data_1DIY
# 
_entry.id   1DIY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DIY         
RCSB  RCSB010117   
WWPDB D_1000010117 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CVU 
;CRYSTAL STRUCTURE OF ARACHIDONIC ACID BOUND TO THE CYCLOOXYGENASE ACTIVE SITE 
OF COX-2
;
unspecified 
PDB 1DDX 
;CRYSTAL STRUCTURE OF A MIXTURE OF ARACHIDONIC ACID AND PROSTAGLANDIN BOUND TO 
THE CYCLOOXYGENASE ACTIVE SITE OF COX-2: PROSTAGLANDIN STRUCTURE
;
unspecified 
PDB 1PRH 'CRYSTAL STRUCTURE OF THE MEMBRANE PROTEIN PROSTAGLANDIN H2 SYNTHASE-1' unspecified 
PDB 1PTH 
;THE STRUCTURAL BASIS OF ASPIRIN ACTIVITY INFERRED FROM THE CRYSTAL STRUCTURE 
OF INACTIVATED PROSTAGLANDIN H2 SYNTHASE-1
;
unspecified 
PDB 1PGE 
;SYNTHESIS AND USE OF IODINATED NONSTEROIDAL ANTIINFLAMMATORY DRUG ANALOGS AS 
CRYSTALLOGRAPHIC PROBES OF THE PROSTAGLANDIN H2 SYNTHASE-1 CYCLOOXYGENASE 
ACTIVE SITE
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DIY 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Malkowski, M.G.' 1 
'Ginell, S.L.'    2 
'Smith, W.L.'     3 
'Garavito, R.M.'  4 
# 
_citation.id                        primary 
_citation.title                     'The productive conformation of arachidonic acid bound to prostaglandin synthase.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            289 
_citation.page_first                1933 
_citation.page_last                 1937 
_citation.year                      2000 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10988074 
_citation.pdbx_database_id_DOI      10.1126/science.289.5486.1933 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Malkowski, M.G.' 1 ? 
primary 'Ginell, S.L.'    2 ? 
primary 'Smith, W.L.'     3 ? 
primary 'Garavito, R.M.'  4 ? 
# 
_cell.entry_id           1DIY 
_cell.length_a           182.10 
_cell.length_b           182.10 
_cell.length_c           103.64 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DIY 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PROSTAGLANDIN H2 SYNTHASE-1' 63724.141 1   1.14.99.1 ? ? ? 
2 branched    man '2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
3 branched    man 
;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1   ?         ? ? ? 
4 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   1   ? ? ? ? 
5 non-polymer syn 'octyl beta-D-glucopyranoside' 292.369   4   ?         ? ? ? 
6 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING CO' 619.575   1   ?         ? ? ? 
7 non-polymer syn 'ARACHIDONIC ACID' 304.467   1   ?         ? ? ? 
8 water       nat water 18.015    109 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDT
LMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDP
QGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPV
LMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQ
LSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPA
GRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEK
CHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDT
LMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDP
QGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPV
LMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQ
LSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPA
GRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEK
CHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   VAL n 
1 3   ASN n 
1 4   PRO n 
1 5   CYS n 
1 6   CYS n 
1 7   TYR n 
1 8   TYR n 
1 9   PRO n 
1 10  CYS n 
1 11  GLN n 
1 12  HIS n 
1 13  GLN n 
1 14  GLY n 
1 15  ILE n 
1 16  CYS n 
1 17  VAL n 
1 18  ARG n 
1 19  PHE n 
1 20  GLY n 
1 21  LEU n 
1 22  ASP n 
1 23  ARG n 
1 24  TYR n 
1 25  GLN n 
1 26  CYS n 
1 27  ASP n 
1 28  CYS n 
1 29  THR n 
1 30  ARG n 
1 31  THR n 
1 32  GLY n 
1 33  TYR n 
1 34  SER n 
1 35  GLY n 
1 36  PRO n 
1 37  ASN n 
1 38  CYS n 
1 39  THR n 
1 40  ILE n 
1 41  PRO n 
1 42  GLU n 
1 43  ILE n 
1 44  TRP n 
1 45  THR n 
1 46  TRP n 
1 47  LEU n 
1 48  ARG n 
1 49  THR n 
1 50  THR n 
1 51  LEU n 
1 52  ARG n 
1 53  PRO n 
1 54  SER n 
1 55  PRO n 
1 56  SER n 
1 57  PHE n 
1 58  ILE n 
1 59  HIS n 
1 60  PHE n 
1 61  LEU n 
1 62  LEU n 
1 63  THR n 
1 64  HIS n 
1 65  GLY n 
1 66  ARG n 
1 67  TRP n 
1 68  LEU n 
1 69  TRP n 
1 70  ASP n 
1 71  PHE n 
1 72  VAL n 
1 73  ASN n 
1 74  ALA n 
1 75  THR n 
1 76  PHE n 
1 77  ILE n 
1 78  ARG n 
1 79  ASP n 
1 80  THR n 
1 81  LEU n 
1 82  MET n 
1 83  ARG n 
1 84  LEU n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  VAL n 
1 89  ARG n 
1 90  SER n 
1 91  ASN n 
1 92  LEU n 
1 93  ILE n 
1 94  PRO n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  THR n 
1 99  TYR n 
1 100 ASN n 
1 101 ILE n 
1 102 ALA n 
1 103 HIS n 
1 104 ASP n 
1 105 TYR n 
1 106 ILE n 
1 107 SER n 
1 108 TRP n 
1 109 GLU n 
1 110 SER n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 VAL n 
1 115 SER n 
1 116 TYR n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 ILE n 
1 121 LEU n 
1 122 PRO n 
1 123 SER n 
1 124 VAL n 
1 125 PRO n 
1 126 ARG n 
1 127 ASP n 
1 128 CYS n 
1 129 PRO n 
1 130 THR n 
1 131 PRO n 
1 132 MET n 
1 133 GLY n 
1 134 THR n 
1 135 LYS n 
1 136 GLY n 
1 137 LYS n 
1 138 LYS n 
1 139 GLN n 
1 140 LEU n 
1 141 PRO n 
1 142 ASP n 
1 143 ALA n 
1 144 GLU n 
1 145 PHE n 
1 146 LEU n 
1 147 SER n 
1 148 ARG n 
1 149 ARG n 
1 150 PHE n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 LYS n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 THR n 
1 164 ASN n 
1 165 LEU n 
1 166 MET n 
1 167 PHE n 
1 168 ALA n 
1 169 PHE n 
1 170 PHE n 
1 171 ALA n 
1 172 GLN n 
1 173 HIS n 
1 174 PHE n 
1 175 THR n 
1 176 HIS n 
1 177 GLN n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 THR n 
1 182 SER n 
1 183 GLY n 
1 184 LYS n 
1 185 MET n 
1 186 GLY n 
1 187 PRO n 
1 188 GLY n 
1 189 PHE n 
1 190 THR n 
1 191 LYS n 
1 192 ALA n 
1 193 LEU n 
1 194 GLY n 
1 195 HIS n 
1 196 GLY n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 GLY n 
1 201 HIS n 
1 202 ILE n 
1 203 TYR n 
1 204 GLY n 
1 205 ASP n 
1 206 ASN n 
1 207 LEU n 
1 208 GLU n 
1 209 ARG n 
1 210 GLN n 
1 211 TYR n 
1 212 GLN n 
1 213 LEU n 
1 214 ARG n 
1 215 LEU n 
1 216 PHE n 
1 217 LYS n 
1 218 ASP n 
1 219 GLY n 
1 220 LYS n 
1 221 LEU n 
1 222 LYS n 
1 223 TYR n 
1 224 GLN n 
1 225 MET n 
1 226 LEU n 
1 227 ASN n 
1 228 GLY n 
1 229 GLU n 
1 230 VAL n 
1 231 TYR n 
1 232 PRO n 
1 233 PRO n 
1 234 SER n 
1 235 VAL n 
1 236 GLU n 
1 237 GLU n 
1 238 ALA n 
1 239 PRO n 
1 240 VAL n 
1 241 LEU n 
1 242 MET n 
1 243 HIS n 
1 244 TYR n 
1 245 PRO n 
1 246 ARG n 
1 247 GLY n 
1 248 ILE n 
1 249 PRO n 
1 250 PRO n 
1 251 GLN n 
1 252 SER n 
1 253 GLN n 
1 254 MET n 
1 255 ALA n 
1 256 VAL n 
1 257 GLY n 
1 258 GLN n 
1 259 GLU n 
1 260 VAL n 
1 261 PHE n 
1 262 GLY n 
1 263 LEU n 
1 264 LEU n 
1 265 PRO n 
1 266 GLY n 
1 267 LEU n 
1 268 MET n 
1 269 LEU n 
1 270 TYR n 
1 271 ALA n 
1 272 THR n 
1 273 ILE n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 GLU n 
1 278 HIS n 
1 279 ASN n 
1 280 ARG n 
1 281 VAL n 
1 282 CYS n 
1 283 ASP n 
1 284 LEU n 
1 285 LEU n 
1 286 LYS n 
1 287 ALA n 
1 288 GLU n 
1 289 HIS n 
1 290 PRO n 
1 291 THR n 
1 292 TRP n 
1 293 GLY n 
1 294 ASP n 
1 295 GLU n 
1 296 GLN n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
1 300 THR n 
1 301 ALA n 
1 302 ARG n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 ILE n 
1 307 GLY n 
1 308 GLU n 
1 309 THR n 
1 310 ILE n 
1 311 LYS n 
1 312 ILE n 
1 313 VAL n 
1 314 ILE n 
1 315 GLU n 
1 316 GLU n 
1 317 TYR n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 LEU n 
1 322 SER n 
1 323 GLY n 
1 324 TYR n 
1 325 PHE n 
1 326 LEU n 
1 327 GLN n 
1 328 LEU n 
1 329 LYS n 
1 330 PHE n 
1 331 ASP n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 PHE n 
1 337 GLY n 
1 338 ALA n 
1 339 GLN n 
1 340 PHE n 
1 341 GLN n 
1 342 TYR n 
1 343 ARG n 
1 344 ASN n 
1 345 ARG n 
1 346 ILE n 
1 347 ALA n 
1 348 MET n 
1 349 GLU n 
1 350 PHE n 
1 351 ASN n 
1 352 GLN n 
1 353 LEU n 
1 354 TYR n 
1 355 HIS n 
1 356 TRP n 
1 357 HIS n 
1 358 PRO n 
1 359 LEU n 
1 360 MET n 
1 361 PRO n 
1 362 ASP n 
1 363 SER n 
1 364 PHE n 
1 365 ARG n 
1 366 VAL n 
1 367 GLY n 
1 368 PRO n 
1 369 GLN n 
1 370 ASP n 
1 371 TYR n 
1 372 SER n 
1 373 TYR n 
1 374 GLU n 
1 375 GLN n 
1 376 PHE n 
1 377 LEU n 
1 378 PHE n 
1 379 ASN n 
1 380 THR n 
1 381 SER n 
1 382 MET n 
1 383 LEU n 
1 384 VAL n 
1 385 ASP n 
1 386 TYR n 
1 387 GLY n 
1 388 VAL n 
1 389 GLU n 
1 390 ALA n 
1 391 LEU n 
1 392 VAL n 
1 393 ASP n 
1 394 ALA n 
1 395 PHE n 
1 396 SER n 
1 397 ARG n 
1 398 GLN n 
1 399 PRO n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 ILE n 
1 404 GLY n 
1 405 GLY n 
1 406 GLY n 
1 407 ARG n 
1 408 ASN n 
1 409 ILE n 
1 410 ASP n 
1 411 HIS n 
1 412 HIS n 
1 413 ILE n 
1 414 LEU n 
1 415 HIS n 
1 416 VAL n 
1 417 ALA n 
1 418 VAL n 
1 419 ASP n 
1 420 VAL n 
1 421 ILE n 
1 422 LYS n 
1 423 GLU n 
1 424 SER n 
1 425 ARG n 
1 426 VAL n 
1 427 LEU n 
1 428 ARG n 
1 429 LEU n 
1 430 GLN n 
1 431 PRO n 
1 432 PHE n 
1 433 ASN n 
1 434 GLU n 
1 435 TYR n 
1 436 ARG n 
1 437 LYS n 
1 438 ARG n 
1 439 PHE n 
1 440 GLY n 
1 441 MET n 
1 442 LYS n 
1 443 PRO n 
1 444 TYR n 
1 445 THR n 
1 446 SER n 
1 447 PHE n 
1 448 GLN n 
1 449 GLU n 
1 450 LEU n 
1 451 THR n 
1 452 GLY n 
1 453 GLU n 
1 454 LYS n 
1 455 GLU n 
1 456 MET n 
1 457 ALA n 
1 458 ALA n 
1 459 GLU n 
1 460 LEU n 
1 461 GLU n 
1 462 GLU n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 ASP n 
1 467 ILE n 
1 468 ASP n 
1 469 ALA n 
1 470 LEU n 
1 471 GLU n 
1 472 PHE n 
1 473 TYR n 
1 474 PRO n 
1 475 GLY n 
1 476 LEU n 
1 477 LEU n 
1 478 LEU n 
1 479 GLU n 
1 480 LYS n 
1 481 CYS n 
1 482 HIS n 
1 483 PRO n 
1 484 ASN n 
1 485 SER n 
1 486 ILE n 
1 487 PHE n 
1 488 GLY n 
1 489 GLU n 
1 490 SER n 
1 491 MET n 
1 492 ILE n 
1 493 GLU n 
1 494 MET n 
1 495 GLY n 
1 496 ALA n 
1 497 PRO n 
1 498 PHE n 
1 499 SER n 
1 500 LEU n 
1 501 LYS n 
1 502 GLY n 
1 503 LEU n 
1 504 LEU n 
1 505 GLY n 
1 506 ASN n 
1 507 PRO n 
1 508 ILE n 
1 509 CYS n 
1 510 SER n 
1 511 PRO n 
1 512 GLU n 
1 513 TYR n 
1 514 TRP n 
1 515 LYS n 
1 516 ALA n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLY n 
1 521 GLY n 
1 522 GLU n 
1 523 VAL n 
1 524 GLY n 
1 525 PHE n 
1 526 ASN n 
1 527 LEU n 
1 528 VAL n 
1 529 LYS n 
1 530 THR n 
1 531 ALA n 
1 532 THR n 
1 533 LEU n 
1 534 LYS n 
1 535 LYS n 
1 536 LEU n 
1 537 VAL n 
1 538 CYS n 
1 539 LEU n 
1 540 ASN n 
1 541 THR n 
1 542 LYS n 
1 543 THR n 
1 544 CYS n 
1 545 PRO n 
1 546 TYR n 
1 547 VAL n 
1 548 SER n 
1 549 PHE n 
1 550 HIS n 
1 551 VAL n 
1 552 PRO n 
1 553 ASP n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                sheep 
_entity_src_nat.pdbx_organism_scientific   'Ovis aries' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9940 
_entity_src_nat.genus                      Ovis 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'SEMINAL VESSICLE' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAA31511 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          165844 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DIY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 553 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             165844 
_struct_ref_seq.db_align_beg                  31 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  583 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       32 
_struct_ref_seq.pdbx_auth_seq_align_end       584 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACD non-polymer                   . 'ARACHIDONIC ACID'                        ? 'C20 H32 O2'       304.467 
ALA 'L-peptide linking'           y ALANINE                                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking'           y ARGININE                                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'       133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                      ? 'C6 H12 O6'        180.156 
BOG D-saccharide                  n 'octyl beta-D-glucopyranoside'            ? 'C14 H28 O6'       292.369 
COH non-polymer                   . 'PROTOPORPHYRIN IX CONTAINING CO'         ? 'C34 H32 Co N4 O4' 619.575 
CYS 'L-peptide linking'           y CYSTEINE                                  ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'             y GLYCINE                                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking'           y HISTIDINE                                 ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer                   . WATER                                     ? 'H2 O'             18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking'           y LEUCINE                                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking'           y LYSINE                                    ? 'C6 H15 N2 O2 1'   147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                     ? 'C6 H12 O6'        180.156 
MET 'L-peptide linking'           y METHIONINE                                ? 'C5 H11 N O2 S'    149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose  ? 'C8 H15 N O6'      221.208 
NDG 'D-saccharide, alpha linking' . 2-acetamido-2-deoxy-alpha-D-glucopyranose ? 'C8 H15 N O6'      221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking'           y PROLINE                                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking'           y SERINE                                    ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking'           y THREONINE                                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking'           y TYROSINE                                  ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking'           y VALINE                                    ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1DIY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.10 
_exptl_crystal.density_percent_sol   69 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'LITHIUM CHLORIDE, SODIUM AZIDE, SODIUM CITRATE, N-OCTYL GLUCOSIDE, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   1999-08-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03321 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.03321 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DIY 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             9.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   19163 
_reflns.number_all                   630793 
_reflns.percent_possible_obs         93.8 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.1 
_reflns_shell.percent_possible_all   81.4 
_reflns_shell.Rmerge_I_obs           0.347 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1DIY 
_refine.ls_number_reflns_obs                     18519 
_refine.ls_number_reflns_all                     19163 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             9.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    93.1 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.29 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  880 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;USED THE MLF TARGET IN CNS UTILIZING BULK SOLVENT AND OVERALL B-FACTOR  
CORRECTIONS
;
_refine.pdbx_starting_model                      '1PRH MOLECULE B, PROTEIN ONLY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            '5% OF THE TOTAL REFLECTIONS WERE SELECTED BY CNS USING THE SCRIPT MAKE_CV.INP' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1DIY 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_sigma_a_obs             0.54 
_refine_analyze.Luzzati_d_res_low_obs           6.0 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.69 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4409 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         262 
_refine_hist.number_atoms_solvent             109 
_refine_hist.number_atoms_total               4780 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        9.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009  ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.51   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.960 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.040  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?      ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?      ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.0 
_refine_ls_shell.d_res_low                        3.1 
_refine_ls_shell.number_reflns_R_work             1468 
_refine_ls_shell.R_factor_R_work                  0.325 
_refine_ls_shell.percent_reflns_obs               78 
_refine_ls_shell.R_factor_R_free                  0.415 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.7 
_refine_ls_shell.number_reflns_R_free             72 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       protein.top 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1DIY 
_struct.title                     'CRYSTAL STRUCTURE OF ARACHIDONIC ACID BOUND IN THE CYCLOOXYGENASE ACTIVE SITE OF PGHS-1' 
_struct.pdbx_descriptor           'PROSTAGLANDIN H2 SYNTHASE-1 (E.C.1.14.99.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DIY 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'ARACHIDONIC ACID, MEMBRANE PROTEIN, PEROXIDASE, DIOXYGENASE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 3   ? TYR A 7   ? ASN A 34  TYR A 38  5 ? 5  
HELX_P HELX_P2  2  GLU A 42  ? ARG A 52  ? GLU A 73  ARG A 83  1 ? 11 
HELX_P HELX_P3  3  SER A 54  ? THR A 63  ? SER A 85  THR A 94  1 ? 10 
HELX_P HELX_P4  4  TRP A 67  ? ALA A 74  ? TRP A 98  ALA A 105 1 ? 8  
HELX_P HELX_P5  5  PHE A 76  ? ASN A 91  ? PHE A 107 ASN A 122 1 ? 16 
HELX_P HELX_P6  6  SER A 107 ? ASN A 113 ? SER A 138 ASN A 144 1 ? 7  
HELX_P HELX_P7  7  ASP A 142 ? LEU A 151 ? ASP A 173 LEU A 182 1 ? 10 
HELX_P HELX_P8  8  ASN A 164 ? HIS A 176 ? ASN A 195 HIS A 207 1 ? 13 
HELX_P HELX_P9  9  ASN A 206 ? ARG A 214 ? ASN A 237 ARG A 245 1 ? 9  
HELX_P HELX_P10 10 LEU A 264 ? HIS A 289 ? LEU A 295 HIS A 320 1 ? 26 
HELX_P HELX_P11 11 GLY A 293 ? GLU A 316 ? GLY A 324 GLU A 347 1 ? 24 
HELX_P HELX_P12 12 GLU A 316 ? GLY A 323 ? GLU A 347 GLY A 354 1 ? 8  
HELX_P HELX_P13 13 ASP A 331 ? PHE A 336 ? ASP A 362 PHE A 367 5 ? 6  
HELX_P HELX_P14 14 ALA A 347 ? TYR A 354 ? ALA A 378 TYR A 385 1 ? 8  
HELX_P HELX_P15 15 HIS A 355 ? HIS A 355 ? HIS A 386 HIS A 386 5 ? 1  
HELX_P HELX_P16 16 TRP A 356 ? MET A 360 ? TRP A 387 MET A 391 5 ? 5  
HELX_P HELX_P17 17 SER A 372 ? LEU A 377 ? SER A 403 LEU A 408 1 ? 6  
HELX_P HELX_P18 18 SER A 381 ? GLY A 387 ? SER A 412 GLY A 418 1 ? 7  
HELX_P HELX_P19 19 GLY A 387 ? GLN A 398 ? GLY A 418 GLN A 429 1 ? 12 
HELX_P HELX_P20 20 ILE A 413 ? ARG A 428 ? ILE A 444 ARG A 459 1 ? 16 
HELX_P HELX_P21 21 PRO A 431 ? PHE A 439 ? PRO A 462 PHE A 470 1 ? 9  
HELX_P HELX_P22 22 SER A 446 ? THR A 451 ? SER A 477 THR A 482 1 ? 6  
HELX_P HELX_P23 23 LYS A 454 ? GLY A 465 ? LYS A 485 GLY A 496 1 ? 12 
HELX_P HELX_P24 24 ASP A 466 ? LEU A 470 ? ASP A 497 LEU A 501 5 ? 5  
HELX_P HELX_P25 25 GLU A 471 ? GLU A 479 ? GLU A 502 GLU A 510 1 ? 9  
HELX_P HELX_P26 26 GLY A 488 ? GLY A 505 ? GLY A 519 GLY A 536 1 ? 18 
HELX_P HELX_P27 27 ASN A 506 ? SER A 510 ? ASN A 537 SER A 541 5 ? 5  
HELX_P HELX_P28 28 LYS A 515 ? PHE A 519 ? LYS A 546 PHE A 550 5 ? 5  
HELX_P HELX_P29 29 GLY A 521 ? THR A 530 ? GLY A 552 THR A 561 1 ? 10 
HELX_P HELX_P30 30 THR A 532 ? LEU A 539 ? THR A 563 LEU A 570 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 5   SG  ? ? ? 1_555 A CYS 16  SG ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf2 disulf ?    ? A CYS 6   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 37  A CYS 159 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf3 disulf ?    ? A CYS 10  SG  ? ? ? 1_555 A CYS 26  SG ? ? A CYS 41  A CYS 57  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf4 disulf ?    ? A CYS 28  SG  ? ? ? 1_555 A CYS 38  SG ? ? A CYS 59  A CYS 69  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf5 disulf ?    ? A CYS 538 SG  ? ? ? 1_555 A CYS 544 SG ? ? A CYS 569 A CYS 575 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
covale1 covale one  ? A ASN 37  ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 68  B NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale2 covale one  ? A ASN 113 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 144 C NAG 1   1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale3 covale one  ? A ASN 379 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 410 D NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B NDG .   C1 ? ? B NAG 1   B NDG 2   1_555 ? ? ? ? ? ? ? 1.406 ? ?               
covale5 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.398 ? ?               
covale6 covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.403 ? ?               
covale7 covale both ? C BMA .   O6  ? ? ? 1_555 C BMA .   C1 ? ? C BMA 3   C BMA 4   1_555 ? ? ? ? ? ? ? 1.407 ? ?               
covale8 covale both ? C BMA .   O3  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 4   C MAN 5   1_555 ? ? ? ? ? ? ? 1.410 ? ?               
covale9 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.386 ? ?               
metalc1 metalc ?    ? A HIS 357 NE2 ? ? ? 1_555 I COH .   CO ? ? A HIS 388 A COH 601 1_555 ? ? ? ? ? ? ? 2.162 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           95 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            126 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    96 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     127 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 15  ? PHE A 19  ? ILE A 46  PHE A 50  
A 2 ARG A 23  ? ASP A 27  ? ARG A 54  ASP A 58  
B 1 TYR A 33  ? SER A 34  ? TYR A 64  SER A 65  
B 2 ILE A 40  ? PRO A 41  ? ILE A 71  PRO A 72  
C 1 GLN A 224 ? LEU A 226 ? GLN A 255 LEU A 257 
C 2 GLU A 229 ? TYR A 231 ? GLU A 260 TYR A 262 
D 1 PHE A 364 ? VAL A 366 ? PHE A 395 VAL A 397 
D 2 GLN A 369 ? TYR A 371 ? GLN A 400 TYR A 402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 19  ? N PHE A 50  O ARG A 23  ? O ARG A 54  
B 1 2 O SER A 34  ? O SER A 65  N ILE A 40  ? N ILE A 71  
C 1 2 N LEU A 226 ? N LEU A 257 O GLU A 229 ? O GLU A 260 
D 1 2 N VAL A 366 ? N VAL A 397 O GLN A 369 ? O GLN A 400 
# 
_database_PDB_matrix.entry_id          1DIY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DIY 
_atom_sites.fract_transf_matrix[1][1]   0.005491 
_atom_sites.fract_transf_matrix[1][2]   0.003171 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006341 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009649 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CO 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 1   ? 209.692 116.514 -38.249 1.00 103.33 ? 32  PRO A N     1 
ATOM   2    C  CA    . PRO A 1 1   ? 210.828 117.486 -38.116 1.00 103.33 ? 32  PRO A CA    1 
ATOM   3    C  C     . PRO A 1 1   ? 212.173 116.756 -38.308 1.00 103.33 ? 32  PRO A C     1 
ATOM   4    O  O     . PRO A 1 1   ? 212.461 115.771 -37.600 1.00 103.33 ? 32  PRO A O     1 
ATOM   5    C  CB    . PRO A 1 1   ? 210.757 118.092 -36.707 1.00 64.93  ? 32  PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 1   ? 209.344 117.662 -36.212 1.00 64.93  ? 32  PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 1   ? 209.023 116.332 -36.943 1.00 64.93  ? 32  PRO A CD    1 
ATOM   8    N  N     . VAL A 1 2   ? 212.994 117.224 -39.248 1.00 64.43  ? 33  VAL A N     1 
ATOM   9    C  CA    . VAL A 1 2   ? 214.293 116.586 -39.487 1.00 64.43  ? 33  VAL A CA    1 
ATOM   10   C  C     . VAL A 1 2   ? 215.321 116.910 -38.397 1.00 64.43  ? 33  VAL A C     1 
ATOM   11   O  O     . VAL A 1 2   ? 215.627 118.079 -38.149 1.00 64.43  ? 33  VAL A O     1 
ATOM   12   C  CB    . VAL A 1 2   ? 214.878 116.999 -40.850 1.00 60.46  ? 33  VAL A CB    1 
ATOM   13   C  CG1   . VAL A 1 2   ? 214.005 116.458 -41.955 1.00 60.46  ? 33  VAL A CG1   1 
ATOM   14   C  CG2   . VAL A 1 2   ? 214.970 118.511 -40.951 1.00 60.46  ? 33  VAL A CG2   1 
ATOM   15   N  N     . ASN A 1 3   ? 215.845 115.865 -37.755 1.00 43.46  ? 34  ASN A N     1 
ATOM   16   C  CA    . ASN A 1 3   ? 216.845 115.995 -36.691 1.00 43.46  ? 34  ASN A CA    1 
ATOM   17   C  C     . ASN A 1 3   ? 217.968 116.929 -37.123 1.00 43.46  ? 34  ASN A C     1 
ATOM   18   O  O     . ASN A 1 3   ? 218.875 116.518 -37.842 1.00 43.46  ? 34  ASN A O     1 
ATOM   19   C  CB    . ASN A 1 3   ? 217.411 114.610 -36.366 1.00 57.32  ? 34  ASN A CB    1 
ATOM   20   C  CG    . ASN A 1 3   ? 218.473 114.646 -35.289 1.00 57.32  ? 34  ASN A CG    1 
ATOM   21   O  OD1   . ASN A 1 3   ? 218.332 115.349 -34.293 1.00 57.32  ? 34  ASN A OD1   1 
ATOM   22   N  ND2   . ASN A 1 3   ? 219.538 113.869 -35.477 1.00 57.32  ? 34  ASN A ND2   1 
ATOM   23   N  N     . PRO A 1 4   ? 217.937 118.195 -36.672 1.00 36.00  ? 35  PRO A N     1 
ATOM   24   C  CA    . PRO A 1 4   ? 218.979 119.145 -37.061 1.00 36.00  ? 35  PRO A CA    1 
ATOM   25   C  C     . PRO A 1 4   ? 220.409 118.624 -37.013 1.00 36.00  ? 35  PRO A C     1 
ATOM   26   O  O     . PRO A 1 4   ? 221.179 118.900 -37.922 1.00 36.00  ? 35  PRO A O     1 
ATOM   27   C  CB    . PRO A 1 4   ? 218.731 120.343 -36.140 1.00 36.94  ? 35  PRO A CB    1 
ATOM   28   C  CG    . PRO A 1 4   ? 218.074 119.751 -34.966 1.00 36.94  ? 35  PRO A CG    1 
ATOM   29   C  CD    . PRO A 1 4   ? 217.134 118.738 -35.567 1.00 36.94  ? 35  PRO A CD    1 
ATOM   30   N  N     . CYS A 1 5   ? 220.777 117.859 -35.988 1.00 41.09  ? 36  CYS A N     1 
ATOM   31   C  CA    . CYS A 1 5   ? 222.145 117.347 -35.938 1.00 41.09  ? 36  CYS A CA    1 
ATOM   32   C  C     . CYS A 1 5   ? 222.466 116.512 -37.163 1.00 41.09  ? 36  CYS A C     1 
ATOM   33   O  O     . CYS A 1 5   ? 223.549 115.951 -37.262 1.00 41.09  ? 36  CYS A O     1 
ATOM   34   C  CB    . CYS A 1 5   ? 222.390 116.515 -34.679 1.00 85.51  ? 36  CYS A CB    1 
ATOM   35   S  SG    . CYS A 1 5   ? 222.276 117.479 -33.124 1.00 85.51  ? 36  CYS A SG    1 
ATOM   36   N  N     . CYS A 1 6   ? 221.518 116.435 -38.092 1.00 32.74  ? 37  CYS A N     1 
ATOM   37   C  CA    . CYS A 1 6   ? 221.694 115.682 -39.329 1.00 32.74  ? 37  CYS A CA    1 
ATOM   38   C  C     . CYS A 1 6   ? 222.498 116.505 -40.307 1.00 32.74  ? 37  CYS A C     1 
ATOM   39   O  O     . CYS A 1 6   ? 222.987 115.997 -41.305 1.00 32.74  ? 37  CYS A O     1 
ATOM   40   C  CB    . CYS A 1 6   ? 220.340 115.346 -39.966 1.00 60.94  ? 37  CYS A CB    1 
ATOM   41   S  SG    . CYS A 1 6   ? 219.391 114.004 -39.167 1.00 60.94  ? 37  CYS A SG    1 
ATOM   42   N  N     . TYR A 1 7   ? 222.621 117.788 -40.014 1.00 30.71  ? 38  TYR A N     1 
ATOM   43   C  CA    . TYR A 1 7   ? 223.364 118.688 -40.875 1.00 30.71  ? 38  TYR A CA    1 
ATOM   44   C  C     . TYR A 1 7   ? 224.777 118.857 -40.356 1.00 30.71  ? 38  TYR A C     1 
ATOM   45   O  O     . TYR A 1 7   ? 225.646 119.359 -41.060 1.00 30.71  ? 38  TYR A O     1 
ATOM   46   C  CB    . TYR A 1 7   ? 222.688 120.061 -40.940 1.00 49.26  ? 38  TYR A CB    1 
ATOM   47   C  CG    . TYR A 1 7   ? 221.279 120.034 -41.480 1.00 49.26  ? 38  TYR A CG    1 
ATOM   48   C  CD1   . TYR A 1 7   ? 220.187 120.045 -40.621 1.00 49.26  ? 38  TYR A CD1   1 
ATOM   49   C  CD2   . TYR A 1 7   ? 221.039 119.997 -42.852 1.00 49.26  ? 38  TYR A CD2   1 
ATOM   50   C  CE1   . TYR A 1 7   ? 218.892 120.024 -41.109 1.00 49.26  ? 38  TYR A CE1   1 
ATOM   51   C  CE2   . TYR A 1 7   ? 219.755 119.973 -43.351 1.00 49.26  ? 38  TYR A CE2   1 
ATOM   52   C  CZ    . TYR A 1 7   ? 218.681 119.988 -42.475 1.00 49.26  ? 38  TYR A CZ    1 
ATOM   53   O  OH    . TYR A 1 7   ? 217.391 119.976 -42.963 1.00 49.26  ? 38  TYR A OH    1 
ATOM   54   N  N     . TYR A 1 8   ? 225.002 118.438 -39.118 1.00 39.29  ? 39  TYR A N     1 
ATOM   55   C  CA    . TYR A 1 8   ? 226.316 118.570 -38.530 1.00 39.29  ? 39  TYR A CA    1 
ATOM   56   C  C     . TYR A 1 8   ? 226.624 120.066 -38.485 1.00 39.29  ? 39  TYR A C     1 
ATOM   57   O  O     . TYR A 1 8   ? 227.629 120.526 -39.019 1.00 39.29  ? 39  TYR A O     1 
ATOM   58   C  CB    . TYR A 1 8   ? 227.343 117.851 -39.403 1.00 32.07  ? 39  TYR A CB    1 
ATOM   59   C  CG    . TYR A 1 8   ? 227.048 116.397 -39.697 1.00 32.07  ? 39  TYR A CG    1 
ATOM   60   C  CD1   . TYR A 1 8   ? 226.950 115.459 -38.674 1.00 32.07  ? 39  TYR A CD1   1 
ATOM   61   C  CD2   . TYR A 1 8   ? 226.956 115.945 -41.010 1.00 32.07  ? 39  TYR A CD2   1 
ATOM   62   C  CE1   . TYR A 1 8   ? 226.780 114.112 -38.953 1.00 32.07  ? 39  TYR A CE1   1 
ATOM   63   C  CE2   . TYR A 1 8   ? 226.789 114.604 -41.302 1.00 32.07  ? 39  TYR A CE2   1 
ATOM   64   C  CZ    . TYR A 1 8   ? 226.706 113.690 -40.273 1.00 32.07  ? 39  TYR A CZ    1 
ATOM   65   O  OH    . TYR A 1 8   ? 226.583 112.349 -40.572 1.00 32.07  ? 39  TYR A OH    1 
ATOM   66   N  N     . PRO A 1 9   ? 225.760 120.844 -37.831 1.00 44.08  ? 40  PRO A N     1 
ATOM   67   C  CA    . PRO A 1 9   ? 225.915 122.293 -37.712 1.00 44.08  ? 40  PRO A CA    1 
ATOM   68   C  C     . PRO A 1 9   ? 227.142 122.717 -36.921 1.00 44.08  ? 40  PRO A C     1 
ATOM   69   O  O     . PRO A 1 9   ? 227.878 123.613 -37.339 1.00 44.08  ? 40  PRO A O     1 
ATOM   70   C  CB    . PRO A 1 9   ? 224.629 122.708 -37.025 1.00 39.02  ? 40  PRO A CB    1 
ATOM   71   C  CG    . PRO A 1 9   ? 224.441 121.603 -36.068 1.00 39.02  ? 40  PRO A CG    1 
ATOM   72   C  CD    . PRO A 1 9   ? 224.729 120.365 -36.899 1.00 39.02  ? 40  PRO A CD    1 
ATOM   73   N  N     . CYS A 1 10  ? 227.360 122.075 -35.777 1.00 48.36  ? 41  CYS A N     1 
ATOM   74   C  CA    . CYS A 1 10  ? 228.494 122.410 -34.932 1.00 48.36  ? 41  CYS A CA    1 
ATOM   75   C  C     . CYS A 1 10  ? 229.806 122.117 -35.623 1.00 48.36  ? 41  CYS A C     1 
ATOM   76   O  O     . CYS A 1 10  ? 229.960 121.068 -36.252 1.00 48.36  ? 41  CYS A O     1 
ATOM   77   C  CB    . CYS A 1 10  ? 228.441 121.623 -33.632 1.00 49.05  ? 41  CYS A CB    1 
ATOM   78   S  SG    . CYS A 1 10  ? 226.813 121.642 -32.839 1.00 49.05  ? 41  CYS A SG    1 
ATOM   79   N  N     . GLN A 1 11  ? 230.750 123.046 -35.482 1.00 37.38  ? 42  GLN A N     1 
ATOM   80   C  CA    . GLN A 1 11  ? 232.082 122.925 -36.072 1.00 37.38  ? 42  GLN A CA    1 
ATOM   81   C  C     . GLN A 1 11  ? 233.157 122.847 -34.992 1.00 37.38  ? 42  GLN A C     1 
ATOM   82   O  O     . GLN A 1 11  ? 232.925 123.232 -33.851 1.00 37.38  ? 42  GLN A O     1 
ATOM   83   C  CB    . GLN A 1 11  ? 232.359 124.141 -36.947 1.00 60.23  ? 42  GLN A CB    1 
ATOM   84   C  CG    . GLN A 1 11  ? 231.366 124.333 -38.063 1.00 60.23  ? 42  GLN A CG    1 
ATOM   85   C  CD    . GLN A 1 11  ? 231.580 123.329 -39.167 1.00 60.23  ? 42  GLN A CD    1 
ATOM   86   O  OE1   . GLN A 1 11  ? 230.659 122.598 -39.548 1.00 60.23  ? 42  GLN A OE1   1 
ATOM   87   N  NE2   . GLN A 1 11  ? 232.808 123.282 -39.692 1.00 60.23  ? 42  GLN A NE2   1 
ATOM   88   N  N     . HIS A 1 12  ? 234.328 122.338 -35.354 1.00 43.25  ? 43  HIS A N     1 
ATOM   89   C  CA    . HIS A 1 12  ? 235.470 122.254 -34.432 1.00 43.25  ? 43  HIS A CA    1 
ATOM   90   C  C     . HIS A 1 12  ? 235.313 121.411 -33.183 1.00 43.25  ? 43  HIS A C     1 
ATOM   91   O  O     . HIS A 1 12  ? 235.837 121.760 -32.130 1.00 43.25  ? 43  HIS A O     1 
ATOM   92   C  CB    . HIS A 1 12  ? 235.902 123.659 -34.005 1.00 29.30  ? 43  HIS A CB    1 
ATOM   93   C  CG    . HIS A 1 12  ? 236.206 124.557 -35.154 1.00 29.30  ? 43  HIS A CG    1 
ATOM   94   N  ND1   . HIS A 1 12  ? 237.099 124.213 -36.145 1.00 29.30  ? 43  HIS A ND1   1 
ATOM   95   C  CD2   . HIS A 1 12  ? 235.703 125.762 -35.500 1.00 29.30  ? 43  HIS A CD2   1 
ATOM   96   C  CE1   . HIS A 1 12  ? 237.132 125.167 -37.055 1.00 29.30  ? 43  HIS A CE1   1 
ATOM   97   N  NE2   . HIS A 1 12  ? 236.293 126.119 -36.687 1.00 29.30  ? 43  HIS A NE2   1 
ATOM   98   N  N     . GLN A 1 13  ? 234.597 120.307 -33.304 1.00 41.79  ? 44  GLN A N     1 
ATOM   99   C  CA    . GLN A 1 13  ? 234.393 119.406 -32.186 1.00 41.79  ? 44  GLN A CA    1 
ATOM   100  C  C     . GLN A 1 13  ? 233.365 119.900 -31.194 1.00 41.79  ? 44  GLN A C     1 
ATOM   101  O  O     . GLN A 1 13  ? 233.402 119.548 -30.020 1.00 41.79  ? 44  GLN A O     1 
ATOM   102  C  CB    . GLN A 1 13  ? 235.719 119.139 -31.484 1.00 37.63  ? 44  GLN A CB    1 
ATOM   103  C  CG    . GLN A 1 13  ? 236.723 118.446 -32.365 1.00 37.63  ? 44  GLN A CG    1 
ATOM   104  C  CD    . GLN A 1 13  ? 237.987 118.103 -31.622 1.00 37.63  ? 44  GLN A CD    1 
ATOM   105  O  OE1   . GLN A 1 13  ? 237.939 117.598 -30.501 1.00 37.63  ? 44  GLN A OE1   1 
ATOM   106  N  NE2   . GLN A 1 13  ? 239.131 118.361 -32.242 1.00 37.63  ? 44  GLN A NE2   1 
ATOM   107  N  N     . GLY A 1 14  ? 232.438 120.710 -31.670 1.00 31.79  ? 45  GLY A N     1 
ATOM   108  C  CA    . GLY A 1 14  ? 231.403 121.201 -30.789 1.00 31.79  ? 45  GLY A CA    1 
ATOM   109  C  C     . GLY A 1 14  ? 230.300 120.172 -30.724 1.00 31.79  ? 45  GLY A C     1 
ATOM   110  O  O     . GLY A 1 14  ? 229.814 119.726 -31.757 1.00 31.79  ? 45  GLY A O     1 
ATOM   111  N  N     . ILE A 1 15  ? 229.899 119.790 -29.520 1.00 28.51  ? 46  ILE A N     1 
ATOM   112  C  CA    . ILE A 1 15  ? 228.844 118.798 -29.345 1.00 28.51  ? 46  ILE A CA    1 
ATOM   113  C  C     . ILE A 1 15  ? 227.428 119.274 -29.737 1.00 28.51  ? 46  ILE A C     1 
ATOM   114  O  O     . ILE A 1 15  ? 226.933 120.285 -29.245 1.00 28.51  ? 46  ILE A O     1 
ATOM   115  C  CB    . ILE A 1 15  ? 228.854 118.279 -27.886 1.00 30.79  ? 46  ILE A CB    1 
ATOM   116  C  CG1   . ILE A 1 15  ? 229.877 117.153 -27.740 1.00 30.79  ? 46  ILE A CG1   1 
ATOM   117  C  CG2   . ILE A 1 15  ? 227.500 117.770 -27.502 1.00 30.79  ? 46  ILE A CG2   1 
ATOM   118  C  CD1   . ILE A 1 15  ? 231.234 117.478 -28.297 1.00 30.79  ? 46  ILE A CD1   1 
ATOM   119  N  N     . CYS A 1 16  ? 226.787 118.529 -30.637 1.00 46.41  ? 47  CYS A N     1 
ATOM   120  C  CA    . CYS A 1 16  ? 225.433 118.844 -31.098 1.00 46.41  ? 47  CYS A CA    1 
ATOM   121  C  C     . CYS A 1 16  ? 224.380 118.227 -30.178 1.00 46.41  ? 47  CYS A C     1 
ATOM   122  O  O     . CYS A 1 16  ? 224.339 117.006 -29.996 1.00 46.41  ? 47  CYS A O     1 
ATOM   123  C  CB    . CYS A 1 16  ? 225.210 118.315 -32.512 1.00 63.28  ? 47  CYS A CB    1 
ATOM   124  S  SG    . CYS A 1 16  ? 223.678 118.961 -33.263 1.00 63.28  ? 47  CYS A SG    1 
ATOM   125  N  N     . VAL A 1 17  ? 223.519 119.064 -29.612 1.00 32.08  ? 48  VAL A N     1 
ATOM   126  C  CA    . VAL A 1 17  ? 222.500 118.570 -28.703 1.00 32.08  ? 48  VAL A CA    1 
ATOM   127  C  C     . VAL A 1 17  ? 221.108 119.056 -29.029 1.00 32.08  ? 48  VAL A C     1 
ATOM   128  O  O     . VAL A 1 17  ? 220.886 120.246 -29.222 1.00 32.08  ? 48  VAL A O     1 
ATOM   129  C  CB    . VAL A 1 17  ? 222.801 118.975 -27.265 1.00 24.38  ? 48  VAL A CB    1 
ATOM   130  C  CG1   . VAL A 1 17  ? 221.701 118.485 -26.352 1.00 24.38  ? 48  VAL A CG1   1 
ATOM   131  C  CG2   . VAL A 1 17  ? 224.135 118.416 -26.849 1.00 24.38  ? 48  VAL A CG2   1 
ATOM   132  N  N     . ARG A 1 18  ? 220.167 118.120 -29.071 1.00 34.72  ? 49  ARG A N     1 
ATOM   133  C  CA    . ARG A 1 18  ? 218.775 118.426 -29.360 1.00 34.72  ? 49  ARG A CA    1 
ATOM   134  C  C     . ARG A 1 18  ? 218.108 119.048 -28.152 1.00 34.72  ? 49  ARG A C     1 
ATOM   135  O  O     . ARG A 1 18  ? 218.151 118.495 -27.066 1.00 34.72  ? 49  ARG A O     1 
ATOM   136  C  CB    . ARG A 1 18  ? 218.019 117.153 -29.735 1.00 44.90  ? 49  ARG A CB    1 
ATOM   137  C  CG    . ARG A 1 18  ? 217.783 116.941 -31.219 1.00 44.90  ? 49  ARG A CG    1 
ATOM   138  C  CD    . ARG A 1 18  ? 216.980 115.660 -31.459 1.00 44.90  ? 49  ARG A CD    1 
ATOM   139  N  NE    . ARG A 1 18  ? 216.219 115.695 -32.708 1.00 44.90  ? 49  ARG A NE    1 
ATOM   140  C  CZ    . ARG A 1 18  ? 215.198 116.516 -32.945 1.00 44.90  ? 49  ARG A CZ    1 
ATOM   141  N  NH1   . ARG A 1 18  ? 214.801 117.380 -32.019 1.00 44.90  ? 49  ARG A NH1   1 
ATOM   142  N  NH2   . ARG A 1 18  ? 214.582 116.477 -34.114 1.00 44.90  ? 49  ARG A NH2   1 
ATOM   143  N  N     . PHE A 1 19  ? 217.506 120.209 -28.347 1.00 53.31  ? 50  PHE A N     1 
ATOM   144  C  CA    . PHE A 1 19  ? 216.790 120.901 -27.278 1.00 53.31  ? 50  PHE A CA    1 
ATOM   145  C  C     . PHE A 1 19  ? 215.376 121.126 -27.785 1.00 53.31  ? 50  PHE A C     1 
ATOM   146  O  O     . PHE A 1 19  ? 215.181 121.764 -28.821 1.00 53.31  ? 50  PHE A O     1 
ATOM   147  C  CB    . PHE A 1 19  ? 217.452 122.242 -26.961 1.00 38.44  ? 50  PHE A CB    1 
ATOM   148  C  CG    . PHE A 1 19  ? 218.575 122.132 -25.986 1.00 38.44  ? 50  PHE A CG    1 
ATOM   149  C  CD1   . PHE A 1 19  ? 218.353 122.346 -24.634 1.00 38.44  ? 50  PHE A CD1   1 
ATOM   150  C  CD2   . PHE A 1 19  ? 219.840 121.743 -26.412 1.00 38.44  ? 50  PHE A CD2   1 
ATOM   151  C  CE1   . PHE A 1 19  ? 219.366 122.170 -23.719 1.00 38.44  ? 50  PHE A CE1   1 
ATOM   152  C  CE2   . PHE A 1 19  ? 220.864 121.564 -25.500 1.00 38.44  ? 50  PHE A CE2   1 
ATOM   153  C  CZ    . PHE A 1 19  ? 220.628 121.776 -24.150 1.00 38.44  ? 50  PHE A CZ    1 
ATOM   154  N  N     . GLY A 1 20  ? 214.388 120.594 -27.074 1.00 64.57  ? 51  GLY A N     1 
ATOM   155  C  CA    . GLY A 1 20  ? 213.017 120.748 -27.527 1.00 64.57  ? 51  GLY A CA    1 
ATOM   156  C  C     . GLY A 1 20  ? 212.726 119.843 -28.716 1.00 64.57  ? 51  GLY A C     1 
ATOM   157  O  O     . GLY A 1 20  ? 213.548 118.997 -29.082 1.00 64.57  ? 51  GLY A O     1 
ATOM   158  N  N     . LEU A 1 21  ? 211.565 120.034 -29.338 1.00 47.29  ? 52  LEU A N     1 
ATOM   159  C  CA    . LEU A 1 21  ? 211.164 119.205 -30.472 1.00 47.29  ? 52  LEU A CA    1 
ATOM   160  C  C     . LEU A 1 21  ? 211.908 119.470 -31.777 1.00 47.29  ? 52  LEU A C     1 
ATOM   161  O  O     . LEU A 1 21  ? 212.127 118.552 -32.565 1.00 47.29  ? 52  LEU A O     1 
ATOM   162  C  CB    . LEU A 1 21  ? 209.666 119.368 -30.746 1.00 49.54  ? 52  LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 21  ? 208.625 119.179 -29.643 1.00 49.54  ? 52  LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 21  ? 207.258 119.431 -30.261 1.00 49.54  ? 52  LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 21  ? 208.699 117.784 -29.034 1.00 49.54  ? 52  LEU A CD2   1 
ATOM   166  N  N     . ASP A 1 22  ? 212.302 120.714 -32.013 1.00 46.92  ? 53  ASP A N     1 
ATOM   167  C  CA    . ASP A 1 22  ? 212.953 121.012 -33.275 1.00 46.92  ? 53  ASP A CA    1 
ATOM   168  C  C     . ASP A 1 22  ? 214.259 121.782 -33.284 1.00 46.92  ? 53  ASP A C     1 
ATOM   169  O  O     . ASP A 1 22  ? 214.832 121.988 -34.353 1.00 46.92  ? 53  ASP A O     1 
ATOM   170  C  CB    . ASP A 1 22  ? 211.969 121.748 -34.179 1.00 73.42  ? 53  ASP A CB    1 
ATOM   171  C  CG    . ASP A 1 22  ? 211.627 123.130 -33.661 1.00 73.42  ? 53  ASP A CG    1 
ATOM   172  O  OD1   . ASP A 1 22  ? 210.779 123.807 -34.295 1.00 73.42  ? 53  ASP A OD1   1 
ATOM   173  O  OD2   . ASP A 1 22  ? 212.206 123.538 -32.624 1.00 73.42  ? 53  ASP A OD2   1 
ATOM   174  N  N     . ARG A 1 23  ? 214.741 122.212 -32.126 1.00 57.61  ? 54  ARG A N     1 
ATOM   175  C  CA    . ARG A 1 23  ? 215.982 122.985 -32.102 1.00 57.61  ? 54  ARG A CA    1 
ATOM   176  C  C     . ARG A 1 23  ? 217.200 122.187 -31.647 1.00 57.61  ? 54  ARG A C     1 
ATOM   177  O  O     . ARG A 1 23  ? 217.099 120.994 -31.320 1.00 57.61  ? 54  ARG A O     1 
ATOM   178  C  CB    . ARG A 1 23  ? 215.808 124.195 -31.200 1.00 54.71  ? 54  ARG A CB    1 
ATOM   179  C  CG    . ARG A 1 23  ? 214.477 124.876 -31.362 1.00 54.71  ? 54  ARG A CG    1 
ATOM   180  C  CD    . ARG A 1 23  ? 214.073 125.511 -30.050 1.00 54.71  ? 54  ARG A CD    1 
ATOM   181  N  NE    . ARG A 1 23  ? 214.040 124.518 -28.981 1.00 54.71  ? 54  ARG A NE    1 
ATOM   182  C  CZ    . ARG A 1 23  ? 213.721 124.784 -27.718 1.00 54.71  ? 54  ARG A CZ    1 
ATOM   183  N  NH1   . ARG A 1 23  ? 213.411 126.021 -27.364 1.00 54.71  ? 54  ARG A NH1   1 
ATOM   184  N  NH2   . ARG A 1 23  ? 213.699 123.810 -26.813 1.00 54.71  ? 54  ARG A NH2   1 
ATOM   185  N  N     . TYR A 1 24  ? 218.344 122.871 -31.624 1.00 49.00  ? 55  TYR A N     1 
ATOM   186  C  CA    . TYR A 1 24  ? 219.617 122.280 -31.207 1.00 49.00  ? 55  TYR A CA    1 
ATOM   187  C  C     . TYR A 1 24  ? 220.590 123.353 -30.709 1.00 49.00  ? 55  TYR A C     1 
ATOM   188  O  O     . TYR A 1 24  ? 220.494 124.523 -31.090 1.00 49.00  ? 55  TYR A O     1 
ATOM   189  C  CB    . TYR A 1 24  ? 220.271 121.554 -32.379 1.00 39.95  ? 55  TYR A CB    1 
ATOM   190  C  CG    . TYR A 1 24  ? 220.969 122.486 -33.343 1.00 39.95  ? 55  TYR A CG    1 
ATOM   191  C  CD1   . TYR A 1 24  ? 222.345 122.660 -33.290 1.00 39.95  ? 55  TYR A CD1   1 
ATOM   192  C  CD2   . TYR A 1 24  ? 220.251 123.198 -34.302 1.00 39.95  ? 55  TYR A CD2   1 
ATOM   193  C  CE1   . TYR A 1 24  ? 222.995 123.520 -34.166 1.00 39.95  ? 55  TYR A CE1   1 
ATOM   194  C  CE2   . TYR A 1 24  ? 220.892 124.060 -35.189 1.00 39.95  ? 55  TYR A CE2   1 
ATOM   195  C  CZ    . TYR A 1 24  ? 222.267 124.218 -35.114 1.00 39.95  ? 55  TYR A CZ    1 
ATOM   196  O  OH    . TYR A 1 24  ? 222.916 125.068 -35.983 1.00 39.95  ? 55  TYR A OH    1 
ATOM   197  N  N     . GLN A 1 25  ? 221.534 122.936 -29.869 1.00 38.94  ? 56  GLN A N     1 
ATOM   198  C  CA    . GLN A 1 25  ? 222.545 123.831 -29.331 1.00 38.94  ? 56  GLN A CA    1 
ATOM   199  C  C     . GLN A 1 25  ? 223.922 123.209 -29.421 1.00 38.94  ? 56  GLN A C     1 
ATOM   200  O  O     . GLN A 1 25  ? 224.088 122.015 -29.189 1.00 38.94  ? 56  GLN A O     1 
ATOM   201  C  CB    . GLN A 1 25  ? 222.246 124.162 -27.878 1.00 57.30  ? 56  GLN A CB    1 
ATOM   202  C  CG    . GLN A 1 25  ? 221.089 125.119 -27.718 1.00 57.30  ? 56  GLN A CG    1 
ATOM   203  C  CD    . GLN A 1 25  ? 220.603 125.217 -26.287 1.00 57.30  ? 56  GLN A CD    1 
ATOM   204  O  OE1   . GLN A 1 25  ? 219.580 125.847 -26.008 1.00 57.30  ? 56  GLN A OE1   1 
ATOM   205  N  NE2   . GLN A 1 25  ? 221.333 124.588 -25.369 1.00 57.30  ? 56  GLN A NE2   1 
ATOM   206  N  N     . CYS A 1 26  ? 224.911 124.022 -29.782 1.00 45.36  ? 57  CYS A N     1 
ATOM   207  C  CA    . CYS A 1 26  ? 226.280 123.542 -29.861 1.00 45.36  ? 57  CYS A CA    1 
ATOM   208  C  C     . CYS A 1 26  ? 227.024 123.917 -28.577 1.00 45.36  ? 57  CYS A C     1 
ATOM   209  O  O     . CYS A 1 26  ? 226.990 125.062 -28.130 1.00 45.36  ? 57  CYS A O     1 
ATOM   210  C  CB    . CYS A 1 26  ? 226.994 124.132 -31.075 1.00 52.20  ? 57  CYS A CB    1 
ATOM   211  S  SG    . CYS A 1 26  ? 226.329 123.610 -32.691 1.00 52.20  ? 57  CYS A SG    1 
ATOM   212  N  N     . ASP A 1 27  ? 227.673 122.927 -27.978 1.00 45.77  ? 58  ASP A N     1 
ATOM   213  C  CA    . ASP A 1 27  ? 228.424 123.112 -26.752 1.00 45.77  ? 58  ASP A CA    1 
ATOM   214  C  C     . ASP A 1 27  ? 229.877 123.283 -27.151 1.00 45.77  ? 58  ASP A C     1 
ATOM   215  O  O     . ASP A 1 27  ? 230.695 122.374 -27.010 1.00 45.77  ? 58  ASP A O     1 
ATOM   216  C  CB    . ASP A 1 27  ? 228.275 121.885 -25.870 1.00 41.05  ? 58  ASP A CB    1 
ATOM   217  C  CG    . ASP A 1 27  ? 228.692 122.143 -24.468 1.00 41.05  ? 58  ASP A CG    1 
ATOM   218  O  OD1   . ASP A 1 27  ? 228.282 123.195 -23.957 1.00 41.05  ? 58  ASP A OD1   1 
ATOM   219  O  OD2   . ASP A 1 27  ? 229.408 121.311 -23.874 1.00 41.05  ? 58  ASP A OD2   1 
ATOM   220  N  N     . CYS A 1 28  ? 230.187 124.466 -27.653 1.00 37.79  ? 59  CYS A N     1 
ATOM   221  C  CA    . CYS A 1 28  ? 231.515 124.778 -28.120 1.00 37.79  ? 59  CYS A CA    1 
ATOM   222  C  C     . CYS A 1 28  ? 232.594 124.749 -27.061 1.00 37.79  ? 59  CYS A C     1 
ATOM   223  O  O     . CYS A 1 28  ? 233.743 125.057 -27.359 1.00 37.79  ? 59  CYS A O     1 
ATOM   224  C  CB    . CYS A 1 28  ? 231.489 126.142 -28.780 1.00 46.39  ? 59  CYS A CB    1 
ATOM   225  S  SG    . CYS A 1 28  ? 230.198 126.309 -30.049 1.00 46.39  ? 59  CYS A SG    1 
ATOM   226  N  N     . THR A 1 29  ? 232.237 124.380 -25.834 1.00 39.06  ? 60  THR A N     1 
ATOM   227  C  CA    . THR A 1 29  ? 233.202 124.331 -24.732 1.00 39.06  ? 60  THR A CA    1 
ATOM   228  C  C     . THR A 1 29  ? 234.583 123.816 -25.139 1.00 39.06  ? 60  THR A C     1 
ATOM   229  O  O     . THR A 1 29  ? 234.693 122.767 -25.771 1.00 39.06  ? 60  THR A O     1 
ATOM   230  C  CB    . THR A 1 29  ? 232.698 123.448 -23.581 1.00 32.77  ? 60  THR A CB    1 
ATOM   231  O  OG1   . THR A 1 29  ? 231.473 123.978 -23.069 1.00 32.77  ? 60  THR A OG1   1 
ATOM   232  C  CG2   . THR A 1 29  ? 233.724 123.400 -22.470 1.00 32.77  ? 60  THR A CG2   1 
ATOM   233  N  N     . ARG A 1 30  ? 235.620 124.569 -24.764 1.00 30.84  ? 61  ARG A N     1 
ATOM   234  C  CA    . ARG A 1 30  ? 237.031 124.253 -25.047 1.00 30.84  ? 61  ARG A CA    1 
ATOM   235  C  C     . ARG A 1 30  ? 237.391 123.880 -26.481 1.00 30.84  ? 61  ARG A C     1 
ATOM   236  O  O     . ARG A 1 30  ? 238.355 123.149 -26.713 1.00 30.84  ? 61  ARG A O     1 
ATOM   237  C  CB    . ARG A 1 30  ? 237.544 123.142 -24.114 1.00 33.41  ? 61  ARG A CB    1 
ATOM   238  C  CG    . ARG A 1 30  ? 237.296 123.420 -22.647 1.00 33.41  ? 61  ARG A CG    1 
ATOM   239  C  CD    . ARG A 1 30  ? 237.953 122.426 -21.713 1.00 33.41  ? 61  ARG A CD    1 
ATOM   240  N  NE    . ARG A 1 30  ? 237.380 122.619 -20.391 1.00 33.41  ? 61  ARG A NE    1 
ATOM   241  C  CZ    . ARG A 1 30  ? 236.312 121.974 -19.950 1.00 33.41  ? 61  ARG A CZ    1 
ATOM   242  N  NH1   . ARG A 1 30  ? 235.718 121.077 -20.720 1.00 33.41  ? 61  ARG A NH1   1 
ATOM   243  N  NH2   . ARG A 1 30  ? 235.802 122.265 -18.763 1.00 33.41  ? 61  ARG A NH2   1 
ATOM   244  N  N     . THR A 1 31  ? 236.630 124.379 -27.442 1.00 38.58  ? 62  THR A N     1 
ATOM   245  C  CA    . THR A 1 31  ? 236.929 124.087 -28.832 1.00 38.58  ? 62  THR A CA    1 
ATOM   246  C  C     . THR A 1 31  ? 237.759 125.222 -29.388 1.00 38.58  ? 62  THR A C     1 
ATOM   247  O  O     . THR A 1 31  ? 238.312 125.136 -30.483 1.00 38.58  ? 62  THR A O     1 
ATOM   248  C  CB    . THR A 1 31  ? 235.654 123.949 -29.670 1.00 49.73  ? 62  THR A CB    1 
ATOM   249  O  OG1   . THR A 1 31  ? 234.808 125.088 -29.459 1.00 49.73  ? 62  THR A OG1   1 
ATOM   250  C  CG2   . THR A 1 31  ? 234.923 122.686 -29.288 1.00 49.73  ? 62  THR A CG2   1 
ATOM   251  N  N     . GLY A 1 32  ? 237.848 126.292 -28.611 1.00 41.31  ? 63  GLY A N     1 
ATOM   252  C  CA    . GLY A 1 32  ? 238.615 127.436 -29.040 1.00 41.31  ? 63  GLY A CA    1 
ATOM   253  C  C     . GLY A 1 32  ? 237.718 128.377 -29.797 1.00 41.31  ? 63  GLY A C     1 
ATOM   254  O  O     . GLY A 1 32  ? 238.115 129.485 -30.123 1.00 41.31  ? 63  GLY A O     1 
ATOM   255  N  N     . TYR A 1 33  ? 236.504 127.932 -30.092 1.00 34.42  ? 64  TYR A N     1 
ATOM   256  C  CA    . TYR A 1 33  ? 235.563 128.777 -30.803 1.00 34.42  ? 64  TYR A CA    1 
ATOM   257  C  C     . TYR A 1 33  ? 234.325 129.019 -29.962 1.00 34.42  ? 64  TYR A C     1 
ATOM   258  O  O     . TYR A 1 33  ? 234.105 128.362 -28.946 1.00 34.42  ? 64  TYR A O     1 
ATOM   259  C  CB    . TYR A 1 33  ? 235.177 128.146 -32.136 1.00 37.88  ? 64  TYR A CB    1 
ATOM   260  C  CG    . TYR A 1 33  ? 236.358 127.903 -33.041 1.00 37.88  ? 64  TYR A CG    1 
ATOM   261  C  CD1   . TYR A 1 33  ? 237.280 126.911 -32.749 1.00 37.88  ? 64  TYR A CD1   1 
ATOM   262  C  CD2   . TYR A 1 33  ? 236.571 128.679 -34.180 1.00 37.88  ? 64  TYR A CD2   1 
ATOM   263  C  CE1   . TYR A 1 33  ? 238.391 126.690 -33.565 1.00 37.88  ? 64  TYR A CE1   1 
ATOM   264  C  CE2   . TYR A 1 33  ? 237.685 128.464 -35.005 1.00 37.88  ? 64  TYR A CE2   1 
ATOM   265  C  CZ    . TYR A 1 33  ? 238.586 127.465 -34.685 1.00 37.88  ? 64  TYR A CZ    1 
ATOM   266  O  OH    . TYR A 1 33  ? 239.685 127.220 -35.467 1.00 37.88  ? 64  TYR A OH    1 
ATOM   267  N  N     . SER A 1 34  ? 233.532 129.989 -30.383 1.00 46.59  ? 65  SER A N     1 
ATOM   268  C  CA    . SER A 1 34  ? 232.302 130.332 -29.689 1.00 46.59  ? 65  SER A CA    1 
ATOM   269  C  C     . SER A 1 34  ? 231.274 130.603 -30.776 1.00 46.59  ? 65  SER A C     1 
ATOM   270  O  O     . SER A 1 34  ? 231.634 130.677 -31.948 1.00 46.59  ? 65  SER A O     1 
ATOM   271  C  CB    . SER A 1 34  ? 232.496 131.590 -28.836 1.00 53.14  ? 65  SER A CB    1 
ATOM   272  O  OG    . SER A 1 34  ? 232.599 132.748 -29.648 1.00 53.14  ? 65  SER A OG    1 
ATOM   273  N  N     . GLY A 1 35  ? 230.007 130.736 -30.400 1.00 37.97  ? 66  GLY A N     1 
ATOM   274  C  CA    . GLY A 1 35  ? 228.988 131.018 -31.393 1.00 37.97  ? 66  GLY A CA    1 
ATOM   275  C  C     . GLY A 1 35  ? 227.939 129.942 -31.562 1.00 37.97  ? 66  GLY A C     1 
ATOM   276  O  O     . GLY A 1 35  ? 228.047 128.870 -30.977 1.00 37.97  ? 66  GLY A O     1 
ATOM   277  N  N     . PRO A 1 36  ? 226.897 130.208 -32.362 1.00 40.53  ? 67  PRO A N     1 
ATOM   278  C  CA    . PRO A 1 36  ? 225.829 129.239 -32.596 1.00 40.53  ? 67  PRO A CA    1 
ATOM   279  C  C     . PRO A 1 36  ? 226.369 127.861 -32.937 1.00 40.53  ? 67  PRO A C     1 
ATOM   280  O  O     . PRO A 1 36  ? 225.932 126.868 -32.366 1.00 40.53  ? 67  PRO A O     1 
ATOM   281  C  CB    . PRO A 1 36  ? 225.061 129.862 -33.746 1.00 37.80  ? 67  PRO A CB    1 
ATOM   282  C  CG    . PRO A 1 36  ? 225.184 131.327 -33.455 1.00 37.80  ? 67  PRO A CG    1 
ATOM   283  C  CD    . PRO A 1 36  ? 226.640 131.457 -33.102 1.00 37.80  ? 67  PRO A CD    1 
ATOM   284  N  N     . ASN A 1 37  ? 227.326 127.796 -33.857 1.00 34.31  ? 68  ASN A N     1 
ATOM   285  C  CA    . ASN A 1 37  ? 227.894 126.510 -34.248 1.00 34.31  ? 68  ASN A CA    1 
ATOM   286  C  C     . ASN A 1 37  ? 229.413 126.446 -34.110 1.00 34.31  ? 68  ASN A C     1 
ATOM   287  O  O     . ASN A 1 37  ? 230.064 125.661 -34.789 1.00 34.31  ? 68  ASN A O     1 
ATOM   288  C  CB    . ASN A 1 37  ? 227.508 126.172 -35.692 1.00 52.90  ? 68  ASN A CB    1 
ATOM   289  C  CG    . ASN A 1 37  ? 226.056 126.476 -36.001 1.00 52.90  ? 68  ASN A CG    1 
ATOM   290  O  OD1   . ASN A 1 37  ? 225.163 126.089 -35.258 1.00 52.90  ? 68  ASN A OD1   1 
ATOM   291  N  ND2   . ASN A 1 37  ? 225.822 127.168 -37.111 1.00 52.90  ? 68  ASN A ND2   1 
ATOM   292  N  N     . CYS A 1 38  ? 229.967 127.269 -33.228 1.00 39.61  ? 69  CYS A N     1 
ATOM   293  C  CA    . CYS A 1 38  ? 231.410 127.305 -32.987 1.00 39.61  ? 69  CYS A CA    1 
ATOM   294  C  C     . CYS A 1 38  ? 232.219 127.738 -34.203 1.00 39.61  ? 69  CYS A C     1 
ATOM   295  O  O     . CYS A 1 38  ? 233.067 126.993 -34.700 1.00 39.61  ? 69  CYS A O     1 
ATOM   296  C  CB    . CYS A 1 38  ? 231.915 125.941 -32.545 1.00 46.94  ? 69  CYS A CB    1 
ATOM   297  S  SG    . CYS A 1 38  ? 230.785 125.004 -31.484 1.00 46.94  ? 69  CYS A SG    1 
ATOM   298  N  N     . THR A 1 39  ? 231.972 128.956 -34.667 1.00 52.09  ? 70  THR A N     1 
ATOM   299  C  CA    . THR A 1 39  ? 232.666 129.486 -35.829 1.00 52.09  ? 70  THR A CA    1 
ATOM   300  C  C     . THR A 1 39  ? 233.185 130.905 -35.588 1.00 52.09  ? 70  THR A C     1 
ATOM   301  O  O     . THR A 1 39  ? 233.206 131.732 -36.492 1.00 52.09  ? 70  THR A O     1 
ATOM   302  C  CB    . THR A 1 39  ? 231.726 129.459 -37.051 1.00 44.61  ? 70  THR A CB    1 
ATOM   303  O  OG1   . THR A 1 39  ? 230.381 129.714 -36.624 1.00 44.61  ? 70  THR A OG1   1 
ATOM   304  C  CG2   . THR A 1 39  ? 231.779 128.102 -37.731 1.00 44.61  ? 70  THR A CG2   1 
ATOM   305  N  N     . ILE A 1 40  ? 233.608 131.177 -34.361 1.00 38.87  ? 71  ILE A N     1 
ATOM   306  C  CA    . ILE A 1 40  ? 234.133 132.486 -34.002 1.00 38.87  ? 71  ILE A CA    1 
ATOM   307  C  C     . ILE A 1 40  ? 235.368 132.279 -33.147 1.00 38.87  ? 71  ILE A C     1 
ATOM   308  O  O     . ILE A 1 40  ? 235.307 132.293 -31.916 1.00 38.87  ? 71  ILE A O     1 
ATOM   309  C  CB    . ILE A 1 40  ? 233.100 133.299 -33.220 1.00 40.53  ? 71  ILE A CB    1 
ATOM   310  C  CG1   . ILE A 1 40  ? 231.909 133.607 -34.126 1.00 40.53  ? 71  ILE A CG1   1 
ATOM   311  C  CG2   . ILE A 1 40  ? 233.729 134.579 -32.698 1.00 40.53  ? 71  ILE A CG2   1 
ATOM   312  C  CD1   . ILE A 1 40  ? 230.797 134.346 -33.435 1.00 40.53  ? 71  ILE A CD1   1 
ATOM   313  N  N     . PRO A 1 41  ? 236.519 132.115 -33.806 1.00 40.02  ? 72  PRO A N     1 
ATOM   314  C  CA    . PRO A 1 41  ? 237.838 131.889 -33.214 1.00 40.02  ? 72  PRO A CA    1 
ATOM   315  C  C     . PRO A 1 41  ? 238.193 132.822 -32.078 1.00 40.02  ? 72  PRO A C     1 
ATOM   316  O  O     . PRO A 1 41  ? 238.121 134.038 -32.221 1.00 40.02  ? 72  PRO A O     1 
ATOM   317  C  CB    . PRO A 1 41  ? 238.776 132.054 -34.404 1.00 37.14  ? 72  PRO A CB    1 
ATOM   318  C  CG    . PRO A 1 41  ? 238.089 133.083 -35.205 1.00 37.14  ? 72  PRO A CG    1 
ATOM   319  C  CD    . PRO A 1 41  ? 236.663 132.600 -35.186 1.00 37.14  ? 72  PRO A CD    1 
ATOM   320  N  N     . GLU A 1 42  ? 238.565 132.253 -30.940 1.00 30.46  ? 73  GLU A N     1 
ATOM   321  C  CA    . GLU A 1 42  ? 238.952 133.077 -29.820 1.00 30.46  ? 73  GLU A CA    1 
ATOM   322  C  C     . GLU A 1 42  ? 240.209 133.758 -30.304 1.00 30.46  ? 73  GLU A C     1 
ATOM   323  O  O     . GLU A 1 42  ? 240.769 133.372 -31.331 1.00 30.46  ? 73  GLU A O     1 
ATOM   324  C  CB    . GLU A 1 42  ? 239.219 132.224 -28.580 1.00 65.23  ? 73  GLU A CB    1 
ATOM   325  C  CG    . GLU A 1 42  ? 237.942 131.812 -27.840 1.00 65.23  ? 73  GLU A CG    1 
ATOM   326  C  CD    . GLU A 1 42  ? 238.147 130.637 -26.882 1.00 65.23  ? 73  GLU A CD    1 
ATOM   327  O  OE1   . GLU A 1 42  ? 237.490 129.586 -27.079 1.00 65.23  ? 73  GLU A OE1   1 
ATOM   328  O  OE2   . GLU A 1 42  ? 238.958 130.760 -25.934 1.00 65.23  ? 73  GLU A OE2   1 
ATOM   329  N  N     . ILE A 1 43  ? 240.641 134.773 -29.574 1.00 36.03  ? 74  ILE A N     1 
ATOM   330  C  CA    . ILE A 1 43  ? 241.815 135.535 -29.959 1.00 36.03  ? 74  ILE A CA    1 
ATOM   331  C  C     . ILE A 1 43  ? 242.999 134.659 -30.368 1.00 36.03  ? 74  ILE A C     1 
ATOM   332  O  O     . ILE A 1 43  ? 243.553 134.834 -31.455 1.00 36.03  ? 74  ILE A O     1 
ATOM   333  C  CB    . ILE A 1 43  ? 242.216 136.529 -28.821 1.00 39.51  ? 74  ILE A CB    1 
ATOM   334  C  CG1   . ILE A 1 43  ? 242.490 137.912 -29.411 1.00 39.51  ? 74  ILE A CG1   1 
ATOM   335  C  CG2   . ILE A 1 43  ? 243.439 136.040 -28.071 1.00 39.51  ? 74  ILE A CG2   1 
ATOM   336  C  CD1   . ILE A 1 43  ? 243.563 137.929 -30.456 1.00 39.51  ? 74  ILE A CD1   1 
ATOM   337  N  N     . TRP A 1 44  ? 243.370 133.701 -29.527 1.00 36.19  ? 75  TRP A N     1 
ATOM   338  C  CA    . TRP A 1 44  ? 244.503 132.854 -29.844 1.00 36.19  ? 75  TRP A CA    1 
ATOM   339  C  C     . TRP A 1 44  ? 244.232 131.837 -30.954 1.00 36.19  ? 75  TRP A C     1 
ATOM   340  O  O     . TRP A 1 44  ? 245.107 131.552 -31.782 1.00 36.19  ? 75  TRP A O     1 
ATOM   341  C  CB    . TRP A 1 44  ? 244.993 132.165 -28.583 1.00 75.51  ? 75  TRP A CB    1 
ATOM   342  C  CG    . TRP A 1 44  ? 245.419 133.145 -27.535 1.00 75.51  ? 75  TRP A CG    1 
ATOM   343  C  CD1   . TRP A 1 44  ? 244.725 133.497 -26.412 1.00 75.51  ? 75  TRP A CD1   1 
ATOM   344  C  CD2   . TRP A 1 44  ? 246.603 133.955 -27.544 1.00 75.51  ? 75  TRP A CD2   1 
ATOM   345  N  NE1   . TRP A 1 44  ? 245.398 134.481 -25.719 1.00 75.51  ? 75  TRP A NE1   1 
ATOM   346  C  CE2   . TRP A 1 44  ? 246.553 134.783 -26.391 1.00 75.51  ? 75  TRP A CE2   1 
ATOM   347  C  CE3   . TRP A 1 44  ? 247.699 134.068 -28.414 1.00 75.51  ? 75  TRP A CE3   1 
ATOM   348  C  CZ2   . TRP A 1 44  ? 247.561 135.717 -26.083 1.00 75.51  ? 75  TRP A CZ2   1 
ATOM   349  C  CZ3   . TRP A 1 44  ? 248.702 134.997 -28.110 1.00 75.51  ? 75  TRP A CZ3   1 
ATOM   350  C  CH2   . TRP A 1 44  ? 248.621 135.809 -26.951 1.00 75.51  ? 75  TRP A CH2   1 
ATOM   351  N  N     . THR A 1 45  ? 243.021 131.289 -30.982 1.00 58.25  ? 76  THR A N     1 
ATOM   352  C  CA    . THR A 1 45  ? 242.654 130.326 -32.021 1.00 58.25  ? 76  THR A CA    1 
ATOM   353  C  C     . THR A 1 45  ? 242.846 131.015 -33.362 1.00 58.25  ? 76  THR A C     1 
ATOM   354  O  O     . THR A 1 45  ? 243.368 130.429 -34.310 1.00 58.25  ? 76  THR A O     1 
ATOM   355  C  CB    . THR A 1 45  ? 241.185 129.910 -31.903 1.00 54.67  ? 76  THR A CB    1 
ATOM   356  O  OG1   . THR A 1 45  ? 240.936 129.425 -30.580 1.00 54.67  ? 76  THR A OG1   1 
ATOM   357  C  CG2   . THR A 1 45  ? 240.862 128.826 -32.904 1.00 54.67  ? 76  THR A CG2   1 
ATOM   358  N  N     . TRP A 1 46  ? 242.415 132.273 -33.423 1.00 62.59  ? 77  TRP A N     1 
ATOM   359  C  CA    . TRP A 1 46  ? 242.549 133.068 -34.631 1.00 62.59  ? 77  TRP A CA    1 
ATOM   360  C  C     . TRP A 1 46  ? 244.021 133.136 -35.025 1.00 62.59  ? 77  TRP A C     1 
ATOM   361  O  O     . TRP A 1 46  ? 244.363 132.954 -36.194 1.00 62.59  ? 77  TRP A O     1 
ATOM   362  C  CB    . TRP A 1 46  ? 242.008 134.480 -34.411 1.00 52.27  ? 77  TRP A CB    1 
ATOM   363  C  CG    . TRP A 1 46  ? 242.235 135.359 -35.592 1.00 52.27  ? 77  TRP A CG    1 
ATOM   364  C  CD1   . TRP A 1 46  ? 241.511 135.389 -36.749 1.00 52.27  ? 77  TRP A CD1   1 
ATOM   365  C  CD2   . TRP A 1 46  ? 243.319 136.274 -35.772 1.00 52.27  ? 77  TRP A CD2   1 
ATOM   366  N  NE1   . TRP A 1 46  ? 242.081 136.263 -37.640 1.00 52.27  ? 77  TRP A NE1   1 
ATOM   367  C  CE2   . TRP A 1 46  ? 243.195 136.819 -37.067 1.00 52.27  ? 77  TRP A CE2   1 
ATOM   368  C  CE3   . TRP A 1 46  ? 244.391 136.685 -34.962 1.00 52.27  ? 77  TRP A CE3   1 
ATOM   369  C  CZ2   . TRP A 1 46  ? 244.104 137.755 -37.575 1.00 52.27  ? 77  TRP A CZ2   1 
ATOM   370  C  CZ3   . TRP A 1 46  ? 245.293 137.615 -35.467 1.00 52.27  ? 77  TRP A CZ3   1 
ATOM   371  C  CH2   . TRP A 1 46  ? 245.143 138.138 -36.761 1.00 52.27  ? 77  TRP A CH2   1 
ATOM   372  N  N     . LEU A 1 47  ? 244.898 133.396 -34.061 1.00 42.20  ? 78  LEU A N     1 
ATOM   373  C  CA    . LEU A 1 47  ? 246.323 133.445 -34.382 1.00 42.20  ? 78  LEU A CA    1 
ATOM   374  C  C     . LEU A 1 47  ? 246.760 132.091 -34.906 1.00 42.20  ? 78  LEU A C     1 
ATOM   375  O  O     . LEU A 1 47  ? 247.274 131.976 -36.021 1.00 42.20  ? 78  LEU A O     1 
ATOM   376  C  CB    . LEU A 1 47  ? 247.170 133.791 -33.150 1.00 48.37  ? 78  LEU A CB    1 
ATOM   377  C  CG    . LEU A 1 47  ? 247.220 135.250 -32.695 1.00 48.37  ? 78  LEU A CG    1 
ATOM   378  C  CD1   . LEU A 1 47  ? 248.045 135.341 -31.421 1.00 48.37  ? 78  LEU A CD1   1 
ATOM   379  C  CD2   . LEU A 1 47  ? 247.808 136.124 -33.799 1.00 48.37  ? 78  LEU A CD2   1 
ATOM   380  N  N     . ARG A 1 48  ? 246.542 131.066 -34.093 1.00 47.96  ? 79  ARG A N     1 
ATOM   381  C  CA    . ARG A 1 48  ? 246.936 129.717 -34.461 1.00 47.96  ? 79  ARG A CA    1 
ATOM   382  C  C     . ARG A 1 48  ? 246.494 129.336 -35.866 1.00 47.96  ? 79  ARG A C     1 
ATOM   383  O  O     . ARG A 1 48  ? 247.312 128.902 -36.677 1.00 47.96  ? 79  ARG A O     1 
ATOM   384  C  CB    . ARG A 1 48  ? 246.389 128.722 -33.456 1.00 65.75  ? 79  ARG A CB    1 
ATOM   385  N  N     . THR A 1 49  ? 245.211 129.501 -36.162 1.00 45.14  ? 80  THR A N     1 
ATOM   386  C  CA    . THR A 1 49  ? 244.726 129.142 -37.484 1.00 45.14  ? 80  THR A CA    1 
ATOM   387  C  C     . THR A 1 49  ? 245.293 129.988 -38.616 1.00 45.14  ? 80  THR A C     1 
ATOM   388  O  O     . THR A 1 49  ? 245.325 129.524 -39.754 1.00 45.14  ? 80  THR A O     1 
ATOM   389  C  CB    . THR A 1 49  ? 243.190 129.161 -37.557 1.00 56.11  ? 80  THR A CB    1 
ATOM   390  O  OG1   . THR A 1 49  ? 242.673 130.052 -36.561 1.00 56.11  ? 80  THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 49  ? 242.631 127.757 -37.343 1.00 56.11  ? 80  THR A CG2   1 
ATOM   392  N  N     . THR A 1 50  ? 245.739 131.216 -38.336 1.00 71.81  ? 81  THR A N     1 
ATOM   393  C  CA    . THR A 1 50  ? 246.314 132.028 -39.419 1.00 71.81  ? 81  THR A CA    1 
ATOM   394  C  C     . THR A 1 50  ? 247.810 131.757 -39.566 1.00 71.81  ? 81  THR A C     1 
ATOM   395  O  O     . THR A 1 50  ? 248.414 132.157 -40.557 1.00 71.81  ? 81  THR A O     1 
ATOM   396  C  CB    . THR A 1 50  ? 246.136 133.587 -39.236 1.00 60.15  ? 81  THR A CB    1 
ATOM   397  O  OG1   . THR A 1 50  ? 247.086 134.088 -38.287 1.00 60.15  ? 81  THR A OG1   1 
ATOM   398  C  CG2   . THR A 1 50  ? 244.725 133.929 -38.784 1.00 60.15  ? 81  THR A CG2   1 
ATOM   399  N  N     . LEU A 1 51  ? 248.408 131.075 -38.589 1.00 52.81  ? 82  LEU A N     1 
ATOM   400  C  CA    . LEU A 1 51  ? 249.834 130.780 -38.649 1.00 52.81  ? 82  LEU A CA    1 
ATOM   401  C  C     . LEU A 1 51  ? 250.193 129.319 -38.925 1.00 52.81  ? 82  LEU A C     1 
ATOM   402  O  O     . LEU A 1 51  ? 251.341 129.009 -39.249 1.00 52.81  ? 82  LEU A O     1 
ATOM   403  C  CB    . LEU A 1 51  ? 250.512 131.225 -37.354 1.00 36.28  ? 82  LEU A CB    1 
ATOM   404  C  CG    . LEU A 1 51  ? 250.866 132.705 -37.283 1.00 36.28  ? 82  LEU A CG    1 
ATOM   405  C  CD1   . LEU A 1 51  ? 251.749 132.964 -36.084 1.00 36.28  ? 82  LEU A CD1   1 
ATOM   406  C  CD2   . LEU A 1 51  ? 251.599 133.100 -38.541 1.00 36.28  ? 82  LEU A CD2   1 
ATOM   407  N  N     . ARG A 1 52  ? 249.220 128.420 -38.812 1.00 67.67  ? 83  ARG A N     1 
ATOM   408  C  CA    . ARG A 1 52  ? 249.490 126.999 -39.027 1.00 67.67  ? 83  ARG A CA    1 
ATOM   409  C  C     . ARG A 1 52  ? 249.569 126.603 -40.496 1.00 67.67  ? 83  ARG A C     1 
ATOM   410  O  O     . ARG A 1 52  ? 248.596 126.763 -41.244 1.00 67.67  ? 83  ARG A O     1 
ATOM   411  C  CB    . ARG A 1 52  ? 248.434 126.144 -38.315 1.00 41.62  ? 83  ARG A CB    1 
ATOM   412  N  N     . PRO A 1 53  ? 250.734 126.077 -40.927 1.00 42.47  ? 84  PRO A N     1 
ATOM   413  C  CA    . PRO A 1 53  ? 250.944 125.645 -42.314 1.00 42.47  ? 84  PRO A CA    1 
ATOM   414  C  C     . PRO A 1 53  ? 250.015 124.483 -42.663 1.00 42.47  ? 84  PRO A C     1 
ATOM   415  O  O     . PRO A 1 53  ? 249.535 123.778 -41.776 1.00 42.47  ? 84  PRO A O     1 
ATOM   416  C  CB    . PRO A 1 53  ? 252.412 125.224 -42.322 1.00 25.47  ? 84  PRO A CB    1 
ATOM   417  C  CG    . PRO A 1 53  ? 252.621 124.743 -40.931 1.00 25.47  ? 84  PRO A CG    1 
ATOM   418  C  CD    . PRO A 1 53  ? 251.930 125.802 -40.113 1.00 25.47  ? 84  PRO A CD    1 
ATOM   419  N  N     . SER A 1 54  ? 249.752 124.280 -43.947 1.00 46.54  ? 85  SER A N     1 
ATOM   420  C  CA    . SER A 1 54  ? 248.890 123.177 -44.342 1.00 46.54  ? 85  SER A CA    1 
ATOM   421  C  C     . SER A 1 54  ? 249.634 121.883 -44.046 1.00 46.54  ? 85  SER A C     1 
ATOM   422  O  O     . SER A 1 54  ? 250.870 121.836 -44.067 1.00 46.54  ? 85  SER A O     1 
ATOM   423  C  CB    . SER A 1 54  ? 248.549 123.233 -45.836 1.00 47.90  ? 85  SER A CB    1 
ATOM   424  O  OG    . SER A 1 54  ? 249.584 122.675 -46.625 1.00 47.90  ? 85  SER A OG    1 
ATOM   425  N  N     . PRO A 1 55  ? 248.887 120.811 -43.751 1.00 52.86  ? 86  PRO A N     1 
ATOM   426  C  CA    . PRO A 1 55  ? 249.507 119.520 -43.455 1.00 52.86  ? 86  PRO A CA    1 
ATOM   427  C  C     . PRO A 1 55  ? 250.331 119.128 -44.671 1.00 52.86  ? 86  PRO A C     1 
ATOM   428  O  O     . PRO A 1 55  ? 251.431 118.601 -44.545 1.00 52.86  ? 86  PRO A O     1 
ATOM   429  C  CB    . PRO A 1 55  ? 248.306 118.609 -43.248 1.00 59.80  ? 86  PRO A CB    1 
ATOM   430  C  CG    . PRO A 1 55  ? 247.243 119.560 -42.733 1.00 59.80  ? 86  PRO A CG    1 
ATOM   431  C  CD    . PRO A 1 55  ? 247.419 120.716 -43.671 1.00 59.80  ? 86  PRO A CD    1 
ATOM   432  N  N     . SER A 1 56  ? 249.776 119.412 -45.847 1.00 60.81  ? 87  SER A N     1 
ATOM   433  C  CA    . SER A 1 56  ? 250.418 119.134 -47.129 1.00 60.81  ? 87  SER A CA    1 
ATOM   434  C  C     . SER A 1 56  ? 251.844 119.662 -47.097 1.00 60.81  ? 87  SER A C     1 
ATOM   435  O  O     . SER A 1 56  ? 252.794 118.980 -47.502 1.00 60.81  ? 87  SER A O     1 
ATOM   436  C  CB    . SER A 1 56  ? 249.660 119.848 -48.250 1.00 71.19  ? 87  SER A CB    1 
ATOM   437  O  OG    . SER A 1 56  ? 248.259 119.844 -48.011 1.00 71.19  ? 87  SER A OG    1 
ATOM   438  N  N     . PHE A 1 57  ? 251.975 120.890 -46.604 1.00 42.78  ? 88  PHE A N     1 
ATOM   439  C  CA    . PHE A 1 57  ? 253.262 121.567 -46.509 1.00 42.78  ? 88  PHE A CA    1 
ATOM   440  C  C     . PHE A 1 57  ? 254.232 120.884 -45.535 1.00 42.78  ? 88  PHE A C     1 
ATOM   441  O  O     . PHE A 1 57  ? 255.373 120.598 -45.894 1.00 42.78  ? 88  PHE A O     1 
ATOM   442  C  CB    . PHE A 1 57  ? 253.033 123.034 -46.116 1.00 37.91  ? 88  PHE A CB    1 
ATOM   443  C  CG    . PHE A 1 57  ? 254.297 123.824 -45.947 1.00 37.91  ? 88  PHE A CG    1 
ATOM   444  C  CD1   . PHE A 1 57  ? 254.675 124.286 -44.687 1.00 37.91  ? 88  PHE A CD1   1 
ATOM   445  C  CD2   . PHE A 1 57  ? 255.124 124.082 -47.041 1.00 37.91  ? 88  PHE A CD2   1 
ATOM   446  C  CE1   . PHE A 1 57  ? 255.857 124.991 -44.514 1.00 37.91  ? 88  PHE A CE1   1 
ATOM   447  C  CE2   . PHE A 1 57  ? 256.309 124.784 -46.881 1.00 37.91  ? 88  PHE A CE2   1 
ATOM   448  C  CZ    . PHE A 1 57  ? 256.678 125.242 -45.608 1.00 37.91  ? 88  PHE A CZ    1 
ATOM   449  N  N     . ILE A 1 58  ? 253.780 120.629 -44.310 1.00 40.39  ? 89  ILE A N     1 
ATOM   450  C  CA    . ILE A 1 58  ? 254.626 119.966 -43.329 1.00 40.39  ? 89  ILE A CA    1 
ATOM   451  C  C     . ILE A 1 58  ? 255.143 118.632 -43.892 1.00 40.39  ? 89  ILE A C     1 
ATOM   452  O  O     . ILE A 1 58  ? 256.332 118.347 -43.796 1.00 40.39  ? 89  ILE A O     1 
ATOM   453  C  CB    . ILE A 1 58  ? 253.862 119.678 -42.024 1.00 48.12  ? 89  ILE A CB    1 
ATOM   454  C  CG1   . ILE A 1 58  ? 253.378 120.985 -41.382 1.00 48.12  ? 89  ILE A CG1   1 
ATOM   455  C  CG2   . ILE A 1 58  ? 254.765 118.909 -41.060 1.00 48.12  ? 89  ILE A CG2   1 
ATOM   456  C  CD1   . ILE A 1 58  ? 254.449 121.737 -40.604 1.00 48.12  ? 89  ILE A CD1   1 
ATOM   457  N  N     . HIS A 1 59  ? 254.263 117.815 -44.476 1.00 44.52  ? 90  HIS A N     1 
ATOM   458  C  CA    . HIS A 1 59  ? 254.699 116.536 -45.035 1.00 44.52  ? 90  HIS A CA    1 
ATOM   459  C  C     . HIS A 1 59  ? 255.821 116.816 -46.010 1.00 44.52  ? 90  HIS A C     1 
ATOM   460  O  O     . HIS A 1 59  ? 256.683 115.963 -46.234 1.00 44.52  ? 90  HIS A O     1 
ATOM   461  C  CB    . HIS A 1 59  ? 253.568 115.811 -45.781 1.00 49.98  ? 90  HIS A CB    1 
ATOM   462  C  CG    . HIS A 1 59  ? 253.965 114.467 -46.335 1.00 49.98  ? 90  HIS A CG    1 
ATOM   463  N  ND1   . HIS A 1 59  ? 254.149 113.352 -45.541 1.00 49.98  ? 90  HIS A ND1   1 
ATOM   464  C  CD2   . HIS A 1 59  ? 254.221 114.065 -47.605 1.00 49.98  ? 90  HIS A CD2   1 
ATOM   465  C  CE1   . HIS A 1 59  ? 254.500 112.325 -46.297 1.00 49.98  ? 90  HIS A CE1   1 
ATOM   466  N  NE2   . HIS A 1 59  ? 254.551 112.731 -47.553 1.00 49.98  ? 90  HIS A NE2   1 
ATOM   467  N  N     . PHE A 1 60  ? 255.802 118.010 -46.598 1.00 44.34  ? 91  PHE A N     1 
ATOM   468  C  CA    . PHE A 1 60  ? 256.843 118.394 -47.545 1.00 44.34  ? 91  PHE A CA    1 
ATOM   469  C  C     . PHE A 1 60  ? 258.186 118.591 -46.832 1.00 44.34  ? 91  PHE A C     1 
ATOM   470  O  O     . PHE A 1 60  ? 259.199 117.997 -47.198 1.00 44.34  ? 91  PHE A O     1 
ATOM   471  C  CB    . PHE A 1 60  ? 256.466 119.686 -48.270 1.00 37.71  ? 91  PHE A CB    1 
ATOM   472  C  CG    . PHE A 1 60  ? 257.538 120.184 -49.199 1.00 37.71  ? 91  PHE A CG    1 
ATOM   473  C  CD1   . PHE A 1 60  ? 257.697 119.629 -50.461 1.00 37.71  ? 91  PHE A CD1   1 
ATOM   474  C  CD2   . PHE A 1 60  ? 258.427 121.178 -48.793 1.00 37.71  ? 91  PHE A CD2   1 
ATOM   475  C  CE1   . PHE A 1 60  ? 258.721 120.051 -51.300 1.00 37.71  ? 91  PHE A CE1   1 
ATOM   476  C  CE2   . PHE A 1 60  ? 259.454 121.604 -49.629 1.00 37.71  ? 91  PHE A CE2   1 
ATOM   477  C  CZ    . PHE A 1 60  ? 259.598 121.039 -50.882 1.00 37.71  ? 91  PHE A CZ    1 
ATOM   478  N  N     . LEU A 1 61  ? 258.190 119.438 -45.813 1.00 43.07  ? 92  LEU A N     1 
ATOM   479  C  CA    . LEU A 1 61  ? 259.411 119.693 -45.078 1.00 43.07  ? 92  LEU A CA    1 
ATOM   480  C  C     . LEU A 1 61  ? 259.966 118.402 -44.519 1.00 43.07  ? 92  LEU A C     1 
ATOM   481  O  O     . LEU A 1 61  ? 261.172 118.168 -44.573 1.00 43.07  ? 92  LEU A O     1 
ATOM   482  C  CB    . LEU A 1 61  ? 259.160 120.689 -43.938 1.00 51.89  ? 92  LEU A CB    1 
ATOM   483  C  CG    . LEU A 1 61  ? 259.196 122.187 -44.275 1.00 51.89  ? 92  LEU A CG    1 
ATOM   484  C  CD1   . LEU A 1 61  ? 258.323 122.472 -45.475 1.00 51.89  ? 92  LEU A CD1   1 
ATOM   485  C  CD2   . LEU A 1 61  ? 258.728 122.984 -43.080 1.00 51.89  ? 92  LEU A CD2   1 
ATOM   486  N  N     . LEU A 1 62  ? 259.082 117.559 -43.996 1.00 38.58  ? 93  LEU A N     1 
ATOM   487  C  CA    . LEU A 1 62  ? 259.493 116.291 -43.402 1.00 38.58  ? 93  LEU A CA    1 
ATOM   488  C  C     . LEU A 1 62  ? 260.057 115.289 -44.402 1.00 38.58  ? 93  LEU A C     1 
ATOM   489  O  O     . LEU A 1 62  ? 260.707 114.322 -44.021 1.00 38.58  ? 93  LEU A O     1 
ATOM   490  C  CB    . LEU A 1 62  ? 258.321 115.671 -42.630 1.00 32.70  ? 93  LEU A CB    1 
ATOM   491  C  CG    . LEU A 1 62  ? 258.092 116.267 -41.236 1.00 32.70  ? 93  LEU A CG    1 
ATOM   492  C  CD1   . LEU A 1 62  ? 256.765 115.822 -40.671 1.00 32.70  ? 93  LEU A CD1   1 
ATOM   493  C  CD2   . LEU A 1 62  ? 259.228 115.845 -40.317 1.00 32.70  ? 93  LEU A CD2   1 
ATOM   494  N  N     . THR A 1 63  ? 259.848 115.544 -45.683 1.00 28.19  ? 94  THR A N     1 
ATOM   495  C  CA    . THR A 1 63  ? 260.326 114.625 -46.700 1.00 28.19  ? 94  THR A CA    1 
ATOM   496  C  C     . THR A 1 63  ? 261.265 115.246 -47.745 1.00 28.19  ? 94  THR A C     1 
ATOM   497  O  O     . THR A 1 63  ? 261.341 114.764 -48.879 1.00 28.19  ? 94  THR A O     1 
ATOM   498  C  CB    . THR A 1 63  ? 259.112 113.965 -47.412 1.00 48.17  ? 94  THR A CB    1 
ATOM   499  O  OG1   . THR A 1 63  ? 258.270 114.976 -47.989 1.00 48.17  ? 94  THR A OG1   1 
ATOM   500  C  CG2   . THR A 1 63  ? 258.284 113.166 -46.417 1.00 48.17  ? 94  THR A CG2   1 
ATOM   501  N  N     . HIS A 1 64  ? 262.004 116.291 -47.364 1.00 48.52  ? 95  HIS A N     1 
ATOM   502  C  CA    . HIS A 1 64  ? 262.891 116.946 -48.324 1.00 48.52  ? 95  HIS A CA    1 
ATOM   503  C  C     . HIS A 1 64  ? 264.286 117.418 -47.914 1.00 48.52  ? 95  HIS A C     1 
ATOM   504  O  O     . HIS A 1 64  ? 265.278 117.087 -48.580 1.00 48.52  ? 95  HIS A O     1 
ATOM   505  C  CB    . HIS A 1 64  ? 262.152 118.116 -48.980 1.00 51.25  ? 95  HIS A CB    1 
ATOM   506  C  CG    . HIS A 1 64  ? 261.135 117.682 -49.983 1.00 51.25  ? 95  HIS A CG    1 
ATOM   507  N  ND1   . HIS A 1 64  ? 259.990 117.005 -49.631 1.00 51.25  ? 95  HIS A ND1   1 
ATOM   508  C  CD2   . HIS A 1 64  ? 261.136 117.742 -51.335 1.00 51.25  ? 95  HIS A CD2   1 
ATOM   509  C  CE1   . HIS A 1 64  ? 259.330 116.658 -50.722 1.00 51.25  ? 95  HIS A CE1   1 
ATOM   510  N  NE2   . HIS A 1 64  ? 260.005 117.093 -51.771 1.00 51.25  ? 95  HIS A NE2   1 
ATOM   511  N  N     . GLY A 1 65  ? 264.368 118.201 -46.846 1.00 53.61  ? 96  GLY A N     1 
ATOM   512  C  CA    . GLY A 1 65  ? 265.661 118.720 -46.425 1.00 53.61  ? 96  GLY A CA    1 
ATOM   513  C  C     . GLY A 1 65  ? 266.713 117.702 -46.011 1.00 53.61  ? 96  GLY A C     1 
ATOM   514  O  O     . GLY A 1 65  ? 267.265 117.798 -44.902 1.00 53.61  ? 96  GLY A O     1 
ATOM   515  N  N     . ARG A 1 66  ? 267.013 116.746 -46.893 1.00 67.10  ? 97  ARG A N     1 
ATOM   516  C  CA    . ARG A 1 66  ? 267.985 115.704 -46.583 1.00 67.10  ? 97  ARG A CA    1 
ATOM   517  C  C     . ARG A 1 66  ? 269.370 116.204 -46.167 1.00 67.10  ? 97  ARG A C     1 
ATOM   518  O  O     . ARG A 1 66  ? 270.362 115.519 -46.374 1.00 67.10  ? 97  ARG A O     1 
ATOM   519  C  CB    . ARG A 1 66  ? 268.119 114.728 -47.758 1.00 65.81  ? 97  ARG A CB    1 
ATOM   520  C  CG    . ARG A 1 66  ? 268.622 115.330 -49.066 1.00 65.81  ? 97  ARG A CG    1 
ATOM   521  C  CD    . ARG A 1 66  ? 269.510 114.335 -49.854 1.00 65.81  ? 97  ARG A CD    1 
ATOM   522  N  NE    . ARG A 1 66  ? 270.872 114.252 -49.312 1.00 65.81  ? 97  ARG A NE    1 
ATOM   523  C  CZ    . ARG A 1 66  ? 271.207 113.673 -48.156 1.00 65.81  ? 97  ARG A CZ    1 
ATOM   524  N  NH1   . ARG A 1 66  ? 272.482 113.678 -47.769 1.00 65.81  ? 97  ARG A NH1   1 
ATOM   525  N  NH2   . ARG A 1 66  ? 270.287 113.075 -47.388 1.00 65.81  ? 97  ARG A NH2   1 
ATOM   526  N  N     . TRP A 1 67  ? 269.427 117.402 -45.591 1.00 48.60  ? 98  TRP A N     1 
ATOM   527  C  CA    . TRP A 1 67  ? 270.665 118.005 -45.091 1.00 48.60  ? 98  TRP A CA    1 
ATOM   528  C  C     . TRP A 1 67  ? 270.297 118.628 -43.762 1.00 48.60  ? 98  TRP A C     1 
ATOM   529  O  O     . TRP A 1 67  ? 270.949 118.408 -42.747 1.00 48.60  ? 98  TRP A O     1 
ATOM   530  C  CB    . TRP A 1 67  ? 271.185 119.097 -46.031 1.00 56.47  ? 98  TRP A CB    1 
ATOM   531  C  CG    . TRP A 1 67  ? 272.224 118.610 -47.002 1.00 56.47  ? 98  TRP A CG    1 
ATOM   532  C  CD1   . TRP A 1 67  ? 272.898 117.414 -46.960 1.00 56.47  ? 98  TRP A CD1   1 
ATOM   533  C  CD2   . TRP A 1 67  ? 272.732 119.315 -48.147 1.00 56.47  ? 98  TRP A CD2   1 
ATOM   534  N  NE1   . TRP A 1 67  ? 273.790 117.335 -48.009 1.00 56.47  ? 98  TRP A NE1   1 
ATOM   535  C  CE2   . TRP A 1 67  ? 273.708 118.485 -48.751 1.00 56.47  ? 98  TRP A CE2   1 
ATOM   536  C  CE3   . TRP A 1 67  ? 272.456 120.563 -48.724 1.00 56.47  ? 98  TRP A CE3   1 
ATOM   537  C  CZ2   . TRP A 1 67  ? 274.407 118.868 -49.904 1.00 56.47  ? 98  TRP A CZ2   1 
ATOM   538  C  CZ3   . TRP A 1 67  ? 273.153 120.938 -49.870 1.00 56.47  ? 98  TRP A CZ3   1 
ATOM   539  C  CH2   . TRP A 1 67  ? 274.116 120.091 -50.445 1.00 56.47  ? 98  TRP A CH2   1 
ATOM   540  N  N     . LEU A 1 68  ? 269.227 119.409 -43.791 1.00 42.35  ? 99  LEU A N     1 
ATOM   541  C  CA    . LEU A 1 68  ? 268.731 120.066 -42.601 1.00 42.35  ? 99  LEU A CA    1 
ATOM   542  C  C     . LEU A 1 68  ? 268.307 118.991 -41.617 1.00 42.35  ? 99  LEU A C     1 
ATOM   543  O  O     . LEU A 1 68  ? 268.422 119.167 -40.408 1.00 42.35  ? 99  LEU A O     1 
ATOM   544  C  CB    . LEU A 1 68  ? 267.537 120.956 -42.951 1.00 65.75  ? 99  LEU A CB    1 
ATOM   545  C  CG    . LEU A 1 68  ? 266.498 121.070 -41.828 1.00 65.75  ? 99  LEU A CG    1 
ATOM   546  C  CD1   . LEU A 1 68  ? 266.437 122.488 -41.260 1.00 65.75  ? 99  LEU A CD1   1 
ATOM   547  C  CD2   . LEU A 1 68  ? 265.146 120.647 -42.386 1.00 65.75  ? 99  LEU A CD2   1 
ATOM   548  N  N     . TRP A 1 69  ? 267.828 117.867 -42.141 1.00 42.74  ? 100 TRP A N     1 
ATOM   549  C  CA    . TRP A 1 69  ? 267.371 116.780 -41.283 1.00 42.74  ? 100 TRP A CA    1 
ATOM   550  C  C     . TRP A 1 69  ? 268.502 115.974 -40.651 1.00 42.74  ? 100 TRP A C     1 
ATOM   551  O  O     . TRP A 1 69  ? 268.434 115.612 -39.476 1.00 42.74  ? 100 TRP A O     1 
ATOM   552  C  CB    . TRP A 1 69  ? 266.407 115.873 -42.053 1.00 23.93  ? 100 TRP A CB    1 
ATOM   553  C  CG    . TRP A 1 69  ? 265.073 116.527 -42.276 1.00 23.93  ? 100 TRP A CG    1 
ATOM   554  C  CD1   . TRP A 1 69  ? 264.519 116.870 -43.470 1.00 23.93  ? 100 TRP A CD1   1 
ATOM   555  C  CD2   . TRP A 1 69  ? 264.147 116.953 -41.269 1.00 23.93  ? 100 TRP A CD2   1 
ATOM   556  N  NE1   . TRP A 1 69  ? 263.311 117.484 -43.276 1.00 23.93  ? 100 TRP A NE1   1 
ATOM   557  C  CE2   . TRP A 1 69  ? 263.056 117.549 -41.933 1.00 23.93  ? 100 TRP A CE2   1 
ATOM   558  C  CE3   . TRP A 1 69  ? 264.134 116.891 -39.870 1.00 23.93  ? 100 TRP A CE3   1 
ATOM   559  C  CZ2   . TRP A 1 69  ? 261.961 118.079 -41.247 1.00 23.93  ? 100 TRP A CZ2   1 
ATOM   560  C  CZ3   . TRP A 1 69  ? 263.048 117.419 -39.190 1.00 23.93  ? 100 TRP A CZ3   1 
ATOM   561  C  CH2   . TRP A 1 69  ? 261.976 118.005 -39.880 1.00 23.93  ? 100 TRP A CH2   1 
ATOM   562  N  N     . ASP A 1 70  ? 269.546 115.703 -41.419 1.00 53.62  ? 101 ASP A N     1 
ATOM   563  C  CA    . ASP A 1 70  ? 270.677 114.963 -40.881 1.00 53.62  ? 101 ASP A CA    1 
ATOM   564  C  C     . ASP A 1 70  ? 271.259 115.739 -39.697 1.00 53.62  ? 101 ASP A C     1 
ATOM   565  O  O     . ASP A 1 70  ? 271.722 115.138 -38.722 1.00 53.62  ? 101 ASP A O     1 
ATOM   566  C  CB    . ASP A 1 70  ? 271.726 114.758 -41.975 1.00 97.24  ? 101 ASP A CB    1 
ATOM   567  C  CG    . ASP A 1 70  ? 271.250 113.785 -43.060 1.00 97.24  ? 101 ASP A CG    1 
ATOM   568  O  OD1   . ASP A 1 70  ? 271.375 112.552 -42.851 1.00 97.24  ? 101 ASP A OD1   1 
ATOM   569  O  OD2   . ASP A 1 70  ? 270.734 114.247 -44.111 1.00 97.24  ? 101 ASP A OD2   1 
ATOM   570  N  N     . PHE A 1 71  ? 271.218 117.072 -39.790 1.00 45.94  ? 102 PHE A N     1 
ATOM   571  C  CA    . PHE A 1 71  ? 271.710 117.963 -38.731 1.00 45.94  ? 102 PHE A CA    1 
ATOM   572  C  C     . PHE A 1 71  ? 270.739 117.888 -37.572 1.00 45.94  ? 102 PHE A C     1 
ATOM   573  O  O     . PHE A 1 71  ? 271.092 117.483 -36.468 1.00 45.94  ? 102 PHE A O     1 
ATOM   574  C  CB    . PHE A 1 71  ? 271.786 119.419 -39.232 1.00 59.15  ? 102 PHE A CB    1 
ATOM   575  C  CG    . PHE A 1 71  ? 271.849 120.459 -38.122 1.00 59.15  ? 102 PHE A CG    1 
ATOM   576  C  CD1   . PHE A 1 71  ? 271.076 121.621 -38.194 1.00 59.15  ? 102 PHE A CD1   1 
ATOM   577  C  CD2   . PHE A 1 71  ? 272.665 120.278 -37.006 1.00 59.15  ? 102 PHE A CD2   1 
ATOM   578  C  CE1   . PHE A 1 71  ? 271.113 122.585 -37.166 1.00 59.15  ? 102 PHE A CE1   1 
ATOM   579  C  CE2   . PHE A 1 71  ? 272.707 121.234 -35.979 1.00 59.15  ? 102 PHE A CE2   1 
ATOM   580  C  CZ    . PHE A 1 71  ? 271.929 122.389 -36.060 1.00 59.15  ? 102 PHE A CZ    1 
ATOM   581  N  N     . VAL A 1 72  ? 269.508 118.294 -37.844 1.00 45.65  ? 103 VAL A N     1 
ATOM   582  C  CA    . VAL A 1 72  ? 268.456 118.270 -36.849 1.00 45.65  ? 103 VAL A CA    1 
ATOM   583  C  C     . VAL A 1 72  ? 268.449 116.922 -36.147 1.00 45.65  ? 103 VAL A C     1 
ATOM   584  O  O     . VAL A 1 72  ? 268.194 116.841 -34.940 1.00 45.65  ? 103 VAL A O     1 
ATOM   585  C  CB    . VAL A 1 72  ? 267.090 118.474 -37.502 1.00 51.90  ? 103 VAL A CB    1 
ATOM   586  C  CG1   . VAL A 1 72  ? 265.998 118.166 -36.501 1.00 51.90  ? 103 VAL A CG1   1 
ATOM   587  C  CG2   . VAL A 1 72  ? 266.964 119.898 -38.016 1.00 51.90  ? 103 VAL A CG2   1 
ATOM   588  N  N     . ASN A 1 73  ? 268.728 115.869 -36.916 1.00 47.30  ? 104 ASN A N     1 
ATOM   589  C  CA    . ASN A 1 73  ? 268.756 114.508 -36.391 1.00 47.30  ? 104 ASN A CA    1 
ATOM   590  C  C     . ASN A 1 73  ? 269.828 114.274 -35.337 1.00 47.30  ? 104 ASN A C     1 
ATOM   591  O  O     . ASN A 1 73  ? 269.619 113.511 -34.391 1.00 47.30  ? 104 ASN A O     1 
ATOM   592  C  CB    . ASN A 1 73  ? 268.953 113.501 -37.520 1.00 46.56  ? 104 ASN A CB    1 
ATOM   593  C  CG    . ASN A 1 73  ? 267.680 112.758 -37.866 1.00 46.56  ? 104 ASN A CG    1 
ATOM   594  O  OD1   . ASN A 1 73  ? 266.850 112.496 -37.002 1.00 46.56  ? 104 ASN A OD1   1 
ATOM   595  N  ND2   . ASN A 1 73  ? 267.531 112.395 -39.131 1.00 46.56  ? 104 ASN A ND2   1 
ATOM   596  N  N     . ALA A 1 74  ? 270.973 114.925 -35.495 1.00 45.05  ? 105 ALA A N     1 
ATOM   597  C  CA    . ALA A 1 74  ? 272.061 114.750 -34.549 1.00 45.05  ? 105 ALA A CA    1 
ATOM   598  C  C     . ALA A 1 74  ? 272.099 115.814 -33.462 1.00 45.05  ? 105 ALA A C     1 
ATOM   599  O  O     . ALA A 1 74  ? 273.161 116.204 -32.994 1.00 45.05  ? 105 ALA A O     1 
ATOM   600  C  CB    . ALA A 1 74  ? 273.371 114.712 -35.289 1.00 46.22  ? 105 ALA A CB    1 
ATOM   601  N  N     . THR A 1 75  ? 270.930 116.285 -33.054 1.00 51.44  ? 106 THR A N     1 
ATOM   602  C  CA    . THR A 1 75  ? 270.859 117.290 -32.006 1.00 51.44  ? 106 THR A CA    1 
ATOM   603  C  C     . THR A 1 75  ? 269.546 117.157 -31.243 1.00 51.44  ? 106 THR A C     1 
ATOM   604  O  O     . THR A 1 75  ? 268.638 116.432 -31.655 1.00 51.44  ? 106 THR A O     1 
ATOM   605  C  CB    . THR A 1 75  ? 270.920 118.726 -32.571 1.00 44.25  ? 106 THR A CB    1 
ATOM   606  O  OG1   . THR A 1 75  ? 269.601 119.292 -32.584 1.00 44.25  ? 106 THR A OG1   1 
ATOM   607  C  CG2   . THR A 1 75  ? 271.472 118.723 -33.990 1.00 44.25  ? 106 THR A CG2   1 
ATOM   608  N  N     . PHE A 1 76  ? 269.469 117.875 -30.130 1.00 59.27  ? 107 PHE A N     1 
ATOM   609  C  CA    . PHE A 1 76  ? 268.294 117.916 -29.261 1.00 59.27  ? 107 PHE A CA    1 
ATOM   610  C  C     . PHE A 1 76  ? 267.072 118.306 -30.091 1.00 59.27  ? 107 PHE A C     1 
ATOM   611  O  O     . PHE A 1 76  ? 265.927 118.017 -29.721 1.00 59.27  ? 107 PHE A O     1 
ATOM   612  C  CB    . PHE A 1 76  ? 268.513 118.987 -28.198 1.00 69.50  ? 107 PHE A CB    1 
ATOM   613  C  CG    . PHE A 1 76  ? 268.679 120.367 -28.785 1.00 69.50  ? 107 PHE A CG    1 
ATOM   614  C  CD1   . PHE A 1 76  ? 267.610 121.273 -28.786 1.00 69.50  ? 107 PHE A CD1   1 
ATOM   615  C  CD2   . PHE A 1 76  ? 269.863 120.712 -29.447 1.00 69.50  ? 107 PHE A CD2   1 
ATOM   616  C  CE1   . PHE A 1 76  ? 267.707 122.498 -29.442 1.00 69.50  ? 107 PHE A CE1   1 
ATOM   617  C  CE2   . PHE A 1 76  ? 269.974 121.925 -30.104 1.00 69.50  ? 107 PHE A CE2   1 
ATOM   618  C  CZ    . PHE A 1 76  ? 268.891 122.826 -30.106 1.00 69.50  ? 107 PHE A CZ    1 
ATOM   619  N  N     . ILE A 1 77  ? 267.328 118.995 -31.200 1.00 50.86  ? 108 ILE A N     1 
ATOM   620  C  CA    . ILE A 1 77  ? 266.265 119.436 -32.079 1.00 50.86  ? 108 ILE A CA    1 
ATOM   621  C  C     . ILE A 1 77  ? 265.404 118.244 -32.485 1.00 50.86  ? 108 ILE A C     1 
ATOM   622  O  O     . ILE A 1 77  ? 264.275 118.399 -32.957 1.00 50.86  ? 108 ILE A O     1 
ATOM   623  C  CB    . ILE A 1 77  ? 266.852 120.127 -33.312 1.00 51.08  ? 108 ILE A CB    1 
ATOM   624  C  CG1   . ILE A 1 77  ? 267.610 121.377 -32.857 1.00 51.08  ? 108 ILE A CG1   1 
ATOM   625  C  CG2   . ILE A 1 77  ? 265.741 120.498 -34.295 1.00 51.08  ? 108 ILE A CG2   1 
ATOM   626  C  CD1   . ILE A 1 77  ? 268.396 122.054 -33.946 1.00 51.08  ? 108 ILE A CD1   1 
ATOM   627  N  N     . ARG A 1 78  ? 265.949 117.051 -32.288 1.00 47.02  ? 109 ARG A N     1 
ATOM   628  C  CA    . ARG A 1 78  ? 265.241 115.819 -32.592 1.00 47.02  ? 109 ARG A CA    1 
ATOM   629  C  C     . ARG A 1 78  ? 264.166 115.621 -31.521 1.00 47.02  ? 109 ARG A C     1 
ATOM   630  O  O     . ARG A 1 78  ? 262.967 115.601 -31.810 1.00 47.02  ? 109 ARG A O     1 
ATOM   631  C  CB    . ARG A 1 78  ? 266.226 114.651 -32.583 1.00 47.67  ? 109 ARG A CB    1 
ATOM   632  C  CG    . ARG A 1 78  ? 265.587 113.306 -32.761 1.00 47.67  ? 109 ARG A CG    1 
ATOM   633  C  CD    . ARG A 1 78  ? 266.630 112.202 -32.864 1.00 47.67  ? 109 ARG A CD    1 
ATOM   634  N  NE    . ARG A 1 78  ? 266.018 110.877 -32.789 1.00 47.67  ? 109 ARG A NE    1 
ATOM   635  C  CZ    . ARG A 1 78  ? 266.669 109.736 -32.978 1.00 47.67  ? 109 ARG A CZ    1 
ATOM   636  N  NH1   . ARG A 1 78  ? 267.967 109.754 -33.258 1.00 47.67  ? 109 ARG A NH1   1 
ATOM   637  N  NH2   . ARG A 1 78  ? 266.022 108.576 -32.890 1.00 47.67  ? 109 ARG A NH2   1 
ATOM   638  N  N     . ASP A 1 79  ? 264.611 115.494 -30.277 1.00 47.65  ? 110 ASP A N     1 
ATOM   639  C  CA    . ASP A 1 79  ? 263.712 115.301 -29.145 1.00 47.65  ? 110 ASP A CA    1 
ATOM   640  C  C     . ASP A 1 79  ? 262.623 116.343 -29.146 1.00 47.65  ? 110 ASP A C     1 
ATOM   641  O  O     . ASP A 1 79  ? 261.485 116.070 -28.773 1.00 47.65  ? 110 ASP A O     1 
ATOM   642  C  CB    . ASP A 1 79  ? 264.474 115.415 -27.830 1.00 56.63  ? 110 ASP A CB    1 
ATOM   643  C  CG    . ASP A 1 79  ? 265.603 114.419 -27.720 1.00 56.63  ? 110 ASP A CG    1 
ATOM   644  O  OD1   . ASP A 1 79  ? 265.639 113.462 -28.528 1.00 56.63  ? 110 ASP A OD1   1 
ATOM   645  O  OD2   . ASP A 1 79  ? 266.448 114.596 -26.814 1.00 56.63  ? 110 ASP A OD2   1 
ATOM   646  N  N     . THR A 1 80  ? 262.994 117.547 -29.555 1.00 46.07  ? 111 THR A N     1 
ATOM   647  C  CA    . THR A 1 80  ? 262.057 118.652 -29.592 1.00 46.07  ? 111 THR A CA    1 
ATOM   648  C  C     . THR A 1 80  ? 260.954 118.352 -30.580 1.00 46.07  ? 111 THR A C     1 
ATOM   649  O  O     . THR A 1 80  ? 259.771 118.466 -30.265 1.00 46.07  ? 111 THR A O     1 
ATOM   650  C  CB    . THR A 1 80  ? 262.743 119.941 -30.021 1.00 41.92  ? 111 THR A CB    1 
ATOM   651  O  OG1   . THR A 1 80  ? 264.084 119.960 -29.515 1.00 41.92  ? 111 THR A OG1   1 
ATOM   652  C  CG2   . THR A 1 80  ? 261.976 121.133 -29.480 1.00 41.92  ? 111 THR A CG2   1 
ATOM   653  N  N     . LEU A 1 81  ? 261.353 117.971 -31.787 1.00 51.80  ? 112 LEU A N     1 
ATOM   654  C  CA    . LEU A 1 81  ? 260.391 117.648 -32.826 1.00 51.80  ? 112 LEU A CA    1 
ATOM   655  C  C     . LEU A 1 81  ? 259.587 116.427 -32.386 1.00 51.80  ? 112 LEU A C     1 
ATOM   656  O  O     . LEU A 1 81  ? 258.353 116.461 -32.387 1.00 51.80  ? 112 LEU A O     1 
ATOM   657  C  CB    . LEU A 1 81  ? 261.120 117.395 -34.151 1.00 39.77  ? 112 LEU A CB    1 
ATOM   658  C  CG    . LEU A 1 81  ? 261.852 118.648 -34.661 1.00 39.77  ? 112 LEU A CG    1 
ATOM   659  C  CD1   . LEU A 1 81  ? 262.932 118.260 -35.629 1.00 39.77  ? 112 LEU A CD1   1 
ATOM   660  C  CD2   . LEU A 1 81  ? 260.862 119.615 -35.309 1.00 39.77  ? 112 LEU A CD2   1 
ATOM   661  N  N     . MET A 1 82  ? 260.274 115.360 -31.975 1.00 60.19  ? 113 MET A N     1 
ATOM   662  C  CA    . MET A 1 82  ? 259.571 114.162 -31.540 1.00 60.19  ? 113 MET A CA    1 
ATOM   663  C  C     . MET A 1 82  ? 258.522 114.532 -30.490 1.00 60.19  ? 113 MET A C     1 
ATOM   664  O  O     . MET A 1 82  ? 257.354 114.159 -30.621 1.00 60.19  ? 113 MET A O     1 
ATOM   665  C  CB    . MET A 1 82  ? 260.551 113.131 -30.977 1.00 44.84  ? 113 MET A CB    1 
ATOM   666  C  CG    . MET A 1 82  ? 259.921 111.749 -30.745 1.00 44.84  ? 113 MET A CG    1 
ATOM   667  S  SD    . MET A 1 82  ? 259.358 110.858 -32.244 1.00 44.84  ? 113 MET A SD    1 
ATOM   668  C  CE    . MET A 1 82  ? 257.629 111.224 -32.269 1.00 44.84  ? 113 MET A CE    1 
ATOM   669  N  N     . ARG A 1 83  ? 258.917 115.281 -29.464 1.00 36.78  ? 114 ARG A N     1 
ATOM   670  C  CA    . ARG A 1 83  ? 257.965 115.677 -28.424 1.00 36.78  ? 114 ARG A CA    1 
ATOM   671  C  C     . ARG A 1 83  ? 256.818 116.461 -29.009 1.00 36.78  ? 114 ARG A C     1 
ATOM   672  O  O     . ARG A 1 83  ? 255.685 116.361 -28.555 1.00 36.78  ? 114 ARG A O     1 
ATOM   673  C  CB    . ARG A 1 83  ? 258.640 116.525 -27.348 1.00 54.99  ? 114 ARG A CB    1 
ATOM   674  C  CG    . ARG A 1 83  ? 257.670 117.218 -26.385 1.00 54.99  ? 114 ARG A CG    1 
ATOM   675  C  CD    . ARG A 1 83  ? 258.363 117.479 -25.062 1.00 54.99  ? 114 ARG A CD    1 
ATOM   676  N  NE    . ARG A 1 83  ? 259.804 117.668 -25.260 1.00 54.99  ? 114 ARG A NE    1 
ATOM   677  C  CZ    . ARG A 1 83  ? 260.748 117.325 -24.378 1.00 54.99  ? 114 ARG A CZ    1 
ATOM   678  N  NH1   . ARG A 1 83  ? 260.412 116.771 -23.214 1.00 54.99  ? 114 ARG A NH1   1 
ATOM   679  N  NH2   . ARG A 1 83  ? 262.036 117.510 -24.671 1.00 54.99  ? 114 ARG A NH2   1 
ATOM   680  N  N     . LEU A 1 84  ? 257.126 117.262 -30.017 1.00 53.61  ? 115 LEU A N     1 
ATOM   681  C  CA    . LEU A 1 84  ? 256.106 118.065 -30.656 1.00 53.61  ? 115 LEU A CA    1 
ATOM   682  C  C     . LEU A 1 84  ? 255.171 117.076 -31.328 1.00 53.61  ? 115 LEU A C     1 
ATOM   683  O  O     . LEU A 1 84  ? 253.976 117.019 -31.010 1.00 53.61  ? 115 LEU A O     1 
ATOM   684  C  CB    . LEU A 1 84  ? 256.745 119.006 -31.682 1.00 40.52  ? 115 LEU A CB    1 
ATOM   685  C  CG    . LEU A 1 84  ? 255.795 119.992 -32.359 1.00 40.52  ? 115 LEU A CG    1 
ATOM   686  C  CD1   . LEU A 1 84  ? 255.269 120.990 -31.343 1.00 40.52  ? 115 LEU A CD1   1 
ATOM   687  C  CD2   . LEU A 1 84  ? 256.524 120.697 -33.480 1.00 40.52  ? 115 LEU A CD2   1 
ATOM   688  N  N     . VAL A 1 85  ? 255.735 116.284 -32.240 1.00 46.34  ? 116 VAL A N     1 
ATOM   689  C  CA    . VAL A 1 85  ? 254.997 115.263 -32.978 1.00 46.34  ? 116 VAL A CA    1 
ATOM   690  C  C     . VAL A 1 85  ? 253.959 114.561 -32.101 1.00 46.34  ? 116 VAL A C     1 
ATOM   691  O  O     . VAL A 1 85  ? 252.757 114.652 -32.354 1.00 46.34  ? 116 VAL A O     1 
ATOM   692  C  CB    . VAL A 1 85  ? 255.951 114.194 -33.540 1.00 37.13  ? 116 VAL A CB    1 
ATOM   693  C  CG1   . VAL A 1 85  ? 255.156 113.109 -34.237 1.00 37.13  ? 116 VAL A CG1   1 
ATOM   694  C  CG2   . VAL A 1 85  ? 256.925 114.829 -34.498 1.00 37.13  ? 116 VAL A CG2   1 
ATOM   695  N  N     . LEU A 1 86  ? 254.430 113.856 -31.075 1.00 34.56  ? 117 LEU A N     1 
ATOM   696  C  CA    . LEU A 1 86  ? 253.539 113.143 -30.163 1.00 34.56  ? 117 LEU A CA    1 
ATOM   697  C  C     . LEU A 1 86  ? 252.374 114.022 -29.695 1.00 34.56  ? 117 LEU A C     1 
ATOM   698  O  O     . LEU A 1 86  ? 251.267 113.923 -30.196 1.00 34.56  ? 117 LEU A O     1 
ATOM   699  C  CB    . LEU A 1 86  ? 254.327 112.650 -28.949 1.00 36.50  ? 117 LEU A CB    1 
ATOM   700  C  CG    . LEU A 1 86  ? 255.552 111.784 -29.207 1.00 36.50  ? 117 LEU A CG    1 
ATOM   701  C  CD1   . LEU A 1 86  ? 256.199 111.461 -27.889 1.00 36.50  ? 117 LEU A CD1   1 
ATOM   702  C  CD2   . LEU A 1 86  ? 255.156 110.509 -29.912 1.00 36.50  ? 117 LEU A CD2   1 
ATOM   703  N  N     . THR A 1 87  ? 252.643 114.880 -28.724 1.00 46.63  ? 118 THR A N     1 
ATOM   704  C  CA    . THR A 1 87  ? 251.639 115.777 -28.170 1.00 46.63  ? 118 THR A CA    1 
ATOM   705  C  C     . THR A 1 87  ? 250.542 116.198 -29.149 1.00 46.63  ? 118 THR A C     1 
ATOM   706  O  O     . THR A 1 87  ? 249.404 115.719 -29.057 1.00 46.63  ? 118 THR A O     1 
ATOM   707  C  CB    . THR A 1 87  ? 252.312 117.043 -27.610 1.00 40.90  ? 118 THR A CB    1 
ATOM   708  O  OG1   . THR A 1 87  ? 253.222 117.566 -28.586 1.00 40.90  ? 118 THR A OG1   1 
ATOM   709  C  CG2   . THR A 1 87  ? 253.072 116.724 -26.341 1.00 40.90  ? 118 THR A CG2   1 
ATOM   710  N  N     . VAL A 1 88  ? 250.896 117.087 -30.083 1.00 54.95  ? 119 VAL A N     1 
ATOM   711  C  CA    . VAL A 1 88  ? 249.953 117.616 -31.076 1.00 54.95  ? 119 VAL A CA    1 
ATOM   712  C  C     . VAL A 1 88  ? 249.073 116.569 -31.729 1.00 54.95  ? 119 VAL A C     1 
ATOM   713  O  O     . VAL A 1 88  ? 247.853 116.731 -31.814 1.00 54.95  ? 119 VAL A O     1 
ATOM   714  C  CB    . VAL A 1 88  ? 250.661 118.347 -32.207 1.00 34.27  ? 119 VAL A CB    1 
ATOM   715  C  CG1   . VAL A 1 88  ? 249.647 119.170 -32.977 1.00 34.27  ? 119 VAL A CG1   1 
ATOM   716  C  CG2   . VAL A 1 88  ? 251.781 119.209 -31.653 1.00 34.27  ? 119 VAL A CG2   1 
ATOM   717  N  N     . ARG A 1 89  ? 249.705 115.511 -32.218 1.00 38.64  ? 120 ARG A N     1 
ATOM   718  C  CA    . ARG A 1 89  ? 248.990 114.424 -32.847 1.00 38.64  ? 120 ARG A CA    1 
ATOM   719  C  C     . ARG A 1 89  ? 248.068 113.763 -31.807 1.00 38.64  ? 120 ARG A C     1 
ATOM   720  O  O     . ARG A 1 89  ? 246.842 113.752 -31.959 1.00 38.64  ? 120 ARG A O     1 
ATOM   721  C  CB    . ARG A 1 89  ? 250.004 113.417 -33.409 1.00 36.44  ? 120 ARG A CB    1 
ATOM   722  C  CG    . ARG A 1 89  ? 249.879 113.139 -34.910 1.00 36.44  ? 120 ARG A CG    1 
ATOM   723  C  CD    . ARG A 1 89  ? 249.605 114.410 -35.693 1.00 36.44  ? 120 ARG A CD    1 
ATOM   724  N  NE    . ARG A 1 89  ? 249.453 114.216 -37.136 1.00 36.44  ? 120 ARG A NE    1 
ATOM   725  C  CZ    . ARG A 1 89  ? 250.408 113.742 -37.928 1.00 36.44  ? 120 ARG A CZ    1 
ATOM   726  N  NH1   . ARG A 1 89  ? 251.582 113.400 -37.415 1.00 36.44  ? 120 ARG A NH1   1 
ATOM   727  N  NH2   . ARG A 1 89  ? 250.208 113.648 -39.234 1.00 36.44  ? 120 ARG A NH2   1 
ATOM   728  N  N     . SER A 1 90  ? 248.657 113.251 -30.734 1.00 42.65  ? 121 SER A N     1 
ATOM   729  C  CA    . SER A 1 90  ? 247.912 112.567 -29.677 1.00 42.65  ? 121 SER A CA    1 
ATOM   730  C  C     . SER A 1 90  ? 246.798 113.376 -29.006 1.00 42.65  ? 121 SER A C     1 
ATOM   731  O  O     . SER A 1 90  ? 245.871 112.811 -28.418 1.00 42.65  ? 121 SER A O     1 
ATOM   732  C  CB    . SER A 1 90  ? 248.890 112.051 -28.609 1.00 66.74  ? 121 SER A CB    1 
ATOM   733  O  OG    . SER A 1 90  ? 249.766 111.052 -29.130 1.00 66.74  ? 121 SER A OG    1 
ATOM   734  N  N     . ASN A 1 91  ? 246.886 114.696 -29.090 1.00 41.25  ? 122 ASN A N     1 
ATOM   735  C  CA    . ASN A 1 91  ? 245.880 115.554 -28.487 1.00 41.25  ? 122 ASN A CA    1 
ATOM   736  C  C     . ASN A 1 91  ? 244.569 115.554 -29.297 1.00 41.25  ? 122 ASN A C     1 
ATOM   737  O  O     . ASN A 1 91  ? 243.661 116.345 -29.036 1.00 41.25  ? 122 ASN A O     1 
ATOM   738  C  CB    . ASN A 1 91  ? 246.439 116.972 -28.385 1.00 79.56  ? 122 ASN A CB    1 
ATOM   739  C  CG    . ASN A 1 91  ? 245.549 117.904 -27.562 1.00 79.56  ? 122 ASN A CG    1 
ATOM   740  O  OD1   . ASN A 1 91  ? 245.453 117.782 -26.329 1.00 79.56  ? 122 ASN A OD1   1 
ATOM   741  N  ND2   . ASN A 1 91  ? 244.888 118.843 -28.245 1.00 79.56  ? 122 ASN A ND2   1 
ATOM   742  N  N     . LEU A 1 92  ? 244.463 114.663 -30.276 1.00 51.22  ? 123 LEU A N     1 
ATOM   743  C  CA    . LEU A 1 92  ? 243.264 114.600 -31.110 1.00 51.22  ? 123 LEU A CA    1 
ATOM   744  C  C     . LEU A 1 92  ? 242.275 113.484 -30.771 1.00 51.22  ? 123 LEU A C     1 
ATOM   745  O  O     . LEU A 1 92  ? 241.124 113.509 -31.214 1.00 51.22  ? 123 LEU A O     1 
ATOM   746  C  CB    . LEU A 1 92  ? 243.659 114.473 -32.583 1.00 33.42  ? 123 LEU A CB    1 
ATOM   747  C  CG    . LEU A 1 92  ? 244.017 115.778 -33.274 1.00 33.42  ? 123 LEU A CG    1 
ATOM   748  C  CD1   . LEU A 1 92  ? 244.295 115.548 -34.746 1.00 33.42  ? 123 LEU A CD1   1 
ATOM   749  C  CD2   . LEU A 1 92  ? 242.857 116.723 -33.123 1.00 33.42  ? 123 LEU A CD2   1 
ATOM   750  N  N     . ILE A 1 93  ? 242.722 112.508 -29.991 1.00 44.63  ? 124 ILE A N     1 
ATOM   751  C  CA    . ILE A 1 93  ? 241.875 111.392 -29.633 1.00 44.63  ? 124 ILE A CA    1 
ATOM   752  C  C     . ILE A 1 93  ? 241.328 111.545 -28.231 1.00 44.63  ? 124 ILE A C     1 
ATOM   753  O  O     . ILE A 1 93  ? 242.057 111.376 -27.260 1.00 44.63  ? 124 ILE A O     1 
ATOM   754  C  CB    . ILE A 1 93  ? 242.658 110.105 -29.703 1.00 30.18  ? 124 ILE A CB    1 
ATOM   755  C  CG1   . ILE A 1 93  ? 243.516 110.095 -30.965 1.00 30.18  ? 124 ILE A CG1   1 
ATOM   756  C  CG2   . ILE A 1 93  ? 241.701 108.941 -29.713 1.00 30.18  ? 124 ILE A CG2   1 
ATOM   757  C  CD1   . ILE A 1 93  ? 242.720 110.230 -32.230 1.00 30.18  ? 124 ILE A CD1   1 
ATOM   758  N  N     . PRO A 1 94  ? 240.031 111.848 -28.098 1.00 41.81  ? 125 PRO A N     1 
ATOM   759  C  CA    . PRO A 1 94  ? 239.423 112.019 -26.777 1.00 41.81  ? 125 PRO A CA    1 
ATOM   760  C  C     . PRO A 1 94  ? 239.745 110.889 -25.812 1.00 41.81  ? 125 PRO A C     1 
ATOM   761  O  O     . PRO A 1 94  ? 239.632 109.715 -26.160 1.00 41.81  ? 125 PRO A O     1 
ATOM   762  C  CB    . PRO A 1 94  ? 237.935 112.124 -27.091 1.00 36.46  ? 125 PRO A CB    1 
ATOM   763  C  CG    . PRO A 1 94  ? 237.803 111.352 -28.328 1.00 36.46  ? 125 PRO A CG    1 
ATOM   764  C  CD    . PRO A 1 94  ? 238.993 111.780 -29.131 1.00 36.46  ? 125 PRO A CD    1 
ATOM   765  N  N     . SER A 1 95  ? 240.154 111.263 -24.600 1.00 37.01  ? 126 SER A N     1 
ATOM   766  C  CA    . SER A 1 95  ? 240.514 110.314 -23.557 1.00 37.01  ? 126 SER A CA    1 
ATOM   767  C  C     . SER A 1 95  ? 240.448 110.974 -22.189 1.00 37.01  ? 126 SER A C     1 
ATOM   768  O  O     . SER A 1 95  ? 241.153 111.930 -21.935 1.00 37.01  ? 126 SER A O     1 
ATOM   769  C  CB    . SER A 1 95  ? 241.923 109.800 -23.792 1.00 31.86  ? 126 SER A CB    1 
ATOM   770  O  OG    . SER A 1 95  ? 242.411 109.198 -22.614 1.00 31.86  ? 126 SER A OG    1 
ATOM   771  N  N     . PRO A 1 96  ? 239.614 110.462 -21.278 1.00 50.31  ? 127 PRO A N     1 
ATOM   772  C  CA    . PRO A 1 96  ? 238.711 109.312 -21.382 1.00 50.31  ? 127 PRO A CA    1 
ATOM   773  C  C     . PRO A 1 96  ? 237.902 109.274 -22.682 1.00 50.31  ? 127 PRO A C     1 
ATOM   774  O  O     . PRO A 1 96  ? 237.579 110.325 -23.238 1.00 50.31  ? 127 PRO A O     1 
ATOM   775  C  CB    . PRO A 1 96  ? 237.842 109.446 -20.129 1.00 27.37  ? 127 PRO A CB    1 
ATOM   776  C  CG    . PRO A 1 96  ? 237.930 110.894 -19.788 1.00 27.37  ? 127 PRO A CG    1 
ATOM   777  C  CD    . PRO A 1 96  ? 239.360 111.202 -20.036 1.00 27.37  ? 127 PRO A CD    1 
ATOM   778  N  N     . PRO A 1 97  ? 237.583 108.059 -23.186 1.00 36.35  ? 128 PRO A N     1 
ATOM   779  C  CA    . PRO A 1 97  ? 236.821 107.832 -24.420 1.00 36.35  ? 128 PRO A CA    1 
ATOM   780  C  C     . PRO A 1 97  ? 235.420 108.405 -24.406 1.00 36.35  ? 128 PRO A C     1 
ATOM   781  O  O     . PRO A 1 97  ? 234.834 108.626 -23.350 1.00 36.35  ? 128 PRO A O     1 
ATOM   782  C  CB    . PRO A 1 97  ? 236.828 106.317 -24.551 1.00 29.00  ? 128 PRO A CB    1 
ATOM   783  C  CG    . PRO A 1 97  ? 236.862 105.872 -23.144 1.00 29.00  ? 128 PRO A CG    1 
ATOM   784  C  CD    . PRO A 1 97  ? 237.898 106.771 -22.550 1.00 29.00  ? 128 PRO A CD    1 
ATOM   785  N  N     . THR A 1 98  ? 234.878 108.625 -25.590 1.00 45.11  ? 129 THR A N     1 
ATOM   786  C  CA    . THR A 1 98  ? 233.556 109.208 -25.697 1.00 45.11  ? 129 THR A CA    1 
ATOM   787  C  C     . THR A 1 98  ? 232.376 108.296 -26.014 1.00 45.11  ? 129 THR A C     1 
ATOM   788  O  O     . THR A 1 98  ? 231.813 107.674 -25.119 1.00 45.11  ? 129 THR A O     1 
ATOM   789  C  CB    . THR A 1 98  ? 233.569 110.327 -26.715 1.00 37.09  ? 129 THR A CB    1 
ATOM   790  O  OG1   . THR A 1 98  ? 234.460 109.974 -27.782 1.00 37.09  ? 129 THR A OG1   1 
ATOM   791  C  CG2   . THR A 1 98  ? 234.005 111.613 -26.062 1.00 37.09  ? 129 THR A CG2   1 
ATOM   792  N  N     . TYR A 1 99  ? 232.001 108.228 -27.287 1.00 42.67  ? 130 TYR A N     1 
ATOM   793  C  CA    . TYR A 1 99  ? 230.851 107.438 -27.712 1.00 42.67  ? 130 TYR A CA    1 
ATOM   794  C  C     . TYR A 1 99  ? 231.177 106.042 -28.216 1.00 42.67  ? 130 TYR A C     1 
ATOM   795  O  O     . TYR A 1 99  ? 232.344 105.704 -28.429 1.00 42.67  ? 130 TYR A O     1 
ATOM   796  C  CB    . TYR A 1 99  ? 230.100 108.192 -28.805 1.00 49.52  ? 130 TYR A CB    1 
ATOM   797  C  CG    . TYR A 1 99  ? 230.223 109.694 -28.692 1.00 49.52  ? 130 TYR A CG    1 
ATOM   798  C  CD1   . TYR A 1 99  ? 231.065 110.412 -29.542 1.00 49.52  ? 130 TYR A CD1   1 
ATOM   799  C  CD2   . TYR A 1 99  ? 229.534 110.395 -27.705 1.00 49.52  ? 130 TYR A CD2   1 
ATOM   800  C  CE1   . TYR A 1 99  ? 231.219 111.786 -29.408 1.00 49.52  ? 130 TYR A CE1   1 
ATOM   801  C  CE2   . TYR A 1 99  ? 229.685 111.768 -27.564 1.00 49.52  ? 130 TYR A CE2   1 
ATOM   802  C  CZ    . TYR A 1 99  ? 230.526 112.453 -28.416 1.00 49.52  ? 130 TYR A CZ    1 
ATOM   803  O  OH    . TYR A 1 99  ? 230.675 113.807 -28.258 1.00 49.52  ? 130 TYR A OH    1 
ATOM   804  N  N     . ASN A 1 100 ? 230.125 105.242 -28.394 1.00 30.39  ? 131 ASN A N     1 
ATOM   805  C  CA    . ASN A 1 100 ? 230.233 103.877 -28.899 1.00 30.39  ? 131 ASN A CA    1 
ATOM   806  C  C     . ASN A 1 100 ? 229.000 103.581 -29.731 1.00 30.39  ? 131 ASN A C     1 
ATOM   807  O  O     . ASN A 1 100 ? 228.090 104.393 -29.801 1.00 30.39  ? 131 ASN A O     1 
ATOM   808  C  CB    . ASN A 1 100 ? 230.334 102.861 -27.764 1.00 34.24  ? 131 ASN A CB    1 
ATOM   809  C  CG    . ASN A 1 100 ? 229.095 102.827 -26.898 1.00 34.24  ? 131 ASN A CG    1 
ATOM   810  O  OD1   . ASN A 1 100 ? 228.064 103.390 -27.246 1.00 34.24  ? 131 ASN A OD1   1 
ATOM   811  N  ND2   . ASN A 1 100 ? 229.192 102.152 -25.763 1.00 34.24  ? 131 ASN A ND2   1 
ATOM   812  N  N     . ILE A 1 101 ? 228.974 102.414 -30.359 1.00 34.29  ? 132 ILE A N     1 
ATOM   813  C  CA    . ILE A 1 101 ? 227.851 102.021 -31.203 1.00 34.29  ? 132 ILE A CA    1 
ATOM   814  C  C     . ILE A 1 101 ? 226.508 102.169 -30.522 1.00 34.29  ? 132 ILE A C     1 
ATOM   815  O  O     . ILE A 1 101 ? 225.485 102.283 -31.183 1.00 34.29  ? 132 ILE A O     1 
ATOM   816  C  CB    . ILE A 1 101 ? 227.963 100.560 -31.647 1.00 30.77  ? 132 ILE A CB    1 
ATOM   817  C  CG1   . ILE A 1 101 ? 226.821 100.218 -32.599 1.00 30.77  ? 132 ILE A CG1   1 
ATOM   818  C  CG2   . ILE A 1 101 ? 227.881 99.658  -30.440 1.00 30.77  ? 132 ILE A CG2   1 
ATOM   819  C  CD1   . ILE A 1 101 ? 226.642 101.207 -33.737 1.00 30.77  ? 132 ILE A CD1   1 
ATOM   820  N  N     . ALA A 1 102 ? 226.512 102.170 -29.200 1.00 29.50  ? 133 ALA A N     1 
ATOM   821  C  CA    . ALA A 1 102 ? 225.275 102.276 -28.449 1.00 29.50  ? 133 ALA A CA    1 
ATOM   822  C  C     . ALA A 1 102 ? 224.912 103.674 -27.982 1.00 29.50  ? 133 ALA A C     1 
ATOM   823  O  O     . ALA A 1 102 ? 223.732 103.986 -27.821 1.00 29.50  ? 133 ALA A O     1 
ATOM   824  C  CB    . ALA A 1 102 ? 225.330 101.353 -27.262 1.00 56.63  ? 133 ALA A CB    1 
ATOM   825  N  N     . HIS A 1 103 ? 225.911 104.520 -27.761 1.00 41.09  ? 134 HIS A N     1 
ATOM   826  C  CA    . HIS A 1 103 ? 225.635 105.868 -27.279 1.00 41.09  ? 134 HIS A CA    1 
ATOM   827  C  C     . HIS A 1 103 ? 226.331 107.004 -28.023 1.00 41.09  ? 134 HIS A C     1 
ATOM   828  O  O     . HIS A 1 103 ? 227.551 107.021 -28.164 1.00 41.09  ? 134 HIS A O     1 
ATOM   829  C  CB    . HIS A 1 103 ? 225.993 105.942 -25.806 1.00 51.28  ? 134 HIS A CB    1 
ATOM   830  C  CG    . HIS A 1 103 ? 225.398 104.842 -24.983 1.00 51.28  ? 134 HIS A CG    1 
ATOM   831  N  ND1   . HIS A 1 103 ? 224.088 104.858 -24.552 1.00 51.28  ? 134 HIS A ND1   1 
ATOM   832  C  CD2   . HIS A 1 103 ? 225.950 103.715 -24.472 1.00 51.28  ? 134 HIS A CD2   1 
ATOM   833  C  CE1   . HIS A 1 103 ? 223.862 103.793 -23.803 1.00 51.28  ? 134 HIS A CE1   1 
ATOM   834  N  NE2   . HIS A 1 103 ? 224.976 103.084 -23.738 1.00 51.28  ? 134 HIS A NE2   1 
ATOM   835  N  N     . ASP A 1 104 ? 225.535 107.954 -28.493 1.00 36.90  ? 135 ASP A N     1 
ATOM   836  C  CA    . ASP A 1 104 ? 226.051 109.116 -29.200 1.00 36.90  ? 135 ASP A CA    1 
ATOM   837  C  C     . ASP A 1 104 ? 226.132 110.252 -28.200 1.00 36.90  ? 135 ASP A C     1 
ATOM   838  O  O     . ASP A 1 104 ? 225.775 111.389 -28.505 1.00 36.90  ? 135 ASP A O     1 
ATOM   839  C  CB    . ASP A 1 104 ? 225.112 109.508 -30.336 1.00 40.66  ? 135 ASP A CB    1 
ATOM   840  C  CG    . ASP A 1 104 ? 225.365 108.721 -31.596 1.00 40.66  ? 135 ASP A CG    1 
ATOM   841  O  OD1   . ASP A 1 104 ? 226.137 107.740 -31.551 1.00 40.66  ? 135 ASP A OD1   1 
ATOM   842  O  OD2   . ASP A 1 104 ? 224.786 109.093 -32.635 1.00 40.66  ? 135 ASP A OD2   1 
ATOM   843  N  N     . TYR A 1 105 ? 226.596 109.920 -26.999 1.00 39.03  ? 136 TYR A N     1 
ATOM   844  C  CA    . TYR A 1 105 ? 226.720 110.886 -25.923 1.00 39.03  ? 136 TYR A CA    1 
ATOM   845  C  C     . TYR A 1 105 ? 227.522 110.279 -24.778 1.00 39.03  ? 136 TYR A C     1 
ATOM   846  O  O     . TYR A 1 105 ? 227.589 109.068 -24.665 1.00 39.03  ? 136 TYR A O     1 
ATOM   847  C  CB    . TYR A 1 105 ? 225.329 111.283 -25.446 1.00 48.85  ? 136 TYR A CB    1 
ATOM   848  C  CG    . TYR A 1 105 ? 224.405 110.113 -25.183 1.00 48.85  ? 136 TYR A CG    1 
ATOM   849  C  CD1   . TYR A 1 105 ? 224.781 109.076 -24.326 1.00 48.85  ? 136 TYR A CD1   1 
ATOM   850  C  CD2   . TYR A 1 105 ? 223.126 110.073 -25.742 1.00 48.85  ? 136 TYR A CD2   1 
ATOM   851  C  CE1   . TYR A 1 105 ? 223.912 108.038 -24.028 1.00 48.85  ? 136 TYR A CE1   1 
ATOM   852  C  CE2   . TYR A 1 105 ? 222.248 109.042 -25.448 1.00 48.85  ? 136 TYR A CE2   1 
ATOM   853  C  CZ    . TYR A 1 105 ? 222.649 108.027 -24.589 1.00 48.85  ? 136 TYR A CZ    1 
ATOM   854  O  OH    . TYR A 1 105 ? 221.788 107.003 -24.288 1.00 48.85  ? 136 TYR A OH    1 
ATOM   855  N  N     . ILE A 1 106 ? 228.128 111.106 -23.929 1.00 31.23  ? 137 ILE A N     1 
ATOM   856  C  CA    . ILE A 1 106 ? 228.920 110.571 -22.823 1.00 31.23  ? 137 ILE A CA    1 
ATOM   857  C  C     . ILE A 1 106 ? 228.024 109.756 -21.923 1.00 31.23  ? 137 ILE A C     1 
ATOM   858  O  O     . ILE A 1 106 ? 226.857 110.080 -21.770 1.00 31.23  ? 137 ILE A O     1 
ATOM   859  C  CB    . ILE A 1 106 ? 229.592 111.687 -21.977 1.00 37.58  ? 137 ILE A CB    1 
ATOM   860  C  CG1   . ILE A 1 106 ? 230.694 112.367 -22.788 1.00 37.58  ? 137 ILE A CG1   1 
ATOM   861  C  CG2   . ILE A 1 106 ? 230.210 111.103 -20.717 1.00 37.58  ? 137 ILE A CG2   1 
ATOM   862  C  CD1   . ILE A 1 106 ? 230.191 113.114 -24.012 1.00 37.58  ? 137 ILE A CD1   1 
ATOM   863  N  N     . SER A 1 107 ? 228.571 108.698 -21.333 1.00 23.38  ? 138 SER A N     1 
ATOM   864  C  CA    . SER A 1 107 ? 227.797 107.842 -20.444 1.00 23.38  ? 138 SER A CA    1 
ATOM   865  C  C     . SER A 1 107 ? 228.718 106.964 -19.627 1.00 23.38  ? 138 SER A C     1 
ATOM   866  O  O     . SER A 1 107 ? 229.769 106.555 -20.101 1.00 23.38  ? 138 SER A O     1 
ATOM   867  C  CB    . SER A 1 107 ? 226.868 106.949 -21.251 1.00 29.74  ? 138 SER A CB    1 
ATOM   868  O  OG    . SER A 1 107 ? 227.630 105.984 -21.947 1.00 29.74  ? 138 SER A OG    1 
ATOM   869  N  N     . TRP A 1 108 ? 228.310 106.655 -18.402 1.00 25.36  ? 139 TRP A N     1 
ATOM   870  C  CA    . TRP A 1 108 ? 229.124 105.812 -17.546 1.00 25.36  ? 139 TRP A CA    1 
ATOM   871  C  C     . TRP A 1 108 ? 229.267 104.431 -18.151 1.00 25.36  ? 139 TRP A C     1 
ATOM   872  O  O     . TRP A 1 108 ? 230.247 103.731 -17.915 1.00 25.36  ? 139 TRP A O     1 
ATOM   873  C  CB    . TRP A 1 108 ? 228.525 105.685 -16.146 1.00 32.69  ? 139 TRP A CB    1 
ATOM   874  C  CG    . TRP A 1 108 ? 229.482 104.975 -15.275 1.00 32.69  ? 139 TRP A CG    1 
ATOM   875  C  CD1   . TRP A 1 108 ? 229.524 103.636 -15.020 1.00 32.69  ? 139 TRP A CD1   1 
ATOM   876  C  CD2   . TRP A 1 108 ? 230.684 105.522 -14.733 1.00 32.69  ? 139 TRP A CD2   1 
ATOM   877  N  NE1   . TRP A 1 108 ? 230.685 103.314 -14.368 1.00 32.69  ? 139 TRP A NE1   1 
ATOM   878  C  CE2   . TRP A 1 108 ? 231.418 104.455 -14.181 1.00 32.69  ? 139 TRP A CE2   1 
ATOM   879  C  CE3   . TRP A 1 108 ? 231.219 106.813 -14.671 1.00 32.69  ? 139 TRP A CE3   1 
ATOM   880  C  CZ2   . TRP A 1 108 ? 232.662 104.640 -13.577 1.00 32.69  ? 139 TRP A CZ2   1 
ATOM   881  C  CZ3   . TRP A 1 108 ? 232.451 106.992 -14.074 1.00 32.69  ? 139 TRP A CZ3   1 
ATOM   882  C  CH2   . TRP A 1 108 ? 233.160 105.913 -13.536 1.00 32.69  ? 139 TRP A CH2   1 
ATOM   883  N  N     . GLU A 1 109 ? 228.263 104.048 -18.929 1.00 39.21  ? 140 GLU A N     1 
ATOM   884  C  CA    . GLU A 1 109 ? 228.249 102.754 -19.595 1.00 39.21  ? 140 GLU A CA    1 
ATOM   885  C  C     . GLU A 1 109 ? 229.390 102.747 -20.609 1.00 39.21  ? 140 GLU A C     1 
ATOM   886  O  O     . GLU A 1 109 ? 230.254 101.865 -20.593 1.00 39.21  ? 140 GLU A O     1 
ATOM   887  C  CB    . GLU A 1 109 ? 226.883 102.542 -20.282 1.00 46.93  ? 140 GLU A CB    1 
ATOM   888  C  CG    . GLU A 1 109 ? 226.736 101.236 -21.064 1.00 46.93  ? 140 GLU A CG    1 
ATOM   889  C  CD    . GLU A 1 109 ? 227.132 100.003 -20.257 1.00 46.93  ? 140 GLU A CD    1 
ATOM   890  O  OE1   . GLU A 1 109 ? 227.009 100.039 -19.014 1.00 46.93  ? 140 GLU A OE1   1 
ATOM   891  O  OE2   . GLU A 1 109 ? 227.572 98.997  -20.865 1.00 46.93  ? 140 GLU A OE2   1 
ATOM   892  N  N     . SER A 1 110 ? 229.396 103.765 -21.463 1.00 31.07  ? 141 SER A N     1 
ATOM   893  C  CA    . SER A 1 110 ? 230.403 103.915 -22.502 1.00 31.07  ? 141 SER A CA    1 
ATOM   894  C  C     . SER A 1 110 ? 231.817 103.905 -21.958 1.00 31.07  ? 141 SER A C     1 
ATOM   895  O  O     . SER A 1 110 ? 232.701 103.254 -22.502 1.00 31.07  ? 141 SER A O     1 
ATOM   896  C  CB    . SER A 1 110 ? 230.168 105.216 -23.258 1.00 47.39  ? 141 SER A CB    1 
ATOM   897  O  OG    . SER A 1 110 ? 231.126 105.357 -24.285 1.00 47.39  ? 141 SER A OG    1 
ATOM   898  N  N     . PHE A 1 111 ? 232.024 104.648 -20.879 1.00 32.09  ? 142 PHE A N     1 
ATOM   899  C  CA    . PHE A 1 111 ? 233.326 104.728 -20.253 1.00 32.09  ? 142 PHE A CA    1 
ATOM   900  C  C     . PHE A 1 111 ? 233.822 103.353 -19.834 1.00 32.09  ? 142 PHE A C     1 
ATOM   901  O  O     . PHE A 1 111 ? 234.882 102.917 -20.275 1.00 32.09  ? 142 PHE A O     1 
ATOM   902  C  CB    . PHE A 1 111 ? 233.265 105.647 -19.028 1.00 26.96  ? 142 PHE A CB    1 
ATOM   903  C  CG    . PHE A 1 111 ? 234.517 105.645 -18.208 1.00 26.96  ? 142 PHE A CG    1 
ATOM   904  C  CD1   . PHE A 1 111 ? 235.704 106.120 -18.730 1.00 26.96  ? 142 PHE A CD1   1 
ATOM   905  C  CD2   . PHE A 1 111 ? 234.520 105.128 -16.927 1.00 26.96  ? 142 PHE A CD2   1 
ATOM   906  C  CE1   . PHE A 1 111 ? 236.876 106.076 -17.991 1.00 26.96  ? 142 PHE A CE1   1 
ATOM   907  C  CE2   . PHE A 1 111 ? 235.688 105.081 -16.187 1.00 26.96  ? 142 PHE A CE2   1 
ATOM   908  C  CZ    . PHE A 1 111 ? 236.866 105.556 -16.724 1.00 26.96  ? 142 PHE A CZ    1 
ATOM   909  N  N     . SER A 1 112 ? 233.019 102.667 -19.016 1.00 37.35  ? 143 SER A N     1 
ATOM   910  C  CA    . SER A 1 112 ? 233.355 101.358 -18.449 1.00 37.35  ? 143 SER A CA    1 
ATOM   911  C  C     . SER A 1 112 ? 233.170 100.051 -19.208 1.00 37.35  ? 143 SER A C     1 
ATOM   912  O  O     . SER A 1 112 ? 233.895 99.102  -18.926 1.00 37.35  ? 143 SER A O     1 
ATOM   913  C  CB    . SER A 1 112 ? 232.663 101.206 -17.097 1.00 38.67  ? 143 SER A CB    1 
ATOM   914  O  OG    . SER A 1 112 ? 231.283 101.497 -17.211 1.00 38.67  ? 143 SER A OG    1 
ATOM   915  N  N     . ASN A 1 113 ? 232.224 99.959  -20.142 1.00 30.17  ? 144 ASN A N     1 
ATOM   916  C  CA    . ASN A 1 113 ? 232.044 98.691  -20.852 1.00 30.17  ? 144 ASN A CA    1 
ATOM   917  C  C     . ASN A 1 113 ? 233.104 98.478  -21.926 1.00 30.17  ? 144 ASN A C     1 
ATOM   918  O  O     . ASN A 1 113 ? 232.859 98.679  -23.106 1.00 30.17  ? 144 ASN A O     1 
ATOM   919  C  CB    . ASN A 1 113 ? 230.647 98.598  -21.473 1.00 47.21  ? 144 ASN A CB    1 
ATOM   920  C  CG    . ASN A 1 113 ? 230.305 97.178  -21.948 1.00 47.21  ? 144 ASN A CG    1 
ATOM   921  O  OD1   . ASN A 1 113 ? 231.183 96.471  -22.448 1.00 47.21  ? 144 ASN A OD1   1 
ATOM   922  N  ND2   . ASN A 1 113 ? 229.038 96.775  -21.804 1.00 47.21  ? 144 ASN A ND2   1 
ATOM   923  N  N     . VAL A 1 114 ? 234.284 98.050  -21.494 1.00 30.96  ? 145 VAL A N     1 
ATOM   924  C  CA    . VAL A 1 114 ? 235.412 97.808  -22.383 1.00 30.96  ? 145 VAL A CA    1 
ATOM   925  C  C     . VAL A 1 114 ? 235.128 96.979  -23.631 1.00 30.96  ? 145 VAL A C     1 
ATOM   926  O  O     . VAL A 1 114 ? 235.958 96.920  -24.537 1.00 30.96  ? 145 VAL A O     1 
ATOM   927  C  CB    . VAL A 1 114 ? 236.567 97.152  -21.609 1.00 28.52  ? 145 VAL A CB    1 
ATOM   928  C  CG1   . VAL A 1 114 ? 237.513 96.444  -22.544 1.00 28.52  ? 145 VAL A CG1   1 
ATOM   929  C  CG2   . VAL A 1 114 ? 237.329 98.214  -20.866 1.00 28.52  ? 145 VAL A CG2   1 
ATOM   930  N  N     . SER A 1 115 ? 233.966 96.347  -23.693 1.00 50.80  ? 146 SER A N     1 
ATOM   931  C  CA    . SER A 1 115 ? 233.642 95.532  -24.852 1.00 50.80  ? 146 SER A CA    1 
ATOM   932  C  C     . SER A 1 115 ? 233.405 96.397  -26.082 1.00 50.80  ? 146 SER A C     1 
ATOM   933  O  O     . SER A 1 115 ? 233.827 96.045  -27.188 1.00 50.80  ? 146 SER A O     1 
ATOM   934  C  CB    . SER A 1 115 ? 232.402 94.677  -24.576 1.00 88.57  ? 146 SER A CB    1 
ATOM   935  O  OG    . SER A 1 115 ? 232.637 93.735  -23.542 1.00 88.57  ? 146 SER A OG    1 
ATOM   936  N  N     . TYR A 1 116 ? 232.726 97.521  -25.889 1.00 43.45  ? 147 TYR A N     1 
ATOM   937  C  CA    . TYR A 1 116 ? 232.433 98.441  -26.985 1.00 43.45  ? 147 TYR A CA    1 
ATOM   938  C  C     . TYR A 1 116 ? 233.675 99.095  -27.607 1.00 43.45  ? 147 TYR A C     1 
ATOM   939  O  O     . TYR A 1 116 ? 234.552 99.592  -26.888 1.00 43.45  ? 147 TYR A O     1 
ATOM   940  C  CB    . TYR A 1 116 ? 231.566 99.593  -26.493 1.00 39.00  ? 147 TYR A CB    1 
ATOM   941  C  CG    . TYR A 1 116 ? 230.121 99.303  -26.218 1.00 39.00  ? 147 TYR A CG    1 
ATOM   942  C  CD1   . TYR A 1 116 ? 229.167 99.408  -27.221 1.00 39.00  ? 147 TYR A CD1   1 
ATOM   943  C  CD2   . TYR A 1 116 ? 229.688 99.042  -24.924 1.00 39.00  ? 147 TYR A CD2   1 
ATOM   944  C  CE1   . TYR A 1 116 ? 227.818 99.277  -26.933 1.00 39.00  ? 147 TYR A CE1   1 
ATOM   945  C  CE2   . TYR A 1 116 ? 228.343 98.906  -24.625 1.00 39.00  ? 147 TYR A CE2   1 
ATOM   946  C  CZ    . TYR A 1 116 ? 227.412 99.030  -25.629 1.00 39.00  ? 147 TYR A CZ    1 
ATOM   947  O  OH    . TYR A 1 116 ? 226.075 98.940  -25.312 1.00 39.00  ? 147 TYR A OH    1 
ATOM   948  N  N     . TYR A 1 117 ? 233.750 99.102  -28.939 1.00 34.67  ? 148 TYR A N     1 
ATOM   949  C  CA    . TYR A 1 117 ? 234.833 99.805  -29.610 1.00 34.67  ? 148 TYR A CA    1 
ATOM   950  C  C     . TYR A 1 117 ? 234.334 101.236 -29.384 1.00 34.67  ? 148 TYR A C     1 
ATOM   951  O  O     . TYR A 1 117 ? 233.165 101.431 -29.030 1.00 34.67  ? 148 TYR A O     1 
ATOM   952  C  CB    . TYR A 1 117 ? 234.859 99.518  -31.115 1.00 27.84  ? 148 TYR A CB    1 
ATOM   953  C  CG    . TYR A 1 117 ? 235.679 98.322  -31.554 1.00 27.84  ? 148 TYR A CG    1 
ATOM   954  C  CD1   . TYR A 1 117 ? 236.888 98.009  -30.948 1.00 27.84  ? 148 TYR A CD1   1 
ATOM   955  C  CD2   . TYR A 1 117 ? 235.275 97.541  -32.630 1.00 27.84  ? 148 TYR A CD2   1 
ATOM   956  C  CE1   . TYR A 1 117 ? 237.668 96.952  -31.408 1.00 27.84  ? 148 TYR A CE1   1 
ATOM   957  C  CE2   . TYR A 1 117 ? 236.052 96.485  -33.094 1.00 27.84  ? 148 TYR A CE2   1 
ATOM   958  C  CZ    . TYR A 1 117 ? 237.239 96.201  -32.482 1.00 27.84  ? 148 TYR A CZ    1 
ATOM   959  O  OH    . TYR A 1 117 ? 237.999 95.165  -32.954 1.00 27.84  ? 148 TYR A OH    1 
ATOM   960  N  N     . THR A 1 118 ? 235.178 102.240 -29.578 1.00 33.63  ? 149 THR A N     1 
ATOM   961  C  CA    . THR A 1 118 ? 234.701 103.598 -29.360 1.00 33.63  ? 149 THR A CA    1 
ATOM   962  C  C     . THR A 1 118 ? 234.843 104.436 -30.599 1.00 33.63  ? 149 THR A C     1 
ATOM   963  O  O     . THR A 1 118 ? 235.686 104.157 -31.431 1.00 33.63  ? 149 THR A O     1 
ATOM   964  C  CB    . THR A 1 118 ? 235.448 104.284 -28.232 1.00 32.06  ? 149 THR A CB    1 
ATOM   965  O  OG1   . THR A 1 118 ? 234.964 105.620 -28.092 1.00 32.06  ? 149 THR A OG1   1 
ATOM   966  C  CG2   . THR A 1 118 ? 236.915 104.304 -28.523 1.00 32.06  ? 149 THR A CG2   1 
ATOM   967  N  N     . ARG A 1 119 ? 234.010 105.461 -30.732 1.00 46.42  ? 150 ARG A N     1 
ATOM   968  C  CA    . ARG A 1 119 ? 234.091 106.306 -31.909 1.00 46.42  ? 150 ARG A CA    1 
ATOM   969  C  C     . ARG A 1 119 ? 234.499 107.748 -31.611 1.00 46.42  ? 150 ARG A C     1 
ATOM   970  O  O     . ARG A 1 119 ? 234.320 108.256 -30.500 1.00 46.42  ? 150 ARG A O     1 
ATOM   971  C  CB    . ARG A 1 119 ? 232.775 106.265 -32.702 1.00 33.94  ? 150 ARG A CB    1 
ATOM   972  C  CG    . ARG A 1 119 ? 231.526 106.700 -31.970 1.00 33.94  ? 150 ARG A CG    1 
ATOM   973  C  CD    . ARG A 1 119 ? 230.369 106.795 -32.948 1.00 33.94  ? 150 ARG A CD    1 
ATOM   974  N  NE    . ARG A 1 119 ? 230.143 105.517 -33.606 1.00 33.94  ? 150 ARG A NE    1 
ATOM   975  C  CZ    . ARG A 1 119 ? 229.664 105.371 -34.837 1.00 33.94  ? 150 ARG A CZ    1 
ATOM   976  N  NH1   . ARG A 1 119 ? 229.350 106.424 -35.572 1.00 33.94  ? 150 ARG A NH1   1 
ATOM   977  N  NH2   . ARG A 1 119 ? 229.517 104.157 -35.342 1.00 33.94  ? 150 ARG A NH2   1 
ATOM   978  N  N     . ILE A 1 120 ? 235.074 108.389 -32.622 1.00 33.95  ? 151 ILE A N     1 
ATOM   979  C  CA    . ILE A 1 120 ? 235.541 109.756 -32.524 1.00 33.95  ? 151 ILE A CA    1 
ATOM   980  C  C     . ILE A 1 120 ? 234.394 110.711 -32.723 1.00 33.95  ? 151 ILE A C     1 
ATOM   981  O  O     . ILE A 1 120 ? 234.207 111.649 -31.952 1.00 33.95  ? 151 ILE A O     1 
ATOM   982  C  CB    . ILE A 1 120 ? 236.580 110.025 -33.590 1.00 35.94  ? 151 ILE A CB    1 
ATOM   983  C  CG1   . ILE A 1 120 ? 237.779 109.121 -33.360 1.00 35.94  ? 151 ILE A CG1   1 
ATOM   984  C  CG2   . ILE A 1 120 ? 236.985 111.478 -33.570 1.00 35.94  ? 151 ILE A CG2   1 
ATOM   985  C  CD1   . ILE A 1 120 ? 238.449 109.346 -32.035 1.00 35.94  ? 151 ILE A CD1   1 
ATOM   986  N  N     . LEU A 1 121 ? 233.634 110.467 -33.783 1.00 37.39  ? 152 LEU A N     1 
ATOM   987  C  CA    . LEU A 1 121 ? 232.480 111.294 -34.111 1.00 37.39  ? 152 LEU A CA    1 
ATOM   988  C  C     . LEU A 1 121 ? 231.214 110.537 -33.768 1.00 37.39  ? 152 LEU A C     1 
ATOM   989  O  O     . LEU A 1 121 ? 231.188 109.314 -33.807 1.00 37.39  ? 152 LEU A O     1 
ATOM   990  C  CB    . LEU A 1 121 ? 232.469 111.612 -35.600 1.00 48.81  ? 152 LEU A CB    1 
ATOM   991  C  CG    . LEU A 1 121 ? 233.572 112.527 -36.110 1.00 48.81  ? 152 LEU A CG    1 
ATOM   992  C  CD1   . LEU A 1 121 ? 233.874 112.225 -37.563 1.00 48.81  ? 152 LEU A CD1   1 
ATOM   993  C  CD2   . LEU A 1 121 ? 233.136 113.968 -35.927 1.00 48.81  ? 152 LEU A CD2   1 
ATOM   994  N  N     . PRO A 1 122 ? 230.141 111.254 -33.428 1.00 23.28  ? 153 PRO A N     1 
ATOM   995  C  CA    . PRO A 1 122 ? 228.937 110.497 -33.112 1.00 23.28  ? 153 PRO A CA    1 
ATOM   996  C  C     . PRO A 1 122 ? 228.573 109.745 -34.374 1.00 23.28  ? 153 PRO A C     1 
ATOM   997  O  O     . PRO A 1 122 ? 229.342 109.735 -35.331 1.00 23.28  ? 153 PRO A O     1 
ATOM   998  C  CB    . PRO A 1 122 ? 227.933 111.590 -32.748 1.00 34.61  ? 153 PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 122 ? 228.355 112.737 -33.596 1.00 34.61  ? 153 PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 122 ? 229.864 112.700 -33.479 1.00 34.61  ? 153 PRO A CD    1 
ATOM   1001 N  N     . SER A 1 123 ? 227.416 109.109 -34.396 1.00 55.44  ? 154 SER A N     1 
ATOM   1002 C  CA    . SER A 1 123 ? 227.035 108.386 -35.601 1.00 55.44  ? 154 SER A CA    1 
ATOM   1003 C  C     . SER A 1 123 ? 225.963 109.149 -36.348 1.00 55.44  ? 154 SER A C     1 
ATOM   1004 O  O     . SER A 1 123 ? 225.429 110.136 -35.842 1.00 55.44  ? 154 SER A O     1 
ATOM   1005 C  CB    . SER A 1 123 ? 226.532 106.974 -35.260 1.00 63.59  ? 154 SER A CB    1 
ATOM   1006 O  OG    . SER A 1 123 ? 225.425 107.004 -34.375 1.00 63.59  ? 154 SER A OG    1 
ATOM   1007 N  N     . VAL A 1 124 ? 225.662 108.697 -37.562 1.00 58.86  ? 155 VAL A N     1 
ATOM   1008 C  CA    . VAL A 1 124 ? 224.624 109.330 -38.364 1.00 58.86  ? 155 VAL A CA    1 
ATOM   1009 C  C     . VAL A 1 124 ? 223.304 108.960 -37.702 1.00 58.86  ? 155 VAL A C     1 
ATOM   1010 O  O     . VAL A 1 124 ? 222.964 107.782 -37.597 1.00 58.86  ? 155 VAL A O     1 
ATOM   1011 C  CB    . VAL A 1 124 ? 224.618 108.793 -39.797 1.00 43.14  ? 155 VAL A CB    1 
ATOM   1012 C  CG1   . VAL A 1 124 ? 223.603 109.556 -40.611 1.00 43.14  ? 155 VAL A CG1   1 
ATOM   1013 C  CG2   . VAL A 1 124 ? 226.016 108.911 -40.406 1.00 43.14  ? 155 VAL A CG2   1 
ATOM   1014 N  N     . PRO A 1 125 ? 222.555 109.956 -37.228 1.00 46.17  ? 156 PRO A N     1 
ATOM   1015 C  CA    . PRO A 1 125 ? 221.265 109.716 -36.566 1.00 46.17  ? 156 PRO A CA    1 
ATOM   1016 C  C     . PRO A 1 125 ? 220.390 108.716 -37.337 1.00 46.17  ? 156 PRO A C     1 
ATOM   1017 O  O     . PRO A 1 125 ? 220.260 108.815 -38.558 1.00 46.17  ? 156 PRO A O     1 
ATOM   1018 C  CB    . PRO A 1 125 ? 220.656 111.110 -36.505 1.00 44.70  ? 156 PRO A CB    1 
ATOM   1019 C  CG    . PRO A 1 125 ? 221.881 111.988 -36.360 1.00 44.70  ? 156 PRO A CG    1 
ATOM   1020 C  CD    . PRO A 1 125 ? 222.838 111.392 -37.353 1.00 44.70  ? 156 PRO A CD    1 
ATOM   1021 N  N     . ARG A 1 126 ? 219.792 107.753 -36.635 1.00 54.78  ? 157 ARG A N     1 
ATOM   1022 C  CA    . ARG A 1 126 ? 218.960 106.748 -37.300 1.00 54.78  ? 157 ARG A CA    1 
ATOM   1023 C  C     . ARG A 1 126 ? 217.684 107.313 -37.917 1.00 54.78  ? 157 ARG A C     1 
ATOM   1024 O  O     . ARG A 1 126 ? 216.746 106.578 -38.225 1.00 54.78  ? 157 ARG A O     1 
ATOM   1025 C  CB    . ARG A 1 126 ? 218.585 105.633 -36.323 1.00 76.05  ? 157 ARG A CB    1 
ATOM   1026 C  CG    . ARG A 1 126 ? 219.672 104.619 -36.097 1.00 76.05  ? 157 ARG A CG    1 
ATOM   1027 C  CD    . ARG A 1 126 ? 219.110 103.298 -35.576 1.00 76.05  ? 157 ARG A CD    1 
ATOM   1028 N  NE    . ARG A 1 126 ? 220.151 102.268 -35.546 1.00 76.05  ? 157 ARG A NE    1 
ATOM   1029 C  CZ    . ARG A 1 126 ? 220.765 101.774 -36.628 1.00 76.05  ? 157 ARG A CZ    1 
ATOM   1030 N  NH1   . ARG A 1 126 ? 220.436 102.206 -37.848 1.00 76.05  ? 157 ARG A NH1   1 
ATOM   1031 N  NH2   . ARG A 1 126 ? 221.740 100.870 -36.492 1.00 76.05  ? 157 ARG A NH2   1 
ATOM   1032 N  N     . ASP A 1 127 ? 217.656 108.621 -38.120 1.00 53.02  ? 158 ASP A N     1 
ATOM   1033 C  CA    . ASP A 1 127 ? 216.475 109.254 -38.675 1.00 53.02  ? 158 ASP A CA    1 
ATOM   1034 C  C     . ASP A 1 127 ? 216.802 110.340 -39.684 1.00 53.02  ? 158 ASP A C     1 
ATOM   1035 O  O     . ASP A 1 127 ? 215.939 111.132 -40.043 1.00 53.02  ? 158 ASP A O     1 
ATOM   1036 C  CB    . ASP A 1 127 ? 215.647 109.845 -37.530 1.00 64.59  ? 158 ASP A CB    1 
ATOM   1037 C  CG    . ASP A 1 127 ? 216.480 110.724 -36.592 1.00 64.59  ? 158 ASP A CG    1 
ATOM   1038 O  OD1   . ASP A 1 127 ? 217.666 110.383 -36.336 1.00 64.59  ? 158 ASP A OD1   1 
ATOM   1039 O  OD2   . ASP A 1 127 ? 215.938 111.743 -36.096 1.00 64.59  ? 158 ASP A OD2   1 
ATOM   1040 N  N     . CYS A 1 128 ? 218.039 110.394 -40.151 1.00 51.74  ? 159 CYS A N     1 
ATOM   1041 C  CA    . CYS A 1 128 ? 218.375 111.442 -41.093 1.00 51.74  ? 159 CYS A CA    1 
ATOM   1042 C  C     . CYS A 1 128 ? 217.895 111.102 -42.480 1.00 51.74  ? 159 CYS A C     1 
ATOM   1043 O  O     . CYS A 1 128 ? 217.825 109.932 -42.854 1.00 51.74  ? 159 CYS A O     1 
ATOM   1044 C  CB    . CYS A 1 128 ? 219.877 111.697 -41.113 1.00 54.12  ? 159 CYS A CB    1 
ATOM   1045 S  SG    . CYS A 1 128 ? 220.509 112.339 -39.531 1.00 54.12  ? 159 CYS A SG    1 
ATOM   1046 N  N     . PRO A 1 129 ? 217.525 112.132 -43.254 1.00 41.82  ? 160 PRO A N     1 
ATOM   1047 C  CA    . PRO A 1 129 ? 217.046 111.973 -44.623 1.00 41.82  ? 160 PRO A CA    1 
ATOM   1048 C  C     . PRO A 1 129 ? 217.884 110.928 -45.334 1.00 41.82  ? 160 PRO A C     1 
ATOM   1049 O  O     . PRO A 1 129 ? 217.469 109.786 -45.485 1.00 41.82  ? 160 PRO A O     1 
ATOM   1050 C  CB    . PRO A 1 129 ? 217.241 113.361 -45.200 1.00 34.37  ? 160 PRO A CB    1 
ATOM   1051 C  CG    . PRO A 1 129 ? 216.861 114.224 -44.051 1.00 34.37  ? 160 PRO A CG    1 
ATOM   1052 C  CD    . PRO A 1 129 ? 217.525 113.552 -42.863 1.00 34.37  ? 160 PRO A CD    1 
ATOM   1053 N  N     . THR A 1 130 ? 219.078 111.331 -45.744 1.00 35.73  ? 161 THR A N     1 
ATOM   1054 C  CA    . THR A 1 130 ? 220.005 110.455 -46.444 1.00 35.73  ? 161 THR A CA    1 
ATOM   1055 C  C     . THR A 1 130 ? 220.749 109.570 -45.446 1.00 35.73  ? 161 THR A C     1 
ATOM   1056 O  O     . THR A 1 130 ? 220.795 109.873 -44.258 1.00 35.73  ? 161 THR A O     1 
ATOM   1057 C  CB    . THR A 1 130 ? 221.027 111.289 -47.230 1.00 48.48  ? 161 THR A CB    1 
ATOM   1058 O  OG1   . THR A 1 130 ? 221.974 111.870 -46.323 1.00 48.48  ? 161 THR A OG1   1 
ATOM   1059 C  CG2   . THR A 1 130 ? 220.317 112.413 -47.973 1.00 48.48  ? 161 THR A CG2   1 
ATOM   1060 N  N     . PRO A 1 131 ? 221.342 108.465 -45.924 1.00 40.36  ? 162 PRO A N     1 
ATOM   1061 C  CA    . PRO A 1 131 ? 222.107 107.481 -45.138 1.00 40.36  ? 162 PRO A CA    1 
ATOM   1062 C  C     . PRO A 1 131 ? 223.358 108.072 -44.490 1.00 40.36  ? 162 PRO A C     1 
ATOM   1063 O  O     . PRO A 1 131 ? 223.834 107.577 -43.467 1.00 40.36  ? 162 PRO A O     1 
ATOM   1064 C  CB    . PRO A 1 131 ? 222.469 106.412 -46.167 1.00 64.88  ? 162 PRO A CB    1 
ATOM   1065 C  CG    . PRO A 1 131 ? 221.358 106.513 -47.162 1.00 64.88  ? 162 PRO A CG    1 
ATOM   1066 C  CD    . PRO A 1 131 ? 221.183 108.008 -47.312 1.00 64.88  ? 162 PRO A CD    1 
ATOM   1067 N  N     . MET A 1 132 ? 223.890 109.118 -45.119 1.00 56.73  ? 163 MET A N     1 
ATOM   1068 C  CA    . MET A 1 132 ? 225.072 109.822 -44.632 1.00 56.73  ? 163 MET A CA    1 
ATOM   1069 C  C     . MET A 1 132 ? 224.642 111.092 -43.895 1.00 56.73  ? 163 MET A C     1 
ATOM   1070 O  O     . MET A 1 132 ? 225.475 111.827 -43.361 1.00 56.73  ? 163 MET A O     1 
ATOM   1071 C  CB    . MET A 1 132 ? 225.983 110.183 -45.799 1.00 52.00  ? 163 MET A CB    1 
ATOM   1072 C  CG    . MET A 1 132 ? 226.502 108.998 -46.541 1.00 52.00  ? 163 MET A CG    1 
ATOM   1073 S  SD    . MET A 1 132 ? 227.703 108.116 -45.560 1.00 52.00  ? 163 MET A SD    1 
ATOM   1074 C  CE    . MET A 1 132 ? 226.683 107.305 -44.385 1.00 52.00  ? 163 MET A CE    1 
ATOM   1075 N  N     . GLY A 1 133 ? 223.339 111.350 -43.880 1.00 37.95  ? 164 GLY A N     1 
ATOM   1076 C  CA    . GLY A 1 133 ? 222.848 112.515 -43.180 1.00 37.95  ? 164 GLY A CA    1 
ATOM   1077 C  C     . GLY A 1 133 ? 221.980 113.451 -43.986 1.00 37.95  ? 164 GLY A C     1 
ATOM   1078 O  O     . GLY A 1 133 ? 220.755 113.414 -43.883 1.00 37.95  ? 164 GLY A O     1 
ATOM   1079 N  N     . THR A 1 134 ? 222.609 114.288 -44.802 1.00 48.61  ? 165 THR A N     1 
ATOM   1080 C  CA    . THR A 1 134 ? 221.870 115.274 -45.583 1.00 48.61  ? 165 THR A CA    1 
ATOM   1081 C  C     . THR A 1 134 ? 222.042 115.142 -47.088 1.00 48.61  ? 165 THR A C     1 
ATOM   1082 O  O     . THR A 1 134 ? 221.074 115.198 -47.844 1.00 48.61  ? 165 THR A O     1 
ATOM   1083 C  CB    . THR A 1 134 ? 222.300 116.700 -45.179 1.00 57.42  ? 165 THR A CB    1 
ATOM   1084 O  OG1   . THR A 1 134 ? 222.346 116.794 -43.750 1.00 57.42  ? 165 THR A OG1   1 
ATOM   1085 C  CG2   . THR A 1 134 ? 221.322 117.728 -45.703 1.00 57.42  ? 165 THR A CG2   1 
ATOM   1086 N  N     . LYS A 1 135 ? 223.281 114.968 -47.522 1.00 50.39  ? 166 LYS A N     1 
ATOM   1087 C  CA    . LYS A 1 135 ? 223.561 114.866 -48.942 1.00 50.39  ? 166 LYS A CA    1 
ATOM   1088 C  C     . LYS A 1 135 ? 223.706 113.428 -49.414 1.00 50.39  ? 166 LYS A C     1 
ATOM   1089 O  O     . LYS A 1 135 ? 223.793 112.503 -48.601 1.00 50.39  ? 166 LYS A O     1 
ATOM   1090 C  CB    . LYS A 1 135 ? 224.816 115.668 -49.249 1.00 66.40  ? 166 LYS A CB    1 
ATOM   1091 C  CG    . LYS A 1 135 ? 224.784 117.027 -48.564 1.00 66.40  ? 166 LYS A CG    1 
ATOM   1092 C  CD    . LYS A 1 135 ? 225.938 117.918 -48.958 1.00 66.40  ? 166 LYS A CD    1 
ATOM   1093 C  CE    . LYS A 1 135 ? 225.861 119.184 -48.160 1.00 66.40  ? 166 LYS A CE    1 
ATOM   1094 N  NZ    . LYS A 1 135 ? 224.448 119.635 -48.137 1.00 66.40  ? 166 LYS A NZ    1 
ATOM   1095 N  N     . GLY A 1 136 ? 223.725 113.240 -50.729 1.00 50.10  ? 167 GLY A N     1 
ATOM   1096 C  CA    . GLY A 1 136 ? 223.842 111.898 -51.273 1.00 50.10  ? 167 GLY A CA    1 
ATOM   1097 C  C     . GLY A 1 136 ? 222.498 111.378 -51.757 1.00 50.10  ? 167 GLY A C     1 
ATOM   1098 O  O     . GLY A 1 136 ? 221.502 112.107 -51.780 1.00 50.10  ? 167 GLY A O     1 
ATOM   1099 N  N     . LYS A 1 137 ? 222.467 110.109 -52.146 1.00 59.90  ? 168 LYS A N     1 
ATOM   1100 C  CA    . LYS A 1 137 ? 221.242 109.486 -52.641 1.00 59.90  ? 168 LYS A CA    1 
ATOM   1101 C  C     . LYS A 1 137 ? 220.604 108.650 -51.539 1.00 59.90  ? 168 LYS A C     1 
ATOM   1102 O  O     . LYS A 1 137 ? 221.286 108.195 -50.617 1.00 59.90  ? 168 LYS A O     1 
ATOM   1103 C  CB    . LYS A 1 137 ? 221.558 108.574 -53.829 1.00 58.85  ? 168 LYS A CB    1 
ATOM   1104 C  CG    . LYS A 1 137 ? 222.404 109.197 -54.938 1.00 58.85  ? 168 LYS A CG    1 
ATOM   1105 C  CD    . LYS A 1 137 ? 222.865 108.093 -55.865 1.00 58.85  ? 168 LYS A CD    1 
ATOM   1106 C  CE    . LYS A 1 137 ? 223.319 108.599 -57.210 1.00 58.85  ? 168 LYS A CE    1 
ATOM   1107 N  NZ    . LYS A 1 137 ? 223.524 107.429 -58.119 1.00 58.85  ? 168 LYS A NZ    1 
ATOM   1108 N  N     . LYS A 1 138 ? 219.298 108.430 -51.644 1.00 56.84  ? 169 LYS A N     1 
ATOM   1109 C  CA    . LYS A 1 138 ? 218.592 107.643 -50.643 1.00 56.84  ? 169 LYS A CA    1 
ATOM   1110 C  C     . LYS A 1 138 ? 219.221 106.251 -50.507 1.00 56.84  ? 169 LYS A C     1 
ATOM   1111 O  O     . LYS A 1 138 ? 218.850 105.476 -49.629 1.00 56.84  ? 169 LYS A O     1 
ATOM   1112 C  CB    . LYS A 1 138 ? 217.124 107.535 -51.015 1.00 47.14  ? 169 LYS A CB    1 
ATOM   1113 N  N     . GLN A 1 139 ? 220.181 105.943 -51.373 1.00 52.84  ? 170 GLN A N     1 
ATOM   1114 C  CA    . GLN A 1 139 ? 220.859 104.651 -51.324 1.00 52.84  ? 170 GLN A CA    1 
ATOM   1115 C  C     . GLN A 1 139 ? 222.354 104.802 -51.613 1.00 52.84  ? 170 GLN A C     1 
ATOM   1116 O  O     . GLN A 1 139 ? 222.757 105.534 -52.525 1.00 52.84  ? 170 GLN A O     1 
ATOM   1117 C  CB    . GLN A 1 139 ? 220.224 103.680 -52.328 1.00 48.16  ? 170 GLN A CB    1 
ATOM   1118 N  N     . LEU A 1 140 ? 223.170 104.106 -50.826 1.00 40.05  ? 171 LEU A N     1 
ATOM   1119 C  CA    . LEU A 1 140 ? 224.618 104.144 -50.986 1.00 40.05  ? 171 LEU A CA    1 
ATOM   1120 C  C     . LEU A 1 140 ? 225.057 103.183 -52.081 1.00 40.05  ? 171 LEU A C     1 
ATOM   1121 O  O     . LEU A 1 140 ? 224.394 102.191 -52.341 1.00 40.05  ? 171 LEU A O     1 
ATOM   1122 C  CB    . LEU A 1 140 ? 225.293 103.755 -49.672 1.00 48.29  ? 171 LEU A CB    1 
ATOM   1123 C  CG    . LEU A 1 140 ? 225.299 104.800 -48.562 1.00 48.29  ? 171 LEU A CG    1 
ATOM   1124 C  CD1   . LEU A 1 140 ? 225.719 104.167 -47.253 1.00 48.29  ? 171 LEU A CD1   1 
ATOM   1125 C  CD2   . LEU A 1 140 ? 226.252 105.915 -48.945 1.00 48.29  ? 171 LEU A CD2   1 
ATOM   1126 N  N     . PRO A 1 141 ? 226.186 103.464 -52.740 1.00 42.66  ? 172 PRO A N     1 
ATOM   1127 C  CA    . PRO A 1 141 ? 226.644 102.560 -53.797 1.00 42.66  ? 172 PRO A CA    1 
ATOM   1128 C  C     . PRO A 1 141 ? 226.696 101.097 -53.333 1.00 42.66  ? 172 PRO A C     1 
ATOM   1129 O  O     . PRO A 1 141 ? 227.045 100.817 -52.193 1.00 42.66  ? 172 PRO A O     1 
ATOM   1130 C  CB    . PRO A 1 141 ? 228.028 103.113 -54.135 1.00 38.98  ? 172 PRO A CB    1 
ATOM   1131 C  CG    . PRO A 1 141 ? 227.850 104.573 -53.919 1.00 38.98  ? 172 PRO A CG    1 
ATOM   1132 C  CD    . PRO A 1 141 ? 227.090 104.617 -52.612 1.00 38.98  ? 172 PRO A CD    1 
ATOM   1133 N  N     . ASP A 1 142 ? 226.336 100.169 -54.214 1.00 42.71  ? 173 ASP A N     1 
ATOM   1134 C  CA    . ASP A 1 142 ? 226.375 98.753  -53.868 1.00 42.71  ? 173 ASP A CA    1 
ATOM   1135 C  C     . ASP A 1 142 ? 227.827 98.386  -53.594 1.00 42.71  ? 173 ASP A C     1 
ATOM   1136 O  O     . ASP A 1 142 ? 228.654 98.340  -54.506 1.00 42.71  ? 173 ASP A O     1 
ATOM   1137 C  CB    . ASP A 1 142 ? 225.817 97.911  -55.009 1.00 44.62  ? 173 ASP A CB    1 
ATOM   1138 N  N     . ALA A 1 143 ? 228.127 98.127  -52.328 1.00 49.78  ? 174 ALA A N     1 
ATOM   1139 C  CA    . ALA A 1 143 ? 229.483 97.787  -51.908 1.00 49.78  ? 174 ALA A CA    1 
ATOM   1140 C  C     . ALA A 1 143 ? 230.191 96.748  -52.761 1.00 49.78  ? 174 ALA A C     1 
ATOM   1141 O  O     . ALA A 1 143 ? 231.411 96.777  -52.878 1.00 49.78  ? 174 ALA A O     1 
ATOM   1142 C  CB    . ALA A 1 143 ? 229.478 97.328  -50.464 1.00 70.13  ? 174 ALA A CB    1 
ATOM   1143 N  N     . GLU A 1 144 ? 229.443 95.820  -53.345 1.00 58.25  ? 175 GLU A N     1 
ATOM   1144 C  CA    . GLU A 1 144 ? 230.071 94.794  -54.170 1.00 58.25  ? 175 GLU A CA    1 
ATOM   1145 C  C     . GLU A 1 144 ? 230.616 95.470  -55.421 1.00 58.25  ? 175 GLU A C     1 
ATOM   1146 O  O     . GLU A 1 144 ? 231.770 95.246  -55.815 1.00 58.25  ? 175 GLU A O     1 
ATOM   1147 C  CB    . GLU A 1 144 ? 229.053 93.714  -54.540 1.00 70.09  ? 175 GLU A CB    1 
ATOM   1148 N  N     . PHE A 1 145 ? 229.777 96.315  -56.023 1.00 67.02  ? 176 PHE A N     1 
ATOM   1149 C  CA    . PHE A 1 145 ? 230.139 97.041  -57.238 1.00 67.02  ? 176 PHE A CA    1 
ATOM   1150 C  C     . PHE A 1 145 ? 231.260 98.019  -56.946 1.00 67.02  ? 176 PHE A C     1 
ATOM   1151 O  O     . PHE A 1 145 ? 232.351 97.931  -57.520 1.00 67.02  ? 176 PHE A O     1 
ATOM   1152 C  CB    . PHE A 1 145 ? 228.938 97.812  -57.780 1.00 57.81  ? 176 PHE A CB    1 
ATOM   1153 C  CG    . PHE A 1 145 ? 229.219 98.533  -59.074 1.00 57.81  ? 176 PHE A CG    1 
ATOM   1154 C  CD1   . PHE A 1 145 ? 229.630 97.828  -60.204 1.00 57.81  ? 176 PHE A CD1   1 
ATOM   1155 C  CD2   . PHE A 1 145 ? 229.067 99.917  -59.167 1.00 57.81  ? 176 PHE A CD2   1 
ATOM   1156 C  CE1   . PHE A 1 145 ? 229.887 98.483  -61.403 1.00 57.81  ? 176 PHE A CE1   1 
ATOM   1157 C  CE2   . PHE A 1 145 ? 229.324 100.588 -60.369 1.00 57.81  ? 176 PHE A CE2   1 
ATOM   1158 C  CZ    . PHE A 1 145 ? 229.735 99.866  -61.487 1.00 57.81  ? 176 PHE A CZ    1 
ATOM   1159 N  N     . LEU A 1 146 ? 230.975 98.951  -56.041 1.00 57.47  ? 177 LEU A N     1 
ATOM   1160 C  CA    . LEU A 1 146 ? 231.936 99.967  -55.635 1.00 57.47  ? 177 LEU A CA    1 
ATOM   1161 C  C     . LEU A 1 146 ? 233.298 99.335  -55.378 1.00 57.47  ? 177 LEU A C     1 
ATOM   1162 O  O     . LEU A 1 146 ? 234.321 99.987  -55.516 1.00 57.47  ? 177 LEU A O     1 
ATOM   1163 C  CB    . LEU A 1 146 ? 231.450 100.657 -54.364 1.00 44.74  ? 177 LEU A CB    1 
ATOM   1164 C  CG    . LEU A 1 146 ? 231.982 102.057 -54.118 1.00 44.74  ? 177 LEU A CG    1 
ATOM   1165 C  CD1   . LEU A 1 146 ? 231.382 102.999 -55.146 1.00 44.74  ? 177 LEU A CD1   1 
ATOM   1166 C  CD2   . LEU A 1 146 ? 231.613 102.493 -52.710 1.00 44.74  ? 177 LEU A CD2   1 
ATOM   1167 N  N     . SER A 1 147 ? 233.296 98.059  -55.012 1.00 44.38  ? 178 SER A N     1 
ATOM   1168 C  CA    . SER A 1 147 ? 234.525 97.339  -54.737 1.00 44.38  ? 178 SER A CA    1 
ATOM   1169 C  C     . SER A 1 147 ? 235.265 96.921  -55.999 1.00 44.38  ? 178 SER A C     1 
ATOM   1170 O  O     . SER A 1 147 ? 236.346 97.433  -56.285 1.00 44.38  ? 178 SER A O     1 
ATOM   1171 C  CB    . SER A 1 147 ? 234.233 96.097  -53.894 1.00 53.29  ? 178 SER A CB    1 
ATOM   1172 O  OG    . SER A 1 147 ? 233.936 96.434  -52.548 1.00 53.29  ? 178 SER A OG    1 
ATOM   1173 N  N     . ARG A 1 148 ? 234.687 95.983  -56.749 1.00 55.37  ? 179 ARG A N     1 
ATOM   1174 C  CA    . ARG A 1 148 ? 235.324 95.494  -57.971 1.00 55.37  ? 179 ARG A CA    1 
ATOM   1175 C  C     . ARG A 1 148 ? 235.691 96.647  -58.898 1.00 55.37  ? 179 ARG A C     1 
ATOM   1176 O  O     . ARG A 1 148 ? 236.714 96.598  -59.579 1.00 55.37  ? 179 ARG A O     1 
ATOM   1177 C  CB    . ARG A 1 148 ? 234.399 94.545  -58.742 1.00 71.64  ? 179 ARG A CB    1 
ATOM   1178 C  CG    . ARG A 1 148 ? 233.592 93.580  -57.890 1.00 71.64  ? 179 ARG A CG    1 
ATOM   1179 C  CD    . ARG A 1 148 ? 233.501 92.197  -58.544 1.00 71.64  ? 179 ARG A CD    1 
ATOM   1180 N  NE    . ARG A 1 148 ? 234.832 91.594  -58.673 1.00 71.64  ? 179 ARG A NE    1 
ATOM   1181 C  CZ    . ARG A 1 148 ? 235.091 90.284  -58.644 1.00 71.64  ? 179 ARG A CZ    1 
ATOM   1182 N  NH1   . ARG A 1 148 ? 236.344 89.852  -58.771 1.00 71.64  ? 179 ARG A NH1   1 
ATOM   1183 N  NH2   . ARG A 1 148 ? 234.106 89.403  -58.482 1.00 71.64  ? 179 ARG A NH2   1 
ATOM   1184 N  N     . ARG A 1 149 ? 234.846 97.677  -58.912 1.00 56.95  ? 180 ARG A N     1 
ATOM   1185 C  CA    . ARG A 1 149 ? 235.025 98.850  -59.769 1.00 56.95  ? 180 ARG A CA    1 
ATOM   1186 C  C     . ARG A 1 149 ? 236.197 99.756  -59.405 1.00 56.95  ? 180 ARG A C     1 
ATOM   1187 O  O     . ARG A 1 149 ? 236.856 100.307 -60.302 1.00 56.95  ? 180 ARG A O     1 
ATOM   1188 C  CB    . ARG A 1 149 ? 233.738 99.690  -59.778 1.00 71.66  ? 180 ARG A CB    1 
ATOM   1189 C  CG    . ARG A 1 149 ? 232.944 99.696  -61.092 1.00 71.66  ? 180 ARG A CG    1 
ATOM   1190 C  CD    . ARG A 1 149 ? 233.557 100.600 -62.174 1.00 71.66  ? 180 ARG A CD    1 
ATOM   1191 N  NE    . ARG A 1 149 ? 234.661 99.974  -62.907 1.00 71.66  ? 180 ARG A NE    1 
ATOM   1192 C  CZ    . ARG A 1 149 ? 235.334 100.557 -63.906 1.00 71.66  ? 180 ARG A CZ    1 
ATOM   1193 N  NH1   . ARG A 1 149 ? 236.326 99.908  -64.515 1.00 71.66  ? 180 ARG A NH1   1 
ATOM   1194 N  NH2   . ARG A 1 149 ? 235.024 101.791 -64.302 1.00 71.66  ? 180 ARG A NH2   1 
ATOM   1195 N  N     . PHE A 1 150 ? 236.459 99.911  -58.102 1.00 51.94  ? 181 PHE A N     1 
ATOM   1196 C  CA    . PHE A 1 150 ? 237.537 100.791 -57.635 1.00 51.94  ? 181 PHE A CA    1 
ATOM   1197 C  C     . PHE A 1 150 ? 238.604 100.191 -56.730 1.00 51.94  ? 181 PHE A C     1 
ATOM   1198 O  O     . PHE A 1 150 ? 239.756 100.624 -56.777 1.00 51.94  ? 181 PHE A O     1 
ATOM   1199 C  CB    . PHE A 1 150 ? 236.931 101.991 -56.932 1.00 50.61  ? 181 PHE A CB    1 
ATOM   1200 C  CG    . PHE A 1 150 ? 235.861 102.664 -57.724 1.00 50.61  ? 181 PHE A CG    1 
ATOM   1201 C  CD1   . PHE A 1 150 ? 234.588 102.828 -57.193 1.00 50.61  ? 181 PHE A CD1   1 
ATOM   1202 C  CD2   . PHE A 1 150 ? 236.122 103.134 -59.002 1.00 50.61  ? 181 PHE A CD2   1 
ATOM   1203 C  CE1   . PHE A 1 150 ? 233.586 103.453 -57.922 1.00 50.61  ? 181 PHE A CE1   1 
ATOM   1204 C  CE2   . PHE A 1 150 ? 235.130 103.760 -59.742 1.00 50.61  ? 181 PHE A CE2   1 
ATOM   1205 C  CZ    . PHE A 1 150 ? 233.854 103.922 -59.199 1.00 50.61  ? 181 PHE A CZ    1 
ATOM   1206 N  N     . LEU A 1 151 ? 238.238 99.210  -55.907 1.00 49.31  ? 182 LEU A N     1 
ATOM   1207 C  CA    . LEU A 1 151 ? 239.209 98.600  -54.998 1.00 49.31  ? 182 LEU A CA    1 
ATOM   1208 C  C     . LEU A 1 151 ? 239.864 97.315  -55.505 1.00 49.31  ? 182 LEU A C     1 
ATOM   1209 O  O     . LEU A 1 151 ? 240.880 96.896  -54.960 1.00 49.31  ? 182 LEU A O     1 
ATOM   1210 C  CB    . LEU A 1 151 ? 238.568 98.335  -53.629 1.00 32.88  ? 182 LEU A CB    1 
ATOM   1211 C  CG    . LEU A 1 151 ? 237.823 99.509  -52.978 1.00 32.88  ? 182 LEU A CG    1 
ATOM   1212 C  CD1   . LEU A 1 151 ? 237.440 99.156  -51.542 1.00 32.88  ? 182 LEU A CD1   1 
ATOM   1213 C  CD2   . LEU A 1 151 ? 238.696 100.754 -52.988 1.00 32.88  ? 182 LEU A CD2   1 
ATOM   1214 N  N     . LEU A 1 152 ? 239.302 96.693  -56.542 1.00 51.83  ? 183 LEU A N     1 
ATOM   1215 C  CA    . LEU A 1 152 ? 239.867 95.447  -57.071 1.00 51.83  ? 183 LEU A CA    1 
ATOM   1216 C  C     . LEU A 1 152 ? 241.116 95.627  -57.932 1.00 51.83  ? 183 LEU A C     1 
ATOM   1217 O  O     . LEU A 1 152 ? 241.101 96.314  -58.954 1.00 51.83  ? 183 LEU A O     1 
ATOM   1218 C  CB    . LEU A 1 152 ? 238.831 94.670  -57.889 1.00 38.31  ? 183 LEU A CB    1 
ATOM   1219 C  CG    . LEU A 1 152 ? 239.476 93.435  -58.528 1.00 38.31  ? 183 LEU A CG    1 
ATOM   1220 C  CD1   . LEU A 1 152 ? 239.737 92.371  -57.473 1.00 38.31  ? 183 LEU A CD1   1 
ATOM   1221 C  CD2   . LEU A 1 152 ? 238.582 92.899  -59.605 1.00 38.31  ? 183 LEU A CD2   1 
ATOM   1222 N  N     . ARG A 1 153 ? 242.188 94.967  -57.520 1.00 43.81  ? 184 ARG A N     1 
ATOM   1223 C  CA    . ARG A 1 153 ? 243.455 95.037  -58.223 1.00 43.81  ? 184 ARG A CA    1 
ATOM   1224 C  C     . ARG A 1 153 ? 243.430 94.382  -59.590 1.00 43.81  ? 184 ARG A C     1 
ATOM   1225 O  O     . ARG A 1 153 ? 242.979 93.248  -59.734 1.00 43.81  ? 184 ARG A O     1 
ATOM   1226 C  CB    . ARG A 1 153 ? 244.544 94.374  -57.389 1.00 50.36  ? 184 ARG A CB    1 
ATOM   1227 C  CG    . ARG A 1 153 ? 245.772 93.983  -58.183 1.00 50.36  ? 184 ARG A CG    1 
ATOM   1228 C  CD    . ARG A 1 153 ? 246.731 93.186  -57.325 1.00 50.36  ? 184 ARG A CD    1 
ATOM   1229 N  NE    . ARG A 1 153 ? 247.062 93.910  -56.103 1.00 50.36  ? 184 ARG A NE    1 
ATOM   1230 C  CZ    . ARG A 1 153 ? 247.879 93.457  -55.159 1.00 50.36  ? 184 ARG A CZ    1 
ATOM   1231 N  NH1   . ARG A 1 153 ? 248.459 92.270  -55.288 1.00 50.36  ? 184 ARG A NH1   1 
ATOM   1232 N  NH2   . ARG A 1 153 ? 248.117 94.194  -54.085 1.00 50.36  ? 184 ARG A NH2   1 
ATOM   1233 N  N     . ARG A 1 154 ? 243.917 95.107  -60.591 1.00 46.91  ? 185 ARG A N     1 
ATOM   1234 C  CA    . ARG A 1 154 ? 244.020 94.574  -61.950 1.00 46.91  ? 185 ARG A CA    1 
ATOM   1235 C  C     . ARG A 1 154 ? 245.499 94.202  -62.079 1.00 46.91  ? 185 ARG A C     1 
ATOM   1236 O  O     . ARG A 1 154 ? 245.869 93.033  -61.978 1.00 46.91  ? 185 ARG A O     1 
ATOM   1237 C  CB    . ARG A 1 154 ? 243.638 95.630  -62.994 1.00 67.45  ? 185 ARG A CB    1 
ATOM   1238 C  CG    . ARG A 1 154 ? 242.168 96.051  -62.942 1.00 67.45  ? 185 ARG A CG    1 
ATOM   1239 C  CD    . ARG A 1 154 ? 241.930 97.100  -61.868 1.00 67.45  ? 185 ARG A CD    1 
ATOM   1240 N  NE    . ARG A 1 154 ? 240.513 97.402  -61.645 1.00 67.45  ? 185 ARG A NE    1 
ATOM   1241 C  CZ    . ARG A 1 154 ? 239.679 97.894  -62.561 1.00 67.45  ? 185 ARG A CZ    1 
ATOM   1242 N  NH1   . ARG A 1 154 ? 240.103 98.146  -63.800 1.00 67.45  ? 185 ARG A NH1   1 
ATOM   1243 N  NH2   . ARG A 1 154 ? 238.419 98.160  -62.224 1.00 67.45  ? 185 ARG A NH2   1 
ATOM   1244 N  N     . LYS A 1 155 ? 246.346 95.206  -62.282 1.00 58.60  ? 186 LYS A N     1 
ATOM   1245 C  CA    . LYS A 1 155 ? 247.787 94.975  -62.360 1.00 58.60  ? 186 LYS A CA    1 
ATOM   1246 C  C     . LYS A 1 155 ? 248.350 95.310  -60.973 1.00 58.60  ? 186 LYS A C     1 
ATOM   1247 O  O     . LYS A 1 155 ? 247.962 96.315  -60.360 1.00 58.60  ? 186 LYS A O     1 
ATOM   1248 C  CB    . LYS A 1 155 ? 248.423 95.874  -63.428 1.00 20.06  ? 186 LYS A CB    1 
ATOM   1249 N  N     . PHE A 1 156 ? 249.249 94.469  -60.470 1.00 42.19  ? 187 PHE A N     1 
ATOM   1250 C  CA    . PHE A 1 156 ? 249.841 94.695  -59.158 1.00 42.19  ? 187 PHE A CA    1 
ATOM   1251 C  C     . PHE A 1 156 ? 250.696 95.947  -59.125 1.00 42.19  ? 187 PHE A C     1 
ATOM   1252 O  O     . PHE A 1 156 ? 251.683 96.056  -59.850 1.00 42.19  ? 187 PHE A O     1 
ATOM   1253 C  CB    . PHE A 1 156 ? 250.674 93.482  -58.755 1.00 57.79  ? 187 PHE A CB    1 
ATOM   1254 C  CG    . PHE A 1 156 ? 251.633 93.736  -57.616 1.00 57.79  ? 187 PHE A CG    1 
ATOM   1255 C  CD1   . PHE A 1 156 ? 252.915 94.226  -57.860 1.00 57.79  ? 187 PHE A CD1   1 
ATOM   1256 C  CD2   . PHE A 1 156 ? 251.276 93.431  -56.305 1.00 57.79  ? 187 PHE A CD2   1 
ATOM   1257 C  CE1   . PHE A 1 156 ? 253.829 94.401  -56.817 1.00 57.79  ? 187 PHE A CE1   1 
ATOM   1258 C  CE2   . PHE A 1 156 ? 252.183 93.602  -55.257 1.00 57.79  ? 187 PHE A CE2   1 
ATOM   1259 C  CZ    . PHE A 1 156 ? 253.462 94.086  -55.514 1.00 57.79  ? 187 PHE A CZ    1 
ATOM   1260 N  N     . ILE A 1 157 ? 250.302 96.897  -58.286 1.00 39.69  ? 188 ILE A N     1 
ATOM   1261 C  CA    . ILE A 1 157 ? 251.046 98.137  -58.135 1.00 39.69  ? 188 ILE A CA    1 
ATOM   1262 C  C     . ILE A 1 157 ? 251.870 98.004  -56.880 1.00 39.69  ? 188 ILE A C     1 
ATOM   1263 O  O     . ILE A 1 157 ? 251.324 97.979  -55.785 1.00 39.69  ? 188 ILE A O     1 
ATOM   1264 C  CB    . ILE A 1 157 ? 250.140 99.341  -57.897 1.00 44.02  ? 188 ILE A CB    1 
ATOM   1265 C  CG1   . ILE A 1 157 ? 249.179 99.511  -59.062 1.00 44.02  ? 188 ILE A CG1   1 
ATOM   1266 C  CG2   . ILE A 1 157 ? 250.993 100.585 -57.682 1.00 44.02  ? 188 ILE A CG2   1 
ATOM   1267 C  CD1   . ILE A 1 157 ? 248.154 100.606 -58.827 1.00 44.02  ? 188 ILE A CD1   1 
ATOM   1268 N  N     . PRO A 1 158 ? 253.192 97.906  -57.011 1.00 41.16  ? 189 PRO A N     1 
ATOM   1269 C  CA    . PRO A 1 158 ? 253.985 97.786  -55.786 1.00 41.16  ? 189 PRO A CA    1 
ATOM   1270 C  C     . PRO A 1 158 ? 254.059 99.104  -55.025 1.00 41.16  ? 189 PRO A C     1 
ATOM   1271 O  O     . PRO A 1 158 ? 253.591 100.135 -55.508 1.00 41.16  ? 189 PRO A O     1 
ATOM   1272 C  CB    . PRO A 1 158 ? 255.341 97.313  -56.295 1.00 56.19  ? 189 PRO A CB    1 
ATOM   1273 C  CG    . PRO A 1 158 ? 255.393 97.880  -57.686 1.00 56.19  ? 189 PRO A CG    1 
ATOM   1274 C  CD    . PRO A 1 158 ? 254.005 97.634  -58.205 1.00 56.19  ? 189 PRO A CD    1 
ATOM   1275 N  N     . ASP A 1 159 ? 254.630 99.062  -53.828 1.00 40.50  ? 190 ASP A N     1 
ATOM   1276 C  CA    . ASP A 1 159 ? 254.759 100.253 -53.004 1.00 40.50  ? 190 ASP A CA    1 
ATOM   1277 C  C     . ASP A 1 159 ? 256.063 100.992 -53.236 1.00 40.50  ? 190 ASP A C     1 
ATOM   1278 O  O     . ASP A 1 159 ? 257.136 100.494 -52.908 1.00 40.50  ? 190 ASP A O     1 
ATOM   1279 C  CB    . ASP A 1 159 ? 254.679 99.892  -51.535 1.00 48.93  ? 190 ASP A CB    1 
ATOM   1280 C  CG    . ASP A 1 159 ? 255.271 100.961 -50.661 1.00 48.93  ? 190 ASP A CG    1 
ATOM   1281 O  OD1   . ASP A 1 159 ? 254.786 102.113 -50.720 1.00 48.93  ? 190 ASP A OD1   1 
ATOM   1282 O  OD2   . ASP A 1 159 ? 256.226 100.648 -49.927 1.00 48.93  ? 190 ASP A OD2   1 
ATOM   1283 N  N     . PRO A 1 160 ? 255.981 102.218 -53.763 1.00 46.82  ? 191 PRO A N     1 
ATOM   1284 C  CA    . PRO A 1 160 ? 257.168 103.027 -54.038 1.00 46.82  ? 191 PRO A CA    1 
ATOM   1285 C  C     . PRO A 1 160 ? 258.097 103.197 -52.839 1.00 46.82  ? 191 PRO A C     1 
ATOM   1286 O  O     . PRO A 1 160 ? 259.300 103.324 -53.012 1.00 46.82  ? 191 PRO A O     1 
ATOM   1287 C  CB    . PRO A 1 160 ? 256.577 104.354 -54.502 1.00 37.84  ? 191 PRO A CB    1 
ATOM   1288 C  CG    . PRO A 1 160 ? 255.332 104.455 -53.696 1.00 37.84  ? 191 PRO A CG    1 
ATOM   1289 C  CD    . PRO A 1 160 ? 254.766 103.049 -53.816 1.00 37.84  ? 191 PRO A CD    1 
ATOM   1290 N  N     . GLN A 1 161 ? 257.548 103.204 -51.628 1.00 38.79  ? 192 GLN A N     1 
ATOM   1291 C  CA    . GLN A 1 161 ? 258.377 103.378 -50.441 1.00 38.79  ? 192 GLN A CA    1 
ATOM   1292 C  C     . GLN A 1 161 ? 259.246 102.160 -50.190 1.00 38.79  ? 192 GLN A C     1 
ATOM   1293 O  O     . GLN A 1 161 ? 260.050 102.152 -49.271 1.00 38.79  ? 192 GLN A O     1 
ATOM   1294 C  CB    . GLN A 1 161 ? 257.520 103.645 -49.198 1.00 44.18  ? 192 GLN A CB    1 
ATOM   1295 C  CG    . GLN A 1 161 ? 256.647 104.883 -49.276 1.00 44.18  ? 192 GLN A CG    1 
ATOM   1296 C  CD    . GLN A 1 161 ? 256.211 105.380 -47.903 1.00 44.18  ? 192 GLN A CD    1 
ATOM   1297 O  OE1   . GLN A 1 161 ? 255.306 106.206 -47.792 1.00 44.18  ? 192 GLN A OE1   1 
ATOM   1298 N  NE2   . GLN A 1 161 ? 256.864 104.890 -46.853 1.00 44.18  ? 192 GLN A NE2   1 
ATOM   1299 N  N     . GLY A 1 162 ? 259.074 101.123 -50.996 1.00 36.94  ? 193 GLY A N     1 
ATOM   1300 C  CA    . GLY A 1 162 ? 259.878 99.932  -50.817 1.00 36.94  ? 193 GLY A CA    1 
ATOM   1301 C  C     . GLY A 1 162 ? 259.406 98.977  -49.735 1.00 36.94  ? 193 GLY A C     1 
ATOM   1302 O  O     . GLY A 1 162 ? 260.076 97.983  -49.455 1.00 36.94  ? 193 GLY A O     1 
ATOM   1303 N  N     . THR A 1 163 ? 258.267 99.267  -49.117 1.00 48.04  ? 194 THR A N     1 
ATOM   1304 C  CA    . THR A 1 163 ? 257.725 98.396  -48.075 1.00 48.04  ? 194 THR A CA    1 
ATOM   1305 C  C     . THR A 1 163 ? 257.775 96.949  -48.553 1.00 48.04  ? 194 THR A C     1 
ATOM   1306 O  O     . THR A 1 163 ? 257.683 96.689  -49.756 1.00 48.04  ? 194 THR A O     1 
ATOM   1307 C  CB    . THR A 1 163 ? 256.272 98.753  -47.777 1.00 40.19  ? 194 THR A CB    1 
ATOM   1308 O  OG1   . THR A 1 163 ? 256.194 100.139 -47.437 1.00 40.19  ? 194 THR A OG1   1 
ATOM   1309 C  CG2   . THR A 1 163 ? 255.739 97.919  -46.640 1.00 40.19  ? 194 THR A CG2   1 
ATOM   1310 N  N     . ASN A 1 164 ? 257.917 96.006  -47.624 1.00 44.70  ? 195 ASN A N     1 
ATOM   1311 C  CA    . ASN A 1 164 ? 257.980 94.594  -47.993 1.00 44.70  ? 195 ASN A CA    1 
ATOM   1312 C  C     . ASN A 1 164 ? 257.010 93.725  -47.205 1.00 44.70  ? 195 ASN A C     1 
ATOM   1313 O  O     . ASN A 1 164 ? 256.371 94.180  -46.257 1.00 44.70  ? 195 ASN A O     1 
ATOM   1314 C  CB    . ASN A 1 164 ? 259.399 94.056  -47.803 1.00 47.61  ? 195 ASN A CB    1 
ATOM   1315 C  CG    . ASN A 1 164 ? 259.801 93.963  -46.343 1.00 47.61  ? 195 ASN A CG    1 
ATOM   1316 O  OD1   . ASN A 1 164 ? 259.015 94.296  -45.449 1.00 47.61  ? 195 ASN A OD1   1 
ATOM   1317 N  ND2   . ASN A 1 164 ? 261.026 93.502  -46.090 1.00 47.61  ? 195 ASN A ND2   1 
ATOM   1318 N  N     . LEU A 1 165 ? 256.925 92.460  -47.594 1.00 45.42  ? 196 LEU A N     1 
ATOM   1319 C  CA    . LEU A 1 165 ? 256.028 91.530  -46.931 1.00 45.42  ? 196 LEU A CA    1 
ATOM   1320 C  C     . LEU A 1 165 ? 256.390 91.278  -45.473 1.00 45.42  ? 196 LEU A C     1 
ATOM   1321 O  O     . LEU A 1 165 ? 255.498 91.108  -44.638 1.00 45.42  ? 196 LEU A O     1 
ATOM   1322 C  CB    . LEU A 1 165 ? 255.971 90.198  -47.688 1.00 41.26  ? 196 LEU A CB    1 
ATOM   1323 C  CG    . LEU A 1 165 ? 255.311 90.214  -49.069 1.00 41.26  ? 196 LEU A CG    1 
ATOM   1324 C  CD1   . LEU A 1 165 ? 255.016 88.794  -49.491 1.00 41.26  ? 196 LEU A CD1   1 
ATOM   1325 C  CD2   . LEU A 1 165 ? 254.023 91.020  -49.026 1.00 41.26  ? 196 LEU A CD2   1 
ATOM   1326 N  N     . MET A 1 166 ? 257.683 91.242  -45.157 1.00 28.88  ? 197 MET A N     1 
ATOM   1327 C  CA    . MET A 1 166 ? 258.084 91.018  -43.776 1.00 28.88  ? 197 MET A CA    1 
ATOM   1328 C  C     . MET A 1 166 ? 257.366 92.056  -42.926 1.00 28.88  ? 197 MET A C     1 
ATOM   1329 O  O     . MET A 1 166 ? 257.094 91.836  -41.743 1.00 28.88  ? 197 MET A O     1 
ATOM   1330 C  CB    . MET A 1 166 ? 259.593 91.155  -43.628 1.00 37.02  ? 197 MET A CB    1 
ATOM   1331 C  CG    . MET A 1 166 ? 260.085 90.954  -42.209 1.00 37.02  ? 197 MET A CG    1 
ATOM   1332 S  SD    . MET A 1 166 ? 259.708 89.349  -41.531 1.00 37.02  ? 197 MET A SD    1 
ATOM   1333 C  CE    . MET A 1 166 ? 260.624 89.388  -39.957 1.00 37.02  ? 197 MET A CE    1 
ATOM   1334 N  N     . PHE A 1 167 ? 257.058 93.193  -43.553 1.00 41.37  ? 198 PHE A N     1 
ATOM   1335 C  CA    . PHE A 1 167 ? 256.331 94.273  -42.901 1.00 41.37  ? 198 PHE A CA    1 
ATOM   1336 C  C     . PHE A 1 167 ? 254.843 93.934  -42.984 1.00 41.37  ? 198 PHE A C     1 
ATOM   1337 O  O     . PHE A 1 167 ? 254.126 93.938  -41.982 1.00 41.37  ? 198 PHE A O     1 
ATOM   1338 C  CB    . PHE A 1 167 ? 256.586 95.610  -43.609 1.00 35.32  ? 198 PHE A CB    1 
ATOM   1339 C  CG    . PHE A 1 167 ? 255.617 96.708  -43.206 1.00 35.32  ? 198 PHE A CG    1 
ATOM   1340 C  CD1   . PHE A 1 167 ? 255.914 97.575  -42.163 1.00 35.32  ? 198 PHE A CD1   1 
ATOM   1341 C  CD2   . PHE A 1 167 ? 254.384 96.845  -43.853 1.00 35.32  ? 198 PHE A CD2   1 
ATOM   1342 C  CE1   . PHE A 1 167 ? 254.993 98.556  -41.773 1.00 35.32  ? 198 PHE A CE1   1 
ATOM   1343 C  CE2   . PHE A 1 167 ? 253.471 97.818  -43.466 1.00 35.32  ? 198 PHE A CE2   1 
ATOM   1344 C  CZ    . PHE A 1 167 ? 253.774 98.671  -42.428 1.00 35.32  ? 198 PHE A CZ    1 
ATOM   1345 N  N     . ALA A 1 168 ? 254.385 93.641  -44.194 1.00 41.66  ? 199 ALA A N     1 
ATOM   1346 C  CA    . ALA A 1 168 ? 252.989 93.303  -44.417 1.00 41.66  ? 199 ALA A CA    1 
ATOM   1347 C  C     . ALA A 1 168 ? 252.457 92.382  -43.330 1.00 41.66  ? 199 ALA A C     1 
ATOM   1348 O  O     . ALA A 1 168 ? 251.396 92.635  -42.759 1.00 41.66  ? 199 ALA A O     1 
ATOM   1349 C  CB    . ALA A 1 168 ? 252.827 92.648  -45.769 1.00 43.27  ? 199 ALA A CB    1 
ATOM   1350 N  N     . PHE A 1 169 ? 253.192 91.311  -43.038 1.00 45.66  ? 200 PHE A N     1 
ATOM   1351 C  CA    . PHE A 1 169 ? 252.746 90.381  -42.020 1.00 45.66  ? 200 PHE A CA    1 
ATOM   1352 C  C     . PHE A 1 169 ? 252.847 90.994  -40.637 1.00 45.66  ? 200 PHE A C     1 
ATOM   1353 O  O     . PHE A 1 169 ? 251.839 91.097  -39.943 1.00 45.66  ? 200 PHE A O     1 
ATOM   1354 C  CB    . PHE A 1 169 ? 253.528 89.075  -42.109 1.00 39.37  ? 200 PHE A CB    1 
ATOM   1355 C  CG    . PHE A 1 169 ? 253.162 88.232  -43.308 1.00 39.37  ? 200 PHE A CG    1 
ATOM   1356 C  CD1   . PHE A 1 169 ? 251.820 88.001  -43.631 1.00 39.37  ? 200 PHE A CD1   1 
ATOM   1357 C  CD2   . PHE A 1 169 ? 254.150 87.670  -44.117 1.00 39.37  ? 200 PHE A CD2   1 
ATOM   1358 C  CE1   . PHE A 1 169 ? 251.466 87.225  -44.744 1.00 39.37  ? 200 PHE A CE1   1 
ATOM   1359 C  CE2   . PHE A 1 169 ? 253.809 86.893  -45.226 1.00 39.37  ? 200 PHE A CE2   1 
ATOM   1360 C  CZ    . PHE A 1 169 ? 252.463 86.672  -45.542 1.00 39.37  ? 200 PHE A CZ    1 
ATOM   1361 N  N     . PHE A 1 170 ? 254.041 91.423  -40.230 1.00 34.75  ? 201 PHE A N     1 
ATOM   1362 C  CA    . PHE A 1 170 ? 254.191 92.042  -38.914 1.00 34.75  ? 201 PHE A CA    1 
ATOM   1363 C  C     . PHE A 1 170 ? 252.974 92.934  -38.676 1.00 34.75  ? 201 PHE A C     1 
ATOM   1364 O  O     . PHE A 1 170 ? 252.343 92.876  -37.630 1.00 34.75  ? 201 PHE A O     1 
ATOM   1365 C  CB    . PHE A 1 170 ? 255.480 92.875  -38.853 1.00 37.91  ? 201 PHE A CB    1 
ATOM   1366 C  CG    . PHE A 1 170 ? 255.757 93.493  -37.493 1.00 37.91  ? 201 PHE A CG    1 
ATOM   1367 C  CD1   . PHE A 1 170 ? 257.025 93.407  -36.922 1.00 37.91  ? 201 PHE A CD1   1 
ATOM   1368 C  CD2   . PHE A 1 170 ? 254.763 94.169  -36.789 1.00 37.91  ? 201 PHE A CD2   1 
ATOM   1369 C  CE1   . PHE A 1 170 ? 257.292 93.982  -35.678 1.00 37.91  ? 201 PHE A CE1   1 
ATOM   1370 C  CE2   . PHE A 1 170 ? 255.023 94.744  -35.547 1.00 37.91  ? 201 PHE A CE2   1 
ATOM   1371 C  CZ    . PHE A 1 170 ? 256.285 94.650  -34.995 1.00 37.91  ? 201 PHE A CZ    1 
ATOM   1372 N  N     . ALA A 1 171 ? 252.644 93.744  -39.673 1.00 35.25  ? 202 ALA A N     1 
ATOM   1373 C  CA    . ALA A 1 171 ? 251.507 94.644  -39.593 1.00 35.25  ? 202 ALA A CA    1 
ATOM   1374 C  C     . ALA A 1 171 ? 250.243 93.888  -39.196 1.00 35.25  ? 202 ALA A C     1 
ATOM   1375 O  O     . ALA A 1 171 ? 249.569 94.247  -38.235 1.00 35.25  ? 202 ALA A O     1 
ATOM   1376 C  CB    . ALA A 1 171 ? 251.308 95.323  -40.923 1.00 38.22  ? 202 ALA A CB    1 
ATOM   1377 N  N     . GLN A 1 172 ? 249.929 92.835  -39.944 1.00 51.62  ? 203 GLN A N     1 
ATOM   1378 C  CA    . GLN A 1 172 ? 248.745 92.022  -39.665 1.00 51.62  ? 203 GLN A CA    1 
ATOM   1379 C  C     . GLN A 1 172 ? 248.763 91.424  -38.263 1.00 51.62  ? 203 GLN A C     1 
ATOM   1380 O  O     . GLN A 1 172 ? 247.830 91.599  -37.480 1.00 51.62  ? 203 GLN A O     1 
ATOM   1381 C  CB    . GLN A 1 172 ? 248.614 90.887  -40.688 1.00 45.84  ? 203 GLN A CB    1 
ATOM   1382 C  CG    . GLN A 1 172 ? 247.425 89.972  -40.404 1.00 45.84  ? 203 GLN A CG    1 
ATOM   1383 C  CD    . GLN A 1 172 ? 246.991 89.173  -41.600 1.00 45.84  ? 203 GLN A CD    1 
ATOM   1384 O  OE1   . GLN A 1 172 ? 245.850 88.741  -41.670 1.00 45.84  ? 203 GLN A OE1   1 
ATOM   1385 N  NE2   . GLN A 1 172 ? 247.896 88.970  -42.549 1.00 45.84  ? 203 GLN A NE2   1 
ATOM   1386 N  N     . HIS A 1 173 ? 249.829 90.698  -37.965 1.00 33.88  ? 204 HIS A N     1 
ATOM   1387 C  CA    . HIS A 1 173 ? 249.985 90.080  -36.669 1.00 33.88  ? 204 HIS A CA    1 
ATOM   1388 C  C     . HIS A 1 173 ? 249.781 91.141  -35.596 1.00 33.88  ? 204 HIS A C     1 
ATOM   1389 O  O     . HIS A 1 173 ? 248.803 91.090  -34.856 1.00 33.88  ? 204 HIS A O     1 
ATOM   1390 C  CB    . HIS A 1 173 ? 251.373 89.444  -36.596 1.00 47.28  ? 204 HIS A CB    1 
ATOM   1391 C  CG    . HIS A 1 173 ? 251.721 88.865  -35.263 1.00 47.28  ? 204 HIS A CG    1 
ATOM   1392 N  ND1   . HIS A 1 173 ? 252.637 87.847  -35.114 1.00 47.28  ? 204 HIS A ND1   1 
ATOM   1393 C  CD2   . HIS A 1 173 ? 251.332 89.205  -34.015 1.00 47.28  ? 204 HIS A CD2   1 
ATOM   1394 C  CE1   . HIS A 1 173 ? 252.797 87.585  -33.829 1.00 47.28  ? 204 HIS A CE1   1 
ATOM   1395 N  NE2   . HIS A 1 173 ? 252.017 88.396  -33.140 1.00 47.28  ? 204 HIS A NE2   1 
ATOM   1396 N  N     . PHE A 1 174 ? 250.686 92.114  -35.536 1.00 35.11  ? 205 PHE A N     1 
ATOM   1397 C  CA    . PHE A 1 174 ? 250.609 93.192  -34.550 1.00 35.11  ? 205 PHE A CA    1 
ATOM   1398 C  C     . PHE A 1 174 ? 249.208 93.785  -34.365 1.00 35.11  ? 205 PHE A C     1 
ATOM   1399 O  O     . PHE A 1 174 ? 248.671 93.764  -33.263 1.00 35.11  ? 205 PHE A O     1 
ATOM   1400 C  CB    . PHE A 1 174 ? 251.602 94.323  -34.911 1.00 38.50  ? 205 PHE A CB    1 
ATOM   1401 C  CG    . PHE A 1 174 ? 251.510 95.552  -34.012 1.00 38.50  ? 205 PHE A CG    1 
ATOM   1402 C  CD1   . PHE A 1 174 ? 252.109 95.568  -32.757 1.00 38.50  ? 205 PHE A CD1   1 
ATOM   1403 C  CD2   . PHE A 1 174 ? 250.775 96.675  -34.413 1.00 38.50  ? 205 PHE A CD2   1 
ATOM   1404 C  CE1   . PHE A 1 174 ? 251.973 96.675  -31.914 1.00 38.50  ? 205 PHE A CE1   1 
ATOM   1405 C  CE2   . PHE A 1 174 ? 250.637 97.778  -33.579 1.00 38.50  ? 205 PHE A CE2   1 
ATOM   1406 C  CZ    . PHE A 1 174 ? 251.234 97.779  -32.326 1.00 38.50  ? 205 PHE A CZ    1 
ATOM   1407 N  N     . THR A 1 175 ? 248.604 94.308  -35.423 1.00 31.63  ? 206 THR A N     1 
ATOM   1408 C  CA    . THR A 1 175 ? 247.293 94.923  -35.268 1.00 31.63  ? 206 THR A CA    1 
ATOM   1409 C  C     . THR A 1 175 ? 246.211 93.987  -34.776 1.00 31.63  ? 206 THR A C     1 
ATOM   1410 O  O     . THR A 1 175 ? 245.170 94.442  -34.301 1.00 31.63  ? 206 THR A O     1 
ATOM   1411 C  CB    . THR A 1 175 ? 246.781 95.508  -36.560 1.00 34.33  ? 206 THR A CB    1 
ATOM   1412 O  OG1   . THR A 1 175 ? 246.247 94.462  -37.370 1.00 34.33  ? 206 THR A OG1   1 
ATOM   1413 C  CG2   . THR A 1 175 ? 247.887 96.175  -37.297 1.00 34.33  ? 206 THR A CG2   1 
ATOM   1414 N  N     . HIS A 1 176 ? 246.435 92.682  -34.890 1.00 49.31  ? 207 HIS A N     1 
ATOM   1415 C  CA    . HIS A 1 176 ? 245.417 91.732  -34.456 1.00 49.31  ? 207 HIS A CA    1 
ATOM   1416 C  C     . HIS A 1 176 ? 245.282 91.533  -32.963 1.00 49.31  ? 207 HIS A C     1 
ATOM   1417 O  O     . HIS A 1 176 ? 244.530 90.665  -32.530 1.00 49.31  ? 207 HIS A O     1 
ATOM   1418 C  CB    . HIS A 1 176 ? 245.609 90.375  -35.138 1.00 47.30  ? 207 HIS A CB    1 
ATOM   1419 C  CG    . HIS A 1 176 ? 244.900 90.271  -36.451 1.00 47.30  ? 207 HIS A CG    1 
ATOM   1420 N  ND1   . HIS A 1 176 ? 245.323 90.942  -37.578 1.00 47.30  ? 207 HIS A ND1   1 
ATOM   1421 C  CD2   . HIS A 1 176 ? 243.745 89.654  -36.791 1.00 47.30  ? 207 HIS A CD2   1 
ATOM   1422 C  CE1   . HIS A 1 176 ? 244.457 90.746  -38.556 1.00 47.30  ? 207 HIS A CE1   1 
ATOM   1423 N  NE2   . HIS A 1 176 ? 243.490 89.969  -38.104 1.00 47.30  ? 207 HIS A NE2   1 
ATOM   1424 N  N     . GLN A 1 177 ? 246.001 92.329  -32.174 1.00 46.60  ? 208 GLN A N     1 
ATOM   1425 C  CA    . GLN A 1 177 ? 245.903 92.207  -30.730 1.00 46.60  ? 208 GLN A CA    1 
ATOM   1426 C  C     . GLN A 1 177 ? 244.893 93.213  -30.204 1.00 46.60  ? 208 GLN A C     1 
ATOM   1427 O  O     . GLN A 1 177 ? 244.359 93.033  -29.115 1.00 46.60  ? 208 GLN A O     1 
ATOM   1428 C  CB    . GLN A 1 177 ? 247.272 92.372  -30.057 1.00 35.76  ? 208 GLN A CB    1 
ATOM   1429 C  CG    . GLN A 1 177 ? 247.843 93.774  -29.986 1.00 35.76  ? 208 GLN A CG    1 
ATOM   1430 C  CD    . GLN A 1 177 ? 249.289 93.781  -29.470 1.00 35.76  ? 208 GLN A CD    1 
ATOM   1431 O  OE1   . GLN A 1 177 ? 250.237 93.754  -30.251 1.00 35.76  ? 208 GLN A OE1   1 
ATOM   1432 N  NE2   . GLN A 1 177 ? 249.455 93.799  -28.149 1.00 35.76  ? 208 GLN A NE2   1 
ATOM   1433 N  N     . PHE A 1 178 ? 244.612 94.266  -30.975 1.00 50.76  ? 209 PHE A N     1 
ATOM   1434 C  CA    . PHE A 1 178 ? 243.610 95.246  -30.543 1.00 50.76  ? 209 PHE A CA    1 
ATOM   1435 C  C     . PHE A 1 178 ? 242.333 95.126  -31.356 1.00 50.76  ? 209 PHE A C     1 
ATOM   1436 O  O     . PHE A 1 178 ? 241.256 95.511  -30.903 1.00 50.76  ? 209 PHE A O     1 
ATOM   1437 C  CB    . PHE A 1 178 ? 244.109 96.708  -30.599 1.00 39.47  ? 209 PHE A CB    1 
ATOM   1438 C  CG    . PHE A 1 178 ? 245.342 96.921  -31.410 1.00 39.47  ? 209 PHE A CG    1 
ATOM   1439 C  CD1   . PHE A 1 178 ? 246.586 96.566  -30.910 1.00 39.47  ? 209 PHE A CD1   1 
ATOM   1440 C  CD2   . PHE A 1 178 ? 245.264 97.523  -32.660 1.00 39.47  ? 209 PHE A CD2   1 
ATOM   1441 C  CE1   . PHE A 1 178 ? 247.732 96.808  -31.636 1.00 39.47  ? 209 PHE A CE1   1 
ATOM   1442 C  CE2   . PHE A 1 178 ? 246.406 97.770  -33.398 1.00 39.47  ? 209 PHE A CE2   1 
ATOM   1443 C  CZ    . PHE A 1 178 ? 247.644 97.413  -32.885 1.00 39.47  ? 209 PHE A CZ    1 
ATOM   1444 N  N     . PHE A 1 179 ? 242.456 94.594  -32.563 1.00 47.62  ? 210 PHE A N     1 
ATOM   1445 C  CA    . PHE A 1 179 ? 241.290 94.405  -33.409 1.00 47.62  ? 210 PHE A CA    1 
ATOM   1446 C  C     . PHE A 1 179 ? 240.836 92.939  -33.319 1.00 47.62  ? 210 PHE A C     1 
ATOM   1447 O  O     . PHE A 1 179 ? 241.466 92.047  -33.896 1.00 47.62  ? 210 PHE A O     1 
ATOM   1448 C  CB    . PHE A 1 179 ? 241.620 94.743  -34.866 1.00 42.97  ? 210 PHE A CB    1 
ATOM   1449 C  CG    . PHE A 1 179 ? 242.137 96.127  -35.070 1.00 42.97  ? 210 PHE A CG    1 
ATOM   1450 C  CD1   . PHE A 1 179 ? 241.403 97.228  -34.650 1.00 42.97  ? 210 PHE A CD1   1 
ATOM   1451 C  CD2   . PHE A 1 179 ? 243.356 96.336  -35.702 1.00 42.97  ? 210 PHE A CD2   1 
ATOM   1452 C  CE1   . PHE A 1 179 ? 241.871 98.522  -34.854 1.00 42.97  ? 210 PHE A CE1   1 
ATOM   1453 C  CE2   . PHE A 1 179 ? 243.838 97.632  -35.914 1.00 42.97  ? 210 PHE A CE2   1 
ATOM   1454 C  CZ    . PHE A 1 179 ? 243.091 98.725  -35.487 1.00 42.97  ? 210 PHE A CZ    1 
ATOM   1455 N  N     . LYS A 1 180 ? 239.768 92.691  -32.571 1.00 34.05  ? 211 LYS A N     1 
ATOM   1456 C  CA    . LYS A 1 180 ? 239.211 91.345  -32.435 1.00 34.05  ? 211 LYS A CA    1 
ATOM   1457 C  C     . LYS A 1 180 ? 237.717 91.520  -32.308 1.00 34.05  ? 211 LYS A C     1 
ATOM   1458 O  O     . LYS A 1 180 ? 237.166 91.477  -31.208 1.00 34.05  ? 211 LYS A O     1 
ATOM   1459 C  CB    . LYS A 1 180 ? 239.737 90.635  -31.192 1.00 24.83  ? 211 LYS A CB    1 
ATOM   1460 C  CG    . LYS A 1 180 ? 241.076 89.974  -31.348 1.00 24.83  ? 211 LYS A CG    1 
ATOM   1461 C  CD    . LYS A 1 180 ? 241.271 89.032  -30.186 1.00 24.83  ? 211 LYS A CD    1 
ATOM   1462 C  CE    . LYS A 1 180 ? 242.688 88.518  -30.092 1.00 24.83  ? 211 LYS A CE    1 
ATOM   1463 N  NZ    . LYS A 1 180 ? 242.875 87.660  -28.887 1.00 24.83  ? 211 LYS A NZ    1 
ATOM   1464 N  N     . THR A 1 181 ? 237.061 91.725  -33.441 1.00 51.41  ? 212 THR A N     1 
ATOM   1465 C  CA    . THR A 1 181 ? 235.631 91.951  -33.421 1.00 51.41  ? 212 THR A CA    1 
ATOM   1466 C  C     . THR A 1 181 ? 234.893 90.663  -33.095 1.00 51.41  ? 212 THR A C     1 
ATOM   1467 O  O     . THR A 1 181 ? 235.063 89.644  -33.768 1.00 51.41  ? 212 THR A O     1 
ATOM   1468 C  CB    . THR A 1 181 ? 235.135 92.544  -34.767 1.00 64.73  ? 212 THR A CB    1 
ATOM   1469 O  OG1   . THR A 1 181 ? 236.022 93.591  -35.198 1.00 64.73  ? 212 THR A OG1   1 
ATOM   1470 C  CG2   . THR A 1 181 ? 233.740 93.147  -34.595 1.00 64.73  ? 212 THR A CG2   1 
ATOM   1471 N  N     . SER A 1 182 ? 234.092 90.725  -32.034 1.00 68.40  ? 213 SER A N     1 
ATOM   1472 C  CA    . SER A 1 182 ? 233.296 89.599  -31.545 1.00 68.40  ? 213 SER A CA    1 
ATOM   1473 C  C     . SER A 1 182 ? 232.059 89.309  -32.401 1.00 68.40  ? 213 SER A C     1 
ATOM   1474 O  O     . SER A 1 182 ? 231.034 89.994  -32.274 1.00 68.40  ? 213 SER A O     1 
ATOM   1475 C  CB    . SER A 1 182 ? 232.866 89.874  -30.099 1.00 48.95  ? 213 SER A CB    1 
ATOM   1476 O  OG    . SER A 1 182 ? 231.728 89.118  -29.736 1.00 48.95  ? 213 SER A OG    1 
ATOM   1477 N  N     . GLY A 1 183 ? 232.162 88.290  -33.262 1.00 67.53  ? 214 GLY A N     1 
ATOM   1478 C  CA    . GLY A 1 183 ? 231.054 87.908  -34.130 1.00 67.53  ? 214 GLY A CA    1 
ATOM   1479 C  C     . GLY A 1 183 ? 229.730 87.783  -33.383 1.00 67.53  ? 214 GLY A C     1 
ATOM   1480 O  O     . GLY A 1 183 ? 228.696 88.299  -33.829 1.00 67.53  ? 214 GLY A O     1 
ATOM   1481 N  N     . LYS A 1 184 ? 229.767 87.098  -32.242 1.00 47.81  ? 215 LYS A N     1 
ATOM   1482 C  CA    . LYS A 1 184 ? 228.589 86.910  -31.406 1.00 47.81  ? 215 LYS A CA    1 
ATOM   1483 C  C     . LYS A 1 184 ? 227.922 88.251  -31.081 1.00 47.81  ? 215 LYS A C     1 
ATOM   1484 O  O     . LYS A 1 184 ? 226.705 88.411  -31.235 1.00 47.81  ? 215 LYS A O     1 
ATOM   1485 C  CB    . LYS A 1 184 ? 228.982 86.198  -30.115 1.00 45.87  ? 215 LYS A CB    1 
ATOM   1486 N  N     . MET A 1 185 ? 228.728 89.205  -30.623 1.00 48.36  ? 216 MET A N     1 
ATOM   1487 C  CA    . MET A 1 185 ? 228.239 90.531  -30.271 1.00 48.36  ? 216 MET A CA    1 
ATOM   1488 C  C     . MET A 1 185 ? 228.041 91.390  -31.516 1.00 48.36  ? 216 MET A C     1 
ATOM   1489 O  O     . MET A 1 185 ? 227.333 92.402  -31.495 1.00 48.36  ? 216 MET A O     1 
ATOM   1490 C  CB    . MET A 1 185 ? 229.217 91.191  -29.305 1.00 62.34  ? 216 MET A CB    1 
ATOM   1491 C  CG    . MET A 1 185 ? 229.203 90.545  -27.934 1.00 62.34  ? 216 MET A CG    1 
ATOM   1492 S  SD    . MET A 1 185 ? 230.635 90.953  -26.898 1.00 62.34  ? 216 MET A SD    1 
ATOM   1493 C  CE    . MET A 1 185 ? 231.703 89.384  -27.044 1.00 62.34  ? 216 MET A CE    1 
ATOM   1494 N  N     . GLY A 1 186 ? 228.670 90.978  -32.607 1.00 77.75  ? 217 GLY A N     1 
ATOM   1495 C  CA    . GLY A 1 186 ? 228.513 91.709  -33.849 1.00 77.75  ? 217 GLY A CA    1 
ATOM   1496 C  C     . GLY A 1 186 ? 229.543 92.782  -34.126 1.00 77.75  ? 217 GLY A C     1 
ATOM   1497 O  O     . GLY A 1 186 ? 230.631 92.770  -33.543 1.00 77.75  ? 217 GLY A O     1 
ATOM   1498 N  N     . PRO A 1 187 ? 229.231 93.724  -35.032 1.00 70.28  ? 218 PRO A N     1 
ATOM   1499 C  CA    . PRO A 1 187 ? 230.176 94.797  -35.357 1.00 70.28  ? 218 PRO A CA    1 
ATOM   1500 C  C     . PRO A 1 187 ? 230.163 95.766  -34.194 1.00 70.28  ? 218 PRO A C     1 
ATOM   1501 O  O     . PRO A 1 187 ? 229.162 95.838  -33.473 1.00 70.28  ? 218 PRO A O     1 
ATOM   1502 C  CB    . PRO A 1 187 ? 229.576 95.430  -36.612 1.00 79.72  ? 218 PRO A CB    1 
ATOM   1503 C  CG    . PRO A 1 187 ? 228.608 94.382  -37.137 1.00 79.72  ? 218 PRO A CG    1 
ATOM   1504 C  CD    . PRO A 1 187 ? 228.031 93.815  -35.876 1.00 79.72  ? 218 PRO A CD    1 
ATOM   1505 N  N     . GLY A 1 188 ? 231.261 96.488  -34.000 1.00 49.21  ? 219 GLY A N     1 
ATOM   1506 C  CA    . GLY A 1 188 ? 231.303 97.460  -32.922 1.00 49.21  ? 219 GLY A CA    1 
ATOM   1507 C  C     . GLY A 1 188 ? 231.608 96.957  -31.524 1.00 49.21  ? 219 GLY A C     1 
ATOM   1508 O  O     . GLY A 1 188 ? 231.533 97.735  -30.577 1.00 49.21  ? 219 GLY A O     1 
ATOM   1509 N  N     . PHE A 1 189 ? 231.930 95.671  -31.385 1.00 42.01  ? 220 PHE A N     1 
ATOM   1510 C  CA    . PHE A 1 189 ? 232.282 95.075  -30.094 1.00 42.01  ? 220 PHE A CA    1 
ATOM   1511 C  C     . PHE A 1 189 ? 233.619 94.362  -30.282 1.00 42.01  ? 220 PHE A C     1 
ATOM   1512 O  O     . PHE A 1 189 ? 233.964 94.005  -31.405 1.00 42.01  ? 220 PHE A O     1 
ATOM   1513 C  CB    . PHE A 1 189 ? 231.221 94.066  -29.650 1.00 31.73  ? 220 PHE A CB    1 
ATOM   1514 C  CG    . PHE A 1 189 ? 229.938 94.693  -29.177 1.00 31.73  ? 220 PHE A CG    1 
ATOM   1515 C  CD1   . PHE A 1 189 ? 229.023 95.204  -30.078 1.00 31.73  ? 220 PHE A CD1   1 
ATOM   1516 C  CD2   . PHE A 1 189 ? 229.649 94.774  -27.817 1.00 31.73  ? 220 PHE A CD2   1 
ATOM   1517 C  CE1   . PHE A 1 189 ? 227.833 95.785  -29.630 1.00 31.73  ? 220 PHE A CE1   1 
ATOM   1518 C  CE2   . PHE A 1 189 ? 228.462 95.354  -27.366 1.00 31.73  ? 220 PHE A CE2   1 
ATOM   1519 C  CZ    . PHE A 1 189 ? 227.555 95.858  -28.274 1.00 31.73  ? 220 PHE A CZ    1 
ATOM   1520 N  N     . THR A 1 190 ? 234.374 94.133  -29.212 1.00 39.79  ? 221 THR A N     1 
ATOM   1521 C  CA    . THR A 1 190 ? 235.670 93.471  -29.373 1.00 39.79  ? 221 THR A CA    1 
ATOM   1522 C  C     . THR A 1 190 ? 236.060 92.480  -28.292 1.00 39.79  ? 221 THR A C     1 
ATOM   1523 O  O     . THR A 1 190 ? 235.877 92.739  -27.105 1.00 39.79  ? 221 THR A O     1 
ATOM   1524 C  CB    . THR A 1 190 ? 236.802 94.485  -29.443 1.00 42.96  ? 221 THR A CB    1 
ATOM   1525 O  OG1   . THR A 1 190 ? 238.050 93.800  -29.582 1.00 42.96  ? 221 THR A OG1   1 
ATOM   1526 C  CG2   . THR A 1 190 ? 236.848 95.298  -28.179 1.00 42.96  ? 221 THR A CG2   1 
ATOM   1527 N  N     . LYS A 1 191 ? 236.626 91.353  -28.705 1.00 44.85  ? 222 LYS A N     1 
ATOM   1528 C  CA    . LYS A 1 191 ? 237.059 90.335  -27.755 1.00 44.85  ? 222 LYS A CA    1 
ATOM   1529 C  C     . LYS A 1 191 ? 238.286 90.866  -27.051 1.00 44.85  ? 222 LYS A C     1 
ATOM   1530 O  O     . LYS A 1 191 ? 238.419 90.751  -25.835 1.00 44.85  ? 222 LYS A O     1 
ATOM   1531 C  CB    . LYS A 1 191 ? 237.425 89.038  -28.471 1.00 79.25  ? 222 LYS A CB    1 
ATOM   1532 C  CG    . LYS A 1 191 ? 236.346 88.533  -29.410 1.00 79.25  ? 222 LYS A CG    1 
ATOM   1533 C  CD    . LYS A 1 191 ? 236.377 87.023  -29.502 1.00 79.25  ? 222 LYS A CD    1 
ATOM   1534 C  CE    . LYS A 1 191 ? 236.077 86.429  -28.129 1.00 79.25  ? 222 LYS A CE    1 
ATOM   1535 N  NZ    . LYS A 1 191 ? 234.851 87.067  -27.551 1.00 79.25  ? 222 LYS A NZ    1 
ATOM   1536 N  N     . ALA A 1 192 ? 239.181 91.446  -27.848 1.00 80.65  ? 223 ALA A N     1 
ATOM   1537 C  CA    . ALA A 1 192 ? 240.436 92.030  -27.368 1.00 80.65  ? 223 ALA A CA    1 
ATOM   1538 C  C     . ALA A 1 192 ? 240.176 93.235  -26.480 1.00 80.65  ? 223 ALA A C     1 
ATOM   1539 O  O     . ALA A 1 192 ? 240.176 94.381  -26.942 1.00 80.65  ? 223 ALA A O     1 
ATOM   1540 C  CB    . ALA A 1 192 ? 241.320 92.444  -28.557 1.00 35.01  ? 223 ALA A CB    1 
ATOM   1541 N  N     . LEU A 1 193 ? 239.917 92.958  -25.208 1.00 78.02  ? 224 LEU A N     1 
ATOM   1542 C  CA    . LEU A 1 193 ? 239.696 94.002  -24.220 1.00 78.02  ? 224 LEU A CA    1 
ATOM   1543 C  C     . LEU A 1 193 ? 241.145 94.403  -23.964 1.00 78.02  ? 224 LEU A C     1 
ATOM   1544 O  O     . LEU A 1 193 ? 242.061 93.685  -24.392 1.00 78.02  ? 224 LEU A O     1 
ATOM   1545 C  CB    . LEU A 1 193 ? 239.048 93.406  -22.959 1.00 28.24  ? 224 LEU A CB    1 
ATOM   1546 C  CG    . LEU A 1 193 ? 237.738 92.604  -23.082 1.00 28.24  ? 224 LEU A CG    1 
ATOM   1547 C  CD1   . LEU A 1 193 ? 237.464 91.935  -21.756 1.00 28.24  ? 224 LEU A CD1   1 
ATOM   1548 C  CD2   . LEU A 1 193 ? 236.568 93.485  -23.476 1.00 28.24  ? 224 LEU A CD2   1 
ATOM   1549 N  N     . GLY A 1 194 ? 241.386 95.520  -23.294 1.00 38.52  ? 225 GLY A N     1 
ATOM   1550 C  CA    . GLY A 1 194 ? 242.773 95.897  -23.081 1.00 38.52  ? 225 GLY A CA    1 
ATOM   1551 C  C     . GLY A 1 194 ? 243.142 96.988  -24.058 1.00 38.52  ? 225 GLY A C     1 
ATOM   1552 O  O     . GLY A 1 194 ? 244.011 97.810  -23.786 1.00 38.52  ? 225 GLY A O     1 
ATOM   1553 N  N     . HIS A 1 195 ? 242.489 96.973  -25.212 1.00 45.83  ? 226 HIS A N     1 
ATOM   1554 C  CA    . HIS A 1 195 ? 242.680 97.995  -26.228 1.00 45.83  ? 226 HIS A CA    1 
ATOM   1555 C  C     . HIS A 1 195 ? 244.099 98.511  -26.446 1.00 45.83  ? 226 HIS A C     1 
ATOM   1556 O  O     . HIS A 1 195 ? 244.357 99.695  -26.257 1.00 45.83  ? 226 HIS A O     1 
ATOM   1557 C  CB    . HIS A 1 195 ? 241.791 99.178  -25.876 1.00 33.47  ? 226 HIS A CB    1 
ATOM   1558 C  CG    . HIS A 1 195 ? 240.363 98.811  -25.666 1.00 33.47  ? 226 HIS A CG    1 
ATOM   1559 N  ND1   . HIS A 1 195 ? 239.463 98.708  -26.701 1.00 33.47  ? 226 HIS A ND1   1 
ATOM   1560 C  CD2   . HIS A 1 195 ? 239.679 98.507  -24.541 1.00 33.47  ? 226 HIS A CD2   1 
ATOM   1561 C  CE1   . HIS A 1 195 ? 238.283 98.358  -26.223 1.00 33.47  ? 226 HIS A CE1   1 
ATOM   1562 N  NE2   . HIS A 1 195 ? 238.387 98.229  -24.915 1.00 33.47  ? 226 HIS A NE2   1 
ATOM   1563 N  N     . GLY A 1 196 ? 245.027 97.667  -26.856 1.00 32.19  ? 227 GLY A N     1 
ATOM   1564 C  CA    . GLY A 1 196 ? 246.349 98.205  -27.054 1.00 32.19  ? 227 GLY A CA    1 
ATOM   1565 C  C     . GLY A 1 196 ? 247.437 97.203  -27.296 1.00 32.19  ? 227 GLY A C     1 
ATOM   1566 O  O     . GLY A 1 196 ? 247.208 96.151  -27.872 1.00 32.19  ? 227 GLY A O     1 
ATOM   1567 N  N     . VAL A 1 197 ? 248.635 97.552  -26.859 1.00 30.12  ? 228 VAL A N     1 
ATOM   1568 C  CA    . VAL A 1 197 ? 249.782 96.690  -27.029 1.00 30.12  ? 228 VAL A CA    1 
ATOM   1569 C  C     . VAL A 1 197 ? 250.020 95.942  -25.724 1.00 30.12  ? 228 VAL A C     1 
ATOM   1570 O  O     . VAL A 1 197 ? 250.884 96.304  -24.933 1.00 30.12  ? 228 VAL A O     1 
ATOM   1571 C  CB    . VAL A 1 197 ? 251.042 97.509  -27.403 1.00 24.33  ? 228 VAL A CB    1 
ATOM   1572 C  CG1   . VAL A 1 197 ? 251.812 96.820  -28.498 1.00 24.33  ? 228 VAL A CG1   1 
ATOM   1573 C  CG2   . VAL A 1 197 ? 250.640 98.901  -27.858 1.00 24.33  ? 228 VAL A CG2   1 
ATOM   1574 N  N     . ASP A 1 198 ? 249.236 94.898  -25.495 1.00 31.05  ? 229 ASP A N     1 
ATOM   1575 C  CA    . ASP A 1 198 ? 249.387 94.104  -24.285 1.00 31.05  ? 229 ASP A CA    1 
ATOM   1576 C  C     . ASP A 1 198 ? 249.808 92.707  -24.683 1.00 31.05  ? 229 ASP A C     1 
ATOM   1577 O  O     . ASP A 1 198 ? 249.874 91.797  -23.855 1.00 31.05  ? 229 ASP A O     1 
ATOM   1578 C  CB    . ASP A 1 198 ? 248.075 94.047  -23.523 1.00 33.31  ? 229 ASP A CB    1 
ATOM   1579 C  CG    . ASP A 1 198 ? 246.965 93.443  -24.339 1.00 33.31  ? 229 ASP A CG    1 
ATOM   1580 O  OD1   . ASP A 1 198 ? 247.223 93.109  -25.518 1.00 33.31  ? 229 ASP A OD1   1 
ATOM   1581 O  OD2   . ASP A 1 198 ? 245.843 93.311  -23.799 1.00 33.31  ? 229 ASP A OD2   1 
ATOM   1582 N  N     . LEU A 1 199 ? 250.103 92.559  -25.969 1.00 45.51  ? 230 LEU A N     1 
ATOM   1583 C  CA    . LEU A 1 199 ? 250.528 91.286  -26.531 1.00 45.51  ? 230 LEU A CA    1 
ATOM   1584 C  C     . LEU A 1 199 ? 249.511 90.181  -26.271 1.00 45.51  ? 230 LEU A C     1 
ATOM   1585 O  O     . LEU A 1 199 ? 249.845 88.984  -26.256 1.00 45.51  ? 230 LEU A O     1 
ATOM   1586 C  CB    . LEU A 1 199 ? 251.903 90.905  -25.981 1.00 32.10  ? 230 LEU A CB    1 
ATOM   1587 C  CG    . LEU A 1 199 ? 253.058 91.401  -26.846 1.00 32.10  ? 230 LEU A CG    1 
ATOM   1588 C  CD1   . LEU A 1 199 ? 252.840 92.853  -27.206 1.00 32.10  ? 230 LEU A CD1   1 
ATOM   1589 C  CD2   . LEU A 1 199 ? 254.371 91.197  -26.122 1.00 32.10  ? 230 LEU A CD2   1 
ATOM   1590 N  N     . GLY A 1 200 ? 248.265 90.605  -26.076 1.00 54.71  ? 231 GLY A N     1 
ATOM   1591 C  CA    . GLY A 1 200 ? 247.180 89.674  -25.836 1.00 54.71  ? 231 GLY A CA    1 
ATOM   1592 C  C     . GLY A 1 200 ? 246.846 88.956  -27.126 1.00 54.71  ? 231 GLY A C     1 
ATOM   1593 O  O     . GLY A 1 200 ? 245.681 88.794  -27.497 1.00 54.71  ? 231 GLY A O     1 
ATOM   1594 N  N     . HIS A 1 201 ? 247.890 88.543  -27.826 1.00 47.17  ? 232 HIS A N     1 
ATOM   1595 C  CA    . HIS A 1 201 ? 247.743 87.837  -29.075 1.00 47.17  ? 232 HIS A CA    1 
ATOM   1596 C  C     . HIS A 1 201 ? 248.927 86.887  -29.075 1.00 47.17  ? 232 HIS A C     1 
ATOM   1597 O  O     . HIS A 1 201 ? 249.228 86.218  -30.061 1.00 47.17  ? 232 HIS A O     1 
ATOM   1598 C  CB    . HIS A 1 201 ? 247.787 88.819  -30.256 1.00 56.33  ? 232 HIS A CB    1 
ATOM   1599 C  CG    . HIS A 1 201 ? 249.113 89.486  -30.448 1.00 56.33  ? 232 HIS A CG    1 
ATOM   1600 N  ND1   . HIS A 1 201 ? 249.623 90.417  -29.568 1.00 56.33  ? 232 HIS A ND1   1 
ATOM   1601 C  CD2   . HIS A 1 201 ? 250.063 89.310  -31.397 1.00 56.33  ? 232 HIS A CD2   1 
ATOM   1602 C  CE1   . HIS A 1 201 ? 250.832 90.779  -29.966 1.00 56.33  ? 232 HIS A CE1   1 
ATOM   1603 N  NE2   . HIS A 1 201 ? 251.123 90.121  -31.073 1.00 56.33  ? 232 HIS A NE2   1 
ATOM   1604 N  N     . ILE A 1 202 ? 249.600 86.854  -27.936 1.00 37.65  ? 233 ILE A N     1 
ATOM   1605 C  CA    . ILE A 1 202 ? 250.735 85.977  -27.731 1.00 37.65  ? 233 ILE A CA    1 
ATOM   1606 C  C     . ILE A 1 202 ? 250.354 85.184  -26.490 1.00 37.65  ? 233 ILE A C     1 
ATOM   1607 O  O     . ILE A 1 202 ? 250.280 83.957  -26.500 1.00 37.65  ? 233 ILE A O     1 
ATOM   1608 C  CB    . ILE A 1 202 ? 252.028 86.776  -27.448 1.00 28.65  ? 233 ILE A CB    1 
ATOM   1609 C  CG1   . ILE A 1 202 ? 252.441 87.539  -28.705 1.00 28.65  ? 233 ILE A CG1   1 
ATOM   1610 C  CG2   . ILE A 1 202 ? 253.130 85.842  -26.971 1.00 28.65  ? 233 ILE A CG2   1 
ATOM   1611 C  CD1   . ILE A 1 202 ? 253.847 88.066  -28.669 1.00 28.65  ? 233 ILE A CD1   1 
ATOM   1612 N  N     . TYR A 1 203 ? 250.073 85.926  -25.430 1.00 39.45  ? 234 TYR A N     1 
ATOM   1613 C  CA    . TYR A 1 203 ? 249.693 85.360  -24.155 1.00 39.45  ? 234 TYR A CA    1 
ATOM   1614 C  C     . TYR A 1 203 ? 248.187 85.200  -24.058 1.00 39.45  ? 234 TYR A C     1 
ATOM   1615 O  O     . TYR A 1 203 ? 247.670 84.870  -23.003 1.00 39.45  ? 234 TYR A O     1 
ATOM   1616 C  CB    . TYR A 1 203 ? 250.179 86.281  -23.051 1.00 41.32  ? 234 TYR A CB    1 
ATOM   1617 C  CG    . TYR A 1 203 ? 251.636 86.632  -23.188 1.00 41.32  ? 234 TYR A CG    1 
ATOM   1618 C  CD1   . TYR A 1 203 ? 252.616 85.656  -23.019 1.00 41.32  ? 234 TYR A CD1   1 
ATOM   1619 C  CD2   . TYR A 1 203 ? 252.043 87.934  -23.488 1.00 41.32  ? 234 TYR A CD2   1 
ATOM   1620 C  CE1   . TYR A 1 203 ? 253.955 85.961  -23.136 1.00 41.32  ? 234 TYR A CE1   1 
ATOM   1621 C  CE2   . TYR A 1 203 ? 253.390 88.248  -23.608 1.00 41.32  ? 234 TYR A CE2   1 
ATOM   1622 C  CZ    . TYR A 1 203 ? 254.334 87.252  -23.428 1.00 41.32  ? 234 TYR A CZ    1 
ATOM   1623 O  OH    . TYR A 1 203 ? 255.668 87.517  -23.532 1.00 41.32  ? 234 TYR A OH    1 
ATOM   1624 N  N     . GLY A 1 204 ? 247.477 85.455  -25.147 1.00 30.18  ? 235 GLY A N     1 
ATOM   1625 C  CA    . GLY A 1 204 ? 246.037 85.308  -25.116 1.00 30.18  ? 235 GLY A CA    1 
ATOM   1626 C  C     . GLY A 1 204 ? 245.303 86.432  -24.422 1.00 30.18  ? 235 GLY A C     1 
ATOM   1627 O  O     . GLY A 1 204 ? 245.915 87.305  -23.817 1.00 30.18  ? 235 GLY A O     1 
ATOM   1628 N  N     . ASP A 1 205 ? 243.977 86.388  -24.484 1.00 28.59  ? 236 ASP A N     1 
ATOM   1629 C  CA    . ASP A 1 205 ? 243.158 87.428  -23.897 1.00 28.59  ? 236 ASP A CA    1 
ATOM   1630 C  C     . ASP A 1 205 ? 242.245 87.036  -22.747 1.00 28.59  ? 236 ASP A C     1 
ATOM   1631 O  O     . ASP A 1 205 ? 241.172 87.608  -22.594 1.00 28.59  ? 236 ASP A O     1 
ATOM   1632 C  CB    . ASP A 1 205 ? 242.318 88.072  -24.982 1.00 43.56  ? 236 ASP A CB    1 
ATOM   1633 C  CG    . ASP A 1 205 ? 241.323 87.116  -25.572 1.00 43.56  ? 236 ASP A CG    1 
ATOM   1634 O  OD1   . ASP A 1 205 ? 240.499 86.597  -24.795 1.00 43.56  ? 236 ASP A OD1   1 
ATOM   1635 O  OD2   . ASP A 1 205 ? 241.363 86.879  -26.801 1.00 43.56  ? 236 ASP A OD2   1 
ATOM   1636 N  N     . ASN A 1 206 ? 242.646 86.051  -21.957 1.00 37.98  ? 237 ASN A N     1 
ATOM   1637 C  CA    . ASN A 1 206 ? 241.883 85.643  -20.777 1.00 37.98  ? 237 ASN A CA    1 
ATOM   1638 C  C     . ASN A 1 206 ? 242.863 84.821  -19.981 1.00 37.98  ? 237 ASN A C     1 
ATOM   1639 O  O     . ASN A 1 206 ? 243.713 84.130  -20.559 1.00 37.98  ? 237 ASN A O     1 
ATOM   1640 C  CB    . ASN A 1 206 ? 240.652 84.814  -21.125 1.00 53.76  ? 237 ASN A CB    1 
ATOM   1641 C  CG    . ASN A 1 206 ? 240.996 83.611  -21.923 1.00 53.76  ? 237 ASN A CG    1 
ATOM   1642 O  OD1   . ASN A 1 206 ? 241.334 83.729  -23.091 1.00 53.76  ? 237 ASN A OD1   1 
ATOM   1643 N  ND2   . ASN A 1 206 ? 240.941 82.436  -21.302 1.00 53.76  ? 237 ASN A ND2   1 
ATOM   1644 N  N     . LEU A 1 207 ? 242.755 84.909  -18.657 1.00 47.92  ? 238 LEU A N     1 
ATOM   1645 C  CA    . LEU A 1 207 ? 243.694 84.224  -17.772 1.00 47.92  ? 238 LEU A CA    1 
ATOM   1646 C  C     . LEU A 1 207 ? 243.877 82.752  -18.084 1.00 47.92  ? 238 LEU A C     1 
ATOM   1647 O  O     . LEU A 1 207 ? 244.998 82.239  -18.100 1.00 47.92  ? 238 LEU A O     1 
ATOM   1648 C  CB    . LEU A 1 207 ? 243.277 84.398  -16.310 1.00 32.02  ? 238 LEU A CB    1 
ATOM   1649 C  CG    . LEU A 1 207 ? 244.346 83.883  -15.346 1.00 32.02  ? 238 LEU A CG    1 
ATOM   1650 C  CD1   . LEU A 1 207 ? 245.670 84.544  -15.679 1.00 32.02  ? 238 LEU A CD1   1 
ATOM   1651 C  CD2   . LEU A 1 207 ? 243.949 84.148  -13.906 1.00 32.02  ? 238 LEU A CD2   1 
ATOM   1652 N  N     . GLU A 1 208 ? 242.762 82.088  -18.344 1.00 35.00  ? 239 GLU A N     1 
ATOM   1653 C  CA    . GLU A 1 208 ? 242.733 80.675  -18.646 1.00 35.00  ? 239 GLU A CA    1 
ATOM   1654 C  C     . GLU A 1 208 ? 243.624 80.398  -19.830 1.00 35.00  ? 239 GLU A C     1 
ATOM   1655 O  O     . GLU A 1 208 ? 244.685 79.786  -19.704 1.00 35.00  ? 239 GLU A O     1 
ATOM   1656 C  CB    . GLU A 1 208 ? 241.301 80.260  -18.973 1.00 86.60  ? 239 GLU A CB    1 
ATOM   1657 C  CG    . GLU A 1 208 ? 240.242 80.914  -18.069 1.00 86.60  ? 239 GLU A CG    1 
ATOM   1658 C  CD    . GLU A 1 208 ? 240.251 82.455  -18.154 1.00 86.60  ? 239 GLU A CD    1 
ATOM   1659 O  OE1   . GLU A 1 208 ? 239.694 83.017  -19.134 1.00 86.60  ? 239 GLU A OE1   1 
ATOM   1660 O  OE2   . GLU A 1 208 ? 240.820 83.105  -17.238 1.00 86.60  ? 239 GLU A OE2   1 
ATOM   1661 N  N     . ARG A 1 209 ? 243.183 80.873  -20.986 1.00 32.19  ? 240 ARG A N     1 
ATOM   1662 C  CA    . ARG A 1 209 ? 243.914 80.679  -22.228 1.00 32.19  ? 240 ARG A CA    1 
ATOM   1663 C  C     . ARG A 1 209 ? 245.406 80.925  -22.032 1.00 32.19  ? 240 ARG A C     1 
ATOM   1664 O  O     . ARG A 1 209 ? 246.248 80.206  -22.564 1.00 32.19  ? 240 ARG A O     1 
ATOM   1665 C  CB    . ARG A 1 209 ? 243.345 81.610  -23.290 1.00 41.80  ? 240 ARG A CB    1 
ATOM   1666 C  CG    . ARG A 1 209 ? 243.845 81.348  -24.670 1.00 41.80  ? 240 ARG A CG    1 
ATOM   1667 C  CD    . ARG A 1 209 ? 243.186 82.283  -25.661 1.00 41.80  ? 240 ARG A CD    1 
ATOM   1668 N  NE    . ARG A 1 209 ? 243.751 82.101  -26.991 1.00 41.80  ? 240 ARG A NE    1 
ATOM   1669 C  CZ    . ARG A 1 209 ? 243.418 81.113  -27.816 1.00 41.80  ? 240 ARG A CZ    1 
ATOM   1670 N  NH1   . ARG A 1 209 ? 242.506 80.219  -27.446 1.00 41.80  ? 240 ARG A NH1   1 
ATOM   1671 N  NH2   . ARG A 1 209 ? 244.011 81.007  -29.002 1.00 41.80  ? 240 ARG A NH2   1 
ATOM   1672 N  N     . GLN A 1 210 ? 245.727 81.951  -21.253 1.00 43.28  ? 241 GLN A N     1 
ATOM   1673 C  CA    . GLN A 1 210 ? 247.108 82.290  -20.969 1.00 43.28  ? 241 GLN A CA    1 
ATOM   1674 C  C     . GLN A 1 210 ? 247.740 81.100  -20.276 1.00 43.28  ? 241 GLN A C     1 
ATOM   1675 O  O     . GLN A 1 210 ? 248.716 80.518  -20.757 1.00 43.28  ? 241 GLN A O     1 
ATOM   1676 C  CB    . GLN A 1 210 ? 247.155 83.497  -20.048 1.00 64.41  ? 241 GLN A CB    1 
ATOM   1677 C  CG    . GLN A 1 210 ? 248.552 83.881  -19.588 1.00 64.41  ? 241 GLN A CG    1 
ATOM   1678 C  CD    . GLN A 1 210 ? 248.508 84.955  -18.531 1.00 64.41  ? 241 GLN A CD    1 
ATOM   1679 O  OE1   . GLN A 1 210 ? 247.944 86.022  -18.752 1.00 64.41  ? 241 GLN A OE1   1 
ATOM   1680 N  NE2   . GLN A 1 210 ? 249.091 84.677  -17.373 1.00 64.41  ? 241 GLN A NE2   1 
ATOM   1681 N  N     . TYR A 1 211 ? 247.159 80.754  -19.130 1.00 62.12  ? 242 TYR A N     1 
ATOM   1682 C  CA    . TYR A 1 211 ? 247.603 79.627  -18.323 1.00 62.12  ? 242 TYR A CA    1 
ATOM   1683 C  C     . TYR A 1 211 ? 247.760 78.378  -19.174 1.00 62.12  ? 242 TYR A C     1 
ATOM   1684 O  O     . TYR A 1 211 ? 248.783 77.692  -19.102 1.00 62.12  ? 242 TYR A O     1 
ATOM   1685 C  CB    . TYR A 1 211 ? 246.581 79.343  -17.232 1.00 49.39  ? 242 TYR A CB    1 
ATOM   1686 C  CG    . TYR A 1 211 ? 246.631 80.286  -16.059 1.00 49.39  ? 242 TYR A CG    1 
ATOM   1687 C  CD1   . TYR A 1 211 ? 245.553 80.371  -15.176 1.00 49.39  ? 242 TYR A CD1   1 
ATOM   1688 C  CD2   . TYR A 1 211 ? 247.761 81.066  -15.801 1.00 49.39  ? 242 TYR A CD2   1 
ATOM   1689 C  CE1   . TYR A 1 211 ? 245.597 81.201  -14.074 1.00 49.39  ? 242 TYR A CE1   1 
ATOM   1690 C  CE2   . TYR A 1 211 ? 247.819 81.895  -14.698 1.00 49.39  ? 242 TYR A CE2   1 
ATOM   1691 C  CZ    . TYR A 1 211 ? 246.733 81.962  -13.835 1.00 49.39  ? 242 TYR A CZ    1 
ATOM   1692 O  OH    . TYR A 1 211 ? 246.766 82.780  -12.728 1.00 49.39  ? 242 TYR A OH    1 
ATOM   1693 N  N     . GLN A 1 212 ? 246.735 78.089  -19.975 1.00 44.03  ? 243 GLN A N     1 
ATOM   1694 C  CA    . GLN A 1 212 ? 246.738 76.917  -20.845 1.00 44.03  ? 243 GLN A CA    1 
ATOM   1695 C  C     . GLN A 1 212 ? 247.954 76.923  -21.754 1.00 44.03  ? 243 GLN A C     1 
ATOM   1696 O  O     . GLN A 1 212 ? 248.366 75.872  -22.248 1.00 44.03  ? 243 GLN A O     1 
ATOM   1697 C  CB    . GLN A 1 212 ? 245.458 76.883  -21.691 1.00 80.58  ? 243 GLN A CB    1 
ATOM   1698 C  CG    . GLN A 1 212 ? 244.701 75.550  -21.662 1.00 80.58  ? 243 GLN A CG    1 
ATOM   1699 C  CD    . GLN A 1 212 ? 244.250 75.154  -20.255 1.00 80.58  ? 243 GLN A CD    1 
ATOM   1700 O  OE1   . GLN A 1 212 ? 244.966 74.449  -19.519 1.00 80.58  ? 243 GLN A OE1   1 
ATOM   1701 N  NE2   . GLN A 1 212 ? 243.064 75.622  -19.868 1.00 80.58  ? 243 GLN A NE2   1 
ATOM   1702 N  N     . LEU A 1 213 ? 248.516 78.117  -21.959 1.00 35.70  ? 244 LEU A N     1 
ATOM   1703 C  CA    . LEU A 1 213 ? 249.692 78.324  -22.808 1.00 35.70  ? 244 LEU A CA    1 
ATOM   1704 C  C     . LEU A 1 213 ? 250.969 78.412  -22.001 1.00 35.70  ? 244 LEU A C     1 
ATOM   1705 O  O     . LEU A 1 213 ? 252.068 78.194  -22.515 1.00 35.70  ? 244 LEU A O     1 
ATOM   1706 C  CB    . LEU A 1 213 ? 249.548 79.617  -23.591 1.00 34.31  ? 244 LEU A CB    1 
ATOM   1707 C  CG    . LEU A 1 213 ? 248.696 79.570  -24.843 1.00 34.31  ? 244 LEU A CG    1 
ATOM   1708 C  CD1   . LEU A 1 213 ? 248.434 80.977  -25.293 1.00 34.31  ? 244 LEU A CD1   1 
ATOM   1709 C  CD2   . LEU A 1 213 ? 249.404 78.771  -25.922 1.00 34.31  ? 244 LEU A CD2   1 
ATOM   1710 N  N     . ARG A 1 214 ? 250.816 78.745  -20.731 1.00 45.18  ? 245 ARG A N     1 
ATOM   1711 C  CA    . ARG A 1 214 ? 251.959 78.903  -19.863 1.00 45.18  ? 245 ARG A CA    1 
ATOM   1712 C  C     . ARG A 1 214 ? 252.498 77.584  -19.348 1.00 45.18  ? 245 ARG A C     1 
ATOM   1713 O  O     . ARG A 1 214 ? 251.753 76.756  -18.833 1.00 45.18  ? 245 ARG A O     1 
ATOM   1714 C  CB    . ARG A 1 214 ? 251.588 79.826  -18.707 1.00 32.28  ? 245 ARG A CB    1 
ATOM   1715 C  CG    . ARG A 1 214 ? 251.197 81.239  -19.133 1.00 32.28  ? 245 ARG A CG    1 
ATOM   1716 C  CD    . ARG A 1 214 ? 251.060 82.128  -17.920 1.00 32.28  ? 245 ARG A CD    1 
ATOM   1717 N  NE    . ARG A 1 214 ? 252.076 81.774  -16.932 1.00 32.28  ? 245 ARG A NE    1 
ATOM   1718 C  CZ    . ARG A 1 214 ? 252.095 82.217  -15.682 1.00 32.28  ? 245 ARG A CZ    1 
ATOM   1719 N  NH1   . ARG A 1 214 ? 251.151 83.046  -15.255 1.00 32.28  ? 245 ARG A NH1   1 
ATOM   1720 N  NH2   . ARG A 1 214 ? 253.047 81.810  -14.851 1.00 32.28  ? 245 ARG A NH2   1 
ATOM   1721 N  N     . LEU A 1 215 ? 253.806 77.415  -19.492 1.00 33.13  ? 246 LEU A N     1 
ATOM   1722 C  CA    . LEU A 1 215 ? 254.531 76.217  -19.071 1.00 33.13  ? 246 LEU A CA    1 
ATOM   1723 C  C     . LEU A 1 215 ? 254.939 76.261  -17.594 1.00 33.13  ? 246 LEU A C     1 
ATOM   1724 O  O     . LEU A 1 215 ? 255.841 75.549  -17.167 1.00 33.13  ? 246 LEU A O     1 
ATOM   1725 C  CB    . LEU A 1 215 ? 255.786 76.095  -19.910 1.00 29.56  ? 246 LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1 215 ? 256.597 74.837  -19.712 1.00 29.56  ? 246 LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1 215 ? 256.185 73.840  -20.774 1.00 29.56  ? 246 LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1 215 ? 258.063 75.154  -19.826 1.00 29.56  ? 246 LEU A CD2   1 
ATOM   1729 N  N     . PHE A 1 216 ? 254.262 77.103  -16.830 1.00 34.57  ? 247 PHE A N     1 
ATOM   1730 C  CA    . PHE A 1 216 ? 254.528 77.308  -15.416 1.00 34.57  ? 247 PHE A CA    1 
ATOM   1731 C  C     . PHE A 1 216 ? 255.825 76.779  -14.838 1.00 34.57  ? 247 PHE A C     1 
ATOM   1732 O  O     . PHE A 1 216 ? 255.811 76.039  -13.861 1.00 34.57  ? 247 PHE A O     1 
ATOM   1733 C  CB    . PHE A 1 216 ? 253.362 76.801  -14.590 1.00 25.70  ? 247 PHE A CB    1 
ATOM   1734 C  CG    . PHE A 1 216 ? 252.083 77.533  -14.852 1.00 25.70  ? 247 PHE A CG    1 
ATOM   1735 C  CD1   . PHE A 1 216 ? 251.433 77.404  -16.065 1.00 25.70  ? 247 PHE A CD1   1 
ATOM   1736 C  CD2   . PHE A 1 216 ? 251.521 78.343  -13.881 1.00 25.70  ? 247 PHE A CD2   1 
ATOM   1737 C  CE1   . PHE A 1 216 ? 250.246 78.065  -16.303 1.00 25.70  ? 247 PHE A CE1   1 
ATOM   1738 C  CE2   . PHE A 1 216 ? 250.332 79.005  -14.115 1.00 25.70  ? 247 PHE A CE2   1 
ATOM   1739 C  CZ    . PHE A 1 216 ? 249.697 78.864  -15.325 1.00 25.70  ? 247 PHE A CZ    1 
ATOM   1740 N  N     . LYS A 1 217 ? 256.944 77.188  -15.437 1.00 59.54  ? 248 LYS A N     1 
ATOM   1741 C  CA    . LYS A 1 217 ? 258.295 76.815  -14.991 1.00 59.54  ? 248 LYS A CA    1 
ATOM   1742 C  C     . LYS A 1 217 ? 259.270 77.805  -15.633 1.00 59.54  ? 248 LYS A C     1 
ATOM   1743 O  O     . LYS A 1 217 ? 259.331 77.928  -16.859 1.00 59.54  ? 248 LYS A O     1 
ATOM   1744 C  CB    . LYS A 1 217 ? 258.636 75.393  -15.415 1.00 30.89  ? 248 LYS A CB    1 
ATOM   1745 N  N     . ASP A 1 218 ? 260.024 78.521  -14.805 1.00 44.38  ? 249 ASP A N     1 
ATOM   1746 C  CA    . ASP A 1 218 ? 260.961 79.511  -15.314 1.00 44.38  ? 249 ASP A CA    1 
ATOM   1747 C  C     . ASP A 1 218 ? 260.252 80.617  -16.096 1.00 44.38  ? 249 ASP A C     1 
ATOM   1748 O  O     . ASP A 1 218 ? 260.834 81.265  -16.972 1.00 44.38  ? 249 ASP A O     1 
ATOM   1749 C  CB    . ASP A 1 218 ? 262.024 78.824  -16.163 1.00 63.12  ? 249 ASP A CB    1 
ATOM   1750 C  CG    . ASP A 1 218 ? 263.058 78.122  -15.306 1.00 63.12  ? 249 ASP A CG    1 
ATOM   1751 O  OD1   . ASP A 1 218 ? 262.837 78.062  -14.072 1.00 63.12  ? 249 ASP A OD1   1 
ATOM   1752 O  OD2   . ASP A 1 218 ? 264.083 77.640  -15.845 1.00 63.12  ? 249 ASP A OD2   1 
ATOM   1753 N  N     . GLY A 1 219 ? 258.986 80.827  -15.743 1.00 51.68  ? 250 GLY A N     1 
ATOM   1754 C  CA    . GLY A 1 219 ? 258.171 81.851  -16.370 1.00 51.68  ? 250 GLY A CA    1 
ATOM   1755 C  C     . GLY A 1 219 ? 258.083 81.743  -17.874 1.00 51.68  ? 250 GLY A C     1 
ATOM   1756 O  O     . GLY A 1 219 ? 257.653 82.688  -18.539 1.00 51.68  ? 250 GLY A O     1 
ATOM   1757 N  N     . LYS A 1 220 ? 258.466 80.588  -18.409 1.00 42.89  ? 251 LYS A N     1 
ATOM   1758 C  CA    . LYS A 1 220 ? 258.451 80.383  -19.849 1.00 42.89  ? 251 LYS A CA    1 
ATOM   1759 C  C     . LYS A 1 220 ? 257.094 80.062  -20.455 1.00 42.89  ? 251 LYS A C     1 
ATOM   1760 O  O     . LYS A 1 220 ? 256.072 80.005  -19.767 1.00 42.89  ? 251 LYS A O     1 
ATOM   1761 C  CB    . LYS A 1 220 ? 259.448 79.292  -20.237 1.00 36.45  ? 251 LYS A CB    1 
ATOM   1762 C  CG    . LYS A 1 220 ? 260.893 79.677  -20.036 1.00 36.45  ? 251 LYS A CG    1 
ATOM   1763 C  CD    . LYS A 1 220 ? 261.840 78.664  -20.649 1.00 36.45  ? 251 LYS A CD    1 
ATOM   1764 C  CE    . LYS A 1 220 ? 263.273 79.166  -20.618 1.00 36.45  ? 251 LYS A CE    1 
ATOM   1765 N  NZ    . LYS A 1 220 ? 264.208 78.207  -21.257 1.00 36.45  ? 251 LYS A NZ    1 
ATOM   1766 N  N     . LEU A 1 221 ? 257.116 79.866  -21.767 1.00 60.31  ? 252 LEU A N     1 
ATOM   1767 C  CA    . LEU A 1 221 ? 255.935 79.549  -22.551 1.00 60.31  ? 252 LEU A CA    1 
ATOM   1768 C  C     . LEU A 1 221 ? 256.149 78.132  -23.094 1.00 60.31  ? 252 LEU A C     1 
ATOM   1769 O  O     . LEU A 1 221 ? 257.296 77.735  -23.335 1.00 60.31  ? 252 LEU A O     1 
ATOM   1770 C  CB    . LEU A 1 221 ? 255.822 80.558  -23.702 1.00 49.17  ? 252 LEU A CB    1 
ATOM   1771 C  CG    . LEU A 1 221 ? 254.560 81.418  -23.873 1.00 49.17  ? 252 LEU A CG    1 
ATOM   1772 C  CD1   . LEU A 1 221 ? 253.908 81.669  -22.538 1.00 49.17  ? 252 LEU A CD1   1 
ATOM   1773 C  CD2   . LEU A 1 221 ? 254.931 82.730  -24.550 1.00 49.17  ? 252 LEU A CD2   1 
ATOM   1774 N  N     . LYS A 1 222 ? 255.065 77.371  -23.277 1.00 51.62  ? 253 LYS A N     1 
ATOM   1775 C  CA    . LYS A 1 222 ? 255.154 75.994  -23.795 1.00 51.62  ? 253 LYS A CA    1 
ATOM   1776 C  C     . LYS A 1 222 ? 255.656 75.964  -25.222 1.00 51.62  ? 253 LYS A C     1 
ATOM   1777 O  O     . LYS A 1 222 ? 255.358 76.852  -26.008 1.00 51.62  ? 253 LYS A O     1 
ATOM   1778 C  CB    . LYS A 1 222 ? 253.793 75.306  -23.757 1.00 53.29  ? 253 LYS A CB    1 
ATOM   1779 C  CG    . LYS A 1 222 ? 253.416 74.689  -22.426 1.00 53.29  ? 253 LYS A CG    1 
ATOM   1780 C  CD    . LYS A 1 222 ? 251.981 74.199  -22.473 1.00 53.29  ? 253 LYS A CD    1 
ATOM   1781 C  CE    . LYS A 1 222 ? 251.555 73.612  -21.155 1.00 53.29  ? 253 LYS A CE    1 
ATOM   1782 N  NZ    . LYS A 1 222 ? 250.134 73.945  -20.899 1.00 53.29  ? 253 LYS A NZ    1 
ATOM   1783 N  N     . TYR A 1 223 ? 256.391 74.920  -25.571 1.00 61.56  ? 254 TYR A N     1 
ATOM   1784 C  CA    . TYR A 1 223 ? 256.926 74.844  -26.916 1.00 61.56  ? 254 TYR A CA    1 
ATOM   1785 C  C     . TYR A 1 223 ? 257.346 73.431  -27.323 1.00 61.56  ? 254 TYR A C     1 
ATOM   1786 O  O     . TYR A 1 223 ? 257.403 72.521  -26.489 1.00 61.56  ? 254 TYR A O     1 
ATOM   1787 C  CB    . TYR A 1 223 ? 258.125 75.761  -26.995 1.00 43.42  ? 254 TYR A CB    1 
ATOM   1788 C  CG    . TYR A 1 223 ? 259.272 75.258  -26.170 1.00 43.42  ? 254 TYR A CG    1 
ATOM   1789 C  CD1   . TYR A 1 223 ? 260.328 74.572  -26.767 1.00 43.42  ? 254 TYR A CD1   1 
ATOM   1790 C  CD2   . TYR A 1 223 ? 259.308 75.466  -24.794 1.00 43.42  ? 254 TYR A CD2   1 
ATOM   1791 C  CE1   . TYR A 1 223 ? 261.404 74.108  -26.017 1.00 43.42  ? 254 TYR A CE1   1 
ATOM   1792 C  CE2   . TYR A 1 223 ? 260.378 75.006  -24.028 1.00 43.42  ? 254 TYR A CE2   1 
ATOM   1793 C  CZ    . TYR A 1 223 ? 261.424 74.330  -24.648 1.00 43.42  ? 254 TYR A CZ    1 
ATOM   1794 O  OH    . TYR A 1 223 ? 262.505 73.892  -23.916 1.00 43.42  ? 254 TYR A OH    1 
ATOM   1795 N  N     . GLN A 1 224 ? 257.671 73.261  -28.603 1.00 54.90  ? 255 GLN A N     1 
ATOM   1796 C  CA    . GLN A 1 224 ? 258.087 71.959  -29.114 1.00 54.90  ? 255 GLN A CA    1 
ATOM   1797 C  C     . GLN A 1 224 ? 259.200 72.010  -30.162 1.00 54.90  ? 255 GLN A C     1 
ATOM   1798 O  O     . GLN A 1 224 ? 259.132 72.779  -31.121 1.00 54.90  ? 255 GLN A O     1 
ATOM   1799 C  CB    . GLN A 1 224 ? 256.886 71.226  -29.705 1.00 66.72  ? 255 GLN A CB    1 
ATOM   1800 C  CG    . GLN A 1 224 ? 256.104 72.046  -30.706 1.00 66.72  ? 255 GLN A CG    1 
ATOM   1801 C  CD    . GLN A 1 224 ? 255.190 71.188  -31.561 1.00 66.72  ? 255 GLN A CD    1 
ATOM   1802 O  OE1   . GLN A 1 224 ? 255.652 70.241  -32.219 1.00 66.72  ? 255 GLN A OE1   1 
ATOM   1803 N  NE2   . GLN A 1 224 ? 253.888 71.507  -31.567 1.00 66.72  ? 255 GLN A NE2   1 
ATOM   1804 N  N     . MET A 1 225 ? 260.218 71.173  -29.979 1.00 48.05  ? 256 MET A N     1 
ATOM   1805 C  CA    . MET A 1 225 ? 261.336 71.112  -30.912 1.00 48.05  ? 256 MET A CA    1 
ATOM   1806 C  C     . MET A 1 225 ? 260.958 70.297  -32.137 1.00 48.05  ? 256 MET A C     1 
ATOM   1807 O  O     . MET A 1 225 ? 260.476 69.175  -32.014 1.00 48.05  ? 256 MET A O     1 
ATOM   1808 C  CB    . MET A 1 225 ? 262.537 70.446  -30.257 1.00 70.00  ? 256 MET A CB    1 
ATOM   1809 C  CG    . MET A 1 225 ? 262.820 70.945  -28.871 1.00 70.00  ? 256 MET A CG    1 
ATOM   1810 S  SD    . MET A 1 225 ? 263.015 72.723  -28.888 1.00 70.00  ? 256 MET A SD    1 
ATOM   1811 C  CE    . MET A 1 225 ? 264.335 72.888  -30.207 1.00 70.00  ? 256 MET A CE    1 
ATOM   1812 N  N     . LEU A 1 226 ? 261.170 70.871  -33.314 1.00 48.33  ? 257 LEU A N     1 
ATOM   1813 C  CA    . LEU A 1 226 ? 260.895 70.191  -34.570 1.00 48.33  ? 257 LEU A CA    1 
ATOM   1814 C  C     . LEU A 1 226 ? 262.097 70.527  -35.444 1.00 48.33  ? 257 LEU A C     1 
ATOM   1815 O  O     . LEU A 1 226 ? 262.308 71.687  -35.798 1.00 48.33  ? 257 LEU A O     1 
ATOM   1816 C  CB    . LEU A 1 226 ? 259.605 70.702  -35.228 1.00 28.74  ? 257 LEU A CB    1 
ATOM   1817 C  CG    . LEU A 1 226 ? 258.249 70.679  -34.509 1.00 28.74  ? 257 LEU A CG    1 
ATOM   1818 C  CD1   . LEU A 1 226 ? 257.158 70.651  -35.567 1.00 28.74  ? 257 LEU A CD1   1 
ATOM   1819 C  CD2   . LEU A 1 226 ? 258.098 69.470  -33.606 1.00 28.74  ? 257 LEU A CD2   1 
ATOM   1820 N  N     . ASN A 1 227 ? 262.890 69.516  -35.775 1.00 55.51  ? 258 ASN A N     1 
ATOM   1821 C  CA    . ASN A 1 227 ? 264.083 69.713  -36.587 1.00 55.51  ? 258 ASN A CA    1 
ATOM   1822 C  C     . ASN A 1 227 ? 265.161 70.301  -35.689 1.00 55.51  ? 258 ASN A C     1 
ATOM   1823 O  O     . ASN A 1 227 ? 266.220 70.730  -36.152 1.00 55.51  ? 258 ASN A O     1 
ATOM   1824 C  CB    . ASN A 1 227 ? 263.784 70.652  -37.762 1.00 67.24  ? 258 ASN A CB    1 
ATOM   1825 C  CG    . ASN A 1 227 ? 262.753 70.074  -38.724 1.00 67.24  ? 258 ASN A CG    1 
ATOM   1826 O  OD1   . ASN A 1 227 ? 262.977 69.012  -39.305 1.00 67.24  ? 258 ASN A OD1   1 
ATOM   1827 N  ND2   . ASN A 1 227 ? 261.619 70.765  -38.893 1.00 67.24  ? 258 ASN A ND2   1 
ATOM   1828 N  N     . GLY A 1 228 ? 264.883 70.309  -34.391 1.00 37.96  ? 259 GLY A N     1 
ATOM   1829 C  CA    . GLY A 1 228 ? 265.843 70.832  -33.442 1.00 37.96  ? 259 GLY A CA    1 
ATOM   1830 C  C     . GLY A 1 228 ? 265.665 72.310  -33.187 1.00 37.96  ? 259 GLY A C     1 
ATOM   1831 O  O     . GLY A 1 228 ? 266.425 72.902  -32.432 1.00 37.96  ? 259 GLY A O     1 
ATOM   1832 N  N     . GLU A 1 229 ? 264.650 72.901  -33.811 1.00 56.89  ? 260 GLU A N     1 
ATOM   1833 C  CA    . GLU A 1 229 ? 264.362 74.328  -33.666 1.00 56.89  ? 260 GLU A CA    1 
ATOM   1834 C  C     . GLU A 1 229 ? 263.065 74.525  -32.880 1.00 56.89  ? 260 GLU A C     1 
ATOM   1835 O  O     . GLU A 1 229 ? 262.118 73.757  -33.044 1.00 56.89  ? 260 GLU A O     1 
ATOM   1836 C  CB    . GLU A 1 229 ? 264.259 74.966  -35.059 1.00 67.54  ? 260 GLU A CB    1 
ATOM   1837 C  CG    . GLU A 1 229 ? 265.516 74.770  -35.945 1.00 67.54  ? 260 GLU A CG    1 
ATOM   1838 C  CD    . GLU A 1 229 ? 266.688 75.715  -35.594 1.00 67.54  ? 260 GLU A CD    1 
ATOM   1839 O  OE1   . GLU A 1 229 ? 266.786 76.189  -34.431 1.00 67.54  ? 260 GLU A OE1   1 
ATOM   1840 O  OE2   . GLU A 1 229 ? 267.520 75.987  -36.494 1.00 67.54  ? 260 GLU A OE2   1 
ATOM   1841 N  N     . VAL A 1 230 ? 263.017 75.557  -32.039 1.00 50.40  ? 261 VAL A N     1 
ATOM   1842 C  CA    . VAL A 1 230 ? 261.828 75.819  -31.210 1.00 50.40  ? 261 VAL A CA    1 
ATOM   1843 C  C     . VAL A 1 230 ? 260.608 76.421  -31.915 1.00 50.40  ? 261 VAL A C     1 
ATOM   1844 O  O     . VAL A 1 230 ? 260.715 77.390  -32.674 1.00 50.40  ? 261 VAL A O     1 
ATOM   1845 C  CB    . VAL A 1 230 ? 262.170 76.745  -30.012 1.00 45.00  ? 261 VAL A CB    1 
ATOM   1846 C  CG1   . VAL A 1 230 ? 260.975 76.858  -29.074 1.00 45.00  ? 261 VAL A CG1   1 
ATOM   1847 C  CG2   . VAL A 1 230 ? 263.383 76.216  -29.273 1.00 45.00  ? 261 VAL A CG2   1 
ATOM   1848 N  N     . TYR A 1 231 ? 259.443 75.842  -31.638 1.00 26.36  ? 262 TYR A N     1 
ATOM   1849 C  CA    . TYR A 1 231 ? 258.185 76.307  -32.207 1.00 26.36  ? 262 TYR A CA    1 
ATOM   1850 C  C     . TYR A 1 231 ? 257.085 76.307  -31.153 1.00 26.36  ? 262 TYR A C     1 
ATOM   1851 O  O     . TYR A 1 231 ? 257.228 75.714  -30.090 1.00 26.36  ? 262 TYR A O     1 
ATOM   1852 C  CB    . TYR A 1 231 ? 257.762 75.414  -33.364 1.00 44.01  ? 262 TYR A CB    1 
ATOM   1853 C  CG    . TYR A 1 231 ? 258.671 75.476  -34.560 1.00 44.01  ? 262 TYR A CG    1 
ATOM   1854 C  CD1   . TYR A 1 231 ? 259.946 74.925  -34.519 1.00 44.01  ? 262 TYR A CD1   1 
ATOM   1855 C  CD2   . TYR A 1 231 ? 258.248 76.077  -35.745 1.00 44.01  ? 262 TYR A CD2   1 
ATOM   1856 C  CE1   . TYR A 1 231 ? 260.784 74.968  -35.629 1.00 44.01  ? 262 TYR A CE1   1 
ATOM   1857 C  CE2   . TYR A 1 231 ? 259.072 76.126  -36.861 1.00 44.01  ? 262 TYR A CE2   1 
ATOM   1858 C  CZ    . TYR A 1 231 ? 260.339 75.569  -36.800 1.00 44.01  ? 262 TYR A CZ    1 
ATOM   1859 O  OH    . TYR A 1 231 ? 261.154 75.603  -37.912 1.00 44.01  ? 262 TYR A OH    1 
ATOM   1860 N  N     . PRO A 1 232 ? 255.962 76.973  -31.436 1.00 47.64  ? 263 PRO A N     1 
ATOM   1861 C  CA    . PRO A 1 232 ? 254.893 76.981  -30.435 1.00 47.64  ? 263 PRO A CA    1 
ATOM   1862 C  C     . PRO A 1 232 ? 254.424 75.547  -30.198 1.00 47.64  ? 263 PRO A C     1 
ATOM   1863 O  O     . PRO A 1 232 ? 254.790 74.638  -30.939 1.00 47.64  ? 263 PRO A O     1 
ATOM   1864 C  CB    . PRO A 1 232 ? 253.791 77.817  -31.098 1.00 45.63  ? 263 PRO A CB    1 
ATOM   1865 C  CG    . PRO A 1 232 ? 254.502 78.610  -32.156 1.00 45.63  ? 263 PRO A CG    1 
ATOM   1866 C  CD    . PRO A 1 232 ? 255.544 77.662  -32.666 1.00 45.63  ? 263 PRO A CD    1 
ATOM   1867 N  N     . PRO A 1 233 ? 253.619 75.320  -29.154 1.00 54.16  ? 264 PRO A N     1 
ATOM   1868 C  CA    . PRO A 1 233 ? 253.128 73.962  -28.893 1.00 54.16  ? 264 PRO A CA    1 
ATOM   1869 C  C     . PRO A 1 233 ? 251.807 73.724  -29.635 1.00 54.16  ? 264 PRO A C     1 
ATOM   1870 O  O     . PRO A 1 233 ? 251.227 74.653  -30.203 1.00 54.16  ? 264 PRO A O     1 
ATOM   1871 C  CB    . PRO A 1 233 ? 252.930 73.961  -27.384 1.00 78.39  ? 264 PRO A CB    1 
ATOM   1872 C  CG    . PRO A 1 233 ? 252.433 75.363  -27.134 1.00 78.39  ? 264 PRO A CG    1 
ATOM   1873 C  CD    . PRO A 1 233 ? 253.404 76.188  -27.980 1.00 78.39  ? 264 PRO A CD    1 
ATOM   1874 N  N     . SER A 1 234 ? 251.341 72.476  -29.622 1.00 69.16  ? 265 SER A N     1 
ATOM   1875 C  CA    . SER A 1 234 ? 250.080 72.095  -30.275 1.00 69.16  ? 265 SER A CA    1 
ATOM   1876 C  C     . SER A 1 234 ? 249.034 71.934  -29.192 1.00 69.16  ? 265 SER A C     1 
ATOM   1877 O  O     . SER A 1 234 ? 249.370 71.866  -28.002 1.00 69.16  ? 265 SER A O     1 
ATOM   1878 C  CB    . SER A 1 234 ? 250.222 70.761  -31.011 1.00 57.50  ? 265 SER A CB    1 
ATOM   1879 O  OG    . SER A 1 234 ? 250.388 69.696  -30.086 1.00 57.50  ? 265 SER A OG    1 
ATOM   1880 N  N     . VAL A 1 235 ? 247.775 71.848  -29.595 1.00 37.44  ? 266 VAL A N     1 
ATOM   1881 C  CA    . VAL A 1 235 ? 246.706 71.706  -28.619 1.00 37.44  ? 266 VAL A CA    1 
ATOM   1882 C  C     . VAL A 1 235 ? 246.924 70.477  -27.714 1.00 37.44  ? 266 VAL A C     1 
ATOM   1883 O  O     . VAL A 1 235 ? 246.396 70.392  -26.605 1.00 37.44  ? 266 VAL A O     1 
ATOM   1884 C  CB    . VAL A 1 235 ? 245.348 71.633  -29.329 1.00 61.32  ? 266 VAL A CB    1 
ATOM   1885 C  CG1   . VAL A 1 235 ? 244.224 71.983  -28.351 1.00 61.32  ? 266 VAL A CG1   1 
ATOM   1886 C  CG2   . VAL A 1 235 ? 245.347 72.586  -30.506 1.00 61.32  ? 266 VAL A CG2   1 
ATOM   1887 N  N     . GLU A 1 236 ? 247.722 69.536  -28.196 1.00 68.65  ? 267 GLU A N     1 
ATOM   1888 C  CA    . GLU A 1 236 ? 248.040 68.348  -27.423 1.00 68.65  ? 267 GLU A CA    1 
ATOM   1889 C  C     . GLU A 1 236 ? 249.150 68.694  -26.406 1.00 68.65  ? 267 GLU A C     1 
ATOM   1890 O  O     . GLU A 1 236 ? 250.281 68.214  -26.491 1.00 68.65  ? 267 GLU A O     1 
ATOM   1891 C  CB    . GLU A 1 236 ? 248.488 67.218  -28.359 1.00 57.29  ? 267 GLU A CB    1 
ATOM   1892 N  N     . GLU A 1 237 ? 248.795 69.563  -25.465 1.00 63.51  ? 268 GLU A N     1 
ATOM   1893 C  CA    . GLU A 1 237 ? 249.639 70.042  -24.361 1.00 63.51  ? 268 GLU A CA    1 
ATOM   1894 C  C     . GLU A 1 237 ? 249.216 71.474  -24.095 1.00 63.51  ? 268 GLU A C     1 
ATOM   1895 O  O     . GLU A 1 237 ? 249.202 71.940  -22.949 1.00 63.51  ? 268 GLU A O     1 
ATOM   1896 C  CB    . GLU A 1 237 ? 251.148 70.040  -24.651 1.00 73.09  ? 268 GLU A CB    1 
ATOM   1897 C  CG    . GLU A 1 237 ? 251.929 70.329  -23.337 1.00 73.09  ? 268 GLU A CG    1 
ATOM   1898 C  CD    . GLU A 1 237 ? 253.378 70.804  -23.525 1.00 73.09  ? 268 GLU A CD    1 
ATOM   1899 O  OE1   . GLU A 1 237 ? 253.870 70.838  -24.682 1.00 73.09  ? 268 GLU A OE1   1 
ATOM   1900 O  OE2   . GLU A 1 237 ? 254.025 71.144  -22.497 1.00 73.09  ? 268 GLU A OE2   1 
ATOM   1901 N  N     . ALA A 1 238 ? 248.882 72.163  -25.182 1.00 37.26  ? 269 ALA A N     1 
ATOM   1902 C  CA    . ALA A 1 238 ? 248.418 73.537  -25.132 1.00 37.26  ? 269 ALA A CA    1 
ATOM   1903 C  C     . ALA A 1 238 ? 246.972 73.429  -25.600 1.00 37.26  ? 269 ALA A C     1 
ATOM   1904 O  O     . ALA A 1 238 ? 246.590 73.941  -26.643 1.00 37.26  ? 269 ALA A O     1 
ATOM   1905 C  CB    . ALA A 1 238 ? 249.243 74.403  -26.077 1.00 66.34  ? 269 ALA A CB    1 
ATOM   1906 N  N     . PRO A 1 239 ? 246.145 72.758  -24.801 1.00 40.41  ? 270 PRO A N     1 
ATOM   1907 C  CA    . PRO A 1 239 ? 244.724 72.501  -25.025 1.00 40.41  ? 270 PRO A CA    1 
ATOM   1908 C  C     . PRO A 1 239 ? 243.905 73.755  -25.186 1.00 40.41  ? 270 PRO A C     1 
ATOM   1909 O  O     . PRO A 1 239 ? 242.961 73.955  -24.422 1.00 40.41  ? 270 PRO A O     1 
ATOM   1910 C  CB    . PRO A 1 239 ? 244.321 71.781  -23.761 1.00 56.39  ? 270 PRO A CB    1 
ATOM   1911 C  CG    . PRO A 1 239 ? 245.082 72.563  -22.743 1.00 56.39  ? 270 PRO A CG    1 
ATOM   1912 C  CD    . PRO A 1 239 ? 246.456 72.622  -23.367 1.00 56.39  ? 270 PRO A CD    1 
ATOM   1913 N  N     . VAL A 1 240 ? 244.226 74.603  -26.154 1.00 39.26  ? 271 VAL A N     1 
ATOM   1914 C  CA    . VAL A 1 240 ? 243.426 75.801  -26.264 1.00 39.26  ? 271 VAL A CA    1 
ATOM   1915 C  C     . VAL A 1 240 ? 242.774 76.084  -27.596 1.00 39.26  ? 271 VAL A C     1 
ATOM   1916 O  O     . VAL A 1 240 ? 243.333 75.832  -28.664 1.00 39.26  ? 271 VAL A O     1 
ATOM   1917 C  CB    . VAL A 1 240 ? 244.211 77.041  -25.837 1.00 44.79  ? 271 VAL A CB    1 
ATOM   1918 C  CG1   . VAL A 1 240 ? 245.171 77.466  -26.944 1.00 44.79  ? 271 VAL A CG1   1 
ATOM   1919 C  CG2   . VAL A 1 240 ? 243.223 78.147  -25.462 1.00 44.79  ? 271 VAL A CG2   1 
ATOM   1920 N  N     . LEU A 1 241 ? 241.571 76.638  -27.501 1.00 46.36  ? 272 LEU A N     1 
ATOM   1921 C  CA    . LEU A 1 241 ? 240.773 76.978  -28.662 1.00 46.36  ? 272 LEU A CA    1 
ATOM   1922 C  C     . LEU A 1 241 ? 241.577 77.613  -29.792 1.00 46.36  ? 272 LEU A C     1 
ATOM   1923 O  O     . LEU A 1 241 ? 242.255 78.610  -29.590 1.00 46.36  ? 272 LEU A O     1 
ATOM   1924 C  CB    . LEU A 1 241 ? 239.627 77.902  -28.225 1.00 47.16  ? 272 LEU A CB    1 
ATOM   1925 C  CG    . LEU A 1 241 ? 238.732 78.583  -29.270 1.00 47.16  ? 272 LEU A CG    1 
ATOM   1926 C  CD1   . LEU A 1 241 ? 238.554 77.713  -30.508 1.00 47.16  ? 272 LEU A CD1   1 
ATOM   1927 C  CD2   . LEU A 1 241 ? 237.380 78.897  -28.620 1.00 47.16  ? 272 LEU A CD2   1 
ATOM   1928 N  N     . MET A 1 242 ? 241.514 77.013  -30.977 1.00 56.92  ? 273 MET A N     1 
ATOM   1929 C  CA    . MET A 1 242 ? 242.199 77.552  -32.148 1.00 56.92  ? 273 MET A CA    1 
ATOM   1930 C  C     . MET A 1 242 ? 241.223 77.671  -33.334 1.00 56.92  ? 273 MET A C     1 
ATOM   1931 O  O     . MET A 1 242 ? 240.034 77.912  -33.122 1.00 56.92  ? 273 MET A O     1 
ATOM   1932 C  CB    . MET A 1 242 ? 243.417 76.694  -32.509 1.00 52.34  ? 273 MET A CB    1 
ATOM   1933 C  CG    . MET A 1 242 ? 244.641 76.941  -31.601 1.00 52.34  ? 273 MET A CG    1 
ATOM   1934 S  SD    . MET A 1 242 ? 245.360 78.640  -31.649 1.00 52.34  ? 273 MET A SD    1 
ATOM   1935 C  CE    . MET A 1 242 ? 246.067 78.669  -33.274 1.00 52.34  ? 273 MET A CE    1 
ATOM   1936 N  N     . HIS A 1 243 ? 241.707 77.521  -34.566 1.00 59.38  ? 274 HIS A N     1 
ATOM   1937 C  CA    . HIS A 1 243 ? 240.835 77.648  -35.739 1.00 59.38  ? 274 HIS A CA    1 
ATOM   1938 C  C     . HIS A 1 243 ? 241.334 76.908  -36.969 1.00 59.38  ? 274 HIS A C     1 
ATOM   1939 O  O     . HIS A 1 243 ? 240.872 77.160  -38.095 1.00 59.38  ? 274 HIS A O     1 
ATOM   1940 C  CB    . HIS A 1 243 ? 240.644 79.117  -36.095 1.00 45.81  ? 274 HIS A CB    1 
ATOM   1941 C  CG    . HIS A 1 243 ? 239.601 79.794  -35.277 1.00 45.81  ? 274 HIS A CG    1 
ATOM   1942 N  ND1   . HIS A 1 243 ? 238.257 79.576  -35.470 1.00 45.81  ? 274 HIS A ND1   1 
ATOM   1943 C  CD2   . HIS A 1 243 ? 239.700 80.621  -34.211 1.00 45.81  ? 274 HIS A CD2   1 
ATOM   1944 C  CE1   . HIS A 1 243 ? 237.569 80.237  -34.555 1.00 45.81  ? 274 HIS A CE1   1 
ATOM   1945 N  NE2   . HIS A 1 243 ? 238.421 80.880  -33.778 1.00 45.81  ? 274 HIS A NE2   1 
ATOM   1946 N  N     . TYR A 1 244 ? 242.282 76.005  -36.758 1.00 68.70  ? 275 TYR A N     1 
ATOM   1947 C  CA    . TYR A 1 244 ? 242.819 75.232  -37.860 1.00 68.70  ? 275 TYR A CA    1 
ATOM   1948 C  C     . TYR A 1 244 ? 241.667 74.469  -38.503 1.00 68.70  ? 275 TYR A C     1 
ATOM   1949 O  O     . TYR A 1 244 ? 240.724 74.054  -37.810 1.00 68.70  ? 275 TYR A O     1 
ATOM   1950 C  CB    . TYR A 1 244 ? 243.813 74.219  -37.340 1.00 47.75  ? 275 TYR A CB    1 
ATOM   1951 C  CG    . TYR A 1 244 ? 245.159 74.745  -36.952 1.00 47.75  ? 275 TYR A CG    1 
ATOM   1952 C  CD1   . TYR A 1 244 ? 246.156 74.944  -37.911 1.00 47.75  ? 275 TYR A CD1   1 
ATOM   1953 C  CD2   . TYR A 1 244 ? 245.480 74.916  -35.612 1.00 47.75  ? 275 TYR A CD2   1 
ATOM   1954 C  CE1   . TYR A 1 244 ? 247.441 75.282  -37.540 1.00 47.75  ? 275 TYR A CE1   1 
ATOM   1955 C  CE2   . TYR A 1 244 ? 246.751 75.253  -35.228 1.00 47.75  ? 275 TYR A CE2   1 
ATOM   1956 C  CZ    . TYR A 1 244 ? 247.733 75.432  -36.189 1.00 47.75  ? 275 TYR A CZ    1 
ATOM   1957 O  OH    . TYR A 1 244 ? 249.009 75.734  -35.765 1.00 47.75  ? 275 TYR A OH    1 
ATOM   1958 N  N     . PRO A 1 245 ? 241.730 74.253  -39.831 1.00 64.05  ? 276 PRO A N     1 
ATOM   1959 C  CA    . PRO A 1 245 ? 240.667 73.517  -40.531 1.00 64.05  ? 276 PRO A CA    1 
ATOM   1960 C  C     . PRO A 1 245 ? 240.567 72.036  -40.105 1.00 64.05  ? 276 PRO A C     1 
ATOM   1961 O  O     . PRO A 1 245 ? 241.572 71.379  -39.792 1.00 64.05  ? 276 PRO A O     1 
ATOM   1962 C  CB    . PRO A 1 245 ? 241.049 73.677  -42.005 1.00 40.77  ? 276 PRO A CB    1 
ATOM   1963 C  CG    . PRO A 1 245 ? 242.560 73.762  -41.947 1.00 40.77  ? 276 PRO A CG    1 
ATOM   1964 C  CD    . PRO A 1 245 ? 242.783 74.685  -40.768 1.00 40.77  ? 276 PRO A CD    1 
ATOM   1965 N  N     . ARG A 1 246 ? 239.334 71.536  -40.092 1.00 88.08  ? 277 ARG A N     1 
ATOM   1966 C  CA    . ARG A 1 246 ? 239.020 70.146  -39.726 1.00 88.08  ? 277 ARG A CA    1 
ATOM   1967 C  C     . ARG A 1 246 ? 239.846 69.174  -40.572 1.00 88.08  ? 277 ARG A C     1 
ATOM   1968 O  O     . ARG A 1 246 ? 239.485 68.870  -41.707 1.00 88.08  ? 277 ARG A O     1 
ATOM   1969 C  CB    . ARG A 1 246 ? 237.523 69.899  -39.956 1.00 77.16  ? 277 ARG A CB    1 
ATOM   1970 C  CG    . ARG A 1 246 ? 236.653 71.044  -39.441 1.00 77.16  ? 277 ARG A CG    1 
ATOM   1971 C  CD    . ARG A 1 246 ? 235.189 70.850  -39.788 1.00 77.16  ? 277 ARG A CD    1 
ATOM   1972 N  NE    . ARG A 1 246 ? 234.783 71.541  -41.015 1.00 77.16  ? 277 ARG A NE    1 
ATOM   1973 C  CZ    . ARG A 1 246 ? 233.548 71.500  -41.521 1.00 77.16  ? 277 ARG A CZ    1 
ATOM   1974 N  NH1   . ARG A 1 246 ? 232.583 70.798  -40.918 1.00 77.16  ? 277 ARG A NH1   1 
ATOM   1975 N  NH2   . ARG A 1 246 ? 233.268 72.173  -42.631 1.00 77.16  ? 277 ARG A NH2   1 
ATOM   1976 N  N     . GLY A 1 247 ? 240.953 68.682  -40.027 1.00 65.13  ? 278 GLY A N     1 
ATOM   1977 C  CA    . GLY A 1 247 ? 241.778 67.777  -40.806 1.00 65.13  ? 278 GLY A CA    1 
ATOM   1978 C  C     . GLY A 1 247 ? 242.844 67.081  -39.991 1.00 65.13  ? 278 GLY A C     1 
ATOM   1979 O  O     . GLY A 1 247 ? 243.009 65.863  -40.116 1.00 65.13  ? 278 GLY A O     1 
ATOM   1980 N  N     . ILE A 1 248 ? 243.589 67.843  -39.189 1.00 66.31  ? 279 ILE A N     1 
ATOM   1981 C  CA    . ILE A 1 248 ? 244.606 67.250  -38.332 1.00 66.31  ? 279 ILE A CA    1 
ATOM   1982 C  C     . ILE A 1 248 ? 244.770 68.035  -37.047 1.00 66.31  ? 279 ILE A C     1 
ATOM   1983 O  O     . ILE A 1 248 ? 245.840 68.600  -36.784 1.00 66.31  ? 279 ILE A O     1 
ATOM   1984 C  CB    . ILE A 1 248 ? 245.993 67.164  -39.001 1.00 53.99  ? 279 ILE A CB    1 
ATOM   1985 C  CG1   . ILE A 1 248 ? 245.893 66.417  -40.333 1.00 53.99  ? 279 ILE A CG1   1 
ATOM   1986 C  CG2   . ILE A 1 248 ? 246.966 66.436  -38.066 1.00 53.99  ? 279 ILE A CG2   1 
ATOM   1987 C  CD1   . ILE A 1 248 ? 247.229 66.230  -41.060 1.00 53.99  ? 279 ILE A CD1   1 
ATOM   1988 N  N     . PRO A 1 249 ? 243.715 68.073  -36.207 1.00 122.16 ? 280 PRO A N     1 
ATOM   1989 C  CA    . PRO A 1 249 ? 243.789 68.806  -34.927 1.00 122.16 ? 280 PRO A CA    1 
ATOM   1990 C  C     . PRO A 1 249 ? 244.909 68.361  -33.946 1.00 122.16 ? 280 PRO A C     1 
ATOM   1991 O  O     . PRO A 1 249 ? 244.978 68.873  -32.816 1.00 122.16 ? 280 PRO A O     1 
ATOM   1992 C  CB    . PRO A 1 249 ? 242.381 68.622  -34.328 1.00 93.13  ? 280 PRO A CB    1 
ATOM   1993 C  CG    . PRO A 1 249 ? 241.500 68.571  -35.579 1.00 93.13  ? 280 PRO A CG    1 
ATOM   1994 C  CD    . PRO A 1 249 ? 242.324 67.660  -36.502 1.00 93.13  ? 280 PRO A CD    1 
ATOM   1995 N  N     . PRO A 1 250 ? 245.765 67.383  -34.342 1.00 70.64  ? 281 PRO A N     1 
ATOM   1996 C  CA    . PRO A 1 250 ? 246.811 67.005  -33.382 1.00 70.64  ? 281 PRO A CA    1 
ATOM   1997 C  C     . PRO A 1 250 ? 248.113 67.778  -33.581 1.00 70.64  ? 281 PRO A C     1 
ATOM   1998 O  O     . PRO A 1 250 ? 248.308 68.850  -33.008 1.00 70.64  ? 281 PRO A O     1 
ATOM   1999 C  CB    . PRO A 1 250 ? 247.003 65.503  -33.636 1.00 112.89 ? 281 PRO A CB    1 
ATOM   2000 C  CG    . PRO A 1 250 ? 245.717 65.086  -34.282 1.00 112.89 ? 281 PRO A CG    1 
ATOM   2001 C  CD    . PRO A 1 250 ? 245.473 66.229  -35.212 1.00 112.89 ? 281 PRO A CD    1 
ATOM   2002 N  N     . GLN A 1 251 ? 249.011 67.220  -34.385 1.00 65.94  ? 282 GLN A N     1 
ATOM   2003 C  CA    . GLN A 1 251 ? 250.281 67.882  -34.625 1.00 65.94  ? 282 GLN A CA    1 
ATOM   2004 C  C     . GLN A 1 251 ? 250.199 68.931  -35.733 1.00 65.94  ? 282 GLN A C     1 
ATOM   2005 O  O     . GLN A 1 251 ? 249.271 68.940  -36.557 1.00 65.94  ? 282 GLN A O     1 
ATOM   2006 C  CB    . GLN A 1 251 ? 251.380 66.862  -34.941 1.00 96.34  ? 282 GLN A CB    1 
ATOM   2007 C  CG    . GLN A 1 251 ? 252.740 67.512  -35.211 1.00 96.34  ? 282 GLN A CG    1 
ATOM   2008 C  CD    . GLN A 1 251 ? 253.193 68.460  -34.085 1.00 96.34  ? 282 GLN A CD    1 
ATOM   2009 O  OE1   . GLN A 1 251 ? 254.096 69.287  -34.285 1.00 96.34  ? 282 GLN A OE1   1 
ATOM   2010 N  NE2   . GLN A 1 251 ? 252.575 68.339  -32.901 1.00 96.34  ? 282 GLN A NE2   1 
ATOM   2011 N  N     . SER A 1 252 ? 251.187 69.818  -35.729 1.00 115.95 ? 283 SER A N     1 
ATOM   2012 C  CA    . SER A 1 252 ? 251.262 70.915  -36.681 1.00 115.95 ? 283 SER A CA    1 
ATOM   2013 C  C     . SER A 1 252 ? 249.984 71.761  -36.541 1.00 115.95 ? 283 SER A C     1 
ATOM   2014 O  O     . SER A 1 252 ? 249.649 72.596  -37.399 1.00 115.95 ? 283 SER A O     1 
ATOM   2015 C  CB    . SER A 1 252 ? 251.425 70.380  -38.104 1.00 101.49 ? 283 SER A CB    1 
ATOM   2016 O  OG    . SER A 1 252 ? 252.429 71.134  -38.774 1.00 101.49 ? 283 SER A OG    1 
ATOM   2017 N  N     . GLN A 1 253 ? 249.288 71.526  -35.434 1.00 50.90  ? 284 GLN A N     1 
ATOM   2018 C  CA    . GLN A 1 253 ? 248.072 72.230  -35.110 1.00 50.90  ? 284 GLN A CA    1 
ATOM   2019 C  C     . GLN A 1 253 ? 248.460 72.940  -33.819 1.00 50.90  ? 284 GLN A C     1 
ATOM   2020 O  O     . GLN A 1 253 ? 248.091 72.520  -32.713 1.00 50.90  ? 284 GLN A O     1 
ATOM   2021 C  CB    . GLN A 1 253 ? 246.951 71.220  -34.892 1.00 60.34  ? 284 GLN A CB    1 
ATOM   2022 C  CG    . GLN A 1 253 ? 245.665 71.640  -35.523 1.00 60.34  ? 284 GLN A CG    1 
ATOM   2023 C  CD    . GLN A 1 253 ? 244.615 71.994  -34.503 1.00 60.34  ? 284 GLN A CD    1 
ATOM   2024 O  OE1   . GLN A 1 253 ? 243.697 72.779  -34.779 1.00 60.34  ? 284 GLN A OE1   1 
ATOM   2025 N  NE2   . GLN A 1 253 ? 244.726 71.407  -33.313 1.00 60.34  ? 284 GLN A NE2   1 
ATOM   2026 N  N     . MET A 1 254 ? 249.220 74.022  -33.992 1.00 50.73  ? 285 MET A N     1 
ATOM   2027 C  CA    . MET A 1 254 ? 249.775 74.833  -32.908 1.00 50.73  ? 285 MET A CA    1 
ATOM   2028 C  C     . MET A 1 254 ? 248.896 75.885  -32.221 1.00 50.73  ? 285 MET A C     1 
ATOM   2029 O  O     . MET A 1 254 ? 248.036 76.510  -32.844 1.00 50.73  ? 285 MET A O     1 
ATOM   2030 C  CB    . MET A 1 254 ? 251.037 75.485  -33.444 1.00 51.54  ? 285 MET A CB    1 
ATOM   2031 C  CG    . MET A 1 254 ? 251.834 74.489  -34.263 1.00 51.54  ? 285 MET A CG    1 
ATOM   2032 S  SD    . MET A 1 254 ? 253.014 75.215  -35.406 1.00 51.54  ? 285 MET A SD    1 
ATOM   2033 C  CE    . MET A 1 254 ? 254.627 74.841  -34.582 1.00 51.54  ? 285 MET A CE    1 
ATOM   2034 N  N     . ALA A 1 255 ? 249.130 76.053  -30.916 1.00 51.52  ? 286 ALA A N     1 
ATOM   2035 C  CA    . ALA A 1 255 ? 248.425 77.026  -30.075 1.00 51.52  ? 286 ALA A CA    1 
ATOM   2036 C  C     . ALA A 1 255 ? 249.345 78.246  -29.918 1.00 51.52  ? 286 ALA A C     1 
ATOM   2037 O  O     . ALA A 1 255 ? 250.563 78.108  -29.722 1.00 51.52  ? 286 ALA A O     1 
ATOM   2038 C  CB    . ALA A 1 255 ? 248.125 76.419  -28.724 1.00 19.64  ? 286 ALA A CB    1 
ATOM   2039 N  N     . VAL A 1 256 ? 248.775 79.443  -29.971 1.00 41.12  ? 287 VAL A N     1 
ATOM   2040 C  CA    . VAL A 1 256 ? 249.620 80.612  -29.913 1.00 41.12  ? 287 VAL A CA    1 
ATOM   2041 C  C     . VAL A 1 256 ? 249.183 81.727  -29.001 1.00 41.12  ? 287 VAL A C     1 
ATOM   2042 O  O     . VAL A 1 256 ? 249.994 82.285  -28.259 1.00 41.12  ? 287 VAL A O     1 
ATOM   2043 C  CB    . VAL A 1 256 ? 249.756 81.197  -31.301 1.00 36.74  ? 287 VAL A CB    1 
ATOM   2044 C  CG1   . VAL A 1 256 ? 250.544 80.262  -32.188 1.00 36.74  ? 287 VAL A CG1   1 
ATOM   2045 C  CG2   . VAL A 1 256 ? 248.371 81.426  -31.879 1.00 36.74  ? 287 VAL A CG2   1 
ATOM   2046 N  N     . GLY A 1 257 ? 247.909 82.075  -29.070 1.00 48.25  ? 288 GLY A N     1 
ATOM   2047 C  CA    . GLY A 1 257 ? 247.428 83.163  -28.248 1.00 48.25  ? 288 GLY A CA    1 
ATOM   2048 C  C     . GLY A 1 257 ? 246.468 83.974  -29.078 1.00 48.25  ? 288 GLY A C     1 
ATOM   2049 O  O     . GLY A 1 257 ? 245.580 84.658  -28.553 1.00 48.25  ? 288 GLY A O     1 
ATOM   2050 N  N     . GLN A 1 258 ? 246.651 83.917  -30.393 1.00 43.07  ? 289 GLN A N     1 
ATOM   2051 C  CA    . GLN A 1 258 ? 245.739 84.623  -31.268 1.00 43.07  ? 289 GLN A CA    1 
ATOM   2052 C  C     . GLN A 1 258 ? 244.984 83.568  -32.072 1.00 43.07  ? 289 GLN A C     1 
ATOM   2053 O  O     . GLN A 1 258 ? 245.471 83.038  -33.076 1.00 43.07  ? 289 GLN A O     1 
ATOM   2054 C  CB    . GLN A 1 258 ? 246.480 85.604  -32.173 1.00 42.78  ? 289 GLN A CB    1 
ATOM   2055 C  CG    . GLN A 1 258 ? 245.762 86.939  -32.261 1.00 42.78  ? 289 GLN A CG    1 
ATOM   2056 C  CD    . GLN A 1 258 ? 244.340 86.819  -32.807 1.00 42.78  ? 289 GLN A CD    1 
ATOM   2057 O  OE1   . GLN A 1 258 ? 243.564 85.968  -32.379 1.00 42.78  ? 289 GLN A OE1   1 
ATOM   2058 N  NE2   . GLN A 1 258 ? 243.994 87.685  -33.750 1.00 42.78  ? 289 GLN A NE2   1 
ATOM   2059 N  N     . GLU A 1 259 ? 243.788 83.264  -31.576 1.00 53.54  ? 290 GLU A N     1 
ATOM   2060 C  CA    . GLU A 1 259 ? 242.891 82.264  -32.142 1.00 53.54  ? 290 GLU A CA    1 
ATOM   2061 C  C     . GLU A 1 259 ? 243.026 81.940  -33.643 1.00 53.54  ? 290 GLU A C     1 
ATOM   2062 O  O     . GLU A 1 259 ? 243.013 80.771  -34.037 1.00 53.54  ? 290 GLU A O     1 
ATOM   2063 C  CB    . GLU A 1 259 ? 241.433 82.656  -31.811 1.00 31.01  ? 290 GLU A CB    1 
ATOM   2064 N  N     . VAL A 1 260 ? 243.189 82.959  -34.476 1.00 34.67  ? 291 VAL A N     1 
ATOM   2065 C  CA    . VAL A 1 260 ? 243.250 82.736  -35.910 1.00 34.67  ? 291 VAL A CA    1 
ATOM   2066 C  C     . VAL A 1 260 ? 244.632 82.664  -36.553 1.00 34.67  ? 291 VAL A C     1 
ATOM   2067 O  O     . VAL A 1 260 ? 244.742 82.523  -37.767 1.00 34.67  ? 291 VAL A O     1 
ATOM   2068 C  CB    . VAL A 1 260 ? 242.432 83.828  -36.620 1.00 32.31  ? 291 VAL A CB    1 
ATOM   2069 C  CG1   . VAL A 1 260 ? 243.121 85.172  -36.465 1.00 32.31  ? 291 VAL A CG1   1 
ATOM   2070 C  CG2   . VAL A 1 260 ? 242.235 83.476  -38.075 1.00 32.31  ? 291 VAL A CG2   1 
ATOM   2071 N  N     . PHE A 1 261 ? 245.687 82.720  -35.749 1.00 44.43  ? 292 PHE A N     1 
ATOM   2072 C  CA    . PHE A 1 261 ? 247.056 82.725  -36.285 1.00 44.43  ? 292 PHE A CA    1 
ATOM   2073 C  C     . PHE A 1 261 ? 247.664 81.467  -36.935 1.00 44.43  ? 292 PHE A C     1 
ATOM   2074 O  O     . PHE A 1 261 ? 248.880 81.395  -37.151 1.00 44.43  ? 292 PHE A O     1 
ATOM   2075 C  CB    . PHE A 1 261 ? 248.005 83.269  -35.205 1.00 53.26  ? 292 PHE A CB    1 
ATOM   2076 C  CG    . PHE A 1 261 ? 247.924 84.771  -35.028 1.00 53.26  ? 292 PHE A CG    1 
ATOM   2077 C  CD1   . PHE A 1 261 ? 246.785 85.475  -35.421 1.00 53.26  ? 292 PHE A CD1   1 
ATOM   2078 C  CD2   . PHE A 1 261 ? 248.981 85.477  -34.468 1.00 53.26  ? 292 PHE A CD2   1 
ATOM   2079 C  CE1   . PHE A 1 261 ? 246.704 86.844  -35.265 1.00 53.26  ? 292 PHE A CE1   1 
ATOM   2080 C  CE2   . PHE A 1 261 ? 248.908 86.851  -34.305 1.00 53.26  ? 292 PHE A CE2   1 
ATOM   2081 C  CZ    . PHE A 1 261 ? 247.767 87.534  -34.705 1.00 53.26  ? 292 PHE A CZ    1 
ATOM   2082 N  N     . GLY A 1 262 ? 246.822 80.494  -37.271 1.00 47.35  ? 293 GLY A N     1 
ATOM   2083 C  CA    . GLY A 1 262 ? 247.317 79.287  -37.909 1.00 47.35  ? 293 GLY A CA    1 
ATOM   2084 C  C     . GLY A 1 262 ? 246.991 79.320  -39.390 1.00 47.35  ? 293 GLY A C     1 
ATOM   2085 O  O     . GLY A 1 262 ? 247.621 78.642  -40.212 1.00 47.35  ? 293 GLY A O     1 
ATOM   2086 N  N     . LEU A 1 263 ? 246.007 80.147  -39.724 1.00 55.52  ? 294 LEU A N     1 
ATOM   2087 C  CA    . LEU A 1 263 ? 245.547 80.294  -41.091 1.00 55.52  ? 294 LEU A CA    1 
ATOM   2088 C  C     . LEU A 1 263 ? 246.505 80.908  -42.105 1.00 55.52  ? 294 LEU A C     1 
ATOM   2089 O  O     . LEU A 1 263 ? 246.131 81.026  -43.268 1.00 55.52  ? 294 LEU A O     1 
ATOM   2090 C  CB    . LEU A 1 263 ? 244.250 81.086  -41.099 1.00 42.57  ? 294 LEU A CB    1 
ATOM   2091 C  CG    . LEU A 1 263 ? 243.165 80.411  -40.273 1.00 42.57  ? 294 LEU A CG    1 
ATOM   2092 C  CD1   . LEU A 1 263 ? 241.882 81.237  -40.326 1.00 42.57  ? 294 LEU A CD1   1 
ATOM   2093 C  CD2   . LEU A 1 263 ? 242.938 79.006  -40.818 1.00 42.57  ? 294 LEU A CD2   1 
ATOM   2094 N  N     . LEU A 1 264 ? 247.716 81.297  -41.684 1.00 48.08  ? 295 LEU A N     1 
ATOM   2095 C  CA    . LEU A 1 264 ? 248.726 81.899  -42.584 1.00 48.08  ? 295 LEU A CA    1 
ATOM   2096 C  C     . LEU A 1 264 ? 250.125 81.733  -41.983 1.00 48.08  ? 295 LEU A C     1 
ATOM   2097 O  O     . LEU A 1 264 ? 250.322 81.998  -40.805 1.00 48.08  ? 295 LEU A O     1 
ATOM   2098 C  CB    . LEU A 1 264 ? 248.428 83.387  -42.780 1.00 45.04  ? 295 LEU A CB    1 
ATOM   2099 C  CG    . LEU A 1 264 ? 247.028 83.729  -43.313 1.00 45.04  ? 295 LEU A CG    1 
ATOM   2100 C  CD1   . LEU A 1 264 ? 246.610 85.125  -42.912 1.00 45.04  ? 295 LEU A CD1   1 
ATOM   2101 C  CD2   . LEU A 1 264 ? 247.028 83.582  -44.814 1.00 45.04  ? 295 LEU A CD2   1 
ATOM   2102 N  N     . PRO A 1 265 ? 251.111 81.275  -42.770 1.00 42.31  ? 296 PRO A N     1 
ATOM   2103 C  CA    . PRO A 1 265 ? 252.458 81.108  -42.215 1.00 42.31  ? 296 PRO A CA    1 
ATOM   2104 C  C     . PRO A 1 265 ? 252.996 82.406  -41.636 1.00 42.31  ? 296 PRO A C     1 
ATOM   2105 O  O     . PRO A 1 265 ? 253.655 82.401  -40.594 1.00 42.31  ? 296 PRO A O     1 
ATOM   2106 C  CB    . PRO A 1 265 ? 253.272 80.638  -43.413 1.00 46.13  ? 296 PRO A CB    1 
ATOM   2107 C  CG    . PRO A 1 265 ? 252.297 79.836  -44.161 1.00 46.13  ? 296 PRO A CG    1 
ATOM   2108 C  CD    . PRO A 1 265 ? 251.049 80.716  -44.126 1.00 46.13  ? 296 PRO A CD    1 
ATOM   2109 N  N     . GLY A 1 266 ? 252.708 83.513  -42.320 1.00 51.83  ? 297 GLY A N     1 
ATOM   2110 C  CA    . GLY A 1 266 ? 253.162 84.815  -41.868 1.00 51.83  ? 297 GLY A CA    1 
ATOM   2111 C  C     . GLY A 1 266 ? 252.895 85.004  -40.391 1.00 51.83  ? 297 GLY A C     1 
ATOM   2112 O  O     . GLY A 1 266 ? 253.822 85.185  -39.609 1.00 51.83  ? 297 GLY A O     1 
ATOM   2113 N  N     . LEU A 1 267 ? 251.628 84.951  -40.002 1.00 27.47  ? 298 LEU A N     1 
ATOM   2114 C  CA    . LEU A 1 267 ? 251.276 85.127  -38.614 1.00 27.47  ? 298 LEU A CA    1 
ATOM   2115 C  C     . LEU A 1 267 ? 251.960 84.098  -37.747 1.00 27.47  ? 298 LEU A C     1 
ATOM   2116 O  O     . LEU A 1 267 ? 252.684 84.454  -36.827 1.00 27.47  ? 298 LEU A O     1 
ATOM   2117 C  CB    . LEU A 1 267 ? 249.769 85.057  -38.431 1.00 20.69  ? 298 LEU A CB    1 
ATOM   2118 C  CG    . LEU A 1 267 ? 249.065 86.294  -38.981 1.00 20.69  ? 298 LEU A CG    1 
ATOM   2119 C  CD1   . LEU A 1 267 ? 249.006 86.240  -40.483 1.00 20.69  ? 298 LEU A CD1   1 
ATOM   2120 C  CD2   . LEU A 1 267 ? 247.679 86.366  -38.429 1.00 20.69  ? 298 LEU A CD2   1 
ATOM   2121 N  N     . MET A 1 268 ? 251.755 82.822  -38.047 1.00 36.91  ? 299 MET A N     1 
ATOM   2122 C  CA    . MET A 1 268 ? 252.372 81.755  -37.261 1.00 36.91  ? 299 MET A CA    1 
ATOM   2123 C  C     . MET A 1 268 ? 253.886 81.966  -37.176 1.00 36.91  ? 299 MET A C     1 
ATOM   2124 O  O     . MET A 1 268 ? 254.500 81.671  -36.152 1.00 36.91  ? 299 MET A O     1 
ATOM   2125 C  CB    . MET A 1 268 ? 252.028 80.386  -37.874 1.00 48.60  ? 299 MET A CB    1 
ATOM   2126 C  CG    . MET A 1 268 ? 252.354 79.157  -37.002 1.00 48.60  ? 299 MET A CG    1 
ATOM   2127 S  SD    . MET A 1 268 ? 251.679 79.148  -35.298 1.00 48.60  ? 299 MET A SD    1 
ATOM   2128 C  CE    . MET A 1 268 ? 249.947 79.535  -35.579 1.00 48.60  ? 299 MET A CE    1 
ATOM   2129 N  N     . LEU A 1 269 ? 254.474 82.495  -38.248 1.00 38.70  ? 300 LEU A N     1 
ATOM   2130 C  CA    . LEU A 1 269 ? 255.912 82.779  -38.285 1.00 38.70  ? 300 LEU A CA    1 
ATOM   2131 C  C     . LEU A 1 269 ? 256.244 83.727  -37.157 1.00 38.70  ? 300 LEU A C     1 
ATOM   2132 O  O     . LEU A 1 269 ? 256.937 83.379  -36.212 1.00 38.70  ? 300 LEU A O     1 
ATOM   2133 C  CB    . LEU A 1 269 ? 256.317 83.446  -39.600 1.00 19.30  ? 300 LEU A CB    1 
ATOM   2134 C  CG    . LEU A 1 269 ? 257.779 83.894  -39.642 1.00 19.30  ? 300 LEU A CG    1 
ATOM   2135 C  CD1   . LEU A 1 269 ? 258.698 82.732  -39.299 1.00 19.30  ? 300 LEU A CD1   1 
ATOM   2136 C  CD2   . LEU A 1 269 ? 258.108 84.428  -41.015 1.00 19.30  ? 300 LEU A CD2   1 
ATOM   2137 N  N     . TYR A 1 270 ? 255.740 84.944  -37.267 1.00 39.92  ? 301 TYR A N     1 
ATOM   2138 C  CA    . TYR A 1 270 ? 255.984 85.923  -36.240 1.00 39.92  ? 301 TYR A CA    1 
ATOM   2139 C  C     . TYR A 1 270 ? 255.673 85.334  -34.872 1.00 39.92  ? 301 TYR A C     1 
ATOM   2140 O  O     . TYR A 1 270 ? 256.461 85.492  -33.939 1.00 39.92  ? 301 TYR A O     1 
ATOM   2141 C  CB    . TYR A 1 270 ? 255.156 87.181  -36.525 1.00 37.50  ? 301 TYR A CB    1 
ATOM   2142 C  CG    . TYR A 1 270 ? 255.909 88.179  -37.387 1.00 37.50  ? 301 TYR A CG    1 
ATOM   2143 C  CD1   . TYR A 1 270 ? 256.946 88.945  -36.850 1.00 37.50  ? 301 TYR A CD1   1 
ATOM   2144 C  CD2   . TYR A 1 270 ? 255.642 88.304  -38.748 1.00 37.50  ? 301 TYR A CD2   1 
ATOM   2145 C  CE1   . TYR A 1 270 ? 257.701 89.806  -37.647 1.00 37.50  ? 301 TYR A CE1   1 
ATOM   2146 C  CE2   . TYR A 1 270 ? 256.391 89.162  -39.552 1.00 37.50  ? 301 TYR A CE2   1 
ATOM   2147 C  CZ    . TYR A 1 270 ? 257.418 89.910  -38.994 1.00 37.50  ? 301 TYR A CZ    1 
ATOM   2148 O  OH    . TYR A 1 270 ? 258.155 90.768  -39.774 1.00 37.50  ? 301 TYR A OH    1 
ATOM   2149 N  N     . ALA A 1 271 ? 254.546 84.630  -34.758 1.00 41.28  ? 302 ALA A N     1 
ATOM   2150 C  CA    . ALA A 1 271 ? 254.144 84.007  -33.490 1.00 41.28  ? 302 ALA A CA    1 
ATOM   2151 C  C     . ALA A 1 271 ? 255.295 83.189  -32.927 1.00 41.28  ? 302 ALA A C     1 
ATOM   2152 O  O     . ALA A 1 271 ? 255.604 83.268  -31.741 1.00 41.28  ? 302 ALA A O     1 
ATOM   2153 C  CB    . ALA A 1 271 ? 252.931 83.118  -33.700 1.00 22.85  ? 302 ALA A CB    1 
ATOM   2154 N  N     . THR A 1 272 ? 255.930 82.409  -33.792 1.00 25.35  ? 303 THR A N     1 
ATOM   2155 C  CA    . THR A 1 272 ? 257.057 81.592  -33.381 1.00 25.35  ? 303 THR A CA    1 
ATOM   2156 C  C     . THR A 1 272 ? 258.150 82.502  -32.847 1.00 25.35  ? 303 THR A C     1 
ATOM   2157 O  O     . THR A 1 272 ? 258.743 82.241  -31.805 1.00 25.35  ? 303 THR A O     1 
ATOM   2158 C  CB    . THR A 1 272 ? 257.651 80.806  -34.567 1.00 28.55  ? 303 THR A CB    1 
ATOM   2159 O  OG1   . THR A 1 272 ? 256.621 80.065  -35.220 1.00 28.55  ? 303 THR A OG1   1 
ATOM   2160 C  CG2   . THR A 1 272 ? 258.730 79.851  -34.086 1.00 28.55  ? 303 THR A CG2   1 
ATOM   2161 N  N     . ILE A 1 273 ? 258.405 83.580  -33.580 1.00 43.20  ? 304 ILE A N     1 
ATOM   2162 C  CA    . ILE A 1 273 ? 259.448 84.537  -33.232 1.00 43.20  ? 304 ILE A CA    1 
ATOM   2163 C  C     . ILE A 1 273 ? 259.277 85.190  -31.874 1.00 43.20  ? 304 ILE A C     1 
ATOM   2164 O  O     . ILE A 1 273 ? 260.226 85.245  -31.094 1.00 43.20  ? 304 ILE A O     1 
ATOM   2165 C  CB    . ILE A 1 273 ? 259.568 85.640  -34.299 1.00 38.22  ? 304 ILE A CB    1 
ATOM   2166 C  CG1   . ILE A 1 273 ? 260.030 85.031  -35.617 1.00 38.22  ? 304 ILE A CG1   1 
ATOM   2167 C  CG2   . ILE A 1 273 ? 260.553 86.695  -33.846 1.00 38.22  ? 304 ILE A CG2   1 
ATOM   2168 C  CD1   . ILE A 1 273 ? 260.205 86.027  -36.712 1.00 38.22  ? 304 ILE A CD1   1 
ATOM   2169 N  N     . TRP A 1 274 ? 258.080 85.690  -31.581 1.00 45.13  ? 305 TRP A N     1 
ATOM   2170 C  CA    . TRP A 1 274 ? 257.875 86.323  -30.289 1.00 45.13  ? 305 TRP A CA    1 
ATOM   2171 C  C     . TRP A 1 274 ? 257.975 85.298  -29.156 1.00 45.13  ? 305 TRP A C     1 
ATOM   2172 O  O     . TRP A 1 274 ? 258.736 85.503  -28.204 1.00 45.13  ? 305 TRP A O     1 
ATOM   2173 C  CB    . TRP A 1 274 ? 256.539 87.095  -30.252 1.00 43.42  ? 305 TRP A CB    1 
ATOM   2174 C  CG    . TRP A 1 274 ? 256.620 88.447  -30.971 1.00 43.42  ? 305 TRP A CG    1 
ATOM   2175 C  CD1   . TRP A 1 274 ? 256.175 88.733  -32.228 1.00 43.42  ? 305 TRP A CD1   1 
ATOM   2176 C  CD2   . TRP A 1 274 ? 257.289 89.633  -30.511 1.00 43.42  ? 305 TRP A CD2   1 
ATOM   2177 N  NE1   . TRP A 1 274 ? 256.531 90.011  -32.582 1.00 43.42  ? 305 TRP A NE1   1 
ATOM   2178 C  CE2   . TRP A 1 274 ? 257.216 90.583  -31.545 1.00 43.42  ? 305 TRP A CE2   1 
ATOM   2179 C  CE3   . TRP A 1 274 ? 257.946 89.978  -29.330 1.00 43.42  ? 305 TRP A CE3   1 
ATOM   2180 C  CZ2   . TRP A 1 274 ? 257.774 91.851  -31.433 1.00 43.42  ? 305 TRP A CZ2   1 
ATOM   2181 C  CZ3   . TRP A 1 274 ? 258.501 91.240  -29.225 1.00 43.42  ? 305 TRP A CZ3   1 
ATOM   2182 C  CH2   . TRP A 1 274 ? 258.410 92.157  -30.270 1.00 43.42  ? 305 TRP A CH2   1 
ATOM   2183 N  N     . LEU A 1 275 ? 257.241 84.193  -29.253 1.00 46.67  ? 306 LEU A N     1 
ATOM   2184 C  CA    . LEU A 1 275 ? 257.326 83.168  -28.214 1.00 46.67  ? 306 LEU A CA    1 
ATOM   2185 C  C     . LEU A 1 275 ? 258.780 82.791  -27.967 1.00 46.67  ? 306 LEU A C     1 
ATOM   2186 O  O     . LEU A 1 275 ? 259.232 82.692  -26.832 1.00 46.67  ? 306 LEU A O     1 
ATOM   2187 C  CB    . LEU A 1 275 ? 256.558 81.916  -28.627 1.00 46.47  ? 306 LEU A CB    1 
ATOM   2188 C  CG    . LEU A 1 275 ? 256.606 80.752  -27.631 1.00 46.47  ? 306 LEU A CG    1 
ATOM   2189 C  CD1   . LEU A 1 275 ? 255.383 79.868  -27.819 1.00 46.47  ? 306 LEU A CD1   1 
ATOM   2190 C  CD2   . LEU A 1 275 ? 257.886 79.964  -27.820 1.00 46.47  ? 306 LEU A CD2   1 
ATOM   2191 N  N     . ARG A 1 276 ? 259.512 82.575  -29.044 1.00 35.63  ? 307 ARG A N     1 
ATOM   2192 C  CA    . ARG A 1 276 ? 260.904 82.208  -28.929 1.00 35.63  ? 307 ARG A CA    1 
ATOM   2193 C  C     . ARG A 1 276 ? 261.721 83.316  -28.274 1.00 35.63  ? 307 ARG A C     1 
ATOM   2194 O  O     . ARG A 1 276 ? 262.828 83.078  -27.802 1.00 35.63  ? 307 ARG A O     1 
ATOM   2195 C  CB    . ARG A 1 276 ? 261.459 81.878  -30.311 1.00 46.76  ? 307 ARG A CB    1 
ATOM   2196 C  CG    . ARG A 1 276 ? 262.767 81.130  -30.269 1.00 46.76  ? 307 ARG A CG    1 
ATOM   2197 C  CD    . ARG A 1 276 ? 262.784 80.016  -31.286 1.00 46.76  ? 307 ARG A CD    1 
ATOM   2198 N  NE    . ARG A 1 276 ? 262.739 80.501  -32.658 1.00 46.76  ? 307 ARG A NE    1 
ATOM   2199 C  CZ    . ARG A 1 276 ? 262.889 79.724  -33.725 1.00 46.76  ? 307 ARG A CZ    1 
ATOM   2200 N  NH1   . ARG A 1 276 ? 263.090 78.416  -33.586 1.00 46.76  ? 307 ARG A NH1   1 
ATOM   2201 N  NH2   . ARG A 1 276 ? 262.867 80.260  -34.937 1.00 46.76  ? 307 ARG A NH2   1 
ATOM   2202 N  N     . GLU A 1 277 ? 261.175 84.528  -28.248 1.00 43.54  ? 308 GLU A N     1 
ATOM   2203 C  CA    . GLU A 1 277 ? 261.846 85.682  -27.636 1.00 43.54  ? 308 GLU A CA    1 
ATOM   2204 C  C     . GLU A 1 277 ? 261.551 85.713  -26.142 1.00 43.54  ? 308 GLU A C     1 
ATOM   2205 O  O     . GLU A 1 277 ? 262.463 85.762  -25.321 1.00 43.54  ? 308 GLU A O     1 
ATOM   2206 C  CB    . GLU A 1 277 ? 261.351 86.982  -28.290 1.00 60.34  ? 308 GLU A CB    1 
ATOM   2207 C  CG    . GLU A 1 277 ? 261.675 88.283  -27.535 1.00 60.34  ? 308 GLU A CG    1 
ATOM   2208 C  CD    . GLU A 1 277 ? 263.160 88.596  -27.467 1.00 60.34  ? 308 GLU A CD    1 
ATOM   2209 O  OE1   . GLU A 1 277 ? 263.514 89.620  -26.847 1.00 60.34  ? 308 GLU A OE1   1 
ATOM   2210 O  OE2   . GLU A 1 277 ? 263.972 87.823  -28.026 1.00 60.34  ? 308 GLU A OE2   1 
ATOM   2211 N  N     . HIS A 1 278 ? 260.266 85.698  -25.809 1.00 31.01  ? 309 HIS A N     1 
ATOM   2212 C  CA    . HIS A 1 278 ? 259.810 85.702  -24.428 1.00 31.01  ? 309 HIS A CA    1 
ATOM   2213 C  C     . HIS A 1 278 ? 260.645 84.758  -23.569 1.00 31.01  ? 309 HIS A C     1 
ATOM   2214 O  O     . HIS A 1 278 ? 261.236 85.148  -22.570 1.00 31.01  ? 309 HIS A O     1 
ATOM   2215 C  CB    . HIS A 1 278 ? 258.360 85.252  -24.379 1.00 33.54  ? 309 HIS A CB    1 
ATOM   2216 C  CG    . HIS A 1 278 ? 257.868 84.962  -23.000 1.00 33.54  ? 309 HIS A CG    1 
ATOM   2217 N  ND1   . HIS A 1 278 ? 256.816 85.643  -22.433 1.00 33.54  ? 309 HIS A ND1   1 
ATOM   2218 C  CD2   . HIS A 1 278 ? 258.302 84.088  -22.064 1.00 33.54  ? 309 HIS A CD2   1 
ATOM   2219 C  CE1   . HIS A 1 278 ? 256.626 85.204  -21.203 1.00 33.54  ? 309 HIS A CE1   1 
ATOM   2220 N  NE2   . HIS A 1 278 ? 257.515 84.260  -20.955 1.00 33.54  ? 309 HIS A NE2   1 
ATOM   2221 N  N     . ASN A 1 279 ? 260.653 83.491  -23.963 1.00 50.13  ? 310 ASN A N     1 
ATOM   2222 C  CA    . ASN A 1 279 ? 261.400 82.458  -23.263 1.00 50.13  ? 310 ASN A CA    1 
ATOM   2223 C  C     . ASN A 1 279 ? 262.861 82.874  -23.143 1.00 50.13  ? 310 ASN A C     1 
ATOM   2224 O  O     . ASN A 1 279 ? 263.535 82.542  -22.167 1.00 50.13  ? 310 ASN A O     1 
ATOM   2225 C  CB    . ASN A 1 279 ? 261.295 81.142  -24.040 1.00 61.25  ? 310 ASN A CB    1 
ATOM   2226 C  CG    . ASN A 1 279 ? 260.047 80.327  -23.684 1.00 61.25  ? 310 ASN A CG    1 
ATOM   2227 O  OD1   . ASN A 1 279 ? 258.952 80.862  -23.469 1.00 61.25  ? 310 ASN A OD1   1 
ATOM   2228 N  ND2   . ASN A 1 279 ? 260.215 79.011  -23.645 1.00 61.25  ? 310 ASN A ND2   1 
ATOM   2229 N  N     . ARG A 1 280 ? 263.345 83.605  -24.144 1.00 47.29  ? 311 ARG A N     1 
ATOM   2230 C  CA    . ARG A 1 280 ? 264.730 84.062  -24.149 1.00 47.29  ? 311 ARG A CA    1 
ATOM   2231 C  C     . ARG A 1 280 ? 264.938 85.082  -23.044 1.00 47.29  ? 311 ARG A C     1 
ATOM   2232 O  O     . ARG A 1 280 ? 265.935 85.026  -22.317 1.00 47.29  ? 311 ARG A O     1 
ATOM   2233 C  CB    . ARG A 1 280 ? 265.108 84.680  -25.503 1.00 43.67  ? 311 ARG A CB    1 
ATOM   2234 C  CG    . ARG A 1 280 ? 266.542 85.196  -25.533 1.00 43.67  ? 311 ARG A CG    1 
ATOM   2235 C  CD    . ARG A 1 280 ? 266.898 85.970  -26.806 1.00 43.67  ? 311 ARG A CD    1 
ATOM   2236 N  NE    . ARG A 1 280 ? 267.784 87.086  -26.480 1.00 43.67  ? 311 ARG A NE    1 
ATOM   2237 C  CZ    . ARG A 1 280 ? 267.383 88.348  -26.377 1.00 43.67  ? 311 ARG A CZ    1 
ATOM   2238 N  NH1   . ARG A 1 280 ? 266.114 88.666  -26.593 1.00 43.67  ? 311 ARG A NH1   1 
ATOM   2239 N  NH2   . ARG A 1 280 ? 268.241 89.288  -26.013 1.00 43.67  ? 311 ARG A NH2   1 
ATOM   2240 N  N     . VAL A 1 281 ? 263.998 86.018  -22.927 1.00 40.16  ? 312 VAL A N     1 
ATOM   2241 C  CA    . VAL A 1 281 ? 264.069 87.038  -21.889 1.00 40.16  ? 312 VAL A CA    1 
ATOM   2242 C  C     . VAL A 1 281 ? 264.186 86.312  -20.551 1.00 40.16  ? 312 VAL A C     1 
ATOM   2243 O  O     . VAL A 1 281 ? 265.112 86.560  -19.781 1.00 40.16  ? 312 VAL A O     1 
ATOM   2244 C  CB    . VAL A 1 281 ? 262.800 87.941  -21.912 1.00 45.06  ? 312 VAL A CB    1 
ATOM   2245 C  CG1   . VAL A 1 281 ? 262.590 88.623  -20.564 1.00 45.06  ? 312 VAL A CG1   1 
ATOM   2246 C  CG2   . VAL A 1 281 ? 262.939 88.984  -23.005 1.00 45.06  ? 312 VAL A CG2   1 
ATOM   2247 N  N     . CYS A 1 282 ? 263.256 85.391  -20.303 1.00 44.20  ? 313 CYS A N     1 
ATOM   2248 C  CA    . CYS A 1 282 ? 263.234 84.594  -19.077 1.00 44.20  ? 313 CYS A CA    1 
ATOM   2249 C  C     . CYS A 1 282 ? 264.607 84.059  -18.703 1.00 44.20  ? 313 CYS A C     1 
ATOM   2250 O  O     . CYS A 1 282 ? 265.032 84.166  -17.551 1.00 44.20  ? 313 CYS A O     1 
ATOM   2251 C  CB    . CYS A 1 282 ? 262.281 83.414  -19.236 1.00 48.03  ? 313 CYS A CB    1 
ATOM   2252 S  SG    . CYS A 1 282 ? 260.641 83.909  -19.700 1.00 48.03  ? 313 CYS A SG    1 
ATOM   2253 N  N     . ASP A 1 283 ? 265.290 83.461  -19.671 1.00 45.21  ? 314 ASP A N     1 
ATOM   2254 C  CA    . ASP A 1 283 ? 266.608 82.925  -19.402 1.00 45.21  ? 314 ASP A CA    1 
ATOM   2255 C  C     . ASP A 1 283 ? 267.479 84.016  -18.804 1.00 45.21  ? 314 ASP A C     1 
ATOM   2256 O  O     . ASP A 1 283 ? 268.139 83.805  -17.791 1.00 45.21  ? 314 ASP A O     1 
ATOM   2257 C  CB    . ASP A 1 283 ? 267.227 82.361  -20.681 1.00 56.29  ? 314 ASP A CB    1 
ATOM   2258 C  CG    . ASP A 1 283 ? 266.683 80.978  -21.029 1.00 56.29  ? 314 ASP A CG    1 
ATOM   2259 O  OD1   . ASP A 1 283 ? 267.019 80.454  -22.116 1.00 56.29  ? 314 ASP A OD1   1 
ATOM   2260 O  OD2   . ASP A 1 283 ? 265.922 80.417  -20.209 1.00 56.29  ? 314 ASP A OD2   1 
ATOM   2261 N  N     . LEU A 1 284 ? 267.466 85.191  -19.418 1.00 34.49  ? 315 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1 284 ? 268.247 86.310  -18.922 1.00 34.49  ? 315 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1 284 ? 267.793 86.673  -17.509 1.00 34.49  ? 315 LEU A C     1 
ATOM   2264 O  O     . LEU A 1 284 ? 268.570 86.595  -16.563 1.00 34.49  ? 315 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1 284 ? 268.067 87.491  -19.858 1.00 22.97  ? 315 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1 284 ? 268.704 87.298  -21.229 1.00 22.97  ? 315 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1 284 ? 268.014 88.155  -22.273 1.00 22.97  ? 315 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1 284 ? 270.168 87.628  -21.115 1.00 22.97  ? 315 LEU A CD2   1 
ATOM   2269 N  N     . LEU A 1 285 ? 266.530 87.054  -17.369 1.00 30.88  ? 316 LEU A N     1 
ATOM   2270 C  CA    . LEU A 1 285 ? 265.979 87.414  -16.070 1.00 30.88  ? 316 LEU A CA    1 
ATOM   2271 C  C     . LEU A 1 285 ? 266.311 86.391  -14.997 1.00 30.88  ? 316 LEU A C     1 
ATOM   2272 O  O     . LEU A 1 285 ? 266.849 86.741  -13.951 1.00 30.88  ? 316 LEU A O     1 
ATOM   2273 C  CB    . LEU A 1 285 ? 264.463 87.566  -16.163 1.00 36.39  ? 316 LEU A CB    1 
ATOM   2274 C  CG    . LEU A 1 285 ? 263.984 88.766  -16.988 1.00 36.39  ? 316 LEU A CG    1 
ATOM   2275 C  CD1   . LEU A 1 285 ? 262.485 88.674  -17.231 1.00 36.39  ? 316 LEU A CD1   1 
ATOM   2276 C  CD2   . LEU A 1 285 ? 264.354 90.052  -16.269 1.00 36.39  ? 316 LEU A CD2   1 
ATOM   2277 N  N     . LYS A 1 286 ? 265.990 85.127  -15.258 1.00 47.82  ? 317 LYS A N     1 
ATOM   2278 C  CA    . LYS A 1 286 ? 266.246 84.044  -14.308 1.00 47.82  ? 317 LYS A CA    1 
ATOM   2279 C  C     . LYS A 1 286 ? 267.686 83.991  -13.811 1.00 47.82  ? 317 LYS A C     1 
ATOM   2280 O  O     . LYS A 1 286 ? 267.936 83.620  -12.666 1.00 47.82  ? 317 LYS A O     1 
ATOM   2281 C  CB    . LYS A 1 286 ? 265.864 82.702  -14.924 1.00 23.25  ? 317 LYS A CB    1 
ATOM   2282 N  N     . ALA A 1 287 ? 268.634 84.364  -14.664 1.00 41.11  ? 318 ALA A N     1 
ATOM   2283 C  CA    . ALA A 1 287 ? 270.041 84.335  -14.281 1.00 41.11  ? 318 ALA A CA    1 
ATOM   2284 C  C     . ALA A 1 287 ? 270.346 85.531  -13.415 1.00 41.11  ? 318 ALA A C     1 
ATOM   2285 O  O     . ALA A 1 287 ? 271.221 85.492  -12.544 1.00 41.11  ? 318 ALA A O     1 
ATOM   2286 C  CB    . ALA A 1 287 ? 270.916 84.359  -15.506 1.00 36.49  ? 318 ALA A CB    1 
ATOM   2287 N  N     . GLU A 1 288 ? 269.607 86.600  -13.666 1.00 43.62  ? 319 GLU A N     1 
ATOM   2288 C  CA    . GLU A 1 288 ? 269.780 87.836  -12.930 1.00 43.62  ? 319 GLU A CA    1 
ATOM   2289 C  C     . GLU A 1 288 ? 269.032 87.745  -11.606 1.00 43.62  ? 319 GLU A C     1 
ATOM   2290 O  O     . GLU A 1 288 ? 269.410 88.376  -10.626 1.00 43.62  ? 319 GLU A O     1 
ATOM   2291 C  CB    . GLU A 1 288 ? 269.246 89.003  -13.765 1.00 63.68  ? 319 GLU A CB    1 
ATOM   2292 C  CG    . GLU A 1 288 ? 269.833 90.348  -13.418 1.00 63.68  ? 319 GLU A CG    1 
ATOM   2293 C  CD    . GLU A 1 288 ? 271.324 90.392  -13.660 1.00 63.68  ? 319 GLU A CD    1 
ATOM   2294 O  OE1   . GLU A 1 288 ? 272.053 90.987  -12.830 1.00 63.68  ? 319 GLU A OE1   1 
ATOM   2295 O  OE2   . GLU A 1 288 ? 271.768 89.824  -14.684 1.00 63.68  ? 319 GLU A OE2   1 
ATOM   2296 N  N     . HIS A 1 289 ? 267.979 86.941  -11.572 1.00 47.01  ? 320 HIS A N     1 
ATOM   2297 C  CA    . HIS A 1 289 ? 267.194 86.811  -10.354 1.00 47.01  ? 320 HIS A CA    1 
ATOM   2298 C  C     . HIS A 1 289 ? 266.851 85.377  -9.946  1.00 47.01  ? 320 HIS A C     1 
ATOM   2299 O  O     . HIS A 1 289 ? 265.686 84.980  -10.003 1.00 47.01  ? 320 HIS A O     1 
ATOM   2300 C  CB    . HIS A 1 289 ? 265.894 87.602  -10.492 1.00 53.56  ? 320 HIS A CB    1 
ATOM   2301 C  CG    . HIS A 1 289 ? 266.093 89.055  -10.790 1.00 53.56  ? 320 HIS A CG    1 
ATOM   2302 N  ND1   . HIS A 1 289 ? 266.365 89.526  -12.056 1.00 53.56  ? 320 HIS A ND1   1 
ATOM   2303 C  CD2   . HIS A 1 289 ? 266.063 90.141  -9.983  1.00 53.56  ? 320 HIS A CD2   1 
ATOM   2304 C  CE1   . HIS A 1 289 ? 266.491 90.840  -12.016 1.00 53.56  ? 320 HIS A CE1   1 
ATOM   2305 N  NE2   . HIS A 1 289 ? 266.313 91.238  -10.769 1.00 53.56  ? 320 HIS A NE2   1 
ATOM   2306 N  N     . PRO A 1 290 ? 267.848 84.590  -9.498  1.00 41.73  ? 321 PRO A N     1 
ATOM   2307 C  CA    . PRO A 1 290 ? 267.563 83.208  -9.094  1.00 41.73  ? 321 PRO A CA    1 
ATOM   2308 C  C     . PRO A 1 290 ? 266.417 83.121  -8.097  1.00 41.73  ? 321 PRO A C     1 
ATOM   2309 O  O     . PRO A 1 290 ? 265.468 82.372  -8.284  1.00 41.73  ? 321 PRO A O     1 
ATOM   2310 C  CB    . PRO A 1 290 ? 268.882 82.748  -8.487  1.00 41.17  ? 321 PRO A CB    1 
ATOM   2311 C  CG    . PRO A 1 290 ? 269.473 84.026  -7.958  1.00 41.17  ? 321 PRO A CG    1 
ATOM   2312 C  CD    . PRO A 1 290 ? 269.206 84.983  -9.085  1.00 41.17  ? 321 PRO A CD    1 
ATOM   2313 N  N     . THR A 1 291 ? 266.503 83.910  -7.041  1.00 32.82  ? 322 THR A N     1 
ATOM   2314 C  CA    . THR A 1 291 ? 265.487 83.916  -6.001  1.00 32.82  ? 322 THR A CA    1 
ATOM   2315 C  C     . THR A 1 291 ? 264.109 84.351  -6.467  1.00 32.82  ? 322 THR A C     1 
ATOM   2316 O  O     . THR A 1 291 ? 263.290 84.748  -5.650  1.00 32.82  ? 322 THR A O     1 
ATOM   2317 C  CB    . THR A 1 291 ? 265.885 84.858  -4.885  1.00 42.27  ? 322 THR A CB    1 
ATOM   2318 O  OG1   . THR A 1 291 ? 265.501 86.190  -5.246  1.00 42.27  ? 322 THR A OG1   1 
ATOM   2319 C  CG2   . THR A 1 291 ? 267.402 84.814  -4.675  1.00 42.27  ? 322 THR A CG2   1 
ATOM   2320 N  N     . TRP A 1 292 ? 263.849 84.286  -7.764  1.00 38.44  ? 323 TRP A N     1 
ATOM   2321 C  CA    . TRP A 1 292 ? 262.556 84.702  -8.299  1.00 38.44  ? 323 TRP A CA    1 
ATOM   2322 C  C     . TRP A 1 292 ? 261.619 83.529  -8.601  1.00 38.44  ? 323 TRP A C     1 
ATOM   2323 O  O     . TRP A 1 292 ? 262.067 82.440  -8.960  1.00 38.44  ? 323 TRP A O     1 
ATOM   2324 C  CB    . TRP A 1 292 ? 262.768 85.515  -9.579  1.00 48.68  ? 323 TRP A CB    1 
ATOM   2325 C  CG    . TRP A 1 292 ? 262.794 87.023  -9.431  1.00 48.68  ? 323 TRP A CG    1 
ATOM   2326 C  CD1   . TRP A 1 292 ? 262.995 87.749  -8.288  1.00 48.68  ? 323 TRP A CD1   1 
ATOM   2327 C  CD2   . TRP A 1 292 ? 262.693 87.975  -10.491 1.00 48.68  ? 323 TRP A CD2   1 
ATOM   2328 N  NE1   . TRP A 1 292 ? 263.027 89.091  -8.576  1.00 48.68  ? 323 TRP A NE1   1 
ATOM   2329 C  CE2   . TRP A 1 292 ? 262.847 89.254  -9.922  1.00 48.68  ? 323 TRP A CE2   1 
ATOM   2330 C  CE3   . TRP A 1 292 ? 262.491 87.869  -11.871 1.00 48.68  ? 323 TRP A CE3   1 
ATOM   2331 C  CZ2   . TRP A 1 292 ? 262.806 90.414  -10.684 1.00 48.68  ? 323 TRP A CZ2   1 
ATOM   2332 C  CZ3   . TRP A 1 292 ? 262.448 89.014  -12.626 1.00 48.68  ? 323 TRP A CZ3   1 
ATOM   2333 C  CH2   . TRP A 1 292 ? 262.606 90.275  -12.032 1.00 48.68  ? 323 TRP A CH2   1 
ATOM   2334 N  N     . GLY A 1 293 ? 260.315 83.769  -8.476  1.00 41.10  ? 324 GLY A N     1 
ATOM   2335 C  CA    . GLY A 1 293 ? 259.333 82.733  -8.748  1.00 41.10  ? 324 GLY A CA    1 
ATOM   2336 C  C     . GLY A 1 293 ? 259.026 82.560  -10.224 1.00 41.10  ? 324 GLY A C     1 
ATOM   2337 O  O     . GLY A 1 293 ? 259.821 82.923  -11.080 1.00 41.10  ? 324 GLY A O     1 
ATOM   2338 N  N     . ASP A 1 294 ? 257.869 81.992  -10.529 1.00 41.38  ? 325 ASP A N     1 
ATOM   2339 C  CA    . ASP A 1 294 ? 257.474 81.779  -11.912 1.00 41.38  ? 325 ASP A CA    1 
ATOM   2340 C  C     . ASP A 1 294 ? 256.660 82.960  -12.388 1.00 41.38  ? 325 ASP A C     1 
ATOM   2341 O  O     . ASP A 1 294 ? 256.937 83.520  -13.442 1.00 41.38  ? 325 ASP A O     1 
ATOM   2342 C  CB    . ASP A 1 294 ? 256.630 80.514  -12.037 1.00 61.63  ? 325 ASP A CB    1 
ATOM   2343 C  CG    . ASP A 1 294 ? 255.950 80.394  -13.397 1.00 61.63  ? 325 ASP A CG    1 
ATOM   2344 O  OD1   . ASP A 1 294 ? 256.640 80.031  -14.383 1.00 61.63  ? 325 ASP A OD1   1 
ATOM   2345 O  OD2   . ASP A 1 294 ? 254.726 80.671  -13.472 1.00 61.63  ? 325 ASP A OD2   1 
ATOM   2346 N  N     . GLU A 1 295 ? 255.636 83.315  -11.617 1.00 51.13  ? 326 GLU A N     1 
ATOM   2347 C  CA    . GLU A 1 295 ? 254.783 84.446  -11.950 1.00 51.13  ? 326 GLU A CA    1 
ATOM   2348 C  C     . GLU A 1 295 ? 255.624 85.662  -12.329 1.00 51.13  ? 326 GLU A C     1 
ATOM   2349 O  O     . GLU A 1 295 ? 255.403 86.279  -13.376 1.00 51.13  ? 326 GLU A O     1 
ATOM   2350 C  CB    . GLU A 1 295 ? 253.888 84.819  -10.771 1.00 37.21  ? 326 GLU A CB    1 
ATOM   2351 C  CG    . GLU A 1 295 ? 252.518 84.201  -10.815 1.00 37.21  ? 326 GLU A CG    1 
ATOM   2352 C  CD    . GLU A 1 295 ? 251.797 84.477  -12.112 1.00 37.21  ? 326 GLU A CD    1 
ATOM   2353 O  OE1   . GLU A 1 295 ? 252.365 84.145  -13.166 1.00 37.21  ? 326 GLU A OE1   1 
ATOM   2354 O  OE2   . GLU A 1 295 ? 250.667 85.015  -12.084 1.00 37.21  ? 326 GLU A OE2   1 
ATOM   2355 N  N     . GLN A 1 296 ? 256.581 86.012  -11.474 1.00 45.51  ? 327 GLN A N     1 
ATOM   2356 C  CA    . GLN A 1 296 ? 257.430 87.152  -11.758 1.00 45.51  ? 327 GLN A CA    1 
ATOM   2357 C  C     . GLN A 1 296 ? 258.071 86.934  -13.122 1.00 45.51  ? 327 GLN A C     1 
ATOM   2358 O  O     . GLN A 1 296 ? 257.698 87.589  -14.098 1.00 45.51  ? 327 GLN A O     1 
ATOM   2359 C  CB    . GLN A 1 296 ? 258.504 87.312  -10.682 1.00 45.02  ? 327 GLN A CB    1 
ATOM   2360 C  CG    . GLN A 1 296 ? 259.421 88.507  -10.904 1.00 45.02  ? 327 GLN A CG    1 
ATOM   2361 C  CD    . GLN A 1 296 ? 259.738 89.237  -9.615  1.00 45.02  ? 327 GLN A CD    1 
ATOM   2362 O  OE1   . GLN A 1 296 ? 260.155 88.626  -8.635  1.00 45.02  ? 327 GLN A OE1   1 
ATOM   2363 N  NE2   . GLN A 1 296 ? 259.550 90.552  -9.613  1.00 45.02  ? 327 GLN A NE2   1 
ATOM   2364 N  N     . LEU A 1 297 ? 259.014 86.002  -13.195 1.00 37.99  ? 328 LEU A N     1 
ATOM   2365 C  CA    . LEU A 1 297 ? 259.681 85.711  -14.453 1.00 37.99  ? 328 LEU A CA    1 
ATOM   2366 C  C     . LEU A 1 297 ? 258.748 85.895  -15.641 1.00 37.99  ? 328 LEU A C     1 
ATOM   2367 O  O     . LEU A 1 297 ? 259.112 86.498  -16.643 1.00 37.99  ? 328 LEU A O     1 
ATOM   2368 C  CB    . LEU A 1 297 ? 260.220 84.286  -14.457 1.00 31.50  ? 328 LEU A CB    1 
ATOM   2369 C  CG    . LEU A 1 297 ? 261.412 83.997  -13.558 1.00 31.50  ? 328 LEU A CG    1 
ATOM   2370 C  CD1   . LEU A 1 297 ? 262.119 82.784  -14.082 1.00 31.50  ? 328 LEU A CD1   1 
ATOM   2371 C  CD2   . LEU A 1 297 ? 262.370 85.147  -13.589 1.00 31.50  ? 328 LEU A CD2   1 
ATOM   2372 N  N     . PHE A 1 298 ? 257.536 85.378  -15.531 1.00 39.34  ? 329 PHE A N     1 
ATOM   2373 C  CA    . PHE A 1 298 ? 256.593 85.517  -16.620 1.00 39.34  ? 329 PHE A CA    1 
ATOM   2374 C  C     . PHE A 1 298 ? 256.249 86.983  -16.832 1.00 39.34  ? 329 PHE A C     1 
ATOM   2375 O  O     . PHE A 1 298 ? 256.657 87.574  -17.823 1.00 39.34  ? 329 PHE A O     1 
ATOM   2376 C  CB    . PHE A 1 298 ? 255.318 84.720  -16.341 1.00 36.37  ? 329 PHE A CB    1 
ATOM   2377 C  CG    . PHE A 1 298 ? 254.288 84.856  -17.414 1.00 36.37  ? 329 PHE A CG    1 
ATOM   2378 C  CD1   . PHE A 1 298 ? 254.550 84.400  -18.701 1.00 36.37  ? 329 PHE A CD1   1 
ATOM   2379 C  CD2   . PHE A 1 298 ? 253.071 85.474  -17.152 1.00 36.37  ? 329 PHE A CD2   1 
ATOM   2380 C  CE1   . PHE A 1 298 ? 253.614 84.561  -19.711 1.00 36.37  ? 329 PHE A CE1   1 
ATOM   2381 C  CE2   . PHE A 1 298 ? 252.128 85.638  -18.153 1.00 36.37  ? 329 PHE A CE2   1 
ATOM   2382 C  CZ    . PHE A 1 298 ? 252.398 85.183  -19.435 1.00 36.37  ? 329 PHE A CZ    1 
ATOM   2383 N  N     . GLN A 1 299 ? 255.506 87.567  -15.898 1.00 36.22  ? 330 GLN A N     1 
ATOM   2384 C  CA    . GLN A 1 299 ? 255.097 88.973  -15.986 1.00 36.22  ? 330 GLN A CA    1 
ATOM   2385 C  C     . GLN A 1 299 ? 256.200 89.952  -16.408 1.00 36.22  ? 330 GLN A C     1 
ATOM   2386 O  O     . GLN A 1 299 ? 255.958 90.826  -17.241 1.00 36.22  ? 330 GLN A O     1 
ATOM   2387 C  CB    . GLN A 1 299 ? 254.534 89.432  -14.646 1.00 53.18  ? 330 GLN A CB    1 
ATOM   2388 C  CG    . GLN A 1 299 ? 253.397 88.587  -14.121 1.00 53.18  ? 330 GLN A CG    1 
ATOM   2389 C  CD    . GLN A 1 299 ? 252.199 88.659  -15.013 1.00 53.18  ? 330 GLN A CD    1 
ATOM   2390 O  OE1   . GLN A 1 299 ? 252.133 89.520  -15.892 1.00 53.18  ? 330 GLN A OE1   1 
ATOM   2391 N  NE2   . GLN A 1 299 ? 251.231 87.767  -14.794 1.00 53.18  ? 330 GLN A NE2   1 
ATOM   2392 N  N     . THR A 1 300 ? 257.393 89.817  -15.829 1.00 36.95  ? 331 THR A N     1 
ATOM   2393 C  CA    . THR A 1 300 ? 258.491 90.715  -16.160 1.00 36.95  ? 331 THR A CA    1 
ATOM   2394 C  C     . THR A 1 300 ? 258.876 90.581  -17.608 1.00 36.95  ? 331 THR A C     1 
ATOM   2395 O  O     . THR A 1 300 ? 259.055 91.571  -18.303 1.00 36.95  ? 331 THR A O     1 
ATOM   2396 C  CB    . THR A 1 300 ? 259.750 90.443  -15.350 1.00 36.75  ? 331 THR A CB    1 
ATOM   2397 O  OG1   . THR A 1 300 ? 259.426 90.352  -13.964 1.00 36.75  ? 331 THR A OG1   1 
ATOM   2398 C  CG2   . THR A 1 300 ? 260.732 91.580  -15.530 1.00 36.75  ? 331 THR A CG2   1 
ATOM   2399 N  N     . ALA A 1 301 ? 259.026 89.350  -18.066 1.00 47.06  ? 332 ALA A N     1 
ATOM   2400 C  CA    . ALA A 1 301 ? 259.390 89.125  -19.454 1.00 47.06  ? 332 ALA A CA    1 
ATOM   2401 C  C     . ALA A 1 301 ? 258.305 89.683  -20.367 1.00 47.06  ? 332 ALA A C     1 
ATOM   2402 O  O     . ALA A 1 301 ? 258.607 90.227  -21.422 1.00 47.06  ? 332 ALA A O     1 
ATOM   2403 C  CB    . ALA A 1 301 ? 259.576 87.651  -19.714 1.00 22.68  ? 332 ALA A CB    1 
ATOM   2404 N  N     . ARG A 1 302 ? 257.043 89.560  -19.969 1.00 24.13  ? 333 ARG A N     1 
ATOM   2405 C  CA    . ARG A 1 302 ? 255.965 90.063  -20.801 1.00 24.13  ? 333 ARG A CA    1 
ATOM   2406 C  C     . ARG A 1 302 ? 256.157 91.543  -21.061 1.00 24.13  ? 333 ARG A C     1 
ATOM   2407 O  O     . ARG A 1 302 ? 256.239 91.976  -22.205 1.00 24.13  ? 333 ARG A O     1 
ATOM   2408 C  CB    . ARG A 1 302 ? 254.616 89.838  -20.134 1.00 32.68  ? 333 ARG A CB    1 
ATOM   2409 C  CG    . ARG A 1 302 ? 253.457 90.278  -20.995 1.00 32.68  ? 333 ARG A CG    1 
ATOM   2410 C  CD    . ARG A 1 302 ? 252.129 89.952  -20.380 1.00 32.68  ? 333 ARG A CD    1 
ATOM   2411 N  NE    . ARG A 1 302 ? 251.060 90.283  -21.309 1.00 32.68  ? 333 ARG A NE    1 
ATOM   2412 C  CZ    . ARG A 1 302 ? 249.819 89.836  -21.199 1.00 32.68  ? 333 ARG A CZ    1 
ATOM   2413 N  NH1   . ARG A 1 302 ? 249.495 89.040  -20.192 1.00 32.68  ? 333 ARG A NH1   1 
ATOM   2414 N  NH2   . ARG A 1 302 ? 248.913 90.173  -22.100 1.00 32.68  ? 333 ARG A NH2   1 
ATOM   2415 N  N     . LEU A 1 303 ? 256.217 92.316  -19.986 1.00 33.21  ? 334 LEU A N     1 
ATOM   2416 C  CA    . LEU A 1 303 ? 256.425 93.751  -20.077 1.00 33.21  ? 334 LEU A CA    1 
ATOM   2417 C  C     . LEU A 1 303 ? 257.646 94.084  -20.950 1.00 33.21  ? 334 LEU A C     1 
ATOM   2418 O  O     . LEU A 1 303 ? 257.610 95.025  -21.731 1.00 33.21  ? 334 LEU A O     1 
ATOM   2419 C  CB    . LEU A 1 303 ? 256.596 94.314  -18.677 1.00 20.91  ? 334 LEU A CB    1 
ATOM   2420 C  CG    . LEU A 1 303 ? 255.348 94.179  -17.819 1.00 20.91  ? 334 LEU A CG    1 
ATOM   2421 C  CD1   . LEU A 1 303 ? 255.675 94.440  -16.375 1.00 20.91  ? 334 LEU A CD1   1 
ATOM   2422 C  CD2   . LEU A 1 303 ? 254.317 95.153  -18.306 1.00 20.91  ? 334 LEU A CD2   1 
ATOM   2423 N  N     . ILE A 1 304 ? 258.723 93.317  -20.820 1.00 29.80  ? 335 ILE A N     1 
ATOM   2424 C  CA    . ILE A 1 304 ? 259.914 93.543  -21.636 1.00 29.80  ? 335 ILE A CA    1 
ATOM   2425 C  C     . ILE A 1 304 ? 259.589 93.371  -23.125 1.00 29.80  ? 335 ILE A C     1 
ATOM   2426 O  O     . ILE A 1 304 ? 260.324 93.832  -23.992 1.00 29.80  ? 335 ILE A O     1 
ATOM   2427 C  CB    . ILE A 1 304 ? 261.045 92.551  -21.272 1.00 17.49  ? 335 ILE A CB    1 
ATOM   2428 C  CG1   . ILE A 1 304 ? 261.583 92.870  -19.886 1.00 17.49  ? 335 ILE A CG1   1 
ATOM   2429 C  CG2   . ILE A 1 304 ? 262.151 92.596  -22.318 1.00 17.49  ? 335 ILE A CG2   1 
ATOM   2430 C  CD1   . ILE A 1 304 ? 262.709 91.980  -19.458 1.00 17.49  ? 335 ILE A CD1   1 
ATOM   2431 N  N     . LEU A 1 305 ? 258.496 92.690  -23.427 1.00 37.44  ? 336 LEU A N     1 
ATOM   2432 C  CA    . LEU A 1 305 ? 258.131 92.492  -24.817 1.00 37.44  ? 336 LEU A CA    1 
ATOM   2433 C  C     . LEU A 1 305 ? 257.151 93.573  -25.227 1.00 37.44  ? 336 LEU A C     1 
ATOM   2434 O  O     . LEU A 1 305 ? 257.074 93.951  -26.394 1.00 37.44  ? 336 LEU A O     1 
ATOM   2435 C  CB    . LEU A 1 305 ? 257.514 91.103  -25.030 1.00 47.06  ? 336 LEU A CB    1 
ATOM   2436 C  CG    . LEU A 1 305 ? 258.418 89.881  -24.828 1.00 47.06  ? 336 LEU A CG    1 
ATOM   2437 C  CD1   . LEU A 1 305 ? 257.729 88.664  -25.396 1.00 47.06  ? 336 LEU A CD1   1 
ATOM   2438 C  CD2   . LEU A 1 305 ? 259.745 90.074  -25.530 1.00 47.06  ? 336 LEU A CD2   1 
ATOM   2439 N  N     . ILE A 1 306 ? 256.394 94.072  -24.262 1.00 38.20  ? 337 ILE A N     1 
ATOM   2440 C  CA    . ILE A 1 306 ? 255.450 95.129  -24.553 1.00 38.20  ? 337 ILE A CA    1 
ATOM   2441 C  C     . ILE A 1 306 ? 256.306 96.351  -24.827 1.00 38.20  ? 337 ILE A C     1 
ATOM   2442 O  O     . ILE A 1 306 ? 255.897 97.273  -25.521 1.00 38.20  ? 337 ILE A O     1 
ATOM   2443 C  CB    . ILE A 1 306 ? 254.540 95.383  -23.368 1.00 34.24  ? 337 ILE A CB    1 
ATOM   2444 C  CG1   . ILE A 1 306 ? 253.892 94.068  -22.946 1.00 34.24  ? 337 ILE A CG1   1 
ATOM   2445 C  CG2   . ILE A 1 306 ? 253.495 96.406  -23.735 1.00 34.24  ? 337 ILE A CG2   1 
ATOM   2446 C  CD1   . ILE A 1 306 ? 253.108 94.150  -21.667 1.00 34.24  ? 337 ILE A CD1   1 
ATOM   2447 N  N     . GLY A 1 307 ? 257.512 96.338  -24.276 1.00 35.62  ? 338 GLY A N     1 
ATOM   2448 C  CA    . GLY A 1 307 ? 258.433 97.432  -24.499 1.00 35.62  ? 338 GLY A CA    1 
ATOM   2449 C  C     . GLY A 1 307 ? 259.027 97.228  -25.873 1.00 35.62  ? 338 GLY A C     1 
ATOM   2450 O  O     . GLY A 1 307 ? 258.788 98.020  -26.770 1.00 35.62  ? 338 GLY A O     1 
ATOM   2451 N  N     . GLU A 1 308 ? 259.788 96.150  -26.042 1.00 32.42  ? 339 GLU A N     1 
ATOM   2452 C  CA    . GLU A 1 308 ? 260.399 95.838  -27.325 1.00 32.42  ? 339 GLU A CA    1 
ATOM   2453 C  C     . GLU A 1 308 ? 259.447 96.080  -28.498 1.00 32.42  ? 339 GLU A C     1 
ATOM   2454 O  O     . GLU A 1 308 ? 259.841 96.629  -29.525 1.00 32.42  ? 339 GLU A O     1 
ATOM   2455 C  CB    . GLU A 1 308 ? 260.865 94.381  -27.348 1.00 44.21  ? 339 GLU A CB    1 
ATOM   2456 C  CG    . GLU A 1 308 ? 262.080 94.103  -26.483 1.00 44.21  ? 339 GLU A CG    1 
ATOM   2457 C  CD    . GLU A 1 308 ? 262.787 92.809  -26.854 1.00 44.21  ? 339 GLU A CD    1 
ATOM   2458 O  OE1   . GLU A 1 308 ? 263.998 92.844  -27.173 1.00 44.21  ? 339 GLU A OE1   1 
ATOM   2459 O  OE2   . GLU A 1 308 ? 262.129 91.752  -26.830 1.00 44.21  ? 339 GLU A OE2   1 
ATOM   2460 N  N     . THR A 1 309 ? 258.196 95.667  -28.352 1.00 31.13  ? 340 THR A N     1 
ATOM   2461 C  CA    . THR A 1 309 ? 257.222 95.849  -29.417 1.00 31.13  ? 340 THR A CA    1 
ATOM   2462 C  C     . THR A 1 309 ? 256.920 97.324  -29.657 1.00 31.13  ? 340 THR A C     1 
ATOM   2463 O  O     . THR A 1 309 ? 256.972 97.799  -30.794 1.00 31.13  ? 340 THR A O     1 
ATOM   2464 C  CB    . THR A 1 309 ? 255.907 95.101  -29.103 1.00 33.46  ? 340 THR A CB    1 
ATOM   2465 O  OG1   . THR A 1 309 ? 256.128 93.693  -29.220 1.00 33.46  ? 340 THR A OG1   1 
ATOM   2466 C  CG2   . THR A 1 309 ? 254.800 95.516  -30.064 1.00 33.46  ? 340 THR A CG2   1 
ATOM   2467 N  N     . ILE A 1 310 ? 256.603 98.050  -28.590 1.00 37.47  ? 341 ILE A N     1 
ATOM   2468 C  CA    . ILE A 1 310 ? 256.295 99.468  -28.720 1.00 37.47  ? 341 ILE A CA    1 
ATOM   2469 C  C     . ILE A 1 310 ? 257.470 100.245 -29.310 1.00 37.47  ? 341 ILE A C     1 
ATOM   2470 O  O     . ILE A 1 310 ? 257.278 101.300 -29.913 1.00 37.47  ? 341 ILE A O     1 
ATOM   2471 C  CB    . ILE A 1 310 ? 255.916 100.085 -27.364 1.00 33.39  ? 341 ILE A CB    1 
ATOM   2472 C  CG1   . ILE A 1 310 ? 254.602 99.480  -26.878 1.00 33.39  ? 341 ILE A CG1   1 
ATOM   2473 C  CG2   . ILE A 1 310 ? 255.800 101.588 -27.486 1.00 33.39  ? 341 ILE A CG2   1 
ATOM   2474 C  CD1   . ILE A 1 310 ? 254.063 100.118 -25.614 1.00 33.39  ? 341 ILE A CD1   1 
ATOM   2475 N  N     . LYS A 1 311 ? 258.681 99.722  -29.141 1.00 34.31  ? 342 LYS A N     1 
ATOM   2476 C  CA    . LYS A 1 311 ? 259.855 100.390 -29.672 1.00 34.31  ? 342 LYS A CA    1 
ATOM   2477 C  C     . LYS A 1 311 ? 260.009 100.099 -31.142 1.00 34.31  ? 342 LYS A C     1 
ATOM   2478 O  O     . LYS A 1 311 ? 260.076 101.018 -31.944 1.00 34.31  ? 342 LYS A O     1 
ATOM   2479 C  CB    . LYS A 1 311 ? 261.123 99.963  -28.952 1.00 43.84  ? 342 LYS A CB    1 
ATOM   2480 C  CG    . LYS A 1 311 ? 262.303 100.826 -29.346 1.00 43.84  ? 342 LYS A CG    1 
ATOM   2481 C  CD    . LYS A 1 311 ? 263.599 100.327 -28.760 1.00 43.84  ? 342 LYS A CD    1 
ATOM   2482 C  CE    . LYS A 1 311 ? 264.791 100.999 -29.426 1.00 43.84  ? 342 LYS A CE    1 
ATOM   2483 N  NZ    . LYS A 1 311 ? 264.768 102.469 -29.232 1.00 43.84  ? 342 LYS A NZ    1 
ATOM   2484 N  N     . ILE A 1 312 ? 260.069 98.824  -31.505 1.00 19.71  ? 343 ILE A N     1 
ATOM   2485 C  CA    . ILE A 1 312 ? 260.209 98.471  -32.911 1.00 19.71  ? 343 ILE A CA    1 
ATOM   2486 C  C     . ILE A 1 312 ? 259.090 99.082  -33.735 1.00 19.71  ? 343 ILE A C     1 
ATOM   2487 O  O     . ILE A 1 312 ? 259.313 99.583  -34.828 1.00 19.71  ? 343 ILE A O     1 
ATOM   2488 C  CB    . ILE A 1 312 ? 260.205 96.955  -33.107 1.00 32.87  ? 343 ILE A CB    1 
ATOM   2489 C  CG1   . ILE A 1 312 ? 261.366 96.347  -32.319 1.00 32.87  ? 343 ILE A CG1   1 
ATOM   2490 C  CG2   . ILE A 1 312 ? 260.332 96.621  -34.583 1.00 32.87  ? 343 ILE A CG2   1 
ATOM   2491 C  CD1   . ILE A 1 312 ? 261.510 94.859  -32.452 1.00 32.87  ? 343 ILE A CD1   1 
ATOM   2492 N  N     . VAL A 1 313 ? 257.881 99.050  -33.204 1.00 31.76  ? 344 VAL A N     1 
ATOM   2493 C  CA    . VAL A 1 313 ? 256.763 99.622  -33.923 1.00 31.76  ? 344 VAL A CA    1 
ATOM   2494 C  C     . VAL A 1 313 ? 257.040 101.075 -34.276 1.00 31.76  ? 344 VAL A C     1 
ATOM   2495 O  O     . VAL A 1 313 ? 256.830 101.482 -35.410 1.00 31.76  ? 344 VAL A O     1 
ATOM   2496 C  CB    . VAL A 1 313 ? 255.460 99.523  -33.099 1.00 41.46  ? 344 VAL A CB    1 
ATOM   2497 C  CG1   . VAL A 1 313 ? 254.347 100.315 -33.752 1.00 41.46  ? 344 VAL A CG1   1 
ATOM   2498 C  CG2   . VAL A 1 313 ? 255.052 98.078  -32.989 1.00 41.46  ? 344 VAL A CG2   1 
ATOM   2499 N  N     . ILE A 1 314 ? 257.529 101.855 -33.317 1.00 32.28  ? 345 ILE A N     1 
ATOM   2500 C  CA    . ILE A 1 314 ? 257.809 103.269 -33.560 1.00 32.28  ? 345 ILE A CA    1 
ATOM   2501 C  C     . ILE A 1 314 ? 259.083 103.585 -34.347 1.00 32.28  ? 345 ILE A C     1 
ATOM   2502 O  O     . ILE A 1 314 ? 259.009 104.142 -35.430 1.00 32.28  ? 345 ILE A O     1 
ATOM   2503 C  CB    . ILE A 1 314 ? 257.852 104.067 -32.237 1.00 19.50  ? 345 ILE A CB    1 
ATOM   2504 C  CG1   . ILE A 1 314 ? 256.436 104.331 -31.731 1.00 19.50  ? 345 ILE A CG1   1 
ATOM   2505 C  CG2   . ILE A 1 314 ? 258.574 105.382 -32.442 1.00 19.50  ? 345 ILE A CG2   1 
ATOM   2506 C  CD1   . ILE A 1 314 ? 256.393 105.084 -30.419 1.00 19.50  ? 345 ILE A CD1   1 
ATOM   2507 N  N     . GLU A 1 315 ? 260.249 103.239 -33.817 1.00 30.03  ? 346 GLU A N     1 
ATOM   2508 C  CA    . GLU A 1 315 ? 261.488 103.559 -34.510 1.00 30.03  ? 346 GLU A CA    1 
ATOM   2509 C  C     . GLU A 1 315 ? 261.766 102.821 -35.810 1.00 30.03  ? 346 GLU A C     1 
ATOM   2510 O  O     . GLU A 1 315 ? 262.767 103.098 -36.466 1.00 30.03  ? 346 GLU A O     1 
ATOM   2511 C  CB    . GLU A 1 315 ? 262.679 103.393 -33.565 1.00 40.62  ? 346 GLU A CB    1 
ATOM   2512 C  CG    . GLU A 1 315 ? 262.632 104.351 -32.380 1.00 40.62  ? 346 GLU A CG    1 
ATOM   2513 C  CD    . GLU A 1 315 ? 263.966 104.511 -31.660 1.00 40.62  ? 346 GLU A CD    1 
ATOM   2514 O  OE1   . GLU A 1 315 ? 265.013 104.080 -32.196 1.00 40.62  ? 346 GLU A OE1   1 
ATOM   2515 O  OE2   . GLU A 1 315 ? 263.959 105.080 -30.549 1.00 40.62  ? 346 GLU A OE2   1 
ATOM   2516 N  N     . GLU A 1 316 ? 260.893 101.892 -36.196 1.00 41.19  ? 347 GLU A N     1 
ATOM   2517 C  CA    . GLU A 1 316 ? 261.095 101.145 -37.441 1.00 41.19  ? 347 GLU A CA    1 
ATOM   2518 C  C     . GLU A 1 316 ? 259.845 100.956 -38.290 1.00 41.19  ? 347 GLU A C     1 
ATOM   2519 O  O     . GLU A 1 316 ? 259.880 101.177 -39.499 1.00 41.19  ? 347 GLU A O     1 
ATOM   2520 C  CB    . GLU A 1 316 ? 261.722 99.783  -37.155 1.00 28.88  ? 347 GLU A CB    1 
ATOM   2521 C  CG    . GLU A 1 316 ? 263.178 99.861  -36.783 1.00 28.88  ? 347 GLU A CG    1 
ATOM   2522 C  CD    . GLU A 1 316 ? 263.789 98.508  -36.537 1.00 28.88  ? 347 GLU A CD    1 
ATOM   2523 O  OE1   . GLU A 1 316 ? 263.747 98.038  -35.383 1.00 28.88  ? 347 GLU A OE1   1 
ATOM   2524 O  OE2   . GLU A 1 316 ? 264.312 97.917  -37.498 1.00 28.88  ? 347 GLU A OE2   1 
ATOM   2525 N  N     . TYR A 1 317 ? 258.745 100.551 -37.665 1.00 30.17  ? 348 TYR A N     1 
ATOM   2526 C  CA    . TYR A 1 317 ? 257.491 100.331 -38.379 1.00 30.17  ? 348 TYR A CA    1 
ATOM   2527 C  C     . TYR A 1 317 ? 256.918 101.655 -38.868 1.00 30.17  ? 348 TYR A C     1 
ATOM   2528 O  O     . TYR A 1 317 ? 256.716 101.849 -40.067 1.00 30.17  ? 348 TYR A O     1 
ATOM   2529 C  CB    . TYR A 1 317 ? 256.496 99.640  -37.452 1.00 43.81  ? 348 TYR A CB    1 
ATOM   2530 C  CG    . TYR A 1 317 ? 255.145 99.313  -38.041 1.00 43.81  ? 348 TYR A CG    1 
ATOM   2531 C  CD1   . TYR A 1 317 ? 254.884 98.060  -38.586 1.00 43.81  ? 348 TYR A CD1   1 
ATOM   2532 C  CD2   . TYR A 1 317 ? 254.091 100.220 -37.946 1.00 43.81  ? 348 TYR A CD2   1 
ATOM   2533 C  CE1   . TYR A 1 317 ? 253.596 97.708  -39.006 1.00 43.81  ? 348 TYR A CE1   1 
ATOM   2534 C  CE2   . TYR A 1 317 ? 252.803 99.884  -38.363 1.00 43.81  ? 348 TYR A CE2   1 
ATOM   2535 C  CZ    . TYR A 1 317 ? 252.557 98.624  -38.886 1.00 43.81  ? 348 TYR A CZ    1 
ATOM   2536 O  OH    . TYR A 1 317 ? 251.271 98.277  -39.247 1.00 43.81  ? 348 TYR A OH    1 
ATOM   2537 N  N     . VAL A 1 318 ? 256.659 102.566 -37.934 1.00 39.31  ? 349 VAL A N     1 
ATOM   2538 C  CA    . VAL A 1 318 ? 256.114 103.873 -38.278 1.00 39.31  ? 349 VAL A CA    1 
ATOM   2539 C  C     . VAL A 1 318 ? 257.114 104.668 -39.118 1.00 39.31  ? 349 VAL A C     1 
ATOM   2540 O  O     . VAL A 1 318 ? 256.729 105.511 -39.919 1.00 39.31  ? 349 VAL A O     1 
ATOM   2541 C  CB    . VAL A 1 318 ? 255.747 104.669 -37.020 1.00 20.43  ? 349 VAL A CB    1 
ATOM   2542 C  CG1   . VAL A 1 318 ? 255.097 105.961 -37.399 1.00 20.43  ? 349 VAL A CG1   1 
ATOM   2543 C  CG2   . VAL A 1 318 ? 254.801 103.869 -36.174 1.00 20.43  ? 349 VAL A CG2   1 
ATOM   2544 N  N     . GLN A 1 319 ? 258.400 104.385 -38.946 1.00 42.46  ? 350 GLN A N     1 
ATOM   2545 C  CA    . GLN A 1 319 ? 259.442 105.066 -39.705 1.00 42.46  ? 350 GLN A CA    1 
ATOM   2546 C  C     . GLN A 1 319 ? 259.220 104.788 -41.186 1.00 42.46  ? 350 GLN A C     1 
ATOM   2547 O  O     . GLN A 1 319 ? 258.824 105.668 -41.940 1.00 42.46  ? 350 GLN A O     1 
ATOM   2548 C  CB    . GLN A 1 319 ? 260.822 104.550 -39.287 1.00 44.50  ? 350 GLN A CB    1 
ATOM   2549 C  CG    . GLN A 1 319 ? 261.983 105.381 -39.803 1.00 44.50  ? 350 GLN A CG    1 
ATOM   2550 C  CD    . GLN A 1 319 ? 262.052 106.753 -39.157 1.00 44.50  ? 350 GLN A CD    1 
ATOM   2551 O  OE1   . GLN A 1 319 ? 262.470 106.894 -38.006 1.00 44.50  ? 350 GLN A OE1   1 
ATOM   2552 N  NE2   . GLN A 1 319 ? 261.630 107.773 -39.895 1.00 44.50  ? 350 GLN A NE2   1 
ATOM   2553 N  N     . GLN A 1 320 ? 259.481 103.551 -41.589 1.00 30.53  ? 351 GLN A N     1 
ATOM   2554 C  CA    . GLN A 1 320 ? 259.313 103.109 -42.968 1.00 30.53  ? 351 GLN A CA    1 
ATOM   2555 C  C     . GLN A 1 320 ? 258.059 103.709 -43.572 1.00 30.53  ? 351 GLN A C     1 
ATOM   2556 O  O     . GLN A 1 320 ? 258.071 104.300 -44.647 1.00 30.53  ? 351 GLN A O     1 
ATOM   2557 C  CB    . GLN A 1 320 ? 259.210 101.590 -42.983 1.00 31.83  ? 351 GLN A CB    1 
ATOM   2558 C  CG    . GLN A 1 320 ? 258.785 100.999 -44.287 1.00 31.83  ? 351 GLN A CG    1 
ATOM   2559 C  CD    . GLN A 1 320 ? 259.644 101.465 -45.420 1.00 31.83  ? 351 GLN A CD    1 
ATOM   2560 O  OE1   . GLN A 1 320 ? 260.801 101.829 -45.223 1.00 31.83  ? 351 GLN A OE1   1 
ATOM   2561 N  NE2   . GLN A 1 320 ? 259.093 101.446 -46.629 1.00 31.83  ? 351 GLN A NE2   1 
ATOM   2562 N  N     . LEU A 1 321 ? 256.974 103.554 -42.840 1.00 31.34  ? 352 LEU A N     1 
ATOM   2563 C  CA    . LEU A 1 321 ? 255.683 104.037 -43.265 1.00 31.34  ? 352 LEU A CA    1 
ATOM   2564 C  C     . LEU A 1 321 ? 255.676 105.520 -43.622 1.00 31.34  ? 352 LEU A C     1 
ATOM   2565 O  O     . LEU A 1 321 ? 255.317 105.901 -44.736 1.00 31.34  ? 352 LEU A O     1 
ATOM   2566 C  CB    . LEU A 1 321 ? 254.677 103.770 -42.151 1.00 54.55  ? 352 LEU A CB    1 
ATOM   2567 C  CG    . LEU A 1 321 ? 253.341 103.129 -42.507 1.00 54.55  ? 352 LEU A CG    1 
ATOM   2568 C  CD1   . LEU A 1 321 ? 253.571 101.759 -43.120 1.00 54.55  ? 352 LEU A CD1   1 
ATOM   2569 C  CD2   . LEU A 1 321 ? 252.498 103.032 -41.250 1.00 54.55  ? 352 LEU A CD2   1 
ATOM   2570 N  N     . SER A 1 322 ? 256.071 106.347 -42.659 1.00 39.07  ? 353 SER A N     1 
ATOM   2571 C  CA    . SER A 1 322 ? 256.097 107.801 -42.809 1.00 39.07  ? 353 SER A CA    1 
ATOM   2572 C  C     . SER A 1 322 ? 256.828 108.324 -44.037 1.00 39.07  ? 353 SER A C     1 
ATOM   2573 O  O     . SER A 1 322 ? 256.264 109.078 -44.832 1.00 39.07  ? 353 SER A O     1 
ATOM   2574 C  CB    . SER A 1 322 ? 256.732 108.437 -41.580 1.00 48.58  ? 353 SER A CB    1 
ATOM   2575 O  OG    . SER A 1 322 ? 258.145 108.335 -41.644 1.00 48.58  ? 353 SER A OG    1 
ATOM   2576 N  N     . GLY A 1 323 ? 258.090 107.931 -44.176 1.00 40.48  ? 354 GLY A N     1 
ATOM   2577 C  CA    . GLY A 1 323 ? 258.890 108.386 -45.292 1.00 40.48  ? 354 GLY A CA    1 
ATOM   2578 C  C     . GLY A 1 323 ? 259.673 109.597 -44.832 1.00 40.48  ? 354 GLY A C     1 
ATOM   2579 O  O     . GLY A 1 323 ? 260.415 110.219 -45.601 1.00 40.48  ? 354 GLY A O     1 
ATOM   2580 N  N     . TYR A 1 324 ? 259.500 109.926 -43.557 1.00 41.45  ? 355 TYR A N     1 
ATOM   2581 C  CA    . TYR A 1 324 ? 260.175 111.064 -42.947 1.00 41.45  ? 355 TYR A CA    1 
ATOM   2582 C  C     . TYR A 1 324 ? 261.694 110.938 -42.947 1.00 41.45  ? 355 TYR A C     1 
ATOM   2583 O  O     . TYR A 1 324 ? 262.250 109.847 -43.081 1.00 41.45  ? 355 TYR A O     1 
ATOM   2584 C  CB    . TYR A 1 324 ? 259.713 111.241 -41.502 1.00 33.29  ? 355 TYR A CB    1 
ATOM   2585 C  CG    . TYR A 1 324 ? 258.271 111.616 -41.341 1.00 33.29  ? 355 TYR A CG    1 
ATOM   2586 C  CD1   . TYR A 1 324 ? 257.690 111.656 -40.082 1.00 33.29  ? 355 TYR A CD1   1 
ATOM   2587 C  CD2   . TYR A 1 324 ? 257.484 111.940 -42.434 1.00 33.29  ? 355 TYR A CD2   1 
ATOM   2588 C  CE1   . TYR A 1 324 ? 256.359 112.012 -39.910 1.00 33.29  ? 355 TYR A CE1   1 
ATOM   2589 C  CE2   . TYR A 1 324 ? 256.147 112.299 -42.274 1.00 33.29  ? 355 TYR A CE2   1 
ATOM   2590 C  CZ    . TYR A 1 324 ? 255.595 112.335 -41.008 1.00 33.29  ? 355 TYR A CZ    1 
ATOM   2591 O  OH    . TYR A 1 324 ? 254.290 112.720 -40.834 1.00 33.29  ? 355 TYR A OH    1 
ATOM   2592 N  N     . PHE A 1 325 ? 262.351 112.085 -42.805 1.00 47.06  ? 356 PHE A N     1 
ATOM   2593 C  CA    . PHE A 1 325 ? 263.805 112.167 -42.726 1.00 47.06  ? 356 PHE A CA    1 
ATOM   2594 C  C     . PHE A 1 325 ? 264.056 112.401 -41.248 1.00 47.06  ? 356 PHE A C     1 
ATOM   2595 O  O     . PHE A 1 325 ? 265.158 112.223 -40.753 1.00 47.06  ? 356 PHE A O     1 
ATOM   2596 C  CB    . PHE A 1 325 ? 264.330 113.350 -43.537 1.00 50.36  ? 356 PHE A CB    1 
ATOM   2597 C  CG    . PHE A 1 325 ? 264.597 113.035 -44.985 1.00 50.36  ? 356 PHE A CG    1 
ATOM   2598 C  CD1   . PHE A 1 325 ? 265.724 112.310 -45.355 1.00 50.36  ? 356 PHE A CD1   1 
ATOM   2599 C  CD2   . PHE A 1 325 ? 263.739 113.501 -45.980 1.00 50.36  ? 356 PHE A CD2   1 
ATOM   2600 C  CE1   . PHE A 1 325 ? 265.995 112.063 -46.699 1.00 50.36  ? 356 PHE A CE1   1 
ATOM   2601 C  CE2   . PHE A 1 325 ? 263.997 113.260 -47.321 1.00 50.36  ? 356 PHE A CE2   1 
ATOM   2602 C  CZ    . PHE A 1 325 ? 265.124 112.544 -47.684 1.00 50.36  ? 356 PHE A CZ    1 
ATOM   2603 N  N     . LEU A 1 326 ? 263.012 112.835 -40.556 1.00 43.11  ? 357 LEU A N     1 
ATOM   2604 C  CA    . LEU A 1 326 ? 263.110 113.032 -39.127 1.00 43.11  ? 357 LEU A CA    1 
ATOM   2605 C  C     . LEU A 1 326 ? 263.195 111.601 -38.627 1.00 43.11  ? 357 LEU A C     1 
ATOM   2606 O  O     . LEU A 1 326 ? 262.458 110.730 -39.073 1.00 43.11  ? 357 LEU A O     1 
ATOM   2607 C  CB    . LEU A 1 326 ? 261.860 113.727 -38.579 1.00 18.16  ? 357 LEU A CB    1 
ATOM   2608 C  CG    . LEU A 1 326 ? 261.702 113.663 -37.059 1.00 18.16  ? 357 LEU A CG    1 
ATOM   2609 C  CD1   . LEU A 1 326 ? 263.000 113.994 -36.366 1.00 18.16  ? 357 LEU A CD1   1 
ATOM   2610 C  CD2   . LEU A 1 326 ? 260.622 114.611 -36.638 1.00 18.16  ? 357 LEU A CD2   1 
ATOM   2611 N  N     . GLN A 1 327 ? 264.101 111.344 -37.709 1.00 44.45  ? 358 GLN A N     1 
ATOM   2612 C  CA    . GLN A 1 327 ? 264.269 109.996 -37.215 1.00 44.45  ? 358 GLN A CA    1 
ATOM   2613 C  C     . GLN A 1 327 ? 263.438 109.734 -35.970 1.00 44.45  ? 358 GLN A C     1 
ATOM   2614 O  O     . GLN A 1 327 ? 263.933 109.884 -34.860 1.00 44.45  ? 358 GLN A O     1 
ATOM   2615 C  CB    . GLN A 1 327 ? 265.749 109.788 -36.938 1.00 57.54  ? 358 GLN A CB    1 
ATOM   2616 C  CG    . GLN A 1 327 ? 266.174 108.397 -36.625 1.00 57.54  ? 358 GLN A CG    1 
ATOM   2617 C  CD    . GLN A 1 327 ? 267.673 108.247 -36.782 1.00 57.54  ? 358 GLN A CD    1 
ATOM   2618 O  OE1   . GLN A 1 327 ? 268.199 108.403 -37.889 1.00 57.54  ? 358 GLN A OE1   1 
ATOM   2619 N  NE2   . GLN A 1 327 ? 268.376 107.959 -35.680 1.00 57.54  ? 358 GLN A NE2   1 
ATOM   2620 N  N     . LEU A 1 328 ? 262.178 109.345 -36.158 1.00 45.03  ? 359 LEU A N     1 
ATOM   2621 C  CA    . LEU A 1 328 ? 261.277 109.053 -35.043 1.00 45.03  ? 359 LEU A CA    1 
ATOM   2622 C  C     . LEU A 1 328 ? 261.999 108.342 -33.905 1.00 45.03  ? 359 LEU A C     1 
ATOM   2623 O  O     . LEU A 1 328 ? 262.925 107.566 -34.145 1.00 45.03  ? 359 LEU A O     1 
ATOM   2624 C  CB    . LEU A 1 328 ? 260.111 108.208 -35.539 1.00 30.30  ? 359 LEU A CB    1 
ATOM   2625 C  CG    . LEU A 1 328 ? 259.297 108.999 -36.557 1.00 30.30  ? 359 LEU A CG    1 
ATOM   2626 C  CD1   . LEU A 1 328 ? 258.099 108.193 -37.010 1.00 30.30  ? 359 LEU A CD1   1 
ATOM   2627 C  CD2   . LEU A 1 328 ? 258.868 110.326 -35.925 1.00 30.30  ? 359 LEU A CD2   1 
ATOM   2628 N  N     . LYS A 1 329 ? 261.578 108.611 -32.669 1.00 33.21  ? 360 LYS A N     1 
ATOM   2629 C  CA    . LYS A 1 329 ? 262.214 108.024 -31.490 1.00 33.21  ? 360 LYS A CA    1 
ATOM   2630 C  C     . LYS A 1 329 ? 261.230 107.690 -30.378 1.00 33.21  ? 360 LYS A C     1 
ATOM   2631 O  O     . LYS A 1 329 ? 260.264 108.412 -30.158 1.00 33.21  ? 360 LYS A O     1 
ATOM   2632 C  CB    . LYS A 1 329 ? 263.275 108.988 -30.966 1.00 42.14  ? 360 LYS A CB    1 
ATOM   2633 C  CG    . LYS A 1 329 ? 263.767 108.730 -29.561 1.00 42.14  ? 360 LYS A CG    1 
ATOM   2634 C  CD    . LYS A 1 329 ? 264.642 109.887 -29.093 1.00 42.14  ? 360 LYS A CD    1 
ATOM   2635 C  CE    . LYS A 1 329 ? 264.821 109.891 -27.581 1.00 42.14  ? 360 LYS A CE    1 
ATOM   2636 N  NZ    . LYS A 1 329 ? 265.331 111.195 -27.048 1.00 42.14  ? 360 LYS A NZ    1 
ATOM   2637 N  N     . PHE A 1 330 ? 261.488 106.587 -29.679 1.00 32.00  ? 361 PHE A N     1 
ATOM   2638 C  CA    . PHE A 1 330 ? 260.635 106.142 -28.583 1.00 32.00  ? 361 PHE A CA    1 
ATOM   2639 C  C     . PHE A 1 330 ? 261.285 106.416 -27.236 1.00 32.00  ? 361 PHE A C     1 
ATOM   2640 O  O     . PHE A 1 330 ? 262.183 105.701 -26.807 1.00 32.00  ? 361 PHE A O     1 
ATOM   2641 C  CB    . PHE A 1 330 ? 260.333 104.644 -28.713 1.00 32.27  ? 361 PHE A CB    1 
ATOM   2642 C  CG    . PHE A 1 330 ? 259.667 104.052 -27.499 1.00 32.27  ? 361 PHE A CG    1 
ATOM   2643 C  CD1   . PHE A 1 330 ? 258.489 104.586 -27.004 1.00 32.27  ? 361 PHE A CD1   1 
ATOM   2644 C  CD2   . PHE A 1 330 ? 260.229 102.974 -26.841 1.00 32.27  ? 361 PHE A CD2   1 
ATOM   2645 C  CE1   . PHE A 1 330 ? 257.887 104.056 -25.870 1.00 32.27  ? 361 PHE A CE1   1 
ATOM   2646 C  CE2   . PHE A 1 330 ? 259.629 102.440 -25.705 1.00 32.27  ? 361 PHE A CE2   1 
ATOM   2647 C  CZ    . PHE A 1 330 ? 258.460 102.983 -25.222 1.00 32.27  ? 361 PHE A CZ    1 
ATOM   2648 N  N     . ASP A 1 331 ? 260.816 107.462 -26.575 1.00 29.98  ? 362 ASP A N     1 
ATOM   2649 C  CA    . ASP A 1 331 ? 261.334 107.853 -25.279 1.00 29.98  ? 362 ASP A CA    1 
ATOM   2650 C  C     . ASP A 1 331 ? 260.174 108.333 -24.421 1.00 29.98  ? 362 ASP A C     1 
ATOM   2651 O  O     . ASP A 1 331 ? 259.847 109.512 -24.410 1.00 29.98  ? 362 ASP A O     1 
ATOM   2652 C  CB    . ASP A 1 331 ? 262.356 108.969 -25.451 1.00 47.70  ? 362 ASP A CB    1 
ATOM   2653 C  CG    . ASP A 1 331 ? 262.901 109.475 -24.130 1.00 47.70  ? 362 ASP A CG    1 
ATOM   2654 O  OD1   . ASP A 1 331 ? 262.496 108.951 -23.066 1.00 47.70  ? 362 ASP A OD1   1 
ATOM   2655 O  OD2   . ASP A 1 331 ? 263.736 110.405 -24.162 1.00 47.70  ? 362 ASP A OD2   1 
ATOM   2656 N  N     . PRO A 1 332 ? 259.548 107.416 -23.672 1.00 40.47  ? 363 PRO A N     1 
ATOM   2657 C  CA    . PRO A 1 332 ? 258.415 107.753 -22.814 1.00 40.47  ? 363 PRO A CA    1 
ATOM   2658 C  C     . PRO A 1 332 ? 258.600 109.045 -22.035 1.00 40.47  ? 363 PRO A C     1 
ATOM   2659 O  O     . PRO A 1 332 ? 257.624 109.716 -21.721 1.00 40.47  ? 363 PRO A O     1 
ATOM   2660 C  CB    . PRO A 1 332 ? 258.310 106.538 -21.896 1.00 38.90  ? 363 PRO A CB    1 
ATOM   2661 C  CG    . PRO A 1 332 ? 258.800 105.429 -22.746 1.00 38.90  ? 363 PRO A CG    1 
ATOM   2662 C  CD    . PRO A 1 332 ? 260.004 106.040 -23.404 1.00 38.90  ? 363 PRO A CD    1 
ATOM   2663 N  N     . GLU A 1 333 ? 259.848 109.392 -21.728 1.00 33.41  ? 364 GLU A N     1 
ATOM   2664 C  CA    . GLU A 1 333 ? 260.128 110.598 -20.957 1.00 33.41  ? 364 GLU A CA    1 
ATOM   2665 C  C     . GLU A 1 333 ? 259.818 111.905 -21.672 1.00 33.41  ? 364 GLU A C     1 
ATOM   2666 O  O     . GLU A 1 333 ? 259.632 112.934 -21.030 1.00 33.41  ? 364 GLU A O     1 
ATOM   2667 C  CB    . GLU A 1 333 ? 261.586 110.616 -20.500 1.00 71.50  ? 364 GLU A CB    1 
ATOM   2668 C  CG    . GLU A 1 333 ? 261.944 109.520 -19.503 1.00 71.50  ? 364 GLU A CG    1 
ATOM   2669 C  CD    . GLU A 1 333 ? 263.329 109.712 -18.874 1.00 71.50  ? 364 GLU A CD    1 
ATOM   2670 O  OE1   . GLU A 1 333 ? 263.402 110.173 -17.706 1.00 71.50  ? 364 GLU A OE1   1 
ATOM   2671 O  OE2   . GLU A 1 333 ? 264.344 109.400 -19.542 1.00 71.50  ? 364 GLU A OE2   1 
ATOM   2672 N  N     . LEU A 1 334 ? 259.763 111.869 -22.997 1.00 32.18  ? 365 LEU A N     1 
ATOM   2673 C  CA    . LEU A 1 334 ? 259.477 113.068 -23.769 1.00 32.18  ? 365 LEU A CA    1 
ATOM   2674 C  C     . LEU A 1 334 ? 258.120 113.658 -23.438 1.00 32.18  ? 365 LEU A C     1 
ATOM   2675 O  O     . LEU A 1 334 ? 257.886 114.828 -23.684 1.00 32.18  ? 365 LEU A O     1 
ATOM   2676 C  CB    . LEU A 1 334 ? 259.523 112.772 -25.263 1.00 34.20  ? 365 LEU A CB    1 
ATOM   2677 C  CG    . LEU A 1 334 ? 260.835 112.328 -25.897 1.00 34.20  ? 365 LEU A CG    1 
ATOM   2678 C  CD1   . LEU A 1 334 ? 260.619 112.132 -27.384 1.00 34.20  ? 365 LEU A CD1   1 
ATOM   2679 C  CD2   . LEU A 1 334 ? 261.908 113.360 -25.659 1.00 34.20  ? 365 LEU A CD2   1 
ATOM   2680 N  N     . LEU A 1 335 ? 257.221 112.850 -22.894 1.00 24.54  ? 366 LEU A N     1 
ATOM   2681 C  CA    . LEU A 1 335 ? 255.896 113.330 -22.550 1.00 24.54  ? 366 LEU A CA    1 
ATOM   2682 C  C     . LEU A 1 335 ? 255.776 113.514 -21.056 1.00 24.54  ? 366 LEU A C     1 
ATOM   2683 O  O     . LEU A 1 335 ? 254.737 113.914 -20.565 1.00 24.54  ? 366 LEU A O     1 
ATOM   2684 C  CB    . LEU A 1 335 ? 254.824 112.338 -22.994 1.00 19.89  ? 366 LEU A CB    1 
ATOM   2685 C  CG    . LEU A 1 335 ? 254.598 112.089 -24.474 1.00 19.89  ? 366 LEU A CG    1 
ATOM   2686 C  CD1   . LEU A 1 335 ? 253.742 110.881 -24.650 1.00 19.89  ? 366 LEU A CD1   1 
ATOM   2687 C  CD2   . LEU A 1 335 ? 253.932 113.264 -25.086 1.00 19.89  ? 366 LEU A CD2   1 
ATOM   2688 N  N     . PHE A 1 336 ? 256.831 113.220 -20.320 1.00 33.82  ? 367 PHE A N     1 
ATOM   2689 C  CA    . PHE A 1 336 ? 256.749 113.353 -18.879 1.00 33.82  ? 367 PHE A CA    1 
ATOM   2690 C  C     . PHE A 1 336 ? 256.312 114.715 -18.392 1.00 33.82  ? 367 PHE A C     1 
ATOM   2691 O  O     . PHE A 1 336 ? 255.836 114.842 -17.267 1.00 33.82  ? 367 PHE A O     1 
ATOM   2692 C  CB    . PHE A 1 336 ? 258.080 113.020 -18.228 1.00 40.33  ? 367 PHE A CB    1 
ATOM   2693 C  CG    . PHE A 1 336 ? 258.298 111.566 -18.008 1.00 40.33  ? 367 PHE A CG    1 
ATOM   2694 C  CD1   . PHE A 1 336 ? 259.436 111.121 -17.357 1.00 40.33  ? 367 PHE A CD1   1 
ATOM   2695 C  CD2   . PHE A 1 336 ? 257.378 110.632 -18.464 1.00 40.33  ? 367 PHE A CD2   1 
ATOM   2696 C  CE1   . PHE A 1 336 ? 259.658 109.766 -17.165 1.00 40.33  ? 367 PHE A CE1   1 
ATOM   2697 C  CE2   . PHE A 1 336 ? 257.591 109.272 -18.277 1.00 40.33  ? 367 PHE A CE2   1 
ATOM   2698 C  CZ    . PHE A 1 336 ? 258.731 108.838 -17.628 1.00 40.33  ? 367 PHE A CZ    1 
ATOM   2699 N  N     . GLY A 1 337 ? 256.470 115.739 -19.221 1.00 51.47  ? 368 GLY A N     1 
ATOM   2700 C  CA    . GLY A 1 337 ? 256.087 117.076 -18.790 1.00 51.47  ? 368 GLY A CA    1 
ATOM   2701 C  C     . GLY A 1 337 ? 254.790 117.593 -19.376 1.00 51.47  ? 368 GLY A C     1 
ATOM   2702 O  O     . GLY A 1 337 ? 254.408 118.741 -19.155 1.00 51.47  ? 368 GLY A O     1 
ATOM   2703 N  N     . ALA A 1 338 ? 254.101 116.735 -20.117 1.00 50.93  ? 369 ALA A N     1 
ATOM   2704 C  CA    . ALA A 1 338 ? 252.851 117.111 -20.758 1.00 50.93  ? 369 ALA A CA    1 
ATOM   2705 C  C     . ALA A 1 338 ? 251.657 116.674 -19.938 1.00 50.93  ? 369 ALA A C     1 
ATOM   2706 O  O     . ALA A 1 338 ? 251.797 116.177 -18.824 1.00 50.93  ? 369 ALA A O     1 
ATOM   2707 C  CB    . ALA A 1 338 ? 252.778 116.479 -22.156 1.00 28.22  ? 369 ALA A CB    1 
ATOM   2708 N  N     . GLN A 1 339 ? 250.480 116.900 -20.501 1.00 41.86  ? 370 GLN A N     1 
ATOM   2709 C  CA    . GLN A 1 339 ? 249.236 116.485 -19.889 1.00 41.86  ? 370 GLN A CA    1 
ATOM   2710 C  C     . GLN A 1 339 ? 248.796 115.363 -20.812 1.00 41.86  ? 370 GLN A C     1 
ATOM   2711 O  O     . GLN A 1 339 ? 248.237 115.608 -21.884 1.00 41.86  ? 370 GLN A O     1 
ATOM   2712 C  CB    . GLN A 1 339 ? 248.247 117.624 -19.919 1.00 63.22  ? 370 GLN A CB    1 
ATOM   2713 C  CG    . GLN A 1 339 ? 248.722 118.818 -19.145 1.00 63.22  ? 370 GLN A CG    1 
ATOM   2714 C  CD    . GLN A 1 339 ? 247.675 119.905 -19.100 1.00 63.22  ? 370 GLN A CD    1 
ATOM   2715 O  OE1   . GLN A 1 339 ? 247.295 120.460 -20.140 1.00 63.22  ? 370 GLN A OE1   1 
ATOM   2716 N  NE2   . GLN A 1 339 ? 247.191 120.216 -17.895 1.00 63.22  ? 370 GLN A NE2   1 
ATOM   2717 N  N     . PHE A 1 340 ? 249.083 114.133 -20.398 1.00 48.23  ? 371 PHE A N     1 
ATOM   2718 C  CA    . PHE A 1 340 ? 248.789 112.963 -21.204 1.00 48.23  ? 371 PHE A CA    1 
ATOM   2719 C  C     . PHE A 1 340 ? 248.182 111.852 -20.376 1.00 48.23  ? 371 PHE A C     1 
ATOM   2720 O  O     . PHE A 1 340 ? 248.697 111.495 -19.325 1.00 48.23  ? 371 PHE A O     1 
ATOM   2721 C  CB    . PHE A 1 340 ? 250.081 112.473 -21.833 1.00 29.94  ? 371 PHE A CB    1 
ATOM   2722 C  CG    . PHE A 1 340 ? 249.889 111.507 -22.942 1.00 29.94  ? 371 PHE A CG    1 
ATOM   2723 C  CD1   . PHE A 1 340 ? 249.130 111.845 -24.046 1.00 29.94  ? 371 PHE A CD1   1 
ATOM   2724 C  CD2   . PHE A 1 340 ? 250.520 110.281 -22.915 1.00 29.94  ? 371 PHE A CD2   1 
ATOM   2725 C  CE1   . PHE A 1 340 ? 249.008 110.976 -25.112 1.00 29.94  ? 371 PHE A CE1   1 
ATOM   2726 C  CE2   . PHE A 1 340 ? 250.408 109.406 -23.971 1.00 29.94  ? 371 PHE A CE2   1 
ATOM   2727 C  CZ    . PHE A 1 340 ? 249.652 109.752 -25.073 1.00 29.94  ? 371 PHE A CZ    1 
ATOM   2728 N  N     . GLN A 1 341 ? 247.083 111.299 -20.865 1.00 51.82  ? 372 GLN A N     1 
ATOM   2729 C  CA    . GLN A 1 341 ? 246.391 110.221 -20.179 1.00 51.82  ? 372 GLN A CA    1 
ATOM   2730 C  C     . GLN A 1 341 ? 246.926 108.874 -20.637 1.00 51.82  ? 372 GLN A C     1 
ATOM   2731 O  O     . GLN A 1 341 ? 246.807 108.534 -21.805 1.00 51.82  ? 372 GLN A O     1 
ATOM   2732 C  CB    . GLN A 1 341 ? 244.904 110.300 -20.498 1.00 42.80  ? 372 GLN A CB    1 
ATOM   2733 C  CG    . GLN A 1 341 ? 244.232 111.548 -20.000 1.00 42.80  ? 372 GLN A CG    1 
ATOM   2734 C  CD    . GLN A 1 341 ? 244.149 111.573 -18.502 1.00 42.80  ? 372 GLN A CD    1 
ATOM   2735 O  OE1   . GLN A 1 341 ? 243.770 110.582 -17.876 1.00 42.80  ? 372 GLN A OE1   1 
ATOM   2736 N  NE2   . GLN A 1 341 ? 244.492 112.705 -17.910 1.00 42.80  ? 372 GLN A NE2   1 
ATOM   2737 N  N     . TYR A 1 342 ? 247.524 108.107 -19.734 1.00 37.31  ? 373 TYR A N     1 
ATOM   2738 C  CA    . TYR A 1 342 ? 248.022 106.794 -20.113 1.00 37.31  ? 373 TYR A CA    1 
ATOM   2739 C  C     . TYR A 1 342 ? 246.841 105.837 -20.114 1.00 37.31  ? 373 TYR A C     1 
ATOM   2740 O  O     . TYR A 1 342 ? 246.600 105.112 -19.150 1.00 37.31  ? 373 TYR A O     1 
ATOM   2741 C  CB    . TYR A 1 342 ? 249.087 106.330 -19.136 1.00 31.30  ? 373 TYR A CB    1 
ATOM   2742 C  CG    . TYR A 1 342 ? 250.270 107.236 -19.166 1.00 31.30  ? 373 TYR A CG    1 
ATOM   2743 C  CD1   . TYR A 1 342 ? 250.373 108.305 -18.286 1.00 31.30  ? 373 TYR A CD1   1 
ATOM   2744 C  CD2   . TYR A 1 342 ? 251.244 107.094 -20.151 1.00 31.30  ? 373 TYR A CD2   1 
ATOM   2745 C  CE1   . TYR A 1 342 ? 251.411 109.217 -18.395 1.00 31.30  ? 373 TYR A CE1   1 
ATOM   2746 C  CE2   . TYR A 1 342 ? 252.281 107.997 -20.267 1.00 31.30  ? 373 TYR A CE2   1 
ATOM   2747 C  CZ    . TYR A 1 342 ? 252.357 109.056 -19.393 1.00 31.30  ? 373 TYR A CZ    1 
ATOM   2748 O  OH    . TYR A 1 342 ? 253.355 109.976 -19.541 1.00 31.30  ? 373 TYR A OH    1 
ATOM   2749 N  N     . ARG A 1 343 ? 246.093 105.847 -21.206 1.00 31.67  ? 374 ARG A N     1 
ATOM   2750 C  CA    . ARG A 1 343 ? 244.930 104.998 -21.308 1.00 31.67  ? 374 ARG A CA    1 
ATOM   2751 C  C     . ARG A 1 343 ? 244.349 105.094 -22.695 1.00 31.67  ? 374 ARG A C     1 
ATOM   2752 O  O     . ARG A 1 343 ? 244.063 106.178 -23.167 1.00 31.67  ? 374 ARG A O     1 
ATOM   2753 C  CB    . ARG A 1 343 ? 243.908 105.430 -20.268 1.00 39.83  ? 374 ARG A CB    1 
ATOM   2754 C  CG    . ARG A 1 343 ? 242.503 105.567 -20.775 1.00 39.83  ? 374 ARG A CG    1 
ATOM   2755 C  CD    . ARG A 1 343 ? 241.610 106.017 -19.647 1.00 39.83  ? 374 ARG A CD    1 
ATOM   2756 N  NE    . ARG A 1 343 ? 241.204 104.925 -18.768 1.00 39.83  ? 374 ARG A NE    1 
ATOM   2757 C  CZ    . ARG A 1 343 ? 240.556 105.104 -17.623 1.00 39.83  ? 374 ARG A CZ    1 
ATOM   2758 N  NH1   . ARG A 1 343 ? 240.249 106.330 -17.227 1.00 39.83  ? 374 ARG A NH1   1 
ATOM   2759 N  NH2   . ARG A 1 343 ? 240.209 104.066 -16.875 1.00 39.83  ? 374 ARG A NH2   1 
ATOM   2760 N  N     . ASN A 1 344 ? 244.188 103.950 -23.347 1.00 41.98  ? 375 ASN A N     1 
ATOM   2761 C  CA    . ASN A 1 344 ? 243.640 103.918 -24.691 1.00 41.98  ? 375 ASN A CA    1 
ATOM   2762 C  C     . ASN A 1 344 ? 242.411 103.020 -24.774 1.00 41.98  ? 375 ASN A C     1 
ATOM   2763 O  O     . ASN A 1 344 ? 242.097 102.276 -23.851 1.00 41.98  ? 375 ASN A O     1 
ATOM   2764 C  CB    . ASN A 1 344 ? 244.690 103.430 -25.688 1.00 41.60  ? 375 ASN A CB    1 
ATOM   2765 C  CG    . ASN A 1 344 ? 244.449 103.963 -27.091 1.00 41.60  ? 375 ASN A CG    1 
ATOM   2766 O  OD1   . ASN A 1 344 ? 244.991 103.443 -28.063 1.00 41.60  ? 375 ASN A OD1   1 
ATOM   2767 N  ND2   . ASN A 1 344 ? 243.644 105.015 -27.200 1.00 41.60  ? 375 ASN A ND2   1 
ATOM   2768 N  N     . ARG A 1 345 ? 241.717 103.104 -25.897 1.00 38.39  ? 376 ARG A N     1 
ATOM   2769 C  CA    . ARG A 1 345 ? 240.514 102.330 -26.133 1.00 38.39  ? 376 ARG A CA    1 
ATOM   2770 C  C     . ARG A 1 345 ? 240.299 102.364 -27.630 1.00 38.39  ? 376 ARG A C     1 
ATOM   2771 O  O     . ARG A 1 345 ? 239.846 103.371 -28.156 1.00 38.39  ? 376 ARG A O     1 
ATOM   2772 C  CB    . ARG A 1 345 ? 239.337 102.987 -25.433 1.00 28.43  ? 376 ARG A CB    1 
ATOM   2773 C  CG    . ARG A 1 345 ? 238.014 102.442 -25.857 1.00 28.43  ? 376 ARG A CG    1 
ATOM   2774 C  CD    . ARG A 1 345 ? 237.570 101.316 -24.967 1.00 28.43  ? 376 ARG A CD    1 
ATOM   2775 N  NE    . ARG A 1 345 ? 236.809 101.821 -23.836 1.00 28.43  ? 376 ARG A NE    1 
ATOM   2776 C  CZ    . ARG A 1 345 ? 237.343 102.185 -22.684 1.00 28.43  ? 376 ARG A CZ    1 
ATOM   2777 N  NH1   . ARG A 1 345 ? 238.656 102.090 -22.505 1.00 28.43  ? 376 ARG A NH1   1 
ATOM   2778 N  NH2   . ARG A 1 345 ? 236.559 102.649 -21.727 1.00 28.43  ? 376 ARG A NH2   1 
ATOM   2779 N  N     . ILE A 1 346 ? 240.627 101.267 -28.307 1.00 26.02  ? 377 ILE A N     1 
ATOM   2780 C  CA    . ILE A 1 346 ? 240.499 101.190 -29.753 1.00 26.02  ? 377 ILE A CA    1 
ATOM   2781 C  C     . ILE A 1 346 ? 239.174 101.709 -30.296 1.00 26.02  ? 377 ILE A C     1 
ATOM   2782 O  O     . ILE A 1 346 ? 238.104 101.458 -29.746 1.00 26.02  ? 377 ILE A O     1 
ATOM   2783 C  CB    . ILE A 1 346 ? 240.724 99.769  -30.235 1.00 28.59  ? 377 ILE A CB    1 
ATOM   2784 C  CG1   . ILE A 1 346 ? 241.980 99.211  -29.581 1.00 28.59  ? 377 ILE A CG1   1 
ATOM   2785 C  CG2   . ILE A 1 346 ? 240.916 99.755  -31.734 1.00 28.59  ? 377 ILE A CG2   1 
ATOM   2786 C  CD1   . ILE A 1 346 ? 243.233 99.884  -30.002 1.00 28.59  ? 377 ILE A CD1   1 
ATOM   2787 N  N     . ALA A 1 347 ? 239.277 102.455 -31.385 1.00 46.79  ? 378 ALA A N     1 
ATOM   2788 C  CA    . ALA A 1 347 ? 238.135 103.061 -32.035 1.00 46.79  ? 378 ALA A CA    1 
ATOM   2789 C  C     . ALA A 1 347 ? 237.741 102.253 -33.248 1.00 46.79  ? 378 ALA A C     1 
ATOM   2790 O  O     . ALA A 1 347 ? 238.557 101.515 -33.788 1.00 46.79  ? 378 ALA A O     1 
ATOM   2791 C  CB    . ALA A 1 347 ? 238.485 104.468 -32.461 1.00 25.14  ? 378 ALA A CB    1 
ATOM   2792 N  N     . MET A 1 348 ? 236.496 102.392 -33.689 1.00 35.49  ? 379 MET A N     1 
ATOM   2793 C  CA    . MET A 1 348 ? 236.047 101.669 -34.863 1.00 35.49  ? 379 MET A CA    1 
ATOM   2794 C  C     . MET A 1 348 ? 236.612 102.294 -36.127 1.00 35.49  ? 379 MET A C     1 
ATOM   2795 O  O     . MET A 1 348 ? 236.929 101.584 -37.077 1.00 35.49  ? 379 MET A O     1 
ATOM   2796 C  CB    . MET A 1 348 ? 234.528 101.640 -34.917 1.00 37.12  ? 379 MET A CB    1 
ATOM   2797 C  CG    . MET A 1 348 ? 233.882 102.938 -34.567 1.00 37.12  ? 379 MET A CG    1 
ATOM   2798 S  SD    . MET A 1 348 ? 232.119 102.763 -34.493 1.00 37.12  ? 379 MET A SD    1 
ATOM   2799 C  CE    . MET A 1 348 ? 231.882 102.159 -32.879 1.00 37.12  ? 379 MET A CE    1 
ATOM   2800 N  N     . GLU A 1 349 ? 236.749 103.620 -36.145 1.00 34.43  ? 380 GLU A N     1 
ATOM   2801 C  CA    . GLU A 1 349 ? 237.308 104.278 -37.323 1.00 34.43  ? 380 GLU A CA    1 
ATOM   2802 C  C     . GLU A 1 349 ? 238.769 103.899 -37.450 1.00 34.43  ? 380 GLU A C     1 
ATOM   2803 O  O     . GLU A 1 349 ? 239.296 103.849 -38.551 1.00 34.43  ? 380 GLU A O     1 
ATOM   2804 C  CB    . GLU A 1 349 ? 237.216 105.802 -37.244 1.00 27.68  ? 380 GLU A CB    1 
ATOM   2805 C  CG    . GLU A 1 349 ? 235.853 106.353 -37.005 1.00 27.68  ? 380 GLU A CG    1 
ATOM   2806 C  CD    . GLU A 1 349 ? 235.566 106.462 -35.541 1.00 27.68  ? 380 GLU A CD    1 
ATOM   2807 O  OE1   . GLU A 1 349 ? 236.016 105.568 -34.798 1.00 27.68  ? 380 GLU A OE1   1 
ATOM   2808 O  OE2   . GLU A 1 349 ? 234.904 107.439 -35.129 1.00 27.68  ? 380 GLU A OE2   1 
ATOM   2809 N  N     . PHE A 1 350 ? 239.425 103.649 -36.321 1.00 36.93  ? 381 PHE A N     1 
ATOM   2810 C  CA    . PHE A 1 350 ? 240.834 103.266 -36.330 1.00 36.93  ? 381 PHE A CA    1 
ATOM   2811 C  C     . PHE A 1 350 ? 240.893 101.876 -36.914 1.00 36.93  ? 381 PHE A C     1 
ATOM   2812 O  O     . PHE A 1 350 ? 241.792 101.550 -37.681 1.00 36.93  ? 381 PHE A O     1 
ATOM   2813 C  CB    . PHE A 1 350 ? 241.427 103.287 -34.907 1.00 30.06  ? 381 PHE A CB    1 
ATOM   2814 C  CG    . PHE A 1 350 ? 242.893 102.898 -34.839 1.00 30.06  ? 381 PHE A CG    1 
ATOM   2815 C  CD1   . PHE A 1 350 ? 243.761 103.190 -35.880 1.00 30.06  ? 381 PHE A CD1   1 
ATOM   2816 C  CD2   . PHE A 1 350 ? 243.401 102.233 -33.724 1.00 30.06  ? 381 PHE A CD2   1 
ATOM   2817 C  CE1   . PHE A 1 350 ? 245.105 102.818 -35.813 1.00 30.06  ? 381 PHE A CE1   1 
ATOM   2818 C  CE2   . PHE A 1 350 ? 244.746 101.861 -33.654 1.00 30.06  ? 381 PHE A CE2   1 
ATOM   2819 C  CZ    . PHE A 1 350 ? 245.593 102.155 -34.704 1.00 30.06  ? 381 PHE A CZ    1 
ATOM   2820 N  N     . ASN A 1 351 ? 239.908 101.064 -36.560 1.00 40.99  ? 382 ASN A N     1 
ATOM   2821 C  CA    . ASN A 1 351 ? 239.831 99.709  -37.071 1.00 40.99  ? 382 ASN A CA    1 
ATOM   2822 C  C     . ASN A 1 351 ? 239.666 99.811  -38.583 1.00 40.99  ? 382 ASN A C     1 
ATOM   2823 O  O     . ASN A 1 351 ? 240.526 99.370  -39.334 1.00 40.99  ? 382 ASN A O     1 
ATOM   2824 C  CB    . ASN A 1 351 ? 238.646 98.986  -36.424 1.00 37.18  ? 382 ASN A CB    1 
ATOM   2825 C  CG    . ASN A 1 351 ? 238.476 97.573  -36.925 1.00 37.18  ? 382 ASN A CG    1 
ATOM   2826 O  OD1   . ASN A 1 351 ? 237.803 97.344  -37.920 1.00 37.18  ? 382 ASN A OD1   1 
ATOM   2827 N  ND2   . ASN A 1 351 ? 239.091 96.618  -36.241 1.00 37.18  ? 382 ASN A ND2   1 
ATOM   2828 N  N     . GLN A 1 352 ? 238.572 100.416 -39.024 1.00 24.56  ? 383 GLN A N     1 
ATOM   2829 C  CA    . GLN A 1 352 ? 238.308 100.588 -40.444 1.00 24.56  ? 383 GLN A CA    1 
ATOM   2830 C  C     . GLN A 1 352 ? 239.559 101.000 -41.216 1.00 24.56  ? 383 GLN A C     1 
ATOM   2831 O  O     . GLN A 1 352 ? 239.993 100.317 -42.132 1.00 24.56  ? 383 GLN A O     1 
ATOM   2832 C  CB    . GLN A 1 352 ? 237.240 101.656 -40.633 1.00 46.71  ? 383 GLN A CB    1 
ATOM   2833 C  CG    . GLN A 1 352 ? 235.897 101.326 -40.020 1.00 46.71  ? 383 GLN A CG    1 
ATOM   2834 C  CD    . GLN A 1 352 ? 234.900 100.841 -41.051 1.00 46.71  ? 383 GLN A CD    1 
ATOM   2835 O  OE1   . GLN A 1 352 ? 234.652 101.519 -42.052 1.00 46.71  ? 383 GLN A OE1   1 
ATOM   2836 N  NE2   . GLN A 1 352 ? 234.315 99.671  -40.813 1.00 46.71  ? 383 GLN A NE2   1 
ATOM   2837 N  N     . LEU A 1 353 ? 240.116 102.139 -40.829 1.00 44.46  ? 384 LEU A N     1 
ATOM   2838 C  CA    . LEU A 1 353 ? 241.310 102.731 -41.437 1.00 44.46  ? 384 LEU A CA    1 
ATOM   2839 C  C     . LEU A 1 353 ? 242.521 101.813 -41.553 1.00 44.46  ? 384 LEU A C     1 
ATOM   2840 O  O     . LEU A 1 353 ? 243.360 101.993 -42.438 1.00 44.46  ? 384 LEU A O     1 
ATOM   2841 C  CB    . LEU A 1 353 ? 241.693 103.976 -40.633 1.00 33.91  ? 384 LEU A CB    1 
ATOM   2842 C  CG    . LEU A 1 353 ? 243.063 104.650 -40.674 1.00 33.91  ? 384 LEU A CG    1 
ATOM   2843 C  CD1   . LEU A 1 353 ? 242.983 105.813 -39.724 1.00 33.91  ? 384 LEU A CD1   1 
ATOM   2844 C  CD2   . LEU A 1 353 ? 244.194 103.726 -40.242 1.00 33.91  ? 384 LEU A CD2   1 
ATOM   2845 N  N     . TYR A 1 354 ? 242.620 100.839 -40.657 1.00 39.23  ? 385 TYR A N     1 
ATOM   2846 C  CA    . TYR A 1 354 ? 243.757 99.929  -40.659 1.00 39.23  ? 385 TYR A CA    1 
ATOM   2847 C  C     . TYR A 1 354 ? 243.582 98.730  -41.572 1.00 39.23  ? 385 TYR A C     1 
ATOM   2848 O  O     . TYR A 1 354 ? 244.353 97.783  -41.490 1.00 39.23  ? 385 TYR A O     1 
ATOM   2849 C  CB    . TYR A 1 354 ? 244.050 99.451  -39.231 1.00 34.33  ? 385 TYR A CB    1 
ATOM   2850 C  CG    . TYR A 1 354 ? 245.517 99.432  -38.873 1.00 34.33  ? 385 TYR A CG    1 
ATOM   2851 C  CD1   . TYR A 1 354 ? 245.952 99.831  -37.616 1.00 34.33  ? 385 TYR A CD1   1 
ATOM   2852 C  CD2   . TYR A 1 354 ? 246.473 99.025  -39.794 1.00 34.33  ? 385 TYR A CD2   1 
ATOM   2853 C  CE1   . TYR A 1 354 ? 247.311 99.829  -37.289 1.00 34.33  ? 385 TYR A CE1   1 
ATOM   2854 C  CE2   . TYR A 1 354 ? 247.829 99.017  -39.473 1.00 34.33  ? 385 TYR A CE2   1 
ATOM   2855 C  CZ    . TYR A 1 354 ? 248.238 99.418  -38.223 1.00 34.33  ? 385 TYR A CZ    1 
ATOM   2856 O  OH    . TYR A 1 354 ? 249.571 99.368  -37.905 1.00 34.33  ? 385 TYR A OH    1 
ATOM   2857 N  N     . HIS A 1 355 ? 242.577 98.754  -42.439 1.00 40.96  ? 386 HIS A N     1 
ATOM   2858 C  CA    . HIS A 1 355 ? 242.368 97.634  -43.344 1.00 40.96  ? 386 HIS A CA    1 
ATOM   2859 C  C     . HIS A 1 355 ? 243.222 97.787  -44.577 1.00 40.96  ? 386 HIS A C     1 
ATOM   2860 O  O     . HIS A 1 355 ? 242.726 98.087  -45.661 1.00 40.96  ? 386 HIS A O     1 
ATOM   2861 C  CB    . HIS A 1 355 ? 240.903 97.509  -43.740 1.00 54.01  ? 386 HIS A CB    1 
ATOM   2862 C  CG    . HIS A 1 355 ? 240.107 96.658  -42.802 1.00 54.01  ? 386 HIS A CG    1 
ATOM   2863 N  ND1   . HIS A 1 355 ? 239.634 97.120  -41.593 1.00 54.01  ? 386 HIS A ND1   1 
ATOM   2864 C  CD2   . HIS A 1 355 ? 239.734 95.358  -42.877 1.00 54.01  ? 386 HIS A CD2   1 
ATOM   2865 C  CE1   . HIS A 1 355 ? 239.003 96.144  -40.965 1.00 54.01  ? 386 HIS A CE1   1 
ATOM   2866 N  NE2   . HIS A 1 355 ? 239.049 95.063  -41.723 1.00 54.01  ? 386 HIS A NE2   1 
ATOM   2867 N  N     . TRP A 1 356 ? 244.515 97.561  -44.400 1.00 32.37  ? 387 TRP A N     1 
ATOM   2868 C  CA    . TRP A 1 356 ? 245.465 97.688  -45.485 1.00 32.37  ? 387 TRP A CA    1 
ATOM   2869 C  C     . TRP A 1 356 ? 245.654 96.373  -46.226 1.00 32.37  ? 387 TRP A C     1 
ATOM   2870 O  O     . TRP A 1 356 ? 246.785 95.930  -46.444 1.00 32.37  ? 387 TRP A O     1 
ATOM   2871 C  CB    . TRP A 1 356 ? 246.807 98.161  -44.930 1.00 34.64  ? 387 TRP A CB    1 
ATOM   2872 C  CG    . TRP A 1 356 ? 246.733 99.403  -44.089 1.00 34.64  ? 387 TRP A CG    1 
ATOM   2873 C  CD1   . TRP A 1 356 ? 245.726 100.327 -44.064 1.00 34.64  ? 387 TRP A CD1   1 
ATOM   2874 C  CD2   . TRP A 1 356 ? 247.739 99.885  -43.198 1.00 34.64  ? 387 TRP A CD2   1 
ATOM   2875 N  NE1   . TRP A 1 356 ? 246.047 101.355 -43.214 1.00 34.64  ? 387 TRP A NE1   1 
ATOM   2876 C  CE2   . TRP A 1 356 ? 247.280 101.107 -42.669 1.00 34.64  ? 387 TRP A CE2   1 
ATOM   2877 C  CE3   . TRP A 1 356 ? 248.988 99.403  -42.797 1.00 34.64  ? 387 TRP A CE3   1 
ATOM   2878 C  CZ2   . TRP A 1 356 ? 248.027 101.852 -41.759 1.00 34.64  ? 387 TRP A CZ2   1 
ATOM   2879 C  CZ3   . TRP A 1 356 ? 249.728 100.142 -41.896 1.00 34.64  ? 387 TRP A CZ3   1 
ATOM   2880 C  CH2   . TRP A 1 356 ? 249.245 101.354 -41.386 1.00 34.64  ? 387 TRP A CH2   1 
ATOM   2881 N  N     . HIS A 1 357 ? 244.552 95.754  -46.635 1.00 36.64  ? 388 HIS A N     1 
ATOM   2882 C  CA    . HIS A 1 357 ? 244.643 94.477  -47.331 1.00 36.64  ? 388 HIS A CA    1 
ATOM   2883 C  C     . HIS A 1 357 ? 245.411 94.484  -48.657 1.00 36.64  ? 388 HIS A C     1 
ATOM   2884 O  O     . HIS A 1 357 ? 245.970 93.455  -49.058 1.00 36.64  ? 388 HIS A O     1 
ATOM   2885 C  CB    . HIS A 1 357 ? 243.244 93.868  -47.493 1.00 60.98  ? 388 HIS A CB    1 
ATOM   2886 C  CG    . HIS A 1 357 ? 242.691 93.300  -46.219 1.00 60.98  ? 388 HIS A CG    1 
ATOM   2887 N  ND1   . HIS A 1 357 ? 242.122 94.056  -45.219 1.00 60.98  ? 388 HIS A ND1   1 
ATOM   2888 C  CD2   . HIS A 1 357 ? 242.710 92.028  -45.744 1.00 60.98  ? 388 HIS A CD2   1 
ATOM   2889 C  CE1   . HIS A 1 357 ? 241.829 93.235  -44.189 1.00 60.98  ? 388 HIS A CE1   1 
ATOM   2890 N  NE2   . HIS A 1 357 ? 242.164 91.979  -44.441 1.00 60.98  ? 388 HIS A NE2   1 
ATOM   2891 N  N     . PRO A 1 358 ? 245.455 95.636  -49.357 1.00 43.11  ? 389 PRO A N     1 
ATOM   2892 C  CA    . PRO A 1 358 ? 246.190 95.692  -50.624 1.00 43.11  ? 389 PRO A CA    1 
ATOM   2893 C  C     . PRO A 1 358 ? 247.714 95.553  -50.487 1.00 43.11  ? 389 PRO A C     1 
ATOM   2894 O  O     . PRO A 1 358 ? 248.440 95.550  -51.480 1.00 43.11  ? 389 PRO A O     1 
ATOM   2895 C  CB    . PRO A 1 358 ? 245.756 97.033  -51.222 1.00 43.98  ? 389 PRO A CB    1 
ATOM   2896 C  CG    . PRO A 1 358 ? 245.335 97.825  -50.051 1.00 43.98  ? 389 PRO A CG    1 
ATOM   2897 C  CD    . PRO A 1 358 ? 244.594 96.821  -49.225 1.00 43.98  ? 389 PRO A CD    1 
ATOM   2898 N  N     . LEU A 1 359 ? 248.203 95.436  -49.260 1.00 48.93  ? 390 LEU A N     1 
ATOM   2899 C  CA    . LEU A 1 359 ? 249.638 95.249  -49.056 1.00 48.93  ? 390 LEU A CA    1 
ATOM   2900 C  C     . LEU A 1 359 ? 249.974 93.860  -49.575 1.00 48.93  ? 390 LEU A C     1 
ATOM   2901 O  O     . LEU A 1 359 ? 251.110 93.576  -49.934 1.00 48.93  ? 390 LEU A O     1 
ATOM   2902 C  CB    . LEU A 1 359 ? 250.000 95.304  -47.568 1.00 43.84  ? 390 LEU A CB    1 
ATOM   2903 C  CG    . LEU A 1 359 ? 249.990 96.633  -46.817 1.00 43.84  ? 390 LEU A CG    1 
ATOM   2904 C  CD1   . LEU A 1 359 ? 250.195 96.380  -45.335 1.00 43.84  ? 390 LEU A CD1   1 
ATOM   2905 C  CD2   . LEU A 1 359 ? 251.089 97.521  -47.366 1.00 43.84  ? 390 LEU A CD2   1 
ATOM   2906 N  N     . MET A 1 360 ? 248.963 92.999  -49.598 1.00 47.36  ? 391 MET A N     1 
ATOM   2907 C  CA    . MET A 1 360 ? 249.119 91.623  -50.034 1.00 47.36  ? 391 MET A CA    1 
ATOM   2908 C  C     . MET A 1 360 ? 249.457 91.488  -51.515 1.00 47.36  ? 391 MET A C     1 
ATOM   2909 O  O     . MET A 1 360 ? 248.837 92.120  -52.375 1.00 47.36  ? 391 MET A O     1 
ATOM   2910 C  CB    . MET A 1 360 ? 247.856 90.836  -49.692 1.00 50.26  ? 391 MET A CB    1 
ATOM   2911 C  CG    . MET A 1 360 ? 247.643 90.671  -48.196 1.00 50.26  ? 391 MET A CG    1 
ATOM   2912 S  SD    . MET A 1 360 ? 248.963 89.731  -47.365 1.00 50.26  ? 391 MET A SD    1 
ATOM   2913 C  CE    . MET A 1 360 ? 250.172 91.001  -47.038 1.00 50.26  ? 391 MET A CE    1 
ATOM   2914 N  N     . PRO A 1 361 ? 250.441 90.634  -51.832 1.00 46.25  ? 392 PRO A N     1 
ATOM   2915 C  CA    . PRO A 1 361 ? 250.916 90.377  -53.191 1.00 46.25  ? 392 PRO A CA    1 
ATOM   2916 C  C     . PRO A 1 361 ? 249.964 89.582  -54.063 1.00 46.25  ? 392 PRO A C     1 
ATOM   2917 O  O     . PRO A 1 361 ? 248.764 89.475  -53.784 1.00 46.25  ? 392 PRO A O     1 
ATOM   2918 C  CB    . PRO A 1 361 ? 252.201 89.614  -52.950 1.00 43.10  ? 392 PRO A CB    1 
ATOM   2919 C  CG    . PRO A 1 361 ? 251.811 88.739  -51.812 1.00 43.10  ? 392 PRO A CG    1 
ATOM   2920 C  CD    . PRO A 1 361 ? 251.074 89.698  -50.884 1.00 43.10  ? 392 PRO A CD    1 
ATOM   2921 N  N     . ASP A 1 362 ? 250.527 89.037  -55.136 1.00 53.75  ? 393 ASP A N     1 
ATOM   2922 C  CA    . ASP A 1 362 ? 249.777 88.219  -56.073 1.00 53.75  ? 393 ASP A CA    1 
ATOM   2923 C  C     . ASP A 1 362 ? 250.049 86.776  -55.687 1.00 53.75  ? 393 ASP A C     1 
ATOM   2924 O  O     . ASP A 1 362 ? 249.126 85.977  -55.567 1.00 53.75  ? 393 ASP A O     1 
ATOM   2925 C  CB    . ASP A 1 362 ? 250.223 88.509  -57.506 1.00 68.48  ? 393 ASP A CB    1 
ATOM   2926 C  CG    . ASP A 1 362 ? 249.538 89.748  -58.100 1.00 68.48  ? 393 ASP A CG    1 
ATOM   2927 O  OD1   . ASP A 1 362 ? 249.832 90.094  -59.275 1.00 68.48  ? 393 ASP A OD1   1 
ATOM   2928 O  OD2   . ASP A 1 362 ? 248.698 90.370  -57.399 1.00 68.48  ? 393 ASP A OD2   1 
ATOM   2929 N  N     . SER A 1 363 ? 251.323 86.461  -55.477 1.00 51.09  ? 394 SER A N     1 
ATOM   2930 C  CA    . SER A 1 363 ? 251.740 85.129  -55.056 1.00 51.09  ? 394 SER A CA    1 
ATOM   2931 C  C     . SER A 1 363 ? 252.788 85.314  -53.960 1.00 51.09  ? 394 SER A C     1 
ATOM   2932 O  O     . SER A 1 363 ? 253.130 86.446  -53.604 1.00 51.09  ? 394 SER A O     1 
ATOM   2933 C  CB    . SER A 1 363 ? 252.335 84.355  -56.224 1.00 51.31  ? 394 SER A CB    1 
ATOM   2934 O  OG    . SER A 1 363 ? 253.473 85.019  -56.735 1.00 51.31  ? 394 SER A OG    1 
ATOM   2935 N  N     . PHE A 1 364 ? 253.304 84.217  -53.420 1.00 35.21  ? 395 PHE A N     1 
ATOM   2936 C  CA    . PHE A 1 364 ? 254.290 84.318  -52.357 1.00 35.21  ? 395 PHE A CA    1 
ATOM   2937 C  C     . PHE A 1 364 ? 255.572 83.607  -52.747 1.00 35.21  ? 395 PHE A C     1 
ATOM   2938 O  O     . PHE A 1 364 ? 255.644 82.387  -52.740 1.00 35.21  ? 395 PHE A O     1 
ATOM   2939 C  CB    . PHE A 1 364 ? 253.725 83.727  -51.061 1.00 34.80  ? 395 PHE A CB    1 
ATOM   2940 C  CG    . PHE A 1 364 ? 252.465 84.398  -50.593 1.00 34.80  ? 395 PHE A CG    1 
ATOM   2941 C  CD1   . PHE A 1 364 ? 251.316 84.373  -51.370 1.00 34.80  ? 395 PHE A CD1   1 
ATOM   2942 C  CD2   . PHE A 1 364 ? 252.431 85.085  -49.391 1.00 34.80  ? 395 PHE A CD2   1 
ATOM   2943 C  CE1   . PHE A 1 364 ? 250.153 85.024  -50.960 1.00 34.80  ? 395 PHE A CE1   1 
ATOM   2944 C  CE2   . PHE A 1 364 ? 251.268 85.742  -48.974 1.00 34.80  ? 395 PHE A CE2   1 
ATOM   2945 C  CZ    . PHE A 1 364 ? 250.129 85.710  -49.761 1.00 34.80  ? 395 PHE A CZ    1 
ATOM   2946 N  N     . ARG A 1 365 ? 256.592 84.379  -53.091 1.00 48.49  ? 396 ARG A N     1 
ATOM   2947 C  CA    . ARG A 1 365 ? 257.860 83.801  -53.496 1.00 48.49  ? 396 ARG A CA    1 
ATOM   2948 C  C     . ARG A 1 365 ? 258.714 83.453  -52.293 1.00 48.49  ? 396 ARG A C     1 
ATOM   2949 O  O     . ARG A 1 365 ? 258.999 84.310  -51.455 1.00 48.49  ? 396 ARG A O     1 
ATOM   2950 C  CB    . ARG A 1 365 ? 258.610 84.769  -54.413 1.00 55.95  ? 396 ARG A CB    1 
ATOM   2951 N  N     . VAL A 1 366 ? 259.110 82.185  -52.214 1.00 46.75  ? 397 VAL A N     1 
ATOM   2952 C  CA    . VAL A 1 366 ? 259.948 81.696  -51.130 1.00 46.75  ? 397 VAL A CA    1 
ATOM   2953 C  C     . VAL A 1 366 ? 261.149 80.991  -51.760 1.00 46.75  ? 397 VAL A C     1 
ATOM   2954 O  O     . VAL A 1 366 ? 261.320 79.773  -51.642 1.00 46.75  ? 397 VAL A O     1 
ATOM   2955 C  CB    . VAL A 1 366 ? 259.173 80.711  -50.209 1.00 40.60  ? 397 VAL A CB    1 
ATOM   2956 C  CG1   . VAL A 1 366 ? 260.022 80.360  -49.000 1.00 40.60  ? 397 VAL A CG1   1 
ATOM   2957 C  CG2   . VAL A 1 366 ? 257.868 81.337  -49.737 1.00 40.60  ? 397 VAL A CG2   1 
ATOM   2958 N  N     . GLY A 1 367 ? 261.978 81.778  -52.441 1.00 72.18  ? 398 GLY A N     1 
ATOM   2959 C  CA    . GLY A 1 367 ? 263.163 81.243  -53.097 1.00 72.18  ? 398 GLY A CA    1 
ATOM   2960 C  C     . GLY A 1 367 ? 262.814 80.881  -54.523 1.00 72.18  ? 398 GLY A C     1 
ATOM   2961 O  O     . GLY A 1 367 ? 262.227 81.686  -55.244 1.00 72.18  ? 398 GLY A O     1 
ATOM   2962 N  N     . PRO A 1 368 ? 263.163 79.677  -54.970 1.00 56.35  ? 399 PRO A N     1 
ATOM   2963 C  CA    . PRO A 1 368 ? 262.815 79.328  -56.346 1.00 56.35  ? 399 PRO A CA    1 
ATOM   2964 C  C     . PRO A 1 368 ? 261.312 79.037  -56.399 1.00 56.35  ? 399 PRO A C     1 
ATOM   2965 O  O     . PRO A 1 368 ? 260.658 79.294  -57.413 1.00 56.35  ? 399 PRO A O     1 
ATOM   2966 C  CB    . PRO A 1 368 ? 263.658 78.089  -56.603 1.00 89.61  ? 399 PRO A CB    1 
ATOM   2967 C  CG    . PRO A 1 368 ? 263.590 77.394  -55.261 1.00 89.61  ? 399 PRO A CG    1 
ATOM   2968 C  CD    . PRO A 1 368 ? 263.791 78.542  -54.271 1.00 89.61  ? 399 PRO A CD    1 
ATOM   2969 N  N     . GLN A 1 369 ? 260.771 78.514  -55.296 1.00 63.04  ? 400 GLN A N     1 
ATOM   2970 C  CA    . GLN A 1 369 ? 259.345 78.194  -55.218 1.00 63.04  ? 400 GLN A CA    1 
ATOM   2971 C  C     . GLN A 1 369 ? 258.519 79.487  -55.300 1.00 63.04  ? 400 GLN A C     1 
ATOM   2972 O  O     . GLN A 1 369 ? 259.049 80.570  -55.057 1.00 63.04  ? 400 GLN A O     1 
ATOM   2973 C  CB    . GLN A 1 369 ? 259.051 77.437  -53.913 1.00 34.13  ? 400 GLN A CB    1 
ATOM   2974 N  N     . ASP A 1 370 ? 257.237 79.377  -55.653 1.00 46.32  ? 401 ASP A N     1 
ATOM   2975 C  CA    . ASP A 1 370 ? 256.373 80.549  -55.767 1.00 46.32  ? 401 ASP A CA    1 
ATOM   2976 C  C     . ASP A 1 370 ? 254.899 80.263  -55.440 1.00 46.32  ? 401 ASP A C     1 
ATOM   2977 O  O     . ASP A 1 370 ? 254.018 80.449  -56.285 1.00 46.32  ? 401 ASP A O     1 
ATOM   2978 C  CB    . ASP A 1 370 ? 256.462 81.122  -57.179 1.00 68.42  ? 401 ASP A CB    1 
ATOM   2979 C  CG    . ASP A 1 370 ? 255.768 82.474  -57.307 1.00 68.42  ? 401 ASP A CG    1 
ATOM   2980 O  OD1   . ASP A 1 370 ? 256.344 83.479  -56.837 1.00 68.42  ? 401 ASP A OD1   1 
ATOM   2981 O  OD2   . ASP A 1 370 ? 254.645 82.542  -57.868 1.00 68.42  ? 401 ASP A OD2   1 
ATOM   2982 N  N     . TYR A 1 371 ? 254.634 79.834  -54.208 1.00 53.34  ? 402 TYR A N     1 
ATOM   2983 C  CA    . TYR A 1 371 ? 253.283 79.502  -53.746 1.00 53.34  ? 402 TYR A CA    1 
ATOM   2984 C  C     . TYR A 1 371 ? 252.182 80.486  -54.105 1.00 53.34  ? 402 TYR A C     1 
ATOM   2985 O  O     . TYR A 1 371 ? 252.430 81.668  -54.332 1.00 53.34  ? 402 TYR A O     1 
ATOM   2986 C  CB    . TYR A 1 371 ? 253.321 79.289  -52.242 1.00 47.24  ? 402 TYR A CB    1 
ATOM   2987 C  CG    . TYR A 1 371 ? 254.349 78.259  -51.902 1.00 47.24  ? 402 TYR A CG    1 
ATOM   2988 C  CD1   . TYR A 1 371 ? 254.088 76.907  -52.095 1.00 47.24  ? 402 TYR A CD1   1 
ATOM   2989 C  CD2   . TYR A 1 371 ? 255.628 78.633  -51.508 1.00 47.24  ? 402 TYR A CD2   1 
ATOM   2990 C  CE1   . TYR A 1 371 ? 255.076 75.947  -51.915 1.00 47.24  ? 402 TYR A CE1   1 
ATOM   2991 C  CE2   . TYR A 1 371 ? 256.632 77.685  -51.323 1.00 47.24  ? 402 TYR A CE2   1 
ATOM   2992 C  CZ    . TYR A 1 371 ? 256.350 76.339  -51.534 1.00 47.24  ? 402 TYR A CZ    1 
ATOM   2993 O  OH    . TYR A 1 371 ? 257.337 75.390  -51.404 1.00 47.24  ? 402 TYR A OH    1 
ATOM   2994 N  N     . SER A 1 372 ? 250.960 79.974  -54.157 1.00 37.93  ? 403 SER A N     1 
ATOM   2995 C  CA    . SER A 1 372 ? 249.789 80.771  -54.493 1.00 37.93  ? 403 SER A CA    1 
ATOM   2996 C  C     . SER A 1 372 ? 248.906 80.843  -53.269 1.00 37.93  ? 403 SER A C     1 
ATOM   2997 O  O     . SER A 1 372 ? 249.239 80.283  -52.236 1.00 37.93  ? 403 SER A O     1 
ATOM   2998 C  CB    . SER A 1 372 ? 249.018 80.086  -55.588 1.00 57.53  ? 403 SER A CB    1 
ATOM   2999 O  OG    . SER A 1 372 ? 248.581 78.838  -55.091 1.00 57.53  ? 403 SER A OG    1 
ATOM   3000 N  N     . TYR A 1 373 ? 247.767 81.512  -53.377 1.00 42.74  ? 404 TYR A N     1 
ATOM   3001 C  CA    . TYR A 1 373 ? 246.885 81.608  -52.225 1.00 42.74  ? 404 TYR A CA    1 
ATOM   3002 C  C     . TYR A 1 373 ? 246.413 80.250  -51.738 1.00 42.74  ? 404 TYR A C     1 
ATOM   3003 O  O     . TYR A 1 373 ? 246.272 80.028  -50.532 1.00 42.74  ? 404 TYR A O     1 
ATOM   3004 C  CB    . TYR A 1 373 ? 245.689 82.494  -52.539 1.00 55.22  ? 404 TYR A CB    1 
ATOM   3005 C  CG    . TYR A 1 373 ? 245.993 83.946  -52.316 1.00 55.22  ? 404 TYR A CG    1 
ATOM   3006 C  CD1   . TYR A 1 373 ? 245.142 84.747  -51.554 1.00 55.22  ? 404 TYR A CD1   1 
ATOM   3007 C  CD2   . TYR A 1 373 ? 247.132 84.526  -52.864 1.00 55.22  ? 404 TYR A CD2   1 
ATOM   3008 C  CE1   . TYR A 1 373 ? 245.422 86.094  -51.345 1.00 55.22  ? 404 TYR A CE1   1 
ATOM   3009 C  CE2   . TYR A 1 373 ? 247.421 85.868  -52.663 1.00 55.22  ? 404 TYR A CE2   1 
ATOM   3010 C  CZ    . TYR A 1 373 ? 246.564 86.645  -51.903 1.00 55.22  ? 404 TYR A CZ    1 
ATOM   3011 O  OH    . TYR A 1 373 ? 246.859 87.969  -51.690 1.00 55.22  ? 404 TYR A OH    1 
ATOM   3012 N  N     . GLU A 1 374 ? 246.170 79.347  -52.683 1.00 54.83  ? 405 GLU A N     1 
ATOM   3013 C  CA    . GLU A 1 374 ? 245.727 78.005  -52.356 1.00 54.83  ? 405 GLU A CA    1 
ATOM   3014 C  C     . GLU A 1 374 ? 246.848 77.313  -51.589 1.00 54.83  ? 405 GLU A C     1 
ATOM   3015 O  O     . GLU A 1 374 ? 246.634 76.790  -50.495 1.00 54.83  ? 405 GLU A O     1 
ATOM   3016 C  CB    . GLU A 1 374 ? 245.406 77.240  -53.624 1.00 41.56  ? 405 GLU A CB    1 
ATOM   3017 N  N     . GLN A 1 375 ? 248.049 77.321  -52.157 1.00 50.35  ? 406 GLN A N     1 
ATOM   3018 C  CA    . GLN A 1 375 ? 249.199 76.695  -51.507 1.00 50.35  ? 406 GLN A CA    1 
ATOM   3019 C  C     . GLN A 1 375 ? 249.543 77.365  -50.167 1.00 50.35  ? 406 GLN A C     1 
ATOM   3020 O  O     . GLN A 1 375 ? 250.006 76.698  -49.234 1.00 50.35  ? 406 GLN A O     1 
ATOM   3021 C  CB    . GLN A 1 375 ? 250.432 76.788  -52.404 1.00 56.09  ? 406 GLN A CB    1 
ATOM   3022 C  CG    . GLN A 1 375 ? 250.340 76.111  -53.756 1.00 56.09  ? 406 GLN A CG    1 
ATOM   3023 C  CD    . GLN A 1 375 ? 251.525 76.476  -54.646 1.00 56.09  ? 406 GLN A CD    1 
ATOM   3024 O  OE1   . GLN A 1 375 ? 251.580 77.578  -55.205 1.00 56.09  ? 406 GLN A OE1   1 
ATOM   3025 N  NE2   . GLN A 1 375 ? 252.489 75.563  -54.761 1.00 56.09  ? 406 GLN A NE2   1 
ATOM   3026 N  N     . PHE A 1 376 ? 249.316 78.681  -50.088 1.00 41.72  ? 407 PHE A N     1 
ATOM   3027 C  CA    . PHE A 1 376 ? 249.643 79.472  -48.902 1.00 41.72  ? 407 PHE A CA    1 
ATOM   3028 C  C     . PHE A 1 376 ? 248.600 79.448  -47.821 1.00 41.72  ? 407 PHE A C     1 
ATOM   3029 O  O     . PHE A 1 376 ? 248.827 78.885  -46.762 1.00 41.72  ? 407 PHE A O     1 
ATOM   3030 C  CB    . PHE A 1 376 ? 249.910 80.926  -49.280 1.00 41.52  ? 407 PHE A CB    1 
ATOM   3031 C  CG    . PHE A 1 376 ? 250.829 81.634  -48.324 1.00 41.52  ? 407 PHE A CG    1 
ATOM   3032 C  CD1   . PHE A 1 376 ? 252.152 81.207  -48.168 1.00 41.52  ? 407 PHE A CD1   1 
ATOM   3033 C  CD2   . PHE A 1 376 ? 250.378 82.709  -47.567 1.00 41.52  ? 407 PHE A CD2   1 
ATOM   3034 C  CE1   . PHE A 1 376 ? 253.007 81.837  -47.275 1.00 41.52  ? 407 PHE A CE1   1 
ATOM   3035 C  CE2   . PHE A 1 376 ? 251.226 83.343  -46.670 1.00 41.52  ? 407 PHE A CE2   1 
ATOM   3036 C  CZ    . PHE A 1 376 ? 252.546 82.905  -46.525 1.00 41.52  ? 407 PHE A CZ    1 
ATOM   3037 N  N     . LEU A 1 377 ? 247.462 80.080  -48.071 1.00 51.18  ? 408 LEU A N     1 
ATOM   3038 C  CA    . LEU A 1 377 ? 246.404 80.090  -47.071 1.00 51.18  ? 408 LEU A CA    1 
ATOM   3039 C  C     . LEU A 1 377 ? 246.266 78.715  -46.404 1.00 51.18  ? 408 LEU A C     1 
ATOM   3040 O  O     . LEU A 1 377 ? 246.424 77.674  -47.044 1.00 51.18  ? 408 LEU A O     1 
ATOM   3041 C  CB    . LEU A 1 377 ? 245.073 80.473  -47.705 1.00 45.63  ? 408 LEU A CB    1 
ATOM   3042 C  CG    . LEU A 1 377 ? 244.913 81.885  -48.251 1.00 45.63  ? 408 LEU A CG    1 
ATOM   3043 C  CD1   . LEU A 1 377 ? 243.502 82.046  -48.806 1.00 45.63  ? 408 LEU A CD1   1 
ATOM   3044 C  CD2   . LEU A 1 377 ? 245.161 82.885  -47.151 1.00 45.63  ? 408 LEU A CD2   1 
ATOM   3045 N  N     . PHE A 1 378 ? 245.987 78.716  -45.111 1.00 38.30  ? 409 PHE A N     1 
ATOM   3046 C  CA    . PHE A 1 378 ? 245.815 77.482  -44.366 1.00 38.30  ? 409 PHE A CA    1 
ATOM   3047 C  C     . PHE A 1 378 ? 246.901 76.446  -44.521 1.00 38.30  ? 409 PHE A C     1 
ATOM   3048 O  O     . PHE A 1 378 ? 246.828 75.400  -43.890 1.00 38.30  ? 409 PHE A O     1 
ATOM   3049 C  CB    . PHE A 1 378 ? 244.498 76.851  -44.730 1.00 50.76  ? 409 PHE A CB    1 
ATOM   3050 C  CG    . PHE A 1 378 ? 243.410 77.830  -44.876 1.00 50.76  ? 409 PHE A CG    1 
ATOM   3051 C  CD1   . PHE A 1 378 ? 243.210 78.476  -46.085 1.00 50.76  ? 409 PHE A CD1   1 
ATOM   3052 C  CD2   . PHE A 1 378 ? 242.593 78.133  -43.796 1.00 50.76  ? 409 PHE A CD2   1 
ATOM   3053 C  CE1   . PHE A 1 378 ? 242.207 79.418  -46.230 1.00 50.76  ? 409 PHE A CE1   1 
ATOM   3054 C  CE2   . PHE A 1 378 ? 241.580 79.075  -43.914 1.00 50.76  ? 409 PHE A CE2   1 
ATOM   3055 C  CZ    . PHE A 1 378 ? 241.382 79.724  -45.143 1.00 50.76  ? 409 PHE A CZ    1 
ATOM   3056 N  N     . ASN A 1 379 ? 247.903 76.698  -45.352 1.00 36.31  ? 410 ASN A N     1 
ATOM   3057 C  CA    . ASN A 1 379 ? 248.970 75.716  -45.470 1.00 36.31  ? 410 ASN A CA    1 
ATOM   3058 C  C     . ASN A 1 379 ? 249.308 75.434  -44.017 1.00 36.31  ? 410 ASN A C     1 
ATOM   3059 O  O     . ASN A 1 379 ? 248.969 76.231  -43.154 1.00 36.31  ? 410 ASN A O     1 
ATOM   3060 C  CB    . ASN A 1 379 ? 250.188 76.301  -46.188 1.00 59.69  ? 410 ASN A CB    1 
ATOM   3061 C  CG    . ASN A 1 379 ? 251.241 75.248  -46.503 1.00 59.69  ? 410 ASN A CG    1 
ATOM   3062 O  OD1   . ASN A 1 379 ? 251.945 74.754  -45.607 1.00 59.69  ? 410 ASN A OD1   1 
ATOM   3063 N  ND2   . ASN A 1 379 ? 251.329 74.894  -47.784 1.00 59.69  ? 410 ASN A ND2   1 
ATOM   3064 N  N     . THR A 1 380 ? 249.962 74.324  -43.717 1.00 38.75  ? 411 THR A N     1 
ATOM   3065 C  CA    . THR A 1 380 ? 250.240 74.064  -42.319 1.00 38.75  ? 411 THR A CA    1 
ATOM   3066 C  C     . THR A 1 380 ? 251.566 73.426  -42.037 1.00 38.75  ? 411 THR A C     1 
ATOM   3067 O  O     . THR A 1 380 ? 251.732 72.790  -41.000 1.00 38.75  ? 411 THR A O     1 
ATOM   3068 C  CB    . THR A 1 380 ? 249.143 73.194  -41.702 1.00 48.59  ? 411 THR A CB    1 
ATOM   3069 O  OG1   . THR A 1 380 ? 248.838 72.107  -42.593 1.00 48.59  ? 411 THR A OG1   1 
ATOM   3070 C  CG2   . THR A 1 380 ? 247.886 74.027  -41.457 1.00 48.59  ? 411 THR A CG2   1 
ATOM   3071 N  N     . SER A 1 381 ? 252.513 73.613  -42.949 1.00 61.40  ? 412 SER A N     1 
ATOM   3072 C  CA    . SER A 1 381 ? 253.842 73.040  -42.779 1.00 61.40  ? 412 SER A CA    1 
ATOM   3073 C  C     . SER A 1 381 ? 254.937 73.931  -43.361 1.00 61.40  ? 412 SER A C     1 
ATOM   3074 O  O     . SER A 1 381 ? 256.123 73.754  -43.050 1.00 61.40  ? 412 SER A O     1 
ATOM   3075 C  CB    . SER A 1 381 ? 253.905 71.670  -43.448 1.00 79.91  ? 412 SER A CB    1 
ATOM   3076 O  OG    . SER A 1 381 ? 253.710 71.797  -44.847 1.00 79.91  ? 412 SER A OG    1 
ATOM   3077 N  N     . MET A 1 382 ? 254.538 74.879  -44.212 1.00 57.27  ? 413 MET A N     1 
ATOM   3078 C  CA    . MET A 1 382 ? 255.487 75.799  -44.839 1.00 57.27  ? 413 MET A CA    1 
ATOM   3079 C  C     . MET A 1 382 ? 256.443 76.339  -43.787 1.00 57.27  ? 413 MET A C     1 
ATOM   3080 O  O     . MET A 1 382 ? 257.651 76.429  -44.021 1.00 57.27  ? 413 MET A O     1 
ATOM   3081 C  CB    . MET A 1 382 ? 254.752 76.967  -45.505 1.00 60.01  ? 413 MET A CB    1 
ATOM   3082 C  CG    . MET A 1 382 ? 255.628 77.796  -46.440 1.00 60.01  ? 413 MET A CG    1 
ATOM   3083 S  SD    . MET A 1 382 ? 254.718 79.011  -47.453 1.00 60.01  ? 413 MET A SD    1 
ATOM   3084 C  CE    . MET A 1 382 ? 253.729 77.931  -48.571 1.00 60.01  ? 413 MET A CE    1 
ATOM   3085 N  N     . LEU A 1 383 ? 255.893 76.678  -42.622 1.00 42.18  ? 414 LEU A N     1 
ATOM   3086 C  CA    . LEU A 1 383 ? 256.689 77.218  -41.530 1.00 42.18  ? 414 LEU A CA    1 
ATOM   3087 C  C     . LEU A 1 383 ? 257.810 76.295  -41.091 1.00 42.18  ? 414 LEU A C     1 
ATOM   3088 O  O     . LEU A 1 383 ? 258.988 76.667  -41.124 1.00 42.18  ? 414 LEU A O     1 
ATOM   3089 C  CB    . LEU A 1 383 ? 255.788 77.547  -40.334 1.00 38.53  ? 414 LEU A CB    1 
ATOM   3090 C  CG    . LEU A 1 383 ? 256.409 78.044  -39.012 1.00 38.53  ? 414 LEU A CG    1 
ATOM   3091 C  CD1   . LEU A 1 383 ? 257.715 78.786  -39.243 1.00 38.53  ? 414 LEU A CD1   1 
ATOM   3092 C  CD2   . LEU A 1 383 ? 255.404 78.945  -38.313 1.00 38.53  ? 414 LEU A CD2   1 
ATOM   3093 N  N     . VAL A 1 384 ? 257.445 75.089  -40.675 1.00 39.28  ? 415 VAL A N     1 
ATOM   3094 C  CA    . VAL A 1 384 ? 258.447 74.146  -40.208 1.00 39.28  ? 415 VAL A CA    1 
ATOM   3095 C  C     . VAL A 1 384 ? 259.186 73.538  -41.372 1.00 39.28  ? 415 VAL A C     1 
ATOM   3096 O  O     . VAL A 1 384 ? 260.283 73.018  -41.214 1.00 39.28  ? 415 VAL A O     1 
ATOM   3097 C  CB    . VAL A 1 384 ? 257.825 73.019  -39.365 1.00 38.21  ? 415 VAL A CB    1 
ATOM   3098 C  CG1   . VAL A 1 384 ? 258.925 72.151  -38.775 1.00 38.21  ? 415 VAL A CG1   1 
ATOM   3099 C  CG2   . VAL A 1 384 ? 256.960 73.608  -38.264 1.00 38.21  ? 415 VAL A CG2   1 
ATOM   3100 N  N     . ASP A 1 385 ? 258.588 73.596  -42.549 1.00 31.68  ? 416 ASP A N     1 
ATOM   3101 C  CA    . ASP A 1 385 ? 259.256 73.037  -43.697 1.00 31.68  ? 416 ASP A CA    1 
ATOM   3102 C  C     . ASP A 1 385 ? 260.420 73.959  -44.014 1.00 31.68  ? 416 ASP A C     1 
ATOM   3103 O  O     . ASP A 1 385 ? 261.580 73.561  -43.932 1.00 31.68  ? 416 ASP A O     1 
ATOM   3104 C  CB    . ASP A 1 385 ? 258.298 72.947  -44.877 1.00 39.83  ? 416 ASP A CB    1 
ATOM   3105 N  N     . TYR A 1 386 ? 260.102 75.212  -44.325 1.00 50.14  ? 417 TYR A N     1 
ATOM   3106 C  CA    . TYR A 1 386 ? 261.106 76.209  -44.681 1.00 50.14  ? 417 TYR A CA    1 
ATOM   3107 C  C     . TYR A 1 386 ? 262.012 76.709  -43.556 1.00 50.14  ? 417 TYR A C     1 
ATOM   3108 O  O     . TYR A 1 386 ? 263.237 76.779  -43.720 1.00 50.14  ? 417 TYR A O     1 
ATOM   3109 C  CB    . TYR A 1 386 ? 260.420 77.390  -45.355 1.00 40.46  ? 417 TYR A CB    1 
ATOM   3110 C  CG    . TYR A 1 386 ? 260.072 77.126  -46.800 1.00 40.46  ? 417 TYR A CG    1 
ATOM   3111 C  CD1   . TYR A 1 386 ? 258.751 77.180  -47.244 1.00 40.46  ? 417 TYR A CD1   1 
ATOM   3112 C  CD2   . TYR A 1 386 ? 261.072 76.877  -47.738 1.00 40.46  ? 417 TYR A CD2   1 
ATOM   3113 C  CE1   . TYR A 1 386 ? 258.432 77.006  -48.596 1.00 40.46  ? 417 TYR A CE1   1 
ATOM   3114 C  CE2   . TYR A 1 386 ? 260.770 76.700  -49.086 1.00 40.46  ? 417 TYR A CE2   1 
ATOM   3115 C  CZ    . TYR A 1 386 ? 259.448 76.773  -49.511 1.00 40.46  ? 417 TYR A CZ    1 
ATOM   3116 O  OH    . TYR A 1 386 ? 259.165 76.677  -50.856 1.00 40.46  ? 417 TYR A OH    1 
ATOM   3117 N  N     . GLY A 1 387 ? 261.421 77.063  -42.419 1.00 76.88  ? 418 GLY A N     1 
ATOM   3118 C  CA    . GLY A 1 387 ? 262.222 77.549  -41.305 1.00 76.88  ? 418 GLY A CA    1 
ATOM   3119 C  C     . GLY A 1 387 ? 262.212 79.065  -41.183 1.00 76.88  ? 418 GLY A C     1 
ATOM   3120 O  O     . GLY A 1 387 ? 262.271 79.785  -42.193 1.00 76.88  ? 418 GLY A O     1 
ATOM   3121 N  N     . VAL A 1 388 ? 262.130 79.553  -39.946 1.00 65.96  ? 419 VAL A N     1 
ATOM   3122 C  CA    . VAL A 1 388 ? 262.105 80.991  -39.688 1.00 65.96  ? 419 VAL A CA    1 
ATOM   3123 C  C     . VAL A 1 388 ? 263.163 81.696  -40.522 1.00 65.96  ? 419 VAL A C     1 
ATOM   3124 O  O     . VAL A 1 388 ? 262.822 82.487  -41.402 1.00 65.96  ? 419 VAL A O     1 
ATOM   3125 C  CB    . VAL A 1 388 ? 262.329 81.309  -38.185 1.00 46.22  ? 419 VAL A CB    1 
ATOM   3126 C  CG1   . VAL A 1 388 ? 262.625 82.787  -37.993 1.00 46.22  ? 419 VAL A CG1   1 
ATOM   3127 C  CG2   . VAL A 1 388 ? 261.088 80.943  -37.398 1.00 46.22  ? 419 VAL A CG2   1 
ATOM   3128 N  N     . GLU A 1 389 ? 264.434 81.401  -40.262 1.00 45.94  ? 420 GLU A N     1 
ATOM   3129 C  CA    . GLU A 1 389 ? 265.505 82.036  -41.015 1.00 45.94  ? 420 GLU A CA    1 
ATOM   3130 C  C     . GLU A 1 389 ? 265.087 82.235  -42.469 1.00 45.94  ? 420 GLU A C     1 
ATOM   3131 O  O     . GLU A 1 389 ? 264.934 83.363  -42.940 1.00 45.94  ? 420 GLU A O     1 
ATOM   3132 C  CB    . GLU A 1 389 ? 266.787 81.192  -40.986 1.00 58.03  ? 420 GLU A CB    1 
ATOM   3133 C  CG    . GLU A 1 389 ? 267.527 81.146  -39.655 1.00 58.03  ? 420 GLU A CG    1 
ATOM   3134 C  CD    . GLU A 1 389 ? 267.011 80.066  -38.706 1.00 58.03  ? 420 GLU A CD    1 
ATOM   3135 O  OE1   . GLU A 1 389 ? 265.768 79.900  -38.582 1.00 58.03  ? 420 GLU A OE1   1 
ATOM   3136 O  OE2   . GLU A 1 389 ? 267.865 79.384  -38.084 1.00 58.03  ? 420 GLU A OE2   1 
ATOM   3137 N  N     . ALA A 1 390 ? 264.877 81.123  -43.165 1.00 41.18  ? 421 ALA A N     1 
ATOM   3138 C  CA    . ALA A 1 390 ? 264.516 81.146  -44.572 1.00 41.18  ? 421 ALA A CA    1 
ATOM   3139 C  C     . ALA A 1 390 ? 263.217 81.868  -44.925 1.00 41.18  ? 421 ALA A C     1 
ATOM   3140 O  O     . ALA A 1 390 ? 263.159 82.554  -45.941 1.00 41.18  ? 421 ALA A O     1 
ATOM   3141 C  CB    . ALA A 1 390 ? 264.487 79.727  -45.108 1.00 31.38  ? 421 ALA A CB    1 
ATOM   3142 N  N     . LEU A 1 391 ? 262.174 81.727  -44.112 1.00 42.54  ? 422 LEU A N     1 
ATOM   3143 C  CA    . LEU A 1 391 ? 260.920 82.396  -44.442 1.00 42.54  ? 422 LEU A CA    1 
ATOM   3144 C  C     . LEU A 1 391 ? 260.909 83.901  -44.193 1.00 42.54  ? 422 LEU A C     1 
ATOM   3145 O  O     . LEU A 1 391 ? 260.146 84.638  -44.831 1.00 42.54  ? 422 LEU A O     1 
ATOM   3146 C  CB    . LEU A 1 391 ? 259.741 81.741  -43.720 1.00 49.80  ? 422 LEU A CB    1 
ATOM   3147 C  CG    . LEU A 1 391 ? 259.062 80.580  -44.458 1.00 49.80  ? 422 LEU A CG    1 
ATOM   3148 C  CD1   . LEU A 1 391 ? 257.659 80.415  -43.888 1.00 49.80  ? 422 LEU A CD1   1 
ATOM   3149 C  CD2   . LEU A 1 391 ? 258.982 80.856  -45.967 1.00 49.80  ? 422 LEU A CD2   1 
ATOM   3150 N  N     . VAL A 1 392 ? 261.735 84.355  -43.255 1.00 71.73  ? 423 VAL A N     1 
ATOM   3151 C  CA    . VAL A 1 392 ? 261.848 85.787  -42.979 1.00 71.73  ? 423 VAL A CA    1 
ATOM   3152 C  C     . VAL A 1 392 ? 262.564 86.378  -44.197 1.00 71.73  ? 423 VAL A C     1 
ATOM   3153 O  O     . VAL A 1 392 ? 262.090 87.331  -44.819 1.00 71.73  ? 423 VAL A O     1 
ATOM   3154 C  CB    . VAL A 1 392 ? 262.686 86.059  -41.703 1.00 42.97  ? 423 VAL A CB    1 
ATOM   3155 C  CG1   . VAL A 1 392 ? 263.124 87.510  -41.662 1.00 42.97  ? 423 VAL A CG1   1 
ATOM   3156 C  CG2   . VAL A 1 392 ? 261.862 85.729  -40.469 1.00 42.97  ? 423 VAL A CG2   1 
ATOM   3157 N  N     . ASP A 1 393 ? 263.699 85.781  -44.546 1.00 47.22  ? 424 ASP A N     1 
ATOM   3158 C  CA    . ASP A 1 393 ? 264.469 86.228  -45.693 1.00 47.22  ? 424 ASP A CA    1 
ATOM   3159 C  C     . ASP A 1 393 ? 263.595 86.317  -46.944 1.00 47.22  ? 424 ASP A C     1 
ATOM   3160 O  O     . ASP A 1 393 ? 263.759 87.211  -47.762 1.00 47.22  ? 424 ASP A O     1 
ATOM   3161 C  CB    . ASP A 1 393 ? 265.625 85.266  -45.962 1.00 54.91  ? 424 ASP A CB    1 
ATOM   3162 C  CG    . ASP A 1 393 ? 266.431 85.664  -47.186 1.00 54.91  ? 424 ASP A CG    1 
ATOM   3163 O  OD1   . ASP A 1 393 ? 267.264 86.592  -47.070 1.00 54.91  ? 424 ASP A OD1   1 
ATOM   3164 O  OD2   . ASP A 1 393 ? 266.218 85.067  -48.270 1.00 54.91  ? 424 ASP A OD2   1 
ATOM   3165 N  N     . ALA A 1 394 ? 262.664 85.386  -47.086 1.00 48.55  ? 425 ALA A N     1 
ATOM   3166 C  CA    . ALA A 1 394 ? 261.788 85.362  -48.249 1.00 48.55  ? 425 ALA A CA    1 
ATOM   3167 C  C     . ALA A 1 394 ? 260.781 86.508  -48.260 1.00 48.55  ? 425 ALA A C     1 
ATOM   3168 O  O     . ALA A 1 394 ? 260.448 87.049  -49.320 1.00 48.55  ? 425 ALA A O     1 
ATOM   3169 C  CB    . ALA A 1 394 ? 261.057 84.033  -48.315 1.00 75.69  ? 425 ALA A CB    1 
ATOM   3170 N  N     . PHE A 1 395 ? 260.284 86.868  -47.086 1.00 59.75  ? 426 PHE A N     1 
ATOM   3171 C  CA    . PHE A 1 395 ? 259.318 87.950  -47.008 1.00 59.75  ? 426 PHE A CA    1 
ATOM   3172 C  C     . PHE A 1 395 ? 260.041 89.289  -47.072 1.00 59.75  ? 426 PHE A C     1 
ATOM   3173 O  O     . PHE A 1 395 ? 259.631 90.196  -47.803 1.00 59.75  ? 426 PHE A O     1 
ATOM   3174 C  CB    . PHE A 1 395 ? 258.494 87.846  -45.720 1.00 49.74  ? 426 PHE A CB    1 
ATOM   3175 C  CG    . PHE A 1 395 ? 257.642 86.609  -45.640 1.00 49.74  ? 426 PHE A CG    1 
ATOM   3176 C  CD1   . PHE A 1 395 ? 256.962 86.139  -46.761 1.00 49.74  ? 426 PHE A CD1   1 
ATOM   3177 C  CD2   . PHE A 1 395 ? 257.492 85.932  -44.437 1.00 49.74  ? 426 PHE A CD2   1 
ATOM   3178 C  CE1   . PHE A 1 395 ? 256.143 85.012  -46.683 1.00 49.74  ? 426 PHE A CE1   1 
ATOM   3179 C  CE2   . PHE A 1 395 ? 256.675 84.804  -44.349 1.00 49.74  ? 426 PHE A CE2   1 
ATOM   3180 C  CZ    . PHE A 1 395 ? 256.000 84.345  -45.476 1.00 49.74  ? 426 PHE A CZ    1 
ATOM   3181 N  N     . SER A 1 396 ? 261.127 89.408  -46.317 1.00 52.89  ? 427 SER A N     1 
ATOM   3182 C  CA    . SER A 1 396 ? 261.889 90.647  -46.309 1.00 52.89  ? 427 SER A CA    1 
ATOM   3183 C  C     . SER A 1 396 ? 262.365 91.009  -47.711 1.00 52.89  ? 427 SER A C     1 
ATOM   3184 O  O     . SER A 1 396 ? 262.777 92.138  -47.951 1.00 52.89  ? 427 SER A O     1 
ATOM   3185 C  CB    . SER A 1 396 ? 263.100 90.538  -45.370 1.00 48.63  ? 427 SER A CB    1 
ATOM   3186 O  OG    . SER A 1 396 ? 262.704 90.475  -44.010 1.00 48.63  ? 427 SER A OG    1 
ATOM   3187 N  N     . ARG A 1 397 ? 262.295 90.057  -48.640 1.00 34.06  ? 428 ARG A N     1 
ATOM   3188 C  CA    . ARG A 1 397 ? 262.747 90.310  -49.996 1.00 34.06  ? 428 ARG A CA    1 
ATOM   3189 C  C     . ARG A 1 397 ? 261.663 90.608  -51.011 1.00 34.06  ? 428 ARG A C     1 
ATOM   3190 O  O     . ARG A 1 397 ? 261.908 91.320  -51.972 1.00 34.06  ? 428 ARG A O     1 
ATOM   3191 C  CB    . ARG A 1 397 ? 263.590 89.145  -50.491 1.00 34.12  ? 428 ARG A CB    1 
ATOM   3192 C  CG    . ARG A 1 397 ? 265.015 89.188  -50.028 1.00 34.12  ? 428 ARG A CG    1 
ATOM   3193 C  CD    . ARG A 1 397 ? 265.560 87.798  -49.962 1.00 34.12  ? 428 ARG A CD    1 
ATOM   3194 N  NE    . ARG A 1 397 ? 266.945 87.752  -49.523 1.00 34.12  ? 428 ARG A NE    1 
ATOM   3195 C  CZ    . ARG A 1 397 ? 267.964 88.188  -50.248 1.00 34.12  ? 428 ARG A CZ    1 
ATOM   3196 N  NH1   . ARG A 1 397 ? 267.735 88.708  -51.452 1.00 34.12  ? 428 ARG A NH1   1 
ATOM   3197 N  NH2   . ARG A 1 397 ? 269.204 88.091  -49.775 1.00 34.12  ? 428 ARG A NH2   1 
ATOM   3198 N  N     . GLN A 1 398 ? 260.467 90.070  -50.827 1.00 42.04  ? 429 GLN A N     1 
ATOM   3199 C  CA    . GLN A 1 398 ? 259.410 90.335  -51.795 1.00 42.04  ? 429 GLN A CA    1 
ATOM   3200 C  C     . GLN A 1 398 ? 258.683 91.606  -51.419 1.00 42.04  ? 429 GLN A C     1 
ATOM   3201 O  O     . GLN A 1 398 ? 258.343 91.812  -50.262 1.00 42.04  ? 429 GLN A O     1 
ATOM   3202 C  CB    . GLN A 1 398 ? 258.412 89.183  -51.845 1.00 56.30  ? 429 GLN A CB    1 
ATOM   3203 C  CG    . GLN A 1 398 ? 257.210 89.447  -52.750 1.00 56.30  ? 429 GLN A CG    1 
ATOM   3204 C  CD    . GLN A 1 398 ? 256.153 88.357  -52.632 1.00 56.30  ? 429 GLN A CD    1 
ATOM   3205 O  OE1   . GLN A 1 398 ? 256.481 87.169  -52.596 1.00 56.30  ? 429 GLN A OE1   1 
ATOM   3206 N  NE2   . GLN A 1 398 ? 254.883 88.751  -52.575 1.00 56.30  ? 429 GLN A NE2   1 
ATOM   3207 N  N     . PRO A 1 399 ? 258.444 92.485  -52.396 1.00 37.58  ? 430 PRO A N     1 
ATOM   3208 C  CA    . PRO A 1 399 ? 257.744 93.741  -52.123 1.00 37.58  ? 430 PRO A CA    1 
ATOM   3209 C  C     . PRO A 1 399 ? 256.269 93.558  -51.797 1.00 37.58  ? 430 PRO A C     1 
ATOM   3210 O  O     . PRO A 1 399 ? 255.667 92.547  -52.159 1.00 37.58  ? 430 PRO A O     1 
ATOM   3211 C  CB    . PRO A 1 399 ? 257.953 94.534  -53.406 1.00 38.22  ? 430 PRO A CB    1 
ATOM   3212 C  CG    . PRO A 1 399 ? 258.084 93.467  -54.449 1.00 38.22  ? 430 PRO A CG    1 
ATOM   3213 C  CD    . PRO A 1 399 ? 258.968 92.464  -53.771 1.00 38.22  ? 430 PRO A CD    1 
ATOM   3214 N  N     . ALA A 1 400 ? 255.716 94.548  -51.094 1.00 40.40  ? 431 ALA A N     1 
ATOM   3215 C  CA    . ALA A 1 400 ? 254.308 94.573  -50.706 1.00 40.40  ? 431 ALA A CA    1 
ATOM   3216 C  C     . ALA A 1 400 ? 253.629 95.442  -51.741 1.00 40.40  ? 431 ALA A C     1 
ATOM   3217 O  O     . ALA A 1 400 ? 254.235 95.762  -52.755 1.00 40.40  ? 431 ALA A O     1 
ATOM   3218 C  CB    . ALA A 1 400 ? 254.144 95.169  -49.339 1.00 33.67  ? 431 ALA A CB    1 
ATOM   3219 N  N     . GLY A 1 401 ? 252.392 95.844  -51.500 1.00 43.44  ? 432 GLY A N     1 
ATOM   3220 C  CA    . GLY A 1 401 ? 251.719 96.665  -52.488 1.00 43.44  ? 432 GLY A CA    1 
ATOM   3221 C  C     . GLY A 1 401 ? 251.300 98.028  -51.988 1.00 43.44  ? 432 GLY A C     1 
ATOM   3222 O  O     . GLY A 1 401 ? 251.103 98.216  -50.793 1.00 43.44  ? 432 GLY A O     1 
ATOM   3223 N  N     . ARG A 1 402 ? 251.165 98.984  -52.897 1.00 33.16  ? 433 ARG A N     1 
ATOM   3224 C  CA    . ARG A 1 402 ? 250.739 100.318 -52.506 1.00 33.16  ? 433 ARG A CA    1 
ATOM   3225 C  C     . ARG A 1 402 ? 249.369 100.233 -51.851 1.00 33.16  ? 433 ARG A C     1 
ATOM   3226 O  O     . ARG A 1 402 ? 248.453 99.628  -52.391 1.00 33.16  ? 433 ARG A O     1 
ATOM   3227 C  CB    . ARG A 1 402 ? 250.679 101.250 -53.719 1.00 67.20  ? 433 ARG A CB    1 
ATOM   3228 C  CG    . ARG A 1 402 ? 249.871 102.522 -53.455 1.00 67.20  ? 433 ARG A CG    1 
ATOM   3229 C  CD    . ARG A 1 402 ? 250.581 103.799 -53.910 1.00 67.20  ? 433 ARG A CD    1 
ATOM   3230 N  NE    . ARG A 1 402 ? 250.704 103.939 -55.365 1.00 67.20  ? 433 ARG A NE    1 
ATOM   3231 C  CZ    . ARG A 1 402 ? 249.691 103.843 -56.228 1.00 67.20  ? 433 ARG A CZ    1 
ATOM   3232 N  NH1   . ARG A 1 402 ? 248.452 103.597 -55.799 1.00 67.20  ? 433 ARG A NH1   1 
ATOM   3233 N  NH2   . ARG A 1 402 ? 249.917 104.009 -57.527 1.00 67.20  ? 433 ARG A NH2   1 
ATOM   3234 N  N     . ILE A 1 403 ? 249.232 100.854 -50.689 1.00 32.82  ? 434 ILE A N     1 
ATOM   3235 C  CA    . ILE A 1 403 ? 247.974 100.824 -49.965 1.00 32.82  ? 434 ILE A CA    1 
ATOM   3236 C  C     . ILE A 1 403 ? 246.895 101.694 -50.578 1.00 32.82  ? 434 ILE A C     1 
ATOM   3237 O  O     . ILE A 1 403 ? 245.753 101.271 -50.694 1.00 32.82  ? 434 ILE A O     1 
ATOM   3238 C  CB    . ILE A 1 403 ? 248.173 101.251 -48.507 1.00 39.62  ? 434 ILE A CB    1 
ATOM   3239 C  CG1   . ILE A 1 403 ? 249.169 100.303 -47.831 1.00 39.62  ? 434 ILE A CG1   1 
ATOM   3240 C  CG2   . ILE A 1 403 ? 246.842 101.239 -47.780 1.00 39.62  ? 434 ILE A CG2   1 
ATOM   3241 C  CD1   . ILE A 1 403 ? 249.564 100.699 -46.417 1.00 39.62  ? 434 ILE A CD1   1 
ATOM   3242 N  N     . GLY A 1 404 ? 247.256 102.910 -50.973 1.00 41.41  ? 435 GLY A N     1 
ATOM   3243 C  CA    . GLY A 1 404 ? 246.276 103.813 -51.550 1.00 41.41  ? 435 GLY A CA    1 
ATOM   3244 C  C     . GLY A 1 404 ? 246.279 103.843 -53.058 1.00 41.41  ? 435 GLY A C     1 
ATOM   3245 O  O     . GLY A 1 404 ? 246.689 102.892 -53.708 1.00 41.41  ? 435 GLY A O     1 
ATOM   3246 N  N     . GLY A 1 405 ? 245.812 104.947 -53.620 1.00 55.34  ? 436 GLY A N     1 
ATOM   3247 C  CA    . GLY A 1 405 ? 245.778 105.070 -55.065 1.00 55.34  ? 436 GLY A CA    1 
ATOM   3248 C  C     . GLY A 1 405 ? 244.494 104.544 -55.673 1.00 55.34  ? 436 GLY A C     1 
ATOM   3249 O  O     . GLY A 1 405 ? 243.895 105.185 -56.549 1.00 55.34  ? 436 GLY A O     1 
ATOM   3250 N  N     . GLY A 1 406 ? 244.073 103.372 -55.200 1.00 50.99  ? 437 GLY A N     1 
ATOM   3251 C  CA    . GLY A 1 406 ? 242.858 102.752 -55.697 1.00 50.99  ? 437 GLY A CA    1 
ATOM   3252 C  C     . GLY A 1 406 ? 243.175 101.570 -56.589 1.00 50.99  ? 437 GLY A C     1 
ATOM   3253 O  O     . GLY A 1 406 ? 244.206 101.559 -57.267 1.00 50.99  ? 437 GLY A O     1 
ATOM   3254 N  N     . ARG A 1 407 ? 242.300 100.569 -56.580 1.00 24.18  ? 438 ARG A N     1 
ATOM   3255 C  CA    . ARG A 1 407 ? 242.485 99.377  -57.399 1.00 24.18  ? 438 ARG A CA    1 
ATOM   3256 C  C     . ARG A 1 407 ? 243.784 98.655  -57.134 1.00 24.18  ? 438 ARG A C     1 
ATOM   3257 O  O     . ARG A 1 407 ? 244.634 98.595  -58.005 1.00 24.18  ? 438 ARG A O     1 
ATOM   3258 C  CB    . ARG A 1 407 ? 242.472 99.719  -58.890 1.00 55.59  ? 438 ARG A CB    1 
ATOM   3259 C  CG    . ARG A 1 407 ? 241.247 100.439 -59.395 1.00 55.59  ? 438 ARG A CG    1 
ATOM   3260 C  CD    . ARG A 1 407 ? 241.289 100.555 -60.911 1.00 55.59  ? 438 ARG A CD    1 
ATOM   3261 N  NE    . ARG A 1 407 ? 240.009 101.025 -61.429 1.00 55.59  ? 438 ARG A NE    1 
ATOM   3262 C  CZ    . ARG A 1 407 ? 239.719 101.135 -62.719 1.00 55.59  ? 438 ARG A CZ    1 
ATOM   3263 N  NH1   . ARG A 1 407 ? 240.627 100.807 -63.634 1.00 55.59  ? 438 ARG A NH1   1 
ATOM   3264 N  NH2   . ARG A 1 407 ? 238.516 101.569 -63.089 1.00 55.59  ? 438 ARG A NH2   1 
ATOM   3265 N  N     . ASN A 1 408 ? 243.957 98.100  -55.949 1.00 44.31  ? 439 ASN A N     1 
ATOM   3266 C  CA    . ASN A 1 408 ? 245.185 97.375  -55.706 1.00 44.31  ? 439 ASN A CA    1 
ATOM   3267 C  C     . ASN A 1 408 ? 245.034 96.283  -54.668 1.00 44.31  ? 439 ASN A C     1 
ATOM   3268 O  O     . ASN A 1 408 ? 246.013 95.838  -54.079 1.00 44.31  ? 439 ASN A O     1 
ATOM   3269 C  CB    . ASN A 1 408 ? 246.300 98.337  -55.321 1.00 47.68  ? 439 ASN A CB    1 
ATOM   3270 C  CG    . ASN A 1 408 ? 247.668 97.708  -55.443 1.00 47.68  ? 439 ASN A CG    1 
ATOM   3271 O  OD1   . ASN A 1 408 ? 247.956 96.984  -56.400 1.00 47.68  ? 439 ASN A OD1   1 
ATOM   3272 N  ND2   . ASN A 1 408 ? 248.527 97.993  -54.479 1.00 47.68  ? 439 ASN A ND2   1 
ATOM   3273 N  N     . ILE A 1 409 ? 243.793 95.854  -54.463 1.00 60.79  ? 440 ILE A N     1 
ATOM   3274 C  CA    . ILE A 1 409 ? 243.458 94.781  -53.525 1.00 60.79  ? 440 ILE A CA    1 
ATOM   3275 C  C     . ILE A 1 409 ? 243.258 93.506  -54.349 1.00 60.79  ? 440 ILE A C     1 
ATOM   3276 O  O     . ILE A 1 409 ? 242.328 93.434  -55.160 1.00 60.79  ? 440 ILE A O     1 
ATOM   3277 C  CB    . ILE A 1 409 ? 242.112 95.037  -52.799 1.00 51.01  ? 440 ILE A CB    1 
ATOM   3278 C  CG1   . ILE A 1 409 ? 242.156 96.339  -52.006 1.00 51.01  ? 440 ILE A CG1   1 
ATOM   3279 C  CG2   . ILE A 1 409 ? 241.784 93.863  -51.895 1.00 51.01  ? 440 ILE A CG2   1 
ATOM   3280 C  CD1   . ILE A 1 409 ? 240.777 96.782  -51.491 1.00 51.01  ? 440 ILE A CD1   1 
ATOM   3281 N  N     . ASP A 1 410 ? 244.117 92.512  -54.149 1.00 54.74  ? 441 ASP A N     1 
ATOM   3282 C  CA    . ASP A 1 410 ? 244.002 91.241  -54.864 1.00 54.74  ? 441 ASP A CA    1 
ATOM   3283 C  C     . ASP A 1 410 ? 242.549 90.754  -54.791 1.00 54.74  ? 441 ASP A C     1 
ATOM   3284 O  O     . ASP A 1 410 ? 241.843 91.060  -53.830 1.00 54.74  ? 441 ASP A O     1 
ATOM   3285 C  CB    . ASP A 1 410 ? 244.912 90.220  -54.205 1.00 55.22  ? 441 ASP A CB    1 
ATOM   3286 C  CG    . ASP A 1 410 ? 244.875 88.893  -54.887 1.00 55.22  ? 441 ASP A CG    1 
ATOM   3287 O  OD1   . ASP A 1 410 ? 245.685 88.694  -55.820 1.00 55.22  ? 441 ASP A OD1   1 
ATOM   3288 O  OD2   . ASP A 1 410 ? 244.029 88.059  -54.491 1.00 55.22  ? 441 ASP A OD2   1 
ATOM   3289 N  N     . HIS A 1 411 ? 242.102 89.994  -55.788 1.00 43.43  ? 442 HIS A N     1 
ATOM   3290 C  CA    . HIS A 1 411 ? 240.719 89.504  -55.806 1.00 43.43  ? 442 HIS A CA    1 
ATOM   3291 C  C     . HIS A 1 411 ? 240.398 88.545  -54.667 1.00 43.43  ? 442 HIS A C     1 
ATOM   3292 O  O     . HIS A 1 411 ? 239.365 88.670  -54.015 1.00 43.43  ? 442 HIS A O     1 
ATOM   3293 C  CB    . HIS A 1 411 ? 240.408 88.802  -57.129 1.00 50.73  ? 442 HIS A CB    1 
ATOM   3294 C  CG    . HIS A 1 411 ? 241.202 87.551  -57.350 1.00 50.73  ? 442 HIS A CG    1 
ATOM   3295 N  ND1   . HIS A 1 411 ? 240.827 86.584  -58.257 1.00 50.73  ? 442 HIS A ND1   1 
ATOM   3296 C  CD2   . HIS A 1 411 ? 242.354 87.113  -56.790 1.00 50.73  ? 442 HIS A CD2   1 
ATOM   3297 C  CE1   . HIS A 1 411 ? 241.712 85.603  -58.243 1.00 50.73  ? 442 HIS A CE1   1 
ATOM   3298 N  NE2   . HIS A 1 411 ? 242.649 85.900  -57.362 1.00 50.73  ? 442 HIS A NE2   1 
ATOM   3299 N  N     . HIS A 1 412 ? 241.279 87.579  -54.441 1.00 51.92  ? 443 HIS A N     1 
ATOM   3300 C  CA    . HIS A 1 412 ? 241.081 86.599  -53.390 1.00 51.92  ? 443 HIS A CA    1 
ATOM   3301 C  C     . HIS A 1 412 ? 240.492 87.212  -52.129 1.00 51.92  ? 443 HIS A C     1 
ATOM   3302 O  O     . HIS A 1 412 ? 239.463 86.757  -51.626 1.00 51.92  ? 443 HIS A O     1 
ATOM   3303 C  CB    . HIS A 1 412 ? 242.403 85.940  -53.038 1.00 51.74  ? 443 HIS A CB    1 
ATOM   3304 C  CG    . HIS A 1 412 ? 243.013 85.181  -54.168 1.00 51.74  ? 443 HIS A CG    1 
ATOM   3305 N  ND1   . HIS A 1 412 ? 242.277 84.354  -54.986 1.00 51.74  ? 443 HIS A ND1   1 
ATOM   3306 C  CD2   . HIS A 1 412 ? 244.300 85.055  -54.565 1.00 51.74  ? 443 HIS A CD2   1 
ATOM   3307 C  CE1   . HIS A 1 412 ? 243.086 83.740  -55.830 1.00 51.74  ? 443 HIS A CE1   1 
ATOM   3308 N  NE2   . HIS A 1 412 ? 244.319 84.148  -55.595 1.00 51.74  ? 443 HIS A NE2   1 
ATOM   3309 N  N     . ILE A 1 413 ? 241.148 88.253  -51.622 1.00 40.14  ? 444 ILE A N     1 
ATOM   3310 C  CA    . ILE A 1 413 ? 240.709 88.910  -50.403 1.00 40.14  ? 444 ILE A CA    1 
ATOM   3311 C  C     . ILE A 1 413 ? 239.779 90.073  -50.669 1.00 40.14  ? 444 ILE A C     1 
ATOM   3312 O  O     . ILE A 1 413 ? 239.266 90.669  -49.732 1.00 40.14  ? 444 ILE A O     1 
ATOM   3313 C  CB    . ILE A 1 413 ? 241.904 89.447  -49.610 1.00 50.02  ? 444 ILE A CB    1 
ATOM   3314 C  CG1   . ILE A 1 413 ? 242.511 90.626  -50.357 1.00 50.02  ? 444 ILE A CG1   1 
ATOM   3315 C  CG2   . ILE A 1 413 ? 242.971 88.373  -49.459 1.00 50.02  ? 444 ILE A CG2   1 
ATOM   3316 C  CD1   . ILE A 1 413 ? 243.693 91.241  -49.642 1.00 50.02  ? 444 ILE A CD1   1 
ATOM   3317 N  N     . LEU A 1 414 ? 239.546 90.406  -51.930 1.00 31.15  ? 445 LEU A N     1 
ATOM   3318 C  CA    . LEU A 1 414 ? 238.675 91.534  -52.202 1.00 31.15  ? 445 LEU A CA    1 
ATOM   3319 C  C     . LEU A 1 414 ? 237.398 91.477  -51.392 1.00 31.15  ? 445 LEU A C     1 
ATOM   3320 O  O     . LEU A 1 414 ? 236.726 92.490  -51.245 1.00 31.15  ? 445 LEU A O     1 
ATOM   3321 C  CB    . LEU A 1 414 ? 238.309 91.640  -53.684 1.00 43.45  ? 445 LEU A CB    1 
ATOM   3322 C  CG    . LEU A 1 414 ? 237.434 92.880  -53.962 1.00 43.45  ? 445 LEU A CG    1 
ATOM   3323 C  CD1   . LEU A 1 414 ? 238.244 94.118  -53.648 1.00 43.45  ? 445 LEU A CD1   1 
ATOM   3324 C  CD2   . LEU A 1 414 ? 236.953 92.939  -55.404 1.00 43.45  ? 445 LEU A CD2   1 
ATOM   3325 N  N     . HIS A 1 415 ? 237.049 90.312  -50.853 1.00 52.82  ? 446 HIS A N     1 
ATOM   3326 C  CA    . HIS A 1 415 ? 235.810 90.239  -50.080 1.00 52.82  ? 446 HIS A CA    1 
ATOM   3327 C  C     . HIS A 1 415 ? 235.861 91.031  -48.777 1.00 52.82  ? 446 HIS A C     1 
ATOM   3328 O  O     . HIS A 1 415 ? 234.873 91.657  -48.378 1.00 52.82  ? 446 HIS A O     1 
ATOM   3329 C  CB    . HIS A 1 415 ? 235.410 88.788  -49.784 1.00 55.16  ? 446 HIS A CB    1 
ATOM   3330 C  CG    . HIS A 1 415 ? 236.412 88.029  -48.975 1.00 55.16  ? 446 HIS A CG    1 
ATOM   3331 N  ND1   . HIS A 1 415 ? 237.624 87.613  -49.488 1.00 55.16  ? 446 HIS A ND1   1 
ATOM   3332 C  CD2   . HIS A 1 415 ? 236.372 87.584  -47.695 1.00 55.16  ? 446 HIS A CD2   1 
ATOM   3333 C  CE1   . HIS A 1 415 ? 238.285 86.938  -48.562 1.00 55.16  ? 446 HIS A CE1   1 
ATOM   3334 N  NE2   . HIS A 1 415 ? 237.549 86.906  -47.464 1.00 55.16  ? 446 HIS A NE2   1 
ATOM   3335 N  N     . VAL A 1 416 ? 237.017 91.023  -48.124 1.00 43.69  ? 447 VAL A N     1 
ATOM   3336 C  CA    . VAL A 1 416 ? 237.159 91.729  -46.864 1.00 43.69  ? 447 VAL A CA    1 
ATOM   3337 C  C     . VAL A 1 416 ? 236.665 93.164  -47.012 1.00 43.69  ? 447 VAL A C     1 
ATOM   3338 O  O     . VAL A 1 416 ? 235.789 93.617  -46.270 1.00 43.69  ? 447 VAL A O     1 
ATOM   3339 C  CB    . VAL A 1 416 ? 238.627 91.742  -46.400 1.00 35.83  ? 447 VAL A CB    1 
ATOM   3340 C  CG1   . VAL A 1 416 ? 238.698 92.176  -44.952 1.00 35.83  ? 447 VAL A CG1   1 
ATOM   3341 C  CG2   . VAL A 1 416 ? 239.246 90.365  -46.569 1.00 35.83  ? 447 VAL A CG2   1 
ATOM   3342 N  N     . ALA A 1 417 ? 237.225 93.859  -47.996 1.00 52.65  ? 448 ALA A N     1 
ATOM   3343 C  CA    . ALA A 1 417 ? 236.886 95.251  -48.274 1.00 52.65  ? 448 ALA A CA    1 
ATOM   3344 C  C     . ALA A 1 417 ? 235.396 95.498  -48.418 1.00 52.65  ? 448 ALA A C     1 
ATOM   3345 O  O     . ALA A 1 417 ? 234.894 96.538  -47.992 1.00 52.65  ? 448 ALA A O     1 
ATOM   3346 C  CB    . ALA A 1 417 ? 237.604 95.725  -49.535 1.00 52.09  ? 448 ALA A CB    1 
ATOM   3347 N  N     . VAL A 1 418 ? 234.688 94.550  -49.021 1.00 46.05  ? 449 VAL A N     1 
ATOM   3348 C  CA    . VAL A 1 418 ? 233.253 94.705  -49.224 1.00 46.05  ? 449 VAL A CA    1 
ATOM   3349 C  C     . VAL A 1 418 ? 232.516 94.712  -47.892 1.00 46.05  ? 449 VAL A C     1 
ATOM   3350 O  O     . VAL A 1 418 ? 231.584 95.493  -47.687 1.00 46.05  ? 449 VAL A O     1 
ATOM   3351 C  CB    . VAL A 1 418 ? 232.693 93.587  -50.124 1.00 38.95  ? 449 VAL A CB    1 
ATOM   3352 C  CG1   . VAL A 1 418 ? 231.271 93.924  -50.554 1.00 38.95  ? 449 VAL A CG1   1 
ATOM   3353 C  CG2   . VAL A 1 418 ? 233.584 93.428  -51.341 1.00 38.95  ? 449 VAL A CG2   1 
ATOM   3354 N  N     . ASP A 1 419 ? 232.947 93.850  -46.985 1.00 52.88  ? 450 ASP A N     1 
ATOM   3355 C  CA    . ASP A 1 419 ? 232.328 93.783  -45.675 1.00 52.88  ? 450 ASP A CA    1 
ATOM   3356 C  C     . ASP A 1 419 ? 232.580 95.071  -44.912 1.00 52.88  ? 450 ASP A C     1 
ATOM   3357 O  O     . ASP A 1 419 ? 231.696 95.592  -44.229 1.00 52.88  ? 450 ASP A O     1 
ATOM   3358 C  CB    . ASP A 1 419 ? 232.889 92.603  -44.895 1.00 66.33  ? 450 ASP A CB    1 
ATOM   3359 C  CG    . ASP A 1 419 ? 232.547 91.280  -45.538 1.00 66.33  ? 450 ASP A CG    1 
ATOM   3360 O  OD1   . ASP A 1 419 ? 231.341 91.057  -45.819 1.00 66.33  ? 450 ASP A OD1   1 
ATOM   3361 O  OD2   . ASP A 1 419 ? 233.476 90.469  -45.761 1.00 66.33  ? 450 ASP A OD2   1 
ATOM   3362 N  N     . VAL A 1 420 ? 233.795 95.589  -45.028 1.00 47.29  ? 451 VAL A N     1 
ATOM   3363 C  CA    . VAL A 1 420 ? 234.127 96.824  -44.346 1.00 47.29  ? 451 VAL A CA    1 
ATOM   3364 C  C     . VAL A 1 420 ? 233.121 97.904  -44.756 1.00 47.29  ? 451 VAL A C     1 
ATOM   3365 O  O     . VAL A 1 420 ? 232.543 98.575  -43.902 1.00 47.29  ? 451 VAL A O     1 
ATOM   3366 C  CB    . VAL A 1 420 ? 235.569 97.265  -44.678 1.00 41.28  ? 451 VAL A CB    1 
ATOM   3367 C  CG1   . VAL A 1 420 ? 235.916 98.514  -43.907 1.00 41.28  ? 451 VAL A CG1   1 
ATOM   3368 C  CG2   . VAL A 1 420 ? 236.545 96.151  -44.321 1.00 41.28  ? 451 VAL A CG2   1 
ATOM   3369 N  N     . ILE A 1 421 ? 232.893 98.055  -46.058 1.00 42.46  ? 452 ILE A N     1 
ATOM   3370 C  CA    . ILE A 1 421 ? 231.936 99.058  -46.529 1.00 42.46  ? 452 ILE A CA    1 
ATOM   3371 C  C     . ILE A 1 421 ? 230.536 98.695  -46.049 1.00 42.46  ? 452 ILE A C     1 
ATOM   3372 O  O     . ILE A 1 421 ? 229.680 99.566  -45.880 1.00 42.46  ? 452 ILE A O     1 
ATOM   3373 C  CB    . ILE A 1 421 ? 231.912 99.174  -48.074 1.00 34.84  ? 452 ILE A CB    1 
ATOM   3374 C  CG1   . ILE A 1 421 ? 233.334 99.405  -48.600 1.00 34.84  ? 452 ILE A CG1   1 
ATOM   3375 C  CG2   . ILE A 1 421 ? 230.967 100.324 -48.498 1.00 34.84  ? 452 ILE A CG2   1 
ATOM   3376 C  CD1   . ILE A 1 421 ? 233.423 99.553  -50.096 1.00 34.84  ? 452 ILE A CD1   1 
ATOM   3377 N  N     . LYS A 1 422 ? 230.304 97.403  -45.835 1.00 60.69  ? 453 LYS A N     1 
ATOM   3378 C  CA    . LYS A 1 422 ? 229.003 96.951  -45.359 1.00 60.69  ? 453 LYS A CA    1 
ATOM   3379 C  C     . LYS A 1 422 ? 228.922 97.313  -43.893 1.00 60.69  ? 453 LYS A C     1 
ATOM   3380 O  O     . LYS A 1 422 ? 227.979 97.969  -43.456 1.00 60.69  ? 453 LYS A O     1 
ATOM   3381 C  CB    . LYS A 1 422 ? 228.840 95.434  -45.507 1.00 56.61  ? 453 LYS A CB    1 
ATOM   3382 C  CG    . LYS A 1 422 ? 228.843 94.913  -46.939 1.00 56.61  ? 453 LYS A CG    1 
ATOM   3383 C  CD    . LYS A 1 422 ? 227.757 93.861  -47.148 1.00 56.61  ? 453 LYS A CD    1 
ATOM   3384 C  CE    . LYS A 1 422 ? 226.357 94.498  -47.094 1.00 56.61  ? 453 LYS A CE    1 
ATOM   3385 N  NZ    . LYS A 1 422 ? 225.227 93.516  -47.223 1.00 56.61  ? 453 LYS A NZ    1 
ATOM   3386 N  N     . GLU A 1 423 ? 229.928 96.886  -43.139 1.00 46.70  ? 454 GLU A N     1 
ATOM   3387 C  CA    . GLU A 1 423 ? 229.975 97.157  -41.709 1.00 46.70  ? 454 GLU A CA    1 
ATOM   3388 C  C     . GLU A 1 423 ? 229.916 98.662  -41.445 1.00 46.70  ? 454 GLU A C     1 
ATOM   3389 O  O     . GLU A 1 423 ? 229.065 99.132  -40.683 1.00 46.70  ? 454 GLU A O     1 
ATOM   3390 C  CB    . GLU A 1 423 ? 231.248 96.569  -41.099 1.00 63.70  ? 454 GLU A CB    1 
ATOM   3391 C  CG    . GLU A 1 423 ? 231.269 96.612  -39.584 1.00 63.70  ? 454 GLU A CG    1 
ATOM   3392 C  CD    . GLU A 1 423 ? 232.623 96.261  -39.001 1.00 63.70  ? 454 GLU A CD    1 
ATOM   3393 O  OE1   . GLU A 1 423 ? 233.591 96.086  -39.782 1.00 63.70  ? 454 GLU A OE1   1 
ATOM   3394 O  OE2   . GLU A 1 423 ? 232.713 96.166  -37.753 1.00 63.70  ? 454 GLU A OE2   1 
ATOM   3395 N  N     . SER A 1 424 ? 230.824 99.409  -42.070 1.00 51.93  ? 455 SER A N     1 
ATOM   3396 C  CA    . SER A 1 424 ? 230.855 100.855 -41.913 1.00 51.93  ? 455 SER A CA    1 
ATOM   3397 C  C     . SER A 1 424 ? 229.441 101.438 -41.895 1.00 51.93  ? 455 SER A C     1 
ATOM   3398 O  O     . SER A 1 424 ? 229.135 102.334 -41.105 1.00 51.93  ? 455 SER A O     1 
ATOM   3399 C  CB    . SER A 1 424 ? 231.640 101.492 -43.060 1.00 39.83  ? 455 SER A CB    1 
ATOM   3400 O  OG    . SER A 1 424 ? 231.239 102.841 -43.254 1.00 39.83  ? 455 SER A OG    1 
ATOM   3401 N  N     . ARG A 1 425 ? 228.584 100.912 -42.768 1.00 41.55  ? 456 ARG A N     1 
ATOM   3402 C  CA    . ARG A 1 425 ? 227.208 101.376 -42.883 1.00 41.55  ? 456 ARG A CA    1 
ATOM   3403 C  C     . ARG A 1 425 ? 226.334 100.971 -41.714 1.00 41.55  ? 456 ARG A C     1 
ATOM   3404 O  O     . ARG A 1 425 ? 225.422 101.705 -41.324 1.00 41.55  ? 456 ARG A O     1 
ATOM   3405 C  CB    . ARG A 1 425 ? 226.606 100.848 -44.170 1.00 44.55  ? 456 ARG A CB    1 
ATOM   3406 C  CG    . ARG A 1 425 ? 227.372 101.275 -45.376 1.00 44.55  ? 456 ARG A CG    1 
ATOM   3407 C  CD    . ARG A 1 425 ? 226.732 100.780 -46.634 1.00 44.55  ? 456 ARG A CD    1 
ATOM   3408 N  NE    . ARG A 1 425 ? 227.181 101.560 -47.772 1.00 44.55  ? 456 ARG A NE    1 
ATOM   3409 C  CZ    . ARG A 1 425 ? 227.194 101.105 -49.014 1.00 44.55  ? 456 ARG A CZ    1 
ATOM   3410 N  NH1   . ARG A 1 425 ? 226.785 99.871  -49.270 1.00 44.55  ? 456 ARG A NH1   1 
ATOM   3411 N  NH2   . ARG A 1 425 ? 227.614 101.885 -49.995 1.00 44.55  ? 456 ARG A NH2   1 
ATOM   3412 N  N     . VAL A 1 426 ? 226.597 99.786  -41.176 1.00 51.37  ? 457 VAL A N     1 
ATOM   3413 C  CA    . VAL A 1 426 ? 225.844 99.290  -40.037 1.00 51.37  ? 457 VAL A CA    1 
ATOM   3414 C  C     . VAL A 1 426 ? 226.157 100.235 -38.895 1.00 51.37  ? 457 VAL A C     1 
ATOM   3415 O  O     . VAL A 1 426 ? 225.261 100.657 -38.162 1.00 51.37  ? 457 VAL A O     1 
ATOM   3416 C  CB    . VAL A 1 426 ? 226.302 97.886  -39.624 1.00 52.03  ? 457 VAL A CB    1 
ATOM   3417 C  CG1   . VAL A 1 426 ? 225.438 97.379  -38.485 1.00 52.03  ? 457 VAL A CG1   1 
ATOM   3418 C  CG2   . VAL A 1 426 ? 226.254 96.955  -40.816 1.00 52.03  ? 457 VAL A CG2   1 
ATOM   3419 N  N     . LEU A 1 427 ? 227.447 100.555 -38.762 1.00 38.76  ? 458 LEU A N     1 
ATOM   3420 C  CA    . LEU A 1 427 ? 227.944 101.449 -37.723 1.00 38.76  ? 458 LEU A CA    1 
ATOM   3421 C  C     . LEU A 1 427 ? 227.449 102.859 -37.953 1.00 38.76  ? 458 LEU A C     1 
ATOM   3422 O  O     . LEU A 1 427 ? 227.336 103.632 -37.019 1.00 38.76  ? 458 LEU A O     1 
ATOM   3423 C  CB    . LEU A 1 427 ? 229.469 101.444 -37.702 1.00 20.55  ? 458 LEU A CB    1 
ATOM   3424 C  CG    . LEU A 1 427 ? 230.109 100.120 -37.308 1.00 20.55  ? 458 LEU A CG    1 
ATOM   3425 C  CD1   . LEU A 1 427 ? 231.598 100.157 -37.569 1.00 20.55  ? 458 LEU A CD1   1 
ATOM   3426 C  CD2   . LEU A 1 427 ? 229.820 99.852  -35.857 1.00 20.55  ? 458 LEU A CD2   1 
ATOM   3427 N  N     . ARG A 1 428 ? 227.150 103.193 -39.198 1.00 47.50  ? 459 ARG A N     1 
ATOM   3428 C  CA    . ARG A 1 428 ? 226.660 104.522 -39.510 1.00 47.50  ? 459 ARG A CA    1 
ATOM   3429 C  C     . ARG A 1 428 ? 227.732 105.584 -39.235 1.00 47.50  ? 459 ARG A C     1 
ATOM   3430 O  O     . ARG A 1 428 ? 227.501 106.557 -38.501 1.00 47.50  ? 459 ARG A O     1 
ATOM   3431 C  CB    . ARG A 1 428 ? 225.402 104.804 -38.692 1.00 49.29  ? 459 ARG A CB    1 
ATOM   3432 C  CG    . ARG A 1 428 ? 224.356 103.719 -38.854 1.00 49.29  ? 459 ARG A CG    1 
ATOM   3433 C  CD    . ARG A 1 428 ? 223.120 103.911 -37.971 1.00 49.29  ? 459 ARG A CD    1 
ATOM   3434 N  NE    . ARG A 1 428 ? 222.326 105.098 -38.302 1.00 49.29  ? 459 ARG A NE    1 
ATOM   3435 C  CZ    . ARG A 1 428 ? 221.858 105.387 -39.517 1.00 49.29  ? 459 ARG A CZ    1 
ATOM   3436 N  NH1   . ARG A 1 428 ? 221.139 106.489 -39.710 1.00 49.29  ? 459 ARG A NH1   1 
ATOM   3437 N  NH2   . ARG A 1 428 ? 222.117 104.582 -40.544 1.00 49.29  ? 459 ARG A NH2   1 
ATOM   3438 N  N     . LEU A 1 429 ? 228.910 105.377 -39.826 1.00 37.33  ? 460 LEU A N     1 
ATOM   3439 C  CA    . LEU A 1 429 ? 230.028 106.299 -39.691 1.00 37.33  ? 460 LEU A CA    1 
ATOM   3440 C  C     . LEU A 1 429 ? 229.694 107.511 -40.542 1.00 37.33  ? 460 LEU A C     1 
ATOM   3441 O  O     . LEU A 1 429 ? 229.129 107.353 -41.619 1.00 37.33  ? 460 LEU A O     1 
ATOM   3442 C  CB    . LEU A 1 429 ? 231.315 105.662 -40.219 1.00 20.46  ? 460 LEU A CB    1 
ATOM   3443 C  CG    . LEU A 1 429 ? 231.776 104.328 -39.634 1.00 20.46  ? 460 LEU A CG    1 
ATOM   3444 C  CD1   . LEU A 1 429 ? 233.209 104.041 -40.048 1.00 20.46  ? 460 LEU A CD1   1 
ATOM   3445 C  CD2   . LEU A 1 429 ? 231.682 104.383 -38.136 1.00 20.46  ? 460 LEU A CD2   1 
ATOM   3446 N  N     . GLN A 1 430 ? 230.026 108.710 -40.059 1.00 31.50  ? 461 GLN A N     1 
ATOM   3447 C  CA    . GLN A 1 430 ? 229.774 109.947 -40.798 1.00 31.50  ? 461 GLN A CA    1 
ATOM   3448 C  C     . GLN A 1 430 ? 230.617 109.946 -42.067 1.00 31.50  ? 461 GLN A C     1 
ATOM   3449 O  O     . GLN A 1 430 ? 231.510 109.129 -42.215 1.00 31.50  ? 461 GLN A O     1 
ATOM   3450 C  CB    . GLN A 1 430 ? 230.126 111.162 -39.939 1.00 40.45  ? 461 GLN A CB    1 
ATOM   3451 C  CG    . GLN A 1 430 ? 229.172 111.400 -38.783 1.00 40.45  ? 461 GLN A CG    1 
ATOM   3452 C  CD    . GLN A 1 430 ? 229.442 112.702 -38.059 1.00 40.45  ? 461 GLN A CD    1 
ATOM   3453 O  OE1   . GLN A 1 430 ? 229.612 113.745 -38.681 1.00 40.45  ? 461 GLN A OE1   1 
ATOM   3454 N  NE2   . GLN A 1 430 ? 229.470 112.651 -36.735 1.00 40.45  ? 461 GLN A NE2   1 
ATOM   3455 N  N     . PRO A 1 431 ? 230.336 110.858 -43.004 1.00 32.30  ? 462 PRO A N     1 
ATOM   3456 C  CA    . PRO A 1 431 ? 231.061 110.971 -44.278 1.00 32.30  ? 462 PRO A CA    1 
ATOM   3457 C  C     . PRO A 1 431 ? 232.552 111.343 -44.220 1.00 32.30  ? 462 PRO A C     1 
ATOM   3458 O  O     . PRO A 1 431 ? 232.985 112.121 -43.368 1.00 32.30  ? 462 PRO A O     1 
ATOM   3459 C  CB    . PRO A 1 431 ? 230.251 112.017 -45.034 1.00 42.24  ? 462 PRO A CB    1 
ATOM   3460 C  CG    . PRO A 1 431 ? 228.874 111.821 -44.507 1.00 42.24  ? 462 PRO A CG    1 
ATOM   3461 C  CD    . PRO A 1 431 ? 229.115 111.679 -43.032 1.00 42.24  ? 462 PRO A CD    1 
ATOM   3462 N  N     . PHE A 1 432 ? 233.321 110.798 -45.162 1.00 37.31  ? 463 PHE A N     1 
ATOM   3463 C  CA    . PHE A 1 432 ? 234.752 111.059 -45.249 1.00 37.31  ? 463 PHE A CA    1 
ATOM   3464 C  C     . PHE A 1 432 ? 235.032 112.490 -44.843 1.00 37.31  ? 463 PHE A C     1 
ATOM   3465 O  O     . PHE A 1 432 ? 235.737 112.726 -43.876 1.00 37.31  ? 463 PHE A O     1 
ATOM   3466 C  CB    . PHE A 1 432 ? 235.261 110.822 -46.676 1.00 32.98  ? 463 PHE A CB    1 
ATOM   3467 C  CG    . PHE A 1 432 ? 236.767 110.822 -46.802 1.00 32.98  ? 463 PHE A CG    1 
ATOM   3468 C  CD1   . PHE A 1 432 ? 237.542 109.905 -46.095 1.00 32.98  ? 463 PHE A CD1   1 
ATOM   3469 C  CD2   . PHE A 1 432 ? 237.411 111.725 -47.639 1.00 32.98  ? 463 PHE A CD2   1 
ATOM   3470 C  CE1   . PHE A 1 432 ? 238.931 109.882 -46.218 1.00 32.98  ? 463 PHE A CE1   1 
ATOM   3471 C  CE2   . PHE A 1 432 ? 238.800 111.712 -47.771 1.00 32.98  ? 463 PHE A CE2   1 
ATOM   3472 C  CZ    . PHE A 1 432 ? 239.560 110.785 -47.056 1.00 32.98  ? 463 PHE A CZ    1 
ATOM   3473 N  N     . ASN A 1 433 ? 234.462 113.445 -45.571 1.00 34.04  ? 464 ASN A N     1 
ATOM   3474 C  CA    . ASN A 1 433 ? 234.673 114.854 -45.262 1.00 34.04  ? 464 ASN A CA    1 
ATOM   3475 C  C     . ASN A 1 433 ? 234.520 115.177 -43.788 1.00 34.04  ? 464 ASN A C     1 
ATOM   3476 O  O     . ASN A 1 433 ? 235.347 115.870 -43.213 1.00 34.04  ? 464 ASN A O     1 
ATOM   3477 C  CB    . ASN A 1 433 ? 233.730 115.745 -46.070 1.00 47.48  ? 464 ASN A CB    1 
ATOM   3478 C  CG    . ASN A 1 433 ? 234.274 116.063 -47.444 1.00 47.48  ? 464 ASN A CG    1 
ATOM   3479 O  OD1   . ASN A 1 433 ? 235.472 115.894 -47.703 1.00 47.48  ? 464 ASN A OD1   1 
ATOM   3480 N  ND2   . ASN A 1 433 ? 233.404 116.543 -48.334 1.00 47.48  ? 464 ASN A ND2   1 
ATOM   3481 N  N     . GLU A 1 434 ? 233.464 114.685 -43.165 1.00 30.98  ? 465 GLU A N     1 
ATOM   3482 C  CA    . GLU A 1 434 ? 233.286 114.963 -41.757 1.00 30.98  ? 465 GLU A CA    1 
ATOM   3483 C  C     . GLU A 1 434 ? 234.499 114.485 -40.973 1.00 30.98  ? 465 GLU A C     1 
ATOM   3484 O  O     . GLU A 1 434 ? 234.952 115.144 -40.047 1.00 30.98  ? 465 GLU A O     1 
ATOM   3485 C  CB    . GLU A 1 434 ? 232.019 114.288 -41.252 1.00 55.87  ? 465 GLU A CB    1 
ATOM   3486 C  CG    . GLU A 1 434 ? 230.777 114.960 -41.774 1.00 55.87  ? 465 GLU A CG    1 
ATOM   3487 C  CD    . GLU A 1 434 ? 230.755 116.430 -41.426 1.00 55.87  ? 465 GLU A CD    1 
ATOM   3488 O  OE1   . GLU A 1 434 ? 230.933 116.736 -40.228 1.00 55.87  ? 465 GLU A OE1   1 
ATOM   3489 O  OE2   . GLU A 1 434 ? 230.568 117.269 -42.338 1.00 55.87  ? 465 GLU A OE2   1 
ATOM   3490 N  N     . TYR A 1 435 ? 235.032 113.333 -41.343 1.00 44.55  ? 466 TYR A N     1 
ATOM   3491 C  CA    . TYR A 1 435 ? 236.198 112.831 -40.649 1.00 44.55  ? 466 TYR A CA    1 
ATOM   3492 C  C     . TYR A 1 435 ? 237.438 113.618 -41.037 1.00 44.55  ? 466 TYR A C     1 
ATOM   3493 O  O     . TYR A 1 435 ? 238.383 113.703 -40.257 1.00 44.55  ? 466 TYR A O     1 
ATOM   3494 C  CB    . TYR A 1 435 ? 236.385 111.337 -40.920 1.00 42.01  ? 466 TYR A CB    1 
ATOM   3495 C  CG    . TYR A 1 435 ? 235.662 110.478 -39.908 1.00 42.01  ? 466 TYR A CG    1 
ATOM   3496 C  CD1   . TYR A 1 435 ? 236.239 110.190 -38.679 1.00 42.01  ? 466 TYR A CD1   1 
ATOM   3497 C  CD2   . TYR A 1 435 ? 234.373 110.005 -40.155 1.00 42.01  ? 466 TYR A CD2   1 
ATOM   3498 C  CE1   . TYR A 1 435 ? 235.556 109.461 -37.724 1.00 42.01  ? 466 TYR A CE1   1 
ATOM   3499 C  CE2   . TYR A 1 435 ? 233.681 109.272 -39.203 1.00 42.01  ? 466 TYR A CE2   1 
ATOM   3500 C  CZ    . TYR A 1 435 ? 234.280 109.007 -37.992 1.00 42.01  ? 466 TYR A CZ    1 
ATOM   3501 O  OH    . TYR A 1 435 ? 233.608 108.284 -37.043 1.00 42.01  ? 466 TYR A OH    1 
ATOM   3502 N  N     . ARG A 1 436 ? 237.440 114.201 -42.231 1.00 49.84  ? 467 ARG A N     1 
ATOM   3503 C  CA    . ARG A 1 436 ? 238.589 114.993 -42.656 1.00 49.84  ? 467 ARG A CA    1 
ATOM   3504 C  C     . ARG A 1 436 ? 238.662 116.224 -41.748 1.00 49.84  ? 467 ARG A C     1 
ATOM   3505 O  O     . ARG A 1 436 ? 239.722 116.542 -41.208 1.00 49.84  ? 467 ARG A O     1 
ATOM   3506 C  CB    . ARG A 1 436 ? 238.448 115.435 -44.112 1.00 46.62  ? 467 ARG A CB    1 
ATOM   3507 C  CG    . ARG A 1 436 ? 238.599 114.338 -45.156 1.00 46.62  ? 467 ARG A CG    1 
ATOM   3508 C  CD    . ARG A 1 436 ? 239.975 114.344 -45.817 1.00 46.62  ? 467 ARG A CD    1 
ATOM   3509 N  NE    . ARG A 1 436 ? 240.476 115.699 -46.038 1.00 46.62  ? 467 ARG A NE    1 
ATOM   3510 C  CZ    . ARG A 1 436 ? 241.586 116.001 -46.708 1.00 46.62  ? 467 ARG A CZ    1 
ATOM   3511 N  NH1   . ARG A 1 436 ? 242.334 115.053 -47.257 1.00 46.62  ? 467 ARG A NH1   1 
ATOM   3512 N  NH2   . ARG A 1 436 ? 241.973 117.261 -46.786 1.00 46.62  ? 467 ARG A NH2   1 
ATOM   3513 N  N     . LYS A 1 437 ? 237.538 116.914 -41.575 1.00 43.73  ? 468 LYS A N     1 
ATOM   3514 C  CA    . LYS A 1 437 ? 237.522 118.085 -40.712 1.00 43.73  ? 468 LYS A CA    1 
ATOM   3515 C  C     . LYS A 1 437 ? 238.059 117.650 -39.360 1.00 43.73  ? 468 LYS A C     1 
ATOM   3516 O  O     . LYS A 1 437 ? 239.121 118.089 -38.934 1.00 43.73  ? 468 LYS A O     1 
ATOM   3517 C  CB    . LYS A 1 437 ? 236.104 118.626 -40.506 1.00 29.12  ? 468 LYS A CB    1 
ATOM   3518 C  CG    . LYS A 1 437 ? 235.376 119.114 -41.740 1.00 29.12  ? 468 LYS A CG    1 
ATOM   3519 C  CD    . LYS A 1 437 ? 234.020 119.630 -41.332 1.00 29.12  ? 468 LYS A CD    1 
ATOM   3520 C  CE    . LYS A 1 437 ? 233.125 119.873 -42.517 1.00 29.12  ? 468 LYS A CE    1 
ATOM   3521 N  NZ    . LYS A 1 437 ? 231.709 120.027 -42.059 1.00 29.12  ? 468 LYS A NZ    1 
ATOM   3522 N  N     . ARG A 1 438 ? 237.317 116.767 -38.703 1.00 32.84  ? 469 ARG A N     1 
ATOM   3523 C  CA    . ARG A 1 438 ? 237.679 116.268 -37.390 1.00 32.84  ? 469 ARG A CA    1 
ATOM   3524 C  C     . ARG A 1 438 ? 239.173 116.037 -37.171 1.00 32.84  ? 469 ARG A C     1 
ATOM   3525 O  O     . ARG A 1 438 ? 239.678 116.244 -36.074 1.00 32.84  ? 469 ARG A O     1 
ATOM   3526 C  CB    . ARG A 1 438 ? 236.905 114.990 -37.093 1.00 34.34  ? 469 ARG A CB    1 
ATOM   3527 C  CG    . ARG A 1 438 ? 237.115 114.469 -35.690 1.00 34.34  ? 469 ARG A CG    1 
ATOM   3528 C  CD    . ARG A 1 438 ? 236.932 115.580 -34.679 1.00 34.34  ? 469 ARG A CD    1 
ATOM   3529 N  NE    . ARG A 1 438 ? 237.928 115.479 -33.622 1.00 34.34  ? 469 ARG A NE    1 
ATOM   3530 C  CZ    . ARG A 1 438 ? 237.798 114.740 -32.537 1.00 34.34  ? 469 ARG A CZ    1 
ATOM   3531 N  NH1   . ARG A 1 438 ? 236.699 114.039 -32.350 1.00 34.34  ? 469 ARG A NH1   1 
ATOM   3532 N  NH2   . ARG A 1 438 ? 238.782 114.687 -31.657 1.00 34.34  ? 469 ARG A NH2   1 
ATOM   3533 N  N     . PHE A 1 439 ? 239.897 115.616 -38.196 1.00 45.11  ? 470 PHE A N     1 
ATOM   3534 C  CA    . PHE A 1 439 ? 241.318 115.407 -37.999 1.00 45.11  ? 470 PHE A CA    1 
ATOM   3535 C  C     . PHE A 1 439 ? 242.201 116.541 -38.496 1.00 45.11  ? 470 PHE A C     1 
ATOM   3536 O  O     . PHE A 1 439 ? 243.358 116.334 -38.882 1.00 45.11  ? 470 PHE A O     1 
ATOM   3537 C  CB    . PHE A 1 439 ? 241.731 114.077 -38.595 1.00 41.63  ? 470 PHE A CB    1 
ATOM   3538 C  CG    . PHE A 1 439 ? 241.473 112.926 -37.678 1.00 41.63  ? 470 PHE A CG    1 
ATOM   3539 C  CD1   . PHE A 1 439 ? 242.483 112.432 -36.863 1.00 41.63  ? 470 PHE A CD1   1 
ATOM   3540 C  CD2   . PHE A 1 439 ? 240.205 112.374 -37.579 1.00 41.63  ? 470 PHE A CD2   1 
ATOM   3541 C  CE1   . PHE A 1 439 ? 242.234 111.411 -35.966 1.00 41.63  ? 470 PHE A CE1   1 
ATOM   3542 C  CE2   . PHE A 1 439 ? 239.948 111.357 -36.687 1.00 41.63  ? 470 PHE A CE2   1 
ATOM   3543 C  CZ    . PHE A 1 439 ? 240.965 110.875 -35.880 1.00 41.63  ? 470 PHE A CZ    1 
ATOM   3544 N  N     . GLY A 1 440 ? 241.636 117.747 -38.462 1.00 42.55  ? 471 GLY A N     1 
ATOM   3545 C  CA    . GLY A 1 440 ? 242.352 118.944 -38.861 1.00 42.55  ? 471 GLY A CA    1 
ATOM   3546 C  C     . GLY A 1 440 ? 242.627 119.192 -40.328 1.00 42.55  ? 471 GLY A C     1 
ATOM   3547 O  O     . GLY A 1 440 ? 243.686 119.721 -40.666 1.00 42.55  ? 471 GLY A O     1 
ATOM   3548 N  N     . MET A 1 441 ? 241.691 118.826 -41.201 1.00 41.37  ? 472 MET A N     1 
ATOM   3549 C  CA    . MET A 1 441 ? 241.858 119.040 -42.634 1.00 41.37  ? 472 MET A CA    1 
ATOM   3550 C  C     . MET A 1 441 ? 240.681 119.768 -43.253 1.00 41.37  ? 472 MET A C     1 
ATOM   3551 O  O     . MET A 1 441 ? 239.706 120.091 -42.583 1.00 41.37  ? 472 MET A O     1 
ATOM   3552 C  CB    . MET A 1 441 ? 242.051 117.715 -43.353 1.00 49.78  ? 472 MET A CB    1 
ATOM   3553 C  CG    . MET A 1 441 ? 243.370 117.076 -43.046 1.00 49.78  ? 472 MET A CG    1 
ATOM   3554 S  SD    . MET A 1 441 ? 243.516 115.454 -43.787 1.00 49.78  ? 472 MET A SD    1 
ATOM   3555 C  CE    . MET A 1 441 ? 242.887 114.442 -42.452 1.00 49.78  ? 472 MET A CE    1 
ATOM   3556 N  N     . LYS A 1 442 ? 240.783 120.035 -44.544 1.00 38.69  ? 473 LYS A N     1 
ATOM   3557 C  CA    . LYS A 1 442 ? 239.716 120.717 -45.245 1.00 38.69  ? 473 LYS A CA    1 
ATOM   3558 C  C     . LYS A 1 442 ? 238.898 119.673 -45.995 1.00 38.69  ? 473 LYS A C     1 
ATOM   3559 O  O     . LYS A 1 442 ? 239.444 118.709 -46.529 1.00 38.69  ? 473 LYS A O     1 
ATOM   3560 C  CB    . LYS A 1 442 ? 240.305 121.744 -46.215 1.00 34.92  ? 473 LYS A CB    1 
ATOM   3561 N  N     . PRO A 1 443 ? 237.569 119.836 -46.021 1.00 36.78  ? 474 PRO A N     1 
ATOM   3562 C  CA    . PRO A 1 443 ? 236.746 118.861 -46.732 1.00 36.78  ? 474 PRO A CA    1 
ATOM   3563 C  C     . PRO A 1 443 ? 237.011 118.987 -48.227 1.00 36.78  ? 474 PRO A C     1 
ATOM   3564 O  O     . PRO A 1 443 ? 237.199 120.102 -48.719 1.00 36.78  ? 474 PRO A O     1 
ATOM   3565 C  CB    . PRO A 1 443 ? 235.329 119.281 -46.349 1.00 26.73  ? 474 PRO A CB    1 
ATOM   3566 C  CG    . PRO A 1 443 ? 235.452 120.751 -46.209 1.00 26.73  ? 474 PRO A CG    1 
ATOM   3567 C  CD    . PRO A 1 443 ? 236.731 120.896 -45.436 1.00 26.73  ? 474 PRO A CD    1 
ATOM   3568 N  N     . TYR A 1 444 ? 237.051 117.867 -48.947 1.00 36.99  ? 475 TYR A N     1 
ATOM   3569 C  CA    . TYR A 1 444 ? 237.276 117.937 -50.386 1.00 36.99  ? 475 TYR A CA    1 
ATOM   3570 C  C     . TYR A 1 444 ? 236.078 118.609 -51.036 1.00 36.99  ? 475 TYR A C     1 
ATOM   3571 O  O     . TYR A 1 444 ? 234.936 118.419 -50.617 1.00 36.99  ? 475 TYR A O     1 
ATOM   3572 C  CB    . TYR A 1 444 ? 237.487 116.552 -50.989 1.00 43.59  ? 475 TYR A CB    1 
ATOM   3573 C  CG    . TYR A 1 444 ? 238.888 116.027 -50.806 1.00 43.59  ? 475 TYR A CG    1 
ATOM   3574 C  CD1   . TYR A 1 444 ? 239.193 115.128 -49.781 1.00 43.59  ? 475 TYR A CD1   1 
ATOM   3575 C  CD2   . TYR A 1 444 ? 239.926 116.456 -51.638 1.00 43.59  ? 475 TYR A CD2   1 
ATOM   3576 C  CE1   . TYR A 1 444 ? 240.502 114.669 -49.587 1.00 43.59  ? 475 TYR A CE1   1 
ATOM   3577 C  CE2   . TYR A 1 444 ? 241.238 116.007 -51.452 1.00 43.59  ? 475 TYR A CE2   1 
ATOM   3578 C  CZ    . TYR A 1 444 ? 241.514 115.115 -50.423 1.00 43.59  ? 475 TYR A CZ    1 
ATOM   3579 O  OH    . TYR A 1 444 ? 242.793 114.672 -50.213 1.00 43.59  ? 475 TYR A OH    1 
ATOM   3580 N  N     . THR A 1 445 ? 236.343 119.404 -52.063 1.00 51.18  ? 476 THR A N     1 
ATOM   3581 C  CA    . THR A 1 445 ? 235.285 120.130 -52.754 1.00 51.18  ? 476 THR A CA    1 
ATOM   3582 C  C     . THR A 1 445 ? 234.778 119.382 -53.990 1.00 51.18  ? 476 THR A C     1 
ATOM   3583 O  O     . THR A 1 445 ? 233.771 119.772 -54.588 1.00 51.18  ? 476 THR A O     1 
ATOM   3584 C  CB    . THR A 1 445 ? 235.788 121.510 -53.196 1.00 62.54  ? 476 THR A CB    1 
ATOM   3585 O  OG1   . THR A 1 445 ? 236.540 121.367 -54.407 1.00 62.54  ? 476 THR A OG1   1 
ATOM   3586 C  CG2   . THR A 1 445 ? 236.694 122.119 -52.123 1.00 62.54  ? 476 THR A CG2   1 
ATOM   3587 N  N     . SER A 1 446 ? 235.476 118.308 -54.359 1.00 48.35  ? 477 SER A N     1 
ATOM   3588 C  CA    . SER A 1 446 ? 235.111 117.507 -55.524 1.00 48.35  ? 477 SER A CA    1 
ATOM   3589 C  C     . SER A 1 446 ? 235.834 116.163 -55.522 1.00 48.35  ? 477 SER A C     1 
ATOM   3590 O  O     . SER A 1 446 ? 236.840 115.999 -54.837 1.00 48.35  ? 477 SER A O     1 
ATOM   3591 C  CB    . SER A 1 446 ? 235.500 118.243 -56.798 1.00 60.42  ? 477 SER A CB    1 
ATOM   3592 O  OG    . SER A 1 446 ? 236.909 118.215 -56.961 1.00 60.42  ? 477 SER A OG    1 
ATOM   3593 N  N     . PHE A 1 447 ? 235.325 115.205 -56.298 1.00 53.20  ? 478 PHE A N     1 
ATOM   3594 C  CA    . PHE A 1 447 ? 235.967 113.897 -56.385 1.00 53.20  ? 478 PHE A CA    1 
ATOM   3595 C  C     . PHE A 1 447 ? 237.218 114.087 -57.220 1.00 53.20  ? 478 PHE A C     1 
ATOM   3596 O  O     . PHE A 1 447 ? 238.217 113.376 -57.057 1.00 53.20  ? 478 PHE A O     1 
ATOM   3597 C  CB    . PHE A 1 447 ? 235.064 112.865 -57.067 1.00 48.02  ? 478 PHE A CB    1 
ATOM   3598 C  CG    . PHE A 1 447 ? 233.900 112.425 -56.231 1.00 48.02  ? 478 PHE A CG    1 
ATOM   3599 C  CD1   . PHE A 1 447 ? 232.800 113.249 -56.055 1.00 48.02  ? 478 PHE A CD1   1 
ATOM   3600 C  CD2   . PHE A 1 447 ? 233.916 111.190 -55.602 1.00 48.02  ? 478 PHE A CD2   1 
ATOM   3601 C  CE1   . PHE A 1 447 ? 231.734 112.853 -55.265 1.00 48.02  ? 478 PHE A CE1   1 
ATOM   3602 C  CE2   . PHE A 1 447 ? 232.854 110.786 -54.810 1.00 48.02  ? 478 PHE A CE2   1 
ATOM   3603 C  CZ    . PHE A 1 447 ? 231.760 111.623 -54.641 1.00 48.02  ? 478 PHE A CZ    1 
ATOM   3604 N  N     . GLN A 1 448 ? 237.150 115.052 -58.132 1.00 63.77  ? 479 GLN A N     1 
ATOM   3605 C  CA    . GLN A 1 448 ? 238.283 115.349 -58.986 1.00 63.77  ? 479 GLN A CA    1 
ATOM   3606 C  C     . GLN A 1 448 ? 239.403 115.767 -58.046 1.00 63.77  ? 479 GLN A C     1 
ATOM   3607 O  O     . GLN A 1 448 ? 240.551 115.357 -58.212 1.00 63.77  ? 479 GLN A O     1 
ATOM   3608 C  CB    . GLN A 1 448 ? 237.934 116.485 -59.965 1.00 48.20  ? 479 GLN A CB    1 
ATOM   3609 N  N     . GLU A 1 449 ? 239.057 116.571 -57.045 1.00 49.83  ? 480 GLU A N     1 
ATOM   3610 C  CA    . GLU A 1 449 ? 240.043 117.050 -56.085 1.00 49.83  ? 480 GLU A CA    1 
ATOM   3611 C  C     . GLU A 1 449 ? 240.510 115.892 -55.199 1.00 49.83  ? 480 GLU A C     1 
ATOM   3612 O  O     . GLU A 1 449 ? 241.677 115.836 -54.813 1.00 49.83  ? 480 GLU A O     1 
ATOM   3613 C  CB    . GLU A 1 449 ? 239.443 118.177 -55.231 1.00 59.51  ? 480 GLU A CB    1 
ATOM   3614 C  CG    . GLU A 1 449 ? 240.466 119.003 -54.457 1.00 59.51  ? 480 GLU A CG    1 
ATOM   3615 C  CD    . GLU A 1 449 ? 239.837 119.913 -53.391 1.00 59.51  ? 480 GLU A CD    1 
ATOM   3616 O  OE1   . GLU A 1 449 ? 240.507 120.179 -52.366 1.00 59.51  ? 480 GLU A OE1   1 
ATOM   3617 O  OE2   . GLU A 1 449 ? 238.681 120.364 -53.568 1.00 59.51  ? 480 GLU A OE2   1 
ATOM   3618 N  N     . LEU A 1 450 ? 239.603 114.972 -54.884 1.00 40.73  ? 481 LEU A N     1 
ATOM   3619 C  CA    . LEU A 1 450 ? 239.940 113.819 -54.057 1.00 40.73  ? 481 LEU A CA    1 
ATOM   3620 C  C     . LEU A 1 450 ? 240.960 112.964 -54.775 1.00 40.73  ? 481 LEU A C     1 
ATOM   3621 O  O     . LEU A 1 450 ? 242.091 112.816 -54.322 1.00 40.73  ? 481 LEU A O     1 
ATOM   3622 C  CB    . LEU A 1 450 ? 238.700 112.970 -53.778 1.00 40.57  ? 481 LEU A CB    1 
ATOM   3623 C  CG    . LEU A 1 450 ? 238.925 111.610 -53.105 1.00 40.57  ? 481 LEU A CG    1 
ATOM   3624 C  CD1   . LEU A 1 450 ? 239.362 111.790 -51.662 1.00 40.57  ? 481 LEU A CD1   1 
ATOM   3625 C  CD2   . LEU A 1 450 ? 237.645 110.818 -53.151 1.00 40.57  ? 481 LEU A CD2   1 
ATOM   3626 N  N     . THR A 1 451 ? 240.549 112.406 -55.908 1.00 53.86  ? 482 THR A N     1 
ATOM   3627 C  CA    . THR A 1 451 ? 241.405 111.538 -56.720 1.00 53.86  ? 482 THR A CA    1 
ATOM   3628 C  C     . THR A 1 451 ? 242.306 112.336 -57.666 1.00 53.86  ? 482 THR A C     1 
ATOM   3629 O  O     . THR A 1 451 ? 241.856 113.271 -58.330 1.00 53.86  ? 482 THR A O     1 
ATOM   3630 C  CB    . THR A 1 451 ? 240.551 110.588 -57.561 1.00 44.57  ? 482 THR A CB    1 
ATOM   3631 O  OG1   . THR A 1 451 ? 240.250 111.203 -58.818 1.00 44.57  ? 482 THR A OG1   1 
ATOM   3632 C  CG2   . THR A 1 451 ? 239.241 110.300 -56.847 1.00 44.57  ? 482 THR A CG2   1 
ATOM   3633 N  N     . GLY A 1 452 ? 243.575 111.960 -57.742 1.00 57.42  ? 483 GLY A N     1 
ATOM   3634 C  CA    . GLY A 1 452 ? 244.482 112.679 -58.622 1.00 57.42  ? 483 GLY A CA    1 
ATOM   3635 C  C     . GLY A 1 452 ? 244.095 112.685 -60.098 1.00 57.42  ? 483 GLY A C     1 
ATOM   3636 O  O     . GLY A 1 452 ? 244.557 113.523 -60.879 1.00 57.42  ? 483 GLY A O     1 
ATOM   3637 N  N     . GLU A 1 453 ? 243.237 111.755 -60.492 1.00 48.86  ? 484 GLU A N     1 
ATOM   3638 C  CA    . GLU A 1 453 ? 242.831 111.658 -61.884 1.00 48.86  ? 484 GLU A CA    1 
ATOM   3639 C  C     . GLU A 1 453 ? 241.471 112.276 -62.160 1.00 48.86  ? 484 GLU A C     1 
ATOM   3640 O  O     . GLU A 1 453 ? 241.045 113.188 -61.447 1.00 48.86  ? 484 GLU A O     1 
ATOM   3641 C  CB    . GLU A 1 453 ? 242.859 110.190 -62.317 1.00 54.97  ? 484 GLU A CB    1 
ATOM   3642 C  CG    . GLU A 1 453 ? 242.182 109.244 -61.343 1.00 54.97  ? 484 GLU A CG    1 
ATOM   3643 C  CD    . GLU A 1 453 ? 240.693 109.133 -61.579 1.00 54.97  ? 484 GLU A CD    1 
ATOM   3644 O  OE1   . GLU A 1 453 ? 239.924 109.972 -61.054 1.00 54.97  ? 484 GLU A OE1   1 
ATOM   3645 O  OE2   . GLU A 1 453 ? 240.298 108.194 -62.301 1.00 54.97  ? 484 GLU A OE2   1 
ATOM   3646 N  N     . LYS A 1 454 ? 240.802 111.782 -63.204 1.00 45.60  ? 485 LYS A N     1 
ATOM   3647 C  CA    . LYS A 1 454 ? 239.495 112.294 -63.596 1.00 45.60  ? 485 LYS A CA    1 
ATOM   3648 C  C     . LYS A 1 454 ? 238.509 111.181 -63.897 1.00 45.60  ? 485 LYS A C     1 
ATOM   3649 O  O     . LYS A 1 454 ? 237.301 111.355 -63.719 1.00 45.60  ? 485 LYS A O     1 
ATOM   3650 C  CB    . LYS A 1 454 ? 239.631 113.209 -64.810 1.00 24.58  ? 485 LYS A CB    1 
ATOM   3651 N  N     . GLU A 1 455 ? 239.019 110.045 -64.363 1.00 47.21  ? 486 GLU A N     1 
ATOM   3652 C  CA    . GLU A 1 455 ? 238.165 108.903 -64.676 1.00 47.21  ? 486 GLU A CA    1 
ATOM   3653 C  C     . GLU A 1 455 ? 237.442 108.439 -63.411 1.00 47.21  ? 486 GLU A C     1 
ATOM   3654 O  O     . GLU A 1 455 ? 236.275 108.771 -63.209 1.00 47.21  ? 486 GLU A O     1 
ATOM   3655 C  CB    . GLU A 1 455 ? 238.994 107.772 -65.261 1.00 27.62  ? 486 GLU A CB    1 
ATOM   3656 N  N     . MET A 1 456 ? 238.132 107.678 -62.563 1.00 39.25  ? 487 MET A N     1 
ATOM   3657 C  CA    . MET A 1 456 ? 237.555 107.185 -61.312 1.00 39.25  ? 487 MET A CA    1 
ATOM   3658 C  C     . MET A 1 456 ? 236.639 108.209 -60.694 1.00 39.25  ? 487 MET A C     1 
ATOM   3659 O  O     . MET A 1 456 ? 235.491 107.920 -60.367 1.00 39.25  ? 487 MET A O     1 
ATOM   3660 C  CB    . MET A 1 456 ? 238.645 106.861 -60.289 1.00 77.59  ? 487 MET A CB    1 
ATOM   3661 C  CG    . MET A 1 456 ? 239.201 105.443 -60.374 1.00 77.59  ? 487 MET A CG    1 
ATOM   3662 S  SD    . MET A 1 456 ? 240.307 105.028 -58.981 1.00 77.59  ? 487 MET A SD    1 
ATOM   3663 C  CE    . MET A 1 456 ? 241.961 104.965 -59.850 1.00 77.59  ? 487 MET A CE    1 
ATOM   3664 N  N     . ALA A 1 457 ? 237.182 109.411 -60.538 1.00 54.01  ? 488 ALA A N     1 
ATOM   3665 C  CA    . ALA A 1 457 ? 236.478 110.544 -59.948 1.00 54.01  ? 488 ALA A CA    1 
ATOM   3666 C  C     . ALA A 1 457 ? 235.046 110.740 -60.466 1.00 54.01  ? 488 ALA A C     1 
ATOM   3667 O  O     . ALA A 1 457 ? 234.080 110.674 -59.697 1.00 54.01  ? 488 ALA A O     1 
ATOM   3668 C  CB    . ALA A 1 457 ? 237.300 111.821 -60.176 1.00 39.23  ? 488 ALA A CB    1 
ATOM   3669 N  N     . ALA A 1 458 ? 234.927 110.989 -61.769 1.00 59.88  ? 489 ALA A N     1 
ATOM   3670 C  CA    . ALA A 1 458 ? 233.637 111.217 -62.412 1.00 59.88  ? 489 ALA A CA    1 
ATOM   3671 C  C     . ALA A 1 458 ? 232.661 110.085 -62.133 1.00 59.88  ? 489 ALA A C     1 
ATOM   3672 O  O     . ALA A 1 458 ? 231.490 110.327 -61.835 1.00 59.88  ? 489 ALA A O     1 
ATOM   3673 C  CB    . ALA A 1 458 ? 233.826 111.377 -63.905 1.00 44.12  ? 489 ALA A CB    1 
ATOM   3674 N  N     . GLU A 1 459 ? 233.147 108.855 -62.230 1.00 45.70  ? 490 GLU A N     1 
ATOM   3675 C  CA    . GLU A 1 459 ? 232.314 107.684 -62.003 1.00 45.70  ? 490 GLU A CA    1 
ATOM   3676 C  C     . GLU A 1 459 ? 231.731 107.650 -60.587 1.00 45.70  ? 490 GLU A C     1 
ATOM   3677 O  O     . GLU A 1 459 ? 230.582 107.239 -60.383 1.00 45.70  ? 490 GLU A O     1 
ATOM   3678 C  CB    . GLU A 1 459 ? 233.137 106.421 -62.269 1.00 70.78  ? 490 GLU A CB    1 
ATOM   3679 C  CG    . GLU A 1 459 ? 232.324 105.140 -62.302 1.00 70.78  ? 490 GLU A CG    1 
ATOM   3680 C  CD    . GLU A 1 459 ? 233.103 103.973 -62.900 1.00 70.78  ? 490 GLU A CD    1 
ATOM   3681 O  OE1   . GLU A 1 459 ? 234.326 104.137 -63.143 1.00 70.78  ? 490 GLU A OE1   1 
ATOM   3682 O  OE2   . GLU A 1 459 ? 232.488 102.899 -63.128 1.00 70.78  ? 490 GLU A OE2   1 
ATOM   3683 N  N     . LEU A 1 460 ? 232.532 108.082 -59.614 1.00 48.26  ? 491 LEU A N     1 
ATOM   3684 C  CA    . LEU A 1 460 ? 232.114 108.106 -58.213 1.00 48.26  ? 491 LEU A CA    1 
ATOM   3685 C  C     . LEU A 1 460 ? 231.064 109.177 -58.015 1.00 48.26  ? 491 LEU A C     1 
ATOM   3686 O  O     . LEU A 1 460 ? 230.033 108.913 -57.420 1.00 48.26  ? 491 LEU A O     1 
ATOM   3687 C  CB    . LEU A 1 460 ? 233.315 108.359 -57.288 1.00 38.63  ? 491 LEU A CB    1 
ATOM   3688 C  CG    . LEU A 1 460 ? 234.291 107.190 -57.093 1.00 38.63  ? 491 LEU A CG    1 
ATOM   3689 C  CD1   . LEU A 1 460 ? 235.673 107.703 -56.717 1.00 38.63  ? 491 LEU A CD1   1 
ATOM   3690 C  CD2   . LEU A 1 460 ? 233.742 106.251 -56.034 1.00 38.63  ? 491 LEU A CD2   1 
ATOM   3691 N  N     . GLU A 1 461 ? 231.318 110.385 -58.513 1.00 54.75  ? 492 GLU A N     1 
ATOM   3692 C  CA    . GLU A 1 461 ? 230.330 111.452 -58.380 1.00 54.75  ? 492 GLU A CA    1 
ATOM   3693 C  C     . GLU A 1 461 ? 228.999 110.910 -58.871 1.00 54.75  ? 492 GLU A C     1 
ATOM   3694 O  O     . GLU A 1 461 ? 227.959 111.088 -58.232 1.00 54.75  ? 492 GLU A O     1 
ATOM   3695 C  CB    . GLU A 1 461 ? 230.689 112.677 -59.228 1.00 62.66  ? 492 GLU A CB    1 
ATOM   3696 C  CG    . GLU A 1 461 ? 229.470 113.595 -59.441 1.00 62.66  ? 492 GLU A CG    1 
ATOM   3697 C  CD    . GLU A 1 461 ? 229.800 114.959 -60.050 1.00 62.66  ? 492 GLU A CD    1 
ATOM   3698 O  OE1   . GLU A 1 461 ? 230.317 115.012 -61.197 1.00 62.66  ? 492 GLU A OE1   1 
ATOM   3699 O  OE2   . GLU A 1 461 ? 229.525 115.983 -59.379 1.00 62.66  ? 492 GLU A OE2   1 
ATOM   3700 N  N     . GLU A 1 462 ? 229.057 110.250 -60.021 1.00 65.08  ? 493 GLU A N     1 
ATOM   3701 C  CA    . GLU A 1 462 ? 227.894 109.658 -60.661 1.00 65.08  ? 493 GLU A CA    1 
ATOM   3702 C  C     . GLU A 1 462 ? 227.187 108.700 -59.700 1.00 65.08  ? 493 GLU A C     1 
ATOM   3703 O  O     . GLU A 1 462 ? 225.967 108.560 -59.750 1.00 65.08  ? 493 GLU A O     1 
ATOM   3704 C  CB    . GLU A 1 462 ? 228.354 108.931 -61.927 1.00 103.60 ? 493 GLU A CB    1 
ATOM   3705 C  CG    . GLU A 1 462 ? 227.295 108.137 -62.681 1.00 103.60 ? 493 GLU A CG    1 
ATOM   3706 C  CD    . GLU A 1 462 ? 227.920 106.998 -63.509 1.00 103.60 ? 493 GLU A CD    1 
ATOM   3707 O  OE1   . GLU A 1 462 ? 227.496 105.827 -63.321 1.00 103.60 ? 493 GLU A OE1   1 
ATOM   3708 O  OE2   . GLU A 1 462 ? 228.835 107.269 -64.332 1.00 103.60 ? 493 GLU A OE2   1 
ATOM   3709 N  N     . LEU A 1 463 ? 227.952 108.061 -58.820 1.00 39.52  ? 494 LEU A N     1 
ATOM   3710 C  CA    . LEU A 1 463 ? 227.396 107.128 -57.849 1.00 39.52  ? 494 LEU A CA    1 
ATOM   3711 C  C     . LEU A 1 463 ? 226.925 107.788 -56.563 1.00 39.52  ? 494 LEU A C     1 
ATOM   3712 O  O     . LEU A 1 463 ? 225.758 107.689 -56.204 1.00 39.52  ? 494 LEU A O     1 
ATOM   3713 C  CB    . LEU A 1 463 ? 228.425 106.069 -57.495 1.00 40.31  ? 494 LEU A CB    1 
ATOM   3714 C  CG    . LEU A 1 463 ? 228.829 105.171 -58.653 1.00 40.31  ? 494 LEU A CG    1 
ATOM   3715 C  CD1   . LEU A 1 463 ? 229.895 104.180 -58.191 1.00 40.31  ? 494 LEU A CD1   1 
ATOM   3716 C  CD2   . LEU A 1 463 ? 227.600 104.437 -59.163 1.00 40.31  ? 494 LEU A CD2   1 
ATOM   3717 N  N     . TYR A 1 464 ? 227.842 108.447 -55.861 1.00 47.74  ? 495 TYR A N     1 
ATOM   3718 C  CA    . TYR A 1 464 ? 227.526 109.113 -54.595 1.00 47.74  ? 495 TYR A CA    1 
ATOM   3719 C  C     . TYR A 1 464 ? 226.722 110.399 -54.793 1.00 47.74  ? 495 TYR A C     1 
ATOM   3720 O  O     . TYR A 1 464 ? 226.045 110.878 -53.875 1.00 47.74  ? 495 TYR A O     1 
ATOM   3721 C  CB    . TYR A 1 464 ? 228.812 109.411 -53.809 1.00 37.89  ? 495 TYR A CB    1 
ATOM   3722 C  CG    . TYR A 1 464 ? 229.440 108.214 -53.099 1.00 37.89  ? 495 TYR A CG    1 
ATOM   3723 C  CD1   . TYR A 1 464 ? 230.406 107.425 -53.717 1.00 37.89  ? 495 TYR A CD1   1 
ATOM   3724 C  CD2   . TYR A 1 464 ? 229.082 107.895 -51.793 1.00 37.89  ? 495 TYR A CD2   1 
ATOM   3725 C  CE1   . TYR A 1 464 ? 230.998 106.363 -53.049 1.00 37.89  ? 495 TYR A CE1   1 
ATOM   3726 C  CE2   . TYR A 1 464 ? 229.670 106.833 -51.122 1.00 37.89  ? 495 TYR A CE2   1 
ATOM   3727 C  CZ    . TYR A 1 464 ? 230.625 106.081 -51.753 1.00 37.89  ? 495 TYR A CZ    1 
ATOM   3728 O  OH    . TYR A 1 464 ? 231.234 105.076 -51.056 1.00 37.89  ? 495 TYR A OH    1 
ATOM   3729 N  N     . GLY A 1 465 ? 226.805 110.956 -55.995 1.00 34.46  ? 496 GLY A N     1 
ATOM   3730 C  CA    . GLY A 1 465 ? 226.055 112.160 -56.306 1.00 34.46  ? 496 GLY A CA    1 
ATOM   3731 C  C     . GLY A 1 465 ? 226.569 113.429 -55.676 1.00 34.46  ? 496 GLY A C     1 
ATOM   3732 O  O     . GLY A 1 465 ? 226.323 114.531 -56.173 1.00 34.46  ? 496 GLY A O     1 
ATOM   3733 N  N     . ASP A 1 466 ? 227.289 113.267 -54.575 1.00 55.98  ? 497 ASP A N     1 
ATOM   3734 C  CA    . ASP A 1 466 ? 227.856 114.400 -53.865 1.00 55.98  ? 497 ASP A CA    1 
ATOM   3735 C  C     . ASP A 1 466 ? 229.108 113.972 -53.099 1.00 55.98  ? 497 ASP A C     1 
ATOM   3736 O  O     . ASP A 1 466 ? 229.099 112.960 -52.403 1.00 55.98  ? 497 ASP A O     1 
ATOM   3737 C  CB    . ASP A 1 466 ? 226.801 114.980 -52.916 1.00 68.24  ? 497 ASP A CB    1 
ATOM   3738 C  CG    . ASP A 1 466 ? 227.224 116.305 -52.314 1.00 68.24  ? 497 ASP A CG    1 
ATOM   3739 O  OD1   . ASP A 1 466 ? 226.335 117.154 -52.075 1.00 68.24  ? 497 ASP A OD1   1 
ATOM   3740 O  OD2   . ASP A 1 466 ? 228.442 116.493 -52.073 1.00 68.24  ? 497 ASP A OD2   1 
ATOM   3741 N  N     . ILE A 1 467 ? 230.186 114.739 -53.240 1.00 46.17  ? 498 ILE A N     1 
ATOM   3742 C  CA    . ILE A 1 467 ? 231.444 114.431 -52.553 1.00 46.17  ? 498 ILE A CA    1 
ATOM   3743 C  C     . ILE A 1 467 ? 231.203 114.250 -51.057 1.00 46.17  ? 498 ILE A C     1 
ATOM   3744 O  O     . ILE A 1 467 ? 231.768 113.346 -50.428 1.00 46.17  ? 498 ILE A O     1 
ATOM   3745 C  CB    . ILE A 1 467 ? 232.493 115.559 -52.754 1.00 47.11  ? 498 ILE A CB    1 
ATOM   3746 C  CG1   . ILE A 1 467 ? 233.836 115.167 -52.124 1.00 47.11  ? 498 ILE A CG1   1 
ATOM   3747 C  CG2   . ILE A 1 467 ? 232.005 116.830 -52.107 1.00 47.11  ? 498 ILE A CG2   1 
ATOM   3748 C  CD1   . ILE A 1 467 ? 234.487 113.943 -52.740 1.00 47.11  ? 498 ILE A CD1   1 
ATOM   3749 N  N     . ASP A 1 468 ? 230.351 115.111 -50.503 1.00 52.65  ? 499 ASP A N     1 
ATOM   3750 C  CA    . ASP A 1 468 ? 230.030 115.073 -49.083 1.00 52.65  ? 499 ASP A CA    1 
ATOM   3751 C  C     . ASP A 1 468 ? 229.454 113.760 -48.625 1.00 52.65  ? 499 ASP A C     1 
ATOM   3752 O  O     . ASP A 1 468 ? 229.587 113.403 -47.460 1.00 52.65  ? 499 ASP A O     1 
ATOM   3753 C  CB    . ASP A 1 468 ? 229.036 116.163 -48.726 1.00 63.63  ? 499 ASP A CB    1 
ATOM   3754 C  CG    . ASP A 1 468 ? 229.576 117.536 -48.987 1.00 63.63  ? 499 ASP A CG    1 
ATOM   3755 O  OD1   . ASP A 1 468 ? 230.724 117.810 -48.560 1.00 63.63  ? 499 ASP A OD1   1 
ATOM   3756 O  OD2   . ASP A 1 468 ? 228.847 118.340 -49.617 1.00 63.63  ? 499 ASP A OD2   1 
ATOM   3757 N  N     . ALA A 1 469 ? 228.804 113.044 -49.534 1.00 43.74  ? 500 ALA A N     1 
ATOM   3758 C  CA    . ALA A 1 469 ? 228.187 111.776 -49.184 1.00 43.74  ? 500 ALA A CA    1 
ATOM   3759 C  C     . ALA A 1 469 ? 229.184 110.641 -49.173 1.00 43.74  ? 500 ALA A C     1 
ATOM   3760 O  O     . ALA A 1 469 ? 228.925 109.610 -48.566 1.00 43.74  ? 500 ALA A O     1 
ATOM   3761 C  CB    . ALA A 1 469 ? 227.052 111.467 -50.144 1.00 72.68  ? 500 ALA A CB    1 
ATOM   3762 N  N     . LEU A 1 470 ? 230.320 110.829 -49.836 1.00 32.53  ? 501 LEU A N     1 
ATOM   3763 C  CA    . LEU A 1 470 ? 231.349 109.795 -49.886 1.00 32.53  ? 501 LEU A CA    1 
ATOM   3764 C  C     . LEU A 1 470 ? 231.554 109.146 -48.526 1.00 32.53  ? 501 LEU A C     1 
ATOM   3765 O  O     . LEU A 1 470 ? 231.303 109.756 -47.492 1.00 32.53  ? 501 LEU A O     1 
ATOM   3766 C  CB    . LEU A 1 470 ? 232.662 110.381 -50.385 1.00 47.01  ? 501 LEU A CB    1 
ATOM   3767 C  CG    . LEU A 1 470 ? 233.906 109.496 -50.307 1.00 47.01  ? 501 LEU A CG    1 
ATOM   3768 C  CD1   . LEU A 1 470 ? 233.619 108.108 -50.811 1.00 47.01  ? 501 LEU A CD1   1 
ATOM   3769 C  CD2   . LEU A 1 470 ? 234.996 110.130 -51.138 1.00 47.01  ? 501 LEU A CD2   1 
ATOM   3770 N  N     . GLU A 1 471 ? 232.025 107.905 -48.540 1.00 50.07  ? 502 GLU A N     1 
ATOM   3771 C  CA    . GLU A 1 471 ? 232.226 107.130 -47.321 1.00 50.07  ? 502 GLU A CA    1 
ATOM   3772 C  C     . GLU A 1 471 ? 233.657 107.101 -46.777 1.00 50.07  ? 502 GLU A C     1 
ATOM   3773 O  O     . GLU A 1 471 ? 234.611 107.372 -47.501 1.00 50.07  ? 502 GLU A O     1 
ATOM   3774 C  CB    . GLU A 1 471 ? 231.731 105.697 -47.555 1.00 57.92  ? 502 GLU A CB    1 
ATOM   3775 C  CG    . GLU A 1 471 ? 230.286 105.601 -48.056 1.00 57.92  ? 502 GLU A CG    1 
ATOM   3776 C  CD    . GLU A 1 471 ? 229.663 104.240 -47.775 1.00 57.92  ? 502 GLU A CD    1 
ATOM   3777 O  OE1   . GLU A 1 471 ? 229.285 103.987 -46.603 1.00 57.92  ? 502 GLU A OE1   1 
ATOM   3778 O  OE2   . GLU A 1 471 ? 229.553 103.424 -48.715 1.00 57.92  ? 502 GLU A OE2   1 
ATOM   3779 N  N     . PHE A 1 472 ? 233.782 106.756 -45.493 1.00 40.59  ? 503 PHE A N     1 
ATOM   3780 C  CA    . PHE A 1 472 ? 235.067 106.688 -44.800 1.00 40.59  ? 503 PHE A CA    1 
ATOM   3781 C  C     . PHE A 1 472 ? 236.095 105.752 -45.441 1.00 40.59  ? 503 PHE A C     1 
ATOM   3782 O  O     . PHE A 1 472 ? 237.140 106.202 -45.893 1.00 40.59  ? 503 PHE A O     1 
ATOM   3783 C  CB    . PHE A 1 472 ? 234.866 106.276 -43.331 1.00 49.25  ? 503 PHE A CB    1 
ATOM   3784 C  CG    . PHE A 1 472 ? 236.134 106.353 -42.491 1.00 49.25  ? 503 PHE A CG    1 
ATOM   3785 C  CD1   . PHE A 1 472 ? 236.630 107.589 -42.050 1.00 49.25  ? 503 PHE A CD1   1 
ATOM   3786 C  CD2   . PHE A 1 472 ? 236.859 105.193 -42.174 1.00 49.25  ? 503 PHE A CD2   1 
ATOM   3787 C  CE1   . PHE A 1 472 ? 237.827 107.669 -41.312 1.00 49.25  ? 503 PHE A CE1   1 
ATOM   3788 C  CE2   . PHE A 1 472 ? 238.061 105.264 -41.436 1.00 49.25  ? 503 PHE A CE2   1 
ATOM   3789 C  CZ    . PHE A 1 472 ? 238.541 106.505 -41.009 1.00 49.25  ? 503 PHE A CZ    1 
ATOM   3790 N  N     . TYR A 1 473 ? 235.813 104.454 -45.485 1.00 38.86  ? 504 TYR A N     1 
ATOM   3791 C  CA    . TYR A 1 473 ? 236.781 103.519 -46.054 1.00 38.86  ? 504 TYR A CA    1 
ATOM   3792 C  C     . TYR A 1 473 ? 237.124 103.742 -47.524 1.00 38.86  ? 504 TYR A C     1 
ATOM   3793 O  O     . TYR A 1 473 ? 238.289 103.711 -47.907 1.00 38.86  ? 504 TYR A O     1 
ATOM   3794 C  CB    . TYR A 1 473 ? 236.318 102.077 -45.875 1.00 42.88  ? 504 TYR A CB    1 
ATOM   3795 C  CG    . TYR A 1 473 ? 237.413 101.086 -46.186 1.00 42.88  ? 504 TYR A CG    1 
ATOM   3796 C  CD1   . TYR A 1 473 ? 238.523 100.963 -45.351 1.00 42.88  ? 504 TYR A CD1   1 
ATOM   3797 C  CD2   . TYR A 1 473 ? 237.358 100.286 -47.327 1.00 42.88  ? 504 TYR A CD2   1 
ATOM   3798 C  CE1   . TYR A 1 473 ? 239.549 100.067 -45.642 1.00 42.88  ? 504 TYR A CE1   1 
ATOM   3799 C  CE2   . TYR A 1 473 ? 238.383 99.386  -47.630 1.00 42.88  ? 504 TYR A CE2   1 
ATOM   3800 C  CZ    . TYR A 1 473 ? 239.472 99.284  -46.781 1.00 42.88  ? 504 TYR A CZ    1 
ATOM   3801 O  OH    . TYR A 1 473 ? 240.488 98.401  -47.074 1.00 42.88  ? 504 TYR A OH    1 
ATOM   3802 N  N     . PRO A 1 474 ? 236.114 103.947 -48.372 1.00 42.16  ? 505 PRO A N     1 
ATOM   3803 C  CA    . PRO A 1 474 ? 236.393 104.165 -49.794 1.00 42.16  ? 505 PRO A CA    1 
ATOM   3804 C  C     . PRO A 1 474 ? 237.220 105.422 -50.053 1.00 42.16  ? 505 PRO A C     1 
ATOM   3805 O  O     . PRO A 1 474 ? 238.099 105.425 -50.911 1.00 42.16  ? 505 PRO A O     1 
ATOM   3806 C  CB    . PRO A 1 474 ? 234.999 104.252 -50.411 1.00 51.38  ? 505 PRO A CB    1 
ATOM   3807 C  CG    . PRO A 1 474 ? 234.172 103.388 -49.493 1.00 51.38  ? 505 PRO A CG    1 
ATOM   3808 C  CD    . PRO A 1 474 ? 234.668 103.808 -48.135 1.00 51.38  ? 505 PRO A CD    1 
ATOM   3809 N  N     . GLY A 1 475 ? 236.925 106.490 -49.313 1.00 37.58  ? 506 GLY A N     1 
ATOM   3810 C  CA    . GLY A 1 475 ? 237.661 107.730 -49.473 1.00 37.58  ? 506 GLY A CA    1 
ATOM   3811 C  C     . GLY A 1 475 ? 239.137 107.530 -49.172 1.00 37.58  ? 506 GLY A C     1 
ATOM   3812 O  O     . GLY A 1 475 ? 240.000 107.835 -49.988 1.00 37.58  ? 506 GLY A O     1 
ATOM   3813 N  N     . LEU A 1 476 ? 239.429 107.015 -47.989 1.00 38.80  ? 507 LEU A N     1 
ATOM   3814 C  CA    . LEU A 1 476 ? 240.798 106.759 -47.598 1.00 38.80  ? 507 LEU A CA    1 
ATOM   3815 C  C     . LEU A 1 476 ? 241.563 105.989 -48.661 1.00 38.80  ? 507 LEU A C     1 
ATOM   3816 O  O     . LEU A 1 476 ? 242.693 106.340 -48.987 1.00 38.80  ? 507 LEU A O     1 
ATOM   3817 C  CB    . LEU A 1 476 ? 240.828 105.971 -46.295 1.00 42.75  ? 507 LEU A CB    1 
ATOM   3818 C  CG    . LEU A 1 476 ? 240.652 106.765 -45.006 1.00 42.75  ? 507 LEU A CG    1 
ATOM   3819 C  CD1   . LEU A 1 476 ? 240.065 105.880 -43.929 1.00 42.75  ? 507 LEU A CD1   1 
ATOM   3820 C  CD2   . LEU A 1 476 ? 241.998 107.319 -44.579 1.00 42.75  ? 507 LEU A CD2   1 
ATOM   3821 N  N     . LEU A 1 477 ? 240.954 104.945 -49.214 1.00 49.26  ? 508 LEU A N     1 
ATOM   3822 C  CA    . LEU A 1 477 ? 241.645 104.141 -50.217 1.00 49.26  ? 508 LEU A CA    1 
ATOM   3823 C  C     . LEU A 1 477 ? 241.563 104.671 -51.631 1.00 49.26  ? 508 LEU A C     1 
ATOM   3824 O  O     . LEU A 1 477 ? 242.293 104.216 -52.508 1.00 49.26  ? 508 LEU A O     1 
ATOM   3825 C  CB    . LEU A 1 477 ? 241.138 102.701 -50.192 1.00 36.90  ? 508 LEU A CB    1 
ATOM   3826 C  CG    . LEU A 1 477 ? 241.582 101.874 -48.989 1.00 36.90  ? 508 LEU A CG    1 
ATOM   3827 C  CD1   . LEU A 1 477 ? 241.138 100.441 -49.175 1.00 36.90  ? 508 LEU A CD1   1 
ATOM   3828 C  CD2   . LEU A 1 477 ? 243.092 101.936 -48.858 1.00 36.90  ? 508 LEU A CD2   1 
ATOM   3829 N  N     . LEU A 1 478 ? 240.678 105.630 -51.859 1.00 52.53  ? 509 LEU A N     1 
ATOM   3830 C  CA    . LEU A 1 478 ? 240.525 106.213 -53.186 1.00 52.53  ? 509 LEU A CA    1 
ATOM   3831 C  C     . LEU A 1 478 ? 241.184 107.591 -53.266 1.00 52.53  ? 509 LEU A C     1 
ATOM   3832 O  O     . LEU A 1 478 ? 241.193 108.228 -54.312 1.00 52.53  ? 509 LEU A O     1 
ATOM   3833 C  CB    . LEU A 1 478 ? 239.040 106.304 -53.540 1.00 32.23  ? 509 LEU A CB    1 
ATOM   3834 C  CG    . LEU A 1 478 ? 238.410 104.940 -53.802 1.00 32.23  ? 509 LEU A CG    1 
ATOM   3835 C  CD1   . LEU A 1 478 ? 236.910 105.034 -53.835 1.00 32.23  ? 509 LEU A CD1   1 
ATOM   3836 C  CD2   . LEU A 1 478 ? 238.936 104.426 -55.109 1.00 32.23  ? 509 LEU A CD2   1 
ATOM   3837 N  N     . GLU A 1 479 ? 241.738 108.044 -52.149 1.00 50.33  ? 510 GLU A N     1 
ATOM   3838 C  CA    . GLU A 1 479 ? 242.403 109.329 -52.093 1.00 50.33  ? 510 GLU A CA    1 
ATOM   3839 C  C     . GLU A 1 479 ? 243.752 109.235 -52.775 1.00 50.33  ? 510 GLU A C     1 
ATOM   3840 O  O     . GLU A 1 479 ? 244.409 108.193 -52.717 1.00 50.33  ? 510 GLU A O     1 
ATOM   3841 C  CB    . GLU A 1 479 ? 242.608 109.744 -50.644 1.00 45.18  ? 510 GLU A CB    1 
ATOM   3842 C  CG    . GLU A 1 479 ? 243.488 110.970 -50.468 1.00 45.18  ? 510 GLU A CG    1 
ATOM   3843 C  CD    . GLU A 1 479 ? 243.463 111.500 -49.050 1.00 45.18  ? 510 GLU A CD    1 
ATOM   3844 O  OE1   . GLU A 1 479 ? 242.646 112.413 -48.773 1.00 45.18  ? 510 GLU A OE1   1 
ATOM   3845 O  OE2   . GLU A 1 479 ? 244.252 111.002 -48.216 1.00 45.18  ? 510 GLU A OE2   1 
ATOM   3846 N  N     . LYS A 1 480 ? 244.166 110.325 -53.409 1.00 45.88  ? 511 LYS A N     1 
ATOM   3847 C  CA    . LYS A 1 480 ? 245.448 110.369 -54.100 1.00 45.88  ? 511 LYS A CA    1 
ATOM   3848 C  C     . LYS A 1 480 ? 246.616 110.218 -53.119 1.00 45.88  ? 511 LYS A C     1 
ATOM   3849 O  O     . LYS A 1 480 ? 246.647 110.870 -52.078 1.00 45.88  ? 511 LYS A O     1 
ATOM   3850 C  CB    . LYS A 1 480 ? 245.564 111.690 -54.865 1.00 57.31  ? 511 LYS A CB    1 
ATOM   3851 C  CG    . LYS A 1 480 ? 245.363 112.929 -53.996 1.00 57.31  ? 511 LYS A CG    1 
ATOM   3852 C  CD    . LYS A 1 480 ? 245.542 114.217 -54.801 1.00 57.31  ? 511 LYS A CD    1 
ATOM   3853 C  CE    . LYS A 1 480 ? 245.730 115.445 -53.906 1.00 57.31  ? 511 LYS A CE    1 
ATOM   3854 N  NZ    . LYS A 1 480 ? 244.536 115.781 -53.080 1.00 57.31  ? 511 LYS A NZ    1 
ATOM   3855 N  N     . CYS A 1 481 ? 247.574 109.358 -53.440 1.00 34.61  ? 512 CYS A N     1 
ATOM   3856 C  CA    . CYS A 1 481 ? 248.721 109.171 -52.559 1.00 34.61  ? 512 CYS A CA    1 
ATOM   3857 C  C     . CYS A 1 481 ? 249.677 110.356 -52.611 1.00 34.61  ? 512 CYS A C     1 
ATOM   3858 O  O     . CYS A 1 481 ? 249.771 111.030 -53.634 1.00 34.61  ? 512 CYS A O     1 
ATOM   3859 C  CB    . CYS A 1 481 ? 249.519 107.934 -52.966 1.00 67.62  ? 512 CYS A CB    1 
ATOM   3860 S  SG    . CYS A 1 481 ? 248.718 106.347 -52.716 1.00 67.62  ? 512 CYS A SG    1 
ATOM   3861 N  N     . HIS A 1 482 ? 250.386 110.617 -51.514 1.00 52.52  ? 513 HIS A N     1 
ATOM   3862 C  CA    . HIS A 1 482 ? 251.380 111.690 -51.528 1.00 52.52  ? 513 HIS A CA    1 
ATOM   3863 C  C     . HIS A 1 482 ? 252.384 111.133 -52.543 1.00 52.52  ? 513 HIS A C     1 
ATOM   3864 O  O     . HIS A 1 482 ? 252.590 109.923 -52.632 1.00 52.52  ? 513 HIS A O     1 
ATOM   3865 C  CB    . HIS A 1 482 ? 252.085 111.860 -50.163 1.00 65.66  ? 513 HIS A CB    1 
ATOM   3866 C  CG    . HIS A 1 482 ? 251.270 112.561 -49.112 1.00 65.66  ? 513 HIS A CG    1 
ATOM   3867 N  ND1   . HIS A 1 482 ? 251.609 112.531 -47.774 1.00 65.66  ? 513 HIS A ND1   1 
ATOM   3868 C  CD2   . HIS A 1 482 ? 250.149 113.319 -49.197 1.00 65.66  ? 513 HIS A CD2   1 
ATOM   3869 C  CE1   . HIS A 1 482 ? 250.732 113.238 -47.081 1.00 65.66  ? 513 HIS A CE1   1 
ATOM   3870 N  NE2   . HIS A 1 482 ? 249.835 113.726 -47.920 1.00 65.66  ? 513 HIS A NE2   1 
ATOM   3871 N  N     . PRO A 1 483 ? 253.022 112.004 -53.320 1.00 52.10  ? 514 PRO A N     1 
ATOM   3872 C  CA    . PRO A 1 483 ? 253.992 111.538 -54.317 1.00 52.10  ? 514 PRO A CA    1 
ATOM   3873 C  C     . PRO A 1 483 ? 255.004 110.515 -53.788 1.00 52.10  ? 514 PRO A C     1 
ATOM   3874 O  O     . PRO A 1 483 ? 255.764 110.807 -52.864 1.00 52.10  ? 514 PRO A O     1 
ATOM   3875 C  CB    . PRO A 1 483 ? 254.658 112.833 -54.770 1.00 70.53  ? 514 PRO A CB    1 
ATOM   3876 C  CG    . PRO A 1 483 ? 253.547 113.855 -54.601 1.00 70.53  ? 514 PRO A CG    1 
ATOM   3877 C  CD    . PRO A 1 483 ? 252.966 113.475 -53.265 1.00 70.53  ? 514 PRO A CD    1 
ATOM   3878 N  N     . ASN A 1 484 ? 255.005 109.326 -54.393 1.00 56.92  ? 515 ASN A N     1 
ATOM   3879 C  CA    . ASN A 1 484 ? 255.910 108.222 -54.028 1.00 56.92  ? 515 ASN A CA    1 
ATOM   3880 C  C     . ASN A 1 484 ? 255.634 107.612 -52.666 1.00 56.92  ? 515 ASN A C     1 
ATOM   3881 O  O     . ASN A 1 484 ? 256.421 106.816 -52.158 1.00 56.92  ? 515 ASN A O     1 
ATOM   3882 C  CB    . ASN A 1 484 ? 257.359 108.682 -54.064 1.00 57.34  ? 515 ASN A CB    1 
ATOM   3883 C  CG    . ASN A 1 484 ? 257.797 109.067 -55.447 1.00 57.34  ? 515 ASN A CG    1 
ATOM   3884 O  OD1   . ASN A 1 484 ? 257.230 109.980 -56.056 1.00 57.34  ? 515 ASN A OD1   1 
ATOM   3885 N  ND2   . ASN A 1 484 ? 258.811 108.371 -55.963 1.00 57.34  ? 515 ASN A ND2   1 
ATOM   3886 N  N     . SER A 1 485 ? 254.501 107.978 -52.087 1.00 61.88  ? 516 SER A N     1 
ATOM   3887 C  CA    . SER A 1 485 ? 254.118 107.494 -50.771 1.00 61.88  ? 516 SER A CA    1 
ATOM   3888 C  C     . SER A 1 485 ? 253.337 106.193 -50.850 1.00 61.88  ? 516 SER A C     1 
ATOM   3889 O  O     . SER A 1 485 ? 252.798 105.852 -51.902 1.00 61.88  ? 516 SER A O     1 
ATOM   3890 C  CB    . SER A 1 485 ? 253.279 108.568 -50.085 1.00 95.60  ? 516 SER A CB    1 
ATOM   3891 O  OG    . SER A 1 485 ? 253.880 109.844 -50.279 1.00 95.60  ? 516 SER A OG    1 
ATOM   3892 N  N     . ILE A 1 486 ? 253.273 105.467 -49.740 1.00 38.45  ? 517 ILE A N     1 
ATOM   3893 C  CA    . ILE A 1 486 ? 252.543 104.212 -49.722 1.00 38.45  ? 517 ILE A CA    1 
ATOM   3894 C  C     . ILE A 1 486 ? 251.053 104.520 -49.795 1.00 38.45  ? 517 ILE A C     1 
ATOM   3895 O  O     . ILE A 1 486 ? 250.257 103.711 -50.278 1.00 38.45  ? 517 ILE A O     1 
ATOM   3896 C  CB    . ILE A 1 486 ? 252.831 103.436 -48.454 1.00 37.49  ? 517 ILE A CB    1 
ATOM   3897 C  CG1   . ILE A 1 486 ? 252.187 102.050 -48.543 1.00 37.49  ? 517 ILE A CG1   1 
ATOM   3898 C  CG2   . ILE A 1 486 ? 252.329 104.225 -47.259 1.00 37.49  ? 517 ILE A CG2   1 
ATOM   3899 C  CD1   . ILE A 1 486 ? 252.708 101.047 -47.525 1.00 37.49  ? 517 ILE A CD1   1 
ATOM   3900 N  N     . PHE A 1 487 ? 250.682 105.698 -49.302 1.00 37.61  ? 518 PHE A N     1 
ATOM   3901 C  CA    . PHE A 1 487 ? 249.297 106.138 -49.339 1.00 37.61  ? 518 PHE A CA    1 
ATOM   3902 C  C     . PHE A 1 487 ? 249.162 107.635 -49.144 1.00 37.61  ? 518 PHE A C     1 
ATOM   3903 O  O     . PHE A 1 487 ? 250.124 108.314 -48.806 1.00 37.61  ? 518 PHE A O     1 
ATOM   3904 C  CB    . PHE A 1 487 ? 248.431 105.368 -48.328 1.00 45.35  ? 518 PHE A CB    1 
ATOM   3905 C  CG    . PHE A 1 487 ? 249.044 105.213 -46.960 1.00 45.35  ? 518 PHE A CG    1 
ATOM   3906 C  CD1   . PHE A 1 487 ? 249.065 103.967 -46.343 1.00 45.35  ? 518 PHE A CD1   1 
ATOM   3907 C  CD2   . PHE A 1 487 ? 249.560 106.301 -46.275 1.00 45.35  ? 518 PHE A CD2   1 
ATOM   3908 C  CE1   . PHE A 1 487 ? 249.589 103.811 -45.072 1.00 45.35  ? 518 PHE A CE1   1 
ATOM   3909 C  CE2   . PHE A 1 487 ? 250.084 106.145 -44.999 1.00 45.35  ? 518 PHE A CE2   1 
ATOM   3910 C  CZ    . PHE A 1 487 ? 250.098 104.900 -44.398 1.00 45.35  ? 518 PHE A CZ    1 
ATOM   3911 N  N     . GLY A 1 488 ? 247.951 108.134 -49.364 1.00 40.81  ? 519 GLY A N     1 
ATOM   3912 C  CA    . GLY A 1 488 ? 247.684 109.559 -49.276 1.00 40.81  ? 519 GLY A CA    1 
ATOM   3913 C  C     . GLY A 1 488 ? 247.693 110.313 -47.957 1.00 40.81  ? 519 GLY A C     1 
ATOM   3914 O  O     . GLY A 1 488 ? 248.074 109.799 -46.906 1.00 40.81  ? 519 GLY A O     1 
ATOM   3915 N  N     . GLU A 1 489 ? 247.255 111.568 -48.045 1.00 48.69  ? 520 GLU A N     1 
ATOM   3916 C  CA    . GLU A 1 489 ? 247.194 112.472 -46.909 1.00 48.69  ? 520 GLU A CA    1 
ATOM   3917 C  C     . GLU A 1 489 ? 246.326 111.943 -45.766 1.00 48.69  ? 520 GLU A C     1 
ATOM   3918 O  O     . GLU A 1 489 ? 246.822 111.690 -44.674 1.00 48.69  ? 520 GLU A O     1 
ATOM   3919 C  CB    . GLU A 1 489 ? 246.673 113.841 -47.372 1.00 58.27  ? 520 GLU A CB    1 
ATOM   3920 C  CG    . GLU A 1 489 ? 246.741 114.943 -46.312 1.00 58.27  ? 520 GLU A CG    1 
ATOM   3921 C  CD    . GLU A 1 489 ? 246.168 116.293 -46.781 1.00 58.27  ? 520 GLU A CD    1 
ATOM   3922 O  OE1   . GLU A 1 489 ? 245.026 116.318 -47.311 1.00 58.27  ? 520 GLU A OE1   1 
ATOM   3923 O  OE2   . GLU A 1 489 ? 246.862 117.332 -46.609 1.00 58.27  ? 520 GLU A OE2   1 
ATOM   3924 N  N     . SER A 1 490 ? 245.037 111.766 -46.027 1.00 33.67  ? 521 SER A N     1 
ATOM   3925 C  CA    . SER A 1 490 ? 244.097 111.303 -45.018 1.00 33.67  ? 521 SER A CA    1 
ATOM   3926 C  C     . SER A 1 490 ? 244.476 110.083 -44.197 1.00 33.67  ? 521 SER A C     1 
ATOM   3927 O  O     . SER A 1 490 ? 243.997 109.935 -43.082 1.00 33.67  ? 521 SER A O     1 
ATOM   3928 C  CB    . SER A 1 490 ? 242.732 111.075 -45.649 1.00 32.93  ? 521 SER A CB    1 
ATOM   3929 O  OG    . SER A 1 490 ? 242.170 112.308 -46.047 1.00 32.93  ? 521 SER A OG    1 
ATOM   3930 N  N     . MET A 1 491 ? 245.319 109.205 -44.725 1.00 35.39  ? 522 MET A N     1 
ATOM   3931 C  CA    . MET A 1 491 ? 245.716 108.013 -43.975 1.00 35.39  ? 522 MET A CA    1 
ATOM   3932 C  C     . MET A 1 491 ? 246.631 108.328 -42.789 1.00 35.39  ? 522 MET A C     1 
ATOM   3933 O  O     . MET A 1 491 ? 246.499 107.742 -41.710 1.00 35.39  ? 522 MET A O     1 
ATOM   3934 C  CB    . MET A 1 491 ? 246.430 107.024 -44.889 1.00 45.51  ? 522 MET A CB    1 
ATOM   3935 C  CG    . MET A 1 491 ? 246.749 105.706 -44.224 1.00 45.51  ? 522 MET A CG    1 
ATOM   3936 S  SD    . MET A 1 491 ? 245.260 104.764 -43.900 1.00 45.51  ? 522 MET A SD    1 
ATOM   3937 C  CE    . MET A 1 491 ? 245.313 103.640 -45.258 1.00 45.51  ? 522 MET A CE    1 
ATOM   3938 N  N     . ILE A 1 492 ? 247.567 109.250 -42.996 1.00 32.86  ? 523 ILE A N     1 
ATOM   3939 C  CA    . ILE A 1 492 ? 248.510 109.635 -41.954 1.00 32.86  ? 523 ILE A CA    1 
ATOM   3940 C  C     . ILE A 1 492 ? 247.848 110.557 -40.955 1.00 32.86  ? 523 ILE A C     1 
ATOM   3941 O  O     . ILE A 1 492 ? 247.880 110.315 -39.758 1.00 32.86  ? 523 ILE A O     1 
ATOM   3942 C  CB    . ILE A 1 492 ? 249.705 110.383 -42.533 1.00 31.43  ? 523 ILE A CB    1 
ATOM   3943 C  CG1   . ILE A 1 492 ? 250.120 109.745 -43.850 1.00 31.43  ? 523 ILE A CG1   1 
ATOM   3944 C  CG2   . ILE A 1 492 ? 250.852 110.355 -41.541 1.00 31.43  ? 523 ILE A CG2   1 
ATOM   3945 C  CD1   . ILE A 1 492 ? 250.741 110.711 -44.814 1.00 31.43  ? 523 ILE A CD1   1 
ATOM   3946 N  N     . GLU A 1 493 ? 247.253 111.626 -41.460 1.00 37.81  ? 524 GLU A N     1 
ATOM   3947 C  CA    . GLU A 1 493 ? 246.588 112.599 -40.617 1.00 37.81  ? 524 GLU A CA    1 
ATOM   3948 C  C     . GLU A 1 493 ? 245.471 112.019 -39.743 1.00 37.81  ? 524 GLU A C     1 
ATOM   3949 O  O     . GLU A 1 493 ? 245.152 112.583 -38.696 1.00 37.81  ? 524 GLU A O     1 
ATOM   3950 C  CB    . GLU A 1 493 ? 246.049 113.728 -41.491 1.00 46.85  ? 524 GLU A CB    1 
ATOM   3951 C  CG    . GLU A 1 493 ? 247.132 114.598 -42.104 1.00 46.85  ? 524 GLU A CG    1 
ATOM   3952 C  CD    . GLU A 1 493 ? 247.788 115.520 -41.085 1.00 46.85  ? 524 GLU A CD    1 
ATOM   3953 O  OE1   . GLU A 1 493 ? 247.062 116.078 -40.224 1.00 46.85  ? 524 GLU A OE1   1 
ATOM   3954 O  OE2   . GLU A 1 493 ? 249.027 115.689 -41.153 1.00 46.85  ? 524 GLU A OE2   1 
ATOM   3955 N  N     . MET A 1 494 ? 244.871 110.908 -40.177 1.00 43.92  ? 525 MET A N     1 
ATOM   3956 C  CA    . MET A 1 494 ? 243.798 110.242 -39.428 1.00 43.92  ? 525 MET A CA    1 
ATOM   3957 C  C     . MET A 1 494 ? 244.344 109.067 -38.641 1.00 43.92  ? 525 MET A C     1 
ATOM   3958 O  O     . MET A 1 494 ? 243.835 108.742 -37.573 1.00 43.92  ? 525 MET A O     1 
ATOM   3959 C  CB    . MET A 1 494 ? 242.697 109.751 -40.369 1.00 36.80  ? 525 MET A CB    1 
ATOM   3960 C  CG    . MET A 1 494 ? 241.596 110.752 -40.573 1.00 36.80  ? 525 MET A CG    1 
ATOM   3961 S  SD    . MET A 1 494 ? 240.357 110.248 -41.771 1.00 36.80  ? 525 MET A SD    1 
ATOM   3962 C  CE    . MET A 1 494 ? 240.353 111.579 -42.939 1.00 36.80  ? 525 MET A CE    1 
ATOM   3963 N  N     . GLY A 1 495 ? 245.397 108.447 -39.172 1.00 34.30  ? 526 GLY A N     1 
ATOM   3964 C  CA    . GLY A 1 495 ? 246.006 107.299 -38.525 1.00 34.30  ? 526 GLY A CA    1 
ATOM   3965 C  C     . GLY A 1 495 ? 246.971 107.556 -37.375 1.00 34.30  ? 526 GLY A C     1 
ATOM   3966 O  O     . GLY A 1 495 ? 246.858 106.929 -36.321 1.00 34.30  ? 526 GLY A O     1 
ATOM   3967 N  N     . ALA A 1 496 ? 247.923 108.466 -37.579 1.00 30.20  ? 527 ALA A N     1 
ATOM   3968 C  CA    . ALA A 1 496 ? 248.924 108.812 -36.571 1.00 30.20  ? 527 ALA A CA    1 
ATOM   3969 C  C     . ALA A 1 496 ? 248.360 109.132 -35.189 1.00 30.20  ? 527 ALA A C     1 
ATOM   3970 O  O     . ALA A 1 496 ? 248.896 108.680 -34.184 1.00 30.20  ? 527 ALA A O     1 
ATOM   3971 C  CB    . ALA A 1 496 ? 249.762 109.968 -37.069 1.00 33.94  ? 527 ALA A CB    1 
ATOM   3972 N  N     . PRO A 1 497 ? 247.291 109.939 -35.117 1.00 26.72  ? 528 PRO A N     1 
ATOM   3973 C  CA    . PRO A 1 497 ? 246.680 110.293 -33.833 1.00 26.72  ? 528 PRO A CA    1 
ATOM   3974 C  C     . PRO A 1 497 ? 246.203 109.055 -33.068 1.00 26.72  ? 528 PRO A C     1 
ATOM   3975 O  O     . PRO A 1 497 ? 246.457 108.899 -31.875 1.00 26.72  ? 528 PRO A O     1 
ATOM   3976 C  CB    . PRO A 1 497 ? 245.528 111.192 -34.244 1.00 12.89  ? 528 PRO A CB    1 
ATOM   3977 C  CG    . PRO A 1 497 ? 246.059 111.862 -35.429 1.00 12.89  ? 528 PRO A CG    1 
ATOM   3978 C  CD    . PRO A 1 497 ? 246.723 110.761 -36.195 1.00 12.89  ? 528 PRO A CD    1 
ATOM   3979 N  N     . PHE A 1 498 ? 245.496 108.177 -33.766 1.00 34.16  ? 529 PHE A N     1 
ATOM   3980 C  CA    . PHE A 1 498 ? 245.007 106.950 -33.168 1.00 34.16  ? 529 PHE A CA    1 
ATOM   3981 C  C     . PHE A 1 498 ? 246.203 106.103 -32.812 1.00 34.16  ? 529 PHE A C     1 
ATOM   3982 O  O     . PHE A 1 498 ? 246.236 105.447 -31.777 1.00 34.16  ? 529 PHE A O     1 
ATOM   3983 C  CB    . PHE A 1 498 ? 244.172 106.184 -34.175 1.00 27.47  ? 529 PHE A CB    1 
ATOM   3984 C  CG    . PHE A 1 498 ? 242.757 106.613 -34.240 1.00 27.47  ? 529 PHE A CG    1 
ATOM   3985 C  CD1   . PHE A 1 498 ? 242.079 106.583 -35.441 1.00 27.47  ? 529 PHE A CD1   1 
ATOM   3986 C  CD2   . PHE A 1 498 ? 242.083 106.997 -33.098 1.00 27.47  ? 529 PHE A CD2   1 
ATOM   3987 C  CE1   . PHE A 1 498 ? 240.757 106.922 -35.504 1.00 27.47  ? 529 PHE A CE1   1 
ATOM   3988 C  CE2   . PHE A 1 498 ? 240.757 107.338 -33.157 1.00 27.47  ? 529 PHE A CE2   1 
ATOM   3989 C  CZ    . PHE A 1 498 ? 240.093 107.299 -34.363 1.00 27.47  ? 529 PHE A CZ    1 
ATOM   3990 N  N     . SER A 1 499 ? 247.191 106.136 -33.694 1.00 31.51  ? 530 SER A N     1 
ATOM   3991 C  CA    . SER A 1 499 ? 248.404 105.347 -33.551 1.00 31.51  ? 530 SER A CA    1 
ATOM   3992 C  C     . SER A 1 499 ? 249.300 105.682 -32.365 1.00 31.51  ? 530 SER A C     1 
ATOM   3993 O  O     . SER A 1 499 ? 249.569 104.828 -31.535 1.00 31.51  ? 530 SER A O     1 
ATOM   3994 C  CB    . SER A 1 499 ? 249.214 105.426 -34.852 1.00 53.08  ? 530 SER A CB    1 
ATOM   3995 O  OG    . SER A 1 499 ? 249.806 104.180 -35.176 1.00 53.08  ? 530 SER A OG    1 
ATOM   3996 N  N     . LEU A 1 500 ? 249.772 106.914 -32.273 1.00 35.73  ? 531 LEU A N     1 
ATOM   3997 C  CA    . LEU A 1 500 ? 250.662 107.256 -31.170 1.00 35.73  ? 531 LEU A CA    1 
ATOM   3998 C  C     . LEU A 1 500 ? 249.901 107.374 -29.858 1.00 35.73  ? 531 LEU A C     1 
ATOM   3999 O  O     . LEU A 1 500 ? 250.436 107.083 -28.798 1.00 35.73  ? 531 LEU A O     1 
ATOM   4000 C  CB    . LEU A 1 500 ? 251.453 108.540 -31.498 1.00 46.95  ? 531 LEU A CB    1 
ATOM   4001 C  CG    . LEU A 1 500 ? 252.355 108.469 -32.757 1.00 46.95  ? 531 LEU A CG    1 
ATOM   4002 C  CD1   . LEU A 1 500 ? 252.853 109.850 -33.130 1.00 46.95  ? 531 LEU A CD1   1 
ATOM   4003 C  CD2   . LEU A 1 500 ? 253.532 107.550 -32.526 1.00 46.95  ? 531 LEU A CD2   1 
ATOM   4004 N  N     . LYS A 1 501 ? 248.641 107.777 -29.923 1.00 34.76  ? 532 LYS A N     1 
ATOM   4005 C  CA    . LYS A 1 501 ? 247.853 107.877 -28.701 1.00 34.76  ? 532 LYS A CA    1 
ATOM   4006 C  C     . LYS A 1 501 ? 247.844 106.514 -28.023 1.00 34.76  ? 532 LYS A C     1 
ATOM   4007 O  O     . LYS A 1 501 ? 247.890 106.413 -26.800 1.00 34.76  ? 532 LYS A O     1 
ATOM   4008 C  CB    . LYS A 1 501 ? 246.416 108.296 -29.017 1.00 27.30  ? 532 LYS A CB    1 
ATOM   4009 C  CG    . LYS A 1 501 ? 245.421 108.025 -27.899 1.00 27.30  ? 532 LYS A CG    1 
ATOM   4010 C  CD    . LYS A 1 501 ? 245.818 108.699 -26.616 1.00 27.30  ? 532 LYS A CD    1 
ATOM   4011 C  CE    . LYS A 1 501 ? 244.783 108.458 -25.548 1.00 27.30  ? 532 LYS A CE    1 
ATOM   4012 N  NZ    . LYS A 1 501 ? 245.124 109.159 -24.287 1.00 27.30  ? 532 LYS A NZ    1 
ATOM   4013 N  N     . GLY A 1 502 ? 247.789 105.473 -28.849 1.00 46.32  ? 533 GLY A N     1 
ATOM   4014 C  CA    . GLY A 1 502 ? 247.757 104.108 -28.368 1.00 46.32  ? 533 GLY A CA    1 
ATOM   4015 C  C     . GLY A 1 502 ? 249.125 103.556 -28.049 1.00 46.32  ? 533 GLY A C     1 
ATOM   4016 O  O     . GLY A 1 502 ? 249.245 102.733 -27.154 1.00 46.32  ? 533 GLY A O     1 
ATOM   4017 N  N     . LEU A 1 503 ? 250.150 103.987 -28.777 1.00 46.12  ? 534 LEU A N     1 
ATOM   4018 C  CA    . LEU A 1 503 ? 251.505 103.513 -28.516 1.00 46.12  ? 534 LEU A CA    1 
ATOM   4019 C  C     . LEU A 1 503 ? 252.027 104.067 -27.191 1.00 46.12  ? 534 LEU A C     1 
ATOM   4020 O  O     . LEU A 1 503 ? 252.477 103.298 -26.351 1.00 46.12  ? 534 LEU A O     1 
ATOM   4021 C  CB    . LEU A 1 503 ? 252.472 103.924 -29.631 1.00 29.90  ? 534 LEU A CB    1 
ATOM   4022 C  CG    . LEU A 1 503 ? 252.834 103.019 -30.809 1.00 29.90  ? 534 LEU A CG    1 
ATOM   4023 C  CD1   . LEU A 1 503 ? 252.595 101.578 -30.443 1.00 29.90  ? 534 LEU A CD1   1 
ATOM   4024 C  CD2   . LEU A 1 503 ? 252.036 103.404 -32.024 1.00 29.90  ? 534 LEU A CD2   1 
ATOM   4025 N  N     . LEU A 1 504 ? 251.967 105.387 -27.000 1.00 35.20  ? 535 LEU A N     1 
ATOM   4026 C  CA    . LEU A 1 504 ? 252.469 106.009 -25.768 1.00 35.20  ? 535 LEU A CA    1 
ATOM   4027 C  C     . LEU A 1 504 ? 251.491 105.988 -24.617 1.00 35.20  ? 535 LEU A C     1 
ATOM   4028 O  O     . LEU A 1 504 ? 251.866 106.289 -23.490 1.00 35.20  ? 535 LEU A O     1 
ATOM   4029 C  CB    . LEU A 1 504 ? 252.898 107.464 -26.001 1.00 30.81  ? 535 LEU A CB    1 
ATOM   4030 C  CG    . LEU A 1 504 ? 254.294 107.785 -26.536 1.00 30.81  ? 535 LEU A CG    1 
ATOM   4031 C  CD1   . LEU A 1 504 ? 255.305 107.007 -25.744 1.00 30.81  ? 535 LEU A CD1   1 
ATOM   4032 C  CD2   . LEU A 1 504 ? 254.406 107.435 -27.997 1.00 30.81  ? 535 LEU A CD2   1 
ATOM   4033 N  N     . GLY A 1 505 ? 250.240 105.641 -24.895 1.00 33.61  ? 536 GLY A N     1 
ATOM   4034 C  CA    . GLY A 1 505 ? 249.235 105.587 -23.842 1.00 33.61  ? 536 GLY A CA    1 
ATOM   4035 C  C     . GLY A 1 505 ? 249.273 104.298 -23.040 1.00 33.61  ? 536 GLY A C     1 
ATOM   4036 O  O     . GLY A 1 505 ? 248.476 104.092 -22.132 1.00 33.61  ? 536 GLY A O     1 
ATOM   4037 N  N     . ASN A 1 506 ? 250.209 103.427 -23.390 1.00 34.92  ? 537 ASN A N     1 
ATOM   4038 C  CA    . ASN A 1 506 ? 250.382 102.153 -22.721 1.00 34.92  ? 537 ASN A CA    1 
ATOM   4039 C  C     . ASN A 1 506 ? 250.942 102.389 -21.333 1.00 34.92  ? 537 ASN A C     1 
ATOM   4040 O  O     . ASN A 1 506 ? 251.933 103.074 -21.172 1.00 34.92  ? 537 ASN A O     1 
ATOM   4041 C  CB    . ASN A 1 506 ? 251.347 101.284 -23.512 1.00 39.52  ? 537 ASN A CB    1 
ATOM   4042 C  CG    . ASN A 1 506 ? 251.392 99.871  -23.010 1.00 39.52  ? 537 ASN A CG    1 
ATOM   4043 O  OD1   . ASN A 1 506 ? 251.795 99.611  -21.880 1.00 39.52  ? 537 ASN A OD1   1 
ATOM   4044 N  ND2   . ASN A 1 506 ? 250.968 98.940  -23.847 1.00 39.52  ? 537 ASN A ND2   1 
ATOM   4045 N  N     . PRO A 1 507 ? 250.326 101.799 -20.309 1.00 22.31  ? 538 PRO A N     1 
ATOM   4046 C  CA    . PRO A 1 507 ? 250.818 101.993 -18.948 1.00 22.31  ? 538 PRO A CA    1 
ATOM   4047 C  C     . PRO A 1 507 ? 252.321 101.890 -18.743 1.00 22.31  ? 538 PRO A C     1 
ATOM   4048 O  O     . PRO A 1 507 ? 252.877 102.625 -17.947 1.00 22.31  ? 538 PRO A O     1 
ATOM   4049 C  CB    . PRO A 1 507 ? 250.042 100.949 -18.151 1.00 27.18  ? 538 PRO A CB    1 
ATOM   4050 C  CG    . PRO A 1 507 ? 249.681 99.930  -19.169 1.00 27.18  ? 538 PRO A CG    1 
ATOM   4051 C  CD    . PRO A 1 507 ? 249.295 100.753 -20.342 1.00 27.18  ? 538 PRO A CD    1 
ATOM   4052 N  N     . ILE A 1 508 ? 252.988 100.993 -19.455 1.00 35.21  ? 539 ILE A N     1 
ATOM   4053 C  CA    . ILE A 1 508 ? 254.427 100.849 -19.276 1.00 35.21  ? 539 ILE A CA    1 
ATOM   4054 C  C     . ILE A 1 508 ? 255.173 102.140 -19.589 1.00 35.21  ? 539 ILE A C     1 
ATOM   4055 O  O     . ILE A 1 508 ? 256.309 102.316 -19.175 1.00 35.21  ? 539 ILE A O     1 
ATOM   4056 C  CB    . ILE A 1 508 ? 255.021 99.736  -20.163 1.00 27.29  ? 539 ILE A CB    1 
ATOM   4057 C  CG1   . ILE A 1 508 ? 255.317 100.271 -21.561 1.00 27.29  ? 539 ILE A CG1   1 
ATOM   4058 C  CG2   . ILE A 1 508 ? 254.048 98.597  -20.265 1.00 27.29  ? 539 ILE A CG2   1 
ATOM   4059 C  CD1   . ILE A 1 508 ? 256.243 99.404  -22.350 1.00 27.29  ? 539 ILE A CD1   1 
ATOM   4060 N  N     . CYS A 1 509 ? 254.527 103.039 -20.321 1.00 32.33  ? 540 CYS A N     1 
ATOM   4061 C  CA    . CYS A 1 509 ? 255.136 104.310 -20.710 1.00 32.33  ? 540 CYS A CA    1 
ATOM   4062 C  C     . CYS A 1 509 ? 254.941 105.463 -19.728 1.00 32.33  ? 540 CYS A C     1 
ATOM   4063 O  O     . CYS A 1 509 ? 255.518 106.526 -19.916 1.00 32.33  ? 540 CYS A O     1 
ATOM   4064 C  CB    . CYS A 1 509 ? 254.603 104.750 -22.072 1.00 34.27  ? 540 CYS A CB    1 
ATOM   4065 S  SG    . CYS A 1 509 ? 255.278 103.875 -23.465 1.00 34.27  ? 540 CYS A SG    1 
ATOM   4066 N  N     . SER A 1 510 ? 254.132 105.272 -18.694 1.00 27.69  ? 541 SER A N     1 
ATOM   4067 C  CA    . SER A 1 510 ? 253.897 106.336 -17.730 1.00 27.69  ? 541 SER A CA    1 
ATOM   4068 C  C     . SER A 1 510 ? 255.100 106.508 -16.826 1.00 27.69  ? 541 SER A C     1 
ATOM   4069 O  O     . SER A 1 510 ? 255.941 105.623 -16.732 1.00 27.69  ? 541 SER A O     1 
ATOM   4070 C  CB    . SER A 1 510 ? 252.670 106.022 -16.888 1.00 35.86  ? 541 SER A CB    1 
ATOM   4071 O  OG    . SER A 1 510 ? 252.902 104.881 -16.094 1.00 35.86  ? 541 SER A OG    1 
ATOM   4072 N  N     . PRO A 1 511 ? 255.200 107.656 -16.144 1.00 30.95  ? 542 PRO A N     1 
ATOM   4073 C  CA    . PRO A 1 511 ? 256.347 107.858 -15.266 1.00 30.95  ? 542 PRO A CA    1 
ATOM   4074 C  C     . PRO A 1 511 ? 256.385 106.770 -14.213 1.00 30.95  ? 542 PRO A C     1 
ATOM   4075 O  O     . PRO A 1 511 ? 257.434 106.204 -13.925 1.00 30.95  ? 542 PRO A O     1 
ATOM   4076 C  CB    . PRO A 1 511 ? 256.078 109.231 -14.665 1.00 30.04  ? 542 PRO A CB    1 
ATOM   4077 C  CG    . PRO A 1 511 ? 255.264 109.906 -15.710 1.00 30.04  ? 542 PRO A CG    1 
ATOM   4078 C  CD    . PRO A 1 511 ? 254.320 108.834 -16.125 1.00 30.04  ? 542 PRO A CD    1 
ATOM   4079 N  N     . GLU A 1 512 ? 255.216 106.479 -13.660 1.00 25.45  ? 543 GLU A N     1 
ATOM   4080 C  CA    . GLU A 1 512 ? 255.050 105.485 -12.614 1.00 25.45  ? 543 GLU A CA    1 
ATOM   4081 C  C     . GLU A 1 512 ? 255.679 104.133 -12.942 1.00 25.45  ? 543 GLU A C     1 
ATOM   4082 O  O     . GLU A 1 512 ? 256.366 103.547 -12.110 1.00 25.45  ? 543 GLU A O     1 
ATOM   4083 C  CB    . GLU A 1 512 ? 253.556 105.315 -12.338 1.00 50.09  ? 543 GLU A CB    1 
ATOM   4084 C  CG    . GLU A 1 512 ? 253.228 104.517 -11.108 1.00 50.09  ? 543 GLU A CG    1 
ATOM   4085 C  CD    . GLU A 1 512 ? 253.737 105.174 -9.836  1.00 50.09  ? 543 GLU A CD    1 
ATOM   4086 O  OE1   . GLU A 1 512 ? 253.051 106.084 -9.325  1.00 50.09  ? 543 GLU A OE1   1 
ATOM   4087 O  OE2   . GLU A 1 512 ? 254.820 104.787 -9.342  1.00 50.09  ? 543 GLU A OE2   1 
ATOM   4088 N  N     . TYR A 1 513 ? 255.446 103.652 -14.161 1.00 32.15  ? 544 TYR A N     1 
ATOM   4089 C  CA    . TYR A 1 513 ? 255.952 102.356 -14.613 1.00 32.15  ? 544 TYR A CA    1 
ATOM   4090 C  C     . TYR A 1 513 ? 257.319 102.361 -15.296 1.00 32.15  ? 544 TYR A C     1 
ATOM   4091 O  O     . TYR A 1 513 ? 258.079 101.419 -15.131 1.00 32.15  ? 544 TYR A O     1 
ATOM   4092 C  CB    . TYR A 1 513 ? 254.961 101.696 -15.588 1.00 31.54  ? 544 TYR A CB    1 
ATOM   4093 C  CG    . TYR A 1 513 ? 253.663 101.126 -15.015 1.00 31.54  ? 544 TYR A CG    1 
ATOM   4094 C  CD1   . TYR A 1 513 ? 252.901 100.223 -15.762 1.00 31.54  ? 544 TYR A CD1   1 
ATOM   4095 C  CD2   . TYR A 1 513 ? 253.180 101.502 -13.762 1.00 31.54  ? 544 TYR A CD2   1 
ATOM   4096 C  CE1   . TYR A 1 513 ? 251.698 99.710  -15.283 1.00 31.54  ? 544 TYR A CE1   1 
ATOM   4097 C  CE2   . TYR A 1 513 ? 251.967 100.990 -13.275 1.00 31.54  ? 544 TYR A CE2   1 
ATOM   4098 C  CZ    . TYR A 1 513 ? 251.237 100.094 -14.047 1.00 31.54  ? 544 TYR A CZ    1 
ATOM   4099 O  OH    . TYR A 1 513 ? 250.049 99.584  -13.591 1.00 31.54  ? 544 TYR A OH    1 
ATOM   4100 N  N     . TRP A 1 514 ? 257.630 103.399 -16.070 1.00 41.60  ? 545 TRP A N     1 
ATOM   4101 C  CA    . TRP A 1 514 ? 258.904 103.473 -16.799 1.00 41.60  ? 545 TRP A CA    1 
ATOM   4102 C  C     . TRP A 1 514 ? 260.141 103.606 -15.905 1.00 41.60  ? 545 TRP A C     1 
ATOM   4103 O  O     . TRP A 1 514 ? 260.835 104.625 -15.918 1.00 41.60  ? 545 TRP A O     1 
ATOM   4104 C  CB    . TRP A 1 514 ? 258.848 104.627 -17.804 1.00 31.61  ? 545 TRP A CB    1 
ATOM   4105 C  CG    . TRP A 1 514 ? 259.850 104.565 -18.932 1.00 31.61  ? 545 TRP A CG    1 
ATOM   4106 C  CD1   . TRP A 1 514 ? 260.844 105.452 -19.175 1.00 31.61  ? 545 TRP A CD1   1 
ATOM   4107 C  CD2   . TRP A 1 514 ? 259.913 103.598 -19.995 1.00 31.61  ? 545 TRP A CD2   1 
ATOM   4108 N  NE1   . TRP A 1 514 ? 261.523 105.111 -20.317 1.00 31.61  ? 545 TRP A NE1   1 
ATOM   4109 C  CE2   . TRP A 1 514 ? 260.972 103.975 -20.839 1.00 31.61  ? 545 TRP A CE2   1 
ATOM   4110 C  CE3   . TRP A 1 514 ? 259.176 102.453 -20.314 1.00 31.61  ? 545 TRP A CE3   1 
ATOM   4111 C  CZ2   . TRP A 1 514 ? 261.315 103.251 -21.982 1.00 31.61  ? 545 TRP A CZ2   1 
ATOM   4112 C  CZ3   . TRP A 1 514 ? 259.521 101.733 -21.455 1.00 31.61  ? 545 TRP A CZ3   1 
ATOM   4113 C  CH2   . TRP A 1 514 ? 260.581 102.137 -22.272 1.00 31.61  ? 545 TRP A CH2   1 
ATOM   4114 N  N     . LYS A 1 515 ? 260.401 102.558 -15.127 1.00 52.69  ? 546 LYS A N     1 
ATOM   4115 C  CA    . LYS A 1 515 ? 261.543 102.494 -14.218 1.00 52.69  ? 546 LYS A CA    1 
ATOM   4116 C  C     . LYS A 1 515 ? 262.288 101.233 -14.600 1.00 52.69  ? 546 LYS A C     1 
ATOM   4117 O  O     . LYS A 1 515 ? 261.745 100.393 -15.306 1.00 52.69  ? 546 LYS A O     1 
ATOM   4118 C  CB    . LYS A 1 515 ? 261.082 102.365 -12.766 1.00 35.14  ? 546 LYS A CB    1 
ATOM   4119 C  CG    . LYS A 1 515 ? 260.075 103.390 -12.359 1.00 35.14  ? 546 LYS A CG    1 
ATOM   4120 C  CD    . LYS A 1 515 ? 259.709 103.260 -10.917 1.00 35.14  ? 546 LYS A CD    1 
ATOM   4121 C  CE    . LYS A 1 515 ? 258.668 104.293 -10.577 1.00 35.14  ? 546 LYS A CE    1 
ATOM   4122 N  NZ    . LYS A 1 515 ? 258.261 104.232 -9.155  1.00 35.14  ? 546 LYS A NZ    1 
ATOM   4123 N  N     . ALA A 1 516 ? 263.518 101.080 -14.126 1.00 48.39  ? 547 ALA A N     1 
ATOM   4124 C  CA    . ALA A 1 516 ? 264.291 99.893  -14.466 1.00 48.39  ? 547 ALA A CA    1 
ATOM   4125 C  C     . ALA A 1 516 ? 263.849 98.703  -13.643 1.00 48.39  ? 547 ALA A C     1 
ATOM   4126 O  O     . ALA A 1 516 ? 264.163 97.565  -13.973 1.00 48.39  ? 547 ALA A O     1 
ATOM   4127 C  CB    . ALA A 1 516 ? 265.770 100.151 -14.255 1.00 43.80  ? 547 ALA A CB    1 
ATOM   4128 N  N     . SER A 1 517 ? 263.118 98.959  -12.571 1.00 40.40  ? 548 SER A N     1 
ATOM   4129 C  CA    . SER A 1 517 ? 262.665 97.872  -11.737 1.00 40.40  ? 548 SER A CA    1 
ATOM   4130 C  C     . SER A 1 517 ? 261.331 97.304  -12.215 1.00 40.40  ? 548 SER A C     1 
ATOM   4131 O  O     . SER A 1 517 ? 260.772 96.414  -11.585 1.00 40.40  ? 548 SER A O     1 
ATOM   4132 C  CB    . SER A 1 517 ? 262.558 98.340  -10.291 1.00 31.96  ? 548 SER A CB    1 
ATOM   4133 O  OG    . SER A 1 517 ? 261.518 99.278  -10.142 1.00 31.96  ? 548 SER A OG    1 
ATOM   4134 N  N     . THR A 1 518 ? 260.807 97.809  -13.326 1.00 39.08  ? 549 THR A N     1 
ATOM   4135 C  CA    . THR A 1 518 ? 259.539 97.293  -13.840 1.00 39.08  ? 549 THR A CA    1 
ATOM   4136 C  C     . THR A 1 518 ? 259.846 96.193  -14.837 1.00 39.08  ? 549 THR A C     1 
ATOM   4137 O  O     . THR A 1 518 ? 258.981 95.417  -15.224 1.00 39.08  ? 549 THR A O     1 
ATOM   4138 C  CB    . THR A 1 518 ? 258.723 98.388  -14.529 1.00 22.74  ? 549 THR A CB    1 
ATOM   4139 O  OG1   . THR A 1 518 ? 258.386 99.385  -13.568 1.00 22.74  ? 549 THR A OG1   1 
ATOM   4140 C  CG2   . THR A 1 518 ? 257.453 97.820  -15.107 1.00 22.74  ? 549 THR A CG2   1 
ATOM   4141 N  N     . PHE A 1 519 ? 261.104 96.148  -15.241 1.00 28.69  ? 550 PHE A N     1 
ATOM   4142 C  CA    . PHE A 1 519 ? 261.588 95.163  -16.177 1.00 28.69  ? 550 PHE A CA    1 
ATOM   4143 C  C     . PHE A 1 519 ? 262.662 94.428  -15.405 1.00 28.69  ? 550 PHE A C     1 
ATOM   4144 O  O     . PHE A 1 519 ? 263.592 93.865  -15.969 1.00 28.69  ? 550 PHE A O     1 
ATOM   4145 C  CB    . PHE A 1 519 ? 262.171 95.855  -17.406 1.00 30.48  ? 550 PHE A CB    1 
ATOM   4146 C  CG    . PHE A 1 519 ? 261.232 96.834  -18.042 1.00 30.48  ? 550 PHE A CG    1 
ATOM   4147 C  CD1   . PHE A 1 519 ? 261.060 98.098  -17.507 1.00 30.48  ? 550 PHE A CD1   1 
ATOM   4148 C  CD2   . PHE A 1 519 ? 260.484 96.479  -19.149 1.00 30.48  ? 550 PHE A CD2   1 
ATOM   4149 C  CE1   . PHE A 1 519 ? 260.159 98.994  -18.061 1.00 30.48  ? 550 PHE A CE1   1 
ATOM   4150 C  CE2   . PHE A 1 519 ? 259.576 97.376  -19.708 1.00 30.48  ? 550 PHE A CE2   1 
ATOM   4151 C  CZ    . PHE A 1 519 ? 259.416 98.635  -19.159 1.00 30.48  ? 550 PHE A CZ    1 
ATOM   4152 N  N     . GLY A 1 520 ? 262.509 94.469  -14.088 1.00 46.31  ? 551 GLY A N     1 
ATOM   4153 C  CA    . GLY A 1 520 ? 263.432 93.816  -13.185 1.00 46.31  ? 551 GLY A CA    1 
ATOM   4154 C  C     . GLY A 1 520 ? 264.868 93.853  -13.642 1.00 46.31  ? 551 GLY A C     1 
ATOM   4155 O  O     . GLY A 1 520 ? 265.311 92.982  -14.388 1.00 46.31  ? 551 GLY A O     1 
ATOM   4156 N  N     . GLY A 1 521 ? 265.601 94.861  -13.192 1.00 42.26  ? 552 GLY A N     1 
ATOM   4157 C  CA    . GLY A 1 521 ? 266.995 94.971  -13.566 1.00 42.26  ? 552 GLY A CA    1 
ATOM   4158 C  C     . GLY A 1 521 ? 267.222 96.008  -14.640 1.00 42.26  ? 552 GLY A C     1 
ATOM   4159 O  O     . GLY A 1 521 ? 266.277 96.544  -15.213 1.00 42.26  ? 552 GLY A O     1 
ATOM   4160 N  N     . GLU A 1 522 ? 268.492 96.293  -14.903 1.00 40.64  ? 553 GLU A N     1 
ATOM   4161 C  CA    . GLU A 1 522 ? 268.875 97.261  -15.914 1.00 40.64  ? 553 GLU A CA    1 
ATOM   4162 C  C     . GLU A 1 522 ? 268.871 96.504  -17.238 1.00 40.64  ? 553 GLU A C     1 
ATOM   4163 O  O     . GLU A 1 522 ? 268.671 97.091  -18.297 1.00 40.64  ? 553 GLU A O     1 
ATOM   4164 C  CB    . GLU A 1 522 ? 270.273 97.811  -15.587 1.00 43.03  ? 553 GLU A CB    1 
ATOM   4165 C  CG    . GLU A 1 522 ? 270.674 99.142  -16.265 1.00 43.03  ? 553 GLU A CG    1 
ATOM   4166 C  CD    . GLU A 1 522 ? 269.892 100.365 -15.770 1.00 43.03  ? 553 GLU A CD    1 
ATOM   4167 O  OE1   . GLU A 1 522 ? 269.424 101.138 -16.638 1.00 43.03  ? 553 GLU A OE1   1 
ATOM   4168 O  OE2   . GLU A 1 522 ? 269.753 100.559 -14.537 1.00 43.03  ? 553 GLU A OE2   1 
ATOM   4169 N  N     . VAL A 1 523 ? 269.071 95.189  -17.158 1.00 33.74  ? 554 VAL A N     1 
ATOM   4170 C  CA    . VAL A 1 523 ? 269.084 94.316  -18.335 1.00 33.74  ? 554 VAL A CA    1 
ATOM   4171 C  C     . VAL A 1 523 ? 267.741 94.357  -19.030 1.00 33.74  ? 554 VAL A C     1 
ATOM   4172 O  O     . VAL A 1 523 ? 267.656 94.285  -20.249 1.00 33.74  ? 554 VAL A O     1 
ATOM   4173 C  CB    . VAL A 1 523 ? 269.380 92.835  -17.967 1.00 36.83  ? 554 VAL A CB    1 
ATOM   4174 C  CG1   . VAL A 1 523 ? 270.863 92.538  -18.129 1.00 36.83  ? 554 VAL A CG1   1 
ATOM   4175 C  CG2   . VAL A 1 523 ? 268.932 92.552  -16.533 1.00 36.83  ? 554 VAL A CG2   1 
ATOM   4176 N  N     . GLY A 1 524 ? 266.686 94.458  -18.243 1.00 29.66  ? 555 GLY A N     1 
ATOM   4177 C  CA    . GLY A 1 524 ? 265.371 94.519  -18.829 1.00 29.66  ? 555 GLY A CA    1 
ATOM   4178 C  C     . GLY A 1 524 ? 265.213 95.808  -19.609 1.00 29.66  ? 555 GLY A C     1 
ATOM   4179 O  O     . GLY A 1 524 ? 264.962 95.784  -20.816 1.00 29.66  ? 555 GLY A O     1 
ATOM   4180 N  N     . PHE A 1 525 ? 265.372 96.934  -18.916 1.00 40.36  ? 556 PHE A N     1 
ATOM   4181 C  CA    . PHE A 1 525 ? 265.238 98.258  -19.523 1.00 40.36  ? 556 PHE A CA    1 
ATOM   4182 C  C     . PHE A 1 525 ? 265.998 98.388  -20.832 1.00 40.36  ? 556 PHE A C     1 
ATOM   4183 O  O     . PHE A 1 525 ? 265.452 98.858  -21.824 1.00 40.36  ? 556 PHE A O     1 
ATOM   4184 C  CB    . PHE A 1 525 ? 265.709 99.356  -18.561 1.00 34.93  ? 556 PHE A CB    1 
ATOM   4185 C  CG    . PHE A 1 525 ? 264.754 100.510 -18.454 1.00 34.93  ? 556 PHE A CG    1 
ATOM   4186 C  CD1   . PHE A 1 525 ? 263.859 100.783 -19.475 1.00 34.93  ? 556 PHE A CD1   1 
ATOM   4187 C  CD2   . PHE A 1 525 ? 264.744 101.320 -17.337 1.00 34.93  ? 556 PHE A CD2   1 
ATOM   4188 C  CE1   . PHE A 1 525 ? 262.969 101.843 -19.380 1.00 34.93  ? 556 PHE A CE1   1 
ATOM   4189 C  CE2   . PHE A 1 525 ? 263.854 102.383 -17.233 1.00 34.93  ? 556 PHE A CE2   1 
ATOM   4190 C  CZ    . PHE A 1 525 ? 262.969 102.642 -18.255 1.00 34.93  ? 556 PHE A CZ    1 
ATOM   4191 N  N     . ASN A 1 526 ? 267.257 97.978  -20.832 1.00 39.49  ? 557 ASN A N     1 
ATOM   4192 C  CA    . ASN A 1 526 ? 268.054 98.057  -22.042 1.00 39.49  ? 557 ASN A CA    1 
ATOM   4193 C  C     . ASN A 1 526 ? 267.485 97.189  -23.167 1.00 39.49  ? 557 ASN A C     1 
ATOM   4194 O  O     . ASN A 1 526 ? 267.609 97.537  -24.340 1.00 39.49  ? 557 ASN A O     1 
ATOM   4195 C  CB    . ASN A 1 526 ? 269.501 97.660  -21.756 1.00 63.40  ? 557 ASN A CB    1 
ATOM   4196 C  CG    . ASN A 1 526 ? 270.219 98.657  -20.843 1.00 63.40  ? 557 ASN A CG    1 
ATOM   4197 O  OD1   . ASN A 1 526 ? 270.348 99.850  -21.163 1.00 63.40  ? 557 ASN A OD1   1 
ATOM   4198 N  ND2   . ASN A 1 526 ? 270.695 98.164  -19.701 1.00 63.40  ? 557 ASN A ND2   1 
ATOM   4199 N  N     . LEU A 1 527 ? 266.863 96.061  -22.821 1.00 50.74  ? 558 LEU A N     1 
ATOM   4200 C  CA    . LEU A 1 527 ? 266.269 95.192  -23.839 1.00 50.74  ? 558 LEU A CA    1 
ATOM   4201 C  C     . LEU A 1 527 ? 265.137 95.972  -24.495 1.00 50.74  ? 558 LEU A C     1 
ATOM   4202 O  O     . LEU A 1 527 ? 264.916 95.879  -25.696 1.00 50.74  ? 558 LEU A O     1 
ATOM   4203 C  CB    . LEU A 1 527 ? 265.742 93.879  -23.226 1.00 37.00  ? 558 LEU A CB    1 
ATOM   4204 C  CG    . LEU A 1 527 ? 266.733 92.773  -22.810 1.00 37.00  ? 558 LEU A CG    1 
ATOM   4205 C  CD1   . LEU A 1 527 ? 265.967 91.568  -22.328 1.00 37.00  ? 558 LEU A CD1   1 
ATOM   4206 C  CD2   . LEU A 1 527 ? 267.601 92.354  -23.971 1.00 37.00  ? 558 LEU A CD2   1 
ATOM   4207 N  N     . VAL A 1 528 ? 264.434 96.766  -23.697 1.00 33.80  ? 559 VAL A N     1 
ATOM   4208 C  CA    . VAL A 1 528 ? 263.341 97.574  -24.214 1.00 33.80  ? 559 VAL A CA    1 
ATOM   4209 C  C     . VAL A 1 528 ? 263.844 98.808  -24.948 1.00 33.80  ? 559 VAL A C     1 
ATOM   4210 O  O     . VAL A 1 528 ? 263.242 99.242  -25.920 1.00 33.80  ? 559 VAL A O     1 
ATOM   4211 C  CB    . VAL A 1 528 ? 262.434 98.048  -23.098 1.00 21.43  ? 559 VAL A CB    1 
ATOM   4212 C  CG1   . VAL A 1 528 ? 261.370 98.953  -23.660 1.00 21.43  ? 559 VAL A CG1   1 
ATOM   4213 C  CG2   . VAL A 1 528 ? 261.823 96.871  -22.410 1.00 21.43  ? 559 VAL A CG2   1 
ATOM   4214 N  N     . LYS A 1 529 ? 264.955 99.363  -24.478 1.00 29.61  ? 560 LYS A N     1 
ATOM   4215 C  CA    . LYS A 1 529 ? 265.534 100.563 -25.064 1.00 29.61  ? 560 LYS A CA    1 
ATOM   4216 C  C     . LYS A 1 529 ? 266.395 100.361 -26.300 1.00 29.61  ? 560 LYS A C     1 
ATOM   4217 O  O     . LYS A 1 529 ? 266.774 101.334 -26.934 1.00 29.61  ? 560 LYS A O     1 
ATOM   4218 C  CB    . LYS A 1 529 ? 266.367 101.295 -24.021 1.00 25.35  ? 560 LYS A CB    1 
ATOM   4219 C  CG    . LYS A 1 529 ? 265.603 101.805 -22.822 1.00 25.35  ? 560 LYS A CG    1 
ATOM   4220 C  CD    . LYS A 1 529 ? 266.582 102.436 -21.845 1.00 25.35  ? 560 LYS A CD    1 
ATOM   4221 C  CE    . LYS A 1 529 ? 265.870 103.083 -20.683 1.00 25.35  ? 560 LYS A CE    1 
ATOM   4222 N  NZ    . LYS A 1 529 ? 266.805 103.756 -19.743 1.00 25.35  ? 560 LYS A NZ    1 
ATOM   4223 N  N     . THR A 1 530 ? 266.715 99.118  -26.647 1.00 33.25  ? 561 THR A N     1 
ATOM   4224 C  CA    . THR A 1 530 ? 267.549 98.860  -27.822 1.00 33.25  ? 561 THR A CA    1 
ATOM   4225 C  C     . THR A 1 530 ? 267.019 97.736  -28.715 1.00 33.25  ? 561 THR A C     1 
ATOM   4226 O  O     . THR A 1 530 ? 267.782 97.078  -29.420 1.00 33.25  ? 561 THR A O     1 
ATOM   4227 C  CB    . THR A 1 530 ? 269.018 98.515  -27.422 1.00 31.47  ? 561 THR A CB    1 
ATOM   4228 O  OG1   . THR A 1 530 ? 269.019 97.454  -26.470 1.00 31.47  ? 561 THR A OG1   1 
ATOM   4229 C  CG2   . THR A 1 530 ? 269.716 99.708  -26.803 1.00 31.47  ? 561 THR A CG2   1 
ATOM   4230 N  N     . ALA A 1 531 ? 265.710 97.526  -28.689 1.00 36.07  ? 562 ALA A N     1 
ATOM   4231 C  CA    . ALA A 1 531 ? 265.088 96.479  -29.496 1.00 36.07  ? 562 ALA A CA    1 
ATOM   4232 C  C     . ALA A 1 531 ? 265.198 96.778  -30.990 1.00 36.07  ? 562 ALA A C     1 
ATOM   4233 O  O     . ALA A 1 531 ? 265.440 97.908  -31.386 1.00 36.07  ? 562 ALA A O     1 
ATOM   4234 C  CB    . ALA A 1 531 ? 263.636 96.326  -29.102 1.00 48.06  ? 562 ALA A CB    1 
ATOM   4235 N  N     . THR A 1 532 ? 264.996 95.766  -31.822 1.00 46.46  ? 563 THR A N     1 
ATOM   4236 C  CA    . THR A 1 532 ? 265.112 95.950  -33.262 1.00 46.46  ? 563 THR A CA    1 
ATOM   4237 C  C     . THR A 1 532 ? 264.493 94.763  -33.965 1.00 46.46  ? 563 THR A C     1 
ATOM   4238 O  O     . THR A 1 532 ? 264.498 93.668  -33.429 1.00 46.46  ? 563 THR A O     1 
ATOM   4239 C  CB    . THR A 1 532 ? 266.583 95.991  -33.680 1.00 31.86  ? 563 THR A CB    1 
ATOM   4240 O  OG1   . THR A 1 532 ? 267.304 96.846  -32.795 1.00 31.86  ? 563 THR A OG1   1 
ATOM   4241 C  CG2   . THR A 1 532 ? 266.725 96.496  -35.097 1.00 31.86  ? 563 THR A CG2   1 
ATOM   4242 N  N     . LEU A 1 533 ? 263.971 94.962  -35.166 1.00 34.71  ? 564 LEU A N     1 
ATOM   4243 C  CA    . LEU A 1 533 ? 263.402 93.844  -35.893 1.00 34.71  ? 564 LEU A CA    1 
ATOM   4244 C  C     . LEU A 1 533 ? 264.538 92.859  -35.996 1.00 34.71  ? 564 LEU A C     1 
ATOM   4245 O  O     . LEU A 1 533 ? 264.414 91.716  -35.572 1.00 34.71  ? 564 LEU A O     1 
ATOM   4246 C  CB    . LEU A 1 533 ? 262.980 94.247  -37.299 1.00 36.88  ? 564 LEU A CB    1 
ATOM   4247 C  CG    . LEU A 1 533 ? 261.645 93.683  -37.778 1.00 36.88  ? 564 LEU A CG    1 
ATOM   4248 C  CD1   . LEU A 1 533 ? 261.580 93.743  -39.290 1.00 36.88  ? 564 LEU A CD1   1 
ATOM   4249 C  CD2   . LEU A 1 533 ? 261.492 92.263  -37.309 1.00 36.88  ? 564 LEU A CD2   1 
ATOM   4250 N  N     . LYS A 1 534 ? 265.661 93.329  -36.536 1.00 49.63  ? 565 LYS A N     1 
ATOM   4251 C  CA    . LYS A 1 534 ? 266.852 92.499  -36.713 1.00 49.63  ? 565 LYS A CA    1 
ATOM   4252 C  C     . LYS A 1 534 ? 267.223 91.674  -35.490 1.00 49.63  ? 565 LYS A C     1 
ATOM   4253 O  O     . LYS A 1 534 ? 267.534 90.487  -35.598 1.00 49.63  ? 565 LYS A O     1 
ATOM   4254 C  CB    . LYS A 1 534 ? 268.058 93.345  -37.112 1.00 52.01  ? 565 LYS A CB    1 
ATOM   4255 C  CG    . LYS A 1 534 ? 269.355 92.548  -37.130 1.00 52.01  ? 565 LYS A CG    1 
ATOM   4256 C  CD    . LYS A 1 534 ? 270.387 93.167  -38.049 1.00 52.01  ? 565 LYS A CD    1 
ATOM   4257 C  CE    . LYS A 1 534 ? 271.609 92.263  -38.215 1.00 52.01  ? 565 LYS A CE    1 
ATOM   4258 N  NZ    . LYS A 1 534 ? 272.490 92.737  -39.339 1.00 52.01  ? 565 LYS A NZ    1 
ATOM   4259 N  N     . LYS A 1 535 ? 267.215 92.295  -34.323 1.00 51.07  ? 566 LYS A N     1 
ATOM   4260 C  CA    . LYS A 1 535 ? 267.543 91.550  -33.127 1.00 51.07  ? 566 LYS A CA    1 
ATOM   4261 C  C     . LYS A 1 535 ? 266.413 90.558  -32.809 1.00 51.07  ? 566 LYS A C     1 
ATOM   4262 O  O     . LYS A 1 535 ? 266.678 89.403  -32.481 1.00 51.07  ? 566 LYS A O     1 
ATOM   4263 C  CB    . LYS A 1 535 ? 267.781 92.511  -31.961 1.00 51.23  ? 566 LYS A CB    1 
ATOM   4264 C  CG    . LYS A 1 535 ? 268.856 93.549  -32.263 1.00 51.23  ? 566 LYS A CG    1 
ATOM   4265 C  CD    . LYS A 1 535 ? 269.116 94.496  -31.098 1.00 51.23  ? 566 LYS A CD    1 
ATOM   4266 C  CE    . LYS A 1 535 ? 269.747 93.787  -29.916 1.00 51.23  ? 566 LYS A CE    1 
ATOM   4267 N  NZ    . LYS A 1 535 ? 270.153 94.764  -28.872 1.00 51.23  ? 566 LYS A NZ    1 
ATOM   4268 N  N     . LEU A 1 536 ? 265.160 90.992  -32.932 1.00 40.64  ? 567 LEU A N     1 
ATOM   4269 C  CA    . LEU A 1 536 ? 264.029 90.118  -32.635 1.00 40.64  ? 567 LEU A CA    1 
ATOM   4270 C  C     . LEU A 1 536 ? 264.149 88.782  -33.351 1.00 40.64  ? 567 LEU A C     1 
ATOM   4271 O  O     . LEU A 1 536 ? 263.693 87.758  -32.859 1.00 40.64  ? 567 LEU A O     1 
ATOM   4272 C  CB    . LEU A 1 536 ? 262.707 90.775  -33.029 1.00 39.27  ? 567 LEU A CB    1 
ATOM   4273 C  CG    . LEU A 1 536 ? 261.509 89.934  -32.585 1.00 39.27  ? 567 LEU A CG    1 
ATOM   4274 C  CD1   . LEU A 1 536 ? 261.613 89.718  -31.087 1.00 39.27  ? 567 LEU A CD1   1 
ATOM   4275 C  CD2   . LEU A 1 536 ? 260.204 90.610  -32.934 1.00 39.27  ? 567 LEU A CD2   1 
ATOM   4276 N  N     . VAL A 1 537 ? 264.760 88.797  -34.523 1.00 37.09  ? 568 VAL A N     1 
ATOM   4277 C  CA    . VAL A 1 537 ? 264.932 87.573  -35.274 1.00 37.09  ? 568 VAL A CA    1 
ATOM   4278 C  C     . VAL A 1 537 ? 266.276 86.926  -34.979 1.00 37.09  ? 568 VAL A C     1 
ATOM   4279 O  O     . VAL A 1 537 ? 266.348 85.913  -34.290 1.00 37.09  ? 568 VAL A O     1 
ATOM   4280 C  CB    . VAL A 1 537 ? 264.828 87.825  -36.789 1.00 39.65  ? 568 VAL A CB    1 
ATOM   4281 C  CG1   . VAL A 1 537 ? 265.240 86.572  -37.553 1.00 39.65  ? 568 VAL A CG1   1 
ATOM   4282 C  CG2   . VAL A 1 537 ? 263.402 88.231  -37.151 1.00 39.65  ? 568 VAL A CG2   1 
ATOM   4283 N  N     . CYS A 1 538 ? 267.340 87.533  -35.487 1.00 48.31  ? 569 CYS A N     1 
ATOM   4284 C  CA    . CYS A 1 538 ? 268.690 87.004  -35.330 1.00 48.31  ? 569 CYS A CA    1 
ATOM   4285 C  C     . CYS A 1 538 ? 269.151 86.587  -33.926 1.00 48.31  ? 569 CYS A C     1 
ATOM   4286 O  O     . CYS A 1 538 ? 270.242 86.043  -33.760 1.00 48.31  ? 569 CYS A O     1 
ATOM   4287 C  CB    . CYS A 1 538 ? 269.683 87.975  -35.982 1.00 52.41  ? 569 CYS A CB    1 
ATOM   4288 S  SG    . CYS A 1 538 ? 269.355 88.071  -37.776 1.00 52.41  ? 569 CYS A SG    1 
ATOM   4289 N  N     . LEU A 1 539 ? 268.326 86.818  -32.918 1.00 46.02  ? 570 LEU A N     1 
ATOM   4290 C  CA    . LEU A 1 539 ? 268.690 86.409  -31.571 1.00 46.02  ? 570 LEU A CA    1 
ATOM   4291 C  C     . LEU A 1 539 ? 267.858 85.183  -31.206 1.00 46.02  ? 570 LEU A C     1 
ATOM   4292 O  O     . LEU A 1 539 ? 267.972 84.623  -30.118 1.00 46.02  ? 570 LEU A O     1 
ATOM   4293 C  CB    . LEU A 1 539 ? 268.435 87.543  -30.580 1.00 39.89  ? 570 LEU A CB    1 
ATOM   4294 C  CG    . LEU A 1 539 ? 269.681 88.248  -30.049 1.00 39.89  ? 570 LEU A CG    1 
ATOM   4295 C  CD1   . LEU A 1 539 ? 270.664 88.491  -31.165 1.00 39.89  ? 570 LEU A CD1   1 
ATOM   4296 C  CD2   . LEU A 1 539 ? 269.269 89.544  -29.397 1.00 39.89  ? 570 LEU A CD2   1 
ATOM   4297 N  N     . ASN A 1 540 ? 267.016 84.765  -32.135 1.00 46.16  ? 571 ASN A N     1 
ATOM   4298 C  CA    . ASN A 1 540 ? 266.193 83.612  -31.893 1.00 46.16  ? 571 ASN A CA    1 
ATOM   4299 C  C     . ASN A 1 540 ? 266.216 82.647  -33.061 1.00 46.16  ? 571 ASN A C     1 
ATOM   4300 O  O     . ASN A 1 540 ? 265.288 81.861  -33.245 1.00 46.16  ? 571 ASN A O     1 
ATOM   4301 C  CB    . ASN A 1 540 ? 264.788 84.070  -31.578 1.00 50.17  ? 571 ASN A CB    1 
ATOM   4302 C  CG    . ASN A 1 540 ? 264.742 84.913  -30.333 1.00 50.17  ? 571 ASN A CG    1 
ATOM   4303 O  OD1   . ASN A 1 540 ? 265.174 84.480  -29.265 1.00 50.17  ? 571 ASN A OD1   1 
ATOM   4304 N  ND2   . ASN A 1 540 ? 264.227 86.124  -30.458 1.00 50.17  ? 571 ASN A ND2   1 
ATOM   4305 N  N     . THR A 1 541 ? 267.293 82.714  -33.842 1.00 56.55  ? 572 THR A N     1 
ATOM   4306 C  CA    . THR A 1 541 ? 267.497 81.824  -34.989 1.00 56.55  ? 572 THR A CA    1 
ATOM   4307 C  C     . THR A 1 541 ? 268.970 81.367  -35.014 1.00 56.55  ? 572 THR A C     1 
ATOM   4308 O  O     . THR A 1 541 ? 269.823 81.957  -34.340 1.00 56.55  ? 572 THR A O     1 
ATOM   4309 C  CB    . THR A 1 541 ? 267.156 82.518  -36.334 1.00 50.01  ? 572 THR A CB    1 
ATOM   4310 O  OG1   . THR A 1 541 ? 268.191 83.445  -36.676 1.00 50.01  ? 572 THR A OG1   1 
ATOM   4311 C  CG2   . THR A 1 541 ? 265.830 83.259  -36.235 1.00 50.01  ? 572 THR A CG2   1 
ATOM   4312 N  N     . LYS A 1 542 ? 269.259 80.308  -35.769 1.00 52.70  ? 573 LYS A N     1 
ATOM   4313 C  CA    . LYS A 1 542 ? 270.623 79.791  -35.869 1.00 52.70  ? 573 LYS A CA    1 
ATOM   4314 C  C     . LYS A 1 542 ? 271.460 80.740  -36.699 1.00 52.70  ? 573 LYS A C     1 
ATOM   4315 O  O     . LYS A 1 542 ? 272.658 80.919  -36.460 1.00 52.70  ? 573 LYS A O     1 
ATOM   4316 C  CB    . LYS A 1 542 ? 270.632 78.404  -36.525 1.00 72.82  ? 573 LYS A CB    1 
ATOM   4317 C  CG    . LYS A 1 542 ? 270.007 77.325  -35.659 1.00 72.82  ? 573 LYS A CG    1 
ATOM   4318 C  CD    . LYS A 1 542 ? 270.765 77.173  -34.337 1.00 72.82  ? 573 LYS A CD    1 
ATOM   4319 C  CE    . LYS A 1 542 ? 269.907 76.492  -33.267 1.00 72.82  ? 573 LYS A CE    1 
ATOM   4320 N  NZ    . LYS A 1 542 ? 269.354 75.184  -33.717 1.00 72.82  ? 573 LYS A NZ    1 
ATOM   4321 N  N     . THR A 1 543 ? 270.817 81.358  -37.676 1.00 56.98  ? 574 THR A N     1 
ATOM   4322 C  CA    . THR A 1 543 ? 271.524 82.276  -38.539 1.00 56.98  ? 574 THR A CA    1 
ATOM   4323 C  C     . THR A 1 543 ? 270.753 83.523  -38.920 1.00 56.98  ? 574 THR A C     1 
ATOM   4324 O  O     . THR A 1 543 ? 269.528 83.521  -39.048 1.00 56.98  ? 574 THR A O     1 
ATOM   4325 C  CB    . THR A 1 543 ? 271.972 81.560  -39.783 1.00 45.97  ? 574 THR A CB    1 
ATOM   4326 O  OG1   . THR A 1 543 ? 271.001 80.553  -40.107 1.00 45.97  ? 574 THR A OG1   1 
ATOM   4327 C  CG2   . THR A 1 543 ? 273.343 80.935  -39.550 1.00 45.97  ? 574 THR A CG2   1 
ATOM   4328 N  N     . CYS A 1 544 ? 271.509 84.591  -39.114 1.00 61.56  ? 575 CYS A N     1 
ATOM   4329 C  CA    . CYS A 1 544 ? 270.958 85.890  -39.444 1.00 61.56  ? 575 CYS A CA    1 
ATOM   4330 C  C     . CYS A 1 544 ? 270.696 86.065  -40.930 1.00 61.56  ? 575 CYS A C     1 
ATOM   4331 O  O     . CYS A 1 544 ? 271.619 86.259  -41.716 1.00 61.56  ? 575 CYS A O     1 
ATOM   4332 C  CB    . CYS A 1 544 ? 271.922 86.971  -38.944 1.00 71.23  ? 575 CYS A CB    1 
ATOM   4333 S  SG    . CYS A 1 544 ? 271.126 88.570  -38.643 1.00 71.23  ? 575 CYS A SG    1 
ATOM   4334 N  N     . PRO A 1 545 ? 269.430 85.994  -41.333 1.00 47.61  ? 576 PRO A N     1 
ATOM   4335 C  CA    . PRO A 1 545 ? 269.027 86.147  -42.729 1.00 47.61  ? 576 PRO A CA    1 
ATOM   4336 C  C     . PRO A 1 545 ? 268.911 87.629  -43.001 1.00 47.61  ? 576 PRO A C     1 
ATOM   4337 O  O     . PRO A 1 545 ? 269.414 88.436  -42.224 1.00 47.61  ? 576 PRO A O     1 
ATOM   4338 C  CB    . PRO A 1 545 ? 267.667 85.489  -42.751 1.00 57.58  ? 576 PRO A CB    1 
ATOM   4339 C  CG    . PRO A 1 545 ? 267.093 85.965  -41.439 1.00 57.58  ? 576 PRO A CG    1 
ATOM   4340 C  CD    . PRO A 1 545 ? 268.260 85.738  -40.479 1.00 57.58  ? 576 PRO A CD    1 
ATOM   4341 N  N     . TYR A 1 546 ? 268.245 87.993  -44.089 1.00 37.17  ? 577 TYR A N     1 
ATOM   4342 C  CA    . TYR A 1 546 ? 268.054 89.401  -44.391 1.00 37.17  ? 577 TYR A CA    1 
ATOM   4343 C  C     . TYR A 1 546 ? 266.697 89.778  -43.845 1.00 37.17  ? 577 TYR A C     1 
ATOM   4344 O  O     . TYR A 1 546 ? 265.712 89.124  -44.151 1.00 37.17  ? 577 TYR A O     1 
ATOM   4345 C  CB    . TYR A 1 546 ? 268.070 89.664  -45.894 1.00 41.69  ? 577 TYR A CB    1 
ATOM   4346 C  CG    . TYR A 1 546 ? 267.565 91.055  -46.241 1.00 41.69  ? 577 TYR A CG    1 
ATOM   4347 C  CD1   . TYR A 1 546 ? 268.377 92.179  -46.096 1.00 41.69  ? 577 TYR A CD1   1 
ATOM   4348 C  CD2   . TYR A 1 546 ? 266.247 91.250  -46.663 1.00 41.69  ? 577 TYR A CD2   1 
ATOM   4349 C  CE1   . TYR A 1 546 ? 267.884 93.460  -46.359 1.00 41.69  ? 577 TYR A CE1   1 
ATOM   4350 C  CE2   . TYR A 1 546 ? 265.753 92.527  -46.922 1.00 41.69  ? 577 TYR A CE2   1 
ATOM   4351 C  CZ    . TYR A 1 546 ? 266.572 93.625  -46.768 1.00 41.69  ? 577 TYR A CZ    1 
ATOM   4352 O  OH    . TYR A 1 546 ? 266.059 94.880  -47.010 1.00 41.69  ? 577 TYR A OH    1 
ATOM   4353 N  N     . VAL A 1 547 ? 266.641 90.833  -43.046 1.00 39.58  ? 578 VAL A N     1 
ATOM   4354 C  CA    . VAL A 1 547 ? 265.372 91.270  -42.475 1.00 39.58  ? 578 VAL A CA    1 
ATOM   4355 C  C     . VAL A 1 547 ? 265.258 92.773  -42.299 1.00 39.58  ? 578 VAL A C     1 
ATOM   4356 O  O     . VAL A 1 547 ? 266.188 93.423  -41.835 1.00 39.58  ? 578 VAL A O     1 
ATOM   4357 C  CB    . VAL A 1 547 ? 265.129 90.607  -41.114 1.00 32.30  ? 578 VAL A CB    1 
ATOM   4358 C  CG1   . VAL A 1 547 ? 266.461 90.295  -40.456 1.00 32.30  ? 578 VAL A CG1   1 
ATOM   4359 C  CG2   . VAL A 1 547 ? 264.283 91.529  -40.225 1.00 32.30  ? 578 VAL A CG2   1 
ATOM   4360 N  N     . SER A 1 548 ? 264.097 93.305  -42.674 1.00 34.25  ? 579 SER A N     1 
ATOM   4361 C  CA    . SER A 1 548 ? 263.789 94.730  -42.568 1.00 34.25  ? 579 SER A CA    1 
ATOM   4362 C  C     . SER A 1 548 ? 262.353 94.942  -43.029 1.00 34.25  ? 579 SER A C     1 
ATOM   4363 O  O     . SER A 1 548 ? 261.722 94.019  -43.536 1.00 34.25  ? 579 SER A O     1 
ATOM   4364 C  CB    . SER A 1 548 ? 264.732 95.573  -43.440 1.00 31.62  ? 579 SER A CB    1 
ATOM   4365 O  OG    . SER A 1 548 ? 264.458 95.408  -44.817 1.00 31.62  ? 579 SER A OG    1 
ATOM   4366 N  N     . PHE A 1 549 ? 261.837 96.153  -42.844 1.00 42.29  ? 580 PHE A N     1 
ATOM   4367 C  CA    . PHE A 1 549 ? 260.480 96.464  -43.267 1.00 42.29  ? 580 PHE A CA    1 
ATOM   4368 C  C     . PHE A 1 549 ? 260.482 97.032  -44.678 1.00 42.29  ? 580 PHE A C     1 
ATOM   4369 O  O     . PHE A 1 549 ? 259.475 97.545  -45.152 1.00 42.29  ? 580 PHE A O     1 
ATOM   4370 C  CB    . PHE A 1 549 ? 259.827 97.453  -42.298 1.00 51.51  ? 580 PHE A CB    1 
ATOM   4371 C  CG    . PHE A 1 549 ? 259.323 96.823  -41.025 1.00 51.51  ? 580 PHE A CG    1 
ATOM   4372 C  CD1   . PHE A 1 549 ? 259.223 97.573  -39.856 1.00 51.51  ? 580 PHE A CD1   1 
ATOM   4373 C  CD2   . PHE A 1 549 ? 258.933 95.490  -40.992 1.00 51.51  ? 580 PHE A CD2   1 
ATOM   4374 C  CE1   . PHE A 1 549 ? 258.743 97.002  -38.675 1.00 51.51  ? 580 PHE A CE1   1 
ATOM   4375 C  CE2   . PHE A 1 549 ? 258.453 94.917  -39.815 1.00 51.51  ? 580 PHE A CE2   1 
ATOM   4376 C  CZ    . PHE A 1 549 ? 258.361 95.676  -38.659 1.00 51.51  ? 580 PHE A CZ    1 
ATOM   4377 N  N     . HIS A 1 550 ? 261.619 96.934  -45.350 1.00 37.10  ? 581 HIS A N     1 
ATOM   4378 C  CA    . HIS A 1 550 ? 261.721 97.429  -46.709 1.00 37.10  ? 581 HIS A CA    1 
ATOM   4379 C  C     . HIS A 1 550 ? 262.669 96.552  -47.490 1.00 37.10  ? 581 HIS A C     1 
ATOM   4380 O  O     . HIS A 1 550 ? 263.725 96.155  -46.997 1.00 37.10  ? 581 HIS A O     1 
ATOM   4381 C  CB    . HIS A 1 550 ? 262.259 98.850  -46.737 1.00 40.15  ? 581 HIS A CB    1 
ATOM   4382 C  CG    . HIS A 1 550 ? 263.686 98.951  -46.318 1.00 40.15  ? 581 HIS A CG    1 
ATOM   4383 N  ND1   . HIS A 1 550 ? 264.072 98.949  -44.996 1.00 40.15  ? 581 HIS A ND1   1 
ATOM   4384 C  CD2   . HIS A 1 550 ? 264.826 98.985  -47.044 1.00 40.15  ? 581 HIS A CD2   1 
ATOM   4385 C  CE1   . HIS A 1 550 ? 265.389 98.977  -44.924 1.00 40.15  ? 581 HIS A CE1   1 
ATOM   4386 N  NE2   . HIS A 1 550 ? 265.871 98.998  -46.154 1.00 40.15  ? 581 HIS A NE2   1 
ATOM   4387 N  N     . VAL A 1 551 ? 262.297 96.267  -48.722 1.00 40.65  ? 582 VAL A N     1 
ATOM   4388 C  CA    . VAL A 1 551 ? 263.110 95.427  -49.572 1.00 40.65  ? 582 VAL A CA    1 
ATOM   4389 C  C     . VAL A 1 551 ? 264.489 96.023  -49.741 1.00 40.65  ? 582 VAL A C     1 
ATOM   4390 O  O     . VAL A 1 551 ? 264.665 97.227  -49.626 1.00 40.65  ? 582 VAL A O     1 
ATOM   4391 C  CB    . VAL A 1 551 ? 262.469 95.292  -50.938 1.00 31.98  ? 582 VAL A CB    1 
ATOM   4392 C  CG1   . VAL A 1 551 ? 262.162 96.654  -51.485 1.00 31.98  ? 582 VAL A CG1   1 
ATOM   4393 C  CG2   . VAL A 1 551 ? 263.392 94.565  -51.868 1.00 31.98  ? 582 VAL A CG2   1 
ATOM   4394 N  N     . PRO A 1 552 ? 265.497 95.176  -49.974 1.00 61.18  ? 583 PRO A N     1 
ATOM   4395 C  CA    . PRO A 1 552 ? 266.853 95.694  -50.163 1.00 61.18  ? 583 PRO A CA    1 
ATOM   4396 C  C     . PRO A 1 552 ? 266.889 96.236  -51.586 1.00 61.18  ? 583 PRO A C     1 
ATOM   4397 O  O     . PRO A 1 552 ? 265.922 96.049  -52.327 1.00 61.18  ? 583 PRO A O     1 
ATOM   4398 C  CB    . PRO A 1 552 ? 267.715 94.447  -50.015 1.00 34.18  ? 583 PRO A CB    1 
ATOM   4399 C  CG    . PRO A 1 552 ? 266.832 93.377  -50.582 1.00 34.18  ? 583 PRO A CG    1 
ATOM   4400 C  CD    . PRO A 1 552 ? 265.501 93.701  -49.953 1.00 34.18  ? 583 PRO A CD    1 
ATOM   4401 N  N     . ASP A 1 553 ? 267.972 96.910  -51.970 1.00 84.68  ? 584 ASP A N     1 
ATOM   4402 C  CA    . ASP A 1 553 ? 268.093 97.431  -53.345 1.00 84.68  ? 584 ASP A CA    1 
ATOM   4403 C  C     . ASP A 1 553 ? 267.101 98.559  -53.719 1.00 84.68  ? 584 ASP A C     1 
ATOM   4404 O  O     . ASP A 1 553 ? 266.221 98.914  -52.889 1.00 84.68  ? 584 ASP A O     1 
ATOM   4405 C  CB    . ASP A 1 553 ? 267.929 96.264  -54.345 1.00 84.28  ? 584 ASP A CB    1 
ATOM   4406 C  CG    . ASP A 1 553 ? 268.672 96.495  -55.657 1.00 84.28  ? 584 ASP A CG    1 
ATOM   4407 O  OD1   . ASP A 1 553 ? 269.915 96.701  -55.603 1.00 84.28  ? 584 ASP A OD1   1 
ATOM   4408 O  OD2   . ASP A 1 553 ? 268.014 96.458  -56.729 1.00 84.28  ? 584 ASP A OD2   1 
ATOM   4409 O  OXT   . ASP A 1 553 ? 267.219 99.070  -54.865 1.00 84.68  ? 584 ASP A OXT   1 
HETATM 4410 C  C1    . NAG B 2 .   ? 224.514 127.145 -37.745 1.00 71.51  ? 1   NAG B C1    1 
HETATM 4411 C  C2    . NAG B 2 .   ? 224.512 128.185 -38.856 1.00 71.51  ? 1   NAG B C2    1 
HETATM 4412 C  C3    . NAG B 2 .   ? 223.215 128.162 -39.631 1.00 71.51  ? 1   NAG B C3    1 
HETATM 4413 C  C4    . NAG B 2 .   ? 223.046 126.769 -40.205 1.00 71.51  ? 1   NAG B C4    1 
HETATM 4414 C  C5    . NAG B 2 .   ? 223.018 125.770 -39.050 1.00 71.51  ? 1   NAG B C5    1 
HETATM 4415 C  C6    . NAG B 2 .   ? 222.921 124.352 -39.572 1.00 71.51  ? 1   NAG B C6    1 
HETATM 4416 C  C7    . NAG B 2 .   ? 225.909 130.099 -38.544 1.00 71.51  ? 1   NAG B C7    1 
HETATM 4417 C  C8    . NAG B 2 .   ? 226.417 131.033 -37.443 1.00 71.51  ? 1   NAG B C8    1 
HETATM 4418 N  N2    . NAG B 2 .   ? 224.738 129.510 -38.326 1.00 71.51  ? 1   NAG B N2    1 
HETATM 4419 O  O3    . NAG B 2 .   ? 223.305 129.109 -40.682 1.00 71.51  ? 1   NAG B O3    1 
HETATM 4420 O  O4    . NAG B 2 .   ? 221.863 126.650 -41.052 1.00 71.51  ? 1   NAG B O4    1 
HETATM 4421 O  O5    . NAG B 2 .   ? 224.255 125.847 -38.301 1.00 71.51  ? 1   NAG B O5    1 
HETATM 4422 O  O6    . NAG B 2 .   ? 223.838 124.144 -40.636 1.00 71.51  ? 1   NAG B O6    1 
HETATM 4423 O  O7    . NAG B 2 .   ? 226.583 129.902 -39.572 1.00 71.51  ? 1   NAG B O7    1 
HETATM 4424 C  C1    . NDG B 2 .   ? 220.641 127.232 -40.671 1.00 71.57  ? 2   NDG B C1    1 
HETATM 4425 C  C2    . NDG B 2 .   ? 219.483 126.602 -41.454 1.00 71.57  ? 2   NDG B C2    1 
HETATM 4426 C  C3    . NDG B 2 .   ? 219.455 126.988 -42.941 1.00 71.57  ? 2   NDG B C3    1 
HETATM 4427 C  C4    . NDG B 2 .   ? 220.055 128.368 -43.305 1.00 71.57  ? 2   NDG B C4    1 
HETATM 4428 C  C5    . NDG B 2 .   ? 221.075 128.916 -42.310 1.00 71.57  ? 2   NDG B C5    1 
HETATM 4429 C  C6    . NDG B 2 .   ? 221.243 130.422 -42.441 1.00 71.57  ? 2   NDG B C6    1 
HETATM 4430 C  C7    . NDG B 2 .   ? 219.322 124.584 -40.164 1.00 71.57  ? 2   NDG B C7    1 
HETATM 4431 C  C8    . NDG B 2 .   ? 219.777 123.142 -39.993 1.00 71.57  ? 2   NDG B C8    1 
HETATM 4432 O  O5    . NDG B 2 .   ? 220.672 128.641 -40.949 1.00 71.57  ? 2   NDG B O5    1 
HETATM 4433 O  O3    . NDG B 2 .   ? 218.096 126.989 -43.355 1.00 71.57  ? 2   NDG B O3    1 
HETATM 4434 O  O4    . NDG B 2 .   ? 220.699 128.274 -44.567 1.00 71.57  ? 2   NDG B O4    1 
HETATM 4435 O  O6    . NDG B 2 .   ? 220.163 131.000 -43.164 1.00 71.57  ? 2   NDG B O6    1 
HETATM 4436 O  O7    . NDG B 2 .   ? 218.793 125.180 -39.216 1.00 71.57  ? 2   NDG B O7    1 
HETATM 4437 N  N2    . NDG B 2 .   ? 219.530 125.158 -41.346 1.00 71.57  ? 2   NDG B N2    1 
HETATM 4438 C  C1    . NAG C 3 .   ? 228.521 95.613  -22.514 1.00 42.03  ? 1   NAG C C1    1 
HETATM 4439 C  C2    . NAG C 3 .   ? 228.268 94.500  -21.495 1.00 42.03  ? 1   NAG C C2    1 
HETATM 4440 C  C3    . NAG C 3 .   ? 227.566 93.306  -22.121 1.00 42.03  ? 1   NAG C C3    1 
HETATM 4441 C  C4    . NAG C 3 .   ? 226.286 93.755  -22.816 1.00 42.03  ? 1   NAG C C4    1 
HETATM 4442 C  C5    . NAG C 3 .   ? 226.610 94.866  -23.824 1.00 42.03  ? 1   NAG C C5    1 
HETATM 4443 C  C6    . NAG C 3 .   ? 225.313 95.438  -24.365 1.00 42.03  ? 1   NAG C C6    1 
HETATM 4444 C  C7    . NAG C 3 .   ? 229.667 94.033  -19.595 1.00 42.03  ? 1   NAG C C7    1 
HETATM 4445 C  C8    . NAG C 3 .   ? 230.577 92.962  -19.014 1.00 42.03  ? 1   NAG C C8    1 
HETATM 4446 N  N2    . NAG C 3 .   ? 229.523 94.065  -20.917 1.00 42.03  ? 1   NAG C N2    1 
HETATM 4447 O  O3    . NAG C 3 .   ? 227.244 92.381  -21.098 1.00 42.03  ? 1   NAG C O3    1 
HETATM 4448 O  O4    . NAG C 3 .   ? 225.652 92.625  -23.485 1.00 42.03  ? 1   NAG C O4    1 
HETATM 4449 O  O5    . NAG C 3 .   ? 227.300 95.969  -23.182 1.00 42.03  ? 1   NAG C O5    1 
HETATM 4450 O  O6    . NAG C 3 .   ? 225.554 96.523  -25.243 1.00 42.03  ? 1   NAG C O6    1 
HETATM 4451 O  O7    . NAG C 3 .   ? 229.094 94.819  -18.844 1.00 42.03  ? 1   NAG C O7    1 
HETATM 4452 C  C1    . NAG C 3 .   ? 224.256 92.625  -23.554 1.00 53.79  ? 2   NAG C C1    1 
HETATM 4453 C  C2    . NAG C 3 .   ? 223.729 91.433  -24.352 1.00 53.79  ? 2   NAG C C2    1 
HETATM 4454 C  C3    . NAG C 3 .   ? 222.216 91.666  -24.516 1.00 53.79  ? 2   NAG C C3    1 
HETATM 4455 C  C4    . NAG C 3 .   ? 221.631 91.478  -23.090 1.00 53.79  ? 2   NAG C C4    1 
HETATM 4456 C  C5    . NAG C 3 .   ? 222.264 92.548  -22.163 1.00 53.79  ? 2   NAG C C5    1 
HETATM 4457 C  C6    . NAG C 3 .   ? 221.881 92.354  -20.707 1.00 53.79  ? 2   NAG C C6    1 
HETATM 4458 C  C7    . NAG C 3 .   ? 224.841 92.120  -26.408 1.00 53.79  ? 2   NAG C C7    1 
HETATM 4459 C  C8    . NAG C 3 .   ? 226.217 91.940  -27.038 1.00 53.79  ? 2   NAG C C8    1 
HETATM 4460 N  N2    . NAG C 3 .   ? 224.422 91.156  -25.601 1.00 53.79  ? 2   NAG C N2    1 
HETATM 4461 O  O3    . NAG C 3 .   ? 221.670 90.747  -25.449 1.00 53.79  ? 2   NAG C O3    1 
HETATM 4462 O  O4    . NAG C 3 .   ? 220.170 91.568  -23.018 1.00 53.79  ? 2   NAG C O4    1 
HETATM 4463 O  O5    . NAG C 3 .   ? 223.726 92.520  -22.218 1.00 53.79  ? 2   NAG C O5    1 
HETATM 4464 O  O6    . NAG C 3 .   ? 222.843 91.551  -20.030 1.00 53.79  ? 2   NAG C O6    1 
HETATM 4465 O  O7    . NAG C 3 .   ? 224.165 93.113  -26.667 1.00 53.79  ? 2   NAG C O7    1 
HETATM 4466 C  C1    . BMA C 3 .   ? 219.315 91.120  -24.036 1.00 67.83  ? 3   BMA C C1    1 
HETATM 4467 C  C2    . BMA C 3 .   ? 219.387 89.562  -24.255 1.00 67.83  ? 3   BMA C C2    1 
HETATM 4468 C  C3    . BMA C 3 .   ? 218.563 88.723  -23.258 1.00 67.83  ? 3   BMA C C3    1 
HETATM 4469 C  C4    . BMA C 3 .   ? 217.506 89.551  -22.543 1.00 67.83  ? 3   BMA C C4    1 
HETATM 4470 C  C5    . BMA C 3 .   ? 216.961 90.590  -23.511 1.00 67.83  ? 3   BMA C C5    1 
HETATM 4471 C  C6    . BMA C 3 .   ? 215.683 91.284  -23.015 1.00 67.83  ? 3   BMA C C6    1 
HETATM 4472 O  O2    . BMA C 3 .   ? 220.741 89.116  -24.215 1.00 67.83  ? 3   BMA C O2    1 
HETATM 4473 O  O3    . BMA C 3 .   ? 219.422 88.125  -22.299 1.00 67.83  ? 3   BMA C O3    1 
HETATM 4474 O  O4    . BMA C 3 .   ? 216.453 88.706  -22.095 1.00 67.83  ? 3   BMA C O4    1 
HETATM 4475 O  O5    . BMA C 3 .   ? 217.967 91.616  -23.757 1.00 67.83  ? 3   BMA C O5    1 
HETATM 4476 O  O6    . BMA C 3 .   ? 215.363 90.867  -21.661 1.00 67.83  ? 3   BMA C O6    1 
HETATM 4477 C  C1    . BMA C 3 .   ? 213.984 90.885  -21.384 1.00 81.51  ? 4   BMA C C1    1 
HETATM 4478 C  C2    . BMA C 3 .   ? 213.651 90.088  -20.088 1.00 81.51  ? 4   BMA C C2    1 
HETATM 4479 C  C3    . BMA C 3 .   ? 212.562 90.855  -19.308 1.00 81.51  ? 4   BMA C C3    1 
HETATM 4480 C  C4    . BMA C 3 .   ? 213.108 92.213  -18.880 1.00 81.51  ? 4   BMA C C4    1 
HETATM 4481 C  C5    . BMA C 3 .   ? 213.632 92.986  -20.110 1.00 81.51  ? 4   BMA C C5    1 
HETATM 4482 C  C6    . BMA C 3 .   ? 215.102 93.384  -20.018 1.00 81.51  ? 4   BMA C C6    1 
HETATM 4483 O  O2    . BMA C 3 .   ? 214.822 89.922  -19.287 1.00 81.51  ? 4   BMA C O2    1 
HETATM 4484 O  O3    . BMA C 3 .   ? 212.018 90.133  -18.159 1.00 81.51  ? 4   BMA C O3    1 
HETATM 4485 O  O4    . BMA C 3 .   ? 212.075 92.953  -18.246 1.00 81.51  ? 4   BMA C O4    1 
HETATM 4486 O  O5    . BMA C 3 .   ? 213.440 92.220  -21.349 1.00 81.51  ? 4   BMA C O5    1 
HETATM 4487 O  O6    . BMA C 3 .   ? 215.652 93.042  -18.754 1.00 81.51  ? 4   BMA C O6    1 
HETATM 4488 C  C1    . MAN C 3 .   ? 212.797 89.181  -17.469 1.00 78.51  ? 5   MAN C C1    1 
HETATM 4489 C  C2    . MAN C 3 .   ? 212.327 87.743  -17.820 1.00 78.51  ? 5   MAN C C2    1 
HETATM 4490 C  C3    . MAN C 3 .   ? 213.273 86.710  -17.185 1.00 78.51  ? 5   MAN C C3    1 
HETATM 4491 C  C4    . MAN C 3 .   ? 214.138 87.362  -16.093 1.00 78.51  ? 5   MAN C C4    1 
HETATM 4492 C  C5    . MAN C 3 .   ? 213.233 88.252  -15.245 1.00 78.51  ? 5   MAN C C5    1 
HETATM 4493 C  C6    . MAN C 3 .   ? 213.940 88.805  -14.027 1.00 78.51  ? 5   MAN C C6    1 
HETATM 4494 O  O2    . MAN C 3 .   ? 212.305 87.553  -19.234 1.00 78.51  ? 5   MAN C O2    1 
HETATM 4495 O  O3    . MAN C 3 .   ? 214.113 86.174  -18.196 1.00 78.51  ? 5   MAN C O3    1 
HETATM 4496 O  O4    . MAN C 3 .   ? 214.774 86.376  -15.285 1.00 78.51  ? 5   MAN C O4    1 
HETATM 4497 O  O5    . MAN C 3 .   ? 212.758 89.377  -16.041 1.00 78.51  ? 5   MAN C O5    1 
HETATM 4498 O  O6    . MAN C 3 .   ? 214.566 87.769  -13.286 1.00 78.51  ? 5   MAN C O6    1 
HETATM 4499 C  C1    . NAG D 4 .   ? 252.145 73.763  -48.173 1.00 49.20  ? 1   NAG D C1    1 
HETATM 4500 C  C2    . NAG D 4 .   ? 251.548 73.109  -49.434 1.00 49.20  ? 1   NAG D C2    1 
HETATM 4501 C  C3    . NAG D 4 .   ? 252.488 72.063  -50.034 1.00 49.20  ? 1   NAG D C3    1 
HETATM 4502 C  C4    . NAG D 4 .   ? 253.879 72.656  -50.208 1.00 49.20  ? 1   NAG D C4    1 
HETATM 4503 C  C5    . NAG D 4 .   ? 254.352 73.140  -48.847 1.00 49.20  ? 1   NAG D C5    1 
HETATM 4504 C  C6    . NAG D 4 .   ? 255.771 73.656  -48.806 1.00 49.20  ? 1   NAG D C6    1 
HETATM 4505 C  C7    . NAG D 4 .   ? 249.170 72.855  -49.675 1.00 49.20  ? 1   NAG D C7    1 
HETATM 4506 C  C8    . NAG D 4 .   ? 247.893 72.682  -48.871 1.00 49.20  ? 1   NAG D C8    1 
HETATM 4507 N  N2    . NAG D 4 .   ? 250.299 72.460  -49.099 1.00 49.20  ? 1   NAG D N2    1 
HETATM 4508 O  O3    . NAG D 4 .   ? 251.986 71.642  -51.291 1.00 49.20  ? 1   NAG D O3    1 
HETATM 4509 O  O4    . NAG D 4 .   ? 254.788 71.682  -50.754 1.00 49.20  ? 1   NAG D O4    1 
HETATM 4510 O  O5    . NAG D 4 .   ? 253.493 74.203  -48.400 1.00 49.20  ? 1   NAG D O5    1 
HETATM 4511 O  O6    . NAG D 4 .   ? 256.367 73.359  -47.547 1.00 49.20  ? 1   NAG D O6    1 
HETATM 4512 O  O7    . NAG D 4 .   ? 249.126 73.352  -50.805 1.00 49.20  ? 1   NAG D O7    1 
HETATM 4513 C  C1    . NAG D 4 .   ? 255.571 72.178  -51.784 1.00 63.39  ? 2   NAG D C1    1 
HETATM 4514 C  C2    . NAG D 4 .   ? 256.848 71.349  -51.919 1.00 63.39  ? 2   NAG D C2    1 
HETATM 4515 C  C3    . NAG D 4 .   ? 257.663 71.826  -53.122 1.00 63.39  ? 2   NAG D C3    1 
HETATM 4516 C  C4    . NAG D 4 .   ? 256.773 71.659  -54.355 1.00 63.39  ? 2   NAG D C4    1 
HETATM 4517 C  C5    . NAG D 4 .   ? 255.555 72.571  -54.149 1.00 63.39  ? 2   NAG D C5    1 
HETATM 4518 C  C6    . NAG D 4 .   ? 254.595 72.614  -55.309 1.00 63.39  ? 2   NAG D C6    1 
HETATM 4519 C  C7    . NAG D 4 .   ? 257.421 70.469  -49.792 1.00 63.39  ? 2   NAG D C7    1 
HETATM 4520 C  C8    . NAG D 4 .   ? 258.663 69.912  -49.099 1.00 63.39  ? 2   NAG D C8    1 
HETATM 4521 N  N2    . NAG D 4 .   ? 257.613 71.422  -50.697 1.00 63.39  ? 2   NAG D N2    1 
HETATM 4522 O  O3    . NAG D 4 .   ? 258.845 71.055  -53.254 1.00 63.39  ? 2   NAG D O3    1 
HETATM 4523 O  O4    . NAG D 4 .   ? 257.481 71.985  -55.548 1.00 63.39  ? 2   NAG D O4    1 
HETATM 4524 O  O5    . NAG D 4 .   ? 254.802 72.126  -52.995 1.00 63.39  ? 2   NAG D O5    1 
HETATM 4525 O  O6    . NAG D 4 .   ? 253.326 73.090  -54.881 1.00 63.39  ? 2   NAG D O6    1 
HETATM 4526 O  O7    . NAG D 4 .   ? 256.291 70.005  -49.537 1.00 63.39  ? 2   NAG D O7    1 
HETATM 4527 C  C1    . BOG E 5 .   ? 254.825 121.992 -51.375 1.00 59.17  ? 750 BOG A C1    1 
HETATM 4528 O  O1    . BOG E 5 .   ? 255.272 123.309 -51.403 1.00 59.17  ? 750 BOG A O1    1 
HETATM 4529 C  C2    . BOG E 5 .   ? 253.326 121.983 -51.064 1.00 59.17  ? 750 BOG A C2    1 
HETATM 4530 O  O2    . BOG E 5 .   ? 253.129 122.449 -49.737 1.00 59.17  ? 750 BOG A O2    1 
HETATM 4531 C  C3    . BOG E 5 .   ? 252.722 120.572 -51.223 1.00 59.17  ? 750 BOG A C3    1 
HETATM 4532 O  O3    . BOG E 5 .   ? 251.303 120.646 -51.134 1.00 59.17  ? 750 BOG A O3    1 
HETATM 4533 C  C4    . BOG E 5 .   ? 253.117 119.979 -52.584 1.00 59.17  ? 750 BOG A C4    1 
HETATM 4534 O  O4    . BOG E 5 .   ? 252.662 118.638 -52.703 1.00 59.17  ? 750 BOG A O4    1 
HETATM 4535 C  C5    . BOG E 5 .   ? 254.629 120.024 -52.735 1.00 59.17  ? 750 BOG A C5    1 
HETATM 4536 O  O5    . BOG E 5 .   ? 255.074 121.401 -52.663 1.00 59.17  ? 750 BOG A O5    1 
HETATM 4537 C  C6    . BOG E 5 .   ? 255.092 119.430 -54.065 1.00 59.17  ? 750 BOG A C6    1 
HETATM 4538 O  O6    . BOG E 5 .   ? 255.979 120.299 -54.766 1.00 59.17  ? 750 BOG A O6    1 
HETATM 4539 C  "C1'" . BOG E 5 .   ? 256.697 123.523 -51.463 1.00 59.17  ? 750 BOG A "C1'" 1 
HETATM 4540 C  "C2'" . BOG E 5 .   ? 257.171 124.183 -50.174 1.00 59.17  ? 750 BOG A "C2'" 1 
HETATM 4541 C  "C3'" . BOG E 5 .   ? 258.615 124.664 -50.296 1.00 59.17  ? 750 BOG A "C3'" 1 
HETATM 4542 C  "C4'" . BOG E 5 .   ? 259.158 125.092 -48.943 1.00 59.17  ? 750 BOG A "C4'" 1 
HETATM 4543 C  "C5'" . BOG E 5 .   ? 260.642 125.381 -49.019 1.00 59.17  ? 750 BOG A "C5'" 1 
HETATM 4544 C  "C6'" . BOG E 5 .   ? 261.265 125.478 -47.631 1.00 59.17  ? 750 BOG A "C6'" 1 
HETATM 4545 C  "C7'" . BOG E 5 .   ? 260.637 126.579 -46.783 1.00 59.17  ? 750 BOG A "C7'" 1 
HETATM 4546 C  "C8'" . BOG E 5 .   ? 261.330 126.660 -45.439 1.00 59.17  ? 750 BOG A "C8'" 1 
HETATM 4547 C  C1    . BOG F 5 .   ? 250.102 118.125 -37.705 1.00 64.90  ? 751 BOG A C1    1 
HETATM 4548 O  O1    . BOG F 5 .   ? 251.261 117.457 -38.091 1.00 64.90  ? 751 BOG A O1    1 
HETATM 4549 C  C2    . BOG F 5 .   ? 249.068 118.040 -38.818 1.00 64.90  ? 751 BOG A C2    1 
HETATM 4550 O  O2    . BOG F 5 .   ? 249.631 118.528 -40.029 1.00 64.90  ? 751 BOG A O2    1 
HETATM 4551 C  C3    . BOG F 5 .   ? 247.829 118.863 -38.409 1.00 64.90  ? 751 BOG A C3    1 
HETATM 4552 O  O3    . BOG F 5 .   ? 246.800 118.729 -39.395 1.00 64.90  ? 751 BOG A O3    1 
HETATM 4553 C  C4    . BOG F 5 .   ? 247.305 118.363 -37.046 1.00 64.90  ? 751 BOG A C4    1 
HETATM 4554 O  O4    . BOG F 5 .   ? 246.301 119.244 -36.548 1.00 64.90  ? 751 BOG A O4    1 
HETATM 4555 C  C5    . BOG F 5 .   ? 248.422 118.220 -35.986 1.00 64.90  ? 751 BOG A C5    1 
HETATM 4556 O  O5    . BOG F 5 .   ? 249.574 117.517 -36.520 1.00 64.90  ? 751 BOG A O5    1 
HETATM 4557 C  C6    . BOG F 5 .   ? 247.919 117.393 -34.808 1.00 64.90  ? 751 BOG A C6    1 
HETATM 4558 O  O6    . BOG F 5 .   ? 247.033 116.354 -35.231 1.00 64.90  ? 751 BOG A O6    1 
HETATM 4559 C  "C1'" . BOG F 5 .   ? 251.897 116.591 -37.123 1.00 64.90  ? 751 BOG A "C1'" 1 
HETATM 4560 C  "C2'" . BOG F 5 .   ? 253.411 116.647 -37.283 1.00 64.90  ? 751 BOG A "C2'" 1 
HETATM 4561 C  "C3'" . BOG F 5 .   ? 254.019 117.854 -36.551 1.00 64.90  ? 751 BOG A "C3'" 1 
HETATM 4562 C  "C4'" . BOG F 5 .   ? 255.207 118.412 -37.340 1.00 64.90  ? 751 BOG A "C4'" 1 
HETATM 4563 C  "C5'" . BOG F 5 .   ? 256.064 119.336 -36.505 1.00 64.90  ? 751 BOG A "C5'" 1 
HETATM 4564 C  "C6'" . BOG F 5 .   ? 257.045 120.087 -37.385 1.00 64.90  ? 751 BOG A "C6'" 1 
HETATM 4565 C  "C7'" . BOG F 5 .   ? 257.781 119.157 -38.328 1.00 64.90  ? 751 BOG A "C7'" 1 
HETATM 4566 C  "C8'" . BOG F 5 .   ? 258.776 119.925 -39.163 1.00 64.90  ? 751 BOG A "C8'" 1 
HETATM 4567 C  C1    . BOG G 5 .   ? 253.009 124.480 -34.587 1.00 78.55  ? 752 BOG A C1    1 
HETATM 4568 O  O1    . BOG G 5 .   ? 253.340 124.973 -33.312 1.00 78.55  ? 752 BOG A O1    1 
HETATM 4569 C  C2    . BOG G 5 .   ? 254.229 123.836 -35.290 1.00 78.55  ? 752 BOG A C2    1 
HETATM 4570 O  O2    . BOG G 5 .   ? 255.282 124.787 -35.424 1.00 78.55  ? 752 BOG A O2    1 
HETATM 4571 C  C3    . BOG G 5 .   ? 253.793 123.324 -36.670 1.00 78.55  ? 752 BOG A C3    1 
HETATM 4572 O  O3    . BOG G 5 .   ? 254.892 122.710 -37.337 1.00 78.55  ? 752 BOG A O3    1 
HETATM 4573 C  C4    . BOG G 5 .   ? 252.638 122.321 -36.487 1.00 78.55  ? 752 BOG A C4    1 
HETATM 4574 O  O4    . BOG G 5 .   ? 252.197 121.837 -37.752 1.00 78.55  ? 752 BOG A O4    1 
HETATM 4575 C  C5    . BOG G 5 .   ? 251.475 123.011 -35.748 1.00 78.55  ? 752 BOG A C5    1 
HETATM 4576 O  O5    . BOG G 5 .   ? 251.936 123.515 -34.461 1.00 78.55  ? 752 BOG A O5    1 
HETATM 4577 C  C6    . BOG G 5 .   ? 250.296 122.073 -35.480 1.00 78.55  ? 752 BOG A C6    1 
HETATM 4578 O  O6    . BOG G 5 .   ? 249.203 122.320 -36.360 1.00 78.55  ? 752 BOG A O6    1 
HETATM 4579 C  "C1'" . BOG G 5 .   ? 254.528 124.473 -32.651 1.00 78.55  ? 752 BOG A "C1'" 1 
HETATM 4580 C  "C2'" . BOG G 5 .   ? 254.586 125.014 -31.240 1.00 78.55  ? 752 BOG A "C2'" 1 
HETATM 4581 C  "C3'" . BOG G 5 .   ? 255.664 124.332 -30.401 1.00 78.55  ? 752 BOG A "C3'" 1 
HETATM 4582 C  "C4'" . BOG G 5 .   ? 255.327 124.474 -28.910 1.00 78.55  ? 752 BOG A "C4'" 1 
HETATM 4583 C  "C5'" . BOG G 5 .   ? 256.333 123.764 -28.018 1.00 78.55  ? 752 BOG A "C5'" 1 
HETATM 4584 C  "C6'" . BOG G 5 .   ? 255.709 123.382 -26.671 1.00 78.55  ? 752 BOG A "C6'" 1 
HETATM 4585 C  "C7'" . BOG G 5 .   ? 255.211 124.594 -25.884 1.00 78.55  ? 752 BOG A "C7'" 1 
HETATM 4586 C  "C8'" . BOG G 5 .   ? 254.697 124.183 -24.507 1.00 78.55  ? 752 BOG A "C8'" 1 
HETATM 4587 C  C1    . BOG H 5 .   ? 264.114 121.374 -47.470 1.00 86.40  ? 753 BOG A C1    1 
HETATM 4588 O  O1    . BOG H 5 .   ? 263.161 121.436 -46.438 1.00 86.40  ? 753 BOG A O1    1 
HETATM 4589 C  C2    . BOG H 5 .   ? 263.656 122.188 -48.691 1.00 86.40  ? 753 BOG A C2    1 
HETATM 4590 O  O2    . BOG H 5 .   ? 262.347 121.820 -49.108 1.00 86.40  ? 753 BOG A O2    1 
HETATM 4591 C  C3    . BOG H 5 .   ? 264.668 121.934 -49.800 1.00 86.40  ? 753 BOG A C3    1 
HETATM 4592 O  O3    . BOG H 5 .   ? 264.226 122.560 -50.995 1.00 86.40  ? 753 BOG A O3    1 
HETATM 4593 C  C4    . BOG H 5 .   ? 266.031 122.505 -49.326 1.00 86.40  ? 753 BOG A C4    1 
HETATM 4594 O  O4    . BOG H 5 .   ? 267.045 122.334 -50.319 1.00 86.40  ? 753 BOG A O4    1 
HETATM 4595 C  C5    . BOG H 5 .   ? 266.459 121.811 -48.006 1.00 86.40  ? 753 BOG A C5    1 
HETATM 4596 O  O5    . BOG H 5 .   ? 265.391 121.890 -47.003 1.00 86.40  ? 753 BOG A O5    1 
HETATM 4597 C  C6    . BOG H 5 .   ? 267.712 122.438 -47.385 1.00 86.40  ? 753 BOG A C6    1 
HETATM 4598 O  O6    . BOG H 5 .   ? 268.896 122.006 -48.044 1.00 86.40  ? 753 BOG A O6    1 
HETATM 4599 C  "C1'" . BOG H 5 .   ? 263.546 122.029 -45.174 1.00 86.40  ? 753 BOG A "C1'" 1 
HETATM 4600 C  "C2'" . BOG H 5 .   ? 262.506 121.697 -44.096 1.00 86.40  ? 753 BOG A "C2'" 1 
HETATM 4601 C  "C3'" . BOG H 5 .   ? 262.663 122.579 -42.832 1.00 86.40  ? 753 BOG A "C3'" 1 
HETATM 4602 C  "C4'" . BOG H 5 .   ? 261.658 122.186 -41.724 1.00 86.40  ? 753 BOG A "C4'" 1 
HETATM 4603 C  "C5'" . BOG H 5 .   ? 261.598 123.212 -40.576 1.00 86.40  ? 753 BOG A "C5'" 1 
HETATM 4604 C  "C6'" . BOG H 5 .   ? 262.856 123.202 -39.698 1.00 86.40  ? 753 BOG A "C6'" 1 
HETATM 4605 C  "C7'" . BOG H 5 .   ? 262.963 121.916 -38.864 1.00 86.40  ? 753 BOG A "C7'" 1 
HETATM 4606 C  "C8'" . BOG H 5 .   ? 264.229 121.902 -37.998 1.00 86.40  ? 753 BOG A "C8'" 1 
HETATM 4607 CO CO    . COH I 6 .   ? 242.258 90.461  -42.905 1.00 74.76  ? 601 COH A CO    1 
HETATM 4608 C  CHA   . COH I 6 .   ? 239.308 90.701  -41.406 1.00 74.76  ? 601 COH A CHA   1 
HETATM 4609 C  CHB   . COH I 6 .   ? 241.165 87.713  -44.657 1.00 74.76  ? 601 COH A CHB   1 
HETATM 4610 C  CHC   . COH I 6 .   ? 245.231 90.197  -44.411 1.00 74.76  ? 601 COH A CHC   1 
HETATM 4611 C  CHD   . COH I 6 .   ? 243.452 93.178  -41.148 1.00 74.76  ? 601 COH A CHD   1 
HETATM 4612 N  NA    . COH I 6 .   ? 240.590 89.386  -43.054 1.00 74.76  ? 601 COH A NA    1 
HETATM 4613 C  C1A   . COH I 6 .   ? 239.405 89.649  -42.321 1.00 74.76  ? 601 COH A C1A   1 
HETATM 4614 C  C2A   . COH I 6 .   ? 238.309 88.644  -42.652 1.00 74.76  ? 601 COH A C2A   1 
HETATM 4615 C  C3A   . COH I 6 .   ? 238.865 87.754  -43.623 1.00 74.76  ? 601 COH A C3A   1 
HETATM 4616 C  C4A   . COH I 6 .   ? 240.295 88.291  -43.816 1.00 74.76  ? 601 COH A C4A   1 
HETATM 4617 C  CMA   . COH I 6 .   ? 238.222 86.547  -44.312 1.00 74.76  ? 601 COH A CMA   1 
HETATM 4618 C  CAA   . COH I 6 .   ? 236.825 88.518  -42.071 1.00 74.76  ? 601 COH A CAA   1 
HETATM 4619 C  CBA   . COH I 6 .   ? 235.729 89.318  -42.827 1.00 74.76  ? 601 COH A CBA   1 
HETATM 4620 C  CGA   . COH I 6 .   ? 235.931 90.846  -42.830 1.00 74.76  ? 601 COH A CGA   1 
HETATM 4621 O  O1A   . COH I 6 .   ? 235.976 91.460  -41.712 1.00 74.76  ? 601 COH A O1A   1 
HETATM 4622 O  O2A   . COH I 6 .   ? 236.003 91.449  -43.932 1.00 74.76  ? 601 COH A O2A   1 
HETATM 4623 N  NB    . COH I 6 .   ? 243.007 89.229  -44.224 1.00 74.76  ? 601 COH A NB    1 
HETATM 4624 C  C1B   . COH I 6 .   ? 242.449 88.115  -44.880 1.00 74.76  ? 601 COH A C1B   1 
HETATM 4625 C  C2B   . COH I 6 .   ? 243.373 87.442  -45.812 1.00 74.76  ? 601 COH A C2B   1 
HETATM 4626 C  C3B   . COH I 6 .   ? 244.534 88.150  -45.740 1.00 74.76  ? 601 COH A C3B   1 
HETATM 4627 C  C4B   . COH I 6 .   ? 244.298 89.240  -44.769 1.00 74.76  ? 601 COH A C4B   1 
HETATM 4628 C  CMB   . COH I 6 .   ? 243.066 86.226  -46.654 1.00 74.76  ? 601 COH A CMB   1 
HETATM 4629 C  CAB   . COH I 6 .   ? 245.787 87.884  -46.484 1.00 74.76  ? 601 COH A CAB   1 
HETATM 4630 C  CBB   . COH I 6 .   ? 246.528 86.716  -46.390 1.00 74.76  ? 601 COH A CBB   1 
HETATM 4631 N  NC    . COH I 6 .   ? 243.967 91.522  -42.775 1.00 74.76  ? 601 COH A NC    1 
HETATM 4632 C  C1C   . COH I 6 .   ? 245.097 91.239  -43.514 1.00 74.76  ? 601 COH A C1C   1 
HETATM 4633 C  C2C   . COH I 6 .   ? 246.160 92.196  -43.219 1.00 74.76  ? 601 COH A C2C   1 
HETATM 4634 C  C3C   . COH I 6 .   ? 245.633 93.055  -42.266 1.00 74.76  ? 601 COH A C3C   1 
HETATM 4635 C  C4C   . COH I 6 .   ? 244.315 92.589  -42.037 1.00 74.76  ? 601 COH A C4C   1 
HETATM 4636 C  CMC   . COH I 6 .   ? 247.570 92.262  -43.908 1.00 74.76  ? 601 COH A CMC   1 
HETATM 4637 C  CAC   . COH I 6 .   ? 246.209 94.192  -41.591 1.00 74.76  ? 601 COH A CAC   1 
HETATM 4638 C  CBC   . COH I 6 .   ? 246.673 95.421  -42.184 1.00 74.76  ? 601 COH A CBC   1 
HETATM 4639 N  ND    . COH I 6 .   ? 241.580 91.694  -41.561 1.00 74.76  ? 601 COH A ND    1 
HETATM 4640 C  C1D   . COH I 6 .   ? 242.123 92.744  -40.912 1.00 74.76  ? 601 COH A C1D   1 
HETATM 4641 C  C2D   . COH I 6 .   ? 241.134 93.404  -39.907 1.00 74.76  ? 601 COH A C2D   1 
HETATM 4642 C  C3D   . COH I 6 .   ? 239.995 92.672  -40.046 1.00 74.76  ? 601 COH A C3D   1 
HETATM 4643 C  C4D   . COH I 6 .   ? 240.247 91.635  -41.025 1.00 74.76  ? 601 COH A C4D   1 
HETATM 4644 C  CMD   . COH I 6 .   ? 241.523 94.606  -39.048 1.00 74.76  ? 601 COH A CMD   1 
HETATM 4645 C  CAD   . COH I 6 .   ? 238.586 92.915  -39.417 1.00 74.76  ? 601 COH A CAD   1 
HETATM 4646 C  CBD   . COH I 6 .   ? 238.248 92.042  -38.208 1.00 74.76  ? 601 COH A CBD   1 
HETATM 4647 C  CGD   . COH I 6 .   ? 239.008 92.372  -36.975 1.00 74.76  ? 601 COH A CGD   1 
HETATM 4648 O  O1D   . COH I 6 .   ? 240.109 91.795  -36.768 1.00 74.76  ? 601 COH A O1D   1 
HETATM 4649 O  O2D   . COH I 6 .   ? 238.503 93.202  -36.212 1.00 74.76  ? 601 COH A O2D   1 
HETATM 4650 C  C1    . ACD J 7 .   ? 253.614 110.993 -37.516 1.00 57.88  ? 700 ACD A C1    1 
HETATM 4651 C  C2    . ACD J 7 .   ? 253.009 109.948 -38.435 1.00 57.88  ? 700 ACD A C2    1 
HETATM 4652 C  C3    . ACD J 7 .   ? 253.983 108.831 -38.757 1.00 57.88  ? 700 ACD A C3    1 
HETATM 4653 C  C4    . ACD J 7 .   ? 253.249 107.634 -39.312 1.00 57.88  ? 700 ACD A C4    1 
HETATM 4654 C  C5    . ACD J 7 .   ? 252.623 107.704 -40.635 1.00 57.88  ? 700 ACD A C5    1 
HETATM 4655 C  C6    . ACD J 7 .   ? 251.457 107.028 -40.900 1.00 57.88  ? 700 ACD A C6    1 
HETATM 4656 C  C7    . ACD J 7 .   ? 250.774 106.208 -39.853 1.00 57.88  ? 700 ACD A C7    1 
HETATM 4657 C  C8    . ACD J 7 .   ? 249.251 106.140 -39.863 1.00 57.88  ? 700 ACD A C8    1 
HETATM 4658 C  C9    . ACD J 7 .   ? 248.564 105.245 -39.047 1.00 57.88  ? 700 ACD A C9    1 
HETATM 4659 C  C10   . ACD J 7 .   ? 249.314 104.299 -38.130 1.00 57.88  ? 700 ACD A C10   1 
HETATM 4660 C  C11   . ACD J 7 .   ? 250.182 103.239 -38.747 1.00 57.88  ? 700 ACD A C11   1 
HETATM 4661 C  C12   . ACD J 7 .   ? 250.510 102.099 -38.046 1.00 57.88  ? 700 ACD A C12   1 
HETATM 4662 C  C13   . ACD J 7 .   ? 249.983 101.869 -36.626 1.00 57.88  ? 700 ACD A C13   1 
HETATM 4663 C  C14   . ACD J 7 .   ? 250.872 101.159 -35.632 1.00 57.88  ? 700 ACD A C14   1 
HETATM 4664 C  C15   . ACD J 7 .   ? 250.565 101.110 -34.288 1.00 57.88  ? 700 ACD A C15   1 
HETATM 4665 C  C16   . ACD J 7 .   ? 249.351 101.770 -33.787 1.00 57.88  ? 700 ACD A C16   1 
HETATM 4666 C  C17   . ACD J 7 .   ? 248.375 101.033 -32.873 1.00 57.88  ? 700 ACD A C17   1 
HETATM 4667 C  C18   . ACD J 7 .   ? 248.899 100.797 -31.457 1.00 57.88  ? 700 ACD A C18   1 
HETATM 4668 C  C19   . ACD J 7 .   ? 247.785 100.235 -30.550 1.00 57.88  ? 700 ACD A C19   1 
HETATM 4669 C  C20   . ACD J 7 .   ? 246.628 101.230 -30.268 1.00 57.88  ? 700 ACD A C20   1 
HETATM 4670 O  O1    . ACD J 7 .   ? 253.552 112.189 -37.879 1.00 57.88  ? 700 ACD A O1    1 
HETATM 4671 O  O2    . ACD J 7 .   ? 254.149 110.616 -36.440 1.00 57.88  ? 700 ACD A O2    1 
HETATM 4672 O  O     . HOH K 8 .   ? 228.905 129.958 -34.795 1.00 18.83  ? 800 HOH A O     1 
HETATM 4673 O  O     . HOH K 8 .   ? 223.200 100.260 -21.691 1.00 21.33  ? 801 HOH A O     1 
HETATM 4674 O  O     . HOH K 8 .   ? 240.459 106.437 -28.606 1.00 19.23  ? 802 HOH A O     1 
HETATM 4675 O  O     . HOH K 8 .   ? 231.196 108.796 -22.420 1.00 23.67  ? 803 HOH A O     1 
HETATM 4676 O  O     . HOH K 8 .   ? 237.093 125.352 -19.495 1.00 28.93  ? 804 HOH A O     1 
HETATM 4677 O  O     . HOH K 8 .   ? 239.465 104.344 -13.982 1.00 21.37  ? 805 HOH A O     1 
HETATM 4678 O  O     . HOH K 8 .   ? 264.773 79.141  -23.647 1.00 34.24  ? 806 HOH A O     1 
HETATM 4679 O  O     . HOH K 8 .   ? 259.631 92.466  -11.864 1.00 24.98  ? 807 HOH A O     1 
HETATM 4680 O  O     . HOH K 8 .   ? 244.284 120.474 -45.850 1.00 29.51  ? 808 HOH A O     1 
HETATM 4681 O  O     . HOH K 8 .   ? 224.126 129.307 -44.766 1.00 26.98  ? 809 HOH A O     1 
HETATM 4682 O  O     . HOH K 8 .   ? 254.846 109.072 -21.437 1.00 27.35  ? 810 HOH A O     1 
HETATM 4683 O  O     . HOH K 8 .   ? 225.340 99.147  -22.826 1.00 26.99  ? 811 HOH A O     1 
HETATM 4684 O  O     . HOH K 8 .   ? 249.191 99.905  -25.428 1.00 29.62  ? 812 HOH A O     1 
HETATM 4685 O  O     . HOH K 8 .   ? 265.037 82.018  -47.944 1.00 34.24  ? 813 HOH A O     1 
HETATM 4686 O  O     . HOH K 8 .   ? 273.496 89.122  -17.521 1.00 29.00  ? 814 HOH A O     1 
HETATM 4687 O  O     . HOH K 8 .   ? 265.230 103.533 -14.616 1.00 37.42  ? 815 HOH A O     1 
HETATM 4688 O  O     . HOH K 8 .   ? 222.479 124.287 -22.387 1.00 27.14  ? 816 HOH A O     1 
HETATM 4689 O  O     . HOH K 8 .   ? 238.159 121.281 -38.257 1.00 31.10  ? 817 HOH A O     1 
HETATM 4690 O  O     . HOH K 8 .   ? 237.984 108.208 -28.333 1.00 22.59  ? 818 HOH A O     1 
HETATM 4691 O  O     . HOH K 8 .   ? 237.980 119.173 -27.475 1.00 32.36  ? 819 HOH A O     1 
HETATM 4692 O  O     . HOH K 8 .   ? 233.868 123.728 -18.131 1.00 33.98  ? 820 HOH A O     1 
HETATM 4693 O  O     . HOH K 8 .   ? 256.422 102.334 -9.016  1.00 33.71  ? 821 HOH A O     1 
HETATM 4694 O  O     . HOH K 8 .   ? 226.646 112.652 -21.970 1.00 37.39  ? 822 HOH A O     1 
HETATM 4695 O  O     . HOH K 8 .   ? 242.940 140.382 -24.449 1.00 33.81  ? 823 HOH A O     1 
HETATM 4696 O  O     . HOH K 8 .   ? 240.414 80.942  -25.397 1.00 31.14  ? 824 HOH A O     1 
HETATM 4697 O  O     . HOH K 8 .   ? 272.726 100.575 -23.762 1.00 33.38  ? 825 HOH A O     1 
HETATM 4698 O  O     . HOH K 8 .   ? 272.070 90.813  -41.405 1.00 28.59  ? 826 HOH A O     1 
HETATM 4699 O  O     . HOH K 8 .   ? 222.058 119.794 -47.179 1.00 37.21  ? 827 HOH A O     1 
HETATM 4700 O  O     . HOH K 8 .   ? 254.621 80.531  -16.240 1.00 36.54  ? 828 HOH A O     1 
HETATM 4701 O  O     . HOH K 8 .   ? 273.172 82.100  -33.670 1.00 36.17  ? 829 HOH A O     1 
HETATM 4702 O  O     . HOH K 8 .   ? 235.605 99.143  -16.669 1.00 33.58  ? 830 HOH A O     1 
HETATM 4703 O  O     . HOH K 8 .   ? 253.466 83.955  -30.712 1.00 28.19  ? 831 HOH A O     1 
HETATM 4704 O  O     . HOH K 8 .   ? 221.552 115.781 -27.251 1.00 35.62  ? 832 HOH A O     1 
HETATM 4705 O  O     . HOH K 8 .   ? 213.912 93.411  -23.660 1.00 32.34  ? 833 HOH A O     1 
HETATM 4706 O  O     . HOH K 8 .   ? 241.857 124.038 -27.007 1.00 28.21  ? 834 HOH A O     1 
HETATM 4707 O  O     . HOH K 8 .   ? 246.566 121.565 -39.485 1.00 40.33  ? 835 HOH A O     1 
HETATM 4708 O  O     . HOH K 8 .   ? 263.841 76.800  -46.436 1.00 40.18  ? 836 HOH A O     1 
HETATM 4709 O  O     . HOH K 8 .   ? 243.710 102.150 -52.350 1.00 41.72  ? 837 HOH A O     1 
HETATM 4710 O  O     . HOH K 8 .   ? 272.852 100.282 -18.347 1.00 41.37  ? 838 HOH A O     1 
HETATM 4711 O  O     . HOH K 8 .   ? 257.284 85.018  -8.566  1.00 39.44  ? 839 HOH A O     1 
HETATM 4712 O  O     . HOH K 8 .   ? 245.952 92.777  -51.825 1.00 27.10  ? 840 HOH A O     1 
HETATM 4713 O  O     . HOH K 8 .   ? 225.496 97.262  -47.415 1.00 39.19  ? 841 HOH A O     1 
HETATM 4714 O  O     . HOH K 8 .   ? 230.768 137.407 -35.080 1.00 34.35  ? 842 HOH A O     1 
HETATM 4715 O  O     . HOH K 8 .   ? 240.896 94.988  -65.734 1.00 47.52  ? 843 HOH A O     1 
HETATM 4716 O  O     . HOH K 8 .   ? 245.315 140.539 -40.044 1.00 34.61  ? 844 HOH A O     1 
HETATM 4717 O  O     . HOH K 8 .   ? 252.789 78.313  -25.076 1.00 36.75  ? 845 HOH A O     1 
HETATM 4718 O  O     . HOH K 8 .   ? 222.786 104.089 -35.284 1.00 39.39  ? 846 HOH A O     1 
HETATM 4719 O  O     . HOH K 8 .   ? 253.801 108.376 -46.532 1.00 26.98  ? 847 HOH A O     1 
HETATM 4720 O  O     . HOH K 8 .   ? 236.151 92.017  -18.818 1.00 43.60  ? 848 HOH A O     1 
HETATM 4721 O  O     . HOH K 8 .   ? 241.749 135.757 -23.161 1.00 44.30  ? 849 HOH A O     1 
HETATM 4722 O  O     . HOH K 8 .   ? 256.063 110.236 -47.902 1.00 30.96  ? 850 HOH A O     1 
HETATM 4723 O  O     . HOH K 8 .   ? 270.789 90.182  -51.763 1.00 30.50  ? 851 HOH A O     1 
HETATM 4724 O  O     . HOH K 8 .   ? 245.801 90.245  -58.063 1.00 43.73  ? 852 HOH A O     1 
HETATM 4725 O  O     . HOH K 8 .   ? 230.912 100.420 -30.397 1.00 38.46  ? 853 HOH A O     1 
HETATM 4726 O  O     . HOH K 8 .   ? 257.637 94.534  -57.757 1.00 39.49  ? 854 HOH A O     1 
HETATM 4727 O  O     . HOH K 8 .   ? 246.509 115.152 -37.393 1.00 36.76  ? 855 HOH A O     1 
HETATM 4728 O  O     . HOH K 8 .   ? 214.226 117.294 -27.228 1.00 36.18  ? 856 HOH A O     1 
HETATM 4729 O  O     . HOH K 8 .   ? 266.739 125.751 -48.136 1.00 33.65  ? 857 HOH A O     1 
HETATM 4730 O  O     . HOH K 8 .   ? 234.329 97.293  -63.468 1.00 39.17  ? 858 HOH A O     1 
HETATM 4731 O  O     . HOH K 8 .   ? 231.061 127.115 -41.184 1.00 31.52  ? 859 HOH A O     1 
HETATM 4732 O  O     . HOH K 8 .   ? 233.431 91.774  -25.215 1.00 39.69  ? 860 HOH A O     1 
HETATM 4733 O  O     . HOH K 8 .   ? 230.574 95.825  -62.983 1.00 45.15  ? 861 HOH A O     1 
HETATM 4734 O  O     . HOH K 8 .   ? 255.487 69.075  -53.325 1.00 35.42  ? 862 HOH A O     1 
HETATM 4735 O  O     . HOH K 8 .   ? 246.283 87.712  -21.009 1.00 36.50  ? 863 HOH A O     1 
HETATM 4736 O  O     . HOH K 8 .   ? 251.480 127.608 -34.236 1.00 35.03  ? 864 HOH A O     1 
HETATM 4737 O  O     . HOH K 8 .   ? 252.557 113.008 -17.347 1.00 36.27  ? 865 HOH A O     1 
HETATM 4738 O  O     . HOH K 8 .   ? 225.256 94.941  -44.163 1.00 41.96  ? 866 HOH A O     1 
HETATM 4739 O  O     . HOH K 8 .   ? 235.194 117.370 -28.613 1.00 36.64  ? 867 HOH A O     1 
HETATM 4740 O  O     . HOH K 8 .   ? 217.306 88.136  -28.548 1.00 34.10  ? 868 HOH A O     1 
HETATM 4741 O  O     . HOH K 8 .   ? 234.620 115.398 -33.639 1.00 50.32  ? 869 HOH A O     1 
HETATM 4742 O  O     . HOH K 8 .   ? 261.198 115.038 -21.376 1.00 41.20  ? 870 HOH A O     1 
HETATM 4743 O  O     . HOH K 8 .   ? 239.200 122.551 -31.421 1.00 38.72  ? 871 HOH A O     1 
HETATM 4744 O  O     . HOH K 8 .   ? 250.960 73.292  -53.070 1.00 38.73  ? 872 HOH A O     1 
HETATM 4745 O  O     . HOH K 8 .   ? 226.808 93.088  -39.026 1.00 46.70  ? 873 HOH A O     1 
HETATM 4746 O  O     . HOH K 8 .   ? 244.144 123.253 -29.636 1.00 39.45  ? 874 HOH A O     1 
HETATM 4747 O  O     . HOH K 8 .   ? 235.159 80.030  -26.014 1.00 45.27  ? 875 HOH A O     1 
HETATM 4748 O  O     . HOH K 8 .   ? 246.236 82.013  -59.894 1.00 44.39  ? 876 HOH A O     1 
HETATM 4749 O  O     . HOH K 8 .   ? 239.269 106.891 -20.194 1.00 44.98  ? 877 HOH A O     1 
HETATM 4750 O  O     . HOH K 8 .   ? 237.255 119.738 -34.971 1.00 54.62  ? 878 HOH A O     1 
HETATM 4751 O  O     . HOH K 8 .   ? 259.307 123.698 -29.952 1.00 35.14  ? 879 HOH A O     1 
HETATM 4752 O  O     . HOH K 8 .   ? 263.818 77.526  -18.564 1.00 40.93  ? 880 HOH A O     1 
HETATM 4753 O  O     . HOH K 8 .   ? 274.830 100.529 -21.463 1.00 55.98  ? 881 HOH A O     1 
HETATM 4754 O  O     . HOH K 8 .   ? 248.111 104.480 -59.652 1.00 40.19  ? 882 HOH A O     1 
HETATM 4755 O  O     . HOH K 8 .   ? 214.368 96.184  -22.628 1.00 44.73  ? 883 HOH A O     1 
HETATM 4756 O  O     . HOH K 8 .   ? 220.652 113.344 -33.009 1.00 45.02  ? 884 HOH A O     1 
HETATM 4757 O  O     . HOH K 8 .   ? 222.885 94.817  -47.034 1.00 44.41  ? 885 HOH A O     1 
HETATM 4758 O  O     . HOH K 8 .   ? 213.355 112.803 -36.411 1.00 42.02  ? 886 HOH A O     1 
HETATM 4759 O  O     . HOH K 8 .   ? 244.051 119.280 -52.127 1.00 45.31  ? 887 HOH A O     1 
HETATM 4760 O  O     . HOH K 8 .   ? 254.472 91.579  -32.473 1.00 54.09  ? 888 HOH A O     1 
HETATM 4761 O  O     . HOH K 8 .   ? 227.950 90.804  -51.779 1.00 39.68  ? 889 HOH A O     1 
HETATM 4762 O  O     . HOH K 8 .   ? 233.897 90.910  -39.066 1.00 57.35  ? 890 HOH A O     1 
HETATM 4763 O  O     . HOH K 8 .   ? 270.445 102.801 -26.867 1.00 37.45  ? 891 HOH A O     1 
HETATM 4764 O  O     . HOH K 8 .   ? 267.593 111.480 -25.131 1.00 45.92  ? 892 HOH A O     1 
HETATM 4765 O  O     . HOH K 8 .   ? 264.540 108.879 -46.689 1.00 46.57  ? 893 HOH A O     1 
HETATM 4766 O  O     . HOH K 8 .   ? 270.573 91.003  -25.131 1.00 51.07  ? 894 HOH A O     1 
HETATM 4767 O  O     . HOH K 8 .   ? 265.367 79.775  -30.211 1.00 48.16  ? 895 HOH A O     1 
HETATM 4768 O  O     . HOH K 8 .   ? 243.237 84.350  -42.048 1.00 44.86  ? 896 HOH A O     1 
HETATM 4769 O  O     . HOH K 8 .   ? 250.143 107.330 -59.319 1.00 48.55  ? 897 HOH A O     1 
HETATM 4770 O  O     . HOH K 8 .   ? 273.634 117.165 -29.477 1.00 57.75  ? 898 HOH A O     1 
HETATM 4771 O  O     . HOH K 8 .   ? 273.371 92.910  -24.477 1.00 51.09  ? 899 HOH A O     1 
HETATM 4772 O  O     . HOH K 8 .   ? 251.742 123.220 -31.620 1.00 58.39  ? 900 HOH A O     1 
HETATM 4773 O  O     . HOH K 8 .   ? 262.180 77.858  -25.713 1.00 54.32  ? 901 HOH A O     1 
HETATM 4774 O  O     . HOH K 8 .   ? 224.809 122.033 -24.368 1.00 53.27  ? 902 HOH A O     1 
HETATM 4775 O  O     . HOH K 8 .   ? 241.714 105.858 -62.501 1.00 48.42  ? 903 HOH A O     1 
HETATM 4776 O  O     . HOH K 8 .   ? 232.592 87.931  -59.973 1.00 64.48  ? 904 HOH A O     1 
HETATM 4777 O  O     . HOH K 8 .   ? 215.614 121.269 -41.169 1.00 53.62  ? 905 HOH A O     1 
HETATM 4778 O  O     . HOH K 8 .   ? 265.062 100.600 -50.158 1.00 50.44  ? 906 HOH A O     1 
HETATM 4779 O  O     . HOH K 8 .   ? 267.609 83.537  -50.988 1.00 55.61  ? 907 HOH A O     1 
HETATM 4780 O  O     . HOH K 8 .   ? 236.592 94.394  -41.195 1.00 58.69  ? 908 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   32  32  PRO PRO A . n 
A 1 2   VAL 2   33  33  VAL VAL A . n 
A 1 3   ASN 3   34  34  ASN ASN A . n 
A 1 4   PRO 4   35  35  PRO PRO A . n 
A 1 5   CYS 5   36  36  CYS CYS A . n 
A 1 6   CYS 6   37  37  CYS CYS A . n 
A 1 7   TYR 7   38  38  TYR TYR A . n 
A 1 8   TYR 8   39  39  TYR TYR A . n 
A 1 9   PRO 9   40  40  PRO PRO A . n 
A 1 10  CYS 10  41  41  CYS CYS A . n 
A 1 11  GLN 11  42  42  GLN GLN A . n 
A 1 12  HIS 12  43  43  HIS HIS A . n 
A 1 13  GLN 13  44  44  GLN GLN A . n 
A 1 14  GLY 14  45  45  GLY GLY A . n 
A 1 15  ILE 15  46  46  ILE ILE A . n 
A 1 16  CYS 16  47  47  CYS CYS A . n 
A 1 17  VAL 17  48  48  VAL VAL A . n 
A 1 18  ARG 18  49  49  ARG ARG A . n 
A 1 19  PHE 19  50  50  PHE PHE A . n 
A 1 20  GLY 20  51  51  GLY GLY A . n 
A 1 21  LEU 21  52  52  LEU LEU A . n 
A 1 22  ASP 22  53  53  ASP ASP A . n 
A 1 23  ARG 23  54  54  ARG ARG A . n 
A 1 24  TYR 24  55  55  TYR TYR A . n 
A 1 25  GLN 25  56  56  GLN GLN A . n 
A 1 26  CYS 26  57  57  CYS CYS A . n 
A 1 27  ASP 27  58  58  ASP ASP A . n 
A 1 28  CYS 28  59  59  CYS CYS A . n 
A 1 29  THR 29  60  60  THR THR A . n 
A 1 30  ARG 30  61  61  ARG ARG A . n 
A 1 31  THR 31  62  62  THR THR A . n 
A 1 32  GLY 32  63  63  GLY GLY A . n 
A 1 33  TYR 33  64  64  TYR TYR A . n 
A 1 34  SER 34  65  65  SER SER A . n 
A 1 35  GLY 35  66  66  GLY GLY A . n 
A 1 36  PRO 36  67  67  PRO PRO A . n 
A 1 37  ASN 37  68  68  ASN ASN A . n 
A 1 38  CYS 38  69  69  CYS CYS A . n 
A 1 39  THR 39  70  70  THR THR A . n 
A 1 40  ILE 40  71  71  ILE ILE A . n 
A 1 41  PRO 41  72  72  PRO PRO A . n 
A 1 42  GLU 42  73  73  GLU GLU A . n 
A 1 43  ILE 43  74  74  ILE ILE A . n 
A 1 44  TRP 44  75  75  TRP TRP A . n 
A 1 45  THR 45  76  76  THR THR A . n 
A 1 46  TRP 46  77  77  TRP TRP A . n 
A 1 47  LEU 47  78  78  LEU LEU A . n 
A 1 48  ARG 48  79  79  ARG ALA A . n 
A 1 49  THR 49  80  80  THR THR A . n 
A 1 50  THR 50  81  81  THR THR A . n 
A 1 51  LEU 51  82  82  LEU LEU A . n 
A 1 52  ARG 52  83  83  ARG ALA A . n 
A 1 53  PRO 53  84  84  PRO PRO A . n 
A 1 54  SER 54  85  85  SER SER A . n 
A 1 55  PRO 55  86  86  PRO PRO A . n 
A 1 56  SER 56  87  87  SER SER A . n 
A 1 57  PHE 57  88  88  PHE PHE A . n 
A 1 58  ILE 58  89  89  ILE ILE A . n 
A 1 59  HIS 59  90  90  HIS HIS A . n 
A 1 60  PHE 60  91  91  PHE PHE A . n 
A 1 61  LEU 61  92  92  LEU LEU A . n 
A 1 62  LEU 62  93  93  LEU LEU A . n 
A 1 63  THR 63  94  94  THR THR A . n 
A 1 64  HIS 64  95  95  HIS HIS A . n 
A 1 65  GLY 65  96  96  GLY GLY A . n 
A 1 66  ARG 66  97  97  ARG ARG A . n 
A 1 67  TRP 67  98  98  TRP TRP A . n 
A 1 68  LEU 68  99  99  LEU LEU A . n 
A 1 69  TRP 69  100 100 TRP TRP A . n 
A 1 70  ASP 70  101 101 ASP ASP A . n 
A 1 71  PHE 71  102 102 PHE PHE A . n 
A 1 72  VAL 72  103 103 VAL VAL A . n 
A 1 73  ASN 73  104 104 ASN ASN A . n 
A 1 74  ALA 74  105 105 ALA ALA A . n 
A 1 75  THR 75  106 106 THR THR A . n 
A 1 76  PHE 76  107 107 PHE PHE A . n 
A 1 77  ILE 77  108 108 ILE ILE A . n 
A 1 78  ARG 78  109 109 ARG ARG A . n 
A 1 79  ASP 79  110 110 ASP ASP A . n 
A 1 80  THR 80  111 111 THR THR A . n 
A 1 81  LEU 81  112 112 LEU LEU A . n 
A 1 82  MET 82  113 113 MET MET A . n 
A 1 83  ARG 83  114 114 ARG ARG A . n 
A 1 84  LEU 84  115 115 LEU LEU A . n 
A 1 85  VAL 85  116 116 VAL VAL A . n 
A 1 86  LEU 86  117 117 LEU LEU A . n 
A 1 87  THR 87  118 118 THR THR A . n 
A 1 88  VAL 88  119 119 VAL VAL A . n 
A 1 89  ARG 89  120 120 ARG ARG A . n 
A 1 90  SER 90  121 121 SER SER A . n 
A 1 91  ASN 91  122 122 ASN ASN A . n 
A 1 92  LEU 92  123 123 LEU LEU A . n 
A 1 93  ILE 93  124 124 ILE ILE A . n 
A 1 94  PRO 94  125 125 PRO PRO A . n 
A 1 95  SER 95  126 126 SER SER A . n 
A 1 96  PRO 96  127 127 PRO PRO A . n 
A 1 97  PRO 97  128 128 PRO PRO A . n 
A 1 98  THR 98  129 129 THR THR A . n 
A 1 99  TYR 99  130 130 TYR TYR A . n 
A 1 100 ASN 100 131 131 ASN ASN A . n 
A 1 101 ILE 101 132 132 ILE ILE A . n 
A 1 102 ALA 102 133 133 ALA ALA A . n 
A 1 103 HIS 103 134 134 HIS HIS A . n 
A 1 104 ASP 104 135 135 ASP ASP A . n 
A 1 105 TYR 105 136 136 TYR TYR A . n 
A 1 106 ILE 106 137 137 ILE ILE A . n 
A 1 107 SER 107 138 138 SER SER A . n 
A 1 108 TRP 108 139 139 TRP TRP A . n 
A 1 109 GLU 109 140 140 GLU GLU A . n 
A 1 110 SER 110 141 141 SER SER A . n 
A 1 111 PHE 111 142 142 PHE PHE A . n 
A 1 112 SER 112 143 143 SER SER A . n 
A 1 113 ASN 113 144 144 ASN ASN A . n 
A 1 114 VAL 114 145 145 VAL VAL A . n 
A 1 115 SER 115 146 146 SER SER A . n 
A 1 116 TYR 116 147 147 TYR TYR A . n 
A 1 117 TYR 117 148 148 TYR TYR A . n 
A 1 118 THR 118 149 149 THR THR A . n 
A 1 119 ARG 119 150 150 ARG ARG A . n 
A 1 120 ILE 120 151 151 ILE ILE A . n 
A 1 121 LEU 121 152 152 LEU LEU A . n 
A 1 122 PRO 122 153 153 PRO PRO A . n 
A 1 123 SER 123 154 154 SER SER A . n 
A 1 124 VAL 124 155 155 VAL VAL A . n 
A 1 125 PRO 125 156 156 PRO PRO A . n 
A 1 126 ARG 126 157 157 ARG ARG A . n 
A 1 127 ASP 127 158 158 ASP ASP A . n 
A 1 128 CYS 128 159 159 CYS CYS A . n 
A 1 129 PRO 129 160 160 PRO PRO A . n 
A 1 130 THR 130 161 161 THR THR A . n 
A 1 131 PRO 131 162 162 PRO PRO A . n 
A 1 132 MET 132 163 163 MET MET A . n 
A 1 133 GLY 133 164 164 GLY GLY A . n 
A 1 134 THR 134 165 165 THR THR A . n 
A 1 135 LYS 135 166 166 LYS LYS A . n 
A 1 136 GLY 136 167 167 GLY GLY A . n 
A 1 137 LYS 137 168 168 LYS LYS A . n 
A 1 138 LYS 138 169 169 LYS ALA A . n 
A 1 139 GLN 139 170 170 GLN ALA A . n 
A 1 140 LEU 140 171 171 LEU LEU A . n 
A 1 141 PRO 141 172 172 PRO PRO A . n 
A 1 142 ASP 142 173 173 ASP ALA A . n 
A 1 143 ALA 143 174 174 ALA ALA A . n 
A 1 144 GLU 144 175 175 GLU ALA A . n 
A 1 145 PHE 145 176 176 PHE PHE A . n 
A 1 146 LEU 146 177 177 LEU LEU A . n 
A 1 147 SER 147 178 178 SER SER A . n 
A 1 148 ARG 148 179 179 ARG ARG A . n 
A 1 149 ARG 149 180 180 ARG ARG A . n 
A 1 150 PHE 150 181 181 PHE PHE A . n 
A 1 151 LEU 151 182 182 LEU LEU A . n 
A 1 152 LEU 152 183 183 LEU LEU A . n 
A 1 153 ARG 153 184 184 ARG ARG A . n 
A 1 154 ARG 154 185 185 ARG ARG A . n 
A 1 155 LYS 155 186 186 LYS ALA A . n 
A 1 156 PHE 156 187 187 PHE PHE A . n 
A 1 157 ILE 157 188 188 ILE ILE A . n 
A 1 158 PRO 158 189 189 PRO PRO A . n 
A 1 159 ASP 159 190 190 ASP ASP A . n 
A 1 160 PRO 160 191 191 PRO PRO A . n 
A 1 161 GLN 161 192 192 GLN GLN A . n 
A 1 162 GLY 162 193 193 GLY GLY A . n 
A 1 163 THR 163 194 194 THR THR A . n 
A 1 164 ASN 164 195 195 ASN ASN A . n 
A 1 165 LEU 165 196 196 LEU LEU A . n 
A 1 166 MET 166 197 197 MET MET A . n 
A 1 167 PHE 167 198 198 PHE PHE A . n 
A 1 168 ALA 168 199 199 ALA ALA A . n 
A 1 169 PHE 169 200 200 PHE PHE A . n 
A 1 170 PHE 170 201 201 PHE PHE A . n 
A 1 171 ALA 171 202 202 ALA ALA A . n 
A 1 172 GLN 172 203 203 GLN GLN A . n 
A 1 173 HIS 173 204 204 HIS HIS A . n 
A 1 174 PHE 174 205 205 PHE PHE A . n 
A 1 175 THR 175 206 206 THR THR A . n 
A 1 176 HIS 176 207 207 HIS HIS A . n 
A 1 177 GLN 177 208 208 GLN GLN A . n 
A 1 178 PHE 178 209 209 PHE PHE A . n 
A 1 179 PHE 179 210 210 PHE PHE A . n 
A 1 180 LYS 180 211 211 LYS LYS A . n 
A 1 181 THR 181 212 212 THR THR A . n 
A 1 182 SER 182 213 213 SER SER A . n 
A 1 183 GLY 183 214 214 GLY GLY A . n 
A 1 184 LYS 184 215 215 LYS ALA A . n 
A 1 185 MET 185 216 216 MET MET A . n 
A 1 186 GLY 186 217 217 GLY GLY A . n 
A 1 187 PRO 187 218 218 PRO PRO A . n 
A 1 188 GLY 188 219 219 GLY GLY A . n 
A 1 189 PHE 189 220 220 PHE PHE A . n 
A 1 190 THR 190 221 221 THR THR A . n 
A 1 191 LYS 191 222 222 LYS LYS A . n 
A 1 192 ALA 192 223 223 ALA ALA A . n 
A 1 193 LEU 193 224 224 LEU LEU A . n 
A 1 194 GLY 194 225 225 GLY GLY A . n 
A 1 195 HIS 195 226 226 HIS HIS A . n 
A 1 196 GLY 196 227 227 GLY GLY A . n 
A 1 197 VAL 197 228 228 VAL VAL A . n 
A 1 198 ASP 198 229 229 ASP ASP A . n 
A 1 199 LEU 199 230 230 LEU LEU A . n 
A 1 200 GLY 200 231 231 GLY GLY A . n 
A 1 201 HIS 201 232 232 HIS HIS A . n 
A 1 202 ILE 202 233 233 ILE ILE A . n 
A 1 203 TYR 203 234 234 TYR TYR A . n 
A 1 204 GLY 204 235 235 GLY GLY A . n 
A 1 205 ASP 205 236 236 ASP ASP A . n 
A 1 206 ASN 206 237 237 ASN ASN A . n 
A 1 207 LEU 207 238 238 LEU LEU A . n 
A 1 208 GLU 208 239 239 GLU GLU A . n 
A 1 209 ARG 209 240 240 ARG ARG A . n 
A 1 210 GLN 210 241 241 GLN GLN A . n 
A 1 211 TYR 211 242 242 TYR TYR A . n 
A 1 212 GLN 212 243 243 GLN GLN A . n 
A 1 213 LEU 213 244 244 LEU LEU A . n 
A 1 214 ARG 214 245 245 ARG ARG A . n 
A 1 215 LEU 215 246 246 LEU LEU A . n 
A 1 216 PHE 216 247 247 PHE PHE A . n 
A 1 217 LYS 217 248 248 LYS ALA A . n 
A 1 218 ASP 218 249 249 ASP ASP A . n 
A 1 219 GLY 219 250 250 GLY GLY A . n 
A 1 220 LYS 220 251 251 LYS LYS A . n 
A 1 221 LEU 221 252 252 LEU LEU A . n 
A 1 222 LYS 222 253 253 LYS LYS A . n 
A 1 223 TYR 223 254 254 TYR TYR A . n 
A 1 224 GLN 224 255 255 GLN GLN A . n 
A 1 225 MET 225 256 256 MET MET A . n 
A 1 226 LEU 226 257 257 LEU LEU A . n 
A 1 227 ASN 227 258 258 ASN ASN A . n 
A 1 228 GLY 228 259 259 GLY GLY A . n 
A 1 229 GLU 229 260 260 GLU GLU A . n 
A 1 230 VAL 230 261 261 VAL VAL A . n 
A 1 231 TYR 231 262 262 TYR TYR A . n 
A 1 232 PRO 232 263 263 PRO PRO A . n 
A 1 233 PRO 233 264 264 PRO PRO A . n 
A 1 234 SER 234 265 265 SER SER A . n 
A 1 235 VAL 235 266 266 VAL VAL A . n 
A 1 236 GLU 236 267 267 GLU ALA A . n 
A 1 237 GLU 237 268 268 GLU GLU A . n 
A 1 238 ALA 238 269 269 ALA ALA A . n 
A 1 239 PRO 239 270 270 PRO PRO A . n 
A 1 240 VAL 240 271 271 VAL VAL A . n 
A 1 241 LEU 241 272 272 LEU LEU A . n 
A 1 242 MET 242 273 273 MET MET A . n 
A 1 243 HIS 243 274 274 HIS HIS A . n 
A 1 244 TYR 244 275 275 TYR TYR A . n 
A 1 245 PRO 245 276 276 PRO PRO A . n 
A 1 246 ARG 246 277 277 ARG ARG A . n 
A 1 247 GLY 247 278 278 GLY GLY A . n 
A 1 248 ILE 248 279 279 ILE ILE A . n 
A 1 249 PRO 249 280 280 PRO PRO A . n 
A 1 250 PRO 250 281 281 PRO PRO A . n 
A 1 251 GLN 251 282 282 GLN GLN A . n 
A 1 252 SER 252 283 283 SER SER A . n 
A 1 253 GLN 253 284 284 GLN GLN A . n 
A 1 254 MET 254 285 285 MET MET A . n 
A 1 255 ALA 255 286 286 ALA ALA A . n 
A 1 256 VAL 256 287 287 VAL VAL A . n 
A 1 257 GLY 257 288 288 GLY GLY A . n 
A 1 258 GLN 258 289 289 GLN GLN A . n 
A 1 259 GLU 259 290 290 GLU ALA A . n 
A 1 260 VAL 260 291 291 VAL VAL A . n 
A 1 261 PHE 261 292 292 PHE PHE A . n 
A 1 262 GLY 262 293 293 GLY GLY A . n 
A 1 263 LEU 263 294 294 LEU LEU A . n 
A 1 264 LEU 264 295 295 LEU LEU A . n 
A 1 265 PRO 265 296 296 PRO PRO A . n 
A 1 266 GLY 266 297 297 GLY GLY A . n 
A 1 267 LEU 267 298 298 LEU LEU A . n 
A 1 268 MET 268 299 299 MET MET A . n 
A 1 269 LEU 269 300 300 LEU LEU A . n 
A 1 270 TYR 270 301 301 TYR TYR A . n 
A 1 271 ALA 271 302 302 ALA ALA A . n 
A 1 272 THR 272 303 303 THR THR A . n 
A 1 273 ILE 273 304 304 ILE ILE A . n 
A 1 274 TRP 274 305 305 TRP TRP A . n 
A 1 275 LEU 275 306 306 LEU LEU A . n 
A 1 276 ARG 276 307 307 ARG ARG A . n 
A 1 277 GLU 277 308 308 GLU GLU A . n 
A 1 278 HIS 278 309 309 HIS HIS A . n 
A 1 279 ASN 279 310 310 ASN ASN A . n 
A 1 280 ARG 280 311 311 ARG ARG A . n 
A 1 281 VAL 281 312 312 VAL VAL A . n 
A 1 282 CYS 282 313 313 CYS CYS A . n 
A 1 283 ASP 283 314 314 ASP ASP A . n 
A 1 284 LEU 284 315 315 LEU LEU A . n 
A 1 285 LEU 285 316 316 LEU LEU A . n 
A 1 286 LYS 286 317 317 LYS ALA A . n 
A 1 287 ALA 287 318 318 ALA ALA A . n 
A 1 288 GLU 288 319 319 GLU GLU A . n 
A 1 289 HIS 289 320 320 HIS HIS A . n 
A 1 290 PRO 290 321 321 PRO PRO A . n 
A 1 291 THR 291 322 322 THR THR A . n 
A 1 292 TRP 292 323 323 TRP TRP A . n 
A 1 293 GLY 293 324 324 GLY GLY A . n 
A 1 294 ASP 294 325 325 ASP ASP A . n 
A 1 295 GLU 295 326 326 GLU GLU A . n 
A 1 296 GLN 296 327 327 GLN GLN A . n 
A 1 297 LEU 297 328 328 LEU LEU A . n 
A 1 298 PHE 298 329 329 PHE PHE A . n 
A 1 299 GLN 299 330 330 GLN GLN A . n 
A 1 300 THR 300 331 331 THR THR A . n 
A 1 301 ALA 301 332 332 ALA ALA A . n 
A 1 302 ARG 302 333 333 ARG ARG A . n 
A 1 303 LEU 303 334 334 LEU LEU A . n 
A 1 304 ILE 304 335 335 ILE ILE A . n 
A 1 305 LEU 305 336 336 LEU LEU A . n 
A 1 306 ILE 306 337 337 ILE ILE A . n 
A 1 307 GLY 307 338 338 GLY GLY A . n 
A 1 308 GLU 308 339 339 GLU GLU A . n 
A 1 309 THR 309 340 340 THR THR A . n 
A 1 310 ILE 310 341 341 ILE ILE A . n 
A 1 311 LYS 311 342 342 LYS LYS A . n 
A 1 312 ILE 312 343 343 ILE ILE A . n 
A 1 313 VAL 313 344 344 VAL VAL A . n 
A 1 314 ILE 314 345 345 ILE ILE A . n 
A 1 315 GLU 315 346 346 GLU GLU A . n 
A 1 316 GLU 316 347 347 GLU GLU A . n 
A 1 317 TYR 317 348 348 TYR TYR A . n 
A 1 318 VAL 318 349 349 VAL VAL A . n 
A 1 319 GLN 319 350 350 GLN GLN A . n 
A 1 320 GLN 320 351 351 GLN GLN A . n 
A 1 321 LEU 321 352 352 LEU LEU A . n 
A 1 322 SER 322 353 353 SER SER A . n 
A 1 323 GLY 323 354 354 GLY GLY A . n 
A 1 324 TYR 324 355 355 TYR TYR A . n 
A 1 325 PHE 325 356 356 PHE PHE A . n 
A 1 326 LEU 326 357 357 LEU LEU A . n 
A 1 327 GLN 327 358 358 GLN GLN A . n 
A 1 328 LEU 328 359 359 LEU LEU A . n 
A 1 329 LYS 329 360 360 LYS LYS A . n 
A 1 330 PHE 330 361 361 PHE PHE A . n 
A 1 331 ASP 331 362 362 ASP ASP A . n 
A 1 332 PRO 332 363 363 PRO PRO A . n 
A 1 333 GLU 333 364 364 GLU GLU A . n 
A 1 334 LEU 334 365 365 LEU LEU A . n 
A 1 335 LEU 335 366 366 LEU LEU A . n 
A 1 336 PHE 336 367 367 PHE PHE A . n 
A 1 337 GLY 337 368 368 GLY GLY A . n 
A 1 338 ALA 338 369 369 ALA ALA A . n 
A 1 339 GLN 339 370 370 GLN GLN A . n 
A 1 340 PHE 340 371 371 PHE PHE A . n 
A 1 341 GLN 341 372 372 GLN GLN A . n 
A 1 342 TYR 342 373 373 TYR TYR A . n 
A 1 343 ARG 343 374 374 ARG ARG A . n 
A 1 344 ASN 344 375 375 ASN ASN A . n 
A 1 345 ARG 345 376 376 ARG ARG A . n 
A 1 346 ILE 346 377 377 ILE ILE A . n 
A 1 347 ALA 347 378 378 ALA ALA A . n 
A 1 348 MET 348 379 379 MET MET A . n 
A 1 349 GLU 349 380 380 GLU GLU A . n 
A 1 350 PHE 350 381 381 PHE PHE A . n 
A 1 351 ASN 351 382 382 ASN ASN A . n 
A 1 352 GLN 352 383 383 GLN GLN A . n 
A 1 353 LEU 353 384 384 LEU LEU A . n 
A 1 354 TYR 354 385 385 TYR TYR A . n 
A 1 355 HIS 355 386 386 HIS HIS A . n 
A 1 356 TRP 356 387 387 TRP TRP A . n 
A 1 357 HIS 357 388 388 HIS HIS A . n 
A 1 358 PRO 358 389 389 PRO PRO A . n 
A 1 359 LEU 359 390 390 LEU LEU A . n 
A 1 360 MET 360 391 391 MET MET A . n 
A 1 361 PRO 361 392 392 PRO PRO A . n 
A 1 362 ASP 362 393 393 ASP ASP A . n 
A 1 363 SER 363 394 394 SER SER A . n 
A 1 364 PHE 364 395 395 PHE PHE A . n 
A 1 365 ARG 365 396 396 ARG ALA A . n 
A 1 366 VAL 366 397 397 VAL VAL A . n 
A 1 367 GLY 367 398 398 GLY GLY A . n 
A 1 368 PRO 368 399 399 PRO PRO A . n 
A 1 369 GLN 369 400 400 GLN ALA A . n 
A 1 370 ASP 370 401 401 ASP ASP A . n 
A 1 371 TYR 371 402 402 TYR TYR A . n 
A 1 372 SER 372 403 403 SER SER A . n 
A 1 373 TYR 373 404 404 TYR TYR A . n 
A 1 374 GLU 374 405 405 GLU ALA A . n 
A 1 375 GLN 375 406 406 GLN GLN A . n 
A 1 376 PHE 376 407 407 PHE PHE A . n 
A 1 377 LEU 377 408 408 LEU LEU A . n 
A 1 378 PHE 378 409 409 PHE PHE A . n 
A 1 379 ASN 379 410 410 ASN ASN A . n 
A 1 380 THR 380 411 411 THR THR A . n 
A 1 381 SER 381 412 412 SER SER A . n 
A 1 382 MET 382 413 413 MET MET A . n 
A 1 383 LEU 383 414 414 LEU LEU A . n 
A 1 384 VAL 384 415 415 VAL VAL A . n 
A 1 385 ASP 385 416 416 ASP ALA A . n 
A 1 386 TYR 386 417 417 TYR TYR A . n 
A 1 387 GLY 387 418 418 GLY GLY A . n 
A 1 388 VAL 388 419 419 VAL VAL A . n 
A 1 389 GLU 389 420 420 GLU GLU A . n 
A 1 390 ALA 390 421 421 ALA ALA A . n 
A 1 391 LEU 391 422 422 LEU LEU A . n 
A 1 392 VAL 392 423 423 VAL VAL A . n 
A 1 393 ASP 393 424 424 ASP ASP A . n 
A 1 394 ALA 394 425 425 ALA ALA A . n 
A 1 395 PHE 395 426 426 PHE PHE A . n 
A 1 396 SER 396 427 427 SER SER A . n 
A 1 397 ARG 397 428 428 ARG ARG A . n 
A 1 398 GLN 398 429 429 GLN GLN A . n 
A 1 399 PRO 399 430 430 PRO PRO A . n 
A 1 400 ALA 400 431 431 ALA ALA A . n 
A 1 401 GLY 401 432 432 GLY GLY A . n 
A 1 402 ARG 402 433 433 ARG ARG A . n 
A 1 403 ILE 403 434 434 ILE ILE A . n 
A 1 404 GLY 404 435 435 GLY GLY A . n 
A 1 405 GLY 405 436 436 GLY GLY A . n 
A 1 406 GLY 406 437 437 GLY GLY A . n 
A 1 407 ARG 407 438 438 ARG ARG A . n 
A 1 408 ASN 408 439 439 ASN ASN A . n 
A 1 409 ILE 409 440 440 ILE ILE A . n 
A 1 410 ASP 410 441 441 ASP ASP A . n 
A 1 411 HIS 411 442 442 HIS HIS A . n 
A 1 412 HIS 412 443 443 HIS HIS A . n 
A 1 413 ILE 413 444 444 ILE ILE A . n 
A 1 414 LEU 414 445 445 LEU LEU A . n 
A 1 415 HIS 415 446 446 HIS HIS A . n 
A 1 416 VAL 416 447 447 VAL VAL A . n 
A 1 417 ALA 417 448 448 ALA ALA A . n 
A 1 418 VAL 418 449 449 VAL VAL A . n 
A 1 419 ASP 419 450 450 ASP ASP A . n 
A 1 420 VAL 420 451 451 VAL VAL A . n 
A 1 421 ILE 421 452 452 ILE ILE A . n 
A 1 422 LYS 422 453 453 LYS LYS A . n 
A 1 423 GLU 423 454 454 GLU GLU A . n 
A 1 424 SER 424 455 455 SER SER A . n 
A 1 425 ARG 425 456 456 ARG ARG A . n 
A 1 426 VAL 426 457 457 VAL VAL A . n 
A 1 427 LEU 427 458 458 LEU LEU A . n 
A 1 428 ARG 428 459 459 ARG ARG A . n 
A 1 429 LEU 429 460 460 LEU LEU A . n 
A 1 430 GLN 430 461 461 GLN GLN A . n 
A 1 431 PRO 431 462 462 PRO PRO A . n 
A 1 432 PHE 432 463 463 PHE PHE A . n 
A 1 433 ASN 433 464 464 ASN ASN A . n 
A 1 434 GLU 434 465 465 GLU GLU A . n 
A 1 435 TYR 435 466 466 TYR TYR A . n 
A 1 436 ARG 436 467 467 ARG ARG A . n 
A 1 437 LYS 437 468 468 LYS LYS A . n 
A 1 438 ARG 438 469 469 ARG ARG A . n 
A 1 439 PHE 439 470 470 PHE PHE A . n 
A 1 440 GLY 440 471 471 GLY GLY A . n 
A 1 441 MET 441 472 472 MET MET A . n 
A 1 442 LYS 442 473 473 LYS ALA A . n 
A 1 443 PRO 443 474 474 PRO PRO A . n 
A 1 444 TYR 444 475 475 TYR TYR A . n 
A 1 445 THR 445 476 476 THR THR A . n 
A 1 446 SER 446 477 477 SER SER A . n 
A 1 447 PHE 447 478 478 PHE PHE A . n 
A 1 448 GLN 448 479 479 GLN ALA A . n 
A 1 449 GLU 449 480 480 GLU GLU A . n 
A 1 450 LEU 450 481 481 LEU LEU A . n 
A 1 451 THR 451 482 482 THR THR A . n 
A 1 452 GLY 452 483 483 GLY GLY A . n 
A 1 453 GLU 453 484 484 GLU GLU A . n 
A 1 454 LYS 454 485 485 LYS ALA A . n 
A 1 455 GLU 455 486 486 GLU ALA A . n 
A 1 456 MET 456 487 487 MET MET A . n 
A 1 457 ALA 457 488 488 ALA ALA A . n 
A 1 458 ALA 458 489 489 ALA ALA A . n 
A 1 459 GLU 459 490 490 GLU GLU A . n 
A 1 460 LEU 460 491 491 LEU LEU A . n 
A 1 461 GLU 461 492 492 GLU GLU A . n 
A 1 462 GLU 462 493 493 GLU GLU A . n 
A 1 463 LEU 463 494 494 LEU LEU A . n 
A 1 464 TYR 464 495 495 TYR TYR A . n 
A 1 465 GLY 465 496 496 GLY GLY A . n 
A 1 466 ASP 466 497 497 ASP ASP A . n 
A 1 467 ILE 467 498 498 ILE ILE A . n 
A 1 468 ASP 468 499 499 ASP ASP A . n 
A 1 469 ALA 469 500 500 ALA ALA A . n 
A 1 470 LEU 470 501 501 LEU LEU A . n 
A 1 471 GLU 471 502 502 GLU GLU A . n 
A 1 472 PHE 472 503 503 PHE PHE A . n 
A 1 473 TYR 473 504 504 TYR TYR A . n 
A 1 474 PRO 474 505 505 PRO PRO A . n 
A 1 475 GLY 475 506 506 GLY GLY A . n 
A 1 476 LEU 476 507 507 LEU LEU A . n 
A 1 477 LEU 477 508 508 LEU LEU A . n 
A 1 478 LEU 478 509 509 LEU LEU A . n 
A 1 479 GLU 479 510 510 GLU GLU A . n 
A 1 480 LYS 480 511 511 LYS LYS A . n 
A 1 481 CYS 481 512 512 CYS CYS A . n 
A 1 482 HIS 482 513 513 HIS HIS A . n 
A 1 483 PRO 483 514 514 PRO PRO A . n 
A 1 484 ASN 484 515 515 ASN ASN A . n 
A 1 485 SER 485 516 516 SER SER A . n 
A 1 486 ILE 486 517 517 ILE ILE A . n 
A 1 487 PHE 487 518 518 PHE PHE A . n 
A 1 488 GLY 488 519 519 GLY GLY A . n 
A 1 489 GLU 489 520 520 GLU GLU A . n 
A 1 490 SER 490 521 521 SER SER A . n 
A 1 491 MET 491 522 522 MET MET A . n 
A 1 492 ILE 492 523 523 ILE ILE A . n 
A 1 493 GLU 493 524 524 GLU GLU A . n 
A 1 494 MET 494 525 525 MET MET A . n 
A 1 495 GLY 495 526 526 GLY GLY A . n 
A 1 496 ALA 496 527 527 ALA ALA A . n 
A 1 497 PRO 497 528 528 PRO PRO A . n 
A 1 498 PHE 498 529 529 PHE PHE A . n 
A 1 499 SER 499 530 530 SER SER A . n 
A 1 500 LEU 500 531 531 LEU LEU A . n 
A 1 501 LYS 501 532 532 LYS LYS A . n 
A 1 502 GLY 502 533 533 GLY GLY A . n 
A 1 503 LEU 503 534 534 LEU LEU A . n 
A 1 504 LEU 504 535 535 LEU LEU A . n 
A 1 505 GLY 505 536 536 GLY GLY A . n 
A 1 506 ASN 506 537 537 ASN ASN A . n 
A 1 507 PRO 507 538 538 PRO PRO A . n 
A 1 508 ILE 508 539 539 ILE ILE A . n 
A 1 509 CYS 509 540 540 CYS CYS A . n 
A 1 510 SER 510 541 541 SER SER A . n 
A 1 511 PRO 511 542 542 PRO PRO A . n 
A 1 512 GLU 512 543 543 GLU GLU A . n 
A 1 513 TYR 513 544 544 TYR TYR A . n 
A 1 514 TRP 514 545 545 TRP TRP A . n 
A 1 515 LYS 515 546 546 LYS LYS A . n 
A 1 516 ALA 516 547 547 ALA ALA A . n 
A 1 517 SER 517 548 548 SER SER A . n 
A 1 518 THR 518 549 549 THR THR A . n 
A 1 519 PHE 519 550 550 PHE PHE A . n 
A 1 520 GLY 520 551 551 GLY GLY A . n 
A 1 521 GLY 521 552 552 GLY GLY A . n 
A 1 522 GLU 522 553 553 GLU GLU A . n 
A 1 523 VAL 523 554 554 VAL VAL A . n 
A 1 524 GLY 524 555 555 GLY GLY A . n 
A 1 525 PHE 525 556 556 PHE PHE A . n 
A 1 526 ASN 526 557 557 ASN ASN A . n 
A 1 527 LEU 527 558 558 LEU LEU A . n 
A 1 528 VAL 528 559 559 VAL VAL A . n 
A 1 529 LYS 529 560 560 LYS LYS A . n 
A 1 530 THR 530 561 561 THR THR A . n 
A 1 531 ALA 531 562 562 ALA ALA A . n 
A 1 532 THR 532 563 563 THR THR A . n 
A 1 533 LEU 533 564 564 LEU LEU A . n 
A 1 534 LYS 534 565 565 LYS LYS A . n 
A 1 535 LYS 535 566 566 LYS LYS A . n 
A 1 536 LEU 536 567 567 LEU LEU A . n 
A 1 537 VAL 537 568 568 VAL VAL A . n 
A 1 538 CYS 538 569 569 CYS CYS A . n 
A 1 539 LEU 539 570 570 LEU LEU A . n 
A 1 540 ASN 540 571 571 ASN ASN A . n 
A 1 541 THR 541 572 572 THR THR A . n 
A 1 542 LYS 542 573 573 LYS LYS A . n 
A 1 543 THR 543 574 574 THR THR A . n 
A 1 544 CYS 544 575 575 CYS CYS A . n 
A 1 545 PRO 545 576 576 PRO PRO A . n 
A 1 546 TYR 546 577 577 TYR TYR A . n 
A 1 547 VAL 547 578 578 VAL VAL A . n 
A 1 548 SER 548 579 579 SER SER A . n 
A 1 549 PHE 549 580 580 PHE PHE A . n 
A 1 550 HIS 550 581 581 HIS HIS A . n 
A 1 551 VAL 551 582 582 VAL VAL A . n 
A 1 552 PRO 552 583 583 PRO PRO A . n 
A 1 553 ASP 553 584 584 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 BOG 1   750 750 BOG BOG A . 
F 5 BOG 1   751 751 BOG BOG A . 
G 5 BOG 1   752 752 BOG BOG A . 
H 5 BOG 1   753 753 BOG BOG A . 
I 6 COH 1   601 601 COH COH A . 
J 7 ACD 1   700 700 ACD ACD A . 
K 8 HOH 1   800 800 HOH TIP A . 
K 8 HOH 2   801 801 HOH TIP A . 
K 8 HOH 3   802 802 HOH TIP A . 
K 8 HOH 4   803 803 HOH TIP A . 
K 8 HOH 5   804 804 HOH TIP A . 
K 8 HOH 6   805 805 HOH TIP A . 
K 8 HOH 7   806 806 HOH TIP A . 
K 8 HOH 8   807 807 HOH TIP A . 
K 8 HOH 9   808 808 HOH TIP A . 
K 8 HOH 10  809 809 HOH TIP A . 
K 8 HOH 11  810 810 HOH TIP A . 
K 8 HOH 12  811 811 HOH TIP A . 
K 8 HOH 13  812 812 HOH TIP A . 
K 8 HOH 14  813 813 HOH TIP A . 
K 8 HOH 15  814 814 HOH TIP A . 
K 8 HOH 16  815 815 HOH TIP A . 
K 8 HOH 17  816 816 HOH TIP A . 
K 8 HOH 18  817 817 HOH TIP A . 
K 8 HOH 19  818 818 HOH TIP A . 
K 8 HOH 20  819 819 HOH TIP A . 
K 8 HOH 21  820 820 HOH TIP A . 
K 8 HOH 22  821 821 HOH TIP A . 
K 8 HOH 23  822 822 HOH TIP A . 
K 8 HOH 24  823 823 HOH TIP A . 
K 8 HOH 25  824 824 HOH TIP A . 
K 8 HOH 26  825 825 HOH TIP A . 
K 8 HOH 27  826 826 HOH TIP A . 
K 8 HOH 28  827 827 HOH TIP A . 
K 8 HOH 29  828 828 HOH TIP A . 
K 8 HOH 30  829 829 HOH TIP A . 
K 8 HOH 31  830 830 HOH TIP A . 
K 8 HOH 32  831 831 HOH TIP A . 
K 8 HOH 33  832 832 HOH TIP A . 
K 8 HOH 34  833 833 HOH TIP A . 
K 8 HOH 35  834 834 HOH TIP A . 
K 8 HOH 36  835 835 HOH TIP A . 
K 8 HOH 37  836 836 HOH TIP A . 
K 8 HOH 38  837 837 HOH TIP A . 
K 8 HOH 39  838 838 HOH TIP A . 
K 8 HOH 40  839 839 HOH TIP A . 
K 8 HOH 41  840 840 HOH TIP A . 
K 8 HOH 42  841 841 HOH TIP A . 
K 8 HOH 43  842 842 HOH TIP A . 
K 8 HOH 44  843 843 HOH TIP A . 
K 8 HOH 45  844 844 HOH TIP A . 
K 8 HOH 46  845 845 HOH TIP A . 
K 8 HOH 47  846 846 HOH TIP A . 
K 8 HOH 48  847 847 HOH TIP A . 
K 8 HOH 49  848 848 HOH TIP A . 
K 8 HOH 50  849 849 HOH TIP A . 
K 8 HOH 51  850 850 HOH TIP A . 
K 8 HOH 52  851 851 HOH TIP A . 
K 8 HOH 53  852 852 HOH TIP A . 
K 8 HOH 54  853 853 HOH TIP A . 
K 8 HOH 55  854 854 HOH TIP A . 
K 8 HOH 56  855 855 HOH TIP A . 
K 8 HOH 57  856 856 HOH TIP A . 
K 8 HOH 58  857 857 HOH TIP A . 
K 8 HOH 59  858 858 HOH TIP A . 
K 8 HOH 60  859 859 HOH TIP A . 
K 8 HOH 61  860 860 HOH TIP A . 
K 8 HOH 62  861 861 HOH TIP A . 
K 8 HOH 63  862 862 HOH TIP A . 
K 8 HOH 64  863 863 HOH TIP A . 
K 8 HOH 65  864 864 HOH TIP A . 
K 8 HOH 66  865 865 HOH TIP A . 
K 8 HOH 67  866 866 HOH TIP A . 
K 8 HOH 68  867 867 HOH TIP A . 
K 8 HOH 69  868 868 HOH TIP A . 
K 8 HOH 70  869 869 HOH TIP A . 
K 8 HOH 71  870 870 HOH TIP A . 
K 8 HOH 72  871 871 HOH TIP A . 
K 8 HOH 73  872 872 HOH TIP A . 
K 8 HOH 74  873 873 HOH TIP A . 
K 8 HOH 75  874 874 HOH TIP A . 
K 8 HOH 76  875 875 HOH TIP A . 
K 8 HOH 77  876 876 HOH TIP A . 
K 8 HOH 78  877 877 HOH TIP A . 
K 8 HOH 79  878 878 HOH TIP A . 
K 8 HOH 80  879 879 HOH TIP A . 
K 8 HOH 81  880 880 HOH TIP A . 
K 8 HOH 82  881 881 HOH TIP A . 
K 8 HOH 83  882 882 HOH TIP A . 
K 8 HOH 84  883 883 HOH TIP A . 
K 8 HOH 85  884 884 HOH TIP A . 
K 8 HOH 86  885 885 HOH TIP A . 
K 8 HOH 87  886 886 HOH TIP A . 
K 8 HOH 88  887 887 HOH TIP A . 
K 8 HOH 89  888 888 HOH TIP A . 
K 8 HOH 90  889 889 HOH TIP A . 
K 8 HOH 91  890 890 HOH TIP A . 
K 8 HOH 92  891 891 HOH TIP A . 
K 8 HOH 93  892 892 HOH TIP A . 
K 8 HOH 94  893 893 HOH TIP A . 
K 8 HOH 95  894 894 HOH TIP A . 
K 8 HOH 96  895 895 HOH TIP A . 
K 8 HOH 97  896 896 HOH TIP A . 
K 8 HOH 98  897 897 HOH TIP A . 
K 8 HOH 99  898 898 HOH TIP A . 
K 8 HOH 100 899 899 HOH TIP A . 
K 8 HOH 101 900 900 HOH TIP A . 
K 8 HOH 102 901 901 HOH TIP A . 
K 8 HOH 103 902 902 HOH TIP A . 
K 8 HOH 104 903 903 HOH TIP A . 
K 8 HOH 105 904 904 HOH TIP A . 
K 8 HOH 106 905 905 HOH TIP A . 
K 8 HOH 107 906 906 HOH TIP A . 
K 8 HOH 108 907 907 HOH TIP A . 
K 8 HOH 109 908 908 HOH TIP A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 37  A ASN 68  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 113 A ASN 144 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 379 A ASN 410 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 18500 ? 
1 MORE         37    ? 
1 'SSA (A^2)'  41370 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000 0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 7_644 y+1,x-1,-z-1/3 -0.5000000000 0.8660254038 0.0000000000 273.1500000000 0.8660254038 
0.5000000000 0.0000000000 -157.7032260291 0.0000000000 0.0000000000 -1.0000000000 -34.5466666667 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 357 ? A HIS 388 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NA ? I COH . ? A COH 601 ? 1_555 106.8 ? 
2  NE2 ? A HIS 357 ? A HIS 388 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NB ? I COH . ? A COH 601 ? 1_555 88.8  ? 
3  NA  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NB ? I COH . ? A COH 601 ? 1_555 86.0  ? 
4  NE2 ? A HIS 357 ? A HIS 388 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NC ? I COH . ? A COH 601 ? 1_555 73.3  ? 
5  NA  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NC ? I COH . ? A COH 601 ? 1_555 178.9 ? 
6  NB  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 NC ? I COH . ? A COH 601 ? 1_555 92.9  ? 
7  NE2 ? A HIS 357 ? A HIS 388 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 ND ? I COH . ? A COH 601 ? 1_555 91.8  ? 
8  NA  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 ND ? I COH . ? A COH 601 ? 1_555 95.9  ? 
9  NB  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 ND ? I COH . ? A COH 601 ? 1_555 177.8 ? 
10 NC  ? I COH .   ? A COH 601 ? 1_555 CO ? I COH . ? A COH 601 ? 1_555 ND ? I COH . ? A COH 601 ? 1_555 85.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-09-22 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-05-30 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Derived calculations'      
3  3 'Structure model' 'Version format compliance' 
4  4 'Structure model' Advisory                    
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Derived calculations'      
7  5 'Structure model' 'Atomic model'              
8  5 'Structure model' 'Data collection'           
9  5 'Structure model' 'Derived calculations'      
10 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' pdbx_distant_solvent_atoms    
2  4 'Structure model' pdbx_struct_assembly          
3  4 'Structure model' pdbx_struct_assembly_gen      
4  4 'Structure model' pdbx_struct_assembly_prop     
5  4 'Structure model' pdbx_struct_oper_list         
6  5 'Structure model' atom_site                     
7  5 'Structure model' chem_comp                     
8  5 'Structure model' entity                        
9  5 'Structure model' pdbx_branch_scheme            
10 5 'Structure model' pdbx_chem_comp_identifier     
11 5 'Structure model' pdbx_entity_branch            
12 5 'Structure model' pdbx_entity_branch_descriptor 
13 5 'Structure model' pdbx_entity_branch_link       
14 5 'Structure model' pdbx_entity_branch_list       
15 5 'Structure model' pdbx_entity_nonpoly           
16 5 'Structure model' pdbx_nonpoly_scheme           
17 5 'Structure model' pdbx_struct_assembly_gen      
18 5 'Structure model' pdbx_struct_conn_angle        
19 5 'Structure model' struct_asym                   
20 5 'Structure model' struct_conn                   
21 5 'Structure model' struct_site                   
22 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_pdbx_struct_assembly_prop.biol_id'          
2  5 'Structure model' '_atom_site.auth_asym_id'                     
3  5 'Structure model' '_atom_site.auth_atom_id'                     
4  5 'Structure model' '_atom_site.auth_seq_id'                      
5  5 'Structure model' '_atom_site.label_asym_id'                    
6  5 'Structure model' '_atom_site.label_atom_id'                    
7  5 'Structure model' '_atom_site.label_entity_id'                  
8  5 'Structure model' '_chem_comp.mon_nstd_flag'                    
9  5 'Structure model' '_chem_comp.name'                             
10 5 'Structure model' '_chem_comp.type'                             
11 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
15 5 'Structure model' '_struct_conn.pdbx_dist_value'                
16 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
17 5 'Structure model' '_struct_conn.pdbx_role'                      
18 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
19 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
22 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
24 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
25 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
26 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
27 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
28 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
29 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
30 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
31 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 34  ? ? -48.41  100.27  
2  1 CYS A 36  ? ? -58.62  3.36    
3  1 CYS A 59  ? ? -63.40  3.23    
4  1 THR A 60  ? ? -38.53  129.81  
5  1 ARG A 61  ? ? 48.94   27.63   
6  1 CYS A 69  ? ? 63.40   61.33   
7  1 HIS A 95  ? ? -139.64 -52.82  
8  1 ARG A 97  ? ? -55.86  27.54   
9  1 TRP A 98  ? ? -137.76 -50.41  
10 1 ALA A 105 ? ? -95.52  33.75   
11 1 LEU A 117 ? ? -47.51  -79.78  
12 1 THR A 118 ? ? -29.78  -74.04  
13 1 THR A 129 ? ? -102.25 -96.75  
14 1 ASP A 135 ? ? -98.05  41.99   
15 1 VAL A 145 ? ? -48.42  -11.90  
16 1 PRO A 153 ? ? -61.81  -171.78 
17 1 ARG A 157 ? ? -66.59  18.45   
18 1 PRO A 160 ? ? -41.06  -77.55  
19 1 LYS A 169 ? ? -56.78  -6.21   
20 1 ARG A 185 ? ? -101.27 -77.19  
21 1 THR A 194 ? ? -46.76  150.23  
22 1 ALA A 223 ? ? -65.74  83.81   
23 1 HIS A 226 ? ? 38.87   62.28   
24 1 ILE A 233 ? ? -124.25 -56.42  
25 1 PHE A 247 ? ? 14.10   55.15   
26 1 GLU A 268 ? ? 147.19  -36.10  
27 1 ALA A 269 ? ? -113.80 65.87   
28 1 PRO A 270 ? ? -58.29  58.00   
29 1 MET A 273 ? ? -128.64 -148.74 
30 1 HIS A 274 ? ? -155.50 15.52   
31 1 ARG A 277 ? ? -53.89  97.93   
32 1 PRO A 280 ? ? -58.20  2.57    
33 1 PRO A 281 ? ? -92.58  -91.43  
34 1 SER A 283 ? ? 58.38   15.13   
35 1 GLN A 284 ? ? -117.51 77.20   
36 1 VAL A 287 ? ? -134.83 -46.07  
37 1 GLU A 290 ? ? -25.34  -42.87  
38 1 THR A 322 ? ? -62.77  19.99   
39 1 GLN A 327 ? ? -55.47  -71.89  
40 1 PHE A 329 ? ? -64.34  -70.58  
41 1 GLU A 347 ? ? -137.02 -46.89  
42 1 GLN A 350 ? ? -60.74  -71.19  
43 1 LEU A 359 ? ? -38.50  146.80  
44 1 ARG A 374 ? ? -174.02 125.49  
45 1 ARG A 376 ? ? -162.09 103.33  
46 1 TRP A 387 ? ? -90.64  51.07   
47 1 PRO A 392 ? ? -71.87  -162.15 
48 1 TYR A 402 ? ? -45.14  155.08  
49 1 PHE A 409 ? ? 50.22   -2.50   
50 1 ASN A 410 ? ? -48.67  160.87  
51 1 THR A 411 ? ? -142.95 24.10   
52 1 SER A 412 ? ? -146.29 -16.62  
53 1 ASN A 439 ? ? -152.69 21.11   
54 1 ASP A 441 ? ? -47.86  151.68  
55 1 LEU A 445 ? ? -47.30  -17.99  
56 1 ARG A 469 ? ? -37.66  -34.66  
57 1 GLU A 484 ? ? -100.58 -153.76 
58 1 GLU A 486 ? ? -61.28  -79.99  
59 1 LEU A 501 ? ? -42.94  154.07  
60 1 TRP A 545 ? ? -66.89  65.63   
61 1 VAL A 568 ? ? -93.38  -72.36  
62 1 CYS A 569 ? ? -48.97  -4.57   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 823 ? 6.52 . 
2 1 O ? A HOH 842 ? 6.34 . 
3 1 O ? A HOH 844 ? 5.88 . 
4 1 O ? A HOH 848 ? 6.13 . 
5 1 O ? A HOH 861 ? 5.82 . 
6 1 O ? A HOH 875 ? 7.21 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 79  ? CG  ? A ARG 48  CG  
2  1 Y 1 A ARG 79  ? CD  ? A ARG 48  CD  
3  1 Y 1 A ARG 79  ? NE  ? A ARG 48  NE  
4  1 Y 1 A ARG 79  ? CZ  ? A ARG 48  CZ  
5  1 Y 1 A ARG 79  ? NH1 ? A ARG 48  NH1 
6  1 Y 1 A ARG 79  ? NH2 ? A ARG 48  NH2 
7  1 Y 1 A ARG 83  ? CG  ? A ARG 52  CG  
8  1 Y 1 A ARG 83  ? CD  ? A ARG 52  CD  
9  1 Y 1 A ARG 83  ? NE  ? A ARG 52  NE  
10 1 Y 1 A ARG 83  ? CZ  ? A ARG 52  CZ  
11 1 Y 1 A ARG 83  ? NH1 ? A ARG 52  NH1 
12 1 Y 1 A ARG 83  ? NH2 ? A ARG 52  NH2 
13 1 Y 1 A LYS 169 ? CG  ? A LYS 138 CG  
14 1 Y 1 A LYS 169 ? CD  ? A LYS 138 CD  
15 1 Y 1 A LYS 169 ? CE  ? A LYS 138 CE  
16 1 Y 1 A LYS 169 ? NZ  ? A LYS 138 NZ  
17 1 Y 1 A GLN 170 ? CG  ? A GLN 139 CG  
18 1 Y 1 A GLN 170 ? CD  ? A GLN 139 CD  
19 1 Y 1 A GLN 170 ? OE1 ? A GLN 139 OE1 
20 1 Y 1 A GLN 170 ? NE2 ? A GLN 139 NE2 
21 1 Y 1 A ASP 173 ? CG  ? A ASP 142 CG  
22 1 Y 1 A ASP 173 ? OD1 ? A ASP 142 OD1 
23 1 Y 1 A ASP 173 ? OD2 ? A ASP 142 OD2 
24 1 Y 1 A GLU 175 ? CG  ? A GLU 144 CG  
25 1 Y 1 A GLU 175 ? CD  ? A GLU 144 CD  
26 1 Y 1 A GLU 175 ? OE1 ? A GLU 144 OE1 
27 1 Y 1 A GLU 175 ? OE2 ? A GLU 144 OE2 
28 1 Y 1 A LYS 186 ? CG  ? A LYS 155 CG  
29 1 Y 1 A LYS 186 ? CD  ? A LYS 155 CD  
30 1 Y 1 A LYS 186 ? CE  ? A LYS 155 CE  
31 1 Y 1 A LYS 186 ? NZ  ? A LYS 155 NZ  
32 1 Y 1 A LYS 215 ? CG  ? A LYS 184 CG  
33 1 Y 1 A LYS 215 ? CD  ? A LYS 184 CD  
34 1 Y 1 A LYS 215 ? CE  ? A LYS 184 CE  
35 1 Y 1 A LYS 215 ? NZ  ? A LYS 184 NZ  
36 1 Y 1 A LYS 248 ? CG  ? A LYS 217 CG  
37 1 Y 1 A LYS 248 ? CD  ? A LYS 217 CD  
38 1 Y 1 A LYS 248 ? CE  ? A LYS 217 CE  
39 1 Y 1 A LYS 248 ? NZ  ? A LYS 217 NZ  
40 1 Y 1 A GLU 267 ? CG  ? A GLU 236 CG  
41 1 Y 1 A GLU 267 ? CD  ? A GLU 236 CD  
42 1 Y 1 A GLU 267 ? OE1 ? A GLU 236 OE1 
43 1 Y 1 A GLU 267 ? OE2 ? A GLU 236 OE2 
44 1 Y 1 A GLU 290 ? CG  ? A GLU 259 CG  
45 1 Y 1 A GLU 290 ? CD  ? A GLU 259 CD  
46 1 Y 1 A GLU 290 ? OE1 ? A GLU 259 OE1 
47 1 Y 1 A GLU 290 ? OE2 ? A GLU 259 OE2 
48 1 Y 1 A LYS 317 ? CG  ? A LYS 286 CG  
49 1 Y 1 A LYS 317 ? CD  ? A LYS 286 CD  
50 1 Y 1 A LYS 317 ? CE  ? A LYS 286 CE  
51 1 Y 1 A LYS 317 ? NZ  ? A LYS 286 NZ  
52 1 Y 1 A ARG 396 ? CG  ? A ARG 365 CG  
53 1 Y 1 A ARG 396 ? CD  ? A ARG 365 CD  
54 1 Y 1 A ARG 396 ? NE  ? A ARG 365 NE  
55 1 Y 1 A ARG 396 ? CZ  ? A ARG 365 CZ  
56 1 Y 1 A ARG 396 ? NH1 ? A ARG 365 NH1 
57 1 Y 1 A ARG 396 ? NH2 ? A ARG 365 NH2 
58 1 Y 1 A GLN 400 ? CG  ? A GLN 369 CG  
59 1 Y 1 A GLN 400 ? CD  ? A GLN 369 CD  
60 1 Y 1 A GLN 400 ? OE1 ? A GLN 369 OE1 
61 1 Y 1 A GLN 400 ? NE2 ? A GLN 369 NE2 
62 1 Y 1 A GLU 405 ? CG  ? A GLU 374 CG  
63 1 Y 1 A GLU 405 ? CD  ? A GLU 374 CD  
64 1 Y 1 A GLU 405 ? OE1 ? A GLU 374 OE1 
65 1 Y 1 A GLU 405 ? OE2 ? A GLU 374 OE2 
66 1 Y 1 A ASP 416 ? CG  ? A ASP 385 CG  
67 1 Y 1 A ASP 416 ? OD1 ? A ASP 385 OD1 
68 1 Y 1 A ASP 416 ? OD2 ? A ASP 385 OD2 
69 1 Y 1 A LYS 473 ? CG  ? A LYS 442 CG  
70 1 Y 1 A LYS 473 ? CD  ? A LYS 442 CD  
71 1 Y 1 A LYS 473 ? CE  ? A LYS 442 CE  
72 1 Y 1 A LYS 473 ? NZ  ? A LYS 442 NZ  
73 1 Y 1 A GLN 479 ? CG  ? A GLN 448 CG  
74 1 Y 1 A GLN 479 ? CD  ? A GLN 448 CD  
75 1 Y 1 A GLN 479 ? OE1 ? A GLN 448 OE1 
76 1 Y 1 A GLN 479 ? NE2 ? A GLN 448 NE2 
77 1 Y 1 A LYS 485 ? CG  ? A LYS 454 CG  
78 1 Y 1 A LYS 485 ? CD  ? A LYS 454 CD  
79 1 Y 1 A LYS 485 ? CE  ? A LYS 454 CE  
80 1 Y 1 A LYS 485 ? NZ  ? A LYS 454 NZ  
81 1 Y 1 A GLU 486 ? CG  ? A GLU 455 CG  
82 1 Y 1 A GLU 486 ? CD  ? A GLU 455 CD  
83 1 Y 1 A GLU 486 ? OE1 ? A GLU 455 OE1 
84 1 Y 1 A GLU 486 ? OE2 ? A GLU 455 OE2 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 B NAG 661 n 
B 2 NDG 2 B NDG 2 B NAG 662 n 
C 3 NAG 1 C NAG 1 C NAG 671 n 
C 3 NAG 2 C NAG 2 C NAG 672 n 
C 3 BMA 3 C BMA 3 C BMA 673 n 
C 3 BMA 4 C BMA 4 C BMA 674 n 
C 3 MAN 5 C MAN 5 C BMA 675 n 
D 4 NAG 1 D NAG 1 D NAG 681 n 
D 4 NAG 2 D NAG 2 D NAG 682 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
BOG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-octylglucoside               
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
NDG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAca                      
NDG 'COMMON NAME'                         GMML     1.0 N-acetyl-a-D-glucopyranosamine 
NDG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-GlcpNAc                    
NDG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
4 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpNAca1-4DGlcpNAcb1-                                                                                     
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a2122h-1a_1-5_2*NCC/3=O]/1-2/a4-b1'                              WURCS PDB2Glycan 
1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{}}}'                                                          LINUCS PDB-CARE   
?     
4 3 DManpa1-3DManpb1-6DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                          
'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/3,5,4/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-2-3/a4-b1_b4-c1_c6-d1_d3-e1' WURCS PDB2Glycan 
1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][b-D-Manp]{[(3+1)][a-D-Manp]{}}}}}}' LINUCS PDB-CARE   
?     
7 4 DGlcpNAcb1-4DGlcpNAcb1-                                                                                     
'Glycam Condensed Sequence' GMML       1.0   
8 4 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1'                                                       WURCS PDB2Glycan 
1.1.0 
9 4 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}'                                                          LINUCS PDB-CARE   
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NDG C1 O1 1 NAG O4 HO4 sing ? 
2 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
3 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
4 3 4 BMA C1 O1 3 BMA O6 HO6 sing ? 
5 3 5 MAN C1 O1 4 BMA O3 HO3 sing ? 
6 4 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NDG 2 n 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 BMA 4 n 
3 MAN 5 n 
4 NAG 1 n 
4 NAG 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'octyl beta-D-glucopyranoside'    BOG 
6 'PROTOPORPHYRIN IX CONTAINING CO' COH 
7 'ARACHIDONIC ACID'                ACD 
8 water                             HOH 
#