1 
ATOM   10512 C  CA  . LEU C 1 307 ? 20.606  -14.854 60.425  1.00 39.12 ? 310  LEU C CA  1 
ATOM   10513 C  C   . LEU C 1 307 ? 21.737  -15.691 59.863  1.00 38.77 ? 310  LEU C C   1 
ATOM   10514 O  O   . LEU C 1 307 ? 22.199  -16.645 60.491  1.00 38.93 ? 310  LEU C O   1 
ATOM   10515 C  CB  . LEU C 1 307 ? 21.155  -13.965 61.532  1.00 39.10 ? 310  LEU C CB  1 
ATOM   10516 C  CG  . LEU C 1 307 ? 20.221  -12.938 62.156  1.00 39.08 ? 310  LEU C CG  1 
ATOM   10517 C  CD1 . LEU C 1 307 ? 20.974  -12.209 63.254  1.00 39.25 ? 310  LEU C CD1 1 
ATOM   10518 C  CD2 . LEU C 1 307 ? 19.727  -11.965 61.108  1.00 39.01 ? 310  LEU C CD2 1 
ATOM   10519 N  N   . ILE C 1 308 ? 22.152  -15.341 58.659  1.00 38.29 ? 311  ILE C N   1 
ATOM   10520 C  CA  . ILE C 1 308 ? 23.223  -16.032 57.978  1.00 37.77 ? 311  ILE C CA  1 
ATOM   10521 C  C   . ILE C 1 308 ? 24.385  -15.054 57.944  1.00 37.54 ? 311  ILE C C   1 
ATOM   10522 O  O   . ILE C 1 308 ? 24.263  -13.953 57.418  1.00 37.50 ? 311  ILE C O   1 
ATOM   10523 C  CB  . ILE C 1 308 ? 22.782  -16.395 56.554  1.00 37.66 ? 311  ILE C CB  1 
ATOM   10524 C  CG1 . ILE C 1 308 ? 21.553  -17.303 56.622  1.00 37.63 ? 311  ILE C CG1 1 
ATOM   10525 C  CG2 . ILE C 1 308 ? 23.907  -17.053 55.791  1.00 37.54 ? 311  ILE C CG2 1 
ATOM   10526 C  CD1 . ILE C 1 308 ? 20.870  -17.512 55.291  1.00 37.64 ? 311  ILE C CD1 1 
ATOM   10527 N  N   . PRO C 1 309 ? 25.511  -15.420 58.566  1.00 37.28 ? 312  PRO C N   1 
ATOM   10528 C  CA  . PRO C 1 309 ? 26.703  -14.566 58.607  1.00 37.11 ? 312  PRO C CA  1 
ATOM   10529 C  C   . PRO C 1 309 ? 27.291  -14.318 57.227  1.00 36.94 ? 312  PRO C C   1 
ATOM   10530 O  O   . PRO C 1 309 ? 27.253  -15.195 56.369  1.00 36.90 ? 312  PRO C O   1 
ATOM   10531 C  CB  . PRO C 1 309 ? 27.654  -15.361 59.494  1.00 37.19 ? 312  PRO C CB  1 
ATOM   10532 C  CG  . PRO C 1 309 ? 27.222  -16.779 59.272  1.00 37.25 ? 312  PRO C CG  1 
ATOM   10533 C  CD  . PRO C 1 309 ? 25.736  -16.670 59.310  1.00 37.30 ? 312  PRO C CD  1 
ATOM   10534 N  N   . VAL C 1 310 ? 27.818  -13.116 57.012  1.00 36.76 ? 313  VAL C N   1 
ATOM   10535 C  CA  . VAL C 1 310 ? 28.397  -12.760 55.724  1.00 36.54 ? 313  VAL C CA  1 
ATOM   10536 C  C   . VAL C 1 310 ? 29.769  -12.124 55.844  1.00 36.41 ? 313  VAL C C   1 
ATOM   10537 O  O   . VAL C 1 310 ? 30.694  -12.501 55.128  1.00 36.39 ? 313  VAL C O   1 
ATOM   10538 C  CB  . VAL C 1 310 ? 27.512  -11.764 54.965  1.00 36.60 ? 313  VAL C CB  1 
ATOM   10539 C  CG1 . VAL C 1 310 ? 28.123  -11.465 53.608  1.00 36.49 ? 313  VAL C CG1 1 
ATOM   10540 C  CG2 . VAL C 1 310 ? 26.103  -12.308 54.806  1.00 36.67 ? 313  VAL C CG2 1 
ATOM   10541 N  N   . GLY C 1 311 ? 29.888  -11.127 56.716  1.00 36.34 ? 314  GLY C N   1 
ATOM   10542 C  CA  . GLY C 1 311 ? 31.161  -10.450 56.873  1.00 36.15 ? 314  GLY C CA  1 
ATOM   10543 C  C   . GLY C 1 311 ? 31.247  -9.496  58.041  1.00 36.00 ? 314  GLY C C   1 
ATOM   10544 O  O   . GLY C 1 311 ? 30.493  -9.612  59.006  1.00 36.18 ? 314  GLY C O   1 
ATOM   10545 N  N   . LYS C 1 312 ? 32.173  -8.549  57.948  1.00 35.87 ? 315  LYS C N   1 
ATOM   10546 C  CA  . LYS C 1 312 ? 32.391  -7.577  59.005  1.00 35.57 ? 315  LYS C CA  1 
ATOM   10547 C  C   . LYS C 1 312 ? 32.495  -6.171  58.469  1.00 35.59 ? 315  LYS C C   1 
ATOM   10548 O  O   . LYS C 1 312 ? 32.961  -5.954  57.352  1.00 35.57 ? 315  LYS C O   1 
ATOM   10549 C  CB  . LYS C 1 312 ? 33.693  -7.887  59.729  1.00 35.44 ? 315  LYS C CB  1 
ATOM   10550 C  CG  . LYS C 1 312 ? 33.644  -9.093  60.604  1.00 35.75 ? 315  LYS C CG  1 
ATOM   10551 C  CD  . LYS C 1 312 ? 33.030  -8.762  61.947  1.00 36.06 ? 315  LYS C CD  1 
ATOM   10552 C  CE  . LYS C 1 312 ? 32.959  -10.010 62.804  1.00 36.22 ? 315  LYS C CE  1 
ATOM   10553 N  NZ  . LYS C 1 312 ? 32.733  -9.642  64.217  1.00 36.52 ? 315  LYS C NZ  1 
ATOM   10554 N  N   . LEU C 1 313 ? 32.052  -5.218  59.283  1.00 35.33 ? 316  LEU C N   1 
ATOM   10555 C  CA  . LEU C 1 313 ? 32.134  -3.804  58.951  1.00 35.19 ? 316  LEU C CA  1 
ATOM   10556 C  C   . LEU C 1 313 ? 33.082  -3.239  59.987  1.00 35.31 ? 316  LEU C C   1 
ATOM   10557 O  O   . LEU C 1 313 ? 32.837  -3.378  61.184  1.00 35.40 ? 316  LEU C O   1 
ATOM   10558 C  CB  . LEU C 1 313 ? 30.774  -3.122  59.099  1.00 34.85 ? 316  LEU C CB  1 
ATOM   10559 C  CG  . LEU C 1 313 ? 29.687  -3.429  58.069  1.00 34.70 ? 316  LEU C CG  1 
ATOM   10560 C  CD1 . LEU C 1 313 ? 28.382  -2.808  58.519  1.00 34.43 ? 316  LEU C CD1 1 
ATOM   10561 C  CD2 . LEU C 1 313 ? 30.087  -2.919  56.691  1.00 34.35 ? 316  LEU C CD2 1 
ATOM   10562 N  N   . VAL C 1 314 ? 34.185  -2.651  59.540  1.00 35.31 ? 317  VAL C N   1 
ATOM   10563 C  CA  . VAL C 1 314 ? 35.155  -2.072  60.463  1.00 35.29 ? 317  VAL C CA  1 
ATOM   10564 C  C   . VAL C 1 314 ? 35.457  -0.615  60.129  1.00 35.43 ? 317  VAL C C   1 
ATOM   10565 O  O   . VAL C 1 314 ? 35.780  -0.275  58.991  1.00 35.34 ? 317  VAL C O   1 
ATOM   10566 C  CB  . VAL C 1 314 ? 36.469  -2.870  60.481  1.00 35.30 ? 317  VAL C CB  1 
ATOM   10567 C  CG1 . VAL C 1 314 ? 37.413  -2.305  61.526  1.00 35.15 ? 317  VAL C CG1 1 
ATOM   10568 C  CG2 . VAL C 1 314 ? 36.187  -4.325  60.774  1.00 35.24 ? 317  VAL C CG2 1 
ATOM   10569 N  N   . LEU C 1 315 ? 35.339  0.240   61.135  1.00 35.46 ? 318  LEU C N   1 
ATOM   10570 C  CA  . LEU C 1 315 ? 35.590  1.665   60.995  1.00 35.63 ? 318  LEU C CA  1 
ATOM   10571 C  C   . LEU C 1 315 ? 36.895  2.004   61.700  1.00 36.02 ? 318  LEU C C   1 
ATOM   10572 O  O   . LEU C 1 315 ? 36.954  2.012   62.933  1.00 35.93 ? 318  LEU C O   1 
ATOM   10573 C  CB  . LEU C 1 315 ? 34.438  2.448   61.622  1.00 35.36 ? 318  LEU C CB  1 
ATOM   10574 C  CG  . LEU C 1 315 ? 33.333  3.016   60.727  1.00 35.28 ? 318  LEU C CG  1 
ATOM   10575 C  CD1 . LEU C 1 315 ? 33.305  2.350   59.378  1.00 35.06 ? 318  LEU C CD1 1 
ATOM   10576 C  CD2 . LEU C 1 315 ? 31.992  2.919   61.442  1.00 35.19 ? 318  LEU C CD2 1 
ATOM   10577 N  N   . ASN C 1 316 ? 37.929  2.321   60.922  1.00 36.28 ? 319  ASN C N   1 
ATOM   10578 C  CA  . ASN C 1 316 ? 39.238  2.627   61.491  1.00 36.65 ? 319  ASN C CA  1 
ATOM   10579 C  C   . ASN C 1 316 ? 39.870  3.938   61.050  1.00 36.90 ? 319  ASN C C   1 
ATOM   10580 O  O   . ASN C 1 316 ? 41.075  4.135   61.240  1.00 36.95 ? 319  ASN C O   1 
ATOM   10581 C  CB  . ASN C 1 316 ? 40.211  1.488   61.192  1.00 36.61 ? 319  ASN C CB  1 
ATOM   10582 C  CG  . ASN C 1 316 ? 40.436  1.292   59.715  1.00 36.81 ? 319  ASN C CG  1 
ATOM   10583 O  OD1 . ASN C 1 316 ? 40.030  2.115   58.898  1.00 36.99 ? 319  ASN C OD1 1 
ATOM   10584 N  ND2 . ASN C 1 316 ? 41.087  0.195   59.358  1.00 37.01 ? 319  ASN C ND2 1 
ATOM   10585 N  N   . ARG C 1 317 ? 39.082  4.831   60.458  1.00 37.10 ? 320  ARG C N   1 
ATOM   10586 C  CA  . ARG C 1 317 ? 39.631  6.099   60.011  1.00 37.27 ? 320  ARG C CA  1 
ATOM   10587 C  C   . ARG C 1 317 ? 38.657  7.238   60.184  1.00 37.27 ? 320  ARG C C   1 
ATOM   10588 O  O   . ARG C 1 317 ? 37.521  7.168   59.724  1.00 37.36 ? 320  ARG C O   1 
ATOM   10589 C  CB  . ARG C 1 317 ? 40.046  6.017   58.549  1.00 37.47 ? 320  ARG C CB  1 
ATOM   10590 C  CG  . ARG C 1 317 ? 40.932  7.160   58.129  1.00 38.04 ? 320  ARG C CG  1 
ATOM   10591 C  CD  . ARG C 1 317 ? 41.380  7.014   56.699  1.00 38.66 ? 320  ARG C CD  1 
ATOM   10592 N  NE  . ARG C 1 317 ? 40.363  7.492   55.774  1.00 39.40 ? 320  ARG C NE  1 
ATOM   10593 C  CZ  . ARG C 1 317 ? 39.766  6.737   54.861  1.00 39.81 ? 320  ARG C CZ  1 
ATOM   10594 N  NH1 . ARG C 1 317 ? 40.082  5.454   54.745  1.00 40.03 ? 320  ARG C NH1 1 
ATOM   10595 N  NH2 . ARG C 1 317 ? 38.850  7.268   54.064  1.00 40.03 ? 320  ARG C NH2 1 
ATOM   10596 N  N   . ASN C 1 318 ? 39.098  8.281   60.873  1.00 37.16 ? 321  ASN C N   1 
ATOM   10597 C  CA  . ASN C 1 318 ? 38.272  9.455   61.091  1.00 36.94 ? 321  ASN C CA  1 
ATOM   10598 C  C   . ASN C 1 318 ? 38.370  10.323  59.856  1.00 36.71 ? 321  ASN C C   1 
ATOM   10599 O  O   . ASN C 1 318 ? 39.241  10.115  59.013  1.00 36.82 ? 321  ASN C O   1 
ATOM   10600 C  CB  . ASN C 1 318 ? 38.790  10.258  62.287  1.00 37.05 ? 321  ASN C CB  1 
ATOM   10601 C  CG  . ASN C 1 318 ? 38.306  9.718   63.614  1.00 37.14 ? 321  ASN C CG  1 
ATOM   10602 O  OD1 . ASN C 1 318 ? 37.130  9.394   63.775  1.00 37.32 ? 321  ASN C OD1 1 
ATOM   10603 N  ND2 . ASN C 1 318 ? 39.204  9.662   64.592  1.00 37.41 ? 321  ASN C ND2 1 
ATOM   10604 N  N   . PRO C 1 319 ? 37.439  11.272  59.697  1.00 36.54 ? 322  PRO C N   1 
ATOM   10605 C  CA  . PRO C 1 319 ? 37.476  12.163  58.534  1.00 36.26 ? 322  PRO C CA  1 
ATOM   10606 C  C   . PRO C 1 319 ? 38.588  13.170  58.785  1.00 36.13 ? 322  PRO C C   1 
ATOM   10607 O  O   . PRO C 1 319 ? 38.900  13.468  59.935  1.00 35.96 ? 322  PRO C O   1 
ATOM   10608 C  CB  . PRO C 1 319 ? 36.123  12.874  58.602  1.00 36.33 ? 322  PRO C CB  1 
ATOM   10609 C  CG  . PRO C 1 319 ? 35.256  11.927  59.384  1.00 36.57 ? 322  PRO C CG  1 
ATOM   10610 C  CD  . PRO C 1 319 ? 36.185  11.440  60.450  1.00 36.55 ? 322  PRO C CD  1 
ATOM   10611 N  N   . VAL C 1 320 ? 39.221  13.661  57.731  1.00 36.07 ? 323  VAL C N   1 
ATOM   10612 C  CA  . VAL C 1 320 ? 40.267  14.658  57.914  1.00 35.97 ? 323  VAL C CA  1 
ATOM   10613 C  C   . VAL C 1 320 ? 39.588  16.028  57.857  1.00 35.92 ? 323  VAL C C   1 
ATOM   10614 O  O   . VAL C 1 320 ? 39.944  16.934  58.601  1.00 35.96 ? 323  VAL C O   1 
ATOM   10615 C  CB  . VAL C 1 320 ? 41.378  14.527  56.857  1.00 35.96 ? 323  VAL C CB  1 
ATOM   10616 C  CG1 . VAL C 1 320 ? 42.520  15.465  57.180  1.00 35.76 ? 323  VAL C CG1 1 
ATOM   10617 C  CG2 . VAL C 1 320 ? 41.878  13.089  56.810  1.00 35.89 ? 323  VAL C CG2 1 
ATOM   10618 N  N   . ASN C 1 321 ? 38.585  16.158  56.995  1.00 35.76 ? 324  ASN C N   1 
ATOM   10619 C  CA  . ASN C 1 321 ? 37.819  17.399  56.881  1.00 35.64 ? 324  ASN C CA  1 
ATOM   10620 C  C   . ASN C 1 321 ? 36.334  17.026  56.886  1.00 35.56 ? 324  ASN C C   1 
ATOM   10621 O  O   . ASN C 1 321 ? 35.827  16.431  55.938  1.00 35.47 ? 324  ASN C O   1 
ATOM   10622 C  CB  . ASN C 1 321 ? 38.177  18.157  55.602  1.00 35.63 ? 324  ASN C CB  1 
ATOM   10623 C  CG  . ASN C 1 321 ? 37.494  19.504  55.521  1.00 35.57 ? 324  ASN C CG  1 
ATOM   10624 O  OD1 . ASN C 1 321 ? 36.351  19.611  55.071  1.00 35.74 ? 324  ASN C OD1 1 
ATOM   10625 N  ND2 . ASN C 1 321 ? 38.181  20.540  55.975  1.00 35.67 ? 324  ASN C ND2 1 
ATOM   10626 N  N   . TYR C 1 322 ? 35.642  17.371  57.964  1.00 35.32 ? 325  TYR C N   1 
ATOM   10627 C  CA  . TYR C 1 322 ? 34.233  17.035  58.108  1.00 35.30 ? 325  TYR C CA  1 
ATOM   10628 C  C   . TYR C 1 322 ? 33.303  17.462  56.963  1.00 35.43 ? 325  TYR C C   1 
ATOM   10629 O  O   . TYR C 1 322 ? 32.511  16.646  56.484  1.00 35.53 ? 325  TYR C O   1 
ATOM   10630 C  CB  . TYR C 1 322 ? 33.708  17.548  59.454  1.00 35.07 ? 325  TYR C CB  1 
ATOM   10631 C  CG  . TYR C 1 322 ? 32.294  17.125  59.767  1.00 34.92 ? 325  TYR C CG  1 
ATOM   10632 C  CD1 . TYR C 1 322 ? 32.035  16.025  60.581  1.00 34.82 ? 325  TYR C CD1 1 
ATOM   10633 C  CD2 . TYR C 1 322 ? 31.214  17.824  59.252  1.00 34.83 ? 325  TYR C CD2 1 
ATOM   10634 C  CE1 . TYR C 1 322 ? 30.726  15.637  60.871  1.00 34.84 ? 325  TYR C CE1 1 
ATOM   10635 C  CE2 . TYR C 1 322 ? 29.912  17.444  59.532  1.00 35.01 ? 325  TYR C CE2 1 
ATOM   10636 C  CZ  . TYR C 1 322 ? 29.672  16.355  60.340  1.00 35.01 ? 325  TYR C CZ  1 
ATOM   10637 O  OH  . TYR C 1 322 ? 28.369  16.006  60.615  1.00 35.12 ? 325  TYR C OH  1 
ATOM   10638 N  N   . PHE C 1 323 ? 33.380  18.720  56.526  1.00 35.20 ? 326  PHE C N   1 
ATOM   10639 C  CA  . PHE C 1 323 ? 32.507  19.196  55.452  1.00 35.06 ? 326  PHE C CA  1 
ATOM   10640 C  C   . PHE C 1 323 ? 32.683  18.409  54.168  1.00 35.08 ? 326  PHE C C   1 
ATOM   10641 O  O   . PHE C 1 323 ? 31.712  17.940  53.578  1.00 35.12 ? 326  PHE C O   1 
ATOM   10642 C  CB  . PHE C 1 323 ? 32.753  20.679  55.163  1.00 34.78 ? 326  PHE C CB  1 
ATOM   10643 C  CG  . PHE C 1 323 ? 31.829  21.257  54.123  1.00 34.51 ? 326  PHE C CG  1 
ATOM   10644 C  CD1 . PHE C 1 323 ? 32.211  21.325  52.788  1.00 34.28 ? 326  PHE C CD1 1 
ATOM   10645 C  CD2 . PHE C 1 323 ? 30.566  21.717  54.476  1.00 34.22 ? 326  PHE C CD2 1 
ATOM   10646 C  CE1 . PHE C 1 323 ? 31.350  21.836  51.829  1.00 33.95 ? 326  PHE C CE1 1 
ATOM   10647 C  CE2 . PHE C 1 323 ? 29.706  22.226  53.524  1.00 34.01 ? 326  PHE C CE2 1 
ATOM   10648 C  CZ  . PHE C 1 323 ? 30.100  22.286  52.199  1.00 33.94 ? 326  PHE C CZ  1 
ATOM   10649 N  N   . ALA C 1 324 ? 33.935  18.273  53.748  1.00 35.12 ? 327  ALA C N   1 
ATOM   10650 C  CA  . ALA C 1 324 ? 34.281  17.575  52.522  1.00 35.04 ? 327  ALA C CA  1 
ATOM   10651 C  C   . ALA C 1 324 ? 33.955  16.088  52.516  1.00 35.25 ? 327  ALA C C   1 
ATOM   10652 O  O   . ALA C 1 324 ? 33.487  15.565  51.500  1.00 35.18 ? 327  ALA C O   1 
ATOM   10653 C  CB  . ALA C 1 324 ? 35.753  17.783  52.211  1.00 34.73 ? 327  ALA C CB  1 
ATOM   10654 N  N   . GLU C 1 325 ? 34.176  15.413  53.643  1.00 35.27 ? 328  GLU C N   1 
ATOM   10655 C  CA  . GLU C 1 325 ? 33.935  13.973  53.733  1.00 35.32 ? 328  GLU C CA  1 
ATOM   10656 C  C   . GLU C 1 325 ? 32.658  13.500  54.404  1.00 35.34 ? 328  GLU C C   1 
ATOM   10657 O  O   . GLU C 1 325 ? 32.251  12.363  54.199  1.00 35.30 ? 328  GLU C O   1 
ATOM   10658 C  CB  . GLU C 1 325 ? 35.106  13.296  54.420  1.00 35.67 ? 328  GLU C CB  1 
ATOM   10659 C  CG  . GLU C 1 325 ? 36.434  13.530  53.753  1.00 36.20 ? 328  GLU C CG  1 
ATOM   10660 C  CD  . GLU C 1 325 ? 37.571  13.014  54.597  1.00 36.68 ? 328  GLU C CD  1 
ATOM   10661 O  OE1 . GLU C 1 325 ? 37.634  11.783  54.822  1.00 37.01 ? 328  GLU C OE1 1 
ATOM   10662 O  OE2 . GLU C 1 325 ? 38.391  13.840  55.054  1.00 36.83 ? 328  GLU C OE2 1 
ATOM   10663 N  N   . VAL C 1 326 ? 32.043  14.331  55.235  1.00 35.18 ? 329  VAL C N   1 
ATOM   10664 C  CA  . VAL C 1 326 ? 30.819  13.914  55.916  1.00 34.99 ? 329  VAL C CA  1 
ATOM   10665 C  C   . VAL C 1 326 ? 29.590  14.705  55.485  1.00 35.20 ? 329  VAL C C   1 
ATOM   10666 O  O   . VAL C 1 326 ? 28.595  14.128  55.039  1.00 35.10 ? 329  VAL C O   1 
ATOM   10667 C  CB  . VAL C 1 326 ? 30.972  13.985  57.452  1.00 34.81 ? 329  VAL C CB  1 
ATOM   10668 C  CG1 . VAL C 1 326 ? 29.772  13.343  58.138  1.00 34.32 ? 329  VAL C CG1 1 
ATOM   10669 C  CG2 . VAL C 1 326 ? 32.263  13.308  57.878  1.00 34.36 ? 329  VAL C CG2 1 
ATOM   10670 N  N   . GLU C 1 327 ? 29.662  16.027  55.588  1.00 35.18 ? 330  GLU C N   1 
ATOM   10671 C  CA  . GLU C 1 327 ? 28.532  16.856  55.211  1.00 35.15 ? 330  GLU C CA  1 
ATOM   10672 C  C   . GLU C 1 327 ? 28.177  16.685  53.745  1.00 35.13 ? 330  GLU C C   1 
ATOM   10673 O  O   . GLU C 1 327 ? 26.998  16.639  53.391  1.00 35.11 ? 330  GLU C O   1 
ATOM   10674 C  CB  . GLU C 1 327 ? 28.812  18.322  55.527  1.00 35.48 ? 330  GLU C CB  1 
ATOM   10675 C  CG  . GLU C 1 327 ? 27.603  19.243  55.356  1.00 35.97 ? 330  GLU C CG  1 
ATOM   10676 C  CD  . GLU C 1 327 ? 26.416  18.876  56.248  1.00 36.32 ? 330  GLU C CD  1 
ATOM   10677 O  OE1 . GLU C 1 327 ? 25.277  19.216  55.869  1.00 36.66 ? 330  GLU C OE1 1 
ATOM   10678 O  OE2 . GLU C 1 327 ? 26.605  18.271  57.328  1.00 36.49 ? 330  GLU C OE2 1 
ATOM   10679 N  N   . GLN C 1 328 ? 29.196  16.542  52.902  1.00 34.89 ? 331  GLN C N   1 
ATOM   10680 C  CA  . GLN C 1 328 ? 28.977  16.368  51.469  1.00 34.61 ? 331  GLN C CA  1 
ATOM   10681 C  C   . GLN C 1 328 ? 28.748  14.941  50.984  1.00 34.60 ? 331  GLN C C   1 
ATOM   10682 O  O   . GLN C 1 328 ? 28.432  14.744  49.818  1.00 34.47 ? 331  GLN C O   1 
ATOM   10683 C  CB  . GLN C 1 328 ? 30.124  16.974  50.668  1.00 34.57 ? 331  GLN C CB  1 
ATOM   10684 C  CG  . GLN C 1 328 ? 30.094  18.477  50.606  1.00 34.49 ? 331  GLN C CG  1 
ATOM   10685 C  CD  . GLN C 1 328 ? 31.057  19.019  49.583  1.00 34.53 ? 331  GLN C CD  1 
ATOM   10686 O  OE1 . GLN C 1 328 ? 30.727  19.936  48.835  1.00 34.43 ? 331  GLN C OE1 1 
ATOM   10687 N  NE2 . GLN C 1 328 ? 32.251  18.441  49.528  1.00 34.39 ? 331  GLN C NE2 1 
ATOM   10688 N  N   . ILE C 1 329 ? 28.913  13.945  51.849  1.00 34.43 ? 332  ILE C N   1 
ATOM   10689 C  CA  . ILE C 1 329 ? 28.713  12.565  51.422  1.00 34.33 ? 332  ILE C CA  1 
ATOM   10690 C  C   . ILE C 1 329 ? 27.251  12.286  51.056  1.00 34.39 ? 332  ILE C C   1 
ATOM   10691 O  O   . ILE C 1 329 ? 26.327  12.771  51.718  1.00 34.34 ? 332  ILE C O   1 
ATOM   10692 C  CB  . ILE C 1 329 ? 29.209  11.567  52.474  1.00 34.48 ? 332  ILE C CB  1 
ATOM   10693 C  CG1 . ILE C 1 329 ? 29.382  10.194  51.834  1.00 34.25 ? 332  ILE C CG1 1 
ATOM   10694 C  CG2 . ILE C 1 329 ? 28.243  11.501  53.648  1.00 34.67 ? 332  ILE C CG2 1 
ATOM   10695 C  CD1 . ILE C 1 329 ? 30.137  9.216   52.689  1.00 34.22 ? 332  ILE C CD1 1 
ATOM   10696 N  N   . ALA C 1 330 ? 27.052  11.490  50.010  1.00 33.98 ? 333  ALA C N   1 
ATOM   10697 C  CA  . ALA C 1 330 ? 25.720  11.175  49.525  1.00 33.73 ? 333  ALA C CA  1 
ATOM   10698 C  C   . ALA C 1 330 ? 25.513  9.690   49.302  1.00 33.73 ? 333  ALA C C   1 
ATOM   10699 O  O   . ALA C 1 330 ? 26.279  9.051   48.580  1.00 33.59 ? 333  ALA C O   1 
ATOM   10700 C  CB  . ALA C 1 330 ? 25.462  11.920  48.235  1.00 33.66 ? 333  ALA C CB  1 
ATOM   10701 N  N   . PHE C 1 331 ? 24.450  9.158   49.903  1.00 33.65 ? 334  PHE C N   1 
ATOM   10702 C  CA  . PHE C 1 331 ? 24.107  7.747   49.772  1.00 33.62 ? 334  PHE C CA  1 
ATOM   10703 C  C   . PHE C 1 331 ? 22.797  7.602   48.995  1.00 33.75 ? 334  PHE C C   1 
ATOM   10704 O  O   . PHE C 1 331 ? 21.788  8.203   49.359  1.00 33.73 ? 334  PHE C O   1 
ATOM   10705 C  CB  . PHE C 1 331 ? 23.923  7.097   51.147  1.00 33.42 ? 334  PHE C CB  1 
ATOM   10706 C  CG  . PHE C 1 331 ? 25.097  7.250   52.072  1.00 33.31 ? 334  PHE C CG  1 
ATOM   10707 C  CD1 . PHE C 1 331 ? 26.120  6.314   52.085  1.00 33.18 ? 334  PHE C CD1 1 
ATOM   10708 C  CD2 . PHE C 1 331 ? 25.162  8.313   52.960  1.00 33.02 ? 334  PHE C CD2 1 
ATOM   10709 C  CE1 . PHE C 1 331 ? 27.184  6.438   52.972  1.00 33.20 ? 334  PHE C CE1 1 
ATOM   10710 C  CE2 . PHE C 1 331 ? 26.223  8.438   53.846  1.00 32.97 ? 334  PHE C CE2 1 
ATOM   10711 C  CZ  . PHE C 1 331 ? 27.232  7.501   53.852  1.00 32.97 ? 334  PHE C CZ  1 
ATOM   10712 N  N   . ASP C 1 332 ? 22.814  6.789   47.942  1.00 33.89 ? 335  ASP C N   1 
ATOM   10713 C  CA  . ASP C 1 332 ? 21.632  6.539   47.118  1.00 33.84 ? 335  ASP C CA  1 
ATOM   10714 C  C   . ASP C 1 332 ? 21.273  5.059   47.160  1.00 33.89 ? 335  ASP C C   1 
ATOM   10715 O  O   . ASP C 1 332 ? 22.041  4.224   46.679  1.00 34.01 ? 335  ASP C O   1 
ATOM   10716 C  CB  . ASP C 1 332 ? 21.904  6.903   45.656  1.00 33.75 ? 335  ASP C CB  1 
ATOM   10717 C  CG  . ASP C 1 332 ? 22.235  8.359   45.464  1.00 33.60 ? 335  ASP C CG  1 
ATOM   10718 O  OD1 . ASP C 1 332 ? 23.208  8.658   44.745  1.00 33.75 ? 335  ASP C OD1 1 
ATOM   10719 O  OD2 . ASP C 1 332 ? 21.512  9.204   46.012  1.00 33.72 ? 335  ASP C OD2 1 
ATOM   10720 N  N   . PRO C 1 333 ? 20.102  4.709   47.731  1.00 33.95 ? 336  PRO C N   1 
ATOM   10721 C  CA  . PRO C 1 333 ? 19.657  3.314   47.817  1.00 33.87 ? 336  PRO C CA  1 
ATOM   10722 C  C   . PRO C 1 333 ? 19.633  2.636   46.455  1.00 33.84 ? 336  PRO C C   1 
ATOM   10723 O  O   . PRO C 1 333 ? 19.758  1.417   46.364  1.00 33.69 ? 336  PRO C O   1 
ATOM   10724 C  CB  . PRO C 1 333 ? 18.248  3.447   48.390  1.00 33.90 ? 336  PRO C CB  1 
ATOM   10725 C  CG  . PRO C 1 333 ? 18.393  4.588   49.312  1.00 33.78 ? 336  PRO C CG  1 
ATOM   10726 C  CD  . PRO C 1 333 ? 19.184  5.583   48.479  1.00 33.82 ? 336  PRO C CD  1 
ATOM   10727 N  N   . SER C 1 334 ? 19.472  3.434   45.402  1.00 34.08 ? 337  SER C N   1 
ATOM   10728 C  CA  . SER C 1 334 ? 19.444  2.925   44.037  1.00 34.37 ? 337  SER C CA  1 
ATOM   10729 C  C   . SER C 1 334 ? 20.826  2.547   43.530  1.00 34.49 ? 337  SER C C   1 
ATOM   10730 O  O   . SER C 1 334 ? 20.958  1.990   42.443  1.00 34.65 ? 337  SER C O   1 
ATOM   10731 C  CB  . SER C 1 334 ? 18.813  3.947   43.099  1.00 34.19 ? 337  SER C CB  1 
ATOM   10732 O  OG  . SER C 1 334 ? 19.461  5.196   43.226  1.00 34.65 ? 337  SER C OG  1 
ATOM   10733 N  N   . ASN C 1 335 ? 21.864  2.892   44.283  1.00 34.78 ? 338  ASN C N   1 
ATOM   10734 C  CA  . ASN C 1 335 ? 23.214  2.529   43.880  1.00 35.03 ? 338  ASN C CA  1 
ATOM   10735 C  C   . ASN C 1 335 ? 23.408  1.070   44.243  1.00 35.18 ? 338  ASN C C   1 
ATOM   10736 O  O   . ASN C 1 335 ? 23.754  0.746   45.377  1.00 35.26 ? 338  ASN C O   1 
ATOM   10737 C  CB  . ASN C 1 335 ? 24.259  3.391   44.587  1.00 35.06 ? 338  ASN C CB  1 
ATOM   10738 C  CG  . ASN C 1 335 ? 24.388  4.773   43.978  1.00 35.20 ? 338  ASN C CG  1 
ATOM   10739 O  OD1 . ASN C 1 335 ? 24.902  5.694   44.607  1.00 35.52 ? 338  ASN C OD1 1 
ATOM   10740 N  ND2 . ASN C 1 335 ? 23.941  4.922   42.742  1.00 35.48 ? 338  ASN C ND2 1 
ATOM   10741 N  N   . MET C 1 336 ? 23.116  0.191   43.291  1.00 35.48 ? 339  MET C N   1 
ATOM   10742 C  CA  . MET C 1 336 ? 23.250  -1.245  43.492  1.00 35.60 ? 339  MET C CA  1 
ATOM   10743 C  C   . MET C 1 336 ? 23.986  -1.890  42.327  1.00 35.49 ? 339  MET C C   1 
ATOM   10744 O  O   . MET C 1 336 ? 23.637  -1.681  41.169  1.00 35.50 ? 339  MET C O   1 
ATOM   10745 C  CB  . MET C 1 336 ? 21.875  -1.895  43.595  1.00 35.92 ? 339  MET C CB  1 
ATOM   10746 C  CG  . MET C 1 336 ? 21.061  -1.503  44.791  1.00 36.42 ? 339  MET C CG  1 
ATOM   10747 S  SD  . MET C 1 336 ? 19.440  -2.249  44.643  1.00 37.24 ? 339  MET C SD  1 
ATOM   10748 C  CE  . MET C 1 336 ? 18.566  -1.389  45.858  1.00 36.62 ? 339  MET C CE  1 
ATOM   10749 N  N   . PRO C 1 337 ? 25.006  -2.706  42.622  1.00 35.31 ? 340  PRO C N   1 
ATOM   10750 C  CA  . PRO C 1 337 ? 25.790  -3.391  41.592  1.00 35.30 ? 340  PRO C CA  1 
ATOM   10751 C  C   . PRO C 1 337 ? 25.080  -4.678  41.199  1.00 35.13 ? 340  PRO C C   1 
ATOM   10752 O  O   . PRO C 1 337 ? 24.124  -5.086  41.857  1.00 35.25 ? 340  PRO C O   1 
ATOM   10753 C  CB  . PRO C 1 337 ? 27.086  -3.706  42.329  1.00 35.32 ? 340  PRO C CB  1 
ATOM   10754 C  CG  . PRO C 1 337 ? 26.583  -4.078  43.682  1.00 35.34 ? 340  PRO C CG  1 
ATOM   10755 C  CD  . PRO C 1 337 ? 25.546  -2.994  43.963  1.00 35.52 ? 340  PRO C CD  1 
ATOM   10756 N  N   . PRO C 1 338 ? 25.519  -5.323  40.112  1.00 34.92 ? 341  PRO C N   1 
ATOM   10757 C  CA  . PRO C 1 338 ? 24.891  -6.573  39.678  1.00 34.90 ? 341  PRO C CA  1 
ATOM   10758 C  C   . PRO C 1 338 ? 24.931  -7.583  40.823  1.00 34.79 ? 341  PRO C C   1 
ATOM   10759 O  O   . PRO C 1 338 ? 25.935  -7.685  41.520  1.00 34.78 ? 341  PRO C O   1 
ATOM   10760 C  CB  . PRO C 1 338 ? 25.792  -7.017  38.537  1.00 35.00 ? 341  PRO C CB  1 
ATOM   10761 C  CG  . PRO C 1 338 ? 26.243  -5.725  37.950  1.00 35.04 ? 341  PRO C CG  1 
ATOM   10762 C  CD  . PRO C 1 338 ? 26.555  -4.892  39.158  1.00 35.12 ? 341  PRO C CD  1 
ATOM   10763 N  N   . GLY C 1 339 ? 23.831  -8.302  41.027  1.00 34.77 ? 342  GLY C N   1 
ATOM   10764 C  CA  . GLY C 1 339 ? 23.764  -9.286  42.094  1.00 34.71 ? 342  GLY C CA  1 
ATOM   10765 C  C   . GLY C 1 339 ? 22.903  -8.843  43.266  1.00 34.79 ? 342  GLY C C   1 
ATOM   10766 O  O   . GLY C 1 339 ? 22.487  -9.662  44.086  1.00 34.68 ? 342  GLY C O   1 
ATOM   10767 N  N   . ILE C 1 340 ? 22.661  -7.539  43.363  1.00 34.82 ? 343  ILE C N   1 
ATOM   10768 C  CA  . ILE C 1 340 ? 21.847  -6.969  44.428  1.00 34.63 ? 343  ILE C CA  1 
ATOM   10769 C  C   . ILE C 1 340 ? 20.828  -6.078  43.754  1.00 34.86 ? 343  ILE C C   1 
ATOM   10770 O  O   . ILE C 1 340 ? 21.193  -5.187  42.993  1.00 34.82 ? 343  ILE C O   1 
ATOM   10771 C  CB  . ILE C 1 340 ? 22.695  -6.126  45.372  1.00 34.59 ? 343  ILE C CB  1 
ATOM   10772 C  CG1 . ILE C 1 340 ? 23.839  -6.973  45.932  1.00 34.44 ? 343  ILE C CG1 1 
ATOM   10773 C  CG2 . ILE C 1 340 ? 21.834  -5.588  46.497  1.00 34.42 ? 343  ILE C CG2 1 
ATOM   10774 C  CD1 . ILE C 1 340 ? 24.824  -6.204  46.758  1.00 34.36 ? 343  ILE C CD1 1 
ATOM   10775 N  N   . GLU C 1 341 ? 19.549  -6.339  44.003  1.00 35.13 ? 344  GLU C N   1 
ATOM   10776 C  CA  . GLU C 1 341 ? 18.485  -5.558  43.383  1.00 35.44 ? 344  GLU C CA  1 
ATOM   10777 C  C   . GLU C 1 341 ? 17.412  -5.133  44.363  1.00 35.68 ? 344  GLU C C   1 
ATOM   10778 O  O   . GLU C 1 341 ? 17.457  -5.494  45.539  1.00 35.72 ? 344  GLU C O   1 
ATOM   10779 C  CB  . GLU C 1 341 ? 17.853  -6.352  42.242  1.00 35.47 ? 344  GLU C CB  1 
ATOM   10780 C  CG  . GLU C 1 341 ? 18.798  -6.610  41.096  1.00 35.64 ? 344  GLU C CG  1 
ATOM   10781 C  CD  . GLU C 1 341 ? 18.161  -7.389  39.973  1.00 35.98 ? 344  GLU C CD  1 
ATOM   10782 O  OE1 . GLU C 1 341 ? 18.894  -8.130  39.282  1.00 36.30 ? 344  GLU C OE1 1 
ATOM   10783 O  OE2 . GLU C 1 341 ? 16.935  -7.260  39.763  1.00 36.07 ? 344  GLU C OE2 1 
ATOM   10784 N  N   . ALA C 1 342 ? 16.448  -4.356  43.874  1.00 35.86 ? 345  ALA C N   1 
ATOM   10785 C  CA  . ALA C 1 342 ? 15.354  -3.879  44.710  1.00 35.92 ? 345  ALA C CA  1 
ATOM   10786 C  C   . ALA C 1 342 ? 14.173  -4.836  44.709  1.00 35.87 ? 345  ALA C C   1 
ATOM   10787 O  O   . ALA C 1 342 ? 14.029  -5.658  43.802  1.00 36.02 ? 345  ALA C O   1 
ATOM   10788 C  CB  . ALA C 1 342 ? 14.900  -2.505  44.242  1.00 36.20 ? 345  ALA C CB  1 
ATOM   10789 N  N   . SER C 1 343 ? 13.356  -4.751  45.755  1.00 35.79 ? 346  SER C N   1 
ATOM   10790 C  CA  . SER C 1 343 ? 12.153  -5.573  45.868  1.00 35.70 ? 346  SER C CA  1 
ATOM   10791 C  C   . SER C 1 343 ? 10.958  -4.630  45.683  1.00 35.84 ? 346  SER C C   1 
ATOM   10792 O  O   . SER C 1 343 ? 11.127  -3.405  45.676  1.00 35.93 ? 346  SER C O   1 
ATOM   10793 C  CB  . SER C 1 343 ? 12.076  -6.234  47.239  1.00 35.13 ? 346  SER C CB  1 
ATOM   10794 O  OG  . SER C 1 343 ? 11.740  -5.279  48.223  1.00 34.88 ? 346  SER C OG  1 
ATOM   10795 N  N   . PRO C 1 344 ? 9.744   -5.178  45.494  1.00 36.08 ? 347  PRO C N   1 
ATOM   10796 C  CA  . PRO C 1 344 ? 8.576   -4.309  45.313  1.00 36.15 ? 347  PRO C CA  1 
ATOM   10797 C  C   . PRO C 1 344 ? 8.097   -3.508  46.537  1.00 36.32 ? 347  PRO C C   1 
ATOM   10798 O  O   . PRO C 1 344 ? 7.001   -2.943  46.513  1.00 36.50 ? 347  PRO C O   1 
ATOM   10799 C  CB  . PRO C 1 344 ? 7.508   -5.273  44.780  1.00 36.17 ? 347  PRO C CB  1 
ATOM   10800 C  CG  . PRO C 1 344 ? 7.927   -6.590  45.296  1.00 36.15 ? 347  PRO C CG  1 
ATOM   10801 C  CD  . PRO C 1 344 ? 9.414   -6.572  45.152  1.00 36.03 ? 347  PRO C CD  1 
ATOM   10802 N  N   . ASP C 1 345 ? 8.918   -3.424  47.587  1.00 36.32 ? 348  ASP C N   1 
ATOM   10803 C  CA  . ASP C 1 345 ? 8.558   -2.658  48.784  1.00 36.09 ? 348  ASP C CA  1 
ATOM   10804 C  C   . ASP C 1 345 ? 8.294   -1.235  48.330  1.00 36.15 ? 348  ASP C C   1 
ATOM   10805 O  O   . ASP C 1 345 ? 9.226   -0.535  47.924  1.00 36.24 ? 348  ASP C O   1 
ATOM   10806 C  CB  . ASP C 1 345 ? 9.709   -2.661  49.799  1.00 35.85 ? 348  ASP C CB  1 
ATOM   10807 C  CG  . ASP C 1 345 ? 9.397   -1.863  51.076  1.00 35.63 ? 348  ASP C CG  1 
ATOM   10808 O  OD1 . ASP C 1 345 ? 8.471   -1.026  51.095  1.00 35.55 ? 348  ASP C OD1 1 
ATOM   10809 O  OD2 . ASP C 1 345 ? 10.100  -2.074  52.085  1.00 35.71 ? 348  ASP C OD2 1 
ATOM   10810 N  N   . LYS C 1 346 ? 7.032   -0.813  48.422  1.00 35.99 ? 349  LYS C N   1 
ATOM   10811 C  CA  . LYS C 1 346 ? 6.625   0.527   48.012  1.00 35.90 ? 349  LYS C CA  1 
ATOM   10812 C  C   . LYS C 1 346 ? 7.533   1.599   48.583  1.00 35.91 ? 349  LYS C C   1 
ATOM   10813 O  O   . LYS C 1 346 ? 7.829   2.591   47.918  1.00 35.96 ? 349  LYS C O   1 
ATOM   10814 C  CB  . LYS C 1 346 ? 5.183   0.810   48.434  1.00 35.71 ? 349  LYS C CB  1 
ATOM   10815 C  CG  . LYS C 1 346 ? 4.163   -0.137  47.836  1.00 35.57 ? 349  LYS C CG  1 
ATOM   10816 C  CD  . LYS C 1 346 ? 2.745   0.292   48.175  1.00 35.56 ? 349  LYS C CD  1 
ATOM   10817 C  CE  . LYS C 1 346 ? 1.755   -0.791  47.796  1.00 35.59 ? 349  LYS C CE  1 
ATOM   10818 N  NZ  . LYS C 1 346 ? 0.353   -0.326  47.943  1.00 35.94 ? 349  LYS C NZ  1 
ATOM   10819 N  N   . MET C 1 347 ? 7.976   1.396   49.816  1.00 35.92 ? 350  MET C N   1 
ATOM   10820 C  CA  . MET C 1 347 ? 8.849   2.354   50.472  1.00 36.09 ? 350  MET C CA  1 
ATOM   10821 C  C   . MET C 1 347 ? 10.214  2.407   49.797  1.00 36.14 ? 350  MET C C   1 
ATOM   10822 O  O   . MET C 1 347 ? 10.754  3.488   49.569  1.00 36.25 ? 350  MET C O   1 
ATOM   10823 C  CB  . MET C 1 347 ? 8.997   2.010   51.955  1.00 36.22 ? 350  MET C CB  1 
ATOM   10824 C  CG  . MET C 1 347 ? 7.739   2.238   52.785  1.00 36.19 ? 350  MET C CG  1 
ATOM   10825 S  SD  . MET C 1 347 ? 7.400   3.988   53.065  1.00 36.60 ? 350  MET C SD  1 
ATOM   10826 C  CE  . MET C 1 347 ? 8.627   4.355   54.330  1.00 36.24 ? 350  MET C CE  1 
ATOM   10827 N  N   . LEU C 1 348 ? 10.769  1.240   49.481  1.00 35.84 ? 351  LEU C N   1 
ATOM   10828 C  CA  . LEU C 1 348 ? 12.065  1.166   48.820  1.00 35.63 ? 351  LEU C CA  1 
ATOM   10829 C  C   . LEU C 1 348 ? 11.947  1.800   47.447  1.00 35.37 ? 351  LEU C C   1 
ATOM   10830 O  O   . LEU C 1 348 ? 12.792  2.599   47.051  1.00 35.26 ? 351  LEU C O   1 
ATOM   10831 C  CB  . LEU C 1 348 ? 12.521  -0.291  48.682  1.00 35.67 ? 351  LEU C CB  1 
ATOM   10832 C  CG  . LEU C 1 348 ? 13.819  -0.501  47.892  1.00 35.83 ? 351  LEU C CG  1 
ATOM   10833 C  CD1 . LEU C 1 348 ? 14.942  0.349   48.482  1.00 35.69 ? 351  LEU C CD1 1 
ATOM   10834 C  CD2 . LEU C 1 348 ? 14.204  -1.971  47.872  1.00 35.65 ? 351  LEU C CD2 1 
ATOM   10835 N  N   . GLN C 1 349 ? 10.877  1.454   46.739  1.00 35.12 ? 352  GLN C N   1 
ATOM   10836 C  CA  . GLN C 1 349 ? 10.624  1.967   45.402  1.00 34.86 ? 352  GLN C CA  1 
ATOM   10837 C  C   . GLN C 1 349 ? 10.650  3.491   45.379  1.00 34.73 ? 352  GLN C C   1 
ATOM   10838 O  O   . GLN C 1 349 ? 11.234  4.097   44.478  1.00 34.69 ? 352  GLN C O   1 
ATOM   10839 C  CB  . GLN C 1 349 ? 9.278   1.448   44.894  1.00 34.87 ? 352  GLN C CB  1 
ATOM   10840 C  CG  . GLN C 1 349 ? 9.230   -0.054  44.680  1.00 34.83 ? 352  GLN C CG  1 
ATOM   10841 C  CD  . GLN C 1 349 ? 9.890   -0.475  43.392  1.00 35.00 ? 352  GLN C CD  1 
ATOM   10842 O  OE1 . GLN C 1 349 ? 9.690   0.146   42.352  1.00 35.27 ? 352  GLN C OE1 1 
ATOM   10843 N  NE2 . GLN C 1 349 ? 10.671  -1.541  43.446  1.00 35.03 ? 352  GLN C NE2 1 
ATOM   10844 N  N   . GLY C 1 350 ? 10.035  4.101   46.386  1.00 34.63 ? 353  GLY C N   1 
ATOM   10845 C  CA  . GLY C 1 350 ? 10.005  5.549   46.477  1.00 34.69 ? 353  GLY C CA  1 
ATOM   10846 C  C   . GLY C 1 350 ? 11.376  6.149   46.732  1.00 34.70 ? 353  GLY C C   1 
ATOM   10847 O  O   . GLY C 1 350 ? 11.703  7.212   46.200  1.00 34.85 ? 353  GLY C O   1 
ATOM   10848 N  N   . ARG C 1 351 ? 12.181  5.474   47.546  1.00 34.57 ? 354  ARG C N   1 
ATOM   10849 C  CA  . ARG C 1 351 ? 13.530  5.946   47.849  1.00 34.32 ? 354  ARG C CA  1 
ATOM   10850 C  C   . ARG C 1 351 ? 14.440  5.851   46.623  1.00 34.21 ? 354  ARG C C   1 
ATOM   10851 O  O   . ARG C 1 351 ? 15.417  6.597   46.511  1.00 34.31 ? 354  ARG C O   1 
ATOM   10852 C  CB  . ARG C 1 351 ? 14.134  5.152   49.013  1.00 34.03 ? 354  ARG C CB  1 
ATOM   10853 C  CG  . ARG C 1 351 ? 13.389  5.313   50.312  1.00 33.42 ? 354  ARG C CG  1 
ATOM   10854 C  CD  . ARG C 1 351 ? 13.962  4.416   51.378  1.00 33.47 ? 354  ARG C CD  1 
ATOM   10855 N  NE  . ARG C 1 351 ? 15.240  4.895   51.899  1.00 33.41 ? 354  ARG C NE  1 
ATOM   10856 C  CZ  . ARG C 1 351 ? 16.178  4.108   52.421  1.00 33.26 ? 354  ARG C CZ  1 
ATOM   10857 N  NH1 . ARG C 1 351 ? 15.989  2.800   52.482  1.00 33.21 ? 354  ARG C