data_1DIC
# 
_entry.id   1DIC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DIC         
WWPDB D_1000172794 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DIC 
_pdbx_database_status.recvd_initial_deposition_date   1998-07-08 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cole, L.B.'       1 
'Kilpatrick, J.M.' 2 
'Chu, N.'          3 
'Babu, Y.S.'       4 
# 
_citation.id                        primary 
_citation.title                     'Structure of 3,4-dichloroisocoumarin-inhibited factor D.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            54 
_citation.page_first                711 
_citation.page_last                 717 
_citation.year                      1998 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9757085 
_citation.pdbx_database_id_DOI      10.1107/S0907444997010457 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cole, L.B.'       1 
primary 'Kilpatrick, J.M.' 2 
primary 'Chu, N.'          3 
primary 'Babu, Y.S.'       4 
# 
_cell.entry_id           1DIC 
_cell.length_a           56.300 
_cell.length_b           51.570 
_cell.length_c           39.840 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DIC 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'FACTOR D'              24438.807 1   3.4.21.46 ? ? '3,4-DICHLOROISOCOUMARIN GROUP LINKED TO SERINE 195' 
2 non-polymer syn 3,4-DICHLOROISOCOUMARIN 215.033   1   ?         ? ? ?                                                    
3 non-polymer syn 'OXYGEN ATOM'           15.999    2   ?         ? ? ?                                                    
4 water       nat water                   18.015    115 ?         ? ? ?                                                    
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LEU n 
1 3   GLY n 
1 4   GLY n 
1 5   ARG n 
1 6   GLU n 
1 7   ALA n 
1 8   GLU n 
1 9   ALA n 
1 10  HIS n 
1 11  ALA n 
1 12  ARG n 
1 13  PRO n 
1 14  TYR n 
1 15  MET n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  GLN n 
1 20  LEU n 
1 21  ASN n 
1 22  GLY n 
1 23  ALA n 
1 24  HIS n 
1 25  LEU n 
1 26  CYS n 
1 27  GLY n 
1 28  GLY n 
1 29  VAL n 
1 30  LEU n 
1 31  VAL n 
1 32  ALA n 
1 33  GLU n 
1 34  GLN n 
1 35  TRP n 
1 36  VAL n 
1 37  LEU n 
1 38  SER n 
1 39  ALA n 
1 40  ALA n 
1 41  HIS n 
1 42  CYS n 
1 43  LEU n 
1 44  GLU n 
1 45  ASP n 
1 46  ALA n 
1 47  ALA n 
1 48  ASP n 
1 49  GLY n 
1 50  LYS n 
1 51  VAL n 
1 52  GLN n 
1 53  VAL n 
1 54  LEU n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  HIS n 
1 59  SER n 
1 60  LEU n 
1 61  SER n 
1 62  GLN n 
1 63  PRO n 
1 64  GLU n 
1 65  PRO n 
1 66  SER n 
1 67  LYS n 
1 68  ARG n 
1 69  LEU n 
1 70  TYR n 
1 71  ASP n 
1 72  VAL n 
1 73  LEU n 
1 74  ARG n 
1 75  ALA n 
1 76  VAL n 
1 77  PRO n 
1 78  HIS n 
1 79  PRO n 
1 80  ASP n 
1 81  SER n 
1 82  GLN n 
1 83  PRO n 
1 84  ASP n 
1 85  THR n 
1 86  ILE n 
1 87  ASP n 
1 88  HIS n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  LEU n 
1 94  GLN n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ALA n 
1 100 THR n 
1 101 LEU n 
1 102 GLY n 
1 103 PRO n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 PRO n 
1 108 LEU n 
1 109 PRO n 
1 110 TRP n 
1 111 GLN n 
1 112 ARG n 
1 113 VAL n 
1 114 ASP n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 ALA n 
1 119 PRO n 
1 120 GLY n 
1 121 THR n 
1 122 LEU n 
1 123 CYS n 
1 124 ASP n 
1 125 VAL n 
1 126 ALA n 
1 127 GLY n 
1 128 TRP n 
1 129 GLY n 
1 130 ILE n 
1 131 VAL n 
1 132 ASN n 
1 133 HIS n 
1 134 ALA n 
1 135 GLY n 
1 136 ARG n 
1 137 ARG n 
1 138 PRO n 
1 139 ASP n 
1 140 SER n 
1 141 LEU n 
1 142 GLN n 
1 143 HIS n 
1 144 VAL n 
1 145 LEU n 
1 146 LEU n 
1 147 PRO n 
1 148 VAL n 
1 149 LEU n 
1 150 ASP n 
1 151 ARG n 
1 152 ALA n 
1 153 THR n 
1 154 CYS n 
1 155 ASN n 
1 156 ARG n 
1 157 ARG n 
1 158 THR n 
1 159 HIS n 
1 160 HIS n 
1 161 ASP n 
1 162 GLY n 
1 163 ALA n 
1 164 ILE n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 LEU n 
1 169 MET n 
1 170 CYS n 
1 171 ALA n 
1 172 GLU n 
1 173 SER n 
1 174 ASN n 
1 175 ARG n 
1 176 ARG n 
1 177 ASP n 
1 178 SER n 
1 179 CYS n 
1 180 LYS n 
1 181 GLY n 
1 182 ASP n 
1 183 SER n 
1 184 GLY n 
1 185 GLY n 
1 186 PRO n 
1 187 LEU n 
1 188 VAL n 
1 189 CYS n 
1 190 GLY n 
1 191 GLY n 
1 192 VAL n 
1 193 LEU n 
1 194 GLU n 
1 195 GLY n 
1 196 VAL n 
1 197 VAL n 
1 198 THR n 
1 199 SER n 
1 200 GLY n 
1 201 SER n 
1 202 ARG n 
1 203 VAL n 
1 204 CYS n 
1 205 GLY n 
1 206 ASN n 
1 207 ARG n 
1 208 LYS n 
1 209 LYS n 
1 210 PRO n 
1 211 GLY n 
1 212 ILE n 
1 213 TYR n 
1 214 THR n 
1 215 ARG n 
1 216 VAL n 
1 217 ALA n 
1 218 SER n 
1 219 TYR n 
1 220 ALA n 
1 221 ALA n 
1 222 TRP n 
1 223 ILE n 
1 224 ASP n 
1 225 SER n 
1 226 VAL n 
1 227 LEU n 
1 228 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'ISOLATED FROM A PATIENT WITH FANCONI SYNDROME' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CFAD_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00746 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MHSSVYFAVLVLLGAAACAARPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLL
GAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAG
RRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DIC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 228 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00746 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  253 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       243 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
DIC non-polymer         . 3,4-DICHLOROISOCOUMARIN ? 'C9 H4 Cl2 O2'   215.033 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
O   non-polymer         . 'OXYGEN ATOM'           ? O                15.999  
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DIC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.27 
_exptl_crystal.density_percent_sol   45.89 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'SIEMENS X1000' 
_diffrn_detector.pdbx_collection_date   1995-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DIC 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.0 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   18850 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              0.0823 
_reflns.pdbx_netI_over_sigmaI        37.3 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.65 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.91 
_reflns_shell.percent_possible_all   57.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.22 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1DIC 
_refine.ls_number_reflns_obs                     17696 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               100000000. 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    90 
_refine.ls_R_factor_obs                          0.182 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.182 
_refine.ls_R_factor_R_free                       0.251 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  1398 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1DSU' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1712 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             115 
_refine_hist.number_atoms_total               1841 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.6  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.88 
_refine_ls_shell.number_reflns_R_work             585 
_refine_ls_shell.R_factor_R_work                  0.264 
_refine_ls_shell.percent_reflns_obs               44.0 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            0.064 
_refine_ls_shell.percent_reflns_R_free            2.1 
_refine_ls_shell.number_reflns_R_free             30 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 ?            TOPH19.PEP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1DIC 
_struct.title                     'STRUCTURE OF 3,4-DICHLOROISOCOUMARIN-INHIBITED FACTOR D' 
_struct.pdbx_descriptor           'FACTOR D, 3,4-DICHLOROISOCOUMARIN, OXYGEN ATOM' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DIC 
_struct_keywords.pdbx_keywords   'SERINE PROTEASE' 
_struct_keywords.text            'SERINE PROTEASE, COMPLEMENT, FACTOR D, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 40  ? ALA A 46  A ALA A 56  ALA A 61  1 ? 7  
HELX_P HELX_P2 2 ARG A 151 ? ASN A 155 ? ARG A 165 ASN A 169 1 ? 5  
HELX_P HELX_P3 3 ALA A 217 ? VAL A 226 ? ALA A 232 VAL A 241 5 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26  SG ? ? ? 1_555 A CYS 42  SG ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 170 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf4 disulf ? ? A CYS 179 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.030 ? 
covale1 covale ? ? B DIC .   C7 ? ? ? 1_555 A SER 183 OG ? ? A DIC 244 A SER 195 1_555 ? ? ? ? ? ? ? 1.294 ? 
covale2 covale ? ? B DIC .   C9 ? ? ? 1_555 C O   .   O  ? ? A DIC 244 A O   245 1_555 ? ? ? ? ? ? ? 1.250 ? 
covale3 covale ? ? B DIC .   C9 ? ? ? 1_555 D O   .   O  ? ? A DIC 244 A O   246 1_555 ? ? ? ? ? ? ? 1.249 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 68  ? ASP A 71  ? ARG A 81  ASP A 84  
A 2 VAL A 51  ? LEU A 55  ? VAL A 64  LEU A 68  
A 3 MET A 15  ? LEU A 20  ? MET A 30  LEU A 35  
A 4 ALA A 23  ? ALA A 32  ? ALA A 39  ALA A 48  
A 5 TRP A 35  ? SER A 38  ? TRP A 51  SER A 54  
A 6 LEU A 91  ? LEU A 95  ? LEU A 104 LEU A 108 
A 7 VAL A 72  ? PRO A 77  ? VAL A 85  PRO A 90  
B 1 LEU A 122 ? GLY A 127 ? LEU A 135 GLY A 140 
B 2 GLN A 142 ? PRO A 147 ? GLN A 156 PRO A 161 
C 1 LEU A 168 ? ALA A 171 ? LEU A 180 ALA A 183 
C 2 GLY A 211 ? ARG A 215 ? GLY A 226 ARG A 230 
C 3 VAL A 192 ? VAL A 197 ? VAL A 208 VAL A 213 
C 4 PRO A 186 ? CYS A 189 ? PRO A 198 CYS A 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 68  ? O ARG A 81  N LEU A 55  ? N LEU A 68  
A 2 3 O GLN A 52  ? O GLN A 65  N GLN A 19  ? N GLN A 34  
A 3 4 O ALA A 16  ? O ALA A 31  N GLY A 28  ? N GLY A 44  
A 4 5 O VAL A 29  ? O VAL A 45  N LEU A 37  ? N LEU A 53  
A 5 6 O VAL A 36  ? O VAL A 52  N LEU A 93  ? N LEU A 106 
A 6 7 O LEU A 92  ? O LEU A 105 N VAL A 76  ? N VAL A 89  
B 1 2 O CYS A 123 ? O CYS A 136 N LEU A 146 ? N LEU A 160 
C 1 2 O MET A 169 ? O MET A 181 N TYR A 213 ? N TYR A 228 
C 2 3 O THR A 214 ? O THR A 229 N VAL A 196 ? N VAL A 212 
C 3 4 O VAL A 192 ? O VAL A 208 N CYS A 189 ? N CYS A 201 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
S1  Unknown  ? ? ? ? 1 '3,4-DICHLOROISOCOUMARIN MOIETY LINKED TO O ATOM OF SER 195.' 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE DIC A 244'                          
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE O A 245'                            
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE O A 246'                            
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  S1  1 DIC B .   ? DIC A 244 . ? 1_555 ? 
2  AC1 8 LYS A 180 ? LYS A 192 . ? 1_555 ? 
3  AC1 8 SER A 183 ? SER A 195 . ? 1_555 ? 
4  AC1 8 THR A 198 ? THR A 214 . ? 1_555 ? 
5  AC1 8 SER A 199 ? SER A 215 . ? 1_555 ? 
6  AC1 8 GLY A 200 ? GLY A 216 . ? 1_555 ? 
7  AC1 8 ARG A 202 ? ARG A 218 . ? 1_555 ? 
8  AC1 8 O   C .   ? O   A 245 . ? 1_555 ? 
9  AC1 8 O   D .   ? O   A 246 . ? 1_555 ? 
10 AC2 5 LYS A 180 ? LYS A 192 . ? 1_555 ? 
11 AC2 5 GLY A 181 ? GLY A 193 . ? 1_555 ? 
12 AC2 5 SER A 183 ? SER A 195 . ? 1_555 ? 
13 AC2 5 DIC B .   ? DIC A 244 . ? 1_555 ? 
14 AC2 5 O   D .   ? O   A 246 . ? 1_555 ? 
15 AC3 2 DIC B .   ? DIC A 244 . ? 1_555 ? 
16 AC3 2 O   C .   ? O   A 245 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DIC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DIC 
_atom_sites.fract_transf_matrix[1][1]   0.017762 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005110 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019391 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026118 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1   ? 17.592  14.412 9.273  1.00 7.47  ? 16  ILE A N   1 
ATOM   2    C CA  . ILE A 1 1   ? 18.157  13.057 9.491  1.00 10.41 ? 16  ILE A CA  1 
ATOM   3    C C   . ILE A 1 1   ? 19.561  12.993 8.839  1.00 13.41 ? 16  ILE A C   1 
ATOM   4    O O   . ILE A 1 1   ? 19.713  13.352 7.665  1.00 12.21 ? 16  ILE A O   1 
ATOM   5    C CB  . ILE A 1 1   ? 17.250  11.965 8.830  1.00 10.45 ? 16  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 1   ? 15.827  11.979 9.421  1.00 12.03 ? 16  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 1   ? 17.873  10.573 8.986  1.00 11.24 ? 16  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 1   ? 15.679  11.366 10.852 1.00 9.67  ? 16  ILE A CD1 1 
ATOM   9    N N   . LEU A 1 2   ? 20.562  12.545 9.595  1.00 12.47 ? 17  LEU A N   1 
ATOM   10   C CA  . LEU A 1 2   ? 21.940  12.406 9.106  1.00 16.07 ? 17  LEU A CA  1 
ATOM   11   C C   . LEU A 1 2   ? 22.248  10.933 8.833  1.00 14.69 ? 17  LEU A C   1 
ATOM   12   O O   . LEU A 1 2   ? 21.895  10.070 9.633  1.00 14.02 ? 17  LEU A O   1 
ATOM   13   C CB  . LEU A 1 2   ? 22.934  12.918 10.158 1.00 20.96 ? 17  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 2   ? 23.471  14.347 10.072 1.00 26.59 ? 17  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 2   ? 22.344  15.363 10.004 1.00 28.14 ? 17  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 2   ? 24.356  14.599 11.289 1.00 30.55 ? 17  LEU A CD2 1 
ATOM   17   N N   . GLY A 1 3   ? 22.875  10.643 7.696  1.00 13.05 ? 18  GLY A N   1 
ATOM   18   C CA  . GLY A 1 3   ? 23.224  9.270  7.374  1.00 11.91 ? 18  GLY A CA  1 
ATOM   19   C C   . GLY A 1 3   ? 22.071  8.368  6.997  1.00 13.07 ? 18  GLY A C   1 
ATOM   20   O O   . GLY A 1 3   ? 22.185  7.142  7.074  1.00 13.56 ? 18  GLY A O   1 
ATOM   21   N N   . GLY A 1 4   ? 20.957  8.956  6.576  1.00 13.68 ? 19  GLY A N   1 
ATOM   22   C CA  . GLY A 1 4   ? 19.803  8.153  6.207  1.00 16.80 ? 19  GLY A CA  1 
ATOM   23   C C   . GLY A 1 4   ? 19.561  8.154  4.714  1.00 18.43 ? 19  GLY A C   1 
ATOM   24   O O   . GLY A 1 4   ? 20.470  8.414  3.921  1.00 21.32 ? 19  GLY A O   1 
ATOM   25   N N   . ARG A 1 5   ? 18.339  7.840  4.323  1.00 19.13 ? 20  ARG A N   1 
ATOM   26   C CA  . ARG A 1 5   ? 17.979  7.823  2.920  1.00 20.65 ? 20  ARG A CA  1 
ATOM   27   C C   . ARG A 1 5   ? 16.525  8.235  2.752  1.00 20.52 ? 20  ARG A C   1 
ATOM   28   O O   . ARG A 1 5   ? 15.765  8.257  3.729  1.00 17.63 ? 20  ARG A O   1 
ATOM   29   C CB  . ARG A 1 5   ? 18.268  6.454  2.310  1.00 26.37 ? 20  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 5   ? 18.074  5.270  3.236  1.00 36.98 ? 20  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 5   ? 18.616  4.000  2.583  1.00 45.55 ? 20  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 5   ? 17.931  3.672  1.326  1.00 53.56 ? 20  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 5   ? 18.437  3.859  0.105  1.00 57.54 ? 20  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 5   ? 19.645  4.391  -0.061 1.00 59.76 ? 20  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 5   ? 17.723  3.522  -0.962 1.00 61.06 ? 20  ARG A NH2 1 
ATOM   36   N N   . GLU A 1 6   ? 16.147  8.615  1.536  1.00 16.06 ? 21  GLU A N   1 
ATOM   37   C CA  . GLU A 1 6   ? 14.783  9.060  1.278  1.00 17.11 ? 21  GLU A CA  1 
ATOM   38   C C   . GLU A 1 6   ? 13.820  7.937  1.601  1.00 15.50 ? 21  GLU A C   1 
ATOM   39   O O   . GLU A 1 6   ? 14.068  6.772  1.291  1.00 15.86 ? 21  GLU A O   1 
ATOM   40   C CB  . GLU A 1 6   ? 14.617  9.498  -0.186 1.00 20.93 ? 21  GLU A CB  1 
ATOM   41   C CG  . GLU A 1 6   ? 13.298  10.207 -0.488 1.00 21.40 ? 21  GLU A CG  1 
ATOM   42   C CD  . GLU A 1 6   ? 13.200  10.706 -1.923 1.00 26.63 ? 21  GLU A CD  1 
ATOM   43   O OE1 . GLU A 1 6   ? 14.238  11.114 -2.488 1.00 29.38 ? 21  GLU A OE1 1 
ATOM   44   O OE2 . GLU A 1 6   ? 12.084  10.707 -2.491 1.00 27.05 ? 21  GLU A OE2 1 
ATOM   45   N N   . ALA A 1 7   ? 12.724  8.281  2.244  1.00 11.70 ? 22  ALA A N   1 
ATOM   46   C CA  . ALA A 1 7   ? 11.752  7.273  2.596  1.00 12.04 ? 22  ALA A CA  1 
ATOM   47   C C   . ALA A 1 7   ? 10.863  6.926  1.410  1.00 12.44 ? 22  ALA A C   1 
ATOM   48   O O   . ALA A 1 7   ? 10.703  7.715  0.477  1.00 13.97 ? 22  ALA A O   1 
ATOM   49   C CB  . ALA A 1 7   ? 10.902  7.751  3.796  1.00 9.90  ? 22  ALA A CB  1 
ATOM   50   N N   . GLU A 1 8   ? 10.297  5.727  1.449  1.00 17.13 ? 23  GLU A N   1 
ATOM   51   C CA  . GLU A 1 8   ? 9.379   5.249  0.420  1.00 18.14 ? 23  GLU A CA  1 
ATOM   52   C C   . GLU A 1 8   ? 8.187   6.191  0.527  1.00 17.15 ? 23  GLU A C   1 
ATOM   53   O O   . GLU A 1 8   ? 7.669   6.423  1.626  1.00 15.46 ? 23  GLU A O   1 
ATOM   54   C CB  . GLU A 1 8   ? 8.960   3.810  0.736  1.00 22.67 ? 23  GLU A CB  1 
ATOM   55   C CG  . GLU A 1 8   ? 10.149  2.852  0.992  1.00 30.55 ? 23  GLU A CG  1 
ATOM   56   C CD  . GLU A 1 8   ? 10.435  2.574  2.487  1.00 34.23 ? 23  GLU A CD  1 
ATOM   57   O OE1 . GLU A 1 8   ? 10.862  3.491  3.231  1.00 26.19 ? 23  GLU A OE1 1 
ATOM   58   O OE2 . GLU A 1 8   ? 10.253  1.406  2.911  1.00 39.53 ? 23  GLU A OE2 1 
ATOM   59   N N   . ALA A 1 9   ? 7.783   6.772  -0.591 1.00 14.47 ? 24  ALA A N   1 
ATOM   60   C CA  . ALA A 1 9   ? 6.692   7.722  -0.587 1.00 15.37 ? 24  ALA A CA  1 
ATOM   61   C C   . ALA A 1 9   ? 5.413   7.202  0.054  1.00 16.66 ? 24  ALA A C   1 
ATOM   62   O O   . ALA A 1 9   ? 4.890   6.139  -0.317 1.00 15.20 ? 24  ALA A O   1 
ATOM   63   C CB  . ALA A 1 9   ? 6.418   8.236  -2.005 1.00 15.59 ? 24  ALA A CB  1 
ATOM   64   N N   . HIS A 1 10  ? 4.971   7.938  1.077  1.00 14.59 ? 25  HIS A N   1 
ATOM   65   C CA  . HIS A 1 10  ? 3.744   7.653  1.811  1.00 13.31 ? 25  HIS A CA  1 
ATOM   66   C C   . HIS A 1 10  ? 3.667   6.304  2.501  1.00 12.31 ? 25  HIS A C   1 
ATOM   67   O O   . HIS A 1 10  ? 2.564   5.812  2.767  1.00 15.14 ? 25  HIS A O   1 
ATOM   68   C CB  . HIS A 1 10  ? 2.542   7.838  0.882  1.00 10.91 ? 25  HIS A CB  1 
ATOM   69   C CG  . HIS A 1 10  ? 2.488   9.191  0.244  1.00 15.24 ? 25  HIS A CG  1 
ATOM   70   N ND1 . HIS A 1 10  ? 2.814   9.405  -1.079 1.00 16.06 ? 25  HIS A ND1 1 
ATOM   71   C CD2 . HIS A 1 10  ? 2.156   10.401 0.749  1.00 13.09 ? 25  HIS A CD2 1 
ATOM   72   C CE1 . HIS A 1 10  ? 2.683   10.689 -1.361 1.00 14.84 ? 25  HIS A CE1 1 
ATOM   73   N NE2 . HIS A 1 10  ? 2.286   11.313 -0.268 1.00 16.54 ? 25  HIS A NE2 1 
ATOM   74   N N   . ALA A 1 11  ? 4.823   5.701  2.776  1.00 11.26 ? 26  ALA A N   1 
ATOM   75   C CA  . ALA A 1 11  ? 4.893   4.400  3.452  1.00 11.40 ? 26  ALA A CA  1 
ATOM   76   C C   . ALA A 1 11  ? 4.752   4.528  4.996  1.00 10.65 ? 26  ALA A C   1 
ATOM   77   O O   . ALA A 1 11  ? 4.682   3.531  5.709  1.00 10.16 ? 26  ALA A O   1 
ATOM   78   C CB  . ALA A 1 11  ? 6.196   3.694  3.089  1.00 12.08 ? 26  ALA A CB  1 
ATOM   79   N N   . ARG A 1 12  ? 4.745   5.762  5.485  1.00 11.08 ? 27  ARG A N   1 
ATOM   80   C CA  . ARG A 1 12  ? 4.605   6.068  6.911  1.00 11.31 ? 27  ARG A CA  1 
ATOM   81   C C   . ARG A 1 12  ? 3.472   7.086  6.977  1.00 7.71  ? 27  ARG A C   1 
ATOM   82   O O   . ARG A 1 12  ? 3.700   8.267  7.205  1.00 10.95 ? 27  ARG A O   1 
ATOM   83   C CB  . ARG A 1 12  ? 5.913   6.660  7.429  1.00 10.67 ? 27  ARG A CB  1 
ATOM   84   C CG  . ARG A 1 12  ? 7.053   5.641  7.417  1.00 14.32 ? 27  ARG A CG  1 
ATOM   85   C CD  . ARG A 1 12  ? 8.445   6.254  7.543  1.00 14.20 ? 27  ARG A CD  1 
ATOM   86   N NE  . ARG A 1 12  ? 9.486   5.217  7.534  1.00 15.07 ? 27  ARG A NE  1 
ATOM   87   C CZ  . ARG A 1 12  ? 9.833   4.490  6.468  1.00 18.52 ? 27  ARG A CZ  1 
ATOM   88   N NH1 . ARG A 1 12  ? 9.252   4.695  5.291  1.00 17.99 ? 27  ARG A NH1 1 
ATOM   89   N NH2 . ARG A 1 12  ? 10.780  3.568  6.571  1.00 16.17 ? 27  ARG A NH2 1 
ATOM   90   N N   . PRO A 1 13  ? 2.225   6.629  6.807  1.00 9.88  ? 28  PRO A N   1 
ATOM   91   C CA  . PRO A 1 13  ? 1.034   7.485  6.824  1.00 8.57  ? 28  PRO A CA  1 
ATOM   92   C C   . PRO A 1 13  ? 0.755   8.304  8.085  1.00 7.82  ? 28  PRO A C   1 
ATOM   93   O O   . PRO A 1 13  ? -0.074  9.214  8.064  1.00 8.60  ? 28  PRO A O   1 
ATOM   94   C CB  . PRO A 1 13  ? -0.094  6.503  6.494  1.00 7.63  ? 28  PRO A CB  1 
ATOM   95   C CG  . PRO A 1 13  ? 0.401   5.207  7.006  1.00 10.19 ? 28  PRO A CG  1 
ATOM   96   C CD  . PRO A 1 13  ? 1.851   5.215  6.618  1.00 10.21 ? 28  PRO A CD  1 
ATOM   97   N N   . TYR A 1 14  ? 1.478   8.011  9.160  1.00 8.51  ? 29  TYR A N   1 
ATOM   98   C CA  . TYR A 1 14  ? 1.314   8.714  10.429 1.00 9.60  ? 29  TYR A CA  1 
ATOM   99   C C   . TYR A 1 14  ? 2.195   9.930  10.521 1.00 9.97  ? 29  TYR A C   1 
ATOM   100  O O   . TYR A 1 14  ? 2.055   10.736 11.431 1.00 9.48  ? 29  TYR A O   1 
ATOM   101  C CB  . TYR A 1 14  ? 1.672   7.774  11.585 1.00 9.52  ? 29  TYR A CB  1 
ATOM   102  C CG  . TYR A 1 14  ? 3.008   7.097  11.423 1.00 8.30  ? 29  TYR A CG  1 
ATOM   103  C CD1 . TYR A 1 14  ? 4.204   7.783  11.658 1.00 5.09  ? 29  TYR A CD1 1 
ATOM   104  C CD2 . TYR A 1 14  ? 3.079   5.781  10.971 1.00 9.79  ? 29  TYR A CD2 1 
ATOM   105  C CE1 . TYR A 1 14  ? 5.430   7.177  11.438 1.00 7.15  ? 29  TYR A CE1 1 
ATOM   106  C CE2 . TYR A 1 14  ? 4.296   5.166  10.750 1.00 11.23 ? 29  TYR A CE2 1 
ATOM   107  C CZ  . TYR A 1 14  ? 5.467   5.864  10.981 1.00 10.79 ? 29  TYR A CZ  1 
ATOM   108  O OH  . TYR A 1 14  ? 6.665   5.226  10.757 1.00 12.34 ? 29  TYR A OH  1 
ATOM   109  N N   . MET A 1 15  ? 3.112   10.072 9.575  1.00 10.43 ? 30  MET A N   1 
ATOM   110  C CA  . MET A 1 15  ? 4.059   11.181 9.608  1.00 10.33 ? 30  MET A CA  1 
ATOM   111  C C   . MET A 1 15  ? 3.436   12.555 9.419  1.00 8.87  ? 30  MET A C   1 
ATOM   112  O O   . MET A 1 15  ? 2.644   12.773 8.505  1.00 12.13 ? 30  MET A O   1 
ATOM   113  C CB  . MET A 1 15  ? 5.197   10.941 8.594  1.00 9.29  ? 30  MET A CB  1 
ATOM   114  C CG  . MET A 1 15  ? 6.451   11.788 8.824  1.00 13.67 ? 30  MET A CG  1 
ATOM   115  S SD  . MET A 1 15  ? 7.320   11.458 10.404 1.00 17.77 ? 30  MET A SD  1 
ATOM   116  C CE  . MET A 1 15  ? 7.899   13.110 10.724 1.00 10.47 ? 30  MET A CE  1 
ATOM   117  N N   . ALA A 1 16  ? 3.811   13.485 10.284 1.00 7.64  ? 31  ALA A N   1 
ATOM   118  C CA  . ALA A 1 16  ? 3.289   14.835 10.199 1.00 9.08  ? 31  ALA A CA  1 
ATOM   119  C C   . ALA A 1 16  ? 4.382   15.878 10.218 1.00 6.47  ? 31  ALA A C   1 
ATOM   120  O O   . ALA A 1 16  ? 5.435   15.685 10.841 1.00 6.40  ? 31  ALA A O   1 
ATOM   121  C CB  . ALA A 1 16  ? 2.330   15.104 11.378 1.00 11.00 ? 31  ALA A CB  1 
ATOM   122  N N   . SER A 1 17  ? 4.117   16.989 9.535  1.00 6.32  ? 32  SER A N   1 
ATOM   123  C CA  . SER A 1 17  ? 5.019   18.131 9.526  1.00 8.03  ? 32  SER A CA  1 
ATOM   124  C C   . SER A 1 17  ? 4.277   19.262 10.237 1.00 6.92  ? 32  SER A C   1 
ATOM   125  O O   . SER A 1 17  ? 3.187   19.670 9.812  1.00 8.73  ? 32  SER A O   1 
ATOM   126  C CB  . SER A 1 17  ? 5.376   18.576 8.109  1.00 6.56  ? 32  SER A CB  1 
ATOM   127  O OG  . SER A 1 17  ? 5.919   19.880 8.160  1.00 8.87  ? 32  SER A OG  1 
ATOM   128  N N   . VAL A 1 18  ? 4.861   19.719 11.340 1.00 8.50  ? 33  VAL A N   1 
ATOM   129  C CA  . VAL A 1 18  ? 4.322   20.804 12.142 1.00 10.53 ? 33  VAL A CA  1 
ATOM   130  C C   . VAL A 1 18  ? 4.974   22.054 11.568 1.00 9.27  ? 33  VAL A C   1 
ATOM   131  O O   . VAL A 1 18  ? 6.207   22.207 11.596 1.00 12.15 ? 33  VAL A O   1 
ATOM   132  C CB  . VAL A 1 18  ? 4.663   20.620 13.662 1.00 10.97 ? 33  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 18  ? 4.189   21.831 14.460 1.00 12.21 ? 33  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 18  ? 4.001   19.332 14.207 1.00 8.40  ? 33  VAL A CG2 1 
ATOM   135  N N   . GLN A 1 19  ? 4.137   22.941 11.043 1.00 10.40 ? 34  GLN A N   1 
ATOM   136  C CA  . GLN A 1 19  ? 4.583   24.159 10.379 1.00 13.27 ? 34  GLN A CA  1 
ATOM   137  C C   . GLN A 1 19  ? 4.242   25.450 11.107 1.00 14.76 ? 34  GLN A C   1 
ATOM   138  O O   . GLN A 1 19  ? 3.211   25.547 11.773 1.00 15.07 ? 34  GLN A O   1 
ATOM   139  C CB  . GLN A 1 19  ? 3.959   24.212 8.978  1.00 11.76 ? 34  GLN A CB  1 
ATOM   140  C CG  . GLN A 1 19  ? 3.915   22.853 8.303  1.00 14.48 ? 34  GLN A CG  1 
ATOM   141  C CD  . GLN A 1 19  ? 4.240   22.894 6.823  1.00 17.96 ? 34  GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 19  ? 5.034   22.081 6.327  1.00 16.98 ? 34  GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 19  ? 3.607   23.804 6.103  1.00 12.87 ? 34  GLN A NE2 1 
ATOM   144  N N   . LEU A 1 20  ? 5.105   26.446 10.951 1.00 16.72 ? 35  LEU A N   1 
ATOM   145  C CA  . LEU A 1 20  ? 4.896   27.761 11.535 1.00 20.42 ? 35  LEU A CA  1 
ATOM   146  C C   . LEU A 1 20  ? 4.939   28.714 10.356 1.00 23.95 ? 35  LEU A C   1 
ATOM   147  O O   . LEU A 1 20  ? 5.971   28.842 9.686  1.00 25.16 ? 35  LEU A O   1 
ATOM   148  C CB  . LEU A 1 20  ? 6.003   28.108 12.531 1.00 21.64 ? 35  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 20  ? 5.935   29.489 13.192 1.00 22.16 ? 35  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 20  ? 4.645   29.639 13.991 1.00 21.47 ? 35  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 20  ? 7.144   29.664 14.082 1.00 22.05 ? 35  LEU A CD2 1 
ATOM   152  N N   . ASN A 1 21  ? 3.799   29.323 10.048 1.00 26.20 ? 36  ASN A N   1 
ATOM   153  C CA  . ASN A 1 21  ? 3.704   30.264 8.928  1.00 29.81 ? 36  ASN A CA  1 
ATOM   154  C C   . ASN A 1 21  ? 4.118   29.639 7.591  1.00 29.75 ? 36  ASN A C   1 
ATOM   155  O O   . ASN A 1 21  ? 4.904   30.225 6.842  1.00 32.53 ? 36  ASN A O   1 
ATOM   156  C CB  . ASN A 1 21  ? 4.563   31.514 9.189  1.00 31.17 ? 36  ASN A CB  1 
ATOM   157  C CG  . ASN A 1 21  ? 4.129   32.270 10.425 1.00 33.34 ? 36  ASN A CG  1 
ATOM   158  O OD1 . ASN A 1 21  ? 2.946   32.601 10.588 1.00 33.42 ? 36  ASN A OD1 1 
ATOM   159  N ND2 . ASN A 1 21  ? 5.078   32.528 11.321 1.00 29.62 ? 36  ASN A ND2 1 
ATOM   160  N N   . GLY A 1 22  ? 3.627   28.435 7.321  1.00 27.30 ? 38  GLY A N   1 
ATOM   161  C CA  . GLY A 1 22  ? 3.928   27.765 6.065  1.00 27.23 ? 38  GLY A CA  1 
ATOM   162  C C   . GLY A 1 22  ? 5.281   27.089 5.919  1.00 26.12 ? 38  GLY A C   1 
ATOM   163  O O   . GLY A 1 22  ? 5.545   26.474 4.883  1.00 26.83 ? 38  GLY A O   1 
ATOM   164  N N   . ALA A 1 23  ? 6.117   27.161 6.951  1.00 22.85 ? 39  ALA A N   1 
ATOM   165  C CA  . ALA A 1 23  ? 7.442   26.555 6.918  1.00 20.03 ? 39  ALA A CA  1 
ATOM   166  C C   . ALA A 1 23  ? 7.537   25.392 7.886  1.00 17.37 ? 39  ALA A C   1 
ATOM   167  O O   . ALA A 1 23  ? 7.045   25.491 9.001  1.00 16.38 ? 39  ALA A O   1 
ATOM   168  C CB  . ALA A 1 23  ? 8.498   27.602 7.269  1.00 22.71 ? 39  ALA A CB  1 
ATOM   169  N N   . HIS A 1 24  ? 8.158   24.293 7.463  1.00 14.83 ? 40  HIS A N   1 
ATOM   170  C CA  . HIS A 1 24  ? 8.329   23.138 8.334  1.00 12.73 ? 40  HIS A CA  1 
ATOM   171  C C   . HIS A 1 24  ? 9.100   23.573 9.571  1.00 15.15 ? 40  HIS A C   1 
ATOM   172  O O   . HIS A 1 24  ? 10.129  24.252 9.463  1.00 14.78 ? 40  HIS A O   1 
ATOM   173  C CB  . HIS A 1 24  ? 9.118   22.020 7.645  1.00 10.84 ? 40  HIS A CB  1 
ATOM   174  C CG  . HIS A 1 24  ? 9.536   20.921 8.583  1.00 9.65  ? 40  HIS A CG  1 
ATOM   175  N ND1 . HIS A 1 24  ? 8.710   19.865 8.905  1.00 7.44  ? 40  HIS A ND1 1 
ATOM   176  C CD2 . HIS A 1 24  ? 10.689  20.717 9.268  1.00 9.30  ? 40  HIS A CD2 1 
ATOM   177  C CE1 . HIS A 1 24  ? 9.336   19.055 9.741  1.00 5.12  ? 40  HIS A CE1 1 
ATOM   178  N NE2 . HIS A 1 24  ? 10.538  19.549 9.978  1.00 9.11  ? 40  HIS A NE2 1 
ATOM   179  N N   . LEU A 1 25  ? 8.646   23.122 10.734 1.00 12.84 ? 41  LEU A N   1 
ATOM   180  C CA  . LEU A 1 25  ? 9.296   23.466 11.997 1.00 13.22 ? 41  LEU A CA  1 
ATOM   181  C C   . LEU A 1 25  ? 9.743   22.209 12.761 1.00 10.21 ? 41  LEU A C   1 
ATOM   182  O O   . LEU A 1 25  ? 10.909  22.062 13.140 1.00 11.78 ? 41  LEU A O   1 
ATOM   183  C CB  . LEU A 1 25  ? 8.329   24.303 12.863 1.00 15.77 ? 41  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 25  ? 8.807   24.739 14.252 1.00 19.96 ? 41  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 25  ? 9.953   25.740 14.121 1.00 21.87 ? 41  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 25  ? 7.662   25.355 15.021 1.00 17.52 ? 41  LEU A CD2 1 
ATOM   187  N N   . CYS A 1 26  ? 8.817   21.282 12.950 1.00 10.49 ? 42  CYS A N   1 
ATOM   188  C CA  . CYS A 1 26  ? 9.113   20.063 13.686 1.00 8.61  ? 42  CYS A CA  1 
ATOM   189  C C   . CYS A 1 26  ? 8.344   18.894 13.110 1.00 6.18  ? 42  CYS A C   1 
ATOM   190  O O   . CYS A 1 26  ? 7.395   19.082 12.357 1.00 9.28  ? 42  CYS A O   1 
ATOM   191  C CB  . CYS A 1 26  ? 8.690   20.234 15.156 1.00 10.27 ? 42  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 26  ? 9.811   21.233 16.175 1.00 15.51 ? 42  CYS A SG  1 
ATOM   193  N N   . GLY A 1 27  ? 8.777   17.690 13.458 1.00 6.64  ? 43  GLY A N   1 
ATOM   194  C CA  . GLY A 1 27  ? 8.080   16.490 13.032 1.00 7.59  ? 43  GLY A CA  1 
ATOM   195  C C   . GLY A 1 27  ? 6.923   16.277 14.016 1.00 10.36 ? 43  GLY A C   1 
ATOM   196  O O   . GLY A 1 27  ? 6.843   16.975 15.045 1.00 6.47  ? 43  GLY A O   1 
ATOM   197  N N   . GLY A 1 28  ? 6.057   15.318 13.706 1.00 9.00  ? 44  GLY A N   1 
ATOM   198  C CA  . GLY A 1 28  ? 4.912   15.019 14.546 1.00 11.66 ? 44  GLY A CA  1 
ATOM   199  C C   . GLY A 1 28  ? 4.397   13.656 14.154 1.00 11.23 ? 44  GLY A C   1 
ATOM   200  O O   . GLY A 1 28  ? 4.791   13.134 13.101 1.00 10.49 ? 44  GLY A O   1 
ATOM   201  N N   . VAL A 1 29  ? 3.537   13.067 14.991 1.00 8.88  ? 45  VAL A N   1 
ATOM   202  C CA  . VAL A 1 29  ? 2.968   11.742 14.736 1.00 8.38  ? 45  VAL A CA  1 
ATOM   203  C C   . VAL A 1 29  ? 1.460   11.788 14.954 1.00 10.13 ? 45  VAL A C   1 
ATOM   204  O O   . VAL A 1 29  ? 1.006   12.294 15.974 1.00 9.66  ? 45  VAL A O   1 
ATOM   205  C CB  . VAL A 1 29  ? 3.485   10.679 15.731 1.00 9.55  ? 45  VAL A CB  1 
ATOM   206  C CG1 . VAL A 1 29  ? 3.244   9.276  15.189 1.00 9.69  ? 45  VAL A CG1 1 
ATOM   207  C CG2 . VAL A 1 29  ? 4.934   10.931 16.108 1.00 12.92 ? 45  VAL A CG2 1 
ATOM   208  N N   . LEU A 1 30  ? 0.693   11.266 14.001 1.00 11.14 ? 46  LEU A N   1 
ATOM   209  C CA  . LEU A 1 30  ? -0.758  11.225 14.110 1.00 9.98  ? 46  LEU A CA  1 
ATOM   210  C C   . LEU A 1 30  ? -1.068  10.021 15.025 1.00 10.07 ? 46  LEU A C   1 
ATOM   211  O O   . LEU A 1 30  ? -0.668  8.887  14.728 1.00 8.82  ? 46  LEU A O   1 
ATOM   212  C CB  . LEU A 1 30  ? -1.400  11.046 12.725 1.00 7.94  ? 46  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 30  ? -2.930  11.083 12.637 1.00 9.82  ? 46  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 30  ? -3.446  12.486 12.860 1.00 7.99  ? 46  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 30  ? -3.387  10.583 11.279 1.00 11.35 ? 46  LEU A CD2 1 
ATOM   216  N N   . VAL A 1 31  ? -1.667  10.288 16.188 1.00 12.14 ? 47  VAL A N   1 
ATOM   217  C CA  . VAL A 1 31  ? -1.997  9.227  17.145 1.00 11.96 ? 47  VAL A CA  1 
ATOM   218  C C   . VAL A 1 31  ? -3.508  8.976  17.284 1.00 14.85 ? 47  VAL A C   1 
ATOM   219  O O   . VAL A 1 31  ? -3.924  8.006  17.921 1.00 15.93 ? 47  VAL A O   1 
ATOM   220  C CB  . VAL A 1 31  ? -1.382  9.500  18.552 1.00 13.92 ? 47  VAL A CB  1 
ATOM   221  C CG1 . VAL A 1 31  ? 0.133   9.457  18.475 1.00 12.79 ? 47  VAL A CG1 1 
ATOM   222  C CG2 . VAL A 1 31  ? -1.836  10.841 19.096 1.00 9.53  ? 47  VAL A CG2 1 
ATOM   223  N N   . ALA A 1 32  ? -4.317  9.836  16.673 1.00 14.44 ? 48  ALA A N   1 
ATOM   224  C CA  . ALA A 1 32  ? -5.774  9.724  16.700 1.00 17.09 ? 48  ALA A CA  1 
ATOM   225  C C   . ALA A 1 32  ? -6.300  10.524 15.508 1.00 16.42 ? 48  ALA A C   1 
ATOM   226  O O   . ALA A 1 32  ? -5.564  11.325 14.934 1.00 17.85 ? 48  ALA A O   1 
ATOM   227  C CB  . ALA A 1 32  ? -6.320  10.305 18.010 1.00 16.59 ? 48  ALA A CB  1 
ATOM   228  N N   . GLU A 1 33  ? -7.574  10.363 15.163 1.00 16.64 ? 49  GLU A N   1 
ATOM   229  C CA  . GLU A 1 33  ? -8.118  11.093 14.018 1.00 16.93 ? 49  GLU A CA  1 
ATOM   230  C C   . GLU A 1 33  ? -7.970  12.599 14.086 1.00 15.59 ? 49  GLU A C   1 
ATOM   231  O O   . GLU A 1 33  ? -7.820  13.241 13.056 1.00 13.51 ? 49  GLU A O   1 
ATOM   232  C CB  . GLU A 1 33  ? -9.586  10.780 13.805 1.00 20.36 ? 49  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 33  ? -9.845  9.394  13.316 1.00 28.13 ? 49  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 33  ? -11.311 9.168  13.037 1.00 35.25 ? 49  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 33  ? -11.891 9.947  12.248 1.00 37.82 ? 49  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 33  ? -11.887 8.224  13.622 1.00 40.28 ? 49  GLU A OE2 1 
ATOM   237  N N   . GLN A 1 34  ? -8.021  13.167 15.288 1.00 12.36 ? 50  GLN A N   1 
ATOM   238  C CA  . GLN A 1 34  ? -7.920  14.607 15.429 1.00 12.58 ? 50  GLN A CA  1 
ATOM   239  C C   . GLN A 1 34  ? -6.747  15.065 16.295 1.00 10.49 ? 50  GLN A C   1 
ATOM   240  O O   . GLN A 1 34  ? -6.690  16.227 16.681 1.00 11.11 ? 50  GLN A O   1 
ATOM   241  C CB  . GLN A 1 34  ? -9.236  15.127 15.999 1.00 13.30 ? 50  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 34  ? -9.485  16.601 15.791 1.00 16.63 ? 50  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 34  ? -10.867 17.028 16.261 1.00 21.79 ? 50  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 34  ? -11.680 16.200 16.668 1.00 23.37 ? 50  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 34  ? -11.140 18.316 16.197 1.00 15.60 ? 50  GLN A NE2 1 
ATOM   246  N N   . TRP A 1 35  ? -5.776  14.187 16.542 1.00 10.44 ? 51  TRP A N   1 
ATOM   247  C CA  . TRP A 1 35  ? -4.649  14.534 17.405 1.00 10.69 ? 51  TRP A CA  1 
ATOM   248  C C   . TRP A 1 35  ? -3.260  14.169 16.908 1.00 8.50  ? 51  TRP A C   1 
ATOM   249  O O   . TRP A 1 35  ? -3.008  13.019 16.556 1.00 7.25  ? 51  TRP A O   1 
ATOM   250  C CB  . TRP A 1 35  ? -4.821  13.865 18.776 1.00 10.10 ? 51  TRP A CB  1 
ATOM   251  C CG  . TRP A 1 35  ? -5.956  14.409 19.579 1.00 12.68 ? 51  TRP A CG  1 
ATOM   252  C CD1 . TRP A 1 35  ? -7.238  13.936 19.607 1.00 11.98 ? 51  TRP A CD1 1 
ATOM   253  C CD2 . TRP A 1 35  ? -5.922  15.542 20.458 1.00 10.80 ? 51  TRP A CD2 1 
ATOM   254  N NE1 . TRP A 1 35  ? -8.008  14.716 20.448 1.00 13.14 ? 51  TRP A NE1 1 
ATOM   255  C CE2 . TRP A 1 35  ? -7.225  15.704 20.985 1.00 12.61 ? 51  TRP A CE2 1 
ATOM   256  C CE3 . TRP A 1 35  ? -4.922  16.434 20.855 1.00 10.46 ? 51  TRP A CE3 1 
ATOM   257  C CZ2 . TRP A 1 35  ? -7.545  16.719 21.888 1.00 12.21 ? 51  TRP A CZ2 1 
ATOM   258  C CZ3 . TRP A 1 35  ? -5.241  17.448 21.756 1.00 14.26 ? 51  TRP A CZ3 1 
ATOM   259  C CH2 . TRP A 1 35  ? -6.542  17.583 22.260 1.00 10.82 ? 51  TRP A CH2 1 
ATOM   260  N N   . VAL A 1 36  ? -2.354  15.132 17.012 1.00 8.22  ? 52  VAL A N   1 
ATOM   261  C CA  . VAL A 1 36  ? -0.962  14.951 16.631 1.00 10.98 ? 52  VAL A CA  1 
ATOM   262  C C   . VAL A 1 36  ? -0.048  15.175 17.840 1.00 9.93  ? 52  VAL A C   1 
ATOM   263  O O   . VAL A 1 36  ? -0.185  16.167 18.562 1.00 10.78 ? 52  VAL A O   1 
ATOM   264  C CB  . VAL A 1 36  ? -0.518  15.944 15.510 1.00 10.09 ? 52  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 36  ? 0.991   15.804 15.247 1.00 8.31  ? 52  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 36  ? -1.275  15.657 14.209 1.00 10.08 ? 52  VAL A CG2 1 
ATOM   267  N N   . LEU A 1 37  ? 0.888   14.250 18.037 1.00 9.41  ? 53  LEU A N   1 
ATOM   268  C CA  . LEU A 1 37  ? 1.876   14.325 19.115 1.00 9.53  ? 53  LEU A CA  1 
ATOM   269  C C   . LEU A 1 37  ? 3.215   14.880 18.577 1.00 11.17 ? 53  LEU A C   1 
ATOM   270  O O   . LEU A 1 37  ? 3.693   14.437 17.520 1.00 10.19 ? 53  LEU A O   1 
ATOM   271  C CB  . LEU A 1 37  ? 2.098   12.921 19.708 1.00 9.31  ? 53  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 37  ? 3.117   12.715 20.832 1.00 9.39  ? 53  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 37  ? 2.656   13.405 22.126 1.00 12.32 ? 53  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 37  ? 3.277   11.222 21.057 1.00 7.96  ? 53  LEU A CD2 1 
ATOM   275  N N   . SER A 1 38  ? 3.793   15.844 19.293 1.00 8.40  ? 54  SER A N   1 
ATOM   276  C CA  . SER A 1 38  ? 5.075   16.468 18.934 1.00 10.34 ? 54  SER A CA  1 
ATOM   277  C C   . SER A 1 38  ? 5.847   16.823 20.228 1.00 11.12 ? 54  SER A C   1 
ATOM   278  O O   . SER A 1 38  ? 5.528   16.299 21.307 1.00 13.04 ? 54  SER A O   1 
ATOM   279  C CB  . SER A 1 38  ? 4.840   17.709 18.059 1.00 11.64 ? 54  SER A CB  1 
ATOM   280  O OG  . SER A 1 38  ? 6.050   18.218 17.503 1.00 8.70  ? 54  SER A OG  1 
ATOM   281  N N   . ALA A 1 39  ? 6.861   17.679 20.131 1.00 9.16  ? 55  ALA A N   1 
ATOM   282  C CA  . ALA A 1 39  ? 7.663   18.078 21.281 1.00 5.55  ? 55  ALA A CA  1 
ATOM   283  C C   . ALA A 1 39  ? 7.279   19.487 21.703 1.00 7.82  ? 55  ALA A C   1 
ATOM   284  O O   . ALA A 1 39  ? 7.076   20.368 20.870 1.00 9.12  ? 55  ALA A O   1 
ATOM   285  C CB  . ALA A 1 39  ? 9.152   18.002 20.963 1.00 4.15  ? 55  ALA A CB  1 
ATOM   286  N N   . ALA A 1 40  ? 7.223   19.706 23.016 1.00 11.14 ? 56  ALA A N   1 
ATOM   287  C CA  . ALA A 1 40  ? 6.838   20.995 23.595 1.00 11.94 ? 56  ALA A CA  1 
ATOM   288  C C   . ALA A 1 40  ? 7.693   22.205 23.203 1.00 11.21 ? 56  ALA A C   1 
ATOM   289  O O   . ALA A 1 40  ? 7.163   23.277 22.895 1.00 13.71 ? 56  ALA A O   1 
ATOM   290  C CB  . ALA A 1 40  ? 6.762   20.872 25.136 1.00 10.53 ? 56  ALA A CB  1 
ATOM   291  N N   . HIS A 1 41  ? 9.010   22.054 23.225 1.00 13.81 ? 57  HIS A N   1 
ATOM   292  C CA  . HIS A 1 41  ? 9.876   23.173 22.883 1.00 18.99 ? 57  HIS A CA  1 
ATOM   293  C C   . HIS A 1 41  ? 9.729   23.675 21.454 1.00 19.67 ? 57  HIS A C   1 
ATOM   294  O O   . HIS A 1 41  ? 10.239  24.744 21.129 1.00 19.32 ? 57  HIS A O   1 
ATOM   295  C CB  . HIS A 1 41  ? 11.323  22.864 23.233 1.00 23.71 ? 57  HIS A CB  1 
ATOM   296  C CG  . HIS A 1 41  ? 11.530  22.630 24.696 1.00 31.49 ? 57  HIS A CG  1 
ATOM   297  N ND1 . HIS A 1 41  ? 11.132  23.538 25.654 1.00 36.17 ? 57  HIS A ND1 1 
ATOM   298  C CD2 . HIS A 1 41  ? 12.018  21.561 25.372 1.00 35.62 ? 57  HIS A CD2 1 
ATOM   299  C CE1 . HIS A 1 41  ? 11.357  23.038 26.856 1.00 36.54 ? 57  HIS A CE1 1 
ATOM   300  N NE2 . HIS A 1 41  ? 11.894  21.841 26.712 1.00 37.66 ? 57  HIS A NE2 1 
ATOM   301  N N   . CYS A 1 42  ? 9.008   22.928 20.620 1.00 21.61 ? 58  CYS A N   1 
ATOM   302  C CA  . CYS A 1 42  ? 8.743   23.332 19.231 1.00 25.47 ? 58  CYS A CA  1 
ATOM   303  C C   . CYS A 1 42  ? 7.742   24.488 19.242 1.00 29.97 ? 58  CYS A C   1 
ATOM   304  O O   . CYS A 1 42  ? 7.760   25.366 18.378 1.00 29.61 ? 58  CYS A O   1 
ATOM   305  C CB  . CYS A 1 42  ? 8.121   22.168 18.449 1.00 23.41 ? 58  CYS A CB  1 
ATOM   306  S SG  . CYS A 1 42  ? 9.242   20.781 18.077 1.00 22.71 ? 58  CYS A SG  1 
ATOM   307  N N   . LEU A 1 43  ? 6.840   24.450 20.217 1.00 35.91 ? 59  LEU A N   1 
ATOM   308  C CA  . LEU A 1 43  ? 5.810   25.466 20.383 1.00 43.89 ? 59  LEU A CA  1 
ATOM   309  C C   . LEU A 1 43  ? 6.420   26.726 20.976 1.00 48.35 ? 59  LEU A C   1 
ATOM   310  O O   . LEU A 1 43  ? 5.953   27.828 20.700 1.00 49.41 ? 59  LEU A O   1 
ATOM   311  C CB  . LEU A 1 43  ? 4.709   24.950 21.311 1.00 46.88 ? 59  LEU A CB  1 
ATOM   312  C CG  . LEU A 1 43  ? 3.397   25.735 21.342 1.00 49.21 ? 59  LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 43  ? 2.667   25.530 20.019 1.00 49.33 ? 59  LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 43  ? 2.528   25.271 22.512 1.00 48.63 ? 59  LEU A CD2 1 
ATOM   315  N N   . GLU A 1 44  ? 7.466   26.552 21.783 1.00 53.87 ? 60  GLU A N   1 
ATOM   316  C CA  . GLU A 1 44  ? 8.168   27.665 22.424 1.00 59.00 ? 60  GLU A CA  1 
ATOM   317  C C   . GLU A 1 44  ? 8.454   28.763 21.394 1.00 61.76 ? 60  GLU A C   1 
ATOM   318  O O   . GLU A 1 44  ? 8.371   29.951 21.702 1.00 62.72 ? 60  GLU A O   1 
ATOM   319  C CB  . GLU A 1 44  ? 9.475   27.172 23.060 1.00 60.31 ? 60  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 44  ? 10.211  28.215 23.902 1.00 64.18 ? 60  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 44  ? 11.601  27.765 24.353 1.00 66.19 ? 60  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 44  ? 11.827  26.543 24.497 1.00 67.24 ? 60  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 44  ? 12.469  28.641 24.568 1.00 65.72 ? 60  GLU A OE2 1 
ATOM   324  N N   . ASP A 1 45  ? 8.777   28.358 20.169 1.00 66.23 ? 61  ASP A N   1 
ATOM   325  C CA  . ASP A 1 45  ? 9.040   29.304 19.085 1.00 68.93 ? 61  ASP A CA  1 
ATOM   326  C C   . ASP A 1 45  ? 7.813   29.444 18.178 1.00 68.84 ? 61  ASP A C   1 
ATOM   327  O O   . ASP A 1 45  ? 7.554   30.506 17.631 1.00 67.45 ? 61  ASP A O   1 
ATOM   328  C CB  . ASP A 1 45  ? 10.247  28.862 18.258 1.00 71.70 ? 61  ASP A CB  1 
ATOM   329  C CG  . ASP A 1 45  ? 10.556  29.821 17.127 1.00 74.48 ? 61  ASP A CG  1 
ATOM   330  O OD1 . ASP A 1 45  ? 10.925  30.985 17.412 1.00 76.74 ? 61  ASP A OD1 1 
ATOM   331  O OD2 . ASP A 1 45  ? 10.412  29.414 15.953 1.00 75.91 ? 61  ASP A OD2 1 
ATOM   332  N N   . ALA A 1 46  A 7.049   28.369 18.036 1.00 69.90 ? 61  ALA A N   1 
ATOM   333  C CA  . ALA A 1 46  A 5.849   28.388 17.208 1.00 71.05 ? 61  ALA A CA  1 
ATOM   334  C C   . ALA A 1 46  A 4.900   29.504 17.630 1.00 71.44 ? 61  ALA A C   1 
ATOM   335  O O   . ALA A 1 46  A 4.024   29.903 16.867 1.00 72.25 ? 61  ALA A O   1 
ATOM   336  C CB  . ALA A 1 46  A 5.138   27.042 17.285 1.00 72.05 ? 61  ALA A CB  1 
ATOM   337  N N   . ALA A 1 47  B 5.084   30.006 18.846 1.00 70.96 ? 61  ALA A N   1 
ATOM   338  C CA  . ALA A 1 47  B 4.243   31.068 19.380 1.00 71.72 ? 61  ALA A CA  1 
ATOM   339  C C   . ALA A 1 47  B 4.246   32.330 18.530 1.00 71.56 ? 61  ALA A C   1 
ATOM   340  O O   . ALA A 1 47  B 3.338   33.156 18.640 1.00 71.64 ? 61  ALA A O   1 
ATOM   341  C CB  . ALA A 1 47  B 4.653   31.396 20.806 1.00 72.89 ? 61  ALA A CB  1 
ATOM   342  N N   . ASP A 1 48  C 5.274   32.497 17.705 1.00 71.18 ? 61  ASP A N   1 
ATOM   343  C CA  . ASP A 1 48  C 5.356   33.673 16.844 1.00 69.18 ? 61  ASP A CA  1 
ATOM   344  C C   . ASP A 1 48  C 4.782   33.438 15.440 1.00 64.56 ? 61  ASP A C   1 
ATOM   345  O O   . ASP A 1 48  C 5.507   33.483 14.436 1.00 64.70 ? 61  ASP A O   1 
ATOM   346  C CB  . ASP A 1 48  C 6.796   34.220 16.781 1.00 73.21 ? 61  ASP A CB  1 
ATOM   347  C CG  . ASP A 1 48  C 7.853   33.136 16.932 1.00 77.32 ? 61  ASP A CG  1 
ATOM   348  O OD1 . ASP A 1 48  C 8.264   32.545 15.909 1.00 79.11 ? 61  ASP A OD1 1 
ATOM   349  O OD2 . ASP A 1 48  C 8.276   32.878 18.083 1.00 79.47 ? 61  ASP A OD2 1 
ATOM   350  N N   . GLY A 1 49  ? 3.474   33.190 15.385 1.00 58.38 ? 62  GLY A N   1 
ATOM   351  C CA  . GLY A 1 49  ? 2.811   32.956 14.116 1.00 50.81 ? 62  GLY A CA  1 
ATOM   352  C C   . GLY A 1 49  ? 1.685   31.936 14.164 1.00 45.31 ? 62  GLY A C   1 
ATOM   353  O O   . GLY A 1 49  ? 1.200   31.586 15.242 1.00 45.33 ? 62  GLY A O   1 
ATOM   354  N N   . LYS A 1 50  ? 1.268   31.473 12.984 1.00 38.89 ? 63  LYS A N   1 
ATOM   355  C CA  . LYS A 1 50  ? 0.189   30.493 12.830 1.00 33.62 ? 63  LYS A CA  1 
ATOM   356  C C   . LYS A 1 50  ? 0.724   29.073 12.622 1.00 30.92 ? 63  LYS A C   1 
ATOM   357  O O   . LYS A 1 50  ? 1.452   28.811 11.659 1.00 29.55 ? 63  LYS A O   1 
ATOM   358  C CB  . LYS A 1 50  ? -0.690  30.890 11.646 1.00 33.11 ? 63  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 50  ? -1.861  29.969 11.375 1.00 32.84 ? 63  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 50  ? -2.547  30.416 10.099 1.00 31.18 ? 63  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 50  ? -3.643  29.477 9.682  1.00 30.88 ? 63  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 50  ? -4.552  29.216 10.811 1.00 34.69 ? 63  LYS A NZ  1 
ATOM   363  N N   . VAL A 1 51  ? 0.326   28.164 13.512 1.00 27.53 ? 64  VAL A N   1 
ATOM   364  C CA  . VAL A 1 51  ? 0.748   26.764 13.480 1.00 23.64 ? 64  VAL A CA  1 
ATOM   365  C C   . VAL A 1 51  ? -0.243  25.883 12.716 1.00 21.28 ? 64  VAL A C   1 
ATOM   366  O O   . VAL A 1 51  ? -1.455  25.966 12.925 1.00 18.81 ? 64  VAL A O   1 
ATOM   367  C CB  . VAL A 1 51  ? 1.007   26.231 14.934 1.00 24.83 ? 64  VAL A CB  1 
ATOM   368  C CG1 . VAL A 1 51  ? -0.071  26.704 15.860 1.00 29.86 ? 64  VAL A CG1 1 
ATOM   369  C CG2 . VAL A 1 51  ? 1.095   24.701 14.972 1.00 26.10 ? 64  VAL A CG2 1 
ATOM   370  N N   . GLN A 1 52  ? 0.282   25.080 11.793 1.00 16.18 ? 65  GLN A N   1 
ATOM   371  C CA  . GLN A 1 52  ? -0.528  24.175 10.980 1.00 13.50 ? 65  GLN A CA  1 
ATOM   372  C C   . GLN A 1 52  ? 0.133   22.814 10.931 1.00 9.37  ? 65  GLN A C   1 
ATOM   373  O O   . GLN A 1 52  ? 1.301   22.682 11.284 1.00 12.97 ? 65  GLN A O   1 
ATOM   374  C CB  . GLN A 1 52  ? -0.695  24.718 9.558  1.00 12.32 ? 65  GLN A CB  1 
ATOM   375  C CG  . GLN A 1 52  ? -1.608  25.914 9.488  1.00 13.13 ? 65  GLN A CG  1 
ATOM   376  C CD  . GLN A 1 52  ? -1.567  26.586 8.146  1.00 18.86 ? 65  GLN A CD  1 
ATOM   377  O OE1 . GLN A 1 52  ? -0.553  27.170 7.767  1.00 24.78 ? 65  GLN A OE1 1 
ATOM   378  N NE2 . GLN A 1 52  ? -2.667  26.512 7.415  1.00 18.72 ? 65  GLN A NE2 1 
ATOM   379  N N   . VAL A 1 53  ? -0.620  21.805 10.522 1.00 7.79  ? 66  VAL A N   1 
ATOM   380  C CA  . VAL A 1 53  ? -0.113  20.448 10.448 1.00 8.93  ? 66  VAL A CA  1 
ATOM   381  C C   . VAL A 1 53  ? -0.336  19.881 9.055  1.00 10.08 ? 66  VAL A C   1 
ATOM   382  O O   . VAL A 1 53  ? -1.463  19.823 8.565  1.00 11.92 ? 66  VAL A O   1 
ATOM   383  C CB  . VAL A 1 53  ? -0.800  19.530 11.477 1.00 9.27  ? 66  VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 53  ? -0.338  18.107 11.308 1.00 9.64  ? 66  VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 53  ? -0.506  20.017 12.882 1.00 10.18 ? 66  VAL A CG2 1 
ATOM   386  N N   . LEU A 1 54  ? 0.748   19.465 8.412  1.00 11.12 ? 67  LEU A N   1 
ATOM   387  C CA  . LEU A 1 54  ? 0.648   18.896 7.073  1.00 9.02  ? 67  LEU A CA  1 
ATOM   388  C C   . LEU A 1 54  ? 0.658   17.377 7.172  1.00 6.35  ? 67  LEU A C   1 
ATOM   389  O O   . LEU A 1 54  ? 1.604   16.771 7.699  1.00 11.38 ? 67  LEU A O   1 
ATOM   390  C CB  . LEU A 1 54  ? 1.799   19.409 6.184  1.00 9.59  ? 67  LEU A CB  1 
ATOM   391  C CG  . LEU A 1 54  ? 1.890   18.835 4.760  1.00 8.85  ? 67  LEU A CG  1 
ATOM   392  C CD1 . LEU A 1 54  ? 0.752   19.338 3.909  1.00 9.13  ? 67  LEU A CD1 1 
ATOM   393  C CD2 . LEU A 1 54  ? 3.237   19.200 4.147  1.00 13.04 ? 67  LEU A CD2 1 
ATOM   394  N N   . LEU A 1 55  ? -0.395  16.759 6.654  1.00 6.66  ? 68  LEU A N   1 
ATOM   395  C CA  . LEU A 1 55  ? -0.532  15.307 6.668  1.00 8.89  ? 68  LEU A CA  1 
ATOM   396  C C   . LEU A 1 55  ? -0.530  14.753 5.241  1.00 6.67  ? 68  LEU A C   1 
ATOM   397  O O   . LEU A 1 55  ? -0.889  15.463 4.318  1.00 8.76  ? 68  LEU A O   1 
ATOM   398  C CB  . LEU A 1 55  ? -1.864  14.925 7.340  1.00 11.25 ? 68  LEU A CB  1 
ATOM   399  C CG  . LEU A 1 55  ? -2.031  15.264 8.832  1.00 14.61 ? 68  LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 55  ? -3.403  14.765 9.282  1.00 12.06 ? 68  LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 55  ? -0.912  14.596 9.651  1.00 9.89  ? 68  LEU A CD2 1 
ATOM   402  N N   . GLY A 1 56  ? -0.190  13.478 5.096  1.00 6.46  ? 69  GLY A N   1 
ATOM   403  C CA  . GLY A 1 56  ? -0.183  12.819 3.795  1.00 8.75  ? 69  GLY A CA  1 
ATOM   404  C C   . GLY A 1 56  ? 0.871   13.306 2.814  1.00 11.47 ? 69  GLY A C   1 
ATOM   405  O O   . GLY A 1 56  ? 0.715   13.136 1.601  1.00 14.27 ? 69  GLY A O   1 
ATOM   406  N N   . ALA A 1 57  ? 1.966   13.864 3.318  1.00 9.49  ? 70  ALA A N   1 
ATOM   407  C CA  . ALA A 1 57  ? 2.996   14.386 2.433  1.00 10.03 ? 70  ALA A CA  1 
ATOM   408  C C   . ALA A 1 57  ? 4.243   13.540 2.324  1.00 11.94 ? 70  ALA A C   1 
ATOM   409  O O   . ALA A 1 57  ? 4.515   12.688 3.174  1.00 11.55 ? 70  ALA A O   1 
ATOM   410  C CB  . ALA A 1 57  ? 3.394   15.780 2.879  1.00 8.16  ? 70  ALA A CB  1 
ATOM   411  N N   . HIS A 1 58  ? 4.946   13.715 1.205  1.00 11.91 ? 71  HIS A N   1 
ATOM   412  C CA  . HIS A 1 58  ? 6.251   13.090 1.010  1.00 11.33 ? 71  HIS A CA  1 
ATOM   413  C C   . HIS A 1 58  ? 7.156   14.297 0.721  1.00 9.85  ? 71  HIS A C   1 
ATOM   414  O O   . HIS A 1 58  ? 8.143   14.531 1.397  1.00 9.60  ? 71  HIS A O   1 
ATOM   415  C CB  . HIS A 1 58  ? 6.294   12.100 -0.155 1.00 9.92  ? 71  HIS A CB  1 
ATOM   416  C CG  . HIS A 1 58  ? 7.625   11.438 -0.299 1.00 12.17 ? 71  HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 58  ? 8.191   10.699 0.717  1.00 13.82 ? 71  HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 58  ? 8.548   11.487 -1.288 1.00 13.99 ? 71  HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 58  ? 9.409   10.327 0.364  1.00 15.91 ? 71  HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 58  ? 9.649   10.792 -0.849 1.00 11.15 ? 71  HIS A NE2 1 
ATOM   421  N N   . SER A 1 59  ? 6.740   15.107 -0.242 1.00 9.85  ? 72  SER A N   1 
ATOM   422  C CA  . SER A 1 59  ? 7.456   16.304 -0.627 1.00 10.50 ? 72  SER A CA  1 
ATOM   423  C C   . SER A 1 59  ? 6.804   17.491 0.051  1.00 8.65  ? 72  SER A C   1 
ATOM   424  O O   . SER A 1 59  ? 5.589   17.630 0.009  1.00 12.72 ? 72  SER A O   1 
ATOM   425  C CB  . SER A 1 59  ? 7.344   16.497 -2.145 1.00 9.34  ? 72  SER A CB  1 
ATOM   426  O OG  . SER A 1 59  ? 7.675   17.826 -2.527 1.00 13.58 ? 72  SER A OG  1 
ATOM   427  N N   . LEU A 1 60  ? 7.610   18.375 0.619  1.00 10.92 ? 73  LEU A N   1 
ATOM   428  C CA  . LEU A 1 60  ? 7.083   19.565 1.254  1.00 12.11 ? 73  LEU A CA  1 
ATOM   429  C C   . LEU A 1 60  ? 6.604   20.620 0.248  1.00 14.15 ? 73  LEU A C   1 
ATOM   430  O O   . LEU A 1 60  ? 5.697   21.389 0.549  1.00 13.79 ? 73  LEU A O   1 
ATOM   431  C CB  . LEU A 1 60  ? 8.133   20.184 2.172  1.00 12.31 ? 73  LEU A CB  1 
ATOM   432  C CG  . LEU A 1 60  ? 8.582   19.453 3.442  1.00 12.83 ? 73  LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 60  ? 9.699   20.247 4.128  1.00 12.42 ? 73  LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 60  ? 7.395   19.278 4.400  1.00 15.86 ? 73  LEU A CD2 1 
ATOM   435  N N   . SER A 1 61  ? 7.167   20.628 -0.959 1.00 17.44 ? 74  SER A N   1 
ATOM   436  C CA  . SER A 1 61  ? 6.816   21.642 -1.961 1.00 18.17 ? 74  SER A CA  1 
ATOM   437  C C   . SER A 1 61  ? 5.953   21.246 -3.168 1.00 17.10 ? 74  SER A C   1 
ATOM   438  O O   . SER A 1 61  ? 5.333   22.098 -3.798 1.00 20.58 ? 74  SER A O   1 
ATOM   439  C CB  . SER A 1 61  ? 8.097   22.323 -2.459 1.00 16.60 ? 74  SER A CB  1 
ATOM   440  O OG  . SER A 1 61  ? 8.888   21.410 -3.187 1.00 14.44 ? 74  SER A OG  1 
ATOM   441  N N   . GLN A 1 62  ? 5.909   19.972 -3.502 1.00 19.06 ? 75  GLN A N   1 
ATOM   442  C CA  . GLN A 1 62  ? 5.139   19.557 -4.658 1.00 23.58 ? 75  GLN A CA  1 
ATOM   443  C C   . GLN A 1 62  ? 3.739   19.097 -4.303 1.00 24.01 ? 75  GLN A C   1 
ATOM   444  O O   . GLN A 1 62  ? 3.509   18.566 -3.217 1.00 23.02 ? 75  GLN A O   1 
ATOM   445  C CB  . GLN A 1 62  ? 5.871   18.440 -5.416 1.00 24.97 ? 75  GLN A CB  1 
ATOM   446  C CG  . GLN A 1 62  ? 7.244   18.856 -5.941 1.00 35.64 ? 75  GLN A CG  1 
ATOM   447  C CD  . GLN A 1 62  ? 7.741   17.979 -7.092 1.00 39.91 ? 75  GLN A CD  1 
ATOM   448  O OE1 . GLN A 1 62  ? 7.569   16.754 -7.073 1.00 42.85 ? 75  GLN A OE1 1 
ATOM   449  N NE2 . GLN A 1 62  ? 8.364   18.605 -8.097 1.00 37.02 ? 75  GLN A NE2 1 
ATOM   450  N N   . PRO A 1 63  ? 2.762   19.397 -5.174 1.00 24.11 ? 76  PRO A N   1 
ATOM   451  C CA  . PRO A 1 63  ? 1.385   18.977 -4.919 1.00 21.56 ? 76  PRO A CA  1 
ATOM   452  C C   . PRO A 1 63  ? 1.295   17.450 -4.972 1.00 21.02 ? 76  PRO A C   1 
ATOM   453  O O   . PRO A 1 63  ? 1.954   16.792 -5.788 1.00 19.13 ? 76  PRO A O   1 
ATOM   454  C CB  . PRO A 1 63  ? 0.611   19.618 -6.077 1.00 24.61 ? 76  PRO A CB  1 
ATOM   455  C CG  . PRO A 1 63  ? 1.375   20.859 -6.344 1.00 23.89 ? 76  PRO A CG  1 
ATOM   456  C CD  . PRO A 1 63  ? 2.813   20.394 -6.259 1.00 24.14 ? 76  PRO A CD  1 
ATOM   457  N N   . GLU A 1 64  ? 0.507   16.891 -4.066 1.00 18.26 ? 77  GLU A N   1 
ATOM   458  C CA  . GLU A 1 64  ? 0.288   15.455 -3.989 1.00 19.07 ? 77  GLU A CA  1 
ATOM   459  C C   . GLU A 1 64  ? -1.181  15.298 -3.643 1.00 18.52 ? 77  GLU A C   1 
ATOM   460  O O   . GLU A 1 64  ? -1.712  16.040 -2.821 1.00 19.50 ? 77  GLU A O   1 
ATOM   461  C CB  . GLU A 1 64  ? 1.173   14.830 -2.911 1.00 20.55 ? 77  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 64  ? 2.650   14.887 -3.253 1.00 20.37 ? 77  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 64  ? 3.557   14.504 -2.100 1.00 22.17 ? 77  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 64  ? 3.064   14.296 -0.974 1.00 19.83 ? 77  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 64  ? 4.783   14.423 -2.325 1.00 23.43 ? 77  GLU A OE2 1 
ATOM   466  N N   . PRO A 1 65  ? -1.861  14.340 -4.272 1.00 19.92 ? 78  PRO A N   1 
ATOM   467  C CA  . PRO A 1 65  ? -3.287  14.132 -4.001 1.00 21.40 ? 78  PRO A CA  1 
ATOM   468  C C   . PRO A 1 65  ? -3.633  13.886 -2.522 1.00 20.49 ? 78  PRO A C   1 
ATOM   469  O O   . PRO A 1 65  ? -4.687  14.314 -2.055 1.00 24.41 ? 78  PRO A O   1 
ATOM   470  C CB  . PRO A 1 65  ? -3.626  12.926 -4.884 1.00 20.86 ? 78  PRO A CB  1 
ATOM   471  C CG  . PRO A 1 65  ? -2.612  13.029 -6.008 1.00 21.55 ? 78  PRO A CG  1 
ATOM   472  C CD  . PRO A 1 65  ? -1.363  13.365 -5.259 1.00 21.06 ? 78  PRO A CD  1 
ATOM   473  N N   . SER A 1 66  ? -2.727  13.251 -1.784 1.00 20.33 ? 79  SER A N   1 
ATOM   474  C CA  . SER A 1 66  ? -2.952  12.947 -0.370 1.00 20.45 ? 79  SER A CA  1 
ATOM   475  C C   . SER A 1 66  ? -2.642  14.077 0.608  1.00 20.23 ? 79  SER A C   1 
ATOM   476  O O   . SER A 1 66  ? -3.022  14.000 1.782  1.00 20.30 ? 79  SER A O   1 
ATOM   477  C CB  . SER A 1 66  ? -2.114  11.736 0.021  1.00 20.40 ? 79  SER A CB  1 
ATOM   478  O OG  . SER A 1 66  ? -0.744  11.973 -0.279 1.00 20.08 ? 79  SER A OG  1 
ATOM   479  N N   . LYS A 1 67  ? -1.917  15.094 0.151  1.00 18.70 ? 80  LYS A N   1 
ATOM   480  C CA  . LYS A 1 67  ? -1.532  16.202 1.018  1.00 19.42 ? 80  LYS A CA  1 
ATOM   481  C C   . LYS A 1 67  ? -2.702  17.030 1.505  1.00 20.51 ? 80  LYS A C   1 
ATOM   482  O O   . LYS A 1 67  ? -3.599  17.370 0.738  1.00 20.80 ? 80  LYS A O   1 
ATOM   483  C CB  . LYS A 1 67  ? -0.489  17.107 0.346  1.00 18.91 ? 80  LYS A CB  1 
ATOM   484  C CG  . LYS A 1 67  ? 0.934   16.582 0.428  1.00 20.92 ? 80  LYS A CG  1 
ATOM   485  C CD  . LYS A 1 67  ? 1.916   17.379 -0.434 1.00 19.32 ? 80  LYS A CD  1 
ATOM   486  C CE  . LYS A 1 67  ? 2.087   18.801 0.022  1.00 17.25 ? 80  LYS A CE  1 
ATOM   487  N NZ  . LYS A 1 67  ? 3.233   19.435 -0.699 1.00 15.04 ? 80  LYS A NZ  1 
ATOM   488  N N   . ARG A 1 68  ? -2.673  17.373 2.787  1.00 19.23 ? 81  ARG A N   1 
ATOM   489  C CA  . ARG A 1 68  ? -3.734  18.162 3.386  1.00 21.25 ? 81  ARG A CA  1 
ATOM   490  C C   . ARG A 1 68  ? -3.138  18.992 4.520  1.00 17.03 ? 81  ARG A C   1 
ATOM   491  O O   . ARG A 1 68  ? -2.411  18.474 5.375  1.00 15.25 ? 81  ARG A O   1 
ATOM   492  C CB  . ARG A 1 68  ? -4.818  17.216 3.923  1.00 25.72 ? 81  ARG A CB  1 
ATOM   493  C CG  . ARG A 1 68  ? -6.247  17.644 3.692  1.00 33.32 ? 81  ARG A CG  1 
ATOM   494  C CD  . ARG A 1 68  ? -6.578  18.878 4.482  1.00 39.69 ? 81  ARG A CD  1 
ATOM   495  N NE  . ARG A 1 68  ? -8.014  19.000 4.718  1.00 46.59 ? 81  ARG A NE  1 
ATOM   496  C CZ  . ARG A 1 68  ? -8.590  20.048 5.306  1.00 50.82 ? 81  ARG A CZ  1 
ATOM   497  N NH1 . ARG A 1 68  ? -7.857  21.084 5.707  1.00 51.41 ? 81  ARG A NH1 1 
ATOM   498  N NH2 . ARG A 1 68  ? -9.907  20.066 5.484  1.00 52.30 ? 81  ARG A NH2 1 
ATOM   499  N N   . LEU A 1 69  ? -3.393  20.289 4.490  1.00 14.68 ? 82  LEU A N   1 
ATOM   500  C CA  . LEU A 1 69  ? -2.901  21.181 5.524  1.00 15.91 ? 82  LEU A CA  1 
ATOM   501  C C   . LEU A 1 69  ? -4.079  21.472 6.478  1.00 16.26 ? 82  LEU A C   1 
ATOM   502  O O   . LEU A 1 69  ? -5.148  21.928 6.056  1.00 17.12 ? 82  LEU A O   1 
ATOM   503  C CB  . LEU A 1 69  ? -2.347  22.460 4.889  1.00 15.57 ? 82  LEU A CB  1 
ATOM   504  C CG  . LEU A 1 69  ? -1.504  23.420 5.729  1.00 18.52 ? 82  LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 69  ? -0.254  22.744 6.284  1.00 16.15 ? 82  LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 69  ? -1.112  24.589 4.864  1.00 22.36 ? 82  LEU A CD2 1 
ATOM   507  N N   . TYR A 1 70  ? -3.895  21.124 7.748  1.00 15.71 ? 83  TYR A N   1 
ATOM   508  C CA  . TYR A 1 70  ? -4.919  21.303 8.782  1.00 16.13 ? 83  TYR A CA  1 
ATOM   509  C C   . TYR A 1 70  ? -4.585  22.413 9.769  1.00 16.44 ? 83  TYR A C   1 
ATOM   510  O O   . TYR A 1 70  ? -3.425  22.601 10.156 1.00 13.77 ? 83  TYR A O   1 
ATOM   511  C CB  . TYR A 1 70  ? -5.088  20.009 9.584  1.00 14.34 ? 83  TYR A CB  1 
ATOM   512  C CG  . TYR A 1 70  ? -5.695  18.858 8.828  1.00 15.40 ? 83  TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 70  ? -4.901  17.990 8.070  1.00 12.38 ? 83  TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 70  ? -7.076  18.640 8.861  1.00 17.02 ? 83  TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 70  ? -5.467  16.942 7.364  1.00 15.49 ? 83  TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 70  ? -7.653  17.597 8.163  1.00 16.52 ? 83  TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 70  ? -6.850  16.752 7.415  1.00 18.60 ? 83  TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 70  ? -7.443  15.733 6.712  1.00 16.29 ? 83  TYR A OH  1 
ATOM   519  N N   . ASP A 1 71  ? -5.594  23.184 10.145 1.00 15.74 ? 84  ASP A N   1 
ATOM   520  C CA  . ASP A 1 71  ? -5.384  24.225 11.131 1.00 15.53 ? 84  ASP A CA  1 
ATOM   521  C C   . ASP A 1 71  ? -5.411  23.549 12.512 1.00 14.82 ? 84  ASP A C   1 
ATOM   522  O O   . ASP A 1 71  ? -5.806  22.389 12.638 1.00 15.27 ? 84  ASP A O   1 
ATOM   523  C CB  . ASP A 1 71  ? -6.467  25.285 11.010 1.00 19.11 ? 84  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 71  ? -6.258  26.193 9.814  1.00 19.74 ? 84  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 71  ? -5.209  26.858 9.757  1.00 18.62 ? 84  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 71  ? -7.148  26.252 8.945  1.00 25.80 ? 84  ASP A OD2 1 
ATOM   527  N N   . VAL A 1 72  ? -4.980  24.258 13.537 1.00 14.99 ? 85  VAL A N   1 
ATOM   528  C CA  . VAL A 1 72  ? -4.955  23.689 14.871 1.00 16.44 ? 85  VAL A CA  1 
ATOM   529  C C   . VAL A 1 72  ? -5.945  24.397 15.801 1.00 16.88 ? 85  VAL A C   1 
ATOM   530  O O   . VAL A 1 72  ? -5.921  25.619 15.920 1.00 16.61 ? 85  VAL A O   1 
ATOM   531  C CB  . VAL A 1 72  ? -3.518  23.769 15.458 1.00 16.21 ? 85  VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 72  ? -3.500  23.401 16.928 1.00 18.32 ? 85  VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 72  ? -2.595  22.830 14.687 1.00 16.46 ? 85  VAL A CG2 1 
ATOM   534  N N   . LEU A 1 73  ? -6.833  23.619 16.416 1.00 18.45 ? 86  LEU A N   1 
ATOM   535  C CA  . LEU A 1 73  ? -7.822  24.127 17.367 1.00 19.91 ? 86  LEU A CA  1 
ATOM   536  C C   . LEU A 1 73  ? -7.111  24.534 18.670 1.00 19.99 ? 86  LEU A C   1 
ATOM   537  O O   . LEU A 1 73  ? -7.302  25.643 19.185 1.00 19.50 ? 86  LEU A O   1 
ATOM   538  C CB  . LEU A 1 73  ? -8.835  23.033 17.686 1.00 22.98 ? 86  LEU A CB  1 
ATOM   539  C CG  . LEU A 1 73  ? -10.315 23.320 17.490 1.00 25.14 ? 86  LEU A CG  1 
ATOM   540  C CD1 . LEU A 1 73  ? -11.064 22.346 18.367 1.00 28.78 ? 86  LEU A CD1 1 
ATOM   541  C CD2 . LEU A 1 73  ? -10.669 24.748 17.866 1.00 25.76 ? 86  LEU A CD2 1 
ATOM   542  N N   . ARG A 1 74  ? -6.313  23.621 19.214 1.00 18.22 ? 87  ARG A N   1 
ATOM   543  C CA  . ARG A 1 74  ? -5.562  23.910 20.429 1.00 19.81 ? 87  ARG A CA  1 
ATOM   544  C C   . ARG A 1 74  ? -4.257  23.115 20.585 1.00 17.00 ? 87  ARG A C   1 
ATOM   545  O O   . ARG A 1 74  ? -4.089  22.032 20.021 1.00 15.97 ? 87  ARG A O   1 
ATOM   546  C CB  . ARG A 1 74  ? -6.449  23.764 21.678 1.00 21.16 ? 87  ARG A CB  1 
ATOM   547  C CG  . ARG A 1 74  ? -7.210  22.469 21.781 1.00 26.47 ? 87  ARG A CG  1 
ATOM   548  C CD  . ARG A 1 74  ? -7.853  22.367 23.146 1.00 30.47 ? 87  ARG A CD  1 
ATOM   549  N NE  . ARG A 1 74  ? -8.676  21.171 23.273 1.00 34.57 ? 87  ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 74  ? -8.656  20.342 24.317 1.00 37.50 ? 87  ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 74  ? -7.832  20.559 25.343 1.00 39.43 ? 87  ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 74  ? -9.460  19.280 24.330 1.00 37.82 ? 87  ARG A NH2 1 
ATOM   553  N N   . ALA A 1 75  ? -3.333  23.690 21.342 1.00 15.79 ? 88  ALA A N   1 
ATOM   554  C CA  . ALA A 1 75  ? -2.038  23.097 21.600 1.00 16.17 ? 88  ALA A CA  1 
ATOM   555  C C   . ALA A 1 75  ? -1.971  22.843 23.093 1.00 17.09 ? 88  ALA A C   1 
ATOM   556  O O   . ALA A 1 75  ? -2.153  23.764 23.884 1.00 17.81 ? 88  ALA A O   1 
ATOM   557  C CB  . ALA A 1 75  ? -0.938  24.065 21.190 1.00 16.50 ? 88  ALA A CB  1 
ATOM   558  N N   . VAL A 1 76  ? -1.668  21.609 23.477 1.00 15.22 ? 89  VAL A N   1 
ATOM   559  C CA  . VAL A 1 76  ? -1.594  21.234 24.886 1.00 13.45 ? 89  VAL A CA  1 
ATOM   560  C C   . VAL A 1 76  ? -0.219  20.700 25.292 1.00 11.62 ? 89  VAL A C   1 
ATOM   561  O O   . VAL A 1 76  ? 0.073   19.521 25.120 1.00 13.75 ? 89  VAL A O   1 
ATOM   562  C CB  . VAL A 1 76  ? -2.662  20.148 25.233 1.00 11.72 ? 89  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 76  ? -2.751  19.941 26.741 1.00 16.14 ? 89  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 76  ? -4.029  20.511 24.663 1.00 14.18 ? 89  VAL A CG2 1 
ATOM   565  N N   . PRO A 1 77  ? 0.668   21.569 25.780 1.00 11.45 ? 90  PRO A N   1 
ATOM   566  C CA  . PRO A 1 77  ? 1.983   21.093 26.197 1.00 12.14 ? 90  PRO A CA  1 
ATOM   567  C C   . PRO A 1 77  ? 1.830   20.335 27.515 1.00 13.43 ? 90  PRO A C   1 
ATOM   568  O O   . PRO A 1 77  ? 0.837   20.534 28.225 1.00 17.35 ? 90  PRO A O   1 
ATOM   569  C CB  . PRO A 1 77  ? 2.759   22.387 26.406 1.00 11.76 ? 90  PRO A CB  1 
ATOM   570  C CG  . PRO A 1 77  ? 1.699   23.367 26.793 1.00 15.66 ? 90  PRO A CG  1 
ATOM   571  C CD  . PRO A 1 77  ? 0.591   23.036 25.843 1.00 16.77 ? 90  PRO A CD  1 
ATOM   572  N N   . HIS A 1 78  ? 2.759   19.438 27.828 1.00 11.97 ? 91  HIS A N   1 
ATOM   573  C CA  . HIS A 1 78  ? 2.693   18.699 29.089 1.00 10.85 ? 91  HIS A CA  1 
ATOM   574  C C   . HIS A 1 78  ? 2.826   19.729 30.225 1.00 12.01 ? 91  HIS A C   1 
ATOM   575  O O   . HIS A 1 78  ? 3.723   20.581 30.203 1.00 10.94 ? 91  HIS A O   1 
ATOM   576  C CB  . HIS A 1 78  ? 3.809   17.669 29.171 1.00 9.81  ? 91  HIS A CB  1 
ATOM   577  C CG  . HIS A 1 78  ? 3.719   16.791 30.374 1.00 7.72  ? 91  HIS A CG  1 
ATOM   578  N ND1 . HIS A 1 78  ? 3.176   15.528 30.333 1.00 12.23 ? 91  HIS A ND1 1 
ATOM   579  C CD2 . HIS A 1 78  ? 4.074   17.005 31.662 1.00 8.04  ? 91  HIS A CD2 1 
ATOM   580  C CE1 . HIS A 1 78  ? 3.196   14.999 31.543 1.00 9.12  ? 91  HIS A CE1 1 
ATOM   581  N NE2 . HIS A 1 78  ? 3.736   15.877 32.367 1.00 11.45 ? 91  HIS A NE2 1 
ATOM   582  N N   . PRO A 1 79  ? 1.960   19.640 31.262 1.00 13.90 ? 92  PRO A N   1 
ATOM   583  C CA  . PRO A 1 79  ? 2.041   20.614 32.359 1.00 13.47 ? 92  PRO A CA  1 
ATOM   584  C C   . PRO A 1 79  ? 3.359   20.771 33.132 1.00 12.51 ? 92  PRO A C   1 
ATOM   585  O O   . PRO A 1 79  ? 3.611   21.827 33.701 1.00 17.02 ? 92  PRO A O   1 
ATOM   586  C CB  . PRO A 1 79  ? 0.839   20.239 33.240 1.00 12.86 ? 92  PRO A CB  1 
ATOM   587  C CG  . PRO A 1 79  ? 0.596   18.804 32.923 1.00 14.91 ? 92  PRO A CG  1 
ATOM   588  C CD  . PRO A 1 79  ? 0.799   18.751 31.443 1.00 12.62 ? 92  PRO A CD  1 
ATOM   589  N N   . ASP A 1 80  ? 4.202   19.747 33.157 1.00 11.38 ? 93  ASP A N   1 
ATOM   590  C CA  . ASP A 1 80  ? 5.479   19.834 33.866 1.00 13.74 ? 93  ASP A CA  1 
ATOM   591  C C   . ASP A 1 80  ? 6.656   20.296 32.993 1.00 15.73 ? 93  ASP A C   1 
ATOM   592  O O   . ASP A 1 80  ? 7.777   20.384 33.490 1.00 17.12 ? 93  ASP A O   1 
ATOM   593  C CB  . ASP A 1 80  ? 5.861   18.484 34.493 1.00 11.60 ? 93  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 80  ? 4.891   18.015 35.581 1.00 14.46 ? 93  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 80  ? 4.597   18.784 36.509 1.00 11.25 ? 93  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 80  ? 4.462   16.843 35.521 1.00 15.07 ? 93  ASP A OD2 1 
ATOM   597  N N   . SER A 1 81  ? 6.443   20.524 31.699 1.00 17.25 ? 94  SER A N   1 
ATOM   598  C CA  . SER A 1 81  ? 7.557   20.950 30.843 1.00 20.94 ? 94  SER A CA  1 
ATOM   599  C C   . SER A 1 81  ? 8.028   22.357 31.175 1.00 24.82 ? 94  SER A C   1 
ATOM   600  O O   . SER A 1 81  ? 7.222   23.237 31.492 1.00 24.08 ? 94  SER A O   1 
ATOM   601  C CB  . SER A 1 81  ? 7.204   20.859 29.348 1.00 17.48 ? 94  SER A CB  1 
ATOM   602  O OG  . SER A 1 81  ? 6.027   21.583 29.043 1.00 14.91 ? 94  SER A OG  1 
ATOM   603  N N   . GLN A 1 82  ? 9.338   22.557 31.103 1.00 28.98 ? 95  GLN A N   1 
ATOM   604  C CA  . GLN A 1 82  ? 9.965   23.846 31.379 1.00 34.77 ? 95  GLN A CA  1 
ATOM   605  C C   . GLN A 1 82  ? 10.889  24.193 30.226 1.00 35.39 ? 95  GLN A C   1 
ATOM   606  O O   . GLN A 1 82  ? 11.506  23.307 29.638 1.00 32.54 ? 95  GLN A O   1 
ATOM   607  C CB  . GLN A 1 82  ? 10.802  23.780 32.649 1.00 38.24 ? 95  GLN A CB  1 
ATOM   608  C CG  . GLN A 1 82  ? 10.015  23.719 33.918 1.00 46.45 ? 95  GLN A CG  1 
ATOM   609  C CD  . GLN A 1 82  ? 10.923  23.661 35.115 1.00 51.64 ? 95  GLN A CD  1 
ATOM   610  O OE1 . GLN A 1 82  ? 11.037  22.625 35.772 1.00 55.28 ? 95  GLN A OE1 1 
ATOM   611  N NE2 . GLN A 1 82  ? 11.609  24.767 35.392 1.00 53.61 ? 95  GLN A NE2 1 
ATOM   612  N N   . PRO A 1 83  ? 11.087  25.495 29.970 1.00 38.54 ? 96  PRO A N   1 
ATOM   613  C CA  . PRO A 1 83  ? 11.945  25.986 28.891 1.00 40.17 ? 96  PRO A CA  1 
ATOM   614  C C   . PRO A 1 83  ? 13.416  25.614 29.033 1.00 40.95 ? 96  PRO A C   1 
ATOM   615  O O   . PRO A 1 83  ? 14.111  25.414 28.038 1.00 42.96 ? 96  PRO A O   1 
ATOM   616  C CB  . PRO A 1 83  ? 11.749  27.497 28.969 1.00 40.71 ? 96  PRO A CB  1 
ATOM   617  C CG  . PRO A 1 83  ? 11.558  27.723 30.436 1.00 41.86 ? 96  PRO A CG  1 
ATOM   618  C CD  . PRO A 1 83  ? 10.580  26.623 30.774 1.00 40.77 ? 96  PRO A CD  1 
ATOM   619  N N   . ASP A 1 84  ? 13.882  25.469 30.260 1.00 41.35 ? 97  ASP A N   1 
ATOM   620  C CA  . ASP A 1 84  ? 15.287  25.153 30.467 1.00 45.13 ? 97  ASP A CA  1 
ATOM   621  C C   . ASP A 1 84  ? 15.612  23.673 30.658 1.00 42.27 ? 97  ASP A C   1 
ATOM   622  O O   . ASP A 1 84  ? 16.741  23.331 31.010 1.00 43.71 ? 97  ASP A O   1 
ATOM   623  C CB  . ASP A 1 84  ? 15.822  25.965 31.653 1.00 52.14 ? 97  ASP A CB  1 
ATOM   624  C CG  . ASP A 1 84  ? 15.085  25.663 32.954 1.00 56.89 ? 97  ASP A CG  1 
ATOM   625  O OD1 . ASP A 1 84  ? 13.832  25.726 32.969 1.00 58.61 ? 97  ASP A OD1 1 
ATOM   626  O OD2 . ASP A 1 84  ? 15.765  25.362 33.962 1.00 59.99 ? 97  ASP A OD2 1 
ATOM   627  N N   . THR A 1 85  ? 14.659  22.790 30.381 1.00 37.19 ? 98  THR A N   1 
ATOM   628  C CA  . THR A 1 85  ? 14.904  21.370 30.590 1.00 30.77 ? 98  THR A CA  1 
ATOM   629  C C   . THR A 1 85  ? 14.393  20.528 29.446 1.00 26.73 ? 98  THR A C   1 
ATOM   630  O O   . THR A 1 85  ? 13.596  20.996 28.650 1.00 26.28 ? 98  THR A O   1 
ATOM   631  C CB  . THR A 1 85  ? 14.198  20.898 31.852 1.00 30.12 ? 98  THR A CB  1 
ATOM   632  O OG1 . THR A 1 85  ? 12.782  21.079 31.693 1.00 29.56 ? 98  THR A OG1 1 
ATOM   633  C CG2 . THR A 1 85  ? 14.678  21.694 33.058 1.00 30.08 ? 98  THR A CG2 1 
ATOM   634  N N   . ILE A 1 86  ? 14.845  19.281 29.370 1.00 24.17 ? 99  ILE A N   1 
ATOM   635  C CA  . ILE A 1 86  ? 14.379  18.377 28.314 1.00 24.12 ? 99  ILE A CA  1 
ATOM   636  C C   . ILE A 1 86  ? 13.339  17.371 28.842 1.00 21.35 ? 99  ILE A C   1 
ATOM   637  O O   . ILE A 1 86  ? 12.880  16.503 28.099 1.00 20.47 ? 99  ILE A O   1 
ATOM   638  C CB  . ILE A 1 86  ? 15.542  17.601 27.622 1.00 25.08 ? 99  ILE A CB  1 
ATOM   639  C CG1 . ILE A 1 86  ? 16.229  16.655 28.611 1.00 25.75 ? 99  ILE A CG1 1 
ATOM   640  C CG2 . ILE A 1 86  ? 16.539  18.570 27.007 1.00 26.69 ? 99  ILE A CG2 1 
ATOM   641  C CD1 . ILE A 1 86  ? 17.355  15.837 28.003 1.00 28.58 ? 99  ILE A CD1 1 
ATOM   642  N N   . ASP A 1 87  ? 12.982  17.470 30.124 1.00 19.53 ? 100 ASP A N   1 
ATOM   643  C CA  . ASP A 1 87  ? 11.990  16.554 30.693 1.00 16.86 ? 100 ASP A CA  1 
ATOM   644  C C   . ASP A 1 87  ? 10.606  16.945 30.242 1.00 11.44 ? 100 ASP A C   1 
ATOM   645  O O   . ASP A 1 87  ? 10.334  18.122 30.004 1.00 11.04 ? 100 ASP A O   1 
ATOM   646  C CB  . ASP A 1 87  ? 11.965  16.625 32.212 1.00 23.22 ? 100 ASP A CB  1 
ATOM   647  C CG  . ASP A 1 87  ? 13.291  16.339 32.831 1.00 27.88 ? 100 ASP A CG  1 
ATOM   648  O OD1 . ASP A 1 87  ? 13.986  15.394 32.391 1.00 29.58 ? 100 ASP A OD1 1 
ATOM   649  O OD2 . ASP A 1 87  ? 13.623  17.067 33.785 1.00 31.89 ? 100 ASP A OD2 1 
ATOM   650  N N   . HIS A 1 88  ? 9.737   15.948 30.179 1.00 10.30 ? 101 HIS A N   1 
ATOM   651  C CA  . HIS A 1 88  ? 8.334   16.112 29.813 1.00 10.43 ? 101 HIS A CA  1 
ATOM   652  C C   . HIS A 1 88  ? 8.130   16.932 28.559 1.00 12.09 ? 101 HIS A C   1 
ATOM   653  O O   . HIS A 1 88  ? 7.160   17.695 28.451 1.00 9.81  ? 101 HIS A O   1 
ATOM   654  C CB  . HIS A 1 88  ? 7.596   16.753 30.980 1.00 13.57 ? 101 HIS A CB  1 
ATOM   655  C CG  . HIS A 1 88  ? 8.036   16.227 32.306 1.00 16.95 ? 101 HIS A CG  1 
ATOM   656  N ND1 . HIS A 1 88  ? 8.766   16.981 33.199 1.00 19.62 ? 101 HIS A ND1 1 
ATOM   657  C CD2 . HIS A 1 88  ? 7.903   15.002 32.864 1.00 19.54 ? 101 HIS A CD2 1 
ATOM   658  C CE1 . HIS A 1 88  ? 9.064   16.243 34.256 1.00 23.15 ? 101 HIS A CE1 1 
ATOM   659  N NE2 . HIS A 1 88  ? 8.552   15.039 34.076 1.00 24.99 ? 101 HIS A NE2 1 
ATOM   660  N N   . ASP A 1 89  ? 9.006   16.713 27.584 1.00 10.36 ? 102 ASP A N   1 
ATOM   661  C CA  . ASP A 1 89  ? 8.963   17.459 26.342 1.00 11.55 ? 102 ASP A CA  1 
ATOM   662  C C   . ASP A 1 89  ? 7.945   16.948 25.308 1.00 11.49 ? 102 ASP A C   1 
ATOM   663  O O   . ASP A 1 89  ? 8.299   16.654 24.158 1.00 12.15 ? 102 ASP A O   1 
ATOM   664  C CB  . ASP A 1 89  ? 10.374  17.488 25.764 1.00 12.05 ? 102 ASP A CB  1 
ATOM   665  C CG  . ASP A 1 89  ? 10.505  18.417 24.599 1.00 13.55 ? 102 ASP A CG  1 
ATOM   666  O OD1 . ASP A 1 89  ? 9.701   19.357 24.470 1.00 10.49 ? 102 ASP A OD1 1 
ATOM   667  O OD2 . ASP A 1 89  ? 11.438  18.196 23.808 1.00 20.44 ? 102 ASP A OD2 1 
ATOM   668  N N   . LEU A 1 90  ? 6.676   16.902 25.700 1.00 11.14 ? 103 LEU A N   1 
ATOM   669  C CA  . LEU A 1 90  ? 5.607   16.417 24.831 1.00 9.22  ? 103 LEU A CA  1 
ATOM   670  C C   . LEU A 1 90  ? 4.561   17.496 24.618 1.00 10.66 ? 103 LEU A C   1 
ATOM   671  O O   . LEU A 1 90  ? 4.349   18.352 25.483 1.00 9.13  ? 103 LEU A O   1 
ATOM   672  C CB  . LEU A 1 90  ? 4.956   15.159 25.412 1.00 8.17  ? 103 LEU A CB  1 
ATOM   673  C CG  . LEU A 1 90  ? 5.750   13.859 25.490 1.00 11.31 ? 103 LEU A CG  1 
ATOM   674  C CD1 . LEU A 1 90  ? 4.873   12.777 26.067 1.00 12.79 ? 103 LEU A CD1 1 
ATOM   675  C CD2 . LEU A 1 90  ? 6.236   13.436 24.112 1.00 12.80 ? 103 LEU A CD2 1 
ATOM   676  N N   . LEU A 1 91  ? 3.896   17.434 23.472 1.00 7.62  ? 104 LEU A N   1 
ATOM   677  C CA  . LEU A 1 91  ? 2.894   18.408 23.109 1.00 10.38 ? 104 LEU A CA  1 
ATOM   678  C C   . LEU A 1 91  ? 1.813   17.736 22.279 1.00 10.90 ? 104 LEU A C   1 
ATOM   679  O O   . LEU A 1 91  ? 2.116   16.959 21.373 1.00 11.53 ? 104 LEU A O   1 
ATOM   680  C CB  . LEU A 1 91  ? 3.550   19.521 22.285 1.00 11.94 ? 104 LEU A CB  1 
ATOM   681  C CG  . LEU A 1 91  ? 2.665   20.563 21.585 1.00 15.19 ? 104 LEU A CG  1 
ATOM   682  C CD1 . LEU A 1 91  ? 2.251   21.637 22.551 1.00 12.98 ? 104 LEU A CD1 1 
ATOM   683  C CD2 . LEU A 1 91  ? 3.464   21.196 20.443 1.00 15.35 ? 104 LEU A CD2 1 
ATOM   684  N N   . LEU A 1 92  ? 0.550   17.984 22.619 1.00 9.74  ? 105 LEU A N   1 
ATOM   685  C CA  . LEU A 1 92  ? -0.551  17.415 21.851 1.00 9.33  ? 105 LEU A CA  1 
ATOM   686  C C   . LEU A 1 92  ? -1.248  18.531 21.089 1.00 9.55  ? 105 LEU A C   1 
ATOM   687  O O   . LEU A 1 92  ? -1.542  19.592 21.648 1.00 10.85 ? 105 LEU A O   1 
ATOM   688  C CB  . LEU A 1 92  ? -1.530  16.634 22.747 1.00 8.21  ? 105 LEU A CB  1 
ATOM   689  C CG  . LEU A 1 92  ? -1.106  15.180 23.012 1.00 7.17  ? 105 LEU A CG  1 
ATOM   690  C CD1 . LEU A 1 92  ? -1.814  14.639 24.245 1.00 11.13 ? 105 LEU A CD1 1 
ATOM   691  C CD2 . LEU A 1 92  ? -1.387  14.302 21.794 1.00 8.79  ? 105 LEU A CD2 1 
ATOM   692  N N   . LEU A 1 93  ? -1.444  18.320 19.791 1.00 10.09 ? 106 LEU A N   1 
ATOM   693  C CA  . LEU A 1 93  ? -2.074  19.316 18.947 1.00 11.30 ? 106 LEU A CA  1 
ATOM   694  C C   . LEU A 1 93  ? -3.412  18.810 18.467 1.00 11.25 ? 106 LEU A C   1 
ATOM   695  O O   . LEU A 1 93  ? -3.488  17.725 17.900 1.00 11.66 ? 106 LEU A O   1 
ATOM   696  C CB  . LEU A 1 93  ? -1.190  19.616 17.724 1.00 11.73 ? 106 LEU A CB  1 
ATOM   697  C CG  . LEU A 1 93  ? 0.140   20.317 17.982 1.00 11.27 ? 106 LEU A CG  1 
ATOM   698  C CD1 . LEU A 1 93  ? 0.985   20.328 16.704 1.00 15.98 ? 106 LEU A CD1 1 
ATOM   699  C CD2 . LEU A 1 93  ? -0.121  21.721 18.465 1.00 12.56 ? 106 LEU A CD2 1 
ATOM   700  N N   . GLN A 1 94  ? -4.471  19.569 18.735 1.00 10.62 ? 107 GLN A N   1 
ATOM   701  C CA  . GLN A 1 94  ? -5.792  19.178 18.276 1.00 11.66 ? 107 GLN A CA  1 
ATOM   702  C C   . GLN A 1 94  ? -6.102  19.874 16.951 1.00 10.18 ? 107 GLN A C   1 
ATOM   703  O O   . GLN A 1 94  ? -6.142  21.104 16.877 1.00 11.49 ? 107 GLN A O   1 
ATOM   704  C CB  . GLN A 1 94  ? -6.870  19.535 19.289 1.00 10.58 ? 107 GLN A CB  1 
ATOM   705  C CG  . GLN A 1 94  ? -8.198  18.902 18.927 1.00 12.24 ? 107 GLN A CG  1 
ATOM   706  C CD  . GLN A 1 94  ? -9.273  19.226 19.936 1.00 19.13 ? 107 GLN A CD  1 
ATOM   707  O OE1 . GLN A 1 94  ? -9.194  20.238 20.635 1.00 20.38 ? 107 GLN A OE1 1 
ATOM   708  N NE2 . GLN A 1 94  ? -10.285 18.371 20.018 1.00 21.27 ? 107 GLN A NE2 1 
ATOM   709  N N   . LEU A 1 95  ? -6.352  19.079 15.918 1.00 13.48 ? 108 LEU A N   1 
ATOM   710  C CA  . LEU A 1 95  ? -6.649  19.602 14.589 1.00 14.13 ? 108 LEU A CA  1 
ATOM   711  C C   . LEU A 1 95  ? -8.062  20.220 14.545 1.00 15.25 ? 108 LEU A C   1 
ATOM   712  O O   . LEU A 1 95  ? -8.956  19.797 15.287 1.00 14.13 ? 108 LEU A O   1 
ATOM   713  C CB  . LEU A 1 95  ? -6.502  18.472 13.553 1.00 14.00 ? 108 LEU A CB  1 
ATOM   714  C CG  . LEU A 1 95  ? -5.175  17.686 13.555 1.00 11.44 ? 108 LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 95  ? -5.245  16.544 12.533 1.00 10.05 ? 108 LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 95  ? -4.008  18.621 13.263 1.00 12.01 ? 108 LEU A CD2 1 
ATOM   717  N N   . SER A 1 96  ? -8.256  21.214 13.682 1.00 12.73 ? 109 SER A N   1 
ATOM   718  C CA  . SER A 1 96  ? -9.543  21.883 13.570 1.00 15.61 ? 109 SER A CA  1 
ATOM   719  C C   . SER A 1 96  ? -10.659 20.907 13.219 1.00 17.24 ? 109 SER A C   1 
ATOM   720  O O   . SER A 1 96  ? -11.829 21.208 13.443 1.00 17.37 ? 109 SER A O   1 
ATOM   721  C CB  . SER A 1 96  ? -9.479  23.025 12.569 1.00 19.25 ? 109 SER A CB  1 
ATOM   722  O OG  . SER A 1 96  ? -9.172  22.522 11.274 1.00 28.99 ? 109 SER A OG  1 
ATOM   723  N N   . GLU A 1 97  ? -10.307 19.752 12.658 1.00 16.89 ? 110 GLU A N   1 
ATOM   724  C CA  . GLU A 1 97  ? -11.292 18.719 12.340 1.00 18.92 ? 110 GLU A CA  1 
ATOM   725  C C   . GLU A 1 97  ? -10.612 17.377 12.214 1.00 17.19 ? 110 GLU A C   1 
ATOM   726  O O   . GLU A 1 97  ? -9.391  17.314 12.136 1.00 18.72 ? 110 GLU A O   1 
ATOM   727  C CB  . GLU A 1 97  ? -12.081 19.033 11.065 1.00 23.54 ? 110 GLU A CB  1 
ATOM   728  C CG  . GLU A 1 97  ? -11.309 18.961 9.755  1.00 27.40 ? 110 GLU A CG  1 
ATOM   729  C CD  . GLU A 1 97  ? -12.159 19.420 8.574  1.00 33.72 ? 110 GLU A CD  1 
ATOM   730  O OE1 . GLU A 1 97  ? -13.355 19.040 8.503  1.00 35.18 ? 110 GLU A OE1 1 
ATOM   731  O OE2 . GLU A 1 97  ? -11.640 20.183 7.730  1.00 35.57 ? 110 GLU A OE2 1 
ATOM   732  N N   . LYS A 1 98  ? -11.397 16.305 12.249 1.00 17.06 ? 111 LYS A N   1 
ATOM   733  C CA  . LYS A 1 98  ? -10.855 14.957 12.116 1.00 21.49 ? 111 LYS A CA  1 
ATOM   734  C C   . LYS A 1 98  ? -10.165 14.807 10.752 1.00 20.67 ? 111 LYS A C   1 
ATOM   735  O O   . LYS A 1 98  ? -10.671 15.277 9.733  1.00 18.18 ? 111 LYS A O   1 
ATOM   736  C CB  . LYS A 1 98  ? -11.958 13.894 12.252 1.00 24.35 ? 111 LYS A CB  1 
ATOM   737  C CG  . LYS A 1 98  ? -12.337 13.548 13.687 1.00 33.24 ? 111 LYS A CG  1 
ATOM   738  C CD  . LYS A 1 98  ? -13.266 12.345 13.743 1.00 38.58 ? 111 LYS A CD  1 
ATOM   739  C CE  . LYS A 1 98  ? -13.329 11.768 15.153 1.00 43.89 ? 111 LYS A CE  1 
ATOM   740  N NZ  . LYS A 1 98  ? -14.067 10.462 15.215 1.00 47.36 ? 111 LYS A NZ  1 
ATOM   741  N N   . ALA A 1 99  ? -9.013  14.157 10.744 1.00 19.04 ? 112 ALA A N   1 
ATOM   742  C CA  . ALA A 1 99  ? -8.274  13.954 9.519  1.00 19.92 ? 112 ALA A CA  1 
ATOM   743  C C   . ALA A 1 99  ? -8.975  12.943 8.626  1.00 18.11 ? 112 ALA A C   1 
ATOM   744  O O   . ALA A 1 99  ? -9.474  11.918 9.095  1.00 17.42 ? 112 ALA A O   1 
ATOM   745  C CB  . ALA A 1 99  ? -6.872  13.480 9.836  1.00 20.41 ? 112 ALA A CB  1 
ATOM   746  N N   . THR A 1 100 ? -9.039  13.252 7.340  1.00 17.66 ? 113 THR A N   1 
ATOM   747  C CA  . THR A 1 100 ? -9.628  12.339 6.373  1.00 17.86 ? 113 THR A CA  1 
ATOM   748  C C   . THR A 1 100 ? -8.607  11.204 6.294  1.00 17.24 ? 113 THR A C   1 
ATOM   749  O O   . THR A 1 100 ? -7.455  11.426 5.901  1.00 20.01 ? 113 THR A O   1 
ATOM   750  C CB  . THR A 1 100 ? -9.736  13.017 4.994  1.00 19.02 ? 113 THR A CB  1 
ATOM   751  O OG1 . THR A 1 100 ? -10.555 14.188 5.097  1.00 21.54 ? 113 THR A OG1 1 
ATOM   752  C CG2 . THR A 1 100 ? -10.331 12.066 3.976  1.00 20.07 ? 113 THR A CG2 1 
ATOM   753  N N   . LEU A 1 101 ? -8.993  10.003 6.697  1.00 17.05 ? 114 LEU A N   1 
ATOM   754  C CA  . LEU A 1 101 ? -8.058  8.885  6.671  1.00 19.10 ? 114 LEU A CA  1 
ATOM   755  C C   . LEU A 1 101 ? -8.027  8.181  5.316  1.00 21.06 ? 114 LEU A C   1 
ATOM   756  O O   . LEU A 1 101 ? -8.986  8.262  4.550  1.00 23.08 ? 114 LEU A O   1 
ATOM   757  C CB  . LEU A 1 101 ? -8.368  7.896  7.798  1.00 18.63 ? 114 LEU A CB  1 
ATOM   758  C CG  . LEU A 1 101 ? -8.400  8.496  9.209  1.00 17.21 ? 114 LEU A CG  1 
ATOM   759  C CD1 . LEU A 1 101 ? -8.457  7.368  10.219 1.00 17.79 ? 114 LEU A CD1 1 
ATOM   760  C CD2 . LEU A 1 101 ? -7.182  9.389  9.462  1.00 15.98 ? 114 LEU A CD2 1 
ATOM   761  N N   . GLY A 1 102 ? -6.922  7.501  5.029  1.00 19.14 ? 115 GLY A N   1 
ATOM   762  C CA  . GLY A 1 102 ? -6.764  6.807  3.765  1.00 18.48 ? 115 GLY A CA  1 
ATOM   763  C C   . GLY A 1 102 ? -5.462  6.035  3.809  1.00 18.53 ? 115 GLY A C   1 
ATOM   764  O O   . GLY A 1 102 ? -4.861  5.923  4.882  1.00 19.74 ? 115 GLY A O   1 
ATOM   765  N N   . PRO A 1 103 ? -4.999  5.473  2.675  1.00 19.83 ? 118 PRO A N   1 
ATOM   766  C CA  . PRO A 1 103 ? -3.744  4.710  2.635  1.00 17.41 ? 118 PRO A CA  1 
ATOM   767  C C   . PRO A 1 103 ? -2.513  5.571  2.969  1.00 16.42 ? 118 PRO A C   1 
ATOM   768  O O   . PRO A 1 103 ? -1.524  5.069  3.506  1.00 19.21 ? 118 PRO A O   1 
ATOM   769  C CB  . PRO A 1 103 ? -3.696  4.210  1.189  1.00 20.53 ? 118 PRO A CB  1 
ATOM   770  C CG  . PRO A 1 103 ? -5.134  4.169  0.779  1.00 18.93 ? 118 PRO A CG  1 
ATOM   771  C CD  . PRO A 1 103 ? -5.669  5.440  1.363  1.00 18.46 ? 118 PRO A CD  1 
ATOM   772  N N   . ALA A 1 104 ? -2.593  6.865  2.677  1.00 13.87 ? 119 ALA A N   1 
ATOM   773  C CA  . ALA A 1 104 ? -1.495  7.783  2.933  1.00 14.21 ? 119 ALA A CA  1 
ATOM   774  C C   . ALA A 1 104 ? -1.631  8.590  4.230  1.00 12.52 ? 119 ALA A C   1 
ATOM   775  O O   . ALA A 1 104 ? -0.748  9.377  4.555  1.00 12.29 ? 119 ALA A O   1 
ATOM   776  C CB  . ALA A 1 104 ? -1.332  8.729  1.755  1.00 15.12 ? 119 ALA A CB  1 
ATOM   777  N N   . VAL A 1 105 ? -2.750  8.439  4.938  1.00 13.96 ? 120 VAL A N   1 
ATOM   778  C CA  . VAL A 1 105 ? -2.982  9.159  6.204  1.00 12.99 ? 120 VAL A CA  1 
ATOM   779  C C   . VAL A 1 105 ? -3.670  8.177  7.166  1.00 13.86 ? 120 VAL A C   1 
ATOM   780  O O   . VAL A 1 105 ? -4.853  7.851  7.001  1.00 11.44 ? 120 VAL A O   1 
ATOM   781  C CB  . VAL A 1 105 ? -3.875  10.432 6.009  1.00 14.05 ? 120 VAL A CB  1 
ATOM   782  C CG1 . VAL A 1 105 ? -3.997  11.215 7.323  1.00 13.52 ? 120 VAL A CG1 1 
ATOM   783  C CG2 . VAL A 1 105 ? -3.298  11.342 4.933  1.00 14.49 ? 120 VAL A CG2 1 
ATOM   784  N N   . ARG A 1 106 ? -2.934  7.741  8.182  1.00 13.65 ? 121 ARG A N   1 
ATOM   785  C CA  . ARG A 1 106 ? -3.438  6.768  9.154  1.00 16.32 ? 121 ARG A CA  1 
ATOM   786  C C   . ARG A 1 106 ? -2.714  6.926  10.516 1.00 14.28 ? 121 ARG A C   1 
ATOM   787  O O   . ARG A 1 106 ? -1.508  7.144  10.557 1.00 10.99 ? 121 ARG A O   1 
ATOM   788  C CB  . ARG A 1 106 ? -3.206  5.360  8.576  1.00 21.20 ? 121 ARG A CB  1 
ATOM   789  C CG  . ARG A 1 106 ? -3.872  4.198  9.291  1.00 31.63 ? 121 ARG A CG  1 
ATOM   790  C CD  . ARG A 1 106 ? -5.375  4.147  9.042  1.00 40.71 ? 121 ARG A CD  1 
ATOM   791  N NE  . ARG A 1 106 ? -5.719  4.019  7.625  1.00 47.13 ? 121 ARG A NE  1 
ATOM   792  C CZ  . ARG A 1 106 ? -6.955  3.794  7.172  1.00 51.17 ? 121 ARG A CZ  1 
ATOM   793  N NH1 . ARG A 1 106 ? -7.978  3.657  8.019  1.00 50.60 ? 121 ARG A NH1 1 
ATOM   794  N NH2 . ARG A 1 106 ? -7.171  3.698  5.863  1.00 52.82 ? 121 ARG A NH2 1 
ATOM   795  N N   . PRO A 1 107 ? -3.461  6.891  11.643 1.00 14.70 ? 122 PRO A N   1 
ATOM   796  C CA  . PRO A 1 107 ? -2.805  7.032  12.956 1.00 12.93 ? 122 PRO A CA  1 
ATOM   797  C C   . PRO A 1 107 ? -1.919  5.814  13.261 1.00 12.08 ? 122 PRO A C   1 
ATOM   798  O O   . PRO A 1 107 ? -2.125  4.730  12.714 1.00 11.62 ? 122 PRO A O   1 
ATOM   799  C CB  . PRO A 1 107 ? -3.989  7.084  13.934 1.00 12.23 ? 122 PRO A CB  1 
ATOM   800  C CG  . PRO A 1 107 ? -5.116  7.589  13.115 1.00 15.57 ? 122 PRO A CG  1 
ATOM   801  C CD  . PRO A 1 107 ? -4.927  6.867  11.794 1.00 11.20 ? 122 PRO A CD  1 
ATOM   802  N N   . LEU A 1 108 ? -0.947  5.990  14.147 1.00 11.40 ? 123 LEU A N   1 
ATOM   803  C CA  . LEU A 1 108 ? -0.057  4.896  14.526 1.00 13.69 ? 123 LEU A CA  1 
ATOM   804  C C   . LEU A 1 108 ? -0.296  4.465  15.985 1.00 13.67 ? 123 LEU A C   1 
ATOM   805  O O   . LEU A 1 108 ? -0.460  5.315  16.864 1.00 13.42 ? 123 LEU A O   1 
ATOM   806  C CB  . LEU A 1 108 ? 1.402   5.353  14.386 1.00 13.71 ? 123 LEU A CB  1 
ATOM   807  C CG  . LEU A 1 108 ? 2.482   4.386  14.854 1.00 11.38 ? 123 LEU A CG  1 
ATOM   808  C CD1 . LEU A 1 108 ? 2.558   3.205  13.914 1.00 14.10 ? 123 LEU A CD1 1 
ATOM   809  C CD2 . LEU A 1 108 ? 3.797   5.118  14.882 1.00 12.68 ? 123 LEU A CD2 1 
ATOM   810  N N   . PRO A 1 109 ? -0.391  3.148  16.246 1.00 14.81 ? 124 PRO A N   1 
ATOM   811  C CA  . PRO A 1 109 ? -0.597  2.678  17.620 1.00 13.97 ? 124 PRO A CA  1 
ATOM   812  C C   . PRO A 1 109 ? 0.628   3.069  18.443 1.00 15.16 ? 124 PRO A C   1 
ATOM   813  O O   . PRO A 1 109 ? 1.765   3.044  17.936 1.00 15.44 ? 124 PRO A O   1 
ATOM   814  C CB  . PRO A 1 109 ? -0.654  1.159  17.455 1.00 13.54 ? 124 PRO A CB  1 
ATOM   815  C CG  . PRO A 1 109 ? -1.210  0.979  16.101 1.00 14.80 ? 124 PRO A CG  1 
ATOM   816  C CD  . PRO A 1 109 ? -0.475  2.020  15.300 1.00 15.52 ? 124 PRO A CD  1 
ATOM   817  N N   . TRP A 1 110 A 0.409   3.466  19.690 1.00 13.68 ? 124 TRP A N   1 
ATOM   818  C CA  . TRP A 1 110 A 1.515   3.857  20.554 1.00 12.66 ? 124 TRP A CA  1 
ATOM   819  C C   . TRP A 1 110 A 1.697   2.923  21.744 1.00 14.89 ? 124 TRP A C   1 
ATOM   820  O O   . TRP A 1 110 A 0.760   2.222  22.142 1.00 14.59 ? 124 TRP A O   1 
ATOM   821  C CB  . TRP A 1 110 A 1.388   5.325  20.970 1.00 16.62 ? 124 TRP A CB  1 
ATOM   822  C CG  . TRP A 1 110 A 0.052   5.756  21.564 1.00 18.98 ? 124 TRP A CG  1 
ATOM   823  C CD1 . TRP A 1 110 A -1.064  6.171  20.888 1.00 19.53 ? 124 TRP A CD1 1 
ATOM   824  C CD2 . TRP A 1 110 A -0.258  5.873  22.960 1.00 19.26 ? 124 TRP A CD2 1 
ATOM   825  N NE1 . TRP A 1 110 A -2.044  6.545  21.781 1.00 16.96 ? 124 TRP A NE1 1 
ATOM   826  C CE2 . TRP A 1 110 A -1.575  6.370  23.057 1.00 18.26 ? 124 TRP A CE2 1 
ATOM   827  C CE3 . TRP A 1 110 A 0.453   5.605  24.138 1.00 18.01 ? 124 TRP A CE3 1 
ATOM   828  C CZ2 . TRP A 1 110 A -2.193  6.604  24.286 1.00 18.35 ? 124 TRP A CZ2 1 
ATOM   829  C CZ3 . TRP A 1 110 A -0.163  5.839  25.356 1.00 17.72 ? 124 TRP A CZ3 1 
ATOM   830  C CH2 . TRP A 1 110 A -1.471  6.332  25.418 1.00 19.04 ? 124 TRP A CH2 1 
ATOM   831  N N   . GLN A 1 111 ? 2.916   2.872  22.273 1.00 13.34 ? 125 GLN A N   1 
ATOM   832  C CA  . GLN A 1 111 ? 3.253   1.987  23.387 1.00 13.42 ? 125 GLN A CA  1 
ATOM   833  C C   . GLN A 1 111 ? 2.716   2.396  24.753 1.00 14.25 ? 125 GLN A C   1 
ATOM   834  O O   . GLN A 1 111 ? 3.067   3.448  25.274 1.00 13.15 ? 125 GLN A O   1 
ATOM   835  C CB  . GLN A 1 111 ? 4.769   1.837  23.501 1.00 13.35 ? 125 GLN A CB  1 
ATOM   836  C CG  . GLN A 1 111 ? 5.201   0.751  24.460 1.00 15.49 ? 125 GLN A CG  1 
ATOM   837  C CD  . GLN A 1 111 ? 4.531   -0.571 24.138 1.00 22.78 ? 125 GLN A CD  1 
ATOM   838  O OE1 . GLN A 1 111 ? 3.596   -0.990 24.824 1.00 26.71 ? 125 GLN A OE1 1 
ATOM   839  N NE2 . GLN A 1 111 ? 4.981   -1.221 23.069 1.00 23.73 ? 125 GLN A NE2 1 
ATOM   840  N N   . ARG A 1 112 ? 1.945   1.502  25.361 1.00 18.18 ? 126 ARG A N   1 
ATOM   841  C CA  . ARG A 1 112 ? 1.363   1.739  26.683 1.00 21.12 ? 126 ARG A CA  1 
ATOM   842  C C   . ARG A 1 112 ? 2.082   0.958  27.791 1.00 22.30 ? 126 ARG A C   1 
ATOM   843  O O   . ARG A 1 112 ? 2.143   1.395  28.940 1.00 26.77 ? 126 ARG A O   1 
ATOM   844  C CB  . ARG A 1 112 ? -0.129  1.403  26.648 1.00 24.05 ? 126 ARG A CB  1 
ATOM   845  C CG  . ARG A 1 112 ? -0.927  2.391  25.806 1.00 26.28 ? 126 ARG A CG  1 
ATOM   846  C CD  . ARG A 1 112 ? -2.239  1.807  25.386 1.00 31.91 ? 126 ARG A CD  1 
ATOM   847  N NE  . ARG A 1 112 ? -3.204  2.822  24.962 1.00 35.50 ? 126 ARG A NE  1 
ATOM   848  C CZ  . ARG A 1 112 ? -3.828  3.666  25.788 1.00 37.25 ? 126 ARG A CZ  1 
ATOM   849  N NH1 . ARG A 1 112 ? -3.560  3.664  27.099 1.00 34.80 ? 126 ARG A NH1 1 
ATOM   850  N NH2 . ARG A 1 112 ? -4.707  4.536  25.296 1.00 35.42 ? 126 ARG A NH2 1 
ATOM   851  N N   . VAL A 1 113 ? 2.649   -0.186 27.438 1.00 21.94 ? 127 VAL A N   1 
ATOM   852  C CA  . VAL A 1 113 ? 3.357   -1.002 28.392 1.00 20.42 ? 127 VAL A CA  1 
ATOM   853  C C   . VAL A 1 113 ? 4.686   -0.332 28.647 1.00 22.76 ? 127 VAL A C   1 
ATOM   854  O O   . VAL A 1 113 ? 5.482   -0.111 27.728 1.00 20.11 ? 127 VAL A O   1 
ATOM   855  C CB  . VAL A 1 113 ? 3.570   -2.418 27.872 1.00 21.01 ? 127 VAL A CB  1 
ATOM   856  C CG1 . VAL A 1 113 ? 4.230   -3.274 28.935 1.00 21.85 ? 127 VAL A CG1 1 
ATOM   857  C CG2 . VAL A 1 113 ? 2.253   -3.017 27.477 1.00 22.34 ? 127 VAL A CG2 1 
ATOM   858  N N   . ASP A 1 114 ? 4.901   0.007  29.914 1.00 23.53 ? 128 ASP A N   1 
ATOM   859  C CA  . ASP A 1 114 ? 6.109   0.675  30.359 1.00 24.86 ? 128 ASP A CA  1 
ATOM   860  C C   . ASP A 1 114 ? 7.274   -0.295 30.542 1.00 25.86 ? 128 ASP A C   1 
ATOM   861  O O   . ASP A 1 114 ? 7.602   -0.674 31.674 1.00 27.04 ? 128 ASP A O   1 
ATOM   862  C CB  . ASP A 1 114 ? 5.829   1.420  31.670 1.00 27.32 ? 128 ASP A CB  1 
ATOM   863  C CG  . ASP A 1 114 ? 6.897   2.449  32.006 1.00 30.63 ? 128 ASP A CG  1 
ATOM   864  O OD1 . ASP A 1 114 ? 8.021   2.387  31.460 1.00 30.08 ? 128 ASP A OD1 1 
ATOM   865  O OD2 . ASP A 1 114 ? 6.607   3.334  32.832 1.00 34.98 ? 128 ASP A OD2 1 
ATOM   866  N N   . ARG A 1 115 ? 7.888   -0.700 29.434 1.00 24.05 ? 129 ARG A N   1 
ATOM   867  C CA  . ARG A 1 115 ? 9.032   -1.604 29.475 1.00 25.08 ? 129 ARG A CA  1 
ATOM   868  C C   . ARG A 1 115 ? 10.054  -1.115 28.452 1.00 21.57 ? 129 ARG A C   1 
ATOM   869  O O   . ARG A 1 115 ? 9.681   -0.648 27.381 1.00 18.35 ? 129 ARG A O   1 
ATOM   870  C CB  . ARG A 1 115 ? 8.601   -3.053 29.172 1.00 30.04 ? 129 ARG A CB  1 
ATOM   871  C CG  . ARG A 1 115 ? 7.651   -3.644 30.236 1.00 42.03 ? 129 ARG A CG  1 
ATOM   872  C CD  . ARG A 1 115 ? 7.197   -5.091 29.978 1.00 50.70 ? 129 ARG A CD  1 
ATOM   873  N NE  . ARG A 1 115 ? 5.970   -5.413 30.726 1.00 57.19 ? 129 ARG A NE  1 
ATOM   874  C CZ  . ARG A 1 115 ? 5.679   -6.595 31.277 1.00 59.55 ? 129 ARG A CZ  1 
ATOM   875  N NH1 . ARG A 1 115 ? 6.522   -7.620 31.191 1.00 61.43 ? 129 ARG A NH1 1 
ATOM   876  N NH2 . ARG A 1 115 ? 4.521   -6.759 31.910 1.00 60.62 ? 129 ARG A NH2 1 
ATOM   877  N N   . ASP A 1 116 A 11.331  -1.153 28.816 1.00 20.74 ? 129 ASP A N   1 
ATOM   878  C CA  . ASP A 1 116 A 12.410  -0.722 27.918 1.00 22.54 ? 129 ASP A CA  1 
ATOM   879  C C   . ASP A 1 116 A 12.551  -1.653 26.717 1.00 20.88 ? 129 ASP A C   1 
ATOM   880  O O   . ASP A 1 116 A 12.406  -2.868 26.852 1.00 20.11 ? 129 ASP A O   1 
ATOM   881  C CB  . ASP A 1 116 A 13.768  -0.708 28.639 1.00 21.17 ? 129 ASP A CB  1 
ATOM   882  C CG  . ASP A 1 116 A 14.014  0.556  29.428 1.00 22.09 ? 129 ASP A CG  1 
ATOM   883  O OD1 . ASP A 1 116 A 13.670  1.656  28.953 1.00 26.61 ? 129 ASP A OD1 1 
ATOM   884  O OD2 . ASP A 1 116 A 14.599  0.449  30.515 1.00 23.41 ? 129 ASP A OD2 1 
ATOM   885  N N   . VAL A 1 117 ? 12.845  -1.073 25.555 1.00 18.05 ? 130 VAL A N   1 
ATOM   886  C CA  . VAL A 1 117 ? 13.066  -1.845 24.340 1.00 17.47 ? 130 VAL A CA  1 
ATOM   887  C C   . VAL A 1 117 ? 14.432  -2.516 24.551 1.00 16.64 ? 130 VAL A C   1 
ATOM   888  O O   . VAL A 1 117 ? 15.345  -1.917 25.144 1.00 16.12 ? 130 VAL A O   1 
ATOM   889  C CB  . VAL A 1 117 ? 13.150  -0.926 23.100 1.00 16.83 ? 130 VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 117 ? 13.375  -1.743 21.841 1.00 16.49 ? 130 VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 117 ? 11.900  -0.113 22.978 1.00 16.50 ? 130 VAL A CG2 1 
ATOM   892  N N   . ALA A 1 118 ? 14.566  -3.753 24.086 1.00 16.27 ? 131 ALA A N   1 
ATOM   893  C CA  . ALA A 1 118 ? 15.814  -4.501 24.225 1.00 18.11 ? 131 ALA A CA  1 
ATOM   894  C C   . ALA A 1 118 ? 16.989  -3.801 23.524 1.00 17.75 ? 131 ALA A C   1 
ATOM   895  O O   . ALA A 1 118 ? 16.846  -3.274 22.406 1.00 16.99 ? 131 ALA A O   1 
ATOM   896  C CB  . ALA A 1 118 ? 15.636  -5.907 23.667 1.00 19.16 ? 131 ALA A CB  1 
ATOM   897  N N   . PRO A 1 119 ? 18.154  -3.752 24.188 1.00 17.14 ? 132 PRO A N   1 
ATOM   898  C CA  . PRO A 1 119 ? 19.311  -3.103 23.567 1.00 17.67 ? 132 PRO A CA  1 
ATOM   899  C C   . PRO A 1 119 ? 19.586  -3.759 22.203 1.00 16.35 ? 132 PRO A C   1 
ATOM   900  O O   . PRO A 1 119 ? 19.392  -4.970 22.030 1.00 17.34 ? 132 PRO A O   1 
ATOM   901  C CB  . PRO A 1 119 ? 20.439  -3.384 24.564 1.00 15.54 ? 132 PRO A CB  1 
ATOM   902  C CG  . PRO A 1 119 ? 19.736  -3.524 25.861 1.00 18.99 ? 132 PRO A CG  1 
ATOM   903  C CD  . PRO A 1 119 ? 18.500  -4.306 25.511 1.00 15.64 ? 132 PRO A CD  1 
ATOM   904  N N   . GLY A 1 120 ? 19.986  -2.952 21.227 1.00 18.02 ? 133 GLY A N   1 
ATOM   905  C CA  . GLY A 1 120 ? 20.277  -3.479 19.908 1.00 15.88 ? 133 GLY A CA  1 
ATOM   906  C C   . GLY A 1 120 ? 19.104  -3.506 18.958 1.00 16.15 ? 133 GLY A C   1 
ATOM   907  O O   . GLY A 1 120 ? 19.294  -3.647 17.751 1.00 17.33 ? 133 GLY A O   1 
ATOM   908  N N   . THR A 1 121 ? 17.887  -3.405 19.473 1.00 14.99 ? 134 THR A N   1 
ATOM   909  C CA  . THR A 1 121 ? 16.723  -3.412 18.592 1.00 14.64 ? 134 THR A CA  1 
ATOM   910  C C   . THR A 1 121 ? 16.842  -2.232 17.614 1.00 15.38 ? 134 THR A C   1 
ATOM   911  O O   . THR A 1 121 ? 17.283  -1.158 18.003 1.00 13.12 ? 134 THR A O   1 
ATOM   912  C CB  . THR A 1 121 ? 15.404  -3.264 19.401 1.00 18.15 ? 134 THR A CB  1 
ATOM   913  O OG1 . THR A 1 121 ? 15.313  -4.315 20.375 1.00 17.63 ? 134 THR A OG1 1 
ATOM   914  C CG2 . THR A 1 121 ? 14.196  -3.329 18.475 1.00 15.46 ? 134 THR A CG2 1 
ATOM   915  N N   . LEU A 1 122 ? 16.482  -2.437 16.349 1.00 13.35 ? 135 LEU A N   1 
ATOM   916  C CA  . LEU A 1 122 ? 16.551  -1.357 15.372 1.00 14.03 ? 135 LEU A CA  1 
ATOM   917  C C   . LEU A 1 122 ? 15.197  -0.677 15.257 1.00 13.18 ? 135 LEU A C   1 
ATOM   918  O O   . LEU A 1 122 ? 14.184  -1.322 14.976 1.00 14.49 ? 135 LEU A O   1 
ATOM   919  C CB  . LEU A 1 122 ? 16.980  -1.884 14.006 1.00 15.02 ? 135 LEU A CB  1 
ATOM   920  C CG  . LEU A 1 122 ? 18.413  -2.409 13.939 1.00 19.72 ? 135 LEU A CG  1 
ATOM   921  C CD1 . LEU A 1 122 ? 18.624  -3.074 12.594 1.00 21.55 ? 135 LEU A CD1 1 
ATOM   922  C CD2 . LEU A 1 122 ? 19.415  -1.278 14.150 1.00 16.08 ? 135 LEU A CD2 1 
ATOM   923  N N   . CYS A 1 123 ? 15.196  0.625  15.481 1.00 10.28 ? 136 CYS A N   1 
ATOM   924  C CA  . CYS A 1 123 ? 13.990  1.409  15.423 1.00 9.87  ? 136 CYS A CA  1 
ATOM   925  C C   . CYS A 1 123 ? 14.121  2.428  14.305 1.00 9.52  ? 136 CYS A C   1 
ATOM   926  O O   . CYS A 1 123 ? 15.225  2.847  13.963 1.00 13.78 ? 136 CYS A O   1 
ATOM   927  C CB  . CYS A 1 123 ? 13.751  2.065  16.778 1.00 12.09 ? 136 CYS A CB  1 
ATOM   928  S SG  . CYS A 1 123 ? 13.600  0.860  18.148 1.00 13.80 ? 136 CYS A SG  1 
ATOM   929  N N   . ASP A 1 124 ? 12.993  2.815  13.736 1.00 8.13  ? 137 ASP A N   1 
ATOM   930  C CA  . ASP A 1 124 ? 12.957  3.739  12.614 1.00 9.83  ? 137 ASP A CA  1 
ATOM   931  C C   . ASP A 1 124 ? 12.570  5.162  13.007 1.00 9.75  ? 137 ASP A C   1 
ATOM   932  O O   . ASP A 1 124 ? 11.598  5.353  13.734 1.00 12.21 ? 137 ASP A O   1 
ATOM   933  C CB  . ASP A 1 124 ? 11.954  3.183  11.596 1.00 13.82 ? 137 ASP A CB  1 
ATOM   934  C CG  . ASP A 1 124 ? 12.087  3.805  10.211 1.00 16.70 ? 137 ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 124 ? 13.192  4.216  9.818  1.00 21.42 ? 137 ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 124 ? 11.074  3.854  9.503  1.00 23.13 ? 137 ASP A OD2 1 
ATOM   937  N N   . VAL A 1 125 ? 13.365  6.140  12.578 1.00 9.59  ? 138 VAL A N   1 
ATOM   938  C CA  . VAL A 1 125 ? 13.106  7.557  12.828 1.00 10.26 ? 138 VAL A CA  1 
ATOM   939  C C   . VAL A 1 125 ? 13.052  8.206  11.450 1.00 13.53 ? 138 VAL A C   1 
ATOM   940  O O   . VAL A 1 125 ? 13.877  7.903  10.575 1.00 12.41 ? 138 VAL A O   1 
ATOM   941  C CB  . VAL A 1 125 ? 14.241  8.249  13.630 1.00 10.40 ? 138 VAL A CB  1 
ATOM   942  C CG1 . VAL A 1 125 ? 13.837  9.690  13.995 1.00 10.57 ? 138 VAL A CG1 1 
ATOM   943  C CG2 . VAL A 1 125 ? 14.572  7.467  14.868 1.00 15.53 ? 138 VAL A CG2 1 
ATOM   944  N N   . ALA A 1 126 ? 12.094  9.103  11.259 1.00 12.59 ? 139 ALA A N   1 
ATOM   945  C CA  . ALA A 1 126 ? 11.910  9.787  9.989  1.00 8.85  ? 139 ALA A CA  1 
ATOM   946  C C   . ALA A 1 126 ? 11.707  11.284 10.230 1.00 10.87 ? 139 ALA A C   1 
ATOM   947  O O   . ALA A 1 126 ? 11.275  11.702 11.317 1.00 11.53 ? 139 ALA A O   1 
ATOM   948  C CB  . ALA A 1 126 ? 10.714  9.188  9.257  1.00 8.30  ? 139 ALA A CB  1 
ATOM   949  N N   . GLY A 1 127 ? 12.052  12.106 9.242  1.00 7.65  ? 140 GLY A N   1 
ATOM   950  C CA  . GLY A 1 127 ? 11.883  13.540 9.388  1.00 6.21  ? 140 GLY A CA  1 
ATOM   951  C C   . GLY A 1 127 ? 12.367  14.326 8.187  1.00 8.05  ? 140 GLY A C   1 
ATOM   952  O O   . GLY A 1 127 ? 12.991  13.764 7.296  1.00 7.88  ? 140 GLY A O   1 
ATOM   953  N N   . TRP A 1 128 ? 12.061  15.621 8.178  1.00 7.81  ? 141 TRP A N   1 
ATOM   954  C CA  . TRP A 1 128 ? 12.464  16.550 7.130  1.00 7.42  ? 141 TRP A CA  1 
ATOM   955  C C   . TRP A 1 128 ? 13.540  17.486 7.692  1.00 6.30  ? 141 TRP A C   1 
ATOM   956  O O   . TRP A 1 128 ? 13.729  18.606 7.211  1.00 7.43  ? 141 TRP A O   1 
ATOM   957  C CB  . TRP A 1 128 ? 11.264  17.375 6.663  1.00 5.80  ? 141 TRP A CB  1 
ATOM   958  C CG  . TRP A 1 128 ? 10.264  16.644 5.818  1.00 8.00  ? 141 TRP A CG  1 
ATOM   959  C CD1 . TRP A 1 128 ? 10.306  16.479 4.453  1.00 7.75  ? 141 TRP A CD1 1 
ATOM   960  C CD2 . TRP A 1 128 ? 9.021   16.070 6.248  1.00 9.40  ? 141 TRP A CD2 1 
ATOM   961  N NE1 . TRP A 1 128 ? 9.173   15.855 4.010  1.00 6.89  ? 141 TRP A NE1 1 
ATOM   962  C CE2 . TRP A 1 128 ? 8.364   15.587 5.084  1.00 10.52 ? 141 TRP A CE2 1 
ATOM   963  C CE3 . TRP A 1 128 ? 8.397   15.916 7.494  1.00 9.60  ? 141 TRP A CE3 1 
ATOM   964  C CZ2 . TRP A 1 128 ? 7.113   14.961 5.132  1.00 10.97 ? 141 TRP A CZ2 1 
ATOM   965  C CZ3 . TRP A 1 128 ? 7.154   15.288 7.543  1.00 9.80  ? 141 TRP A CZ3 1 
ATOM   966  C CH2 . TRP A 1 128 ? 6.525   14.821 6.369  1.00 11.03 ? 141 TRP A CH2 1 
ATOM   967  N N   . GLY A 1 129 ? 14.228  17.027 8.736  1.00 9.11  ? 142 GLY A N   1 
ATOM   968  C CA  . GLY A 1 129 ? 15.274  17.819 9.367  1.00 8.95  ? 142 GLY A CA  1 
ATOM   969  C C   . GLY A 1 129 ? 16.546  17.896 8.537  1.00 12.25 ? 142 GLY A C   1 
ATOM   970  O O   . GLY A 1 129 ? 16.654  17.217 7.514  1.00 11.68 ? 142 GLY A O   1 
ATOM   971  N N   . ILE A 1 130 ? 17.526  18.667 8.992  1.00 11.94 ? 143 ILE A N   1 
ATOM   972  C CA  . ILE A 1 130 ? 18.758  18.818 8.228  1.00 12.90 ? 143 ILE A CA  1 
ATOM   973  C C   . ILE A 1 130 ? 19.456  17.496 7.952  1.00 13.18 ? 143 ILE A C   1 
ATOM   974  O O   . ILE A 1 130 ? 19.454  16.583 8.790  1.00 9.34  ? 143 ILE A O   1 
ATOM   975  C CB  . ILE A 1 130 ? 19.707  19.834 8.853  1.00 12.53 ? 143 ILE A CB  1 
ATOM   976  C CG1 . ILE A 1 130 ? 20.292  19.303 10.156 1.00 14.29 ? 143 ILE A CG1 1 
ATOM   977  C CG2 . ILE A 1 130 ? 19.001  21.157 9.044  1.00 10.90 ? 143 ILE A CG2 1 
ATOM   978  C CD1 . ILE A 1 130 ? 21.388  20.205 10.719 1.00 16.34 ? 143 ILE A CD1 1 
ATOM   979  N N   . VAL A 1 131 ? 19.988  17.381 6.732  1.00 13.47 ? 144 VAL A N   1 
ATOM   980  C CA  . VAL A 1 131 ? 20.665  16.167 6.251  1.00 14.31 ? 144 VAL A CA  1 
ATOM   981  C C   . VAL A 1 131 ? 22.195  16.157 6.310  1.00 15.27 ? 144 VAL A C   1 
ATOM   982  O O   . VAL A 1 131 ? 22.817  15.134 6.015  1.00 14.18 ? 144 VAL A O   1 
ATOM   983  C CB  . VAL A 1 131 ? 20.197  15.792 4.822  1.00 15.72 ? 144 VAL A CB  1 
ATOM   984  C CG1 . VAL A 1 131 ? 18.713  15.455 4.832  1.00 15.36 ? 144 VAL A CG1 1 
ATOM   985  C CG2 . VAL A 1 131 ? 20.464  16.939 3.854  1.00 13.01 ? 144 VAL A CG2 1 
ATOM   986  N N   . ASN A 1 132 ? 22.794  17.287 6.675  1.00 17.97 ? 145 ASN A N   1 
ATOM   987  C CA  . ASN A 1 132 ? 24.243  17.382 6.827  1.00 19.63 ? 145 ASN A CA  1 
ATOM   988  C C   . ASN A 1 132 ? 24.577  18.496 7.791  1.00 20.24 ? 145 ASN A C   1 
ATOM   989  O O   . ASN A 1 132 ? 23.696  19.246 8.201  1.00 18.32 ? 145 ASN A O   1 
ATOM   990  C CB  . ASN A 1 132 ? 24.963  17.592 5.486  1.00 19.89 ? 145 ASN A CB  1 
ATOM   991  C CG  . ASN A 1 132 ? 24.493  18.825 4.739  1.00 21.30 ? 145 ASN A CG  1 
ATOM   992  O OD1 . ASN A 1 132 ? 24.100  19.833 5.331  1.00 21.62 ? 145 ASN A OD1 1 
ATOM   993  N ND2 . ASN A 1 132 ? 24.548  18.754 3.420  1.00 22.47 ? 145 ASN A ND2 1 
ATOM   994  N N   . HIS A 1 133 ? 25.852  18.612 8.149  1.00 23.11 ? 146 HIS A N   1 
ATOM   995  C CA  . HIS A 1 133 ? 26.290  19.650 9.086  1.00 24.67 ? 146 HIS A CA  1 
ATOM   996  C C   . HIS A 1 133 ? 26.182  21.098 8.593  1.00 22.86 ? 146 HIS A C   1 
ATOM   997  O O   . HIS A 1 133 ? 26.110  22.026 9.401  1.00 22.99 ? 146 HIS A O   1 
ATOM   998  C CB  . HIS A 1 133 ? 27.702  19.350 9.607  1.00 27.37 ? 146 HIS A CB  1 
ATOM   999  C CG  . HIS A 1 133 ? 27.741  18.304 10.681 1.00 34.20 ? 146 HIS A CG  1 
ATOM   1000 N ND1 . HIS A 1 133 ? 28.869  18.046 11.431 1.00 38.90 ? 146 HIS A ND1 1 
ATOM   1001 C CD2 . HIS A 1 133 ? 26.786  17.458 11.140 1.00 36.50 ? 146 HIS A CD2 1 
ATOM   1002 C CE1 . HIS A 1 133 ? 28.611  17.086 12.301 1.00 38.46 ? 146 HIS A CE1 1 
ATOM   1003 N NE2 . HIS A 1 133 ? 27.353  16.712 12.144 1.00 36.60 ? 146 HIS A NE2 1 
ATOM   1004 N N   . ALA A 1 134 ? 26.133  21.282 7.276  1.00 19.67 ? 147 ALA A N   1 
ATOM   1005 C CA  . ALA A 1 134 ? 26.013  22.610 6.672  1.00 17.77 ? 147 ALA A CA  1 
ATOM   1006 C C   . ALA A 1 134 ? 24.611  23.175 6.896  1.00 16.72 ? 147 ALA A C   1 
ATOM   1007 O O   . ALA A 1 134 ? 24.373  24.370 6.706  1.00 16.69 ? 147 ALA A O   1 
ATOM   1008 C CB  . ALA A 1 134 ? 26.314  22.531 5.164  1.00 18.72 ? 147 ALA A CB  1 
ATOM   1009 N N   . GLY A 1 135 ? 23.676  22.300 7.262  1.00 17.30 ? 149 GLY A N   1 
ATOM   1010 C CA  . GLY A 1 135 ? 22.315  22.733 7.516  1.00 15.80 ? 149 GLY A CA  1 
ATOM   1011 C C   . GLY A 1 135 ? 21.375  22.575 6.344  1.00 14.77 ? 149 GLY A C   1 
ATOM   1012 O O   . GLY A 1 135 ? 20.326  23.231 6.316  1.00 15.43 ? 149 GLY A O   1 
ATOM   1013 N N   . ARG A 1 136 ? 21.702  21.669 5.416  1.00 15.12 ? 150 ARG A N   1 
ATOM   1014 C CA  . ARG A 1 136 ? 20.868  21.449 4.235  1.00 16.83 ? 150 ARG A CA  1 
ATOM   1015 C C   . ARG A 1 136 ? 19.547  20.783 4.608  1.00 13.68 ? 150 ARG A C   1 
ATOM   1016 O O   . ARG A 1 136 ? 19.523  19.802 5.333  1.00 13.90 ? 150 ARG A O   1 
ATOM   1017 C CB  . ARG A 1 136 ? 21.593  20.592 3.189  1.00 18.57 ? 150 ARG A CB  1 
ATOM   1018 C CG  . ARG A 1 136 ? 20.893  20.627 1.836  1.00 25.69 ? 150 ARG A CG  1 
ATOM   1019 C CD  . ARG A 1 136 ? 21.137  19.383 0.988  1.00 33.83 ? 150 ARG A CD  1 
ATOM   1020 N NE  . ARG A 1 136 ? 19.887  19.002 0.325  1.00 42.42 ? 150 ARG A NE  1 
ATOM   1021 C CZ  . ARG A 1 136 ? 19.583  17.773 -0.082 1.00 43.73 ? 150 ARG A CZ  1 
ATOM   1022 N NH1 . ARG A 1 136 ? 20.448  16.776 0.083  1.00 46.05 ? 150 ARG A NH1 1 
ATOM   1023 N NH2 . ARG A 1 136 ? 18.372  17.527 -0.574 1.00 42.54 ? 150 ARG A NH2 1 
ATOM   1024 N N   . ARG A 1 137 ? 18.451  21.319 4.099  1.00 15.66 ? 151 ARG A N   1 
ATOM   1025 C CA  . ARG A 1 137 ? 17.127  20.782 4.387  1.00 17.93 ? 151 ARG A CA  1 
ATOM   1026 C C   . ARG A 1 137 ? 16.581  20.047 3.169  1.00 15.33 ? 151 ARG A C   1 
ATOM   1027 O O   . ARG A 1 137 ? 16.562  20.588 2.067  1.00 17.04 ? 151 ARG A O   1 
ATOM   1028 C CB  . ARG A 1 137 ? 16.177  21.922 4.770  1.00 22.85 ? 151 ARG A CB  1 
ATOM   1029 C CG  . ARG A 1 137 ? 16.589  22.685 6.014  1.00 31.97 ? 151 ARG A CG  1 
ATOM   1030 C CD  . ARG A 1 137 ? 15.896  24.042 6.110  1.00 41.51 ? 151 ARG A CD  1 
ATOM   1031 N NE  . ARG A 1 137 ? 16.322  25.007 5.082  1.00 50.74 ? 151 ARG A NE  1 
ATOM   1032 C CZ  . ARG A 1 137 ? 17.582  25.404 4.865  1.00 54.52 ? 151 ARG A CZ  1 
ATOM   1033 N NH1 . ARG A 1 137 ? 18.588  24.916 5.578  1.00 55.83 ? 151 ARG A NH1 1 
ATOM   1034 N NH2 . ARG A 1 137 ? 17.846  26.291 3.913  1.00 55.94 ? 151 ARG A NH2 1 
ATOM   1035 N N   . PRO A 1 138 ? 16.110  18.810 3.351  1.00 14.17 ? 152 PRO A N   1 
ATOM   1036 C CA  . PRO A 1 138 ? 15.566  18.044 2.227  1.00 13.43 ? 152 PRO A CA  1 
ATOM   1037 C C   . PRO A 1 138 ? 14.142  18.465 1.875  1.00 14.48 ? 152 PRO A C   1 
ATOM   1038 O O   . PRO A 1 138 ? 13.430  19.028 2.706  1.00 17.19 ? 152 PRO A O   1 
ATOM   1039 C CB  . PRO A 1 138 ? 15.596  16.622 2.761  1.00 12.85 ? 152 PRO A CB  1 
ATOM   1040 C CG  . PRO A 1 138 ? 15.254  16.834 4.240  1.00 12.27 ? 152 PRO A CG  1 
ATOM   1041 C CD  . PRO A 1 138 ? 16.091  18.024 4.603  1.00 12.32 ? 152 PRO A CD  1 
ATOM   1042 N N   . ASP A 1 139 ? 13.729  18.240 0.635  1.00 12.67 ? 153 ASP A N   1 
ATOM   1043 C CA  . ASP A 1 139 ? 12.364  18.567 0.251  1.00 11.08 ? 153 ASP A CA  1 
ATOM   1044 C C   . ASP A 1 139 ? 11.465  17.377 0.582  1.00 8.92  ? 153 ASP A C   1 
ATOM   1045 O O   . ASP A 1 139 ? 10.280  17.537 0.878  1.00 10.46 ? 153 ASP A O   1 
ATOM   1046 C CB  . ASP A 1 139 ? 12.269  18.886 -1.251 1.00 10.03 ? 153 ASP A CB  1 
ATOM   1047 C CG  . ASP A 1 139 ? 10.825  18.978 -1.738 1.00 11.44 ? 153 ASP A CG  1 
ATOM   1048 O OD1 . ASP A 1 139 ? 10.172  20.011 -1.507 1.00 12.43 ? 153 ASP A OD1 1 
ATOM   1049 O OD2 . ASP A 1 139 ? 10.340  18.007 -2.344 1.00 9.88  ? 153 ASP A OD2 1 
ATOM   1050 N N   . SER A 1 140 ? 12.031  16.177 0.512  1.00 10.56 ? 154 SER A N   1 
ATOM   1051 C CA  . SER A 1 140 ? 11.269  14.972 0.761  1.00 11.66 ? 154 SER A CA  1 
ATOM   1052 C C   . SER A 1 140 ? 11.673  14.288 2.056  1.00 10.49 ? 154 SER A C   1 
ATOM   1053 O O   . SER A 1 140 ? 12.778  14.487 2.563  1.00 10.28 ? 154 SER A O   1 
ATOM   1054 C CB  . SER A 1 140 ? 11.394  14.011 -0.429 1.00 13.26 ? 154 SER A CB  1 
ATOM   1055 O OG  . SER A 1 140 ? 12.721  13.534 -0.581 1.00 16.62 ? 154 SER A OG  1 
ATOM   1056 N N   . LEU A 1 141 ? 10.771  13.461 2.566  1.00 10.98 ? 155 LEU A N   1 
ATOM   1057 C CA  . LEU A 1 141 ? 10.975  12.733 3.817  1.00 10.34 ? 155 LEU A CA  1 
ATOM   1058 C C   . LEU A 1 141 ? 12.144  11.756 3.787  1.00 10.52 ? 155 LEU A C   1 
ATOM   1059 O O   . LEU A 1 141 ? 12.238  10.909 2.894  1.00 11.40 ? 155 LEU A O   1 
ATOM   1060 C CB  . LEU A 1 141 ? 9.684   11.972 4.187  1.00 9.76  ? 155 LEU A CB  1 
ATOM   1061 C CG  . LEU A 1 141 ? 9.599   11.276 5.557  1.00 10.40 ? 155 LEU A CG  1 
ATOM   1062 C CD1 . LEU A 1 141 ? 9.560   12.321 6.661  1.00 8.20  ? 155 LEU A CD1 1 
ATOM   1063 C CD2 . LEU A 1 141 ? 8.370   10.407 5.616  1.00 8.60  ? 155 LEU A CD2 1 
ATOM   1064 N N   . GLN A 1 142 ? 12.994  11.847 4.802  1.00 8.86  ? 156 GLN A N   1 
ATOM   1065 C CA  . GLN A 1 142 ? 14.151  10.983 4.951  1.00 9.40  ? 156 GLN A CA  1 
ATOM   1066 C C   . GLN A 1 142 ? 13.896  10.077 6.148  1.00 11.38 ? 156 GLN A C   1 
ATOM   1067 O O   . GLN A 1 142 ? 13.003  10.347 6.950  1.00 11.86 ? 156 GLN A O   1 
ATOM   1068 C CB  . GLN A 1 142 ? 15.386  11.833 5.255  1.00 8.28  ? 156 GLN A CB  1 
ATOM   1069 C CG  . GLN A 1 142 ? 15.629  12.970 4.265  1.00 11.03 ? 156 GLN A CG  1 
ATOM   1070 C CD  . GLN A 1 142 ? 16.000  12.450 2.890  1.00 13.24 ? 156 GLN A CD  1 
ATOM   1071 O OE1 . GLN A 1 142 ? 16.962  11.710 2.759  1.00 13.76 ? 156 GLN A OE1 1 
ATOM   1072 N NE2 . GLN A 1 142 ? 15.207  12.781 1.876  1.00 12.42 ? 156 GLN A NE2 1 
ATOM   1073 N N   . HIS A 1 143 ? 14.685  9.021  6.289  1.00 10.19 ? 157 HIS A N   1 
ATOM   1074 C CA  . HIS A 1 143 ? 14.557  8.124  7.436  1.00 12.88 ? 157 HIS A CA  1 
ATOM   1075 C C   . HIS A 1 143 ? 15.870  7.362  7.656  1.00 14.90 ? 157 HIS A C   1 
ATOM   1076 O O   . HIS A 1 143 ? 16.746  7.364  6.781  1.00 13.78 ? 157 HIS A O   1 
ATOM   1077 C CB  . HIS A 1 143 ? 13.364  7.170  7.285  1.00 11.06 ? 157 HIS A CB  1 
ATOM   1078 C CG  . HIS A 1 143 ? 13.666  5.948  6.484  1.00 13.73 ? 157 HIS A CG  1 
ATOM   1079 N ND1 . HIS A 1 143 ? 13.735  4.691  7.043  1.00 15.02 ? 157 HIS A ND1 1 
ATOM   1080 C CD2 . HIS A 1 143 ? 13.954  5.792  5.171  1.00 13.67 ? 157 HIS A CD2 1 
ATOM   1081 C CE1 . HIS A 1 143 ? 14.057  3.813  6.111  1.00 16.69 ? 157 HIS A CE1 1 
ATOM   1082 N NE2 . HIS A 1 143 ? 14.195  4.456  4.968  1.00 14.47 ? 157 HIS A NE2 1 
ATOM   1083 N N   . VAL A 1 144 ? 16.023  6.758  8.832  1.00 11.27 ? 158 VAL A N   1 
ATOM   1084 C CA  . VAL A 1 144 ? 17.227  6.010  9.178  1.00 11.79 ? 158 VAL A CA  1 
ATOM   1085 C C   . VAL A 1 144 ? 16.884  4.994  10.271 1.00 15.03 ? 158 VAL A C   1 
ATOM   1086 O O   . VAL A 1 144 ? 15.990  5.242  11.086 1.00 14.64 ? 158 VAL A O   1 
ATOM   1087 C CB  . VAL A 1 144 ? 18.341  6.983  9.664  1.00 10.45 ? 158 VAL A CB  1 
ATOM   1088 C CG1 . VAL A 1 144 ? 18.020  7.539  11.035 1.00 10.28 ? 158 VAL A CG1 1 
ATOM   1089 C CG2 . VAL A 1 144 ? 19.707  6.308  9.655  1.00 13.68 ? 158 VAL A CG2 1 
ATOM   1090 N N   . LEU A 1 145 ? 17.496  3.813  10.221 1.00 14.16 ? 159 LEU A N   1 
ATOM   1091 C CA  . LEU A 1 145 ? 17.259  2.799  11.237 1.00 15.24 ? 159 LEU A CA  1 
ATOM   1092 C C   . LEU A 1 145 ? 18.372  2.956  12.255 1.00 15.82 ? 159 LEU A C   1 
ATOM   1093 O O   . LEU A 1 145 ? 19.550  3.006  11.882 1.00 14.72 ? 159 LEU A O   1 
ATOM   1094 C CB  . LEU A 1 145 ? 17.303  1.402  10.634 1.00 17.19 ? 159 LEU A CB  1 
ATOM   1095 C CG  . LEU A 1 145 ? 16.192  1.020  9.662  1.00 19.65 ? 159 LEU A CG  1 
ATOM   1096 C CD1 . LEU A 1 145 ? 16.492  -0.359 9.115  1.00 23.25 ? 159 LEU A CD1 1 
ATOM   1097 C CD2 . LEU A 1 145 ? 14.857  1.002  10.379 1.00 23.14 ? 159 LEU A CD2 1 
ATOM   1098 N N   . LEU A 1 146 ? 18.014  3.060  13.532 1.00 12.60 ? 160 LEU A N   1 
ATOM   1099 C CA  . LEU A 1 146 ? 19.008  3.230  14.593 1.00 11.29 ? 160 LEU A CA  1 
ATOM   1100 C C   . LEU A 1 146 ? 18.813  2.189  15.696 1.00 13.22 ? 160 LEU A C   1 
ATOM   1101 O O   . LEU A 1 146 ? 17.685  1.862  16.047 1.00 12.69 ? 160 LEU A O   1 
ATOM   1102 C CB  . LEU A 1 146 ? 18.876  4.625  15.206 1.00 13.16 ? 160 LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 146 ? 19.032  5.887  14.348 1.00 13.48 ? 160 LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 146 ? 18.575  7.091  15.144 1.00 15.35 ? 160 LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 146 ? 20.489  6.075  13.896 1.00 14.36 ? 160 LEU A CD2 1 
ATOM   1106 N N   . PRO A 1 147 ? 19.909  1.627  16.226 1.00 13.47 ? 161 PRO A N   1 
ATOM   1107 C CA  . PRO A 1 147 ? 19.810  0.626  17.296 1.00 14.57 ? 161 PRO A CA  1 
ATOM   1108 C C   . PRO A 1 147 ? 19.695  1.305  18.649 1.00 10.06 ? 161 PRO A C   1 
ATOM   1109 O O   . PRO A 1 147 ? 20.365  2.300  18.911 1.00 8.71  ? 161 PRO A O   1 
ATOM   1110 C CB  . PRO A 1 147 ? 21.125  -0.146 17.164 1.00 14.40 ? 161 PRO A CB  1 
ATOM   1111 C CG  . PRO A 1 147 ? 22.065  0.918  16.769 1.00 16.61 ? 161 PRO A CG  1 
ATOM   1112 C CD  . PRO A 1 147 ? 21.295  1.739  15.746 1.00 15.25 ? 161 PRO A CD  1 
ATOM   1113 N N   . VAL A 1 148 ? 18.822  0.771  19.498 1.00 13.14 ? 162 VAL A N   1 
ATOM   1114 C CA  . VAL A 1 148 ? 18.595  1.309  20.843 1.00 11.29 ? 162 VAL A CA  1 
ATOM   1115 C C   . VAL A 1 148 ? 19.738  0.947  21.791 1.00 10.93 ? 162 VAL A C   1 
ATOM   1116 O O   . VAL A 1 148 ? 20.259  -0.154 21.746 1.00 13.02 ? 162 VAL A O   1 
ATOM   1117 C CB  . VAL A 1 148 ? 17.253  0.786  21.422 1.00 12.20 ? 162 VAL A CB  1 
ATOM   1118 C CG1 . VAL A 1 148 ? 17.103  1.159  22.908 1.00 8.80  ? 162 VAL A CG1 1 
ATOM   1119 C CG2 . VAL A 1 148 ? 16.103  1.362  20.628 1.00 11.95 ? 162 VAL A CG2 1 
ATOM   1120 N N   . LEU A 1 149 ? 20.120  1.897  22.632 1.00 12.85 ? 163 LEU A N   1 
ATOM   1121 C CA  . LEU A 1 149 ? 21.183  1.739  23.625 1.00 17.25 ? 163 LEU A CA  1 
ATOM   1122 C C   . LEU A 1 149 ? 20.614  1.306  24.985 1.00 19.75 ? 163 LEU A C   1 
ATOM   1123 O O   . LEU A 1 149 ? 19.556  1.783  25.390 1.00 20.82 ? 163 LEU A O   1 
ATOM   1124 C CB  . LEU A 1 149 ? 21.877  3.080  23.808 1.00 17.54 ? 163 LEU A CB  1 
ATOM   1125 C CG  . LEU A 1 149 ? 23.373  3.095  23.556 1.00 20.81 ? 163 LEU A CG  1 
ATOM   1126 C CD1 . LEU A 1 149 ? 23.661  2.251  22.350 1.00 19.75 ? 163 LEU A CD1 1 
ATOM   1127 C CD2 . LEU A 1 149 ? 23.844  4.522  23.365 1.00 23.69 ? 163 LEU A CD2 1 
ATOM   1128 N N   . ASP A 1 150 ? 21.314  0.422  25.694 1.00 20.37 ? 164 ASP A N   1 
ATOM   1129 C CA  . ASP A 1 150 ? 20.855  -0.018 27.013 1.00 20.82 ? 164 ASP A CA  1 
ATOM   1130 C C   . ASP A 1 150 ? 20.832  1.203  27.930 1.00 20.99 ? 164 ASP A C   1 
ATOM   1131 O O   . ASP A 1 150 ? 21.631  2.133  27.768 1.00 18.24 ? 164 ASP A O   1 
ATOM   1132 C CB  . ASP A 1 150 ? 21.761  -1.113 27.592 1.00 21.13 ? 164 ASP A CB  1 
ATOM   1133 C CG  . ASP A 1 150 ? 23.185  -0.635 27.835 1.00 22.27 ? 164 ASP A CG  1 
ATOM   1134 O OD1 . ASP A 1 150 ? 23.933  -0.463 26.853 1.00 21.60 ? 164 ASP A OD1 1 
ATOM   1135 O OD2 . ASP A 1 150 ? 23.559  -0.424 29.003 1.00 19.33 ? 164 ASP A OD2 1 
ATOM   1136 N N   . ARG A 1 151 ? 19.917  1.192  28.892 1.00 26.63 ? 165 ARG A N   1 
ATOM   1137 C CA  . ARG A 1 151 ? 19.745  2.310  29.828 1.00 27.89 ? 165 ARG A CA  1 
ATOM   1138 C C   . ARG A 1 151 ? 21.020  2.779  30.519 1.00 24.93 ? 165 ARG A C   1 
ATOM   1139 O O   . ARG A 1 151 ? 21.323  3.974  30.543 1.00 26.93 ? 165 ARG A O   1 
ATOM   1140 C CB  . ARG A 1 151 ? 18.689  1.947  30.868 1.00 30.00 ? 165 ARG A CB  1 
ATOM   1141 C CG  . ARG A 1 151 ? 18.357  3.078  31.819 1.00 35.45 ? 165 ARG A CG  1 
ATOM   1142 C CD  . ARG A 1 151 ? 16.969  2.893  32.424 1.00 36.31 ? 165 ARG A CD  1 
ATOM   1143 N NE  . ARG A 1 151 ? 15.919  3.043  31.421 1.00 29.69 ? 165 ARG A NE  1 
ATOM   1144 C CZ  . ARG A 1 151 ? 15.644  4.178  30.795 1.00 23.29 ? 165 ARG A CZ  1 
ATOM   1145 N NH1 . ARG A 1 151 ? 16.336  5.275  31.066 1.00 22.74 ? 165 ARG A NH1 1 
ATOM   1146 N NH2 . ARG A 1 151 ? 14.691  4.207  29.876 1.00 22.89 ? 165 ARG A NH2 1 
ATOM   1147 N N   . ALA A 1 152 ? 21.787  1.829  31.040 1.00 24.35 ? 166 ALA A N   1 
ATOM   1148 C CA  . ALA A 1 152 ? 23.022  2.139  31.749 1.00 24.11 ? 166 ALA A CA  1 
ATOM   1149 C C   . ALA A 1 152 ? 24.063  2.876  30.916 1.00 26.95 ? 166 ALA A C   1 
ATOM   1150 O O   . ALA A 1 152 ? 24.606  3.884  31.363 1.00 29.33 ? 166 ALA A O   1 
ATOM   1151 C CB  . ALA A 1 152 ? 23.624  0.854  32.331 1.00 21.61 ? 166 ALA A CB  1 
ATOM   1152 N N   . THR A 1 153 ? 24.304  2.403  29.693 1.00 30.88 ? 167 THR A N   1 
ATOM   1153 C CA  . THR A 1 153 ? 25.319  2.974  28.789 1.00 31.78 ? 167 THR A CA  1 
ATOM   1154 C C   . THR A 1 153 ? 25.191  4.442  28.404 1.00 34.62 ? 167 THR A C   1 
ATOM   1155 O O   . THR A 1 153 ? 26.196  5.133  28.186 1.00 36.37 ? 167 THR A O   1 
ATOM   1156 C CB  . THR A 1 153 ? 25.437  2.131  27.490 1.00 30.82 ? 167 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 153 ? 26.038  0.869  27.797 1.00 30.56 ? 167 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 153 ? 26.287  2.837  26.434 1.00 30.92 ? 167 THR A CG2 1 
ATOM   1159 N N   . CYS A 1 154 ? 23.970  4.934  28.325 1.00 35.69 ? 168 CYS A N   1 
ATOM   1160 C CA  . CYS A 1 154 ? 23.776  6.310  27.920 1.00 41.03 ? 168 CYS A CA  1 
ATOM   1161 C C   . CYS A 1 154 ? 24.183  7.306  28.995 1.00 44.12 ? 168 CYS A C   1 
ATOM   1162 O O   . CYS A 1 154 ? 24.600  8.437  28.696 1.00 44.58 ? 168 CYS A O   1 
ATOM   1163 C CB  . CYS A 1 154 ? 22.322  6.528  27.525 1.00 40.52 ? 168 CYS A CB  1 
ATOM   1164 S SG  . CYS A 1 154 ? 22.085  7.893  26.344 1.00 39.03 ? 168 CYS A SG  1 
ATOM   1165 N N   . ASN A 1 155 ? 24.111  6.856  30.243 1.00 48.52 ? 169 ASN A N   1 
ATOM   1166 C CA  . ASN A 1 155 ? 24.434  7.683  31.398 1.00 49.90 ? 169 ASN A CA  1 
ATOM   1167 C C   . ASN A 1 155 ? 25.914  7.835  31.728 1.00 53.13 ? 169 ASN A C   1 
ATOM   1168 O O   . ASN A 1 155 ? 26.268  8.550  32.666 1.00 53.47 ? 169 ASN A O   1 
ATOM   1169 C CB  . ASN A 1 155 ? 23.654  7.185  32.613 1.00 47.26 ? 169 ASN A CB  1 
ATOM   1170 C CG  . ASN A 1 155 ? 22.215  7.627  32.585 1.00 44.33 ? 169 ASN A CG  1 
ATOM   1171 O OD1 . ASN A 1 155 ? 21.942  8.815  32.516 1.00 43.42 ? 169 ASN A OD1 1 
ATOM   1172 N ND2 . ASN A 1 155 ? 21.287  6.679  32.614 1.00 42.16 ? 169 ASN A ND2 1 
ATOM   1173 N N   . ARG A 1 156 ? 26.772  7.175  30.954 1.00 57.70 ? 170 ARG A N   1 
ATOM   1174 C CA  . ARG A 1 156 ? 28.221  7.252  31.145 1.00 63.37 ? 170 ARG A CA  1 
ATOM   1175 C C   . ARG A 1 156 ? 28.690  8.708  31.243 1.00 65.40 ? 170 ARG A C   1 
ATOM   1176 O O   . ARG A 1 156 ? 28.126  9.588  30.592 1.00 65.32 ? 170 ARG A O   1 
ATOM   1177 C CB  . ARG A 1 156 ? 28.944  6.580  29.971 1.00 65.36 ? 170 ARG A CB  1 
ATOM   1178 C CG  . ARG A 1 156 ? 29.646  5.267  30.294 1.00 68.89 ? 170 ARG A CG  1 
ATOM   1179 C CD  . ARG A 1 156 ? 28.675  4.108  30.462 1.00 71.69 ? 170 ARG A CD  1 
ATOM   1180 N NE  . ARG A 1 156 ? 27.948  4.158  31.728 1.00 75.05 ? 170 ARG A NE  1 
ATOM   1181 C CZ  . ARG A 1 156 ? 27.277  3.133  32.248 1.00 76.50 ? 170 ARG A CZ  1 
ATOM   1182 N NH1 . ARG A 1 156 ? 27.234  1.966  31.616 1.00 75.53 ? 170 ARG A NH1 1 
ATOM   1183 N NH2 . ARG A 1 156 ? 26.637  3.278  33.401 1.00 76.93 ? 170 ARG A NH2 1 
ATOM   1184 N N   . ARG A 1 157 A 29.736  8.943  32.036 1.00 68.35 ? 170 ARG A N   1 
ATOM   1185 C CA  . ARG A 1 157 A 30.309  10.283 32.228 1.00 70.90 ? 170 ARG A CA  1 
ATOM   1186 C C   . ARG A 1 157 A 30.681  10.904 30.883 1.00 70.12 ? 170 ARG A C   1 
ATOM   1187 O O   . ARG A 1 157 A 30.500  12.102 30.651 1.00 69.16 ? 170 ARG A O   1 
ATOM   1188 C CB  . ARG A 1 157 A 31.571  10.197 33.097 1.00 74.63 ? 170 ARG A CB  1 
ATOM   1189 C CG  . ARG A 1 157 A 32.172  11.550 33.485 1.00 79.57 ? 170 ARG A CG  1 
ATOM   1190 C CD  . ARG A 1 157 A 33.656  11.436 33.833 1.00 84.80 ? 170 ARG A CD  1 
ATOM   1191 N NE  . ARG A 1 157 A 34.512  11.446 32.643 1.00 89.50 ? 170 ARG A NE  1 
ATOM   1192 C CZ  . ARG A 1 157 A 35.250  10.418 32.223 1.00 91.36 ? 170 ARG A CZ  1 
ATOM   1193 N NH1 . ARG A 1 157 A 35.251  9.267  32.889 1.00 92.34 ? 170 ARG A NH1 1 
ATOM   1194 N NH2 . ARG A 1 157 A 36.005  10.549 31.138 1.00 91.66 ? 170 ARG A NH2 1 
ATOM   1195 N N   . THR A 1 158 B 31.215  10.062 30.010 1.00 69.86 ? 170 THR A N   1 
ATOM   1196 C CA  . THR A 1 158 B 31.635  10.461 28.679 1.00 70.43 ? 170 THR A CA  1 
ATOM   1197 C C   . THR A 1 158 B 30.462  10.645 27.703 1.00 69.83 ? 170 THR A C   1 
ATOM   1198 O O   . THR A 1 158 B 30.666  10.967 26.527 1.00 69.98 ? 170 THR A O   1 
ATOM   1199 C CB  . THR A 1 158 B 32.635  9.427  28.124 1.00 71.10 ? 170 THR A CB  1 
ATOM   1200 O OG1 . THR A 1 158 B 32.153  8.099  28.390 1.00 71.83 ? 170 THR A OG1 1 
ATOM   1201 C CG2 . THR A 1 158 B 33.993  9.604  28.792 1.00 71.69 ? 170 THR A CG2 1 
ATOM   1202 N N   . HIS A 1 159 ? 29.244  10.421 28.195 1.00 68.87 ? 171 HIS A N   1 
ATOM   1203 C CA  . HIS A 1 159 ? 28.031  10.554 27.392 1.00 67.22 ? 171 HIS A CA  1 
ATOM   1204 C C   . HIS A 1 159 ? 27.074  11.546 28.055 1.00 66.28 ? 171 HIS A C   1 
ATOM   1205 O O   . HIS A 1 159 ? 27.395  12.726 28.197 1.00 66.12 ? 171 HIS A O   1 
ATOM   1206 C CB  . HIS A 1 159 ? 27.347  9.192  27.226 1.00 66.11 ? 171 HIS A CB  1 
ATOM   1207 C CG  . HIS A 1 159 ? 28.116  8.224  26.386 1.00 65.35 ? 171 HIS A CG  1 
ATOM   1208 N ND1 . HIS A 1 159 ? 27.776  6.893  26.288 1.00 66.00 ? 171 HIS A ND1 1 
ATOM   1209 C CD2 . HIS A 1 159 ? 29.196  8.396  25.588 1.00 65.69 ? 171 HIS A CD2 1 
ATOM   1210 C CE1 . HIS A 1 159 ? 28.610  6.288  25.461 1.00 65.84 ? 171 HIS A CE1 1 
ATOM   1211 N NE2 . HIS A 1 159 ? 29.481  7.177  25.022 1.00 65.68 ? 171 HIS A NE2 1 
ATOM   1212 N N   . HIS A 1 160 ? 25.902  11.066 28.464 1.00 64.74 ? 172 HIS A N   1 
ATOM   1213 C CA  . HIS A 1 160 ? 24.913  11.910 29.111 1.00 65.08 ? 172 HIS A CA  1 
ATOM   1214 C C   . HIS A 1 160 ? 24.917  11.553 30.579 1.00 67.52 ? 172 HIS A C   1 
ATOM   1215 O O   . HIS A 1 160 ? 24.030  10.852 31.064 1.00 70.07 ? 172 HIS A O   1 
ATOM   1216 C CB  . HIS A 1 160 ? 23.542  11.677 28.492 1.00 62.05 ? 172 HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 160 ? 23.479  12.034 27.038 1.00 61.22 ? 172 HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 160 ? 22.957  11.189 26.083 1.00 59.81 ? 172 HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 160 ? 23.881  13.146 26.375 1.00 59.39 ? 172 HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 160 ? 23.039  11.764 24.897 1.00 57.57 ? 172 HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 160 ? 23.595  12.953 25.046 1.00 58.10 ? 172 HIS A NE2 1 
ATOM   1222 N N   . ASP A 1 161 ? 25.954  12.027 31.261 1.00 69.63 ? 173 ASP A N   1 
ATOM   1223 C CA  . ASP A 1 161 ? 26.179  11.790 32.683 1.00 71.54 ? 173 ASP A CA  1 
ATOM   1224 C C   . ASP A 1 161 ? 24.924  11.997 33.535 1.00 71.38 ? 173 ASP A C   1 
ATOM   1225 O O   . ASP A 1 161 ? 24.640  13.115 33.979 1.00 72.67 ? 173 ASP A O   1 
ATOM   1226 C CB  . ASP A 1 161 ? 27.315  12.701 33.177 1.00 73.72 ? 173 ASP A CB  1 
ATOM   1227 C CG  . ASP A 1 161 ? 28.001  12.176 34.436 1.00 76.46 ? 173 ASP A CG  1 
ATOM   1228 O OD1 . ASP A 1 161 ? 27.407  11.354 35.169 1.00 77.93 ? 173 ASP A OD1 1 
ATOM   1229 O OD2 . ASP A 1 161 ? 29.152  12.594 34.692 1.00 76.82 ? 173 ASP A OD2 1 
ATOM   1230 N N   . GLY A 1 162 ? 24.164  10.919 33.726 1.00 70.10 ? 174 GLY A N   1 
ATOM   1231 C CA  . GLY A 1 162 ? 22.955  10.968 34.537 1.00 67.64 ? 174 GLY A CA  1 
ATOM   1232 C C   . GLY A 1 162 ? 21.778  11.760 33.992 1.00 65.40 ? 174 GLY A C   1 
ATOM   1233 O O   . GLY A 1 162 ? 20.720  11.802 34.629 1.00 66.56 ? 174 GLY A O   1 
ATOM   1234 N N   . ALA A 1 163 ? 21.938  12.350 32.807 1.00 62.31 ? 175 ALA A N   1 
ATOM   1235 C CA  . ALA A 1 163 ? 20.886  13.158 32.181 1.00 58.22 ? 175 ALA A CA  1 
ATOM   1236 C C   . ALA A 1 163 ? 19.679  12.346 31.724 1.00 54.53 ? 175 ALA A C   1 
ATOM   1237 O O   . ALA A 1 163 ? 18.599  12.896 31.497 1.00 55.42 ? 175 ALA A O   1 
ATOM   1238 C CB  . ALA A 1 163 ? 21.452  13.933 31.001 1.00 59.32 ? 175 ALA A CB  1 
ATOM   1239 N N   . ILE A 1 164 ? 19.871  11.039 31.593 1.00 49.31 ? 176 ILE A N   1 
ATOM   1240 C CA  . ILE A 1 164 ? 18.825  10.139 31.142 1.00 43.45 ? 176 ILE A CA  1 
ATOM   1241 C C   . ILE A 1 164 ? 17.993  9.540  32.294 1.00 40.78 ? 176 ILE A C   1 
ATOM   1242 O O   . ILE A 1 164 ? 18.484  8.734  33.086 1.00 39.73 ? 176 ILE A O   1 
ATOM   1243 C CB  . ILE A 1 164 ? 19.439  9.004  30.293 1.00 43.45 ? 176 ILE A CB  1 
ATOM   1244 C CG1 . ILE A 1 164 ? 20.466  9.576  29.295 1.00 44.55 ? 176 ILE A CG1 1 
ATOM   1245 C CG2 . ILE A 1 164 ? 18.346  8.214  29.585 1.00 44.63 ? 176 ILE A CG2 1 
ATOM   1246 C CD1 . ILE A 1 164 ? 19.924  10.625 28.332 1.00 38.82 ? 176 ILE A CD1 1 
ATOM   1247 N N   . THR A 1 165 ? 16.730  9.942  32.391 1.00 35.70 ? 177 THR A N   1 
ATOM   1248 C CA  . THR A 1 165 ? 15.853  9.414  33.430 1.00 30.71 ? 177 THR A CA  1 
ATOM   1249 C C   . THR A 1 165 ? 15.112  8.193  32.871 1.00 28.17 ? 177 THR A C   1 
ATOM   1250 O O   . THR A 1 165 ? 15.280  7.845  31.703 1.00 26.84 ? 177 THR A O   1 
ATOM   1251 C CB  . THR A 1 165 ? 14.828  10.474 33.898 1.00 29.72 ? 177 THR A CB  1 
ATOM   1252 O OG1 . THR A 1 165 ? 13.946  10.803 32.815 1.00 26.06 ? 177 THR A OG1 1 
ATOM   1253 C CG2 . THR A 1 165 ? 15.536  11.736 34.371 1.00 30.99 ? 177 THR A CG2 1 
ATOM   1254 N N   . GLU A 1 166 ? 14.253  7.584  33.685 1.00 26.01 ? 178 GLU A N   1 
ATOM   1255 C CA  . GLU A 1 166 ? 13.485  6.408  33.269 1.00 23.66 ? 178 GLU A CA  1 
ATOM   1256 C C   . GLU A 1 166 ? 12.484  6.760  32.172 1.00 16.43 ? 178 GLU A C   1 
ATOM   1257 O O   . GLU A 1 166 ? 11.936  5.876  31.529 1.00 16.30 ? 178 GLU A O   1 
ATOM   1258 C CB  . GLU A 1 166 ? 12.732  5.795  34.464 1.00 29.96 ? 178 GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 166 ? 13.520  5.714  35.800 1.00 44.82 ? 178 GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 166 ? 14.406  4.463  35.948 1.00 52.17 ? 178 GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 166 ? 15.534  4.436  35.389 1.00 55.68 ? 178 GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 166 ? 13.983  3.519  36.661 1.00 57.11 ? 178 GLU A OE2 1 
ATOM   1263 N N   . ARG A 1 167 ? 12.212  8.043  31.979 1.00 14.48 ? 179 ARG A N   1 
ATOM   1264 C CA  . ARG A 1 167 ? 11.257  8.452  30.944 1.00 16.11 ? 179 ARG A CA  1 
ATOM   1265 C C   . ARG A 1 167 ? 11.945  8.796  29.613 1.00 15.12 ? 179 ARG A C   1 
ATOM   1266 O O   . ARG A 1 167 ? 11.297  9.249  28.658 1.00 11.38 ? 179 ARG A O   1 
ATOM   1267 C CB  . ARG A 1 167 ? 10.426  9.650  31.416 1.00 15.51 ? 179 ARG A CB  1 
ATOM   1268 C CG  . ARG A 1 167 ? 9.631   9.392  32.692 1.00 20.58 ? 179 ARG A CG  1 
ATOM   1269 C CD  . ARG A 1 167 ? 8.661   10.533 32.998 1.00 28.18 ? 179 ARG A CD  1 
ATOM   1270 N NE  . ARG A 1 167 ? 7.794   10.228 34.133 1.00 32.62 ? 179 ARG A NE  1 
ATOM   1271 C CZ  . ARG A 1 167 ? 6.492   10.502 34.194 1.00 33.91 ? 179 ARG A CZ  1 
ATOM   1272 N NH1 . ARG A 1 167 ? 5.870   11.104 33.192 1.00 37.40 ? 179 ARG A NH1 1 
ATOM   1273 N NH2 . ARG A 1 167 ? 5.791   10.116 35.248 1.00 35.57 ? 179 ARG A NH2 1 
ATOM   1274 N N   . LEU A 1 168 ? 13.249  8.564  29.551 1.00 15.57 ? 180 LEU A N   1 
ATOM   1275 C CA  . LEU A 1 168 ? 14.031  8.869  28.356 1.00 13.54 ? 180 LEU A CA  1 
ATOM   1276 C C   . LEU A 1 168 ? 14.704  7.612  27.859 1.00 12.86 ? 180 LEU A C   1 
ATOM   1277 O O   . LEU A 1 168 ? 14.920  6.682  28.634 1.00 11.45 ? 180 LEU A O   1 
ATOM   1278 C CB  . LEU A 1 168 ? 15.100  9.920  28.686 1.00 13.50 ? 180 LEU A CB  1 
ATOM   1279 C CG  . LEU A 1 168 ? 14.675  11.330 29.109 1.00 12.37 ? 180 LEU A CG  1 
ATOM   1280 C CD1 . LEU A 1 168 ? 15.900  12.160 29.474 1.00 13.15 ? 180 LEU A CD1 1 
ATOM   1281 C CD2 . LEU A 1 168 ? 13.883  12.000 27.994 1.00 16.45 ? 180 LEU A CD2 1 
ATOM   1282 N N   . MET A 1 169 ? 14.959  7.554  26.552 1.00 11.68 ? 181 MET A N   1 
ATOM   1283 C CA  . MET A 1 169 ? 15.654  6.419  25.955 1.00 11.38 ? 181 MET A CA  1 
ATOM   1284 C C   . MET A 1 169 ? 16.676  6.971  24.957 1.00 11.14 ? 181 MET A C   1 
ATOM   1285 O O   . MET A 1 169 ? 16.587  8.132  24.548 1.00 10.58 ? 181 MET A O   1 
ATOM   1286 C CB  . MET A 1 169 ? 14.684  5.412  25.315 1.00 9.35  ? 181 MET A CB  1 
ATOM   1287 C CG  . MET A 1 169 ? 13.957  5.861  24.065 1.00 10.03 ? 181 MET A CG  1 
ATOM   1288 S SD  . MET A 1 169 ? 12.773  4.618  23.499 1.00 17.28 ? 181 MET A SD  1 
ATOM   1289 C CE  . MET A 1 169 ? 13.841  3.298  22.973 1.00 16.83 ? 181 MET A CE  1 
ATOM   1290 N N   . CYS A 1 170 ? 17.693  6.179  24.644 1.00 10.31 ? 182 CYS A N   1 
ATOM   1291 C CA  . CYS A 1 170 ? 18.728  6.625  23.718 1.00 14.11 ? 182 CYS A CA  1 
ATOM   1292 C C   . CYS A 1 170 ? 18.913  5.658  22.575 1.00 12.20 ? 182 CYS A C   1 
ATOM   1293 O O   . CYS A 1 170 ? 18.628  4.468  22.706 1.00 10.46 ? 182 CYS A O   1 
ATOM   1294 C CB  . CYS A 1 170 ? 20.074  6.735  24.436 1.00 18.64 ? 182 CYS A CB  1 
ATOM   1295 S SG  . CYS A 1 170 ? 20.107  7.770  25.927 1.00 24.86 ? 182 CYS A SG  1 
ATOM   1296 N N   . ALA A 1 171 ? 19.417  6.167  21.458 1.00 11.76 ? 183 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 171 ? 19.707  5.321  20.305 1.00 11.19 ? 183 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 171 ? 21.129  5.680  19.830 1.00 15.00 ? 183 ALA A C   1 
ATOM   1299 O O   . ALA A 1 171 ? 21.594  6.811  20.046 1.00 15.50 ? 183 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 171 ? 18.699  5.551  19.206 1.00 10.95 ? 183 ALA A CB  1 
ATOM   1301 N N   . GLU A 1 172 ? 21.846  4.720  19.255 1.00 15.85 ? 184 GLU A N   1 
ATOM   1302 C CA  . GLU A 1 172 ? 23.189  5.003  18.765 1.00 19.81 ? 184 GLU A CA  1 
ATOM   1303 C C   . GLU A 1 172 ? 23.197  6.168  17.776 1.00 19.06 ? 184 GLU A C   1 
ATOM   1304 O O   . GLU A 1 172 ? 22.270  6.334  16.981 1.00 20.71 ? 184 GLU A O   1 
ATOM   1305 C CB  . GLU A 1 172 ? 23.797  3.772  18.113 1.00 23.12 ? 184 GLU A CB  1 
ATOM   1306 C CG  . GLU A 1 172 ? 24.286  2.758  19.115 1.00 32.28 ? 184 GLU A CG  1 
ATOM   1307 C CD  . GLU A 1 172 ? 25.122  1.664  18.482 1.00 37.17 ? 184 GLU A CD  1 
ATOM   1308 O OE1 . GLU A 1 172 ? 25.957  1.980  17.602 1.00 40.69 ? 184 GLU A OE1 1 
ATOM   1309 O OE2 . GLU A 1 172 ? 24.945  0.488  18.873 1.00 37.88 ? 184 GLU A OE2 1 
ATOM   1310 N N   . SER A 1 173 ? 24.263  6.956  17.805 1.00 18.30 ? 185 SER A N   1 
ATOM   1311 C CA  . SER A 1 173 ? 24.370  8.112  16.940 1.00 17.27 ? 185 SER A CA  1 
ATOM   1312 C C   . SER A 1 173 ? 25.674  8.151  16.134 1.00 18.36 ? 185 SER A C   1 
ATOM   1313 O O   . SER A 1 173 ? 26.169  9.231  15.810 1.00 19.63 ? 185 SER A O   1 
ATOM   1314 C CB  . SER A 1 173 ? 24.288  9.354  17.814 1.00 16.61 ? 185 SER A CB  1 
ATOM   1315 O OG  . SER A 1 173 ? 25.296  9.272  18.811 1.00 18.91 ? 185 SER A OG  1 
ATOM   1316 N N   . ASN A 1 174 ? 26.212  6.996  15.779 1.00 19.26 ? 186 ASN A N   1 
ATOM   1317 C CA  . ASN A 1 174 ? 27.459  6.967  15.022 1.00 21.55 ? 186 ASN A CA  1 
ATOM   1318 C C   . ASN A 1 174 ? 27.272  7.264  13.532 1.00 21.42 ? 186 ASN A C   1 
ATOM   1319 O O   . ASN A 1 174 ? 26.993  6.362  12.742 1.00 21.66 ? 186 ASN A O   1 
ATOM   1320 C CB  . ASN A 1 174 ? 28.152  5.626  15.210 1.00 26.14 ? 186 ASN A CB  1 
ATOM   1321 C CG  . ASN A 1 174 ? 29.522  5.588  14.562 1.00 30.04 ? 186 ASN A CG  1 
ATOM   1322 O OD1 . ASN A 1 174 ? 30.261  6.587  14.555 1.00 29.94 ? 186 ASN A OD1 1 
ATOM   1323 N ND2 . ASN A 1 174 ? 29.868  4.437  14.004 1.00 29.94 ? 186 ASN A ND2 1 
ATOM   1324 N N   . ARG A 1 175 ? 27.422  8.532  13.149 1.00 22.40 ? 187 ARG A N   1 
ATOM   1325 C CA  . ARG A 1 175 ? 27.266  8.962  11.750 1.00 23.95 ? 187 ARG A CA  1 
ATOM   1326 C C   . ARG A 1 175 ? 25.818  8.951  11.226 1.00 23.84 ? 187 ARG A C   1 
ATOM   1327 O O   . ARG A 1 175 ? 25.559  9.428  10.121 1.00 24.72 ? 187 ARG A O   1 
ATOM   1328 C CB  . ARG A 1 175 ? 28.148  8.131  10.812 1.00 29.74 ? 187 ARG A CB  1 
ATOM   1329 C CG  . ARG A 1 175 ? 29.645  8.263  11.060 1.00 40.43 ? 187 ARG A CG  1 
ATOM   1330 C CD  . ARG A 1 175 ? 30.460  7.373  10.107 1.00 48.59 ? 187 ARG A CD  1 
ATOM   1331 N NE  . ARG A 1 175 ? 30.406  5.940  10.428 1.00 56.51 ? 187 ARG A NE  1 
ATOM   1332 C CZ  . ARG A 1 175 ? 31.211  5.331  11.304 1.00 61.39 ? 187 ARG A CZ  1 
ATOM   1333 N NH1 . ARG A 1 175 ? 32.114  6.031  11.989 1.00 62.32 ? 187 ARG A NH1 1 
ATOM   1334 N NH2 . ARG A 1 175 ? 31.098  4.023  11.520 1.00 61.54 ? 187 ARG A NH2 1 
ATOM   1335 N N   . ARG A 1 176 ? 24.896  8.367  11.988 1.00 20.60 ? 188 ARG A N   1 
ATOM   1336 C CA  . ARG A 1 176 ? 23.478  8.319  11.625 1.00 19.83 ? 188 ARG A CA  1 
ATOM   1337 C C   . ARG A 1 176 ? 22.765  8.850  12.859 1.00 15.97 ? 188 ARG A C   1 
ATOM   1338 O O   . ARG A 1 176 ? 23.037  8.381  13.965 1.00 15.76 ? 188 ARG A O   1 
ATOM   1339 C CB  . ARG A 1 176 ? 23.036  6.890  11.327 1.00 22.14 ? 188 ARG A CB  1 
ATOM   1340 C CG  . ARG A 1 176 ? 23.387  6.432  9.936  1.00 30.91 ? 188 ARG A CG  1 
ATOM   1341 C CD  . ARG A 1 176 ? 23.036  4.979  9.746  1.00 34.94 ? 188 ARG A CD  1 
ATOM   1342 N NE  . ARG A 1 176 ? 23.934  4.134  10.518 1.00 42.31 ? 188 ARG A NE  1 
ATOM   1343 C CZ  . ARG A 1 176 ? 25.162  3.810  10.127 1.00 46.31 ? 188 ARG A CZ  1 
ATOM   1344 N NH1 . ARG A 1 176 ? 25.620  4.234  8.952  1.00 48.67 ? 188 ARG A NH1 1 
ATOM   1345 N NH2 . ARG A 1 176 ? 25.925  3.043  10.897 1.00 48.31 ? 188 ARG A NH2 1 
ATOM   1346 N N   . ASP A 1 177 ? 21.846  9.790  12.672 1.00 10.94 ? 189 ASP A N   1 
ATOM   1347 C CA  . ASP A 1 177 ? 21.182  10.408 13.806 1.00 11.91 ? 189 ASP A CA  1 
ATOM   1348 C C   . ASP A 1 177 ? 20.004  11.245 13.352 1.00 14.77 ? 189 ASP A C   1 
ATOM   1349 O O   . ASP A 1 177 ? 19.801  11.464 12.144 1.00 13.95 ? 189 ASP A O   1 
ATOM   1350 C CB  . ASP A 1 177 ? 22.187  11.356 14.484 1.00 9.67  ? 189 ASP A CB  1 
ATOM   1351 C CG  . ASP A 1 177 ? 21.876  11.630 15.968 1.00 10.98 ? 189 ASP A CG  1 
ATOM   1352 O OD1 . ASP A 1 177 ? 20.824  11.201 16.484 1.00 9.09  ? 189 ASP A OD1 1 
ATOM   1353 O OD2 . ASP A 1 177 ? 22.706  12.293 16.616 1.00 9.63  ? 189 ASP A OD2 1 
ATOM   1354 N N   . SER A 1 178 ? 19.186  11.650 14.321 1.00 13.35 ? 190 SER A N   1 
ATOM   1355 C CA  . SER A 1 178 ? 18.084  12.544 14.052 1.00 10.76 ? 190 SER A CA  1 
ATOM   1356 C C   . SER A 1 178 ? 18.782  13.866 14.374 1.00 10.13 ? 190 SER A C   1 
ATOM   1357 O O   . SER A 1 178 ? 19.747  13.894 15.151 1.00 11.19 ? 190 SER A O   1 
ATOM   1358 C CB  . SER A 1 178 ? 16.881  12.262 14.974 1.00 14.46 ? 190 SER A CB  1 
ATOM   1359 O OG  . SER A 1 178 ? 17.273  12.171 16.335 1.00 13.34 ? 190 SER A OG  1 
ATOM   1360 N N   . CYS A 1 179 ? 18.331  14.960 13.775 1.00 10.45 ? 191 CYS A N   1 
ATOM   1361 C CA  . CYS A 1 179 ? 18.988  16.228 13.992 1.00 10.73 ? 191 CYS A CA  1 
ATOM   1362 C C   . CYS A 1 179 ? 17.978  17.374 13.966 1.00 11.09 ? 191 CYS A C   1 
ATOM   1363 O O   . CYS A 1 179 ? 16.768  17.145 14.052 1.00 9.95  ? 191 CYS A O   1 
ATOM   1364 C CB  . CYS A 1 179 ? 20.075  16.393 12.916 1.00 13.93 ? 191 CYS A CB  1 
ATOM   1365 S SG  . CYS A 1 179 ? 21.370  17.584 13.350 1.00 19.05 ? 191 CYS A SG  1 
ATOM   1366 N N   . LYS A 1 180 ? 18.476  18.603 13.888 1.00 11.91 ? 192 LYS A N   1 
ATOM   1367 C CA  . LYS A 1 180 ? 17.625  19.791 13.852 1.00 13.53 ? 192 LYS A CA  1 
ATOM   1368 C C   . LYS A 1 180 ? 16.512  19.702 12.813 1.00 13.18 ? 192 LYS A C   1 
ATOM   1369 O O   . LYS A 1 180 ? 16.773  19.398 11.656 1.00 10.14 ? 192 LYS A O   1 
ATOM   1370 C CB  . LYS A 1 180 ? 18.480  21.035 13.620 1.00 16.23 ? 192 LYS A CB  1 
ATOM   1371 C CG  . LYS A 1 180 ? 17.691  22.318 13.504 1.00 24.63 ? 192 LYS A CG  1 
ATOM   1372 C CD  . LYS A 1 180 ? 18.574  23.510 13.831 1.00 30.83 ? 192 LYS A CD  1 
ATOM   1373 C CE  . LYS A 1 180 ? 17.794  24.814 13.815 1.00 35.42 ? 192 LYS A CE  1 
ATOM   1374 N NZ  . LYS A 1 180 ? 18.488  25.838 14.663 1.00 39.01 ? 192 LYS A NZ  1 
ATOM   1375 N N   . GLY A 1 181 ? 15.273  19.932 13.249 1.00 10.44 ? 193 GLY A N   1 
ATOM   1376 C CA  . GLY A 1 181 ? 14.120  19.866 12.368 1.00 7.62  ? 193 GLY A CA  1 
ATOM   1377 C C   . GLY A 1 181 ? 13.447  18.510 12.419 1.00 4.92  ? 193 GLY A C   1 
ATOM   1378 O O   . GLY A 1 181 ? 12.397  18.330 11.814 1.00 10.94 ? 193 GLY A O   1 
ATOM   1379 N N   . ASP A 1 182 ? 14.071  17.539 13.078 1.00 5.77  ? 194 ASP A N   1 
ATOM   1380 C CA  . ASP A 1 182 ? 13.503  16.184 13.224 1.00 4.46  ? 194 ASP A CA  1 
ATOM   1381 C C   . ASP A 1 182 ? 12.816  16.034 14.585 1.00 6.62  ? 194 ASP A C   1 
ATOM   1382 O O   . ASP A 1 182 ? 12.163  15.021 14.850 1.00 5.43  ? 194 ASP A O   1 
ATOM   1383 C CB  . ASP A 1 182 ? 14.589  15.106 13.155 1.00 4.54  ? 194 ASP A CB  1 
ATOM   1384 C CG  . ASP A 1 182 ? 15.222  14.975 11.763 1.00 9.01  ? 194 ASP A CG  1 
ATOM   1385 O OD1 . ASP A 1 182 ? 14.479  15.024 10.764 1.00 7.91  ? 194 ASP A OD1 1 
ATOM   1386 O OD2 . ASP A 1 182 ? 16.454  14.796 11.677 1.00 8.59  ? 194 ASP A OD2 1 
ATOM   1387 N N   . SER A 1 183 ? 13.024  17.015 15.453 1.00 7.16  ? 195 SER A N   1 
ATOM   1388 C CA  . SER A 1 183 ? 12.452  17.003 16.803 1.00 8.36  ? 195 SER A CA  1 
ATOM   1389 C C   . SER A 1 183 ? 10.928  16.939 16.780 1.00 10.30 ? 195 SER A C   1 
ATOM   1390 O O   . SER A 1 183 ? 10.300  17.556 15.919 1.00 8.18  ? 195 SER A O   1 
ATOM   1391 C CB  . SER A 1 183 ? 12.942  18.226 17.554 1.00 11.31 ? 195 SER A CB  1 
ATOM   1392 O OG  . SER A 1 183 ? 14.359  18.228 17.496 1.00 20.81 ? 195 SER A OG  1 
ATOM   1393 N N   . GLY A 1 184 ? 10.347  16.148 17.686 1.00 10.30 ? 196 GLY A N   1 
ATOM   1394 C CA  . GLY A 1 184 ? 8.898   15.981 17.729 1.00 9.72  ? 196 GLY A CA  1 
ATOM   1395 C C   . GLY A 1 184 ? 8.402   14.815 16.889 1.00 12.16 ? 196 GLY A C   1 
ATOM   1396 O O   . GLY A 1 184 ? 7.241   14.429 16.992 1.00 13.25 ? 196 GLY A O   1 
ATOM   1397 N N   . GLY A 1 185 ? 9.290   14.243 16.070 1.00 10.78 ? 197 GLY A N   1 
ATOM   1398 C CA  . GLY A 1 185 ? 8.946   13.126 15.206 1.00 6.17  ? 197 GLY A CA  1 
ATOM   1399 C C   . GLY A 1 185 ? 9.010   11.789 15.897 1.00 5.59  ? 197 GLY A C   1 
ATOM   1400 O O   . GLY A 1 185 ? 9.541   11.679 17.003 1.00 8.57  ? 197 GLY A O   1 
ATOM   1401 N N   . PRO A 1 186 ? 8.592   10.722 15.209 1.00 7.13  ? 198 PRO A N   1 
ATOM   1402 C CA  . PRO A 1 186 ? 8.567   9.358  15.736 1.00 9.05  ? 198 PRO A CA  1 
ATOM   1403 C C   . PRO A 1 186 ? 9.799   8.465  15.704 1.00 13.76 ? 198 PRO A C   1 
ATOM   1404 O O   . PRO A 1 186 ? 10.629  8.530  14.788 1.00 15.86 ? 198 PRO A O   1 
ATOM   1405 C CB  . PRO A 1 186 ? 7.458   8.721  14.916 1.00 10.28 ? 198 PRO A CB  1 
ATOM   1406 C CG  . PRO A 1 186 ? 7.694   9.334  13.531 1.00 9.30  ? 198 PRO A CG  1 
ATOM   1407 C CD  . PRO A 1 186 ? 8.000   10.786 13.853 1.00 8.73  ? 198 PRO A CD  1 
ATOM   1408 N N   . LEU A 1 187 ? 9.877   7.610  16.719 1.00 11.09 ? 199 LEU A N   1 
ATOM   1409 C CA  . LEU A 1 187 ? 10.901  6.580  16.853 1.00 12.51 ? 199 LEU A CA  1 
ATOM   1410 C C   . LEU A 1 187 ? 9.978   5.346  16.955 1.00 12.16 ? 199 LEU A C   1 
ATOM   1411 O O   . LEU A 1 187 ? 9.244   5.163  17.943 1.00 12.47 ? 199 LEU A O   1 
ATOM   1412 C CB  . LEU A 1 187 ? 11.730  6.805  18.124 1.00 12.13 ? 199 LEU A CB  1 
ATOM   1413 C CG  . LEU A 1 187 ? 12.869  5.883  18.577 1.00 16.33 ? 199 LEU A CG  1 
ATOM   1414 C CD1 . LEU A 1 187 ? 12.313  4.591  19.111 1.00 21.67 ? 199 LEU A CD1 1 
ATOM   1415 C CD2 . LEU A 1 187 ? 13.879  5.645  17.480 1.00 17.43 ? 199 LEU A CD2 1 
ATOM   1416 N N   . VAL A 1 188 ? 9.932   4.568  15.883 1.00 10.95 ? 200 VAL A N   1 
ATOM   1417 C CA  . VAL A 1 188 ? 9.063   3.397  15.794 1.00 8.94  ? 200 VAL A CA  1 
ATOM   1418 C C   . VAL A 1 188 ? 9.835   2.090  15.889 1.00 12.34 ? 200 VAL A C   1 
ATOM   1419 O O   . VAL A 1 188 ? 10.806  1.892  15.169 1.00 11.85 ? 200 VAL A O   1 
ATOM   1420 C CB  . VAL A 1 188 ? 8.278   3.448  14.472 1.00 8.03  ? 200 VAL A CB  1 
ATOM   1421 C CG1 . VAL A 1 188 ? 7.296   2.314  14.366 1.00 7.74  ? 200 VAL A CG1 1 
ATOM   1422 C CG2 . VAL A 1 188 ? 7.557   4.766  14.356 1.00 6.65  ? 200 VAL A CG2 1 
ATOM   1423 N N   . CYS A 1 189 ? 9.440   1.223  16.818 1.00 10.86 ? 201 CYS A N   1 
ATOM   1424 C CA  . CYS A 1 189 ? 10.079  -0.081 16.996 1.00 13.26 ? 201 CYS A CA  1 
ATOM   1425 C C   . CYS A 1 189 ? 9.002   -1.152 16.875 1.00 16.00 ? 201 CYS A C   1 
ATOM   1426 O O   . CYS A 1 189 ? 8.004   -1.118 17.598 1.00 16.27 ? 201 CYS A O   1 
ATOM   1427 C CB  . CYS A 1 189 ? 10.739  -0.204 18.378 1.00 13.82 ? 201 CYS A CB  1 
ATOM   1428 S SG  . CYS A 1 189 ? 11.749  1.207  18.908 1.00 13.66 ? 201 CYS A SG  1 
ATOM   1429 N N   . GLY A 1 190 ? 9.185   -2.064 15.923 1.00 17.48 ? 202 GLY A N   1 
ATOM   1430 C CA  . GLY A 1 190 ? 8.243   -3.146 15.718 1.00 16.94 ? 202 GLY A CA  1 
ATOM   1431 C C   . GLY A 1 190 ? 6.864   -2.657 15.348 1.00 17.44 ? 202 GLY A C   1 
ATOM   1432 O O   . GLY A 1 190 ? 5.871   -3.216 15.809 1.00 19.77 ? 202 GLY A O   1 
ATOM   1433 N N   . GLY A 1 191 ? 6.810   -1.592 14.550 1.00 17.19 ? 207 GLY A N   1 
ATOM   1434 C CA  . GLY A 1 191 ? 5.543   -1.033 14.104 1.00 17.03 ? 207 GLY A CA  1 
ATOM   1435 C C   . GLY A 1 191 ? 4.704   -0.280 15.134 1.00 16.21 ? 207 GLY A C   1 
ATOM   1436 O O   . GLY A 1 191 ? 3.535   0.021  14.878 1.00 16.39 ? 207 GLY A O   1 
ATOM   1437 N N   . VAL A 1 192 ? 5.301   0.057  16.275 1.00 14.10 ? 208 VAL A N   1 
ATOM   1438 C CA  . VAL A 1 192 ? 4.605   0.779  17.330 1.00 13.94 ? 208 VAL A CA  1 
ATOM   1439 C C   . VAL A 1 192 ? 5.427   1.988  17.735 1.00 10.40 ? 208 VAL A C   1 
ATOM   1440 O O   . VAL A 1 192 ? 6.645   1.924  17.742 1.00 10.68 ? 208 VAL A O   1 
ATOM   1441 C CB  . VAL A 1 192 ? 4.415   -0.131 18.570 1.00 14.61 ? 208 VAL A CB  1 
ATOM   1442 C CG1 . VAL A 1 192 ? 3.795   0.648  19.723 1.00 13.87 ? 208 VAL A CG1 1 
ATOM   1443 C CG2 . VAL A 1 192 ? 3.537   -1.316 18.211 1.00 15.93 ? 208 VAL A CG2 1 
ATOM   1444 N N   . LEU A 1 193 ? 4.759   3.092  18.053 1.00 9.21  ? 209 LEU A N   1 
ATOM   1445 C CA  . LEU A 1 193 ? 5.434   4.308  18.490 1.00 10.28 ? 209 LEU A CA  1 
ATOM   1446 C C   . LEU A 1 193 ? 6.006   4.063  19.882 1.00 12.14 ? 209 LEU A C   1 
ATOM   1447 O O   . LEU A 1 193 ? 5.260   3.771  20.832 1.00 11.72 ? 209 LEU A O   1 
ATOM   1448 C CB  . LEU A 1 193 ? 4.443   5.475  18.554 1.00 10.96 ? 209 LEU A CB  1 
ATOM   1449 C CG  . LEU A 1 193 ? 5.007   6.834  18.957 1.00 11.00 ? 209 LEU A CG  1 
ATOM   1450 C CD1 . LEU A 1 193 ? 5.965   7.333  17.882 1.00 10.89 ? 209 LEU A CD1 1 
ATOM   1451 C CD2 . LEU A 1 193 ? 3.856   7.831  19.128 1.00 13.10 ? 209 LEU A CD2 1 
ATOM   1452 N N   . GLU A 1 194 ? 7.320   4.186  20.003 1.00 9.77  ? 210 GLU A N   1 
ATOM   1453 C CA  . GLU A 1 194 ? 8.001   3.974  21.267 1.00 10.25 ? 210 GLU A CA  1 
ATOM   1454 C C   . GLU A 1 194 ? 8.513   5.273  21.824 1.00 10.83 ? 210 GLU A C   1 
ATOM   1455 O O   . GLU A 1 194 ? 8.544   5.462  23.043 1.00 10.73 ? 210 GLU A O   1 
ATOM   1456 C CB  . GLU A 1 194 ? 9.185   3.022  21.095 1.00 11.91 ? 210 GLU A CB  1 
ATOM   1457 C CG  . GLU A 1 194 ? 8.802   1.559  20.973 1.00 16.74 ? 210 GLU A CG  1 
ATOM   1458 C CD  . GLU A 1 194 ? 8.400   0.922  22.310 1.00 19.23 ? 210 GLU A CD  1 
ATOM   1459 O OE1 . GLU A 1 194 ? 8.727   1.465  23.383 1.00 18.20 ? 210 GLU A OE1 1 
ATOM   1460 O OE2 . GLU A 1 194 ? 7.789   -0.157 22.285 1.00 19.14 ? 210 GLU A OE2 1 
ATOM   1461 N N   . GLY A 1 195 ? 8.968   6.148  20.937 1.00 8.03  ? 211 GLY A N   1 
ATOM   1462 C CA  . GLY A 1 195 ? 9.502   7.413  21.381 1.00 7.21  ? 211 GLY A CA  1 
ATOM   1463 C C   . GLY A 1 195 ? 9.214   8.579  20.470 1.00 8.00  ? 211 GLY A C   1 
ATOM   1464 O O   . GLY A 1 195 ? 8.679   8.423  19.371 1.00 8.72  ? 211 GLY A O   1 
ATOM   1465 N N   . VAL A 1 196 ? 9.562   9.757  20.961 1.00 6.42  ? 212 VAL A N   1 
ATOM   1466 C CA  . VAL A 1 196 ? 9.398   11.000 20.251 1.00 7.74  ? 212 VAL A CA  1 
ATOM   1467 C C   . VAL A 1 196 ? 10.755  11.679 20.345 1.00 8.03  ? 212 VAL A C   1 
ATOM   1468 O O   . VAL A 1 196 ? 11.351  11.723 21.421 1.00 9.88  ? 212 VAL A O   1 
ATOM   1469 C CB  . VAL A 1 196 ? 8.330   11.879 20.944 1.00 12.11 ? 212 VAL A CB  1 
ATOM   1470 C CG1 . VAL A 1 196 ? 8.321   13.279 20.351 1.00 11.27 ? 212 VAL A CG1 1 
ATOM   1471 C CG2 . VAL A 1 196 ? 6.958   11.236 20.820 1.00 12.35 ? 212 VAL A CG2 1 
ATOM   1472 N N   . VAL A 1 197 ? 11.255  12.210 19.230 1.00 9.09  ? 213 VAL A N   1 
ATOM   1473 C CA  . VAL A 1 197 ? 12.555  12.886 19.207 1.00 8.35  ? 213 VAL A CA  1 
ATOM   1474 C C   . VAL A 1 197 ? 12.517  14.130 20.117 1.00 5.94  ? 213 VAL A C   1 
ATOM   1475 O O   . VAL A 1 197 ? 11.774  15.089 19.867 1.00 8.09  ? 213 VAL A O   1 
ATOM   1476 C CB  . VAL A 1 197 ? 12.944  13.298 17.732 1.00 6.69  ? 213 VAL A CB  1 
ATOM   1477 C CG1 . VAL A 1 197 ? 14.297  13.981 17.701 1.00 8.62  ? 213 VAL A CG1 1 
ATOM   1478 C CG2 . VAL A 1 197 ? 12.957  12.051 16.814 1.00 7.62  ? 213 VAL A CG2 1 
ATOM   1479 N N   . THR A 1 198 ? 13.342  14.115 21.154 1.00 7.68  ? 214 THR A N   1 
ATOM   1480 C CA  . THR A 1 198 ? 13.403  15.208 22.112 1.00 13.47 ? 214 THR A CA  1 
ATOM   1481 C C   . THR A 1 198 ? 13.988  16.475 21.504 1.00 18.32 ? 214 THR A C   1 
ATOM   1482 O O   . THR A 1 198 ? 14.878  16.406 20.648 1.00 21.57 ? 214 THR A O   1 
ATOM   1483 C CB  . THR A 1 198 ? 14.259  14.795 23.332 1.00 13.11 ? 214 THR A CB  1 
ATOM   1484 O OG1 . THR A 1 198 ? 13.813  13.520 23.816 1.00 16.58 ? 214 THR A OG1 1 
ATOM   1485 C CG2 . THR A 1 198 ? 14.133  15.792 24.451 1.00 15.00 ? 214 THR A CG2 1 
ATOM   1486 N N   . SER A 1 199 ? 13.430  17.619 21.897 1.00 20.43 ? 215 SER A N   1 
ATOM   1487 C CA  . SER A 1 199 ? 13.905  18.937 21.461 1.00 22.70 ? 215 SER A CA  1 
ATOM   1488 C C   . SER A 1 199 ? 15.178  19.294 22.241 1.00 24.43 ? 215 SER A C   1 
ATOM   1489 O O   . SER A 1 199 ? 15.537  18.628 23.222 1.00 26.83 ? 215 SER A O   1 
ATOM   1490 C CB  . SER A 1 199 ? 12.872  20.029 21.765 1.00 22.32 ? 215 SER A CB  1 
ATOM   1491 O OG  . SER A 1 199 ? 11.626  19.756 21.177 1.00 27.15 ? 215 SER A OG  1 
ATOM   1492 N N   . GLY A 1 200 ? 15.837  20.373 21.840 1.00 24.43 ? 216 GLY A N   1 
ATOM   1493 C CA  . GLY A 1 200 ? 17.037  20.771 22.544 1.00 24.37 ? 216 GLY A CA  1 
ATOM   1494 C C   . GLY A 1 200 ? 18.242  20.745 21.643 1.00 25.57 ? 216 GLY A C   1 
ATOM   1495 O O   . GLY A 1 200 ? 18.424  19.820 20.844 1.00 24.46 ? 216 GLY A O   1 
ATOM   1496 N N   . SER A 1 201 ? 19.037  21.800 21.744 1.00 26.63 ? 217 SER A N   1 
ATOM   1497 C CA  . SER A 1 201 ? 20.257  21.948 20.958 1.00 28.58 ? 217 SER A CA  1 
ATOM   1498 C C   . SER A 1 201 ? 21.269  20.869 21.373 1.00 26.62 ? 217 SER A C   1 
ATOM   1499 O O   . SER A 1 201 ? 21.535  20.679 22.565 1.00 30.50 ? 217 SER A O   1 
ATOM   1500 C CB  . SER A 1 201 ? 20.844  23.345 21.189 1.00 27.65 ? 217 SER A CB  1 
ATOM   1501 O OG  . SER A 1 201 ? 21.938  23.599 20.323 1.00 38.28 ? 217 SER A OG  1 
ATOM   1502 N N   . ARG A 1 202 ? 21.807  20.146 20.393 1.00 23.56 ? 218 ARG A N   1 
ATOM   1503 C CA  . ARG A 1 202 ? 22.786  19.083 20.650 1.00 20.66 ? 218 ARG A CA  1 
ATOM   1504 C C   . ARG A 1 202 ? 23.464  18.723 19.332 1.00 18.90 ? 218 ARG A C   1 
ATOM   1505 O O   . ARG A 1 202 ? 22.900  18.946 18.249 1.00 15.02 ? 218 ARG A O   1 
ATOM   1506 C CB  . ARG A 1 202 ? 22.093  17.823 21.191 1.00 19.77 ? 218 ARG A CB  1 
ATOM   1507 C CG  . ARG A 1 202 ? 20.964  17.348 20.279 1.00 23.31 ? 218 ARG A CG  1 
ATOM   1508 C CD  . ARG A 1 202 ? 20.457  15.961 20.597 1.00 26.79 ? 218 ARG A CD  1 
ATOM   1509 N NE  . ARG A 1 202 ? 21.393  14.925 20.182 1.00 31.13 ? 218 ARG A NE  1 
ATOM   1510 C CZ  . ARG A 1 202 ? 21.187  14.083 19.174 1.00 28.15 ? 218 ARG A CZ  1 
ATOM   1511 N NH1 . ARG A 1 202 ? 20.074  14.136 18.454 1.00 26.73 ? 218 ARG A NH1 1 
ATOM   1512 N NH2 . ARG A 1 202 ? 22.101  13.176 18.901 1.00 27.72 ? 218 ARG A NH2 1 
ATOM   1513 N N   . VAL A 1 203 ? 24.677  18.183 19.427 1.00 20.19 ? 219 VAL A N   1 
ATOM   1514 C CA  . VAL A 1 203 ? 25.408  17.751 18.242 1.00 19.28 ? 219 VAL A CA  1 
ATOM   1515 C C   . VAL A 1 203 ? 24.749  16.481 17.705 1.00 18.31 ? 219 VAL A C   1 
ATOM   1516 O O   . VAL A 1 203 ? 24.263  15.639 18.468 1.00 19.11 ? 219 VAL A O   1 
ATOM   1517 C CB  . VAL A 1 203 ? 26.895  17.448 18.542 1.00 19.97 ? 219 VAL A CB  1 
ATOM   1518 C CG1 . VAL A 1 203 ? 27.675  18.738 18.681 1.00 21.92 ? 219 VAL A CG1 1 
ATOM   1519 C CG2 . VAL A 1 203 ? 27.023  16.583 19.812 1.00 22.35 ? 219 VAL A CG2 1 
ATOM   1520 N N   . CYS A 1 204 ? 24.752  16.347 16.388 1.00 17.72 ? 220 CYS A N   1 
ATOM   1521 C CA  . CYS A 1 204 ? 24.174  15.197 15.720 1.00 17.41 ? 220 CYS A CA  1 
ATOM   1522 C C   . CYS A 1 204 ? 25.280  14.365 15.082 1.00 17.01 ? 220 CYS A C   1 
ATOM   1523 O O   . CYS A 1 204 ? 26.285  14.916 14.627 1.00 15.12 ? 220 CYS A O   1 
ATOM   1524 C CB  . CYS A 1 204 ? 23.235  15.663 14.616 1.00 16.05 ? 220 CYS A CB  1 
ATOM   1525 S SG  . CYS A 1 204 ? 22.050  16.933 15.148 1.00 19.12 ? 220 CYS A SG  1 
ATOM   1526 N N   . GLY A 1 205 ? 25.085  13.048 15.063 1.00 17.39 ? 221 GLY A N   1 
ATOM   1527 C CA  . GLY A 1 205 ? 26.032  12.137 14.448 1.00 20.30 ? 221 GLY A CA  1 
ATOM   1528 C C   . GLY A 1 205 ? 27.307  11.850 15.203 1.00 20.21 ? 221 GLY A C   1 
ATOM   1529 O O   . GLY A 1 205 ? 28.190  11.198 14.666 1.00 22.51 ? 221 GLY A O   1 
ATOM   1530 N N   . ASN A 1 206 ? 27.389  12.308 16.445 1.00 20.77 ? 222 ASN A N   1 
ATOM   1531 C CA  . ASN A 1 206 ? 28.555  12.094 17.290 1.00 22.83 ? 222 ASN A CA  1 
ATOM   1532 C C   . ASN A 1 206 ? 28.265  10.889 18.170 1.00 23.88 ? 222 ASN A C   1 
ATOM   1533 O O   . ASN A 1 206 ? 27.402  10.950 19.037 1.00 21.62 ? 222 ASN A O   1 
ATOM   1534 C CB  . ASN A 1 206 ? 28.783  13.322 18.173 1.00 24.77 ? 222 ASN A CB  1 
ATOM   1535 C CG  . ASN A 1 206 ? 30.067  13.246 18.966 1.00 28.83 ? 222 ASN A CG  1 
ATOM   1536 O OD1 . ASN A 1 206 ? 30.444  12.196 19.480 1.00 28.61 ? 222 ASN A OD1 1 
ATOM   1537 N ND2 . ASN A 1 206 ? 30.747  14.372 19.077 1.00 30.94 ? 222 ASN A ND2 1 
ATOM   1538 N N   . ARG A 1 207 ? 29.018  9.813  17.983 1.00 27.60 ? 223 ARG A N   1 
ATOM   1539 C CA  . ARG A 1 207 ? 28.818  8.590  18.761 1.00 31.56 ? 223 ARG A CA  1 
ATOM   1540 C C   . ARG A 1 207 ? 28.979  8.714  20.286 1.00 29.46 ? 223 ARG A C   1 
ATOM   1541 O O   . ARG A 1 207 ? 28.457  7.875  21.025 1.00 29.03 ? 223 ARG A O   1 
ATOM   1542 C CB  . ARG A 1 207 ? 29.694  7.452  18.220 1.00 37.57 ? 223 ARG A CB  1 
ATOM   1543 C CG  . ARG A 1 207 ? 31.181  7.766  18.159 1.00 46.89 ? 223 ARG A CG  1 
ATOM   1544 C CD  . ARG A 1 207 ? 31.992  6.572  17.674 1.00 54.69 ? 223 ARG A CD  1 
ATOM   1545 N NE  . ARG A 1 207 ? 32.034  5.499  18.668 1.00 62.99 ? 223 ARG A NE  1 
ATOM   1546 C CZ  . ARG A 1 207 ? 31.232  4.434  18.671 1.00 66.10 ? 223 ARG A CZ  1 
ATOM   1547 N NH1 . ARG A 1 207 ? 30.307  4.283  17.729 1.00 66.90 ? 223 ARG A NH1 1 
ATOM   1548 N NH2 . ARG A 1 207 ? 31.357  3.516  19.626 1.00 69.75 ? 223 ARG A NH2 1 
ATOM   1549 N N   . LYS A 1 208 A 29.698  9.737  20.756 1.00 28.76 ? 223 LYS A N   1 
ATOM   1550 C CA  . LYS A 1 208 A 29.893  9.950  22.195 1.00 29.42 ? 223 LYS A CA  1 
ATOM   1551 C C   . LYS A 1 208 A 28.668  10.593 22.841 1.00 28.04 ? 223 LYS A C   1 
ATOM   1552 O O   . LYS A 1 208 A 28.508  10.543 24.058 1.00 27.10 ? 223 LYS A O   1 
ATOM   1553 C CB  . LYS A 1 208 A 31.118  10.830 22.482 1.00 32.52 ? 223 LYS A CB  1 
ATOM   1554 C CG  . LYS A 1 208 A 32.457  10.095 22.549 1.00 39.90 ? 223 LYS A CG  1 
ATOM   1555 C CD  . LYS A 1 208 A 32.997  9.803  21.152 1.00 45.37 ? 223 LYS A CD  1 
ATOM   1556 C CE  . LYS A 1 208 A 34.376  9.136  21.170 1.00 49.22 ? 223 LYS A CE  1 
ATOM   1557 N NZ  . LYS A 1 208 A 34.830  8.773  19.783 1.00 52.51 ? 223 LYS A NZ  1 
ATOM   1558 N N   . LYS A 1 209 ? 27.803  11.187 22.025 1.00 25.10 ? 224 LYS A N   1 
ATOM   1559 C CA  . LYS A 1 209 ? 26.599  11.843 22.513 1.00 22.63 ? 224 LYS A CA  1 
ATOM   1560 C C   . LYS A 1 209 ? 25.369  11.299 21.782 1.00 19.35 ? 224 LYS A C   1 
ATOM   1561 O O   . LYS A 1 209 ? 24.870  11.912 20.836 1.00 20.74 ? 224 LYS A O   1 
ATOM   1562 C CB  . LYS A 1 209 ? 26.711  13.351 22.304 1.00 24.81 ? 224 LYS A CB  1 
ATOM   1563 C CG  . LYS A 1 209 ? 27.889  13.992 23.016 1.00 33.42 ? 224 LYS A CG  1 
ATOM   1564 C CD  . LYS A 1 209 ? 27.796  13.830 24.539 1.00 39.13 ? 224 LYS A CD  1 
ATOM   1565 C CE  . LYS A 1 209 ? 28.898  14.623 25.268 1.00 43.62 ? 224 LYS A CE  1 
ATOM   1566 N NZ  . LYS A 1 209 ? 28.857  14.511 26.765 1.00 44.19 ? 224 LYS A NZ  1 
ATOM   1567 N N   . PRO A 1 210 ? 24.844  10.151 22.240 1.00 17.14 ? 225 PRO A N   1 
ATOM   1568 C CA  . PRO A 1 210 ? 23.669  9.479  21.658 1.00 15.12 ? 225 PRO A CA  1 
ATOM   1569 C C   . PRO A 1 210 ? 22.445  10.364 21.551 1.00 12.55 ? 225 PRO A C   1 
ATOM   1570 O O   . PRO A 1 210 ? 22.332  11.359 22.257 1.00 13.19 ? 225 PRO A O   1 
ATOM   1571 C CB  . PRO A 1 210 ? 23.426  8.328  22.623 1.00 13.59 ? 225 PRO A CB  1 
ATOM   1572 C CG  . PRO A 1 210 ? 24.780  8.017  23.131 1.00 15.93 ? 225 PRO A CG  1 
ATOM   1573 C CD  . PRO A 1 210 ? 25.365  9.387  23.384 1.00 16.30 ? 225 PRO A CD  1 
ATOM   1574 N N   . GLY A 1 211 ? 21.554  10.020 20.631 1.00 13.42 ? 226 GLY A N   1 
ATOM   1575 C CA  . GLY A 1 211 ? 20.324  10.771 20.445 1.00 12.42 ? 226 GLY A CA  1 
ATOM   1576 C C   . GLY A 1 211 ? 19.414  10.423 21.600 1.00 12.21 ? 226 GLY A C   1 
ATOM   1577 O O   . GLY A 1 211 ? 19.480  9.305  22.116 1.00 12.51 ? 226 GLY A O   1 
ATOM   1578 N N   . ILE A 1 212 ? 18.558  11.359 21.996 1.00 13.73 ? 227 ILE A N   1 
ATOM   1579 C CA  . ILE A 1 212 ? 17.650  11.156 23.136 1.00 11.02 ? 227 ILE A CA  1 
ATOM   1580 C C   . ILE A 1 212 ? 16.198  11.238 22.652 1.00 9.43  ? 227 ILE A C   1 
ATOM   1581 O O   . ILE A 1 212 ? 15.866  12.101 21.837 1.00 6.97  ? 227 ILE A O   1 
ATOM   1582 C CB  . ILE A 1 212 ? 17.936  12.228 24.212 1.00 10.99 ? 227 ILE A CB  1 
ATOM   1583 C CG1 . ILE A 1 212 ? 19.389  12.080 24.682 1.00 14.44 ? 227 ILE A CG1 1 
ATOM   1584 C CG2 . ILE A 1 212 ? 16.998  12.076 25.412 1.00 11.61 ? 227 ILE A CG2 1 
ATOM   1585 C CD1 . ILE A 1 212 ? 20.015  13.373 25.159 1.00 17.51 ? 227 ILE A CD1 1 
ATOM   1586 N N   . TYR A 1 213 ? 15.367  10.292 23.102 1.00 8.92  ? 228 TYR A N   1 
ATOM   1587 C CA  . TYR A 1 213 ? 13.955  10.213 22.740 1.00 6.25  ? 228 TYR A CA  1 
ATOM   1588 C C   . TYR A 1 213 ? 13.109  10.088 24.016 1.00 10.16 ? 228 TYR A C   1 
ATOM   1589 O O   . TYR A 1 213 ? 13.515  9.439  24.999 1.00 8.00  ? 228 TYR A O   1 
ATOM   1590 C CB  . TYR A 1 213 ? 13.707  8.996  21.832 1.00 10.25 ? 228 TYR A CB  1 
ATOM   1591 C CG  . TYR A 1 213 ? 14.630  8.989  20.632 1.00 12.31 ? 228 TYR A CG  1 
ATOM   1592 C CD1 . TYR A 1 213 ? 15.965  8.581  20.760 1.00 14.14 ? 228 TYR A CD1 1 
ATOM   1593 C CD2 . TYR A 1 213 ? 14.224  9.534  19.414 1.00 13.48 ? 228 TYR A CD2 1 
ATOM   1594 C CE1 . TYR A 1 213 ? 16.881  8.740  19.708 1.00 16.26 ? 228 TYR A CE1 1 
ATOM   1595 C CE2 . TYR A 1 213 ? 15.132  9.689  18.347 1.00 13.09 ? 228 TYR A CE2 1 
ATOM   1596 C CZ  . TYR A 1 213 ? 16.456  9.296  18.509 1.00 13.83 ? 228 TYR A CZ  1 
ATOM   1597 O OH  . TYR A 1 213 ? 17.358  9.491  17.486 1.00 16.50 ? 228 TYR A OH  1 
ATOM   1598 N N   . THR A 1 214 ? 11.972  10.772 24.022 1.00 9.12  ? 229 THR A N   1 
ATOM   1599 C CA  . THR A 1 214 ? 11.043  10.720 25.156 1.00 11.32 ? 229 THR A CA  1 
ATOM   1600 C C   . THR A 1 214 ? 10.154  9.464  25.047 1.00 9.91  ? 229 THR A C   1 
ATOM   1601 O O   . THR A 1 214 ? 9.518   9.232  24.006 1.00 9.15  ? 229 THR A O   1 
ATOM   1602 C CB  . THR A 1 214 ? 10.144  11.965 25.171 1.00 11.16 ? 229 THR A CB  1 
ATOM   1603 O OG1 . THR A 1 214 ? 10.961  13.143 25.143 1.00 10.44 ? 229 THR A OG1 1 
ATOM   1604 C CG2 . THR A 1 214 ? 9.267   11.969 26.442 1.00 12.11 ? 229 THR A CG2 1 
ATOM   1605 N N   . ARG A 1 215 ? 10.138  8.626  26.078 1.00 7.85  ? 230 ARG A N   1 
ATOM   1606 C CA  . ARG A 1 215 ? 9.312   7.415  26.029 1.00 7.51  ? 230 ARG A CA  1 
ATOM   1607 C C   . ARG A 1 215 ? 7.828   7.745  26.239 1.00 11.35 ? 230 ARG A C   1 
ATOM   1608 O O   . ARG A 1 215 ? 7.460   8.310  27.265 1.00 15.42 ? 230 ARG A O   1 
ATOM   1609 C CB  . ARG A 1 215 ? 9.787   6.416  27.073 1.00 7.41  ? 230 ARG A CB  1 
ATOM   1610 C CG  . ARG A 1 215 ? 11.262  6.082  26.971 1.00 10.44 ? 230 ARG A CG  1 
ATOM   1611 C CD  . ARG A 1 215 ? 11.712  5.174  28.096 1.00 11.55 ? 230 ARG A CD  1 
ATOM   1612 N NE  . ARG A 1 215 ? 10.941  3.945  28.082 1.00 14.04 ? 230 ARG A NE  1 
ATOM   1613 C CZ  . ARG A 1 215 ? 10.117  3.569  29.051 1.00 16.81 ? 230 ARG A CZ  1 
ATOM   1614 N NH1 . ARG A 1 215 ? 10.020  4.292  30.158 1.00 16.82 ? 230 ARG A NH1 1 
ATOM   1615 N NH2 . ARG A 1 215 ? 9.442   2.441  28.931 1.00 19.53 ? 230 ARG A NH2 1 
ATOM   1616 N N   . VAL A 1 216 ? 6.979   7.393  25.274 1.00 11.76 ? 231 VAL A N   1 
ATOM   1617 C CA  . VAL A 1 216 ? 5.552   7.694  25.356 1.00 12.19 ? 231 VAL A CA  1 
ATOM   1618 C C   . VAL A 1 216 ? 4.784   6.847  26.371 1.00 11.69 ? 231 VAL A C   1 
ATOM   1619 O O   . VAL A 1 216 ? 3.763   7.289  26.897 1.00 12.89 ? 231 VAL A O   1 
ATOM   1620 C CB  . VAL A 1 216 ? 4.835   7.593  23.986 1.00 11.59 ? 231 VAL A CB  1 
ATOM   1621 C CG1 . VAL A 1 216 ? 5.469   8.530  23.001 1.00 17.22 ? 231 VAL A CG1 1 
ATOM   1622 C CG2 . VAL A 1 216 ? 4.817   6.171  23.487 1.00 12.70 ? 231 VAL A CG2 1 
ATOM   1623 N N   . ALA A 1 217 ? 5.281   5.648  26.652 1.00 12.66 ? 232 ALA A N   1 
ATOM   1624 C CA  . ALA A 1 217 ? 4.627   4.759  27.611 1.00 13.30 ? 232 ALA A CA  1 
ATOM   1625 C C   . ALA A 1 217 ? 4.570   5.413  28.993 1.00 15.96 ? 232 ALA A C   1 
ATOM   1626 O O   . ALA A 1 217 ? 3.583   5.266  29.715 1.00 14.16 ? 232 ALA A O   1 
ATOM   1627 C CB  . ALA A 1 217 ? 5.350   3.434  27.677 1.00 12.20 ? 232 ALA A CB  1 
ATOM   1628 N N   . SER A 1 218 ? 5.596   6.199  29.316 1.00 13.57 ? 233 SER A N   1 
ATOM   1629 C CA  . SER A 1 218 ? 5.670   6.895  30.593 1.00 14.48 ? 233 SER A CA  1 
ATOM   1630 C C   . SER A 1 218 ? 4.593   7.967  30.727 1.00 14.25 ? 233 SER A C   1 
ATOM   1631 O O   . SER A 1 218 ? 4.320   8.429  31.837 1.00 15.59 ? 233 SER A O   1 
ATOM   1632 C CB  . SER A 1 218 ? 7.025   7.585  30.742 1.00 13.99 ? 233 SER A CB  1 
ATOM   1633 O OG  . SER A 1 218 ? 8.086   6.664  30.810 1.00 21.22 ? 233 SER A OG  1 
ATOM   1634 N N   . TYR A 1 219 ? 3.991   8.361  29.607 1.00 11.03 ? 234 TYR A N   1 
ATOM   1635 C CA  . TYR A 1 219 ? 3.001   9.423  29.592 1.00 10.42 ? 234 TYR A CA  1 
ATOM   1636 C C   . TYR A 1 219 ? 1.635   8.957  29.146 1.00 9.90  ? 234 TYR A C   1 
ATOM   1637 O O   . TYR A 1 219 ? 0.784   9.768  28.789 1.00 11.11 ? 234 TYR A O   1 
ATOM   1638 C CB  . TYR A 1 219 ? 3.480   10.568 28.688 1.00 12.46 ? 234 TYR A CB  1 
ATOM   1639 C CG  . TYR A 1 219 ? 4.745   11.241 29.188 1.00 12.06 ? 234 TYR A CG  1 
ATOM   1640 C CD1 . TYR A 1 219 ? 4.677   12.292 30.101 1.00 11.32 ? 234 TYR A CD1 1 
ATOM   1641 C CD2 . TYR A 1 219 ? 6.013   10.787 28.794 1.00 11.88 ? 234 TYR A CD2 1 
ATOM   1642 C CE1 . TYR A 1 219 ? 5.829   12.879 30.624 1.00 10.36 ? 234 TYR A CE1 1 
ATOM   1643 C CE2 . TYR A 1 219 ? 7.183   11.375 29.312 1.00 11.85 ? 234 TYR A CE2 1 
ATOM   1644 C CZ  . TYR A 1 219 ? 7.075   12.419 30.231 1.00 12.96 ? 234 TYR A CZ  1 
ATOM   1645 O OH  . TYR A 1 219 ? 8.197   12.986 30.786 1.00 13.46 ? 234 TYR A OH  1 
ATOM   1646 N N   . ALA A 1 220 ? 1.417   7.649  29.183 1.00 13.01 ? 235 ALA A N   1 
ATOM   1647 C CA  . ALA A 1 220 ? 0.142   7.064  28.766 1.00 14.43 ? 235 ALA A CA  1 
ATOM   1648 C C   . ALA A 1 220 ? -1.060  7.705  29.460 1.00 16.33 ? 235 ALA A C   1 
ATOM   1649 O O   . ALA A 1 220 ? -2.085  7.957  28.826 1.00 16.05 ? 235 ALA A O   1 
ATOM   1650 C CB  . ALA A 1 220 ? 0.164   5.570  29.011 1.00 15.66 ? 235 ALA A CB  1 
ATOM   1651 N N   . ALA A 1 221 ? -0.917  7.988  30.758 1.00 17.88 ? 236 ALA A N   1 
ATOM   1652 C CA  . ALA A 1 221 ? -1.986  8.609  31.548 1.00 17.78 ? 236 ALA A CA  1 
ATOM   1653 C C   . ALA A 1 221 ? -2.261  10.043 31.111 1.00 16.31 ? 236 ALA A C   1 
ATOM   1654 O O   . ALA A 1 221 ? -3.414  10.479 31.097 1.00 16.27 ? 236 ALA A O   1 
ATOM   1655 C CB  . ALA A 1 221 ? -1.656  8.571  33.041 1.00 18.76 ? 236 ALA A CB  1 
ATOM   1656 N N   . TRP A 1 222 ? -1.216  10.790 30.774 1.00 14.06 ? 237 TRP A N   1 
ATOM   1657 C CA  . TRP A 1 222 ? -1.427  12.153 30.337 1.00 12.27 ? 237 TRP A CA  1 
ATOM   1658 C C   . TRP A 1 222 ? -2.092  12.172 28.954 1.00 11.97 ? 237 TRP A C   1 
ATOM   1659 O O   . TRP A 1 222 ? -3.035  12.936 28.711 1.00 11.12 ? 237 TRP A O   1 
ATOM   1660 C CB  . TRP A 1 222 ? -0.111  12.929 30.333 1.00 10.91 ? 237 TRP A CB  1 
ATOM   1661 C CG  . TRP A 1 222 ? -0.242  14.311 29.727 1.00 14.78 ? 237 TRP A CG  1 
ATOM   1662 C CD1 . TRP A 1 222 ? -0.868  15.396 30.277 1.00 15.39 ? 237 TRP A CD1 1 
ATOM   1663 C CD2 . TRP A 1 222 ? 0.244   14.738 28.438 1.00 12.38 ? 237 TRP A CD2 1 
ATOM   1664 N NE1 . TRP A 1 222 ? -0.809  16.466 29.409 1.00 16.09 ? 237 TRP A NE1 1 
ATOM   1665 C CE2 . TRP A 1 222 ? -0.129  16.091 28.278 1.00 13.90 ? 237 TRP A CE2 1 
ATOM   1666 C CE3 . TRP A 1 222 ? 0.963   14.105 27.405 1.00 16.26 ? 237 TRP A CE3 1 
ATOM   1667 C CZ2 . TRP A 1 222 ? 0.193   16.829 27.128 1.00 12.54 ? 237 TRP A CZ2 1 
ATOM   1668 C CZ3 . TRP A 1 222 ? 1.283   14.840 26.264 1.00 12.56 ? 237 TRP A CZ3 1 
ATOM   1669 C CH2 . TRP A 1 222 ? 0.897   16.187 26.139 1.00 13.49 ? 237 TRP A CH2 1 
ATOM   1670 N N   . ILE A 1 223 ? -1.625  11.321 28.049 1.00 12.21 ? 238 ILE A N   1 
ATOM   1671 C CA  . ILE A 1 223 ? -2.206  11.284 26.708 1.00 10.24 ? 238 ILE A CA  1 
ATOM   1672 C C   . ILE A 1 223 ? -3.687  10.902 26.788 1.00 11.21 ? 238 ILE A C   1 
ATOM   1673 O O   . ILE A 1 223 ? -4.554  11.580 26.220 1.00 10.59 ? 238 ILE A O   1 
ATOM   1674 C CB  . ILE A 1 223 ? -1.429  10.323 25.784 1.00 12.02 ? 238 ILE A CB  1 
ATOM   1675 C CG1 . ILE A 1 223 ? -0.023  10.886 25.520 1.00 7.66  ? 238 ILE A CG1 1 
ATOM   1676 C CG2 . ILE A 1 223 ? -2.167  10.159 24.446 1.00 12.41 ? 238 ILE A CG2 1 
ATOM   1677 C CD1 . ILE A 1 223 ? 0.972   9.834  25.043 1.00 13.51 ? 238 ILE A CD1 1 
ATOM   1678 N N   . ASP A 1 224 ? -3.970  9.824  27.507 1.00 12.09 ? 239 ASP A N   1 
ATOM   1679 C CA  . ASP A 1 224 ? -5.348  9.371  27.694 1.00 15.07 ? 239 ASP A CA  1 
ATOM   1680 C C   . ASP A 1 224 ? -6.250  10.477 28.200 1.00 13.72 ? 239 ASP A C   1 
ATOM   1681 O O   . ASP A 1 224 ? -7.384  10.606 27.726 1.00 15.34 ? 239 ASP A O   1 
ATOM   1682 C CB  . ASP A 1 224 ? -5.403  8.205  28.680 1.00 15.49 ? 239 ASP A CB  1 
ATOM   1683 C CG  . ASP A 1 224 ? -5.056  6.887  28.038 1.00 20.45 ? 239 ASP A CG  1 
ATOM   1684 O OD1 . ASP A 1 224 ? -5.139  6.794  26.797 1.00 21.65 ? 239 ASP A OD1 1 
ATOM   1685 O OD2 . ASP A 1 224 ? -4.720  5.936  28.769 1.00 23.13 ? 239 ASP A OD2 1 
ATOM   1686 N N   . SER A 1 225 ? -5.754  11.285 29.141 1.00 15.59 ? 240 SER A N   1 
ATOM   1687 C CA  . SER A 1 225 ? -6.555  12.363 29.707 1.00 18.26 ? 240 SER A CA  1 
ATOM   1688 C C   . SER A 1 225 ? -6.823  13.505 28.752 1.00 18.63 ? 240 SER A C   1 
ATOM   1689 O O   . SER A 1 225 ? -7.902  14.095 28.768 1.00 19.27 ? 240 SER A O   1 
ATOM   1690 C CB  . SER A 1 225 ? -5.951  12.895 31.007 1.00 22.02 ? 240 SER A CB  1 
ATOM   1691 O OG  . SER A 1 225 ? -4.662  13.429 30.802 1.00 27.78 ? 240 SER A OG  1 
ATOM   1692 N N   . VAL A 1 226 ? -5.851  13.820 27.911 1.00 18.48 ? 241 VAL A N   1 
ATOM   1693 C CA  . VAL A 1 226 ? -6.038  14.892 26.958 1.00 16.19 ? 241 VAL A CA  1 
ATOM   1694 C C   . VAL A 1 226 ? -6.991  14.491 25.826 1.00 18.46 ? 241 VAL A C   1 
ATOM   1695 O O   . VAL A 1 226 ? -7.805  15.304 25.389 1.00 17.90 ? 241 VAL A O   1 
ATOM   1696 C CB  . VAL A 1 226 ? -4.688  15.372 26.378 1.00 14.91 ? 241 VAL A CB  1 
ATOM   1697 C CG1 . VAL A 1 226 ? -4.927  16.472 25.354 1.00 14.12 ? 241 VAL A CG1 1 
ATOM   1698 C CG2 . VAL A 1 226 ? -3.786  15.871 27.502 1.00 11.44 ? 241 VAL A CG2 1 
ATOM   1699 N N   . LEU A 1 227 ? -6.917  13.237 25.381 1.00 21.92 ? 242 LEU A N   1 
ATOM   1700 C CA  . LEU A 1 227 ? -7.768  12.765 24.282 1.00 27.74 ? 242 LEU A CA  1 
ATOM   1701 C C   . LEU A 1 227 ? -9.211  12.457 24.687 1.00 33.16 ? 242 LEU A C   1 
ATOM   1702 O O   . LEU A 1 227 ? -10.100 12.397 23.826 1.00 33.92 ? 242 LEU A O   1 
ATOM   1703 C CB  . LEU A 1 227 ? -7.165  11.522 23.622 1.00 24.49 ? 242 LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 227 ? -5.686  11.543 23.216 1.00 28.14 ? 242 LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 227 ? -5.446  10.474 22.174 1.00 28.66 ? 242 LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 227 ? -5.279  12.886 22.656 1.00 25.97 ? 242 LEU A CD2 1 
ATOM   1707 N N   . ALA A 1 228 ? -9.418  12.231 25.985 1.00 37.60 ? 243 ALA A N   1 
ATOM   1708 C CA  . ALA A 1 228 ? -10.731 11.908 26.550 1.00 41.68 ? 243 ALA A CA  1 
ATOM   1709 C C   . ALA A 1 228 ? -11.779 12.991 26.289 1.00 44.26 ? 243 ALA A C   1 
ATOM   1710 O O   . ALA A 1 228 ? -11.471 14.188 26.502 1.00 46.39 ? 243 ALA A O   1 
ATOM   1711 C CB  . ALA A 1 228 ? -10.609 11.652 28.055 1.00 39.74 ? 243 ALA A CB  1 
ATOM   1712 O OXT . ALA A 1 228 ? -12.901 12.620 25.870 1.00 48.03 ? 243 ALA A OXT 1 
HETATM 1713 C C1  . DIC B 2 .   ? 19.231  18.370 17.425 1.00 21.87 ? 244 DIC A C1  1 
HETATM 1714 C C2  . DIC B 2 .   ? 18.787  19.697 17.375 1.00 24.01 ? 244 DIC A C2  1 
HETATM 1715 C C3  . DIC B 2 .   ? 17.426  20.004 17.559 1.00 26.83 ? 244 DIC A C3  1 
HETATM 1716 C C4  . DIC B 2 .   ? 16.506  18.916 17.802 1.00 25.26 ? 244 DIC A C4  1 
HETATM 1717 C C5  . DIC B 2 .   ? 16.979  17.589 17.843 1.00 23.14 ? 244 DIC A C5  1 
HETATM 1718 C C6  . DIC B 2 .   ? 18.335  17.324 17.655 1.00 22.16 ? 244 DIC A C6  1 
HETATM 1719 C C7  . DIC B 2 .   ? 15.057  19.172 18.041 1.00 25.46 ? 244 DIC A C7  1 
HETATM 1720 O O7  . DIC B 2 .   ? 14.563  20.128 18.651 1.00 30.94 ? 244 DIC A O7  1 
HETATM 1721 C C8  . DIC B 2 .   ? 16.975  21.499 17.470 1.00 31.19 ? 244 DIC A C8  1 
HETATM 1722 C C9  . DIC B 2 .   ? 15.793  21.775 16.508 1.00 36.50 ? 244 DIC A C9  1 
HETATM 1723 O O   . O   C 3 .   ? 15.344  20.826 15.830 1.00 38.09 ? 245 O   A O   1 
HETATM 1724 O O   . O   D 3 .   ? 15.294  22.918 16.444 1.00 42.03 ? 246 O   A O   1 
HETATM 1725 O O   . HOH E 4 .   ? 19.643  11.507 5.496  1.00 21.18 ? 300 HOH A O   1 
HETATM 1726 O O   . HOH E 4 .   ? 19.545  24.344 2.545  1.00 51.38 ? 301 HOH A O   1 
HETATM 1727 O O   . HOH E 4 .   ? 23.500  12.705 5.610  1.00 34.60 ? 302 HOH A O   1 
HETATM 1728 O O   . HOH E 4 .   ? 27.300  15.951 7.319  1.00 41.56 ? 303 HOH A O   1 
HETATM 1729 O O   . HOH E 4 .   ? -14.930 20.608 14.237 1.00 50.31 ? 304 HOH A O   1 
HETATM 1730 O O   . HOH E 4 .   ? 21.085  4.986  6.338  1.00 36.18 ? 305 HOH A O   1 
HETATM 1731 O O   . HOH E 4 .   ? 19.020  3.042  7.682  1.00 38.82 ? 306 HOH A O   1 
HETATM 1732 O O   . HOH E 4 .   ? 3.645   11.619 -4.090 1.00 39.38 ? 307 HOH A O   1 
HETATM 1733 O O   . HOH E 4 .   ? 2.786   -0.413 32.247 1.00 28.57 ? 308 HOH A O   1 
HETATM 1734 O O   . HOH E 4 .   ? 18.055  7.846  -0.804 1.00 29.60 ? 309 HOH A O   1 
HETATM 1735 O O   . HOH E 4 .   ? 14.146  3.654  2.121  1.00 38.76 ? 310 HOH A O   1 
HETATM 1736 O O   . HOH E 4 .   ? -5.249  21.653 2.816  1.00 59.44 ? 311 HOH A O   1 
HETATM 1737 O O   . HOH E 4 .   ? 11.308  7.179  -2.061 1.00 33.32 ? 312 HOH A O   1 
HETATM 1738 O O   . HOH E 4 .   ? 12.500  1.046  7.712  1.00 54.94 ? 313 HOH A O   1 
HETATM 1739 O O   . HOH E 4 .   ? 9.193   5.682  -3.072 1.00 52.50 ? 314 HOH A O   1 
HETATM 1740 O O   . HOH E 4 .   ? -11.566 13.542 17.802 1.00 56.58 ? 315 HOH A O   1 
HETATM 1741 O O   . HOH E 4 .   ? 16.087  12.828 -1.158 1.00 29.27 ? 316 HOH A O   1 
HETATM 1742 O O   . HOH E 4 .   ? 7.735   6.856  4.333  1.00 11.37 ? 317 HOH A O   1 
HETATM 1743 O O   . HOH E 4 .   ? 5.364   8.556  4.733  1.00 10.11 ? 318 HOH A O   1 
HETATM 1744 O O   . HOH E 4 .   ? 6.028   10.235 2.728  1.00 14.07 ? 319 HOH A O   1 
HETATM 1745 O O   . HOH E 4 .   ? 1.814   9.691  3.536  1.00 12.69 ? 320 HOH A O   1 
HETATM 1746 O O   . HOH E 4 .   ? 7.961   5.589  33.352 1.00 42.83 ? 321 HOH A O   1 
HETATM 1747 O O   . HOH E 4 .   ? 9.202   6.352  11.364 1.00 18.62 ? 322 HOH A O   1 
HETATM 1748 O O   . HOH E 4 .   ? 2.737   14.531 6.288  1.00 10.23 ? 323 HOH A O   1 
HETATM 1749 O O   . HOH E 4 .   ? 0.877   11.452 6.969  1.00 15.82 ? 324 HOH A O   1 
HETATM 1750 O O   . HOH E 4 .   ? 3.556   11.183 5.290  1.00 7.71  ? 325 HOH A O   1 
HETATM 1751 O O   . HOH E 4 .   ? 1.556   27.509 9.191  1.00 32.06 ? 326 HOH A O   1 
HETATM 1752 O O   . HOH E 4 .   ? 10.599  16.355 10.729 1.00 9.39  ? 327 HOH A O   1 
HETATM 1753 O O   . HOH E 4 .   ? 10.775  14.181 12.497 1.00 8.24  ? 328 HOH A O   1 
HETATM 1754 O O   . HOH E 4 .   ? 3.535   -3.795 21.643 1.00 64.95 ? 329 HOH A O   1 
HETATM 1755 O O   . HOH E 4 .   ? 15.390  22.555 10.046 1.00 20.00 ? 330 HOH A O   1 
HETATM 1756 O O   . HOH E 4 .   ? 9.338   -0.427 13.144 1.00 24.70 ? 331 HOH A O   1 
HETATM 1757 O O   . HOH E 4 .   ? -2.875  5.399  17.836 1.00 21.32 ? 332 HOH A O   1 
HETATM 1758 O O   . HOH E 4 .   ? -11.845 10.832 9.730  1.00 32.27 ? 333 HOH A O   1 
HETATM 1759 O O   . HOH E 4 .   ? 2.644   3.203  31.142 1.00 69.46 ? 334 HOH A O   1 
HETATM 1760 O O   . HOH E 4 .   ? -4.694  6.879  20.434 1.00 46.28 ? 335 HOH A O   1 
HETATM 1761 O O   . HOH E 4 .   ? -9.485  11.806 17.491 1.00 20.78 ? 336 HOH A O   1 
HETATM 1762 O O   . HOH E 4 .   ? -3.906  27.148 13.113 1.00 21.44 ? 337 HOH A O   1 
HETATM 1763 O O   . HOH E 4 .   ? 24.163  15.193 31.728 1.00 51.00 ? 338 HOH A O   1 
HETATM 1764 O O   . HOH E 4 .   ? -5.778  13.640 5.564  1.00 22.46 ? 339 HOH A O   1 
HETATM 1765 O O   . HOH E 4 .   ? -5.403  13.621 2.936  1.00 19.23 ? 340 HOH A O   1 
HETATM 1766 O O   . HOH E 4 .   ? -4.941  8.905  2.112  1.00 19.80 ? 341 HOH A O   1 
HETATM 1767 O O   . HOH E 4 .   ? 13.410  12.699 -5.171 1.00 20.26 ? 342 HOH A O   1 
HETATM 1768 O O   . HOH E 4 .   ? 11.397  15.843 -3.697 1.00 31.54 ? 343 HOH A O   1 
HETATM 1769 O O   . HOH E 4 .   ? 6.437   14.061 -4.606 1.00 25.19 ? 344 HOH A O   1 
HETATM 1770 O O   . HOH E 4 .   ? 5.418   9.558  -5.640 1.00 26.32 ? 345 HOH A O   1 
HETATM 1771 O O   . HOH E 4 .   ? -0.429  11.302 -2.716 1.00 50.83 ? 346 HOH A O   1 
HETATM 1772 O O   . HOH E 4 .   ? 11.543  22.108 0.003  1.00 46.74 ? 347 HOH A O   1 
HETATM 1773 O O   . HOH E 4 .   ? -0.887  21.925 29.985 1.00 27.05 ? 348 HOH A O   1 
HETATM 1774 O O   . HOH E 4 .   ? 14.027  20.987 8.251  1.00 20.00 ? 349 HOH A O   1 
HETATM 1775 O O   . HOH E 4 .   ? 13.021  20.302 5.161  1.00 20.92 ? 350 HOH A O   1 
HETATM 1776 O O   . HOH E 4 .   ? 12.231  22.810 4.963  1.00 33.27 ? 351 HOH A O   1 
HETATM 1777 O O   . HOH E 4 .   ? 4.409   4.466  33.825 1.00 20.00 ? 352 HOH A O   1 
HETATM 1778 O O   . HOH E 4 .   ? 24.056  5.059  14.543 1.00 33.17 ? 353 HOH A O   1 
HETATM 1779 O O   . HOH E 4 .   ? 10.824  20.500 29.421 1.00 20.00 ? 354 HOH A O   1 
HETATM 1780 O O   . HOH E 4 .   ? 23.747  -0.915 24.107 1.00 28.16 ? 355 HOH A O   1 
HETATM 1781 O O   . HOH E 4 .   ? 2.912   22.026 0.003  1.00 50.72 ? 356 HOH A O   1 
HETATM 1782 O O   . HOH E 4 .   ? -14.441 16.763 12.732 1.00 25.81 ? 357 HOH A O   1 
HETATM 1783 O O   . HOH E 4 .   ? -10.620 15.984 24.538 1.00 43.04 ? 358 HOH A O   1 
HETATM 1784 O O   . HOH E 4 .   ? -12.982 23.207 14.794 1.00 28.39 ? 359 HOH A O   1 
HETATM 1785 O O   . HOH E 4 .   ? 16.166  2.369  27.966 1.00 39.05 ? 360 HOH A O   1 
HETATM 1786 O O   . HOH E 4 .   ? 6.371   1.827  7.302  1.00 66.49 ? 361 HOH A O   1 
HETATM 1787 O O   . HOH E 4 .   ? 15.852  14.707 7.134  1.00 9.06  ? 362 HOH A O   1 
HETATM 1788 O O   . HOH E 4 .   ? 10.343  14.885 23.186 1.00 16.27 ? 363 HOH A O   1 
HETATM 1789 O O   . HOH E 4 .   ? 10.528  19.586 32.904 1.00 38.50 ? 364 HOH A O   1 
HETATM 1790 O O   . HOH E 4 .   ? 1.468   6.641  32.608 1.00 46.96 ? 365 HOH A O   1 
HETATM 1791 O O   . HOH E 4 .   ? 14.602  24.025 21.419 1.00 44.85 ? 366 HOH A O   1 
HETATM 1792 O O   . HOH E 4 .   ? 10.884  13.075 29.936 1.00 11.34 ? 367 HOH A O   1 
HETATM 1793 O O   . HOH E 4 .   ? 12.611  12.889 31.965 1.00 22.83 ? 368 HOH A O   1 
HETATM 1794 O O   . HOH E 4 .   ? 11.168  14.544 27.579 1.00 10.23 ? 369 HOH A O   1 
HETATM 1795 O O   . HOH E 4 .   ? 8.554   -1.395 25.038 1.00 27.49 ? 370 HOH A O   1 
HETATM 1796 O O   . HOH E 4 .   ? 7.555   4.104  25.392 1.00 11.58 ? 371 HOH A O   1 
HETATM 1797 O O   . HOH E 4 .   ? 10.606  2.336  25.775 1.00 29.27 ? 372 HOH A O   1 
HETATM 1798 O O   . HOH E 4 .   ? 17.197  -0.424 26.299 1.00 26.82 ? 373 HOH A O   1 
HETATM 1799 O O   . HOH E 4 .   ? 17.848  3.517  26.155 1.00 16.84 ? 374 HOH A O   1 
HETATM 1800 O O   . HOH E 4 .   ? -11.803 9.524  7.349  1.00 20.00 ? 375 HOH A O   1 
HETATM 1801 O O   . HOH E 4 .   ? 12.189  -4.975 22.781 1.00 25.23 ? 376 HOH A O   1 
HETATM 1802 O O   . HOH E 4 .   ? -0.016  4.683  10.696 1.00 40.07 ? 377 HOH A O   1 
HETATM 1803 O O   . HOH E 4 .   ? -1.275  18.970 -2.875 1.00 62.49 ? 378 HOH A O   1 
HETATM 1804 O O   . HOH E 4 .   ? 23.138  -1.017 20.882 1.00 21.60 ? 379 HOH A O   1 
HETATM 1805 O O   . HOH E 4 .   ? 7.686   -1.900 20.186 1.00 27.75 ? 380 HOH A O   1 
HETATM 1806 O O   . HOH E 4 .   ? 12.574  23.983 7.408  1.00 34.37 ? 381 HOH A O   1 
HETATM 1807 O O   . HOH E 4 .   ? 20.085  8.866  17.941 1.00 10.98 ? 382 HOH A O   1 
HETATM 1808 O O   . HOH E 4 .   ? 26.308  6.114  19.979 1.00 20.21 ? 383 HOH A O   1 
HETATM 1809 O O   . HOH E 4 .   ? 2.948   24.312 3.478  1.00 31.74 ? 384 HOH A O   1 
HETATM 1810 O O   . HOH E 4 .   ? -13.244 12.971 8.718  1.00 20.00 ? 385 HOH A O   1 
HETATM 1811 O O   . HOH E 4 .   ? 24.207  27.727 28.513 1.00 59.33 ? 386 HOH A O   1 
HETATM 1812 O O   . HOH E 4 .   ? 16.905  14.167 20.359 1.00 18.65 ? 387 HOH A O   1 
HETATM 1813 O O   . HOH E 4 .   ? 25.343  13.201 18.445 1.00 20.57 ? 388 HOH A O   1 
HETATM 1814 O O   . HOH E 4 .   ? 30.430  9.149  15.441 1.00 34.95 ? 389 HOH A O   1 
HETATM 1815 O O   . HOH E 4 .   ? 19.486  -7.207 23.447 1.00 20.48 ? 390 HOH A O   1 
HETATM 1816 O O   . HOH E 4 .   ? 5.072   22.748 3.066  1.00 21.22 ? 391 HOH A O   1 
HETATM 1817 O O   . HOH E 4 .   ? 5.001   24.452 24.589 1.00 28.92 ? 392 HOH A O   1 
HETATM 1818 O O   . HOH E 4 .   ? 1.974   -0.099 12.449 1.00 32.14 ? 393 HOH A O   1 
HETATM 1819 O O   . HOH E 4 .   ? -12.461 6.680  6.483  1.00 49.26 ? 394 HOH A O   1 
HETATM 1820 O O   . HOH E 4 .   ? 1.674   10.127 32.727 1.00 32.11 ? 395 HOH A O   1 
HETATM 1821 O O   . HOH E 4 .   ? 17.625  17.200 21.120 1.00 22.22 ? 396 HOH A O   1 
HETATM 1822 O O   . HOH E 4 .   ? 14.832  15.285 -0.460 1.00 20.84 ? 397 HOH A O   1 
HETATM 1823 O O   . HOH E 4 .   ? 8.445   21.944 -6.091 1.00 36.68 ? 398 HOH A O   1 
HETATM 1824 O O   . HOH E 4 .   ? -8.923  28.390 15.900 1.00 41.04 ? 399 HOH A O   1 
HETATM 1825 O O   . HOH E 4 .   ? 22.323  20.498 16.403 1.00 24.60 ? 400 HOH A O   1 
HETATM 1826 O O   . HOH E 4 .   ? -10.879 14.433 21.838 1.00 40.04 ? 401 HOH A O   1 
HETATM 1827 O O   . HOH E 4 .   ? 17.916  -1.413 28.721 1.00 25.45 ? 402 HOH A O   1 
HETATM 1828 O O   . HOH E 4 .   ? 3.661   3.488  0.355  1.00 37.53 ? 403 HOH A O   1 
HETATM 1829 O O   . HOH E 4 .   ? -5.818  28.614 7.110  1.00 41.25 ? 404 HOH A O   1 
HETATM 1830 O O   . HOH E 4 .   ? 14.453  -4.315 29.673 1.00 55.55 ? 405 HOH A O   1 
HETATM 1831 O O   . HOH E 4 .   ? 13.541  1.754  26.015 1.00 34.73 ? 406 HOH A O   1 
HETATM 1832 O O   . HOH E 4 .   ? -6.426  10.688 3.387  1.00 38.57 ? 407 HOH A O   1 
HETATM 1833 O O   . HOH E 4 .   ? -9.010  8.724  26.641 1.00 35.22 ? 408 HOH A O   1 
HETATM 1834 O O   . HOH E 4 .   ? 0.712   22.481 1.644  1.00 65.15 ? 409 HOH A O   1 
HETATM 1835 O O   . HOH E 4 .   ? 19.054  24.863 8.239  1.00 21.51 ? 410 HOH A O   1 
HETATM 1836 O O   . HOH E 4 .   ? -4.454  26.550 22.329 1.00 53.93 ? 411 HOH A O   1 
HETATM 1837 O O   . HOH E 4 .   ? -2.218  -2.615 29.745 1.00 54.23 ? 412 HOH A O   1 
HETATM 1838 O O   . HOH E 4 .   ? -8.250  28.450 18.415 1.00 39.47 ? 413 HOH A O   1 
HETATM 1839 O O   . HOH E 4 .   ? -0.598  5.689  -1.052 1.00 41.66 ? 414 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   LEU 2   17  17  LEU LEU A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   ARG 5   20  20  ARG ARG A . n 
A 1 6   GLU 6   21  21  GLU GLU A . n 
A 1 7   ALA 7   22  22  ALA ALA A . n 
A 1 8   GLU 8   23  23  GLU GLU A . n 
A 1 9   ALA 9   24  24  ALA ALA A . n 
A 1 10  HIS 10  25  25  HIS HIS A . n 
A 1 11  ALA 11  26  26  ALA ALA A . n 
A 1 12  ARG 12  27  27  ARG ARG A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  TYR 14  29  29  TYR TYR A . n 
A 1 15  MET 15  30  30  MET MET A . n 
A 1 16  ALA 16  31  31  ALA ALA A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  VAL 18  33  33  VAL VAL A . n 
A 1 19  GLN 19  34  34  GLN GLN A . n 
A 1 20  LEU 20  35  35  LEU LEU A . n 
A 1 21  ASN 21  36  36  ASN ASN A . n 
A 1 22  GLY 22  38  38  GLY GLY A . n 
A 1 23  ALA 23  39  39  ALA ALA A . n 
A 1 24  HIS 24  40  40  HIS HIS A . n 
A 1 25  LEU 25  41  41  LEU LEU A . n 
A 1 26  CYS 26  42  42  CYS CYS A . n 
A 1 27  GLY 27  43  43  GLY GLY A . n 
A 1 28  GLY 28  44  44  GLY GLY A . n 
A 1 29  VAL 29  45  45  VAL VAL A . n 
A 1 30  LEU 30  46  46  LEU LEU A . n 
A 1 31  VAL 31  47  47  VAL VAL A . n 
A 1 32  ALA 32  48  48  ALA ALA A . n 
A 1 33  GLU 33  49  49  GLU GLU A . n 
A 1 34  GLN 34  50  50  GLN GLN A . n 
A 1 35  TRP 35  51  51  TRP TRP A . n 
A 1 36  VAL 36  52  52  VAL VAL A . n 
A 1 37  LEU 37  53  53  LEU LEU A . n 
A 1 38  SER 38  54  54  SER SER A . n 
A 1 39  ALA 39  55  55  ALA ALA A . n 
A 1 40  ALA 40  56  56  ALA ALA A . n 
A 1 41  HIS 41  57  57  HIS HIS A . n 
A 1 42  CYS 42  58  58  CYS CYS A . n 
A 1 43  LEU 43  59  59  LEU LEU A . n 
A 1 44  GLU 44  60  60  GLU GLU A . n 
A 1 45  ASP 45  61  61  ASP ASP A . n 
A 1 46  ALA 46  61  61  ALA ALA A A n 
A 1 47  ALA 47  61  61  ALA ALA A B n 
A 1 48  ASP 48  61  61  ASP ASP A C n 
A 1 49  GLY 49  62  62  GLY GLY A . n 
A 1 50  LYS 50  63  63  LYS LYS A . n 
A 1 51  VAL 51  64  64  VAL VAL A . n 
A 1 52  GLN 52  65  65  GLN GLN A . n 
A 1 53  VAL 53  66  66  VAL VAL A . n 
A 1 54  LEU 54  67  67  LEU LEU A . n 
A 1 55  LEU 55  68  68  LEU LEU A . n 
A 1 56  GLY 56  69  69  GLY GLY A . n 
A 1 57  ALA 57  70  70  ALA ALA A . n 
A 1 58  HIS 58  71  71  HIS HIS A . n 
A 1 59  SER 59  72  72  SER SER A . n 
A 1 60  LEU 60  73  73  LEU LEU A . n 
A 1 61  SER 61  74  74  SER SER A . n 
A 1 62  GLN 62  75  75  GLN GLN A . n 
A 1 63  PRO 63  76  76  PRO PRO A . n 
A 1 64  GLU 64  77  77  GLU GLU A . n 
A 1 65  PRO 65  78  78  PRO PRO A . n 
A 1 66  SER 66  79  79  SER SER A . n 
A 1 67  LYS 67  80  80  LYS LYS A . n 
A 1 68  ARG 68  81  81  ARG ARG A . n 
A 1 69  LEU 69  82  82  LEU LEU A . n 
A 1 70  TYR 70  83  83  TYR TYR A . n 
A 1 71  ASP 71  84  84  ASP ASP A . n 
A 1 72  VAL 72  85  85  VAL VAL A . n 
A 1 73  LEU 73  86  86  LEU LEU A . n 
A 1 74  ARG 74  87  87  ARG ARG A . n 
A 1 75  ALA 75  88  88  ALA ALA A . n 
A 1 76  VAL 76  89  89  VAL VAL A . n 
A 1 77  PRO 77  90  90  PRO PRO A . n 
A 1 78  HIS 78  91  91  HIS HIS A . n 
A 1 79  PRO 79  92  92  PRO PRO A . n 
A 1 80  ASP 80  93  93  ASP ASP A . n 
A 1 81  SER 81  94  94  SER SER A . n 
A 1 82  GLN 82  95  95  GLN GLN A . n 
A 1 83  PRO 83  96  96  PRO PRO A . n 
A 1 84  ASP 84  97  97  ASP ASP A . n 
A 1 85  THR 85  98  98  THR THR A . n 
A 1 86  ILE 86  99  99  ILE ILE A . n 
A 1 87  ASP 87  100 100 ASP ASP A . n 
A 1 88  HIS 88  101 101 HIS HIS A . n 
A 1 89  ASP 89  102 102 ASP ASP A . n 
A 1 90  LEU 90  103 103 LEU LEU A . n 
A 1 91  LEU 91  104 104 LEU LEU A . n 
A 1 92  LEU 92  105 105 LEU LEU A . n 
A 1 93  LEU 93  106 106 LEU LEU A . n 
A 1 94  GLN 94  107 107 GLN GLN A . n 
A 1 95  LEU 95  108 108 LEU LEU A . n 
A 1 96  SER 96  109 109 SER SER A . n 
A 1 97  GLU 97  110 110 GLU GLU A . n 
A 1 98  LYS 98  111 111 LYS LYS A . n 
A 1 99  ALA 99  112 112 ALA ALA A . n 
A 1 100 THR 100 113 113 THR THR A . n 
A 1 101 LEU 101 114 114 LEU LEU A . n 
A 1 102 GLY 102 115 115 GLY GLY A . n 
A 1 103 PRO 103 118 118 PRO PRO A . n 
A 1 104 ALA 104 119 119 ALA ALA A . n 
A 1 105 VAL 105 120 120 VAL VAL A . n 
A 1 106 ARG 106 121 121 ARG ARG A . n 
A 1 107 PRO 107 122 122 PRO PRO A . n 
A 1 108 LEU 108 123 123 LEU LEU A . n 
A 1 109 PRO 109 124 124 PRO PRO A . n 
A 1 110 TRP 110 124 124 TRP TRP A A n 
A 1 111 GLN 111 125 125 GLN GLN A . n 
A 1 112 ARG 112 126 126 ARG ARG A . n 
A 1 113 VAL 113 127 127 VAL VAL A . n 
A 1 114 ASP 114 128 128 ASP ASP A . n 
A 1 115 ARG 115 129 129 ARG ARG A . n 
A 1 116 ASP 116 129 129 ASP ASP A A n 
A 1 117 VAL 117 130 130 VAL VAL A . n 
A 1 118 ALA 118 131 131 ALA ALA A . n 
A 1 119 PRO 119 132 132 PRO PRO A . n 
A 1 120 GLY 120 133 133 GLY GLY A . n 
A 1 121 THR 121 134 134 THR THR A . n 
A 1 122 LEU 122 135 135 LEU LEU A . n 
A 1 123 CYS 123 136 136 CYS CYS A . n 
A 1 124 ASP 124 137 137 ASP ASP A . n 
A 1 125 VAL 125 138 138 VAL VAL A . n 
A 1 126 ALA 126 139 139 ALA ALA A . n 
A 1 127 GLY 127 140 140 GLY GLY A . n 
A 1 128 TRP 128 141 141 TRP TRP A . n 
A 1 129 GLY 129 142 142 GLY GLY A . n 
A 1 130 ILE 130 143 143 ILE ILE A . n 
A 1 131 VAL 131 144 144 VAL VAL A . n 
A 1 132 ASN 132 145 145 ASN ASN A . n 
A 1 133 HIS 133 146 146 HIS HIS A . n 
A 1 134 ALA 134 147 147 ALA ALA A . n 
A 1 135 GLY 135 149 149 GLY GLY A . n 
A 1 136 ARG 136 150 150 ARG ARG A . n 
A 1 137 ARG 137 151 151 ARG ARG A . n 
A 1 138 PRO 138 152 152 PRO PRO A . n 
A 1 139 ASP 139 153 153 ASP ASP A . n 
A 1 140 SER 140 154 154 SER SER A . n 
A 1 141 LEU 141 155 155 LEU LEU A . n 
A 1 142 GLN 142 156 156 GLN GLN A . n 
A 1 143 HIS 143 157 157 HIS HIS A . n 
A 1 144 VAL 144 158 158 VAL VAL A . n 
A 1 145 LEU 145 159 159 LEU LEU A . n 
A 1 146 LEU 146 160 160 LEU LEU A . n 
A 1 147 PRO 147 161 161 PRO PRO A . n 
A 1 148 VAL 148 162 162 VAL VAL A . n 
A 1 149 LEU 149 163 163 LEU LEU A . n 
A 1 150 ASP 150 164 164 ASP ASP A . n 
A 1 151 ARG 151 165 165 ARG ARG A . n 
A 1 152 ALA 152 166 166 ALA ALA A . n 
A 1 153 THR 153 167 167 THR THR A . n 
A 1 154 CYS 154 168 168 CYS CYS A . n 
A 1 155 ASN 155 169 169 ASN ASN A . n 
A 1 156 ARG 156 170 170 ARG ARG A . n 
A 1 157 ARG 157 170 170 ARG ARG A A n 
A 1 158 THR 158 170 170 THR THR A B n 
A 1 159 HIS 159 171 171 HIS HIS A . n 
A 1 160 HIS 160 172 172 HIS HIS A . n 
A 1 161 ASP 161 173 173 ASP ASP A . n 
A 1 162 GLY 162 174 174 GLY GLY A . n 
A 1 163 ALA 163 175 175 ALA ALA A . n 
A 1 164 ILE 164 176 176 ILE ILE A . n 
A 1 165 THR 165 177 177 THR THR A . n 
A 1 166 GLU 166 178 178 GLU GLU A . n 
A 1 167 ARG 167 179 179 ARG ARG A . n 
A 1 168 LEU 168 180 180 LEU LEU A . n 
A 1 169 MET 169 181 181 MET MET A . n 
A 1 170 CYS 170 182 182 CYS CYS A . n 
A 1 171 ALA 171 183 183 ALA ALA A . n 
A 1 172 GLU 172 184 184 GLU GLU A . n 
A 1 173 SER 173 185 185 SER SER A . n 
A 1 174 ASN 174 186 186 ASN ASN A . n 
A 1 175 ARG 175 187 187 ARG ARG A . n 
A 1 176 ARG 176 188 188 ARG ARG A . n 
A 1 177 ASP 177 189 189 ASP ASP A . n 
A 1 178 SER 178 190 190 SER SER A . n 
A 1 179 CYS 179 191 191 CYS CYS A . n 
A 1 180 LYS 180 192 192 LYS LYS A . n 
A 1 181 GLY 181 193 193 GLY GLY A . n 
A 1 182 ASP 182 194 194 ASP ASP A . n 
A 1 183 SER 183 195 195 SER SER A . n 
A 1 184 GLY 184 196 196 GLY GLY A . n 
A 1 185 GLY 185 197 197 GLY GLY A . n 
A 1 186 PRO 186 198 198 PRO PRO A . n 
A 1 187 LEU 187 199 199 LEU LEU A . n 
A 1 188 VAL 188 200 200 VAL VAL A . n 
A 1 189 CYS 189 201 201 CYS CYS A . n 
A 1 190 GLY 190 202 202 GLY GLY A . n 
A 1 191 GLY 191 207 207 GLY GLY A . n 
A 1 192 VAL 192 208 208 VAL VAL A . n 
A 1 193 LEU 193 209 209 LEU LEU A . n 
A 1 194 GLU 194 210 210 GLU GLU A . n 
A 1 195 GLY 195 211 211 GLY GLY A . n 
A 1 196 VAL 196 212 212 VAL VAL A . n 
A 1 197 VAL 197 213 213 VAL VAL A . n 
A 1 198 THR 198 214 214 THR THR A . n 
A 1 199 SER 199 215 215 SER SER A . n 
A 1 200 GLY 200 216 216 GLY GLY A . n 
A 1 201 SER 201 217 217 SER SER A . n 
A 1 202 ARG 202 218 218 ARG ARG A . n 
A 1 203 VAL 203 219 219 VAL VAL A . n 
A 1 204 CYS 204 220 220 CYS CYS A . n 
A 1 205 GLY 205 221 221 GLY GLY A . n 
A 1 206 ASN 206 222 222 ASN ASN A . n 
A 1 207 ARG 207 223 223 ARG ARG A . n 
A 1 208 LYS 208 223 223 LYS LYS A A n 
A 1 209 LYS 209 224 224 LYS LYS A . n 
A 1 210 PRO 210 225 225 PRO PRO A . n 
A 1 211 GLY 211 226 226 GLY GLY A . n 
A 1 212 ILE 212 227 227 ILE ILE A . n 
A 1 213 TYR 213 228 228 TYR TYR A . n 
A 1 214 THR 214 229 229 THR THR A . n 
A 1 215 ARG 215 230 230 ARG ARG A . n 
A 1 216 VAL 216 231 231 VAL VAL A . n 
A 1 217 ALA 217 232 232 ALA ALA A . n 
A 1 218 SER 218 233 233 SER SER A . n 
A 1 219 TYR 219 234 234 TYR TYR A . n 
A 1 220 ALA 220 235 235 ALA ALA A . n 
A 1 221 ALA 221 236 236 ALA ALA A . n 
A 1 222 TRP 222 237 237 TRP TRP A . n 
A 1 223 ILE 223 238 238 ILE ILE A . n 
A 1 224 ASP 224 239 239 ASP ASP A . n 
A 1 225 SER 225 240 240 SER SER A . n 
A 1 226 VAL 226 241 241 VAL VAL A . n 
A 1 227 LEU 227 242 242 LEU LEU A . n 
A 1 228 ALA 228 243 243 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DIC 1   244 244 DIC DIC A . 
C 3 O   1   245 245 O   O   A . 
D 3 O   1   246 246 O   O   A . 
E 4 HOH 1   300 300 HOH HOH A . 
E 4 HOH 2   301 301 HOH HOH A . 
E 4 HOH 3   302 302 HOH HOH A . 
E 4 HOH 4   303 303 HOH HOH A . 
E 4 HOH 5   304 304 HOH HOH A . 
E 4 HOH 6   305 305 HOH HOH A . 
E 4 HOH 7   306 306 HOH HOH A . 
E 4 HOH 8   307 307 HOH HOH A . 
E 4 HOH 9   308 308 HOH HOH A . 
E 4 HOH 10  309 309 HOH HOH A . 
E 4 HOH 11  310 310 HOH HOH A . 
E 4 HOH 12  311 311 HOH HOH A . 
E 4 HOH 13  312 312 HOH HOH A . 
E 4 HOH 14  313 313 HOH HOH A . 
E 4 HOH 15  314 314 HOH HOH A . 
E 4 HOH 16  315 315 HOH HOH A . 
E 4 HOH 17  316 316 HOH HOH A . 
E 4 HOH 18  317 317 HOH HOH A . 
E 4 HOH 19  318 318 HOH HOH A . 
E 4 HOH 20  319 319 HOH HOH A . 
E 4 HOH 21  320 320 HOH HOH A . 
E 4 HOH 22  321 321 HOH HOH A . 
E 4 HOH 23  322 322 HOH HOH A . 
E 4 HOH 24  323 323 HOH HOH A . 
E 4 HOH 25  324 324 HOH HOH A . 
E 4 HOH 26  325 325 HOH HOH A . 
E 4 HOH 27  326 326 HOH HOH A . 
E 4 HOH 28  327 327 HOH HOH A . 
E 4 HOH 29  328 328 HOH HOH A . 
E 4 HOH 30  329 329 HOH HOH A . 
E 4 HOH 31  330 330 HOH HOH A . 
E 4 HOH 32  331 331 HOH HOH A . 
E 4 HOH 33  332 332 HOH HOH A . 
E 4 HOH 34  333 333 HOH HOH A . 
E 4 HOH 35  334 334 HOH HOH A . 
E 4 HOH 36  335 335 HOH HOH A . 
E 4 HOH 37  336 336 HOH HOH A . 
E 4 HOH 38  337 337 HOH HOH A . 
E 4 HOH 39  338 338 HOH HOH A . 
E 4 HOH 40  339 339 HOH HOH A . 
E 4 HOH 41  340 340 HOH HOH A . 
E 4 HOH 42  341 341 HOH HOH A . 
E 4 HOH 43  342 342 HOH HOH A . 
E 4 HOH 44  343 343 HOH HOH A . 
E 4 HOH 45  344 344 HOH HOH A . 
E 4 HOH 46  345 345 HOH HOH A . 
E 4 HOH 47  346 346 HOH HOH A . 
E 4 HOH 48  347 347 HOH HOH A . 
E 4 HOH 49  348 348 HOH HOH A . 
E 4 HOH 50  349 349 HOH HOH A . 
E 4 HOH 51  350 350 HOH HOH A . 
E 4 HOH 52  351 351 HOH HOH A . 
E 4 HOH 53  352 352 HOH HOH A . 
E 4 HOH 54  353 353 HOH HOH A . 
E 4 HOH 55  354 354 HOH HOH A . 
E 4 HOH 56  355 355 HOH HOH A . 
E 4 HOH 57  356 356 HOH HOH A . 
E 4 HOH 58  357 357 HOH HOH A . 
E 4 HOH 59  358 358 HOH HOH A . 
E 4 HOH 60  359 359 HOH HOH A . 
E 4 HOH 61  360 360 HOH HOH A . 
E 4 HOH 62  361 361 HOH HOH A . 
E 4 HOH 63  362 362 HOH HOH A . 
E 4 HOH 64  363 363 HOH HOH A . 
E 4 HOH 65  364 364 HOH HOH A . 
E 4 HOH 66  365 365 HOH HOH A . 
E 4 HOH 67  366 366 HOH HOH A . 
E 4 HOH 68  367 367 HOH HOH A . 
E 4 HOH 69  368 368 HOH HOH A . 
E 4 HOH 70  369 369 HOH HOH A . 
E 4 HOH 71  370 370 HOH HOH A . 
E 4 HOH 72  371 371 HOH HOH A . 
E 4 HOH 73  372 372 HOH HOH A . 
E 4 HOH 74  373 373 HOH HOH A . 
E 4 HOH 75  374 374 HOH HOH A . 
E 4 HOH 76  375 375 HOH HOH A . 
E 4 HOH 77  376 376 HOH HOH A . 
E 4 HOH 78  377 377 HOH HOH A . 
E 4 HOH 79  378 378 HOH HOH A . 
E 4 HOH 80  379 379 HOH HOH A . 
E 4 HOH 81  380 380 HOH HOH A . 
E 4 HOH 82  381 381 HOH HOH A . 
E 4 HOH 83  382 382 HOH HOH A . 
E 4 HOH 84  383 383 HOH HOH A . 
E 4 HOH 85  384 384 HOH HOH A . 
E 4 HOH 86  385 385 HOH HOH A . 
E 4 HOH 87  386 386 HOH HOH A . 
E 4 HOH 88  387 387 HOH HOH A . 
E 4 HOH 89  388 388 HOH HOH A . 
E 4 HOH 90  389 389 HOH HOH A . 
E 4 HOH 91  390 390 HOH HOH A . 
E 4 HOH 92  391 391 HOH HOH A . 
E 4 HOH 93  392 392 HOH HOH A . 
E 4 HOH 94  393 393 HOH HOH A . 
E 4 HOH 95  394 394 HOH HOH A . 
E 4 HOH 96  395 395 HOH HOH A . 
E 4 HOH 97  396 396 HOH HOH A . 
E 4 HOH 98  397 397 HOH HOH A . 
E 4 HOH 99  398 398 HOH HOH A . 
E 4 HOH 100 399 399 HOH HOH A . 
E 4 HOH 101 400 400 HOH HOH A . 
E 4 HOH 102 401 401 HOH HOH A . 
E 4 HOH 103 402 402 HOH HOH A . 
E 4 HOH 104 403 403 HOH HOH A . 
E 4 HOH 105 404 404 HOH HOH A . 
E 4 HOH 106 405 405 HOH HOH A . 
E 4 HOH 107 406 406 HOH HOH A . 
E 4 HOH 108 407 407 HOH HOH A . 
E 4 HOH 109 408 408 HOH HOH A . 
E 4 HOH 110 409 409 HOH HOH A . 
E 4 HOH 111 410 410 HOH HOH A . 
E 4 HOH 112 411 411 HOH HOH A . 
E 4 HOH 113 412 412 HOH HOH A . 
E 4 HOH 114 413 413 HOH HOH A . 
E 4 HOH 115 414 414 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-07-22 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' . ? 1 
XENGEN 'data reduction'  . ? 2 
X-PLOR 'model building'  . ? 3 
X-PLOR refinement        . ? 4 
XENGEN 'data scaling'    . ? 5 
X-PLOR phasing           . ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   O 
_pdbx_validate_close_contact.auth_seq_id_1    245 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   O 
_pdbx_validate_close_contact.auth_seq_id_2    246 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 41  ? ? -122.15 -52.06  
2 1 HIS A 71  ? ? -123.52 -52.33  
3 1 HIS A 171 ? ? -123.70 -116.62 
4 1 HIS A 172 ? ? -106.20 75.48   
5 1 ASP A 173 ? ? -46.02  90.74   
6 1 ARG A 187 ? ? 71.55   -10.37  
# 
_pdbx_unobs_or_zero_occ_atoms.id               1 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag     N 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id     DIC 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id      244 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id     CL1 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id     ? 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id    B 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id    DIC 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id     1 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id    CL1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 3,4-DICHLOROISOCOUMARIN DIC 
3 'OXYGEN ATOM'           O   
4 water                   HOH 
#