data_1DMO
# 
_entry.id   1DMO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DMO         
WWPDB D_1000172843 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DMO 
_pdbx_database_status.recvd_initial_deposition_date   1996-04-24 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, M.'  1 
'Tanaka, T.' 2 
'Ikura, M.'  3 
# 
_citation.id                        primary 
_citation.title                     
'Calcium-induced conformational transition revealed by the solution structure of apo calmodulin.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            2 
_citation.page_first                758 
_citation.page_last                 767 
_citation.year                      1995 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   7552747 
_citation.pdbx_database_id_DOI      10.1038/nsb0995-758 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zhang, M.'  1 
primary 'Tanaka, T.' 2 
primary 'Ikura, M.'  3 
# 
_cell.entry_id           1DMO 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DMO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           CALMODULIN 
_entity.formula_weight             16720.363 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD
SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD
SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   GLN n 
1 4   LEU n 
1 5   THR n 
1 6   GLU n 
1 7   GLU n 
1 8   GLN n 
1 9   ILE n 
1 10  ALA n 
1 11  GLU n 
1 12  PHE n 
1 13  LYS n 
1 14  GLU n 
1 15  ALA n 
1 16  PHE n 
1 17  SER n 
1 18  LEU n 
1 19  PHE n 
1 20  ASP n 
1 21  LYS n 
1 22  ASP n 
1 23  GLY n 
1 24  ASP n 
1 25  GLY n 
1 26  THR n 
1 27  ILE n 
1 28  THR n 
1 29  THR n 
1 30  LYS n 
1 31  GLU n 
1 32  LEU n 
1 33  GLY n 
1 34  THR n 
1 35  VAL n 
1 36  MET n 
1 37  ARG n 
1 38  SER n 
1 39  LEU n 
1 40  GLY n 
1 41  GLN n 
1 42  ASN n 
1 43  PRO n 
1 44  THR n 
1 45  GLU n 
1 46  ALA n 
1 47  GLU n 
1 48  LEU n 
1 49  GLN n 
1 50  ASP n 
1 51  MET n 
1 52  ILE n 
1 53  ASN n 
1 54  GLU n 
1 55  VAL n 
1 56  ASP n 
1 57  ALA n 
1 58  ASP n 
1 59  GLY n 
1 60  ASN n 
1 61  GLY n 
1 62  THR n 
1 63  ILE n 
1 64  ASP n 
1 65  PHE n 
1 66  PRO n 
1 67  GLU n 
1 68  PHE n 
1 69  LEU n 
1 70  THR n 
1 71  MET n 
1 72  MET n 
1 73  ALA n 
1 74  ARG n 
1 75  LYS n 
1 76  MET n 
1 77  LYS n 
1 78  ASP n 
1 79  THR n 
1 80  ASP n 
1 81  SER n 
1 82  GLU n 
1 83  GLU n 
1 84  GLU n 
1 85  ILE n 
1 86  ARG n 
1 87  GLU n 
1 88  ALA n 
1 89  PHE n 
1 90  ARG n 
1 91  VAL n 
1 92  PHE n 
1 93  ASP n 
1 94  LYS n 
1 95  ASP n 
1 96  GLY n 
1 97  ASN n 
1 98  GLY n 
1 99  TYR n 
1 100 ILE n 
1 101 SER n 
1 102 ALA n 
1 103 ALA n 
1 104 GLU n 
1 105 LEU n 
1 106 ARG n 
1 107 HIS n 
1 108 VAL n 
1 109 MET n 
1 110 THR n 
1 111 ASN n 
1 112 LEU n 
1 113 GLY n 
1 114 GLU n 
1 115 LYS n 
1 116 LEU n 
1 117 THR n 
1 118 ASP n 
1 119 GLU n 
1 120 GLU n 
1 121 VAL n 
1 122 ASP n 
1 123 GLU n 
1 124 MET n 
1 125 ILE n 
1 126 ARG n 
1 127 GLU n 
1 128 ALA n 
1 129 ASN n 
1 130 ILE n 
1 131 ASP n 
1 132 GLY n 
1 133 ASP n 
1 134 GLY n 
1 135 GLN n 
1 136 VAL n 
1 137 ASN n 
1 138 TYR n 
1 139 GLU n 
1 140 GLU n 
1 141 PHE n 
1 142 VAL n 
1 143 GLN n 
1 144 MET n 
1 145 MET n 
1 146 THR n 
1 147 ALA n 
1 148 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'African clawed frog' 
_entity_src_gen.gene_src_genus                     Xenopus 
_entity_src_gen.pdbx_gene_src_gene                 'XENOPUS LAEVIS' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Xenopus laevis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     8355 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 'XENOPUS LAEVIS' 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PAS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CALM_XENLA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P62155 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTD
SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREANIDGDGQVNYEEFVQMMTAK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DMO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 148 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62155 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  148 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       148 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1DMO 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    30 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          3.0 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1DMO 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1DMO 
_struct.title                     'CALMODULIN, NMR, 30 STRUCTURES' 
_struct.pdbx_descriptor           CALMODULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DMO 
_struct_keywords.pdbx_keywords   'CALCIUM-BINDING PROTEIN' 
_struct_keywords.text            'CALCIUM-INDUCED CONFORMATIONAL CHANGE, CALCIUM-BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 6   ? LEU A 18  ? GLU A 6   LEU A 18  1 ? 13 
HELX_P HELX_P2 2 THR A 29  ? LEU A 39  ? THR A 29  LEU A 39  1 ? 11 
HELX_P HELX_P3 3 GLU A 45  ? VAL A 55  ? GLU A 45  VAL A 55  1 ? 11 
HELX_P HELX_P4 4 PHE A 65  ? MET A 76  ? PHE A 65  MET A 76  1 ? 12 
HELX_P HELX_P5 5 GLU A 82  ? ARG A 90  ? GLU A 82  ARG A 90  1 ? 9  
HELX_P HELX_P6 6 ALA A 102 ? LEU A 112 ? ALA A 102 LEU A 112 1 ? 11 
HELX_P HELX_P7 7 ASP A 118 ? GLU A 127 ? ASP A 118 GLU A 127 1 ? 10 
HELX_P HELX_P8 8 TYR A 138 ? GLN A 143 ? TYR A 138 GLN A 143 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 27  ? THR A 28  ? ILE A 27  THR A 28  
A 2 THR A 62  ? ILE A 63  ? THR A 62  ILE A 63  
B 1 ILE A 100 ? SER A 101 ? ILE A 100 SER A 101 
B 2 GLN A 135 ? VAL A 136 ? GLN A 135 VAL A 136 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 27  ? O ILE A 27  N ILE A 63  ? N ILE A 63  
B 1 2 N ILE A 100 ? N ILE A 100 O VAL A 136 ? O VAL A 136 
# 
_database_PDB_matrix.entry_id          1DMO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DMO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? 12.018  -1.163  -12.487 1.00 0.00 ? 1   ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? 10.943  -0.591  -13.332 1.00 0.00 ? 1   ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? 9.785   -0.121  -12.461 1.00 0.00 ? 1   ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? 8.738   -0.736  -12.433 1.00 0.00 ? 1   ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? 10.418  -1.659  -14.306 1.00 0.00 ? 1   ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? 11.864  -0.887  -11.496 1.00 0.00 ? 1   ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1   ? 12.005  -2.200  -12.565 1.00 0.00 ? 1   ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1   ? 12.939  -0.802  -12.808 1.00 0.00 ? 1   ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1   ? 11.342  0.266   -13.876 1.00 0.00 ? 1   ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1   ? 10.292  -2.598  -13.785 1.00 0.00 ? 1   ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1   ? 9.468   -1.348  -14.711 1.00 0.00 ? 1   ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1   ? 11.122  -1.793  -15.114 1.00 0.00 ? 1   ALA A HB3  1  
ATOM 13    N N    . ASP A 1 2   ? 9.994   0.965   -11.764 1.00 0.00 ? 2   ASP A N    1  
ATOM 14    C CA   . ASP A 1 2   ? 8.915   1.488   -10.890 1.00 0.00 ? 2   ASP A CA   1  
ATOM 15    C C    . ASP A 1 2   ? 8.077   2.524   -11.627 1.00 0.00 ? 2   ASP A C    1  
ATOM 16    O O    . ASP A 1 2   ? 7.335   3.267   -11.023 1.00 0.00 ? 2   ASP A O    1  
ATOM 17    C CB   . ASP A 1 2   ? 9.557   2.147   -9.658  1.00 0.00 ? 2   ASP A CB   1  
ATOM 18    C CG   . ASP A 1 2   ? 10.890  2.779   -10.057 1.00 0.00 ? 2   ASP A CG   1  
ATOM 19    O OD1  . ASP A 1 2   ? 11.833  2.016   -10.192 1.00 0.00 ? 2   ASP A OD1  1  
ATOM 20    O OD2  . ASP A 1 2   ? 10.892  3.990   -10.203 1.00 0.00 ? 2   ASP A OD2  1  
ATOM 21    H H    . ASP A 1 2   ? 10.854  1.431   -11.819 1.00 0.00 ? 2   ASP A H    1  
ATOM 22    H HA   . ASP A 1 2   ? 8.270   0.660   -10.593 1.00 0.00 ? 2   ASP A HA   1  
ATOM 23    H HB2  . ASP A 1 2   ? 8.902   2.912   -9.267  1.00 0.00 ? 2   ASP A HB2  1  
ATOM 24    H HB3  . ASP A 1 2   ? 9.731   1.403   -8.893  1.00 0.00 ? 2   ASP A HB3  1  
ATOM 25    N N    . GLN A 1 3   ? 8.217   2.556   -12.926 1.00 0.00 ? 3   GLN A N    1  
ATOM 26    C CA   . GLN A 1 3   ? 7.436   3.539   -13.723 1.00 0.00 ? 3   GLN A CA   1  
ATOM 27    C C    . GLN A 1 3   ? 7.696   4.962   -13.259 1.00 0.00 ? 3   GLN A C    1  
ATOM 28    O O    . GLN A 1 3   ? 8.810   5.322   -12.933 1.00 0.00 ? 3   GLN A O    1  
ATOM 29    C CB   . GLN A 1 3   ? 5.942   3.229   -13.542 1.00 0.00 ? 3   GLN A CB   1  
ATOM 30    C CG   . GLN A 1 3   ? 5.734   1.715   -13.582 1.00 0.00 ? 3   GLN A CG   1  
ATOM 31    C CD   . GLN A 1 3   ? 6.204   1.177   -14.935 1.00 0.00 ? 3   GLN A CD   1  
ATOM 32    O OE1  . GLN A 1 3   ? 6.225   1.884   -15.924 1.00 0.00 ? 3   GLN A OE1  1  
ATOM 33    N NE2  . GLN A 1 3   ? 6.588   -0.068  -15.024 1.00 0.00 ? 3   GLN A NE2  1  
ATOM 34    H H    . GLN A 1 3   ? 8.832   1.938   -13.372 1.00 0.00 ? 3   GLN A H    1  
ATOM 35    H HA   . GLN A 1 3   ? 7.719   3.454   -14.767 1.00 0.00 ? 3   GLN A HA   1  
ATOM 36    H HB2  . GLN A 1 3   ? 5.602   3.618   -12.593 1.00 0.00 ? 3   GLN A HB2  1  
ATOM 37    H HB3  . GLN A 1 3   ? 5.376   3.694   -14.336 1.00 0.00 ? 3   GLN A HB3  1  
ATOM 38    H HG2  . GLN A 1 3   ? 6.305   1.247   -12.794 1.00 0.00 ? 3   GLN A HG2  1  
ATOM 39    H HG3  . GLN A 1 3   ? 4.688   1.484   -13.450 1.00 0.00 ? 3   GLN A HG3  1  
ATOM 40    H HE21 . GLN A 1 3   ? 6.574   -0.643  -14.231 1.00 0.00 ? 3   GLN A HE21 1  
ATOM 41    H HE22 . GLN A 1 3   ? 6.890   -0.428  -15.885 1.00 0.00 ? 3   GLN A HE22 1  
ATOM 42    N N    . LEU A 1 4   ? 6.658   5.744   -13.247 1.00 0.00 ? 4   LEU A N    1  
ATOM 43    C CA   . LEU A 1 4   ? 6.800   7.157   -12.810 1.00 0.00 ? 4   LEU A CA   1  
ATOM 44    C C    . LEU A 1 4   ? 7.345   7.241   -11.387 1.00 0.00 ? 4   LEU A C    1  
ATOM 45    O O    . LEU A 1 4   ? 7.792   6.259   -10.829 1.00 0.00 ? 4   LEU A O    1  
ATOM 46    C CB   . LEU A 1 4   ? 5.407   7.809   -12.840 1.00 0.00 ? 4   LEU A CB   1  
ATOM 47    C CG   . LEU A 1 4   ? 5.027   8.141   -14.289 1.00 0.00 ? 4   LEU A CG   1  
ATOM 48    C CD1  . LEU A 1 4   ? 5.372   6.956   -15.193 1.00 0.00 ? 4   LEU A CD1  1  
ATOM 49    C CD2  . LEU A 1 4   ? 3.523   8.401   -14.364 1.00 0.00 ? 4   LEU A CD2  1  
ATOM 50    H H    . LEU A 1 4   ? 5.786   5.401   -13.529 1.00 0.00 ? 4   LEU A H    1  
ATOM 51    H HA   . LEU A 1 4   ? 7.483   7.671   -13.484 1.00 0.00 ? 4   LEU A HA   1  
ATOM 52    H HB2  . LEU A 1 4   ? 4.681   7.129   -12.422 1.00 0.00 ? 4   LEU A HB2  1  
ATOM 53    H HB3  . LEU A 1 4   ? 5.421   8.716   -12.253 1.00 0.00 ? 4   LEU A HB3  1  
ATOM 54    H HG   . LEU A 1 4   ? 5.565   9.019   -14.617 1.00 0.00 ? 4   LEU A HG   1  
ATOM 55    H HD11 . LEU A 1 4   ? 4.907   6.059   -14.812 1.00 0.00 ? 4   LEU A HD11 1  
ATOM 56    H HD12 . LEU A 1 4   ? 5.011   7.146   -16.194 1.00 0.00 ? 4   LEU A HD12 1  
ATOM 57    H HD13 . LEU A 1 4   ? 6.442   6.819   -15.223 1.00 0.00 ? 4   LEU A HD13 1  
ATOM 58    H HD21 . LEU A 1 4   ? 2.988   7.563   -13.942 1.00 0.00 ? 4   LEU A HD21 1  
ATOM 59    H HD22 . LEU A 1 4   ? 3.281   9.295   -13.810 1.00 0.00 ? 4   LEU A HD22 1  
ATOM 60    H HD23 . LEU A 1 4   ? 3.227   8.530   -15.395 1.00 0.00 ? 4   LEU A HD23 1  
ATOM 61    N N    . THR A 1 5   ? 7.300   8.421   -10.825 1.00 0.00 ? 5   THR A N    1  
ATOM 62    C CA   . THR A 1 5   ? 7.812   8.587   -9.441  1.00 0.00 ? 5   THR A CA   1  
ATOM 63    C C    . THR A 1 5   ? 6.800   8.074   -8.419  1.00 0.00 ? 5   THR A C    1  
ATOM 64    O O    . THR A 1 5   ? 5.607   8.130   -8.639  1.00 0.00 ? 5   THR A O    1  
ATOM 65    C CB   . THR A 1 5   ? 8.057   10.078  -9.188  1.00 0.00 ? 5   THR A CB   1  
ATOM 66    O OG1  . THR A 1 5   ? 8.188   10.203  -7.787  1.00 0.00 ? 5   THR A OG1  1  
ATOM 67    C CG2  . THR A 1 5   ? 6.810   10.903  -9.533  1.00 0.00 ? 5   THR A CG2  1  
ATOM 68    H H    . THR A 1 5   ? 6.933   9.188   -11.312 1.00 0.00 ? 5   THR A H    1  
ATOM 69    H HA   . THR A 1 5   ? 8.738   8.021   -9.336  1.00 0.00 ? 5   THR A HA   1  
ATOM 70    H HB   . THR A 1 5   ? 8.952   10.433  -9.695  1.00 0.00 ? 5   THR A HB   1  
ATOM 71    H HG1  . THR A 1 5   ? 8.786   9.516   -7.482  1.00 0.00 ? 5   THR A HG1  1  
ATOM 72    H HG21 . THR A 1 5   ? 6.245   10.401  -10.303 1.00 0.00 ? 5   THR A HG21 1  
ATOM 73    H HG22 . THR A 1 5   ? 6.194   11.015  -8.654  1.00 0.00 ? 5   THR A HG22 1  
ATOM 74    H HG23 . THR A 1 5   ? 7.105   11.878  -9.888  1.00 0.00 ? 5   THR A HG23 1  
ATOM 75    N N    . GLU A 1 6   ? 7.303   7.587   -7.318  1.00 0.00 ? 6   GLU A N    1  
ATOM 76    C CA   . GLU A 1 6   ? 6.398   7.061   -6.262  1.00 0.00 ? 6   GLU A CA   1  
ATOM 77    C C    . GLU A 1 6   ? 5.240   8.013   -5.987  1.00 0.00 ? 6   GLU A C    1  
ATOM 78    O O    . GLU A 1 6   ? 4.119   7.588   -5.798  1.00 0.00 ? 6   GLU A O    1  
ATOM 79    C CB   . GLU A 1 6   ? 7.212   6.888   -4.967  1.00 0.00 ? 6   GLU A CB   1  
ATOM 80    C CG   . GLU A 1 6   ? 7.992   8.181   -4.675  1.00 0.00 ? 6   GLU A CG   1  
ATOM 81    C CD   . GLU A 1 6   ? 7.174   9.074   -3.737  1.00 0.00 ? 6   GLU A CD   1  
ATOM 82    O OE1  . GLU A 1 6   ? 6.565   8.509   -2.843  1.00 0.00 ? 6   GLU A OE1  1  
ATOM 83    O OE2  . GLU A 1 6   ? 7.207   10.270  -3.966  1.00 0.00 ? 6   GLU A OE2  1  
ATOM 84    H H    . GLU A 1 6   ? 8.274   7.571   -7.187  1.00 0.00 ? 6   GLU A H    1  
ATOM 85    H HA   . GLU A 1 6   ? 5.993   6.106   -6.591  1.00 0.00 ? 6   GLU A HA   1  
ATOM 86    H HB2  . GLU A 1 6   ? 6.544   6.674   -4.147  1.00 0.00 ? 6   GLU A HB2  1  
ATOM 87    H HB3  . GLU A 1 6   ? 7.904   6.067   -5.082  1.00 0.00 ? 6   GLU A HB3  1  
ATOM 88    H HG2  . GLU A 1 6   ? 8.934   7.940   -4.205  1.00 0.00 ? 6   GLU A HG2  1  
ATOM 89    H HG3  . GLU A 1 6   ? 8.181   8.712   -5.595  1.00 0.00 ? 6   GLU A HG3  1  
ATOM 90    N N    . GLU A 1 7   ? 5.526   9.282   -5.960  1.00 0.00 ? 7   GLU A N    1  
ATOM 91    C CA   . GLU A 1 7   ? 4.440   10.256  -5.696  1.00 0.00 ? 7   GLU A CA   1  
ATOM 92    C C    . GLU A 1 7   ? 3.351   10.139  -6.741  1.00 0.00 ? 7   GLU A C    1  
ATOM 93    O O    . GLU A 1 7   ? 2.232   9.782   -6.433  1.00 0.00 ? 7   GLU A O    1  
ATOM 94    C CB   . GLU A 1 7   ? 5.030   11.674  -5.741  1.00 0.00 ? 7   GLU A CB   1  
ATOM 95    C CG   . GLU A 1 7   ? 4.059   12.645  -5.071  1.00 0.00 ? 7   GLU A CG   1  
ATOM 96    C CD   . GLU A 1 7   ? 4.200   12.533  -3.551  1.00 0.00 ? 7   GLU A CD   1  
ATOM 97    O OE1  . GLU A 1 7   ? 5.037   13.251  -3.031  1.00 0.00 ? 7   GLU A OE1  1  
ATOM 98    O OE2  . GLU A 1 7   ? 3.463   11.735  -2.997  1.00 0.00 ? 7   GLU A OE2  1  
ATOM 99    H H    . GLU A 1 7   ? 6.444   9.589   -6.111  1.00 0.00 ? 7   GLU A H    1  
ATOM 100   H HA   . GLU A 1 7   ? 4.007   10.043  -4.724  1.00 0.00 ? 7   GLU A HA   1  
ATOM 101   H HB2  . GLU A 1 7   ? 5.976   11.690  -5.221  1.00 0.00 ? 7   GLU A HB2  1  
ATOM 102   H HB3  . GLU A 1 7   ? 5.188   11.969  -6.768  1.00 0.00 ? 7   GLU A HB3  1  
ATOM 103   H HG2  . GLU A 1 7   ? 4.284   13.657  -5.376  1.00 0.00 ? 7   GLU A HG2  1  
ATOM 104   H HG3  . GLU A 1 7   ? 3.045   12.403  -5.355  1.00 0.00 ? 7   GLU A HG3  1  
ATOM 105   N N    . GLN A 1 8   ? 3.683   10.446  -7.958  1.00 0.00 ? 8   GLN A N    1  
ATOM 106   C CA   . GLN A 1 8   ? 2.662   10.348  -9.020  1.00 0.00 ? 8   GLN A CA   1  
ATOM 107   C C    . GLN A 1 8   ? 1.979   8.999   -8.943  1.00 0.00 ? 8   GLN A C    1  
ATOM 108   O O    . GLN A 1 8   ? 0.805   8.874   -9.232  1.00 0.00 ? 8   GLN A O    1  
ATOM 109   C CB   . GLN A 1 8   ? 3.353   10.482  -10.383 1.00 0.00 ? 8   GLN A CB   1  
ATOM 110   C CG   . GLN A 1 8   ? 3.917   11.895  -10.519 1.00 0.00 ? 8   GLN A CG   1  
ATOM 111   C CD   . GLN A 1 8   ? 2.762   12.898  -10.550 1.00 0.00 ? 8   GLN A CD   1  
ATOM 112   O OE1  . GLN A 1 8   ? 2.579   13.680  -9.638  1.00 0.00 ? 8   GLN A OE1  1  
ATOM 113   N NE2  . GLN A 1 8   ? 1.959   12.909  -11.580 1.00 0.00 ? 8   GLN A NE2  1  
ATOM 114   H H    . GLN A 1 8   ? 4.594   10.735  -8.167  1.00 0.00 ? 8   GLN A H    1  
ATOM 115   H HA   . GLN A 1 8   ? 1.919   11.133  -8.875  1.00 0.00 ? 8   GLN A HA   1  
ATOM 116   H HB2  . GLN A 1 8   ? 4.152   9.762   -10.459 1.00 0.00 ? 8   GLN A HB2  1  
ATOM 117   H HB3  . GLN A 1 8   ? 2.636   10.300  -11.172 1.00 0.00 ? 8   GLN A HB3  1  
ATOM 118   H HG2  . GLN A 1 8   ? 4.559   12.114  -9.679  1.00 0.00 ? 8   GLN A HG2  1  
ATOM 119   H HG3  . GLN A 1 8   ? 4.485   11.974  -11.434 1.00 0.00 ? 8   GLN A HG3  1  
ATOM 120   H HE21 . GLN A 1 8   ? 2.102   12.280  -12.318 1.00 0.00 ? 8   GLN A HE21 1  
ATOM 121   H HE22 . GLN A 1 8   ? 1.214   13.544  -11.614 1.00 0.00 ? 8   GLN A HE22 1  
ATOM 122   N N    . ILE A 1 9   ? 2.732   8.004   -8.557  1.00 0.00 ? 9   ILE A N    1  
ATOM 123   C CA   . ILE A 1 9   ? 2.145   6.656   -8.453  1.00 0.00 ? 9   ILE A CA   1  
ATOM 124   C C    . ILE A 1 9   ? 1.193   6.594   -7.269  1.00 0.00 ? 9   ILE A C    1  
ATOM 125   O O    . ILE A 1 9   ? 0.222   5.864   -7.290  1.00 0.00 ? 9   ILE A O    1  
ATOM 126   C CB   . ILE A 1 9   ? 3.264   5.642   -8.247  1.00 0.00 ? 9   ILE A CB   1  
ATOM 127   C CG1  . ILE A 1 9   ? 3.900   5.305   -9.585  1.00 0.00 ? 9   ILE A CG1  1  
ATOM 128   C CG2  . ILE A 1 9   ? 2.654   4.362   -7.665  1.00 0.00 ? 9   ILE A CG2  1  
ATOM 129   C CD1  . ILE A 1 9   ? 5.386   5.010   -9.377  1.00 0.00 ? 9   ILE A CD1  1  
ATOM 130   H H    . ILE A 1 9   ? 3.679   8.152   -8.340  1.00 0.00 ? 9   ILE A H    1  
ATOM 131   H HA   . ILE A 1 9   ? 1.591   6.440   -9.364  1.00 0.00 ? 9   ILE A HA   1  
ATOM 132   H HB   . ILE A 1 9   ? 4.016   6.059   -7.581  1.00 0.00 ? 9   ILE A HB   1  
ATOM 133   H HG12 . ILE A 1 9   ? 3.414   4.438   -10.009 1.00 0.00 ? 9   ILE A HG12 1  
ATOM 134   H HG13 . ILE A 1 9   ? 3.787   6.139   -10.261 1.00 0.00 ? 9   ILE A HG13 1  
ATOM 135   H HG21 . ILE A 1 9   ? 1.776   4.090   -8.231  1.00 0.00 ? 9   ILE A HG21 1  
ATOM 136   H HG22 . ILE A 1 9   ? 3.372   3.560   -7.717  1.00 0.00 ? 9   ILE A HG22 1  
ATOM 137   H HG23 . ILE A 1 9   ? 2.376   4.527   -6.635  1.00 0.00 ? 9   ILE A HG23 1  
ATOM 138   H HD11 . ILE A 1 9   ? 5.832   5.785   -8.774  1.00 0.00 ? 9   ILE A HD11 1  
ATOM 139   H HD12 . ILE A 1 9   ? 5.503   4.058   -8.879  1.00 0.00 ? 9   ILE A HD12 1  
ATOM 140   H HD13 . ILE A 1 9   ? 5.883   4.973   -10.333 1.00 0.00 ? 9   ILE A HD13 1  
ATOM 141   N N    . ALA A 1 10  ? 1.488   7.364   -6.245  1.00 0.00 ? 10  ALA A N    1  
ATOM 142   C CA   . ALA A 1 10  ? 0.599   7.349   -5.062  1.00 0.00 ? 10  ALA A CA   1  
ATOM 143   C C    . ALA A 1 10  ? -0.757  7.934   -5.423  1.00 0.00 ? 10  ALA A C    1  
ATOM 144   O O    . ALA A 1 10  ? -1.784  7.358   -5.123  1.00 0.00 ? 10  ALA A O    1  
ATOM 145   C CB   . ALA A 1 10  ? 1.236   8.205   -3.956  1.00 0.00 ? 10  ALA A CB   1  
ATOM 146   H H    . ALA A 1 10  ? 2.289   7.943   -6.261  1.00 0.00 ? 10  ALA A H    1  
ATOM 147   H HA   . ALA A 1 10  ? 0.465   6.318   -4.732  1.00 0.00 ? 10  ALA A HA   1  
ATOM 148   H HB1  . ALA A 1 10  ? 2.246   7.869   -3.773  1.00 0.00 ? 10  ALA A HB1  1  
ATOM 149   H HB2  . ALA A 1 10  ? 1.255   9.241   -4.261  1.00 0.00 ? 10  ALA A HB2  1  
ATOM 150   H HB3  . ALA A 1 10  ? 0.661   8.112   -3.046  1.00 0.00 ? 10  ALA A HB3  1  
ATOM 151   N N    . GLU A 1 11  ? -0.739  9.073   -6.064  1.00 0.00 ? 11  GLU A N    1  
ATOM 152   C CA   . GLU A 1 11  ? -2.021  9.704   -6.451  1.00 0.00 ? 11  GLU A CA   1  
ATOM 153   C C    . GLU A 1 11  ? -2.725  8.845   -7.487  1.00 0.00 ? 11  GLU A C    1  
ATOM 154   O O    . GLU A 1 11  ? -3.938  8.842   -7.582  1.00 0.00 ? 11  GLU A O    1  
ATOM 155   C CB   . GLU A 1 11  ? -1.725  11.083  -7.060  1.00 0.00 ? 11  GLU A CB   1  
ATOM 156   C CG   . GLU A 1 11  ? -3.039  11.852  -7.224  1.00 0.00 ? 11  GLU A CG   1  
ATOM 157   C CD   . GLU A 1 11  ? -2.754  13.354  -7.195  1.00 0.00 ? 11  GLU A CD   1  
ATOM 158   O OE1  . GLU A 1 11  ? -1.871  13.753  -7.936  1.00 0.00 ? 11  GLU A OE1  1  
ATOM 159   O OE2  . GLU A 1 11  ? -3.437  14.020  -6.433  1.00 0.00 ? 11  GLU A OE2  1  
ATOM 160   H H    . GLU A 1 11  ? 0.115   9.505   -6.287  1.00 0.00 ? 11  GLU A H    1  
ATOM 161   H HA   . GLU A 1 11  ? -2.658  9.793   -5.571  1.00 0.00 ? 11  GLU A HA   1  
ATOM 162   H HB2  . GLU A 1 11  ? -1.062  11.633  -6.408  1.00 0.00 ? 11  GLU A HB2  1  
ATOM 163   H HB3  . GLU A 1 11  ? -1.253  10.961  -8.024  1.00 0.00 ? 11  GLU A HB3  1  
ATOM 164   H HG2  . GLU A 1 11  ? -3.498  11.593  -8.167  1.00 0.00 ? 11  GLU A HG2  1  
ATOM 165   H HG3  . GLU A 1 11  ? -3.712  11.600  -6.418  1.00 0.00 ? 11  GLU A HG3  1  
ATOM 166   N N    . PHE A 1 12  ? -1.946  8.123   -8.248  1.00 0.00 ? 12  PHE A N    1  
ATOM 167   C CA   . PHE A 1 12  ? -2.544  7.254   -9.284  1.00 0.00 ? 12  PHE A CA   1  
ATOM 168   C C    . PHE A 1 12  ? -3.314  6.126   -8.629  1.00 0.00 ? 12  PHE A C    1  
ATOM 169   O O    . PHE A 1 12  ? -4.450  5.872   -8.967  1.00 0.00 ? 12  PHE A O    1  
ATOM 170   C CB   . PHE A 1 12  ? -1.415  6.654   -10.131 1.00 0.00 ? 12  PHE A CB   1  
ATOM 171   C CG   . PHE A 1 12  ? -0.969  7.673   -11.184 1.00 0.00 ? 12  PHE A CG   1  
ATOM 172   C CD1  . PHE A 1 12  ? -1.201  9.029   -11.000 1.00 0.00 ? 12  PHE A CD1  1  
ATOM 173   C CD2  . PHE A 1 12  ? -0.345  7.251   -12.344 1.00 0.00 ? 12  PHE A CD2  1  
ATOM 174   C CE1  . PHE A 1 12  ? -0.817  9.938   -11.963 1.00 0.00 ? 12  PHE A CE1  1  
ATOM 175   C CE2  . PHE A 1 12  ? 0.038   8.165   -13.303 1.00 0.00 ? 12  PHE A CE2  1  
ATOM 176   C CZ   . PHE A 1 12  ? -0.201  9.507   -13.111 1.00 0.00 ? 12  PHE A CZ   1  
ATOM 177   H H    . PHE A 1 12  ? -0.973  8.156   -8.133  1.00 0.00 ? 12  PHE A H    1  
ATOM 178   H HA   . PHE A 1 12  ? -3.227  7.845   -9.900  1.00 0.00 ? 12  PHE A HA   1  
ATOM 179   H HB2  . PHE A 1 12  ? -0.579  6.404   -9.500  1.00 0.00 ? 12  PHE A HB2  1  
ATOM 180   H HB3  . PHE A 1 12  ? -1.765  5.761   -10.627 1.00 0.00 ? 12  PHE A HB3  1  
ATOM 181   H HD1  . PHE A 1 12  ? -1.673  9.377   -10.096 1.00 0.00 ? 12  PHE A HD1  1  
ATOM 182   H HD2  . PHE A 1 12  ? -0.146  6.198   -12.496 1.00 0.00 ? 12  PHE A HD2  1  
ATOM 183   H HE1  . PHE A 1 12  ? -1.003  10.991  -11.815 1.00 0.00 ? 12  PHE A HE1  1  
ATOM 184   H HE2  . PHE A 1 12  ? 0.529   7.830   -14.203 1.00 0.00 ? 12  PHE A HE2  1  
ATOM 185   H HZ   . PHE A 1 12  ? 0.086   10.217  -13.866 1.00 0.00 ? 12  PHE A HZ   1  
ATOM 186   N N    . LYS A 1 13  ? -2.680  5.462   -7.699  1.00 0.00 ? 13  LYS A N    1  
ATOM 187   C CA   . LYS A 1 13  ? -3.370  4.351   -7.018  1.00 0.00 ? 13  LYS A CA   1  
ATOM 188   C C    . LYS A 1 13  ? -4.691  4.847   -6.463  1.00 0.00 ? 13  LYS A C    1  
ATOM 189   O O    . LYS A 1 13  ? -5.703  4.184   -6.574  1.00 0.00 ? 13  LYS A O    1  
ATOM 190   C CB   . LYS A 1 13  ? -2.485  3.856   -5.869  1.00 0.00 ? 13  LYS A CB   1  
ATOM 191   C CG   . LYS A 1 13  ? -3.189  2.713   -5.139  1.00 0.00 ? 13  LYS A CG   1  
ATOM 192   C CD   . LYS A 1 13  ? -2.146  1.901   -4.367  1.00 0.00 ? 13  LYS A CD   1  
ATOM 193   C CE   . LYS A 1 13  ? -2.811  0.657   -3.775  1.00 0.00 ? 13  LYS A CE   1  
ATOM 194   N NZ   . LYS A 1 13  ? -3.375  0.954   -2.428  1.00 0.00 ? 13  LYS A NZ   1  
ATOM 195   H H    . LYS A 1 13  ? -1.758  5.701   -7.452  1.00 0.00 ? 13  LYS A H    1  
ATOM 196   H HA   . LYS A 1 13  ? -3.562  3.555   -7.737  1.00 0.00 ? 13  LYS A HA   1  
ATOM 197   H HB2  . LYS A 1 13  ? -1.544  3.504   -6.266  1.00 0.00 ? 13  LYS A HB2  1  
ATOM 198   H HB3  . LYS A 1 13  ? -2.298  4.664   -5.182  1.00 0.00 ? 13  LYS A HB3  1  
ATOM 199   H HG2  . LYS A 1 13  ? -3.919  3.115   -4.452  1.00 0.00 ? 13  LYS A HG2  1  
ATOM 200   H HG3  . LYS A 1 13  ? -3.689  2.078   -5.855  1.00 0.00 ? 13  LYS A HG3  1  
ATOM 201   H HD2  . LYS A 1 13  ? -1.352  1.603   -5.036  1.00 0.00 ? 13  LYS A HD2  1  
ATOM 202   H HD3  . LYS A 1 13  ? -1.731  2.504   -3.573  1.00 0.00 ? 13  LYS A HD3  1  
ATOM 203   H HE2  . LYS A 1 13  ? -3.607  0.327   -4.426  1.00 0.00 ? 13  LYS A HE2  1  
ATOM 204   H HE3  . LYS A 1 13  ? -2.081  -0.134  -3.683  1.00 0.00 ? 13  LYS A HE3  1  
ATOM 205   H HZ1  . LYS A 1 13  ? -3.051  1.892   -2.115  1.00 0.00 ? 13  LYS A HZ1  1  
ATOM 206   H HZ2  . LYS A 1 13  ? -4.414  0.946   -2.478  1.00 0.00 ? 13  LYS A HZ2  1  
ATOM 207   H HZ3  . LYS A 1 13  ? -3.055  0.234   -1.750  1.00 0.00 ? 13  LYS A HZ3  1  
ATOM 208   N N    . GLU A 1 14  ? -4.663  6.016   -5.869  1.00 0.00 ? 14  GLU A N    1  
ATOM 209   C CA   . GLU A 1 14  ? -5.915  6.562   -5.310  1.00 0.00 ? 14  GLU A CA   1  
ATOM 210   C C    . GLU A 1 14  ? -6.988  6.498   -6.375  1.00 0.00 ? 14  GLU A C    1  
ATOM 211   O O    . GLU A 1 14  ? -8.068  5.992   -6.149  1.00 0.00 ? 14  GLU A O    1  
ATOM 212   C CB   . GLU A 1 14  ? -5.679  8.028   -4.915  1.00 0.00 ? 14  GLU A CB   1  
ATOM 213   C CG   . GLU A 1 14  ? -6.922  8.566   -4.202  1.00 0.00 ? 14  GLU A CG   1  
ATOM 214   C CD   . GLU A 1 14  ? -7.222  7.697   -2.977  1.00 0.00 ? 14  GLU A CD   1  
ATOM 215   O OE1  . GLU A 1 14  ? -6.533  7.896   -1.991  1.00 0.00 ? 14  GLU A OE1  1  
ATOM 216   O OE2  . GLU A 1 14  ? -8.124  6.884   -3.099  1.00 0.00 ? 14  GLU A OE2  1  
ATOM 217   H H    . GLU A 1 14  ? -3.824  6.520   -5.797  1.00 0.00 ? 14  GLU A H    1  
ATOM 218   H HA   . GLU A 1 14  ? -6.219  5.964   -4.454  1.00 0.00 ? 14  GLU A HA   1  
ATOM 219   H HB2  . GLU A 1 14  ? -4.826  8.092   -4.256  1.00 0.00 ? 14  GLU A HB2  1  
ATOM 220   H HB3  . GLU A 1 14  ? -5.486  8.615   -5.801  1.00 0.00 ? 14  GLU A HB3  1  
ATOM 221   H HG2  . GLU A 1 14  ? -6.749  9.583   -3.883  1.00 0.00 ? 14  GLU A HG2  1  
ATOM 222   H HG3  . GLU A 1 14  ? -7.769  8.542   -4.873  1.00 0.00 ? 14  GLU A HG3  1  
ATOM 223   N N    . ALA A 1 15  ? -6.664  7.018   -7.529  1.00 0.00 ? 15  ALA A N    1  
ATOM 224   C CA   . ALA A 1 15  ? -7.644  6.998   -8.633  1.00 0.00 ? 15  ALA A CA   1  
ATOM 225   C C    . ALA A 1 15  ? -8.023  5.561   -8.915  1.00 0.00 ? 15  ALA A C    1  
ATOM 226   O O    . ALA A 1 15  ? -9.185  5.224   -9.049  1.00 0.00 ? 15  ALA A O    1  
ATOM 227   C CB   . ALA A 1 15  ? -6.977  7.590   -9.889  1.00 0.00 ? 15  ALA A CB   1  
ATOM 228   H H    . ALA A 1 15  ? -5.780  7.423   -7.658  1.00 0.00 ? 15  ALA A H    1  
ATOM 229   H HA   . ALA A 1 15  ? -8.531  7.559   -8.347  1.00 0.00 ? 15  ALA A HA   1  
ATOM 230   H HB1  . ALA A 1 15  ? -6.566  8.563   -9.661  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 231   H HB2  . ALA A 1 15  ? -6.181  6.938   -10.222 1.00 0.00 ? 15  ALA A HB2  1  
ATOM 232   H HB3  . ALA A 1 15  ? -7.707  7.689   -10.679 1.00 0.00 ? 15  ALA A HB3  1  
ATOM 233   N N    . PHE A 1 16  ? -7.020  4.736   -8.994  1.00 0.00 ? 16  PHE A N    1  
ATOM 234   C CA   . PHE A 1 16  ? -7.261  3.310   -9.264  1.00 0.00 ? 16  PHE A CA   1  
ATOM 235   C C    . PHE A 1 16  ? -8.216  2.730   -8.230  1.00 0.00 ? 16  PHE A C    1  
ATOM 236   O O    . PHE A 1 16  ? -8.872  1.739   -8.476  1.00 0.00 ? 16  PHE A O    1  
ATOM 237   C CB   . PHE A 1 16  ? -5.917  2.575   -9.167  1.00 0.00 ? 16  PHE A CB   1  
ATOM 238   C CG   . PHE A 1 16  ? -5.961  1.323   -10.033 1.00 0.00 ? 16  PHE A CG   1  
ATOM 239   C CD1  . PHE A 1 16  ? -6.228  1.417   -11.386 1.00 0.00 ? 16  PHE A CD1  1  
ATOM 240   C CD2  . PHE A 1 16  ? -5.742  0.079   -9.475  1.00 0.00 ? 16  PHE A CD2  1  
ATOM 241   C CE1  . PHE A 1 16  ? -6.276  0.285   -12.167 1.00 0.00 ? 16  PHE A CE1  1  
ATOM 242   C CE2  . PHE A 1 16  ? -5.789  -1.054  -10.256 1.00 0.00 ? 16  PHE A CE2  1  
ATOM 243   C CZ   . PHE A 1 16  ? -6.058  -0.952  -11.605 1.00 0.00 ? 16  PHE A CZ   1  
ATOM 244   H H    . PHE A 1 16  ? -6.104  5.067   -8.882  1.00 0.00 ? 16  PHE A H    1  
ATOM 245   H HA   . PHE A 1 16  ? -7.698  3.200   -10.257 1.00 0.00 ? 16  PHE A HA   1  
ATOM 246   H HB2  . PHE A 1 16  ? -5.123  3.221   -9.512  1.00 0.00 ? 16  PHE A HB2  1  
ATOM 247   H HB3  . PHE A 1 16  ? -5.727  2.293   -8.142  1.00 0.00 ? 16  PHE A HB3  1  
ATOM 248   H HD1  . PHE A 1 16  ? -6.399  2.385   -11.833 1.00 0.00 ? 16  PHE A HD1  1  
ATOM 249   H HD2  . PHE A 1 16  ? -5.529  -0.006  -8.419  1.00 0.00 ? 16  PHE A HD2  1  
ATOM 250   H HE1  . PHE A 1 16  ? -6.473  0.370   -13.222 1.00 0.00 ? 16  PHE A HE1  1  
ATOM 251   H HE2  . PHE A 1 16  ? -5.597  -2.019  -9.813  1.00 0.00 ? 16  PHE A HE2  1  
ATOM 252   H HZ   . PHE A 1 16  ? -6.114  -1.843  -12.217 1.00 0.00 ? 16  PHE A HZ   1  
ATOM 253   N N    . SER A 1 17  ? -8.270  3.353   -7.084  1.00 0.00 ? 17  SER A N    1  
ATOM 254   C CA   . SER A 1 17  ? -9.179  2.848   -6.032  1.00 0.00 ? 17  SER A CA   1  
ATOM 255   C C    . SER A 1 17  ? -10.575 3.391   -6.250  1.00 0.00 ? 17  SER A C    1  
ATOM 256   O O    . SER A 1 17  ? -11.537 2.649   -6.224  1.00 0.00 ? 17  SER A O    1  
ATOM 257   C CB   . SER A 1 17  ? -8.667  3.312   -4.666  1.00 0.00 ? 17  SER A CB   1  
ATOM 258   O OG   . SER A 1 17  ? -9.490  2.622   -3.737  1.00 0.00 ? 17  SER A OG   1  
ATOM 259   H H    . SER A 1 17  ? -7.717  4.144   -6.922  1.00 0.00 ? 17  SER A H    1  
ATOM 260   H HA   . SER A 1 17  ? -9.210  1.764   -6.087  1.00 0.00 ? 17  SER A HA   1  
ATOM 261   H HB2  . SER A 1 17  ? -7.634  3.032   -4.530  1.00 0.00 ? 17  SER A HB2  1  
ATOM 262   H HB3  . SER A 1 17  ? -8.789  4.375   -4.554  1.00 0.00 ? 17  SER A HB3  1  
ATOM 263   H HG   . SER A 1 17  ? -10.387 2.622   -4.077  1.00 0.00 ? 17  SER A HG   1  
ATOM 264   N N    . LEU A 1 18  ? -10.671 4.687   -6.453  1.00 0.00 ? 18  LEU A N    1  
ATOM 265   C CA   . LEU A 1 18  ? -12.012 5.281   -6.676  1.00 0.00 ? 18  LEU A CA   1  
ATOM 266   C C    . LEU A 1 18  ? -12.758 4.419   -7.661  1.00 0.00 ? 18  LEU A C    1  
ATOM 267   O O    . LEU A 1 18  ? -13.973 4.351   -7.654  1.00 0.00 ? 18  LEU A O    1  
ATOM 268   C CB   . LEU A 1 18  ? -11.842 6.687   -7.270  1.00 0.00 ? 18  LEU A CB   1  
ATOM 269   C CG   . LEU A 1 18  ? -11.349 7.632   -6.176  1.00 0.00 ? 18  LEU A CG   1  
ATOM 270   C CD1  . LEU A 1 18  ? -10.926 8.959   -6.811  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 271   C CD2  . LEU A 1 18  ? -12.487 7.889   -5.185  1.00 0.00 ? 18  LEU A CD2  1  
ATOM 272   H H    . LEU A 1 18  ? -9.870  5.249   -6.456  1.00 0.00 ? 18  LEU A H    1  
ATOM 273   H HA   . LEU A 1 18  ? -12.556 5.310   -5.734  1.00 0.00 ? 18  LEU A HA   1  
ATOM 274   H HB2  . LEU A 1 18  ? -11.123 6.659   -8.075  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 275   H HB3  . LEU A 1 18  ? -12.788 7.038   -7.652  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 276   H HG   . LEU A 1 18  ? -10.511 7.188   -5.664  1.00 0.00 ? 18  LEU A HG   1  
ATOM 277   H HD11 . LEU A 1 18  ? -10.309 8.768   -7.678  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 278   H HD12 . LEU A 1 18  ? -11.802 9.514   -7.113  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 279   H HD13 . LEU A 1 18  ? -10.364 9.542   -6.096  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 280   H HD21 . LEU A 1 18  ? -13.436 7.826   -5.696  1.00 0.00 ? 18  LEU A HD21 1  
ATOM 281   H HD22 . LEU A 1 18  ? -12.458 7.149   -4.397  1.00 0.00 ? 18  LEU A HD22 1  
ATOM 282   H HD23 . LEU A 1 18  ? -12.380 8.872   -4.753  1.00 0.00 ? 18  LEU A HD23 1  
ATOM 283   N N    . PHE A 1 19  ? -11.992 3.772   -8.495  1.00 0.00 ? 19  PHE A N    1  
ATOM 284   C CA   . PHE A 1 19  ? -12.568 2.885   -9.514  1.00 0.00 ? 19  PHE A CA   1  
ATOM 285   C C    . PHE A 1 19  ? -12.061 1.478   -9.274  1.00 0.00 ? 19  PHE A C    1  
ATOM 286   O O    . PHE A 1 19  ? -10.988 1.133   -9.691  1.00 0.00 ? 19  PHE A O    1  
ATOM 287   C CB   . PHE A 1 19  ? -12.095 3.356   -10.897 1.00 0.00 ? 19  PHE A CB   1  
ATOM 288   C CG   . PHE A 1 19  ? -12.627 4.763   -11.159 1.00 0.00 ? 19  PHE A CG   1  
ATOM 289   C CD1  . PHE A 1 19  ? -13.945 4.956   -11.533 1.00 0.00 ? 19  PHE A CD1  1  
ATOM 290   C CD2  . PHE A 1 19  ? -11.800 5.865   -11.021 1.00 0.00 ? 19  PHE A CD2  1  
ATOM 291   C CE1  . PHE A 1 19  ? -14.428 6.228   -11.765 1.00 0.00 ? 19  PHE A CE1  1  
ATOM 292   C CE2  . PHE A 1 19  ? -12.286 7.136   -11.254 1.00 0.00 ? 19  PHE A CE2  1  
ATOM 293   C CZ   . PHE A 1 19  ? -13.598 7.316   -11.625 1.00 0.00 ? 19  PHE A CZ   1  
ATOM 294   H H    . PHE A 1 19  ? -11.022 3.883   -8.443  1.00 0.00 ? 19  PHE A H    1  
ATOM 295   H HA   . PHE A 1 19  ? -13.651 2.897   -9.441  1.00 0.00 ? 19  PHE A HA   1  
ATOM 296   H HB2  . PHE A 1 19  ? -11.015 3.371   -10.929 1.00 0.00 ? 19  PHE A HB2  1  
ATOM 297   H HB3  . PHE A 1 19  ? -12.466 2.687   -11.659 1.00 0.00 ? 19  PHE A HB3  1  
ATOM 298   H HD1  . PHE A 1 19  ? -14.599 4.104   -11.647 1.00 0.00 ? 19  PHE A HD1  1  
ATOM 299   H HD2  . PHE A 1 19  ? -10.767 5.729   -10.732 1.00 0.00 ? 19  PHE A HD2  1  
ATOM 300   H HE1  . PHE A 1 19  ? -15.458 6.369   -12.055 1.00 0.00 ? 19  PHE A HE1  1  
ATOM 301   H HE2  . PHE A 1 19  ? -11.634 7.990   -11.145 1.00 0.00 ? 19  PHE A HE2  1  
ATOM 302   H HZ   . PHE A 1 19  ? -13.978 8.310   -11.805 1.00 0.00 ? 19  PHE A HZ   1  
ATOM 303   N N    . ASP A 1 20  ? -12.829 0.704   -8.580  1.00 0.00 ? 20  ASP A N    1  
ATOM 304   C CA   . ASP A 1 20  ? -12.401 -0.687  -8.303  1.00 0.00 ? 20  ASP A CA   1  
ATOM 305   C C    . ASP A 1 20  ? -13.608 -1.618  -8.218  1.00 0.00 ? 20  ASP A C    1  
ATOM 306   O O    . ASP A 1 20  ? -14.336 -1.611  -7.244  1.00 0.00 ? 20  ASP A O    1  
ATOM 307   C CB   . ASP A 1 20  ? -11.653 -0.694  -6.951  1.00 0.00 ? 20  ASP A CB   1  
ATOM 308   C CG   . ASP A 1 20  ? -11.765 -2.080  -6.313  1.00 0.00 ? 20  ASP A CG   1  
ATOM 309   O OD1  . ASP A 1 20  ? -11.714 -3.033  -7.073  1.00 0.00 ? 20  ASP A OD1  1  
ATOM 310   O OD2  . ASP A 1 20  ? -11.895 -2.107  -5.100  1.00 0.00 ? 20  ASP A OD2  1  
ATOM 311   H H    . ASP A 1 20  ? -13.676 1.035   -8.244  1.00 0.00 ? 20  ASP A H    1  
ATOM 312   H HA   . ASP A 1 20  ? -11.749 -1.024  -9.107  1.00 0.00 ? 20  ASP A HA   1  
ATOM 313   H HB2  . ASP A 1 20  ? -10.609 -0.456  -7.109  1.00 0.00 ? 20  ASP A HB2  1  
ATOM 314   H HB3  . ASP A 1 20  ? -12.087 0.043   -6.288  1.00 0.00 ? 20  ASP A HB3  1  
ATOM 315   N N    . LYS A 1 21  ? -13.796 -2.405  -9.247  1.00 0.00 ? 21  LYS A N    1  
ATOM 316   C CA   . LYS A 1 21  ? -14.947 -3.346  -9.254  1.00 0.00 ? 21  LYS A CA   1  
ATOM 317   C C    . LYS A 1 21  ? -14.592 -4.662  -8.573  1.00 0.00 ? 21  LYS A C    1  
ATOM 318   O O    . LYS A 1 21  ? -15.274 -5.099  -7.667  1.00 0.00 ? 21  LYS A O    1  
ATOM 319   C CB   . LYS A 1 21  ? -15.315 -3.638  -10.711 1.00 0.00 ? 21  LYS A CB   1  
ATOM 320   C CG   . LYS A 1 21  ? -16.726 -4.224  -10.762 1.00 0.00 ? 21  LYS A CG   1  
ATOM 321   C CD   . LYS A 1 21  ? -17.051 -4.605  -12.203 1.00 0.00 ? 21  LYS A CD   1  
ATOM 322   C CE   . LYS A 1 21  ? -18.423 -5.281  -12.249 1.00 0.00 ? 21  LYS A CE   1  
ATOM 323   N NZ   . LYS A 1 21  ? -19.351 -4.648  -11.271 1.00 0.00 ? 21  LYS A NZ   1  
ATOM 324   H H    . LYS A 1 21  ? -13.182 -2.373  -10.009 1.00 0.00 ? 21  LYS A H    1  
ATOM 325   H HA   . LYS A 1 21  ? -15.780 -2.891  -8.731  1.00 0.00 ? 21  LYS A HA   1  
ATOM 326   H HB2  . LYS A 1 21  ? -15.280 -2.724  -11.285 1.00 0.00 ? 21  LYS A HB2  1  
ATOM 327   H HB3  . LYS A 1 21  ? -14.613 -4.345  -11.127 1.00 0.00 ? 21  LYS A HB3  1  
ATOM 328   H HG2  . LYS A 1 21  ? -16.778 -5.102  -10.134 1.00 0.00 ? 21  LYS A HG2  1  
ATOM 329   H HG3  . LYS A 1 21  ? -17.437 -3.492  -10.409 1.00 0.00 ? 21  LYS A HG3  1  
ATOM 330   H HD2  . LYS A 1 21  ? -17.064 -3.716  -12.817 1.00 0.00 ? 21  LYS A HD2  1  
ATOM 331   H HD3  . LYS A 1 21  ? -16.299 -5.282  -12.575 1.00 0.00 ? 21  LYS A HD3  1  
ATOM 332   H HE2  . LYS A 1 21  ? -18.838 -5.189  -13.242 1.00 0.00 ? 21  LYS A HE2  1  
ATOM 333   H HE3  . LYS A 1 21  ? -18.317 -6.328  -12.008 1.00 0.00 ? 21  LYS A HE3  1  
ATOM 334   H HZ1  . LYS A 1 21  ? -19.170 -3.625  -11.233 1.00 0.00 ? 21  LYS A HZ1  1  
ATOM 335   H HZ2  . LYS A 1 21  ? -20.335 -4.816  -11.568 1.00 0.00 ? 21  LYS A HZ2  1  
ATOM 336   H HZ3  . LYS A 1 21  ? -19.199 -5.063  -10.329 1.00 0.00 ? 21  LYS A HZ3  1  
ATOM 337   N N    . ASP A 1 22  ? -13.534 -5.272  -9.027  1.00 0.00 ? 22  ASP A N    1  
ATOM 338   C CA   . ASP A 1 22  ? -13.111 -6.563  -8.425  1.00 0.00 ? 22  ASP A CA   1  
ATOM 339   C C    . ASP A 1 22  ? -12.968 -6.445  -6.914  1.00 0.00 ? 22  ASP A C    1  
ATOM 340   O O    . ASP A 1 22  ? -12.630 -7.402  -6.244  1.00 0.00 ? 22  ASP A O    1  
ATOM 341   C CB   . ASP A 1 22  ? -11.749 -6.946  -9.018  1.00 0.00 ? 22  ASP A CB   1  
ATOM 342   C CG   . ASP A 1 22  ? -11.947 -8.029  -10.078 1.00 0.00 ? 22  ASP A CG   1  
ATOM 343   O OD1  . ASP A 1 22  ? -12.041 -9.174  -9.669  1.00 0.00 ? 22  ASP A OD1  1  
ATOM 344   O OD2  . ASP A 1 22  ? -11.993 -7.651  -11.236 1.00 0.00 ? 22  ASP A OD2  1  
ATOM 345   H H    . ASP A 1 22  ? -13.021 -4.880  -9.763  1.00 0.00 ? 22  ASP A H    1  
ATOM 346   H HA   . ASP A 1 22  ? -13.859 -7.322  -8.652  1.00 0.00 ? 22  ASP A HA   1  
ATOM 347   H HB2  . ASP A 1 22  ? -11.292 -6.080  -9.474  1.00 0.00 ? 22  ASP A HB2  1  
ATOM 348   H HB3  . ASP A 1 22  ? -11.103 -7.322  -8.239  1.00 0.00 ? 22  ASP A HB3  1  
ATOM 349   N N    . GLY A 1 23  ? -13.225 -5.274  -6.401  1.00 0.00 ? 23  GLY A N    1  
ATOM 350   C CA   . GLY A 1 23  ? -13.107 -5.082  -4.930  1.00 0.00 ? 23  GLY A CA   1  
ATOM 351   C C    . GLY A 1 23  ? -11.642 -5.167  -4.507  1.00 0.00 ? 23  GLY A C    1  
ATOM 352   O O    . GLY A 1 23  ? -11.278 -4.741  -3.428  1.00 0.00 ? 23  GLY A O    1  
ATOM 353   H H    . GLY A 1 23  ? -13.491 -4.529  -6.977  1.00 0.00 ? 23  GLY A H    1  
ATOM 354   H HA2  . GLY A 1 23  ? -13.501 -4.113  -4.664  1.00 0.00 ? 23  GLY A HA2  1  
ATOM 355   H HA3  . GLY A 1 23  ? -13.671 -5.850  -4.422  1.00 0.00 ? 23  GLY A HA3  1  
ATOM 356   N N    . ASP A 1 24  ? -10.830 -5.714  -5.366  1.00 0.00 ? 24  ASP A N    1  
ATOM 357   C CA   . ASP A 1 24  ? -9.393  -5.834  -5.032  1.00 0.00 ? 24  ASP A CA   1  
ATOM 358   C C    . ASP A 1 24  ? -8.664  -4.532  -5.322  1.00 0.00 ? 24  ASP A C    1  
ATOM 359   O O    . ASP A 1 24  ? -7.866  -4.076  -4.527  1.00 0.00 ? 24  ASP A O    1  
ATOM 360   C CB   . ASP A 1 24  ? -8.785  -6.948  -5.896  1.00 0.00 ? 24  ASP A CB   1  
ATOM 361   C CG   . ASP A 1 24  ? -9.440  -8.282  -5.533  1.00 0.00 ? 24  ASP A CG   1  
ATOM 362   O OD1  . ASP A 1 24  ? -10.555 -8.222  -5.041  1.00 0.00 ? 24  ASP A OD1  1  
ATOM 363   O OD2  . ASP A 1 24  ? -8.787  -9.286  -5.767  1.00 0.00 ? 24  ASP A OD2  1  
ATOM 364   H H    . ASP A 1 24  ? -11.167 -6.042  -6.227  1.00 0.00 ? 24  ASP A H    1  
ATOM 365   H HA   . ASP A 1 24  ? -9.295  -6.068  -3.973  1.00 0.00 ? 24  ASP A HA   1  
ATOM 366   H HB2  . ASP A 1 24  ? -8.958  -6.737  -6.941  1.00 0.00 ? 24  ASP A HB2  1  
ATOM 367   H HB3  . ASP A 1 24  ? -7.722  -7.011  -5.715  1.00 0.00 ? 24  ASP A HB3  1  
ATOM 368   N N    . GLY A 1 25  ? -8.947  -3.952  -6.457  1.00 0.00 ? 25  GLY A N    1  
ATOM 369   C CA   . GLY A 1 25  ? -8.272  -2.672  -6.809  1.00 0.00 ? 25  GLY A CA   1  
ATOM 370   C C    . GLY A 1 25  ? -8.151  -2.519  -8.328  1.00 0.00 ? 25  GLY A C    1  
ATOM 371   O O    . GLY A 1 25  ? -7.948  -1.431  -8.828  1.00 0.00 ? 25  GLY A O    1  
ATOM 372   H H    . GLY A 1 25  ? -9.598  -4.354  -7.071  1.00 0.00 ? 25  GLY A H    1  
ATOM 373   H HA2  . GLY A 1 25  ? -8.845  -1.847  -6.413  1.00 0.00 ? 25  GLY A HA2  1  
ATOM 374   H HA3  . GLY A 1 25  ? -7.284  -2.661  -6.372  1.00 0.00 ? 25  GLY A HA3  1  
ATOM 375   N N    . THR A 1 26  ? -8.281  -3.611  -9.034  1.00 0.00 ? 26  THR A N    1  
ATOM 376   C CA   . THR A 1 26  ? -8.174  -3.533  -10.512 1.00 0.00 ? 26  THR A CA   1  
ATOM 377   C C    . THR A 1 26  ? -9.432  -2.925  -11.123 1.00 0.00 ? 26  THR A C    1  
ATOM 378   O O    . THR A 1 26  ? -10.431 -2.755  -10.452 1.00 0.00 ? 26  THR A O    1  
ATOM 379   C CB   . THR A 1 26  ? -7.983  -4.943  -11.063 1.00 0.00 ? 26  THR A CB   1  
ATOM 380   O OG1  . THR A 1 26  ? -9.260  -5.544  -11.013 1.00 0.00 ? 26  THR A OG1  1  
ATOM 381   C CG2  . THR A 1 26  ? -7.118  -5.785  -10.115 1.00 0.00 ? 26  THR A CG2  1  
ATOM 382   H H    . THR A 1 26  ? -8.447  -4.471  -8.594  1.00 0.00 ? 26  THR A H    1  
ATOM 383   H HA   . THR A 1 26  ? -7.326  -2.908  -10.768 1.00 0.00 ? 26  THR A HA   1  
ATOM 384   H HB   . THR A 1 26  ? -7.599  -4.926  -12.079 1.00 0.00 ? 26  THR A HB   1  
ATOM 385   H HG1  . THR A 1 26  ? -9.200  -6.404  -11.435 1.00 0.00 ? 26  THR A HG1  1  
ATOM 386   H HG21 . THR A 1 26  ? -6.180  -5.279  -9.932  1.00 0.00 ? 26  THR A HG21 1  
ATOM 387   H HG22 . THR A 1 26  ? -7.634  -5.926  -9.177  1.00 0.00 ? 26  THR A HG22 1  
ATOM 388   H HG23 . THR A 1 26  ? -6.919  -6.748  -10.561 1.00 0.00 ? 26  THR A HG23 1  
ATOM 389   N N    . ILE A 1 27  ? -9.353  -2.610  -12.394 1.00 0.00 ? 27  ILE A N    1  
ATOM 390   C CA   . ILE A 1 27  ? -10.527 -2.009  -13.089 1.00 0.00 ? 27  ILE A CA   1  
ATOM 391   C C    . ILE A 1 27  ? -10.731 -2.643  -14.443 1.00 0.00 ? 27  ILE A C    1  
ATOM 392   O O    . ILE A 1 27  ? -9.902  -3.393  -14.903 1.00 0.00 ? 27  ILE A O    1  
ATOM 393   C CB   . ILE A 1 27  ? -10.248 -0.526  -13.308 1.00 0.00 ? 27  ILE A CB   1  
ATOM 394   C CG1  . ILE A 1 27  ? -9.074  -0.360  -14.271 1.00 0.00 ? 27  ILE A CG1  1  
ATOM 395   C CG2  . ILE A 1 27  ? -9.877  0.101   -11.963 1.00 0.00 ? 27  ILE A CG2  1  
ATOM 396   C CD1  . ILE A 1 27  ? -8.809  1.128   -14.498 1.00 0.00 ? 27  ILE A CD1  1  
ATOM 397   H H    . ILE A 1 27  ? -8.523  -2.774  -12.889 1.00 0.00 ? 27  ILE A H    1  
ATOM 398   H HA   . ILE A 1 27  ? -11.422 -2.154  -12.485 1.00 0.00 ? 27  ILE A HA   1  
ATOM 399   H HB   . ILE A 1 27  ? -11.135 -0.050  -13.734 1.00 0.00 ? 27  ILE A HB   1  
ATOM 400   H HG12 . ILE A 1 27  ? -8.195  -0.825  -13.855 1.00 0.00 ? 27  ILE A HG12 1  
ATOM 401   H HG13 . ILE A 1 27  ? -9.308  -0.829  -15.214 1.00 0.00 ? 27  ILE A HG13 1  
ATOM 402   H HG21 . ILE A 1 27  ? -10.276 -0.505  -11.162 1.00 0.00 ? 27  ILE A HG21 1  
ATOM 403   H HG22 . ILE A 1 27  ? -8.806  0.156   -11.868 1.00 0.00 ? 27  ILE A HG22 1  
ATOM 404   H HG23 . ILE A 1 27  ? -10.292 1.097   -11.902 1.00 0.00 ? 27  ILE A HG23 1  
ATOM 405   H HD11 . ILE A 1 27  ? -8.708  1.628   -13.549 1.00 0.00 ? 27  ILE A HD11 1  
ATOM 406   H HD12 . ILE A 1 27  ? -7.897  1.252   -15.065 1.00 0.00 ? 27  ILE A HD12 1  
ATOM 407   H HD13 . ILE A 1 27  ? -9.630  1.564   -15.046 1.00 0.00 ? 27  ILE A HD13 1  
ATOM 408   N N    . THR A 1 28  ? -11.840 -2.328  -15.058 1.00 0.00 ? 28  THR A N    1  
ATOM 409   C CA   . THR A 1 28  ? -12.124 -2.900  -16.391 1.00 0.00 ? 28  THR A CA   1  
ATOM 410   C C    . THR A 1 28  ? -11.874 -1.863  -17.479 1.00 0.00 ? 28  THR A C    1  
ATOM 411   O O    . THR A 1 28  ? -12.138 -0.688  -17.301 1.00 0.00 ? 28  THR A O    1  
ATOM 412   C CB   . THR A 1 28  ? -13.589 -3.318  -16.444 1.00 0.00 ? 28  THR A CB   1  
ATOM 413   O OG1  . THR A 1 28  ? -14.289 -2.323  -15.723 1.00 0.00 ? 28  THR A OG1  1  
ATOM 414   C CG2  . THR A 1 28  ? -13.818 -4.611  -15.647 1.00 0.00 ? 28  THR A CG2  1  
ATOM 415   H H    . THR A 1 28  ? -12.480 -1.716  -14.637 1.00 0.00 ? 28  THR A H    1  
ATOM 416   H HA   . THR A 1 28  ? -11.471 -3.756  -16.562 1.00 0.00 ? 28  THR A HA   1  
ATOM 417   H HB   . THR A 1 28  ? -13.946 -3.384  -17.470 1.00 0.00 ? 28  THR A HB   1  
ATOM 418   H HG1  . THR A 1 28  ? -13.852 -2.206  -14.877 1.00 0.00 ? 28  THR A HG1  1  
ATOM 419   H HG21 . THR A 1 28  ? -12.995 -4.771  -14.967 1.00 0.00 ? 28  THR A HG21 1  
ATOM 420   H HG22 . THR A 1 28  ? -14.735 -4.532  -15.082 1.00 0.00 ? 28  THR A HG22 1  
ATOM 421   H HG23 . THR A 1 28  ? -13.889 -5.449  -16.324 1.00 0.00 ? 28  THR A HG23 1  
ATOM 422   N N    . THR A 1 29  ? -11.362 -2.322  -18.579 1.00 0.00 ? 29  THR A N    1  
ATOM 423   C CA   . THR A 1 29  ? -11.075 -1.400  -19.709 1.00 0.00 ? 29  THR A CA   1  
ATOM 424   C C    . THR A 1 29  ? -12.170 -0.345  -19.878 1.00 0.00 ? 29  THR A C    1  
ATOM 425   O O    . THR A 1 29  ? -11.914 0.743   -20.354 1.00 0.00 ? 29  THR A O    1  
ATOM 426   C CB   . THR A 1 29  ? -11.006 -2.235  -20.987 1.00 0.00 ? 29  THR A CB   1  
ATOM 427   O OG1  . THR A 1 29  ? -12.193 -3.000  -20.994 1.00 0.00 ? 29  THR A OG1  1  
ATOM 428   C CG2  . THR A 1 29  ? -9.878  -3.272  -20.899 1.00 0.00 ? 29  THR A CG2  1  
ATOM 429   H H    . THR A 1 29  ? -11.156 -3.274  -18.660 1.00 0.00 ? 29  THR A H    1  
ATOM 430   H HA   . THR A 1 29  ? -10.124 -0.898  -19.525 1.00 0.00 ? 29  THR A HA   1  
ATOM 431   H HB   . THR A 1 29  ? -10.943 -1.612  -21.876 1.00 0.00 ? 29  THR A HB   1  
ATOM 432   H HG1  . THR A 1 29  ? -12.895 -2.463  -20.617 1.00 0.00 ? 29  THR A HG1  1  
ATOM 433   H HG21 . THR A 1 29  ? -9.834  -3.678  -19.900 1.00 0.00 ? 29  THR A HG21 1  
ATOM 434   H HG22 . THR A 1 29  ? -10.062 -4.071  -21.601 1.00 0.00 ? 29  THR A HG22 1  
ATOM 435   H HG23 . THR A 1 29  ? -8.933  -2.803  -21.134 1.00 0.00 ? 29  THR A HG23 1  
ATOM 436   N N    . LYS A 1 30  ? -13.369 -0.682  -19.488 1.00 0.00 ? 30  LYS A N    1  
ATOM 437   C CA   . LYS A 1 30  ? -14.482 0.297   -19.625 1.00 0.00 ? 30  LYS A CA   1  
ATOM 438   C C    . LYS A 1 30  ? -14.286 1.484   -18.689 1.00 0.00 ? 30  LYS A C    1  
ATOM 439   O O    . LYS A 1 30  ? -14.492 2.619   -19.070 1.00 0.00 ? 30  LYS A O    1  
ATOM 440   C CB   . LYS A 1 30  ? -15.799 -0.408  -19.263 1.00 0.00 ? 30  LYS A CB   1  
ATOM 441   C CG   . LYS A 1 30  ? -15.681 -1.001  -17.861 1.00 0.00 ? 30  LYS A CG   1  
ATOM 442   C CD   . LYS A 1 30  ? -16.456 -2.320  -17.805 1.00 0.00 ? 30  LYS A CD   1  
ATOM 443   C CE   . LYS A 1 30  ? -17.952 -2.035  -17.965 1.00 0.00 ? 30  LYS A CE   1  
ATOM 444   N NZ   . LYS A 1 30  ? -18.584 -3.050  -18.857 1.00 0.00 ? 30  LYS A NZ   1  
ATOM 445   H H    . LYS A 1 30  ? -13.536 -1.571  -19.108 1.00 0.00 ? 30  LYS A H    1  
ATOM 446   H HA   . LYS A 1 30  ? -14.506 0.659   -20.650 1.00 0.00 ? 30  LYS A HA   1  
ATOM 447   H HB2  . LYS A 1 30  ? -16.610 0.305   -19.290 1.00 0.00 ? 30  LYS A HB2  1  
ATOM 448   H HB3  . LYS A 1 30  ? -15.995 -1.196  -19.976 1.00 0.00 ? 30  LYS A HB3  1  
ATOM 449   H HG2  . LYS A 1 30  ? -14.642 -1.180  -17.631 1.00 0.00 ? 30  LYS A HG2  1  
ATOM 450   H HG3  . LYS A 1 30  ? -16.090 -0.309  -17.139 1.00 0.00 ? 30  LYS A HG3  1  
ATOM 451   H HD2  . LYS A 1 30  ? -16.124 -2.971  -18.602 1.00 0.00 ? 30  LYS A HD2  1  
ATOM 452   H HD3  . LYS A 1 30  ? -16.279 -2.806  -16.857 1.00 0.00 ? 30  LYS A HD3  1  
ATOM 453   H HE2  . LYS A 1 30  ? -18.432 -2.068  -16.999 1.00 0.00 ? 30  LYS A HE2  1  
ATOM 454   H HE3  . LYS A 1 30  ? -18.089 -1.054  -18.395 1.00 0.00 ? 30  LYS A HE3  1  
ATOM 455   H HZ1  . LYS A 1 30  ? -17.979 -3.894  -18.904 1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 456   H HZ2  . LYS A 1 30  ? -19.516 -3.312  -18.478 1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 457   H HZ3  . LYS A 1 30  ? -18.698 -2.650  -19.811 1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 458   N N    . GLU A 1 31  ? -13.891 1.200   -17.482 1.00 0.00 ? 31  GLU A N    1  
ATOM 459   C CA   . GLU A 1 31  ? -13.677 2.301   -16.506 1.00 0.00 ? 31  GLU A CA   1  
ATOM 460   C C    . GLU A 1 31  ? -12.314 2.951   -16.708 1.00 0.00 ? 31  GLU A C    1  
ATOM 461   O O    . GLU A 1 31  ? -12.018 3.971   -16.123 1.00 0.00 ? 31  GLU A O    1  
ATOM 462   C CB   . GLU A 1 31  ? -13.741 1.710   -15.089 1.00 0.00 ? 31  GLU A CB   1  
ATOM 463   C CG   . GLU A 1 31  ? -15.089 1.015   -14.896 1.00 0.00 ? 31  GLU A CG   1  
ATOM 464   C CD   . GLU A 1 31  ? -15.615 1.307   -13.488 1.00 0.00 ? 31  GLU A CD   1  
ATOM 465   O OE1  . GLU A 1 31  ? -15.858 2.475   -13.233 1.00 0.00 ? 31  GLU A OE1  1  
ATOM 466   O OE2  . GLU A 1 31  ? -15.742 0.345   -12.747 1.00 0.00 ? 31  GLU A OE2  1  
ATOM 467   H H    . GLU A 1 31  ? -13.735 0.270   -17.219 1.00 0.00 ? 31  GLU A H    1  
ATOM 468   H HA   . GLU A 1 31  ? -14.452 3.057   -16.646 1.00 0.00 ? 31  GLU A HA   1  
ATOM 469   H HB2  . GLU A 1 31  ? -12.942 0.996   -14.956 1.00 0.00 ? 31  GLU A HB2  1  
ATOM 470   H HB3  . GLU A 1 31  ? -13.634 2.502   -14.361 1.00 0.00 ? 31  GLU A HB3  1  
ATOM 471   H HG2  . GLU A 1 31  ? -15.798 1.381   -15.624 1.00 0.00 ? 31  GLU A HG2  1  
ATOM 472   H HG3  . GLU A 1 31  ? -14.971 -0.052  -15.018 1.00 0.00 ? 31  GLU A HG3  1  
ATOM 473   N N    . LEU A 1 32  ? -11.505 2.351   -17.530 1.00 0.00 ? 32  LEU A N    1  
ATOM 474   C CA   . LEU A 1 32  ? -10.167 2.924   -17.774 1.00 0.00 ? 32  LEU A CA   1  
ATOM 475   C C    . LEU A 1 32  ? -10.241 4.427   -18.040 1.00 0.00 ? 32  LEU A C    1  
ATOM 476   O O    . LEU A 1 32  ? -9.813  5.227   -17.232 1.00 0.00 ? 32  LEU A O    1  
ATOM 477   C CB   . LEU A 1 32  ? -9.584  2.248   -19.011 1.00 0.00 ? 32  LEU A CB   1  
ATOM 478   C CG   . LEU A 1 32  ? -8.091  2.518   -19.058 1.00 0.00 ? 32  LEU A CG   1  
ATOM 479   C CD1  . LEU A 1 32  ? -7.418  1.770   -17.908 1.00 0.00 ? 32  LEU A CD1  1  
ATOM 480   C CD2  . LEU A 1 32  ? -7.536  2.017   -20.387 1.00 0.00 ? 32  LEU A CD2  1  
ATOM 481   H H    . LEU A 1 32  ? -11.775 1.523   -17.983 1.00 0.00 ? 32  LEU A H    1  
ATOM 482   H HA   . LEU A 1 32  ? -9.537  2.743   -16.902 1.00 0.00 ? 32  LEU A HA   1  
ATOM 483   H HB2  . LEU A 1 32  ? -9.761  1.185   -18.961 1.00 0.00 ? 32  LEU A HB2  1  
ATOM 484   H HB3  . LEU A 1 32  ? -10.055 2.644   -19.900 1.00 0.00 ? 32  LEU A HB3  1  
ATOM 485   H HG   . LEU A 1 32  ? -7.909  3.579   -18.961 1.00 0.00 ? 32  LEU A HG   1  
ATOM 486   H HD11 . LEU A 1 32  ? -8.048  0.953   -17.588 1.00 0.00 ? 32  LEU A HD11 1  
ATOM 487   H HD12 . LEU A 1 32  ? -6.465  1.379   -18.233 1.00 0.00 ? 32  LEU A HD12 1  
ATOM 488   H HD13 . LEU A 1 32  ? -7.263  2.443   -17.080 1.00 0.00 ? 32  LEU A HD13 1  
ATOM 489   H HD21 . LEU A 1 32  ? -7.810  0.982   -20.527 1.00 0.00 ? 32  LEU A HD21 1  
ATOM 490   H HD22 . LEU A 1 32  ? -7.945  2.605   -21.196 1.00 0.00 ? 32  LEU A HD22 1  
ATOM 491   H HD23 . LEU A 1 32  ? -6.462  2.105   -20.390 1.00 0.00 ? 32  LEU A HD23 1  
ATOM 492   N N    . GLY A 1 33  ? -10.785 4.778   -19.172 1.00 0.00 ? 33  GLY A N    1  
ATOM 493   C CA   . GLY A 1 33  ? -10.900 6.224   -19.520 1.00 0.00 ? 33  GLY A CA   1  
ATOM 494   C C    . GLY A 1 33  ? -11.403 7.038   -18.331 1.00 0.00 ? 33  GLY A C    1  
ATOM 495   O O    . GLY A 1 33  ? -10.906 8.111   -18.059 1.00 0.00 ? 33  GLY A O    1  
ATOM 496   H H    . GLY A 1 33  ? -11.121 4.096   -19.788 1.00 0.00 ? 33  GLY A H    1  
ATOM 497   H HA2  . GLY A 1 33  ? -9.931  6.594   -19.818 1.00 0.00 ? 33  GLY A HA2  1  
ATOM 498   H HA3  . GLY A 1 33  ? -11.588 6.334   -20.342 1.00 0.00 ? 33  GLY A HA3  1  
ATOM 499   N N    . THR A 1 34  ? -12.380 6.517   -17.644 1.00 0.00 ? 34  THR A N    1  
ATOM 500   C CA   . THR A 1 34  ? -12.912 7.260   -16.478 1.00 0.00 ? 34  THR A CA   1  
ATOM 501   C C    . THR A 1 34  ? -11.821 7.492   -15.443 1.00 0.00 ? 34  THR A C    1  
ATOM 502   O O    . THR A 1 34  ? -11.758 8.540   -14.832 1.00 0.00 ? 34  THR A O    1  
ATOM 503   C CB   . THR A 1 34  ? -14.045 6.442   -15.851 1.00 0.00 ? 34  THR A CB   1  
ATOM 504   O OG1  . THR A 1 34  ? -15.017 6.316   -16.868 1.00 0.00 ? 34  THR A OG1  1  
ATOM 505   C CG2  . THR A 1 34  ? -14.749 7.242   -14.744 1.00 0.00 ? 34  THR A CG2  1  
ATOM 506   H H    . THR A 1 34  ? -12.754 5.645   -17.894 1.00 0.00 ? 34  THR A H    1  
ATOM 507   H HA   . THR A 1 34  ? -13.276 8.224   -16.816 1.00 0.00 ? 34  THR A HA   1  
ATOM 508   H HB   . THR A 1 34  ? -13.706 5.470   -15.518 1.00 0.00 ? 34  THR A HB   1  
ATOM 509   H HG1  . THR A 1 34  ? -15.059 7.149   -17.344 1.00 0.00 ? 34  THR A HG1  1  
ATOM 510   H HG21 . THR A 1 34  ? -14.022 7.580   -14.020 1.00 0.00 ? 34  THR A HG21 1  
ATOM 511   H HG22 . THR A 1 34  ? -15.248 8.097   -15.174 1.00 0.00 ? 34  THR A HG22 1  
ATOM 512   H HG23 . THR A 1 34  ? -15.478 6.616   -14.250 1.00 0.00 ? 34  THR A HG23 1  
ATOM 513   N N    . VAL A 1 35  ? -10.976 6.516   -15.266 1.00 0.00 ? 35  VAL A N    1  
ATOM 514   C CA   . VAL A 1 35  ? -9.887  6.678   -14.273 1.00 0.00 ? 35  VAL A CA   1  
ATOM 515   C C    . VAL A 1 35  ? -8.870  7.695   -14.768 1.00 0.00 ? 35  VAL A C    1  
ATOM 516   O O    . VAL A 1 35  ? -8.434  8.555   -14.027 1.00 0.00 ? 35  VAL A O    1  
ATOM 517   C CB   . VAL A 1 35  ? -9.181  5.328   -14.091 1.00 0.00 ? 35  VAL A CB   1  
ATOM 518   C CG1  . VAL A 1 35  ? -8.133  5.461   -12.982 1.00 0.00 ? 35  VAL A CG1  1  
ATOM 519   C CG2  . VAL A 1 35  ? -10.206 4.268   -13.690 1.00 0.00 ? 35  VAL A CG2  1  
ATOM 520   H H    . VAL A 1 35  ? -11.061 5.686   -15.781 1.00 0.00 ? 35  VAL A H    1  
ATOM 521   H HA   . VAL A 1 35  ? -10.310 7.024   -13.334 1.00 0.00 ? 35  VAL A HA   1  
ATOM 522   H HB   . VAL A 1 35  ? -8.702  5.043   -15.012 1.00 0.00 ? 35  VAL A HB   1  
ATOM 523   H HG11 . VAL A 1 35  ? -8.587  5.891   -12.101 1.00 0.00 ? 35  VAL A HG11 1  
ATOM 524   H HG12 . VAL A 1 35  ? -7.735  4.487   -12.738 1.00 0.00 ? 35  VAL A HG12 1  
ATOM 525   H HG13 . VAL A 1 35  ? -7.329  6.101   -13.315 1.00 0.00 ? 35  VAL A HG13 1  
ATOM 526   H HG21 . VAL A 1 35  ? -11.149 4.741   -13.461 1.00 0.00 ? 35  VAL A HG21 1  
ATOM 527   H HG22 . VAL A 1 35  ? -10.345 3.571   -14.502 1.00 0.00 ? 35  VAL A HG22 1  
ATOM 528   H HG23 . VAL A 1 35  ? -9.856  3.733   -12.819 1.00 0.00 ? 35  VAL A HG23 1  
ATOM 529   N N    . MET A 1 36  ? -8.508  7.579   -16.020 1.00 0.00 ? 36  MET A N    1  
ATOM 530   C CA   . MET A 1 36  ? -7.521  8.530   -16.585 1.00 0.00 ? 36  MET A CA   1  
ATOM 531   C C    . MET A 1 36  ? -8.012  9.962   -16.426 1.00 0.00 ? 36  MET A C    1  
ATOM 532   O O    . MET A 1 36  ? -7.242  10.860  -16.150 1.00 0.00 ? 36  MET A O    1  
ATOM 533   C CB   . MET A 1 36  ? -7.356  8.235   -18.088 1.00 0.00 ? 36  MET A CB   1  
ATOM 534   C CG   . MET A 1 36  ? -7.030  6.752   -18.290 1.00 0.00 ? 36  MET A CG   1  
ATOM 535   S SD   . MET A 1 36  ? -5.672  6.349   -19.417 1.00 0.00 ? 36  MET A SD   1  
ATOM 536   C CE   . MET A 1 36  ? -4.555  5.643   -18.181 1.00 0.00 ? 36  MET A CE   1  
ATOM 537   H H    . MET A 1 36  ? -8.886  6.869   -16.580 1.00 0.00 ? 36  MET A H    1  
ATOM 538   H HA   . MET A 1 36  ? -6.572  8.415   -16.058 1.00 0.00 ? 36  MET A HA   1  
ATOM 539   H HB2  . MET A 1 36  ? -8.272  8.478   -18.607 1.00 0.00 ? 36  MET A HB2  1  
ATOM 540   H HB3  . MET A 1 36  ? -6.554  8.838   -18.488 1.00 0.00 ? 36  MET A HB3  1  
ATOM 541   H HG2  . MET A 1 36  ? -6.797  6.324   -17.328 1.00 0.00 ? 36  MET A HG2  1  
ATOM 542   H HG3  . MET A 1 36  ? -7.917  6.261   -18.660 1.00 0.00 ? 36  MET A HG3  1  
ATOM 543   H HE1  . MET A 1 36  ? -4.605  6.228   -17.275 1.00 0.00 ? 36  MET A HE1  1  
ATOM 544   H HE2  . MET A 1 36  ? -4.848  4.626   -17.970 1.00 0.00 ? 36  MET A HE2  1  
ATOM 545   H HE3  . MET A 1 36  ? -3.544  5.655   -18.561 1.00 0.00 ? 36  MET A HE3  1  
ATOM 546   N N    . ARG A 1 37  ? -9.295  10.148  -16.603 1.00 0.00 ? 37  ARG A N    1  
ATOM 547   C CA   . ARG A 1 37  ? -9.857  11.512  -16.469 1.00 0.00 ? 37  ARG A CA   1  
ATOM 548   C C    . ARG A 1 37  ? -9.803  11.980  -15.019 1.00 0.00 ? 37  ARG A C    1  
ATOM 549   O O    . ARG A 1 37  ? -9.608  13.148  -14.747 1.00 0.00 ? 37  ARG A O    1  
ATOM 550   C CB   . ARG A 1 37  ? -11.323 11.471  -16.925 1.00 0.00 ? 37  ARG A CB   1  
ATOM 551   C CG   . ARG A 1 37  ? -11.749 12.870  -17.370 1.00 0.00 ? 37  ARG A CG   1  
ATOM 552   C CD   . ARG A 1 37  ? -13.275 12.925  -17.473 1.00 0.00 ? 37  ARG A CD   1  
ATOM 553   N NE   . ARG A 1 37  ? -13.788 13.924  -16.494 1.00 0.00 ? 37  ARG A NE   1  
ATOM 554   C CZ   . ARG A 1 37  ? -13.851 15.183  -16.835 1.00 0.00 ? 37  ARG A CZ   1  
ATOM 555   N NH1  . ARG A 1 37  ? -14.927 15.623  -17.428 1.00 0.00 ? 37  ARG A NH1  1  
ATOM 556   N NH2  . ARG A 1 37  ? -12.836 15.960  -16.572 1.00 0.00 ? 37  ARG A NH2  1  
ATOM 557   H H    . ARG A 1 37  ? -9.882  9.390   -16.823 1.00 0.00 ? 37  ARG A H    1  
ATOM 558   H HA   . ARG A 1 37  ? -9.278  12.198  -17.085 1.00 0.00 ? 37  ARG A HA   1  
ATOM 559   H HB2  . ARG A 1 37  ? -11.427 10.780  -17.748 1.00 0.00 ? 37  ARG A HB2  1  
ATOM 560   H HB3  . ARG A 1 37  ? -11.949 11.143  -16.107 1.00 0.00 ? 37  ARG A HB3  1  
ATOM 561   H HG2  . ARG A 1 37  ? -11.407 13.599  -16.652 1.00 0.00 ? 37  ARG A HG2  1  
ATOM 562   H HG3  . ARG A 1 37  ? -11.313 13.091  -18.333 1.00 0.00 ? 37  ARG A HG3  1  
ATOM 563   H HD2  . ARG A 1 37  ? -13.564 13.219  -18.471 1.00 0.00 ? 37  ARG A HD2  1  
ATOM 564   H HD3  . ARG A 1 37  ? -13.695 11.955  -17.249 1.00 0.00 ? 37  ARG A HD3  1  
ATOM 565   H HE   . ARG A 1 37  ? -14.076 13.639  -15.601 1.00 0.00 ? 37  ARG A HE   1  
ATOM 566   H HH11 . ARG A 1 37  ? -15.686 14.999  -17.614 1.00 0.00 ? 37  ARG A HH11 1  
ATOM 567   H HH12 . ARG A 1 37  ? -14.993 16.584  -17.697 1.00 0.00 ? 37  ARG A HH12 1  
ATOM 568   H HH21 . ARG A 1 37  ? -12.027 15.588  -16.116 1.00 0.00 ? 37  ARG A HH21 1  
ATOM 569   H HH22 . ARG A 1 37  ? -12.866 16.927  -16.825 1.00 0.00 ? 37  ARG A HH22 1  
ATOM 570   N N    . SER A 1 38  ? -9.975  11.058  -14.111 1.00 0.00 ? 38  SER A N    1  
ATOM 571   C CA   . SER A 1 38  ? -9.938  11.429  -12.675 1.00 0.00 ? 38  SER A CA   1  
ATOM 572   C C    . SER A 1 38  ? -8.529  11.832  -12.241 1.00 0.00 ? 38  SER A C    1  
ATOM 573   O O    . SER A 1 38  ? -8.359  12.742  -11.453 1.00 0.00 ? 38  SER A O    1  
ATOM 574   C CB   . SER A 1 38  ? -10.381 10.210  -11.850 1.00 0.00 ? 38  SER A CB   1  
ATOM 575   O OG   . SER A 1 38  ? -11.676 9.907   -12.352 1.00 0.00 ? 38  SER A OG   1  
ATOM 576   H H    . SER A 1 38  ? -10.130 10.127  -14.376 1.00 0.00 ? 38  SER A H    1  
ATOM 577   H HA   . SER A 1 38  ? -10.612 12.270  -12.510 1.00 0.00 ? 38  SER A HA   1  
ATOM 578   H HB2  . SER A 1 38  ? -9.713  9.377   -12.011 1.00 0.00 ? 38  SER A HB2  1  
ATOM 579   H HB3  . SER A 1 38  ? -10.435 10.454  -10.801 1.00 0.00 ? 38  SER A HB3  1  
ATOM 580   H HG   . SER A 1 38  ? -12.267 9.799   -11.603 1.00 0.00 ? 38  SER A HG   1  
ATOM 581   N N    . LEU A 1 39  ? -7.540  11.151  -12.762 1.00 0.00 ? 39  LEU A N    1  
ATOM 582   C CA   . LEU A 1 39  ? -6.144  11.495  -12.380 1.00 0.00 ? 39  LEU A CA   1  
ATOM 583   C C    . LEU A 1 39  ? -5.893  12.988  -12.549 1.00 0.00 ? 39  LEU A C    1  
ATOM 584   O O    . LEU A 1 39  ? -5.338  13.630  -11.682 1.00 0.00 ? 39  LEU A O    1  
ATOM 585   C CB   . LEU A 1 39  ? -5.177  10.725  -13.297 1.00 0.00 ? 39  LEU A CB   1  
ATOM 586   C CG   . LEU A 1 39  ? -4.731  9.430   -12.600 1.00 0.00 ? 39  LEU A CG   1  
ATOM 587   C CD1  . LEU A 1 39  ? -5.811  8.370   -12.772 1.00 0.00 ? 39  LEU A CD1  1  
ATOM 588   C CD2  . LEU A 1 39  ? -3.443  8.931   -13.244 1.00 0.00 ? 39  LEU A CD2  1  
ATOM 589   H H    . LEU A 1 39  ? -7.716  10.424  -13.394 1.00 0.00 ? 39  LEU A H    1  
ATOM 590   H HA   . LEU A 1 39  ? -5.988  11.229  -11.340 1.00 0.00 ? 39  LEU A HA   1  
ATOM 591   H HB2  . LEU A 1 39  ? -5.673  10.482  -14.225 1.00 0.00 ? 39  LEU A HB2  1  
ATOM 592   H HB3  . LEU A 1 39  ? -4.314  11.339  -13.510 1.00 0.00 ? 39  LEU A HB3  1  
ATOM 593   H HG   . LEU A 1 39  ? -4.561  9.613   -11.548 1.00 0.00 ? 39  LEU A HG   1  
ATOM 594   H HD11 . LEU A 1 39  ? -6.740  8.728   -12.360 1.00 0.00 ? 39  LEU A HD11 1  
ATOM 595   H HD12 . LEU A 1 39  ? -5.947  8.157   -13.822 1.00 0.00 ? 39  LEU A HD12 1  
ATOM 596   H HD13 . LEU A 1 39  ? -5.518  7.466   -12.260 1.00 0.00 ? 39  LEU A HD13 1  
ATOM 597   H HD21 . LEU A 1 39  ? -2.777  9.763   -13.416 1.00 0.00 ? 39  LEU A HD21 1  
ATOM 598   H HD22 . LEU A 1 39  ? -2.961  8.218   -12.590 1.00 0.00 ? 39  LEU A HD22 1  
ATOM 599   H HD23 . LEU A 1 39  ? -3.668  8.455   -14.185 1.00 0.00 ? 39  LEU A HD23 1  
ATOM 600   N N    . GLY A 1 40  ? -6.310  13.513  -13.667 1.00 0.00 ? 40  GLY A N    1  
ATOM 601   C CA   . GLY A 1 40  ? -6.106  14.968  -13.916 1.00 0.00 ? 40  GLY A CA   1  
ATOM 602   C C    . GLY A 1 40  ? -5.845  15.226  -15.402 1.00 0.00 ? 40  GLY A C    1  
ATOM 603   O O    . GLY A 1 40  ? -5.618  16.347  -15.808 1.00 0.00 ? 40  GLY A O    1  
ATOM 604   H H    . GLY A 1 40  ? -6.751  12.954  -14.339 1.00 0.00 ? 40  GLY A H    1  
ATOM 605   H HA2  . GLY A 1 40  ? -6.989  15.509  -13.610 1.00 0.00 ? 40  GLY A HA2  1  
ATOM 606   H HA3  . GLY A 1 40  ? -5.260  15.314  -13.340 1.00 0.00 ? 40  GLY A HA3  1  
ATOM 607   N N    . GLN A 1 41  ? -5.884  14.171  -16.184 1.00 0.00 ? 41  GLN A N    1  
ATOM 608   C CA   . GLN A 1 41  ? -5.642  14.326  -17.645 1.00 0.00 ? 41  GLN A CA   1  
ATOM 609   C C    . GLN A 1 41  ? -6.955  14.307  -18.418 1.00 0.00 ? 41  GLN A C    1  
ATOM 610   O O    . GLN A 1 41  ? -8.020  14.227  -17.839 1.00 0.00 ? 41  GLN A O    1  
ATOM 611   C CB   . GLN A 1 41  ? -4.778  13.146  -18.120 1.00 0.00 ? 41  GLN A CB   1  
ATOM 612   C CG   . GLN A 1 41  ? -3.400  13.235  -17.462 1.00 0.00 ? 41  GLN A CG   1  
ATOM 613   C CD   . GLN A 1 41  ? -2.683  14.491  -17.959 1.00 0.00 ? 41  GLN A CD   1  
ATOM 614   O OE1  . GLN A 1 41  ? -2.798  14.873  -19.107 1.00 0.00 ? 41  GLN A OE1  1  
ATOM 615   N NE2  . GLN A 1 41  ? -1.933  15.163  -17.128 1.00 0.00 ? 41  GLN A NE2  1  
ATOM 616   H H    . GLN A 1 41  ? -6.073  13.286  -15.807 1.00 0.00 ? 41  GLN A H    1  
ATOM 617   H HA   . GLN A 1 41  ? -5.137  15.273  -17.828 1.00 0.00 ? 41  GLN A HA   1  
ATOM 618   H HB2  . GLN A 1 41  ? -5.253  12.216  -17.847 1.00 0.00 ? 41  GLN A HB2  1  
ATOM 619   H HB3  . GLN A 1 41  ? -4.670  13.186  -19.194 1.00 0.00 ? 41  GLN A HB3  1  
ATOM 620   H HG2  . GLN A 1 41  ? -3.510  13.287  -16.389 1.00 0.00 ? 41  GLN A HG2  1  
ATOM 621   H HG3  . GLN A 1 41  ? -2.815  12.364  -17.720 1.00 0.00 ? 41  GLN A HG3  1  
ATOM 622   H HE21 . GLN A 1 41  ? -1.837  14.860  -16.201 1.00 0.00 ? 41  GLN A HE21 1  
ATOM 623   H HE22 . GLN A 1 41  ? -1.467  15.970  -17.431 1.00 0.00 ? 41  GLN A HE22 1  
ATOM 624   N N    . ASN A 1 42  ? -6.852  14.380  -19.716 1.00 0.00 ? 42  ASN A N    1  
ATOM 625   C CA   . ASN A 1 42  ? -8.079  14.369  -20.547 1.00 0.00 ? 42  ASN A CA   1  
ATOM 626   C C    . ASN A 1 42  ? -7.816  13.677  -21.879 1.00 0.00 ? 42  ASN A C    1  
ATOM 627   O O    . ASN A 1 42  ? -7.789  14.297  -22.924 1.00 0.00 ? 42  ASN A O    1  
ATOM 628   C CB   . ASN A 1 42  ? -8.492  15.826  -20.815 1.00 0.00 ? 42  ASN A CB   1  
ATOM 629   C CG   . ASN A 1 42  ? -9.919  15.856  -21.366 1.00 0.00 ? 42  ASN A CG   1  
ATOM 630   O OD1  . ASN A 1 42  ? -10.170 15.475  -22.490 1.00 0.00 ? 42  ASN A OD1  1  
ATOM 631   N ND2  . ASN A 1 42  ? -10.882 16.304  -20.606 1.00 0.00 ? 42  ASN A ND2  1  
ATOM 632   H H    . ASN A 1 42  ? -5.970  14.444  -20.139 1.00 0.00 ? 42  ASN A H    1  
ATOM 633   H HA   . ASN A 1 42  ? -8.863  13.834  -20.017 1.00 0.00 ? 42  ASN A HA   1  
ATOM 634   H HB2  . ASN A 1 42  ? -8.453  16.391  -19.895 1.00 0.00 ? 42  ASN A HB2  1  
ATOM 635   H HB3  . ASN A 1 42  ? -7.821  16.270  -21.535 1.00 0.00 ? 42  ASN A HB3  1  
ATOM 636   H HD21 . ASN A 1 42  ? -10.685 16.614  -19.698 1.00 0.00 ? 42  ASN A HD21 1  
ATOM 637   H HD22 . ASN A 1 42  ? -11.801 16.331  -20.945 1.00 0.00 ? 42  ASN A HD22 1  
ATOM 638   N N    . PRO A 1 43  ? -7.626  12.386  -21.796 1.00 0.00 ? 43  PRO A N    1  
ATOM 639   C CA   . PRO A 1 43  ? -7.358  11.560  -22.970 1.00 0.00 ? 43  PRO A CA   1  
ATOM 640   C C    . PRO A 1 43  ? -8.582  11.443  -23.873 1.00 0.00 ? 43  PRO A C    1  
ATOM 641   O O    . PRO A 1 43  ? -9.652  11.913  -23.535 1.00 0.00 ? 43  PRO A O    1  
ATOM 642   C CB   . PRO A 1 43  ? -7.014  10.170  -22.398 1.00 0.00 ? 43  PRO A CB   1  
ATOM 643   C CG   . PRO A 1 43  ? -7.237  10.238  -20.853 1.00 0.00 ? 43  PRO A CG   1  
ATOM 644   C CD   . PRO A 1 43  ? -7.656  11.674  -20.518 1.00 0.00 ? 43  PRO A CD   1  
ATOM 645   H HA   . PRO A 1 43  ? -6.522  11.971  -23.528 1.00 0.00 ? 43  PRO A HA   1  
ATOM 646   H HB2  . PRO A 1 43  ? -7.659  9.420   -22.832 1.00 0.00 ? 43  PRO A HB2  1  
ATOM 647   H HB3  . PRO A 1 43  ? -5.983  9.927   -22.610 1.00 0.00 ? 43  PRO A HB3  1  
ATOM 648   H HG2  . PRO A 1 43  ? -8.018  9.550   -20.562 1.00 0.00 ? 43  PRO A HG2  1  
ATOM 649   H HG3  . PRO A 1 43  ? -6.324  9.992   -20.337 1.00 0.00 ? 43  PRO A HG3  1  
ATOM 650   H HD2  . PRO A 1 43  ? -8.654  11.687  -20.108 1.00 0.00 ? 43  PRO A HD2  1  
ATOM 651   H HD3  . PRO A 1 43  ? -6.960  12.123  -19.825 1.00 0.00 ? 43  PRO A HD3  1  
ATOM 652   N N    . THR A 1 44  ? -8.391  10.811  -25.008 1.00 0.00 ? 44  THR A N    1  
ATOM 653   C CA   . THR A 1 44  ? -9.510  10.636  -25.964 1.00 0.00 ? 44  THR A CA   1  
ATOM 654   C C    . THR A 1 44  ? -9.877  9.162   -26.096 1.00 0.00 ? 44  THR A C    1  
ATOM 655   O O    . THR A 1 44  ? -9.019  8.322   -26.285 1.00 0.00 ? 44  THR A O    1  
ATOM 656   C CB   . THR A 1 44  ? -9.051  11.150  -27.324 1.00 0.00 ? 44  THR A CB   1  
ATOM 657   O OG1  . THR A 1 44  ? -8.896  12.546  -27.167 1.00 0.00 ? 44  THR A OG1  1  
ATOM 658   C CG2  . THR A 1 44  ? -10.161 10.998  -28.366 1.00 0.00 ? 44  THR A CG2  1  
ATOM 659   H H    . THR A 1 44  ? -7.506  10.458  -25.228 1.00 0.00 ? 44  THR A H    1  
ATOM 660   H HA   . THR A 1 44  ? -10.376 11.189  -25.615 1.00 0.00 ? 44  THR A HA   1  
ATOM 661   H HB   . THR A 1 44  ? -8.118  10.690  -27.632 1.00 0.00 ? 44  THR A HB   1  
ATOM 662   H HG1  . THR A 1 44  ? -9.769  12.946  -27.190 1.00 0.00 ? 44  THR A HG1  1  
ATOM 663   H HG21 . THR A 1 44  ? -11.123 11.096  -27.888 1.00 0.00 ? 44  THR A HG21 1  
ATOM 664   H HG22 . THR A 1 44  ? -10.059 11.762  -29.120 1.00 0.00 ? 44  THR A HG22 1  
ATOM 665   H HG23 . THR A 1 44  ? -10.092 10.025  -28.831 1.00 0.00 ? 44  THR A HG23 1  
ATOM 666   N N    . GLU A 1 45  ? -11.144 8.873   -25.995 1.00 0.00 ? 45  GLU A N    1  
ATOM 667   C CA   . GLU A 1 45  ? -11.584 7.460   -26.113 1.00 0.00 ? 45  GLU A CA   1  
ATOM 668   C C    . GLU A 1 45  ? -10.883 6.756   -27.272 1.00 0.00 ? 45  GLU A C    1  
ATOM 669   O O    . GLU A 1 45  ? -10.847 5.542   -27.332 1.00 0.00 ? 45  GLU A O    1  
ATOM 670   C CB   . GLU A 1 45  ? -13.095 7.442   -26.372 1.00 0.00 ? 45  GLU A CB   1  
ATOM 671   C CG   . GLU A 1 45  ? -13.461 8.598   -27.300 1.00 0.00 ? 45  GLU A CG   1  
ATOM 672   C CD   . GLU A 1 45  ? -12.808 8.380   -28.668 1.00 0.00 ? 45  GLU A CD   1  
ATOM 673   O OE1  . GLU A 1 45  ? -12.694 7.221   -29.034 1.00 0.00 ? 45  GLU A OE1  1  
ATOM 674   O OE2  . GLU A 1 45  ? -12.459 9.383   -29.267 1.00 0.00 ? 45  GLU A OE2  1  
ATOM 675   H H    . GLU A 1 45  ? -11.799 9.583   -25.836 1.00 0.00 ? 45  GLU A H    1  
ATOM 676   H HA   . GLU A 1 45  ? -11.348 6.941   -25.190 1.00 0.00 ? 45  GLU A HA   1  
ATOM 677   H HB2  . GLU A 1 45  ? -13.373 6.506   -26.832 1.00 0.00 ? 45  GLU A HB2  1  
ATOM 678   H HB3  . GLU A 1 45  ? -13.623 7.548   -25.437 1.00 0.00 ? 45  GLU A HB3  1  
ATOM 679   H HG2  . GLU A 1 45  ? -14.531 8.643   -27.419 1.00 0.00 ? 45  GLU A HG2  1  
ATOM 680   H HG3  . GLU A 1 45  ? -13.110 9.528   -26.881 1.00 0.00 ? 45  GLU A HG3  1  
ATOM 681   N N    . ALA A 1 46  ? -10.336 7.528   -28.169 1.00 0.00 ? 46  ALA A N    1  
ATOM 682   C CA   . ALA A 1 46  ? -9.637  6.912   -29.328 1.00 0.00 ? 46  ALA A CA   1  
ATOM 683   C C    . ALA A 1 46  ? -8.320  6.294   -28.895 1.00 0.00 ? 46  ALA A C    1  
ATOM 684   O O    . ALA A 1 46  ? -8.180  5.087   -28.867 1.00 0.00 ? 46  ALA A O    1  
ATOM 685   C CB   . ALA A 1 46  ? -9.353  8.010   -30.364 1.00 0.00 ? 46  ALA A CB   1  
ATOM 686   H H    . ALA A 1 46  ? -10.382 8.499   -28.077 1.00 0.00 ? 46  ALA A H    1  
ATOM 687   H HA   . ALA A 1 46  ? -10.270 6.133   -29.749 1.00 0.00 ? 46  ALA A HA   1  
ATOM 688   H HB1  . ALA A 1 46  ? -10.265 8.540   -30.593 1.00 0.00 ? 46  ALA A HB1  1  
ATOM 689   H HB2  . ALA A 1 46  ? -8.628  8.707   -29.969 1.00 0.00 ? 46  ALA A HB2  1  
ATOM 690   H HB3  . ALA A 1 46  ? -8.962  7.566   -31.268 1.00 0.00 ? 46  ALA A HB3  1  
ATOM 691   N N    . GLU A 1 47  ? -7.372  7.124   -28.564 1.00 0.00 ? 47  GLU A N    1  
ATOM 692   C CA   . GLU A 1 47  ? -6.066  6.581   -28.133 1.00 0.00 ? 47  GLU A CA   1  
ATOM 693   C C    . GLU A 1 47  ? -6.275  5.634   -26.970 1.00 0.00 ? 47  GLU A C    1  
ATOM 694   O O    . GLU A 1 47  ? -5.654  4.593   -26.887 1.00 0.00 ? 47  GLU A O    1  
ATOM 695   C CB   . GLU A 1 47  ? -5.173  7.747   -27.683 1.00 0.00 ? 47  GLU A CB   1  
ATOM 696   C CG   . GLU A 1 47  ? -3.707  7.350   -27.858 1.00 0.00 ? 47  GLU A CG   1  
ATOM 697   C CD   . GLU A 1 47  ? -2.812  8.496   -27.385 1.00 0.00 ? 47  GLU A CD   1  
ATOM 698   O OE1  . GLU A 1 47  ? -3.113  9.015   -26.322 1.00 0.00 ? 47  GLU A OE1  1  
ATOM 699   O OE2  . GLU A 1 47  ? -1.877  8.788   -28.112 1.00 0.00 ? 47  GLU A OE2  1  
ATOM 700   H H    . GLU A 1 47  ? -7.524  8.092   -28.599 1.00 0.00 ? 47  GLU A H    1  
ATOM 701   H HA   . GLU A 1 47  ? -5.615  6.033   -28.960 1.00 0.00 ? 47  GLU A HA   1  
ATOM 702   H HB2  . GLU A 1 47  ? -5.386  8.621   -28.283 1.00 0.00 ? 47  GLU A HB2  1  
ATOM 703   H HB3  . GLU A 1 47  ? -5.366  7.975   -26.646 1.00 0.00 ? 47  GLU A HB3  1  
ATOM 704   H HG2  . GLU A 1 47  ? -3.496  6.467   -27.275 1.00 0.00 ? 47  GLU A HG2  1  
ATOM 705   H HG3  . GLU A 1 47  ? -3.506  7.146   -28.899 1.00 0.00 ? 47  GLU A HG3  1  
ATOM 706   N N    . LEU A 1 48  ? -7.152  6.018   -26.090 1.00 0.00 ? 48  LEU A N    1  
ATOM 707   C CA   . LEU A 1 48  ? -7.433  5.164   -24.922 1.00 0.00 ? 48  LEU A CA   1  
ATOM 708   C C    . LEU A 1 48  ? -7.788  3.767   -25.393 1.00 0.00 ? 48  LEU A C    1  
ATOM 709   O O    . LEU A 1 48  ? -7.389  2.783   -24.799 1.00 0.00 ? 48  LEU A O    1  
ATOM 710   C CB   . LEU A 1 48  ? -8.635  5.765   -24.180 1.00 0.00 ? 48  LEU A CB   1  
ATOM 711   C CG   . LEU A 1 48  ? -8.823  5.045   -22.846 1.00 0.00 ? 48  LEU A CG   1  
ATOM 712   C CD1  . LEU A 1 48  ? -7.820  5.594   -21.830 1.00 0.00 ? 48  LEU A CD1  1  
ATOM 713   C CD2  . LEU A 1 48  ? -10.240 5.303   -22.339 1.00 0.00 ? 48  LEU A CD2  1  
ATOM 714   H H    . LEU A 1 48  ? -7.621  6.871   -26.202 1.00 0.00 ? 48  LEU A H    1  
ATOM 715   H HA   . LEU A 1 48  ? -6.553  5.119   -24.279 1.00 0.00 ? 48  LEU A HA   1  
ATOM 716   H HB2  . LEU A 1 48  ? -8.462  6.817   -24.003 1.00 0.00 ? 48  LEU A HB2  1  
ATOM 717   H HB3  . LEU A 1 48  ? -9.526  5.651   -24.782 1.00 0.00 ? 48  LEU A HB3  1  
ATOM 718   H HG   . LEU A 1 48  ? -8.669  3.985   -22.977 1.00 0.00 ? 48  LEU A HG   1  
ATOM 719   H HD11 . LEU A 1 48  ? -7.845  6.673   -21.839 1.00 0.00 ? 48  LEU A HD11 1  
ATOM 720   H HD12 . LEU A 1 48  ? -8.075  5.240   -20.841 1.00 0.00 ? 48  LEU A HD12 1  
ATOM 721   H HD13 . LEU A 1 48  ? -6.825  5.258   -22.082 1.00 0.00 ? 48  LEU A HD13 1  
ATOM 722   H HD21 . LEU A 1 48  ? -10.957 4.973   -23.076 1.00 0.00 ? 48  LEU A HD21 1  
ATOM 723   H HD22 . LEU A 1 48  ? -10.402 4.764   -21.418 1.00 0.00 ? 48  LEU A HD22 1  
ATOM 724   H HD23 . LEU A 1 48  ? -10.374 6.360   -22.162 1.00 0.00 ? 48  LEU A HD23 1  
ATOM 725   N N    . GLN A 1 49  ? -8.531  3.706   -26.467 1.00 0.00 ? 49  GLN A N    1  
ATOM 726   C CA   . GLN A 1 49  ? -8.927  2.388   -27.001 1.00 0.00 ? 49  GLN A CA   1  
ATOM 727   C C    . GLN A 1 49  ? -7.733  1.696   -27.643 1.00 0.00 ? 49  GLN A C    1  
ATOM 728   O O    . GLN A 1 49  ? -7.650  0.484   -27.656 1.00 0.00 ? 49  GLN A O    1  
ATOM 729   C CB   . GLN A 1 49  ? -10.013 2.604   -28.066 1.00 0.00 ? 49  GLN A CB   1  
ATOM 730   C CG   . GLN A 1 49  ? -10.511 1.245   -28.560 1.00 0.00 ? 49  GLN A CG   1  
ATOM 731   C CD   . GLN A 1 49  ? -11.074 0.451   -27.380 1.00 0.00 ? 49  GLN A CD   1  
ATOM 732   O OE1  . GLN A 1 49  ? -11.053 -0.763  -27.368 1.00 0.00 ? 49  GLN A OE1  1  
ATOM 733   N NE2  . GLN A 1 49  ? -11.585 1.098   -26.368 1.00 0.00 ? 49  GLN A NE2  1  
ATOM 734   H H    . GLN A 1 49  ? -8.823  4.530   -26.916 1.00 0.00 ? 49  GLN A H    1  
ATOM 735   H HA   . GLN A 1 49  ? -9.300  1.771   -26.184 1.00 0.00 ? 49  GLN A HA   1  
ATOM 736   H HB2  . GLN A 1 49  ? -10.836 3.157   -27.638 1.00 0.00 ? 49  GLN A HB2  1  
ATOM 737   H HB3  . GLN A 1 49  ? -9.604  3.164   -28.895 1.00 0.00 ? 49  GLN A HB3  1  
ATOM 738   H HG2  . GLN A 1 49  ? -11.287 1.386   -29.298 1.00 0.00 ? 49  GLN A HG2  1  
ATOM 739   H HG3  . GLN A 1 49  ? -9.693  0.695   -29.003 1.00 0.00 ? 49  GLN A HG3  1  
ATOM 740   H HE21 . GLN A 1 49  ? -11.606 2.076   -26.372 1.00 0.00 ? 49  GLN A HE21 1  
ATOM 741   H HE22 . GLN A 1 49  ? -11.950 0.602   -25.604 1.00 0.00 ? 49  GLN A HE22 1  
ATOM 742   N N    . ASP A 1 50  ? -6.824  2.479   -28.168 1.00 0.00 ? 50  ASP A N    1  
ATOM 743   C CA   . ASP A 1 50  ? -5.634  1.873   -28.810 1.00 0.00 ? 50  ASP A CA   1  
ATOM 744   C C    . ASP A 1 50  ? -4.846  1.046   -27.802 1.00 0.00 ? 50  ASP A C    1  
ATOM 745   O O    . ASP A 1 50  ? -4.316  0.003   -28.128 1.00 0.00 ? 50  ASP A O    1  
ATOM 746   C CB   . ASP A 1 50  ? -4.738  3.003   -29.336 1.00 0.00 ? 50  ASP A CB   1  
ATOM 747   C CG   . ASP A 1 50  ? -4.006  2.523   -30.590 1.00 0.00 ? 50  ASP A CG   1  
ATOM 748   O OD1  . ASP A 1 50  ? -4.669  1.890   -31.396 1.00 0.00 ? 50  ASP A OD1  1  
ATOM 749   O OD2  . ASP A 1 50  ? -2.825  2.817   -30.673 1.00 0.00 ? 50  ASP A OD2  1  
ATOM 750   H H    . ASP A 1 50  ? -6.928  3.457   -28.138 1.00 0.00 ? 50  ASP A H    1  
ATOM 751   H HA   . ASP A 1 50  ? -5.960  1.226   -29.621 1.00 0.00 ? 50  ASP A HA   1  
ATOM 752   H HB2  . ASP A 1 50  ? -5.341  3.864   -29.582 1.00 0.00 ? 50  ASP A HB2  1  
ATOM 753   H HB3  . ASP A 1 50  ? -4.015  3.278   -28.583 1.00 0.00 ? 50  ASP A HB3  1  
ATOM 754   N N    . MET A 1 51  ? -4.783  1.531   -26.591 1.00 0.00 ? 51  MET A N    1  
ATOM 755   C CA   . MET A 1 51  ? -4.036  0.789   -25.544 1.00 0.00 ? 51  MET A CA   1  
ATOM 756   C C    . MET A 1 51  ? -4.822  -0.424  -25.089 1.00 0.00 ? 51  MET A C    1  
ATOM 757   O O    . MET A 1 51  ? -4.270  -1.490  -24.901 1.00 0.00 ? 51  MET A O    1  
ATOM 758   C CB   . MET A 1 51  ? -3.821  1.723   -24.344 1.00 0.00 ? 51  MET A CB   1  
ATOM 759   C CG   . MET A 1 51  ? -2.937  2.900   -24.770 1.00 0.00 ? 51  MET A CG   1  
ATOM 760   S SD   . MET A 1 51  ? -3.742  4.505   -24.996 1.00 0.00 ? 51  MET A SD   1  
ATOM 761   C CE   . MET A 1 51  ? -3.629  5.059   -23.276 1.00 0.00 ? 51  MET A CE   1  
ATOM 762   H H    . MET A 1 51  ? -5.225  2.378   -26.374 1.00 0.00 ? 51  MET A H    1  
ATOM 763   H HA   . MET A 1 51  ? -3.089  0.455   -25.951 1.00 0.00 ? 51  MET A HA   1  
ATOM 764   H HB2  . MET A 1 51  ? -4.774  2.094   -23.997 1.00 0.00 ? 51  MET A HB2  1  
ATOM 765   H HB3  . MET A 1 51  ? -3.340  1.182   -23.546 1.00 0.00 ? 51  MET A HB3  1  
ATOM 766   H HG2  . MET A 1 51  ? -2.162  3.024   -24.027 1.00 0.00 ? 51  MET A HG2  1  
ATOM 767   H HG3  . MET A 1 51  ? -2.455  2.642   -25.702 1.00 0.00 ? 51  MET A HG3  1  
ATOM 768   H HE1  . MET A 1 51  ? -3.821  4.226   -22.616 1.00 0.00 ? 51  MET A HE1  1  
ATOM 769   H HE2  . MET A 1 51  ? -2.641  5.448   -23.086 1.00 0.00 ? 51  MET A HE2  1  
ATOM 770   H HE3  . MET A 1 51  ? -4.361  5.834   -23.098 1.00 0.00 ? 51  MET A HE3  1  
ATOM 771   N N    . ILE A 1 52  ? -6.099  -0.245  -24.916 1.00 0.00 ? 52  ILE A N    1  
ATOM 772   C CA   . ILE A 1 52  ? -6.929  -1.384  -24.474 1.00 0.00 ? 52  ILE A CA   1  
ATOM 773   C C    . ILE A 1 52  ? -6.828  -2.523  -25.466 1.00 0.00 ? 52  ILE A C    1  
ATOM 774   O O    . ILE A 1 52  ? -6.539  -3.643  -25.104 1.00 0.00 ? 52  ILE A O    1  
ATOM 775   C CB   . ILE A 1 52  ? -8.372  -0.925  -24.399 1.00 0.00 ? 52  ILE A CB   1  
ATOM 776   C CG1  . ILE A 1 52  ? -8.592  -0.195  -23.092 1.00 0.00 ? 52  ILE A CG1  1  
ATOM 777   C CG2  . ILE A 1 52  ? -9.288  -2.160  -24.430 1.00 0.00 ? 52  ILE A CG2  1  
ATOM 778   C CD1  . ILE A 1 52  ? -9.649  0.871   -23.303 1.00 0.00 ? 52  ILE A CD1  1  
ATOM 779   H H    . ILE A 1 52  ? -6.504  0.633   -25.080 1.00 0.00 ? 52  ILE A H    1  
ATOM 780   H HA   . ILE A 1 52  ? -6.582  -1.720  -23.504 1.00 0.00 ? 52  ILE A HA   1  
ATOM 781   H HB   . ILE A 1 52  ? -8.586  -0.254  -25.232 1.00 0.00 ? 52  ILE A HB   1  
ATOM 782   H HG12 . ILE A 1 52  ? -8.923  -0.892  -22.338 1.00 0.00 ? 52  ILE A HG12 1  
ATOM 783   H HG13 . ILE A 1 52  ? -7.670  0.263   -22.772 1.00 0.00 ? 52  ILE A HG13 1  
ATOM 784   H HG21 . ILE A 1 52  ? -8.883  -2.931  -23.791 1.00 0.00 ? 52  ILE A HG21 1  
ATOM 785   H HG22 . ILE A 1 52  ? -10.274 -1.891  -24.081 1.00 0.00 ? 52  ILE A HG22 1  
ATOM 786   H HG23 . ILE A 1 52  ? -9.358  -2.535  -25.440 1.00 0.00 ? 52  ILE A HG23 1  
ATOM 787   H HD11 . ILE A 1 52  ? -10.532 0.425   -23.734 1.00 0.00 ? 52  ILE A HD11 1  
ATOM 788   H HD12 . ILE A 1 52  ? -9.901  1.321   -22.359 1.00 0.00 ? 52  ILE A HD12 1  
ATOM 789   H HD13 . ILE A 1 52  ? -9.270  1.628   -23.971 1.00 0.00 ? 52  ILE A HD13 1  
ATOM 790   N N    . ASN A 1 53  ? -7.070  -2.211  -26.707 1.00 0.00 ? 53  ASN A N    1  
ATOM 791   C CA   . ASN A 1 53  ? -6.994  -3.259  -27.751 1.00 0.00 ? 53  ASN A CA   1  
ATOM 792   C C    . ASN A 1 53  ? -5.773  -4.148  -27.534 1.00 0.00 ? 53  ASN A C    1  
ATOM 793   O O    . ASN A 1 53  ? -5.753  -5.290  -27.947 1.00 0.00 ? 53  ASN A O    1  
ATOM 794   C CB   . ASN A 1 53  ? -6.872  -2.569  -29.120 1.00 0.00 ? 53  ASN A CB   1  
ATOM 795   C CG   . ASN A 1 53  ? -7.022  -3.611  -30.229 1.00 0.00 ? 53  ASN A CG   1  
ATOM 796   O OD1  . ASN A 1 53  ? -7.362  -4.751  -29.984 1.00 0.00 ? 53  ASN A OD1  1  
ATOM 797   N ND2  . ASN A 1 53  ? -6.780  -3.260  -31.462 1.00 0.00 ? 53  ASN A ND2  1  
ATOM 798   H H    . ASN A 1 53  ? -7.306  -1.290  -26.947 1.00 0.00 ? 53  ASN A H    1  
ATOM 799   H HA   . ASN A 1 53  ? -7.894  -3.872  -27.706 1.00 0.00 ? 53  ASN A HA   1  
ATOM 800   H HB2  . ASN A 1 53  ? -7.649  -1.824  -29.224 1.00 0.00 ? 53  ASN A HB2  1  
ATOM 801   H HB3  . ASN A 1 53  ? -5.908  -2.092  -29.205 1.00 0.00 ? 53  ASN A HB3  1  
ATOM 802   H HD21 . ASN A 1 53  ? -6.508  -2.341  -31.665 1.00 0.00 ? 53  ASN A HD21 1  
ATOM 803   H HD22 . ASN A 1 53  ? -6.872  -3.916  -32.184 1.00 0.00 ? 53  ASN A HD22 1  
ATOM 804   N N    . GLU A 1 54  ? -4.773  -3.604  -26.884 1.00 0.00 ? 54  GLU A N    1  
ATOM 805   C CA   . GLU A 1 54  ? -3.550  -4.406  -26.631 1.00 0.00 ? 54  GLU A CA   1  
ATOM 806   C C    . GLU A 1 54  ? -3.692  -5.233  -25.352 1.00 0.00 ? 54  GLU A C    1  
ATOM 807   O O    . GLU A 1 54  ? -3.764  -6.446  -25.398 1.00 0.00 ? 54  GLU A O    1  
ATOM 808   C CB   . GLU A 1 54  ? -2.367  -3.438  -26.464 1.00 0.00 ? 54  GLU A CB   1  
ATOM 809   C CG   . GLU A 1 54  ? -1.058  -4.187  -26.727 1.00 0.00 ? 54  GLU A CG   1  
ATOM 810   C CD   . GLU A 1 54  ? -0.807  -5.182  -25.592 1.00 0.00 ? 54  GLU A CD   1  
ATOM 811   O OE1  . GLU A 1 54  ? -0.548  -4.705  -24.499 1.00 0.00 ? 54  GLU A OE1  1  
ATOM 812   O OE2  . GLU A 1 54  ? -0.888  -6.365  -25.881 1.00 0.00 ? 54  GLU A OE2  1  
ATOM 813   H H    . GLU A 1 54  ? -4.826  -2.671  -26.576 1.00 0.00 ? 54  GLU A H    1  
ATOM 814   H HA   . GLU A 1 54  ? -3.386  -5.076  -27.472 1.00 0.00 ? 54  GLU A HA   1  
ATOM 815   H HB2  . GLU A 1 54  ? -2.465  -2.622  -27.163 1.00 0.00 ? 54  GLU A HB2  1  
ATOM 816   H HB3  . GLU A 1 54  ? -2.362  -3.043  -25.459 1.00 0.00 ? 54  GLU A HB3  1  
ATOM 817   H HG2  . GLU A 1 54  ? -1.122  -4.721  -27.663 1.00 0.00 ? 54  GLU A HG2  1  
ATOM 818   H HG3  . GLU A 1 54  ? -0.237  -3.485  -26.773 1.00 0.00 ? 54  GLU A HG3  1  
ATOM 819   N N    . VAL A 1 55  ? -3.732  -4.558  -24.233 1.00 0.00 ? 55  VAL A N    1  
ATOM 820   C CA   . VAL A 1 55  ? -3.869  -5.277  -22.940 1.00 0.00 ? 55  VAL A CA   1  
ATOM 821   C C    . VAL A 1 55  ? -5.145  -6.114  -22.897 1.00 0.00 ? 55  VAL A C    1  
ATOM 822   O O    . VAL A 1 55  ? -5.490  -6.664  -21.869 1.00 0.00 ? 55  VAL A O    1  
ATOM 823   C CB   . VAL A 1 55  ? -3.935  -4.232  -21.822 1.00 0.00 ? 55  VAL A CB   1  
ATOM 824   C CG1  . VAL A 1 55  ? -2.741  -3.283  -21.944 1.00 0.00 ? 55  VAL A CG1  1  
ATOM 825   C CG2  . VAL A 1 55  ? -5.235  -3.434  -21.960 1.00 0.00 ? 55  VAL A CG2  1  
ATOM 826   H H    . VAL A 1 55  ? -3.671  -3.580  -24.244 1.00 0.00 ? 55  VAL A H    1  
ATOM 827   H HA   . VAL A 1 55  ? -3.009  -5.933  -22.805 1.00 0.00 ? 55  VAL A HA   1  
ATOM 828   H HB   . VAL A 1 55  ? -3.912  -4.724  -20.865 1.00 0.00 ? 55  VAL A HB   1  
ATOM 829   H HG11 . VAL A 1 55  ? -2.704  -2.870  -22.941 1.00 0.00 ? 55  VAL A HG11 1  
ATOM 830   H HG12 . VAL A 1 55  ? -2.839  -2.478  -21.229 1.00 0.00 ? 55  VAL A HG12 1  
ATOM 831   H HG13 . VAL A 1 55  ? -1.826  -3.822  -21.749 1.00 0.00 ? 55  VAL A HG13 1  
ATOM 832   H HG21 . VAL A 1 55  ? -5.712  -3.675  -22.898 1.00 0.00 ? 55  VAL A HG21 1  
ATOM 833   H HG22 . VAL A 1 55  ? -5.903  -3.682  -21.148 1.00 0.00 ? 55  VAL A HG22 1  
ATOM 834   H HG23 . VAL A 1 55  ? -5.019  -2.378  -21.933 1.00 0.00 ? 55  VAL A HG23 1  
ATOM 835   N N    . ASP A 1 56  ? -5.821  -6.198  -24.005 1.00 0.00 ? 56  ASP A N    1  
ATOM 836   C CA   . ASP A 1 56  ? -7.071  -6.995  -24.030 1.00 0.00 ? 56  ASP A CA   1  
ATOM 837   C C    . ASP A 1 56  ? -6.756  -8.472  -24.207 1.00 0.00 ? 56  ASP A C    1  
ATOM 838   O O    . ASP A 1 56  ? -7.531  -9.212  -24.785 1.00 0.00 ? 56  ASP A O    1  
ATOM 839   C CB   . ASP A 1 56  ? -7.930  -6.520  -25.212 1.00 0.00 ? 56  ASP A CB   1  
ATOM 840   C CG   . ASP A 1 56  ? -7.247  -6.905  -26.524 1.00 0.00 ? 56  ASP A CG   1  
ATOM 841   O OD1  . ASP A 1 56  ? -6.143  -7.413  -26.431 1.00 0.00 ? 56  ASP A OD1  1  
ATOM 842   O OD2  . ASP A 1 56  ? -7.867  -6.668  -27.546 1.00 0.00 ? 56  ASP A OD2  1  
ATOM 843   H H    . ASP A 1 56  ? -5.508  -5.747  -24.810 1.00 0.00 ? 56  ASP A H    1  
ATOM 844   H HA   . ASP A 1 56  ? -7.596  -6.857  -23.087 1.00 0.00 ? 56  ASP A HA   1  
ATOM 845   H HB2  . ASP A 1 56  ? -8.904  -6.986  -25.165 1.00 0.00 ? 56  ASP A HB2  1  
ATOM 846   H HB3  . ASP A 1 56  ? -8.047  -5.449  -25.169 1.00 0.00 ? 56  ASP A HB3  1  
ATOM 847   N N    . ALA A 1 57  ? -5.614  -8.869  -23.706 1.00 0.00 ? 57  ALA A N    1  
ATOM 848   C CA   . ALA A 1 57  ? -5.206  -10.293 -23.822 1.00 0.00 ? 57  ALA A CA   1  
ATOM 849   C C    . ALA A 1 57  ? -4.676  -10.809 -22.497 1.00 0.00 ? 57  ALA A C    1  
ATOM 850   O O    . ALA A 1 57  ? -3.917  -11.756 -22.456 1.00 0.00 ? 57  ALA A O    1  
ATOM 851   C CB   . ALA A 1 57  ? -4.079  -10.388 -24.854 1.00 0.00 ? 57  ALA A CB   1  
ATOM 852   H H    . ALA A 1 57  ? -5.031  -8.229  -23.259 1.00 0.00 ? 57  ALA A H    1  
ATOM 853   H HA   . ALA A 1 57  ? -6.058  -10.891 -24.120 1.00 0.00 ? 57  ALA A HA   1  
ATOM 854   H HB1  . ALA A 1 57  ? -4.195  -9.610  -25.591 1.00 0.00 ? 57  ALA A HB1  1  
ATOM 855   H HB2  . ALA A 1 57  ? -3.123  -10.273 -24.360 1.00 0.00 ? 57  ALA A HB2  1  
ATOM 856   H HB3  . ALA A 1 57  ? -4.113  -11.350 -25.342 1.00 0.00 ? 57  ALA A HB3  1  
ATOM 857   N N    . ASP A 1 58  ? -5.082  -10.181 -21.434 1.00 0.00 ? 58  ASP A N    1  
ATOM 858   C CA   . ASP A 1 58  ? -4.605  -10.631 -20.112 1.00 0.00 ? 58  ASP A CA   1  
ATOM 859   C C    . ASP A 1 58  ? -5.278  -11.937 -19.703 1.00 0.00 ? 58  ASP A C    1  
ATOM 860   O O    . ASP A 1 58  ? -4.763  -12.667 -18.878 1.00 0.00 ? 58  ASP A O    1  
ATOM 861   C CB   . ASP A 1 58  ? -4.946  -9.547  -19.077 1.00 0.00 ? 58  ASP A CB   1  
ATOM 862   C CG   . ASP A 1 58  ? -4.806  -10.128 -17.670 1.00 0.00 ? 58  ASP A CG   1  
ATOM 863   O OD1  . ASP A 1 58  ? -3.667  -10.283 -17.261 1.00 0.00 ? 58  ASP A OD1  1  
ATOM 864   O OD2  . ASP A 1 58  ? -5.844  -10.384 -17.084 1.00 0.00 ? 58  ASP A OD2  1  
ATOM 865   H H    . ASP A 1 58  ? -5.695  -9.420  -21.509 1.00 0.00 ? 58  ASP A H    1  
ATOM 866   H HA   . ASP A 1 58  ? -3.528  -10.788 -20.169 1.00 0.00 ? 58  ASP A HA   1  
ATOM 867   H HB2  . ASP A 1 58  ? -4.273  -8.709  -19.186 1.00 0.00 ? 58  ASP A HB2  1  
ATOM 868   H HB3  . ASP A 1 58  ? -5.962  -9.209  -19.223 1.00 0.00 ? 58  ASP A HB3  1  
ATOM 869   N N    . GLY A 1 59  ? -6.421  -12.206 -20.292 1.00 0.00 ? 59  GLY A N    1  
ATOM 870   C CA   . GLY A 1 59  ? -7.158  -13.465 -19.958 1.00 0.00 ? 59  GLY A CA   1  
ATOM 871   C C    . GLY A 1 59  ? -8.514  -13.132 -19.333 1.00 0.00 ? 59  GLY A C    1  
ATOM 872   O O    . GLY A 1 59  ? -9.521  -13.718 -19.677 1.00 0.00 ? 59  GLY A O    1  
ATOM 873   H H    . GLY A 1 59  ? -6.791  -11.581 -20.950 1.00 0.00 ? 59  GLY A H    1  
ATOM 874   H HA2  . GLY A 1 59  ? -7.314  -14.037 -20.861 1.00 0.00 ? 59  GLY A HA2  1  
ATOM 875   H HA3  . GLY A 1 59  ? -6.580  -14.052 -19.261 1.00 0.00 ? 59  GLY A HA3  1  
ATOM 876   N N    . ASN A 1 60  ? -8.511  -12.194 -18.425 1.00 0.00 ? 60  ASN A N    1  
ATOM 877   C CA   . ASN A 1 60  ? -9.785  -11.810 -17.771 1.00 0.00 ? 60  ASN A CA   1  
ATOM 878   C C    . ASN A 1 60  ? -10.431 -10.646 -18.504 1.00 0.00 ? 60  ASN A C    1  
ATOM 879   O O    . ASN A 1 60  ? -11.635 -10.489 -18.486 1.00 0.00 ? 60  ASN A O    1  
ATOM 880   C CB   . ASN A 1 60  ? -9.480  -11.373 -16.329 1.00 0.00 ? 60  ASN A CB   1  
ATOM 881   C CG   . ASN A 1 60  ? -8.791  -12.518 -15.587 1.00 0.00 ? 60  ASN A CG   1  
ATOM 882   O OD1  . ASN A 1 60  ? -8.463  -13.537 -16.161 1.00 0.00 ? 60  ASN A OD1  1  
ATOM 883   N ND2  . ASN A 1 60  ? -8.554  -12.390 -14.311 1.00 0.00 ? 60  ASN A ND2  1  
ATOM 884   H H    . ASN A 1 60  ? -7.674  -11.746 -18.181 1.00 0.00 ? 60  ASN A H    1  
ATOM 885   H HA   . ASN A 1 60  ? -10.464 -12.662 -17.784 1.00 0.00 ? 60  ASN A HA   1  
ATOM 886   H HB2  . ASN A 1 60  ? -8.830  -10.511 -16.338 1.00 0.00 ? 60  ASN A HB2  1  
ATOM 887   H HB3  . ASN A 1 60  ? -10.400 -11.122 -15.822 1.00 0.00 ? 60  ASN A HB3  1  
ATOM 888   H HD21 . ASN A 1 60  ? -8.816  -11.570 -13.844 1.00 0.00 ? 60  ASN A HD21 1  
ATOM 889   H HD22 . ASN A 1 60  ? -8.113  -13.114 -13.820 1.00 0.00 ? 60  ASN A HD22 1  
ATOM 890   N N    . GLY A 1 61  ? -9.612  -9.849  -19.137 1.00 0.00 ? 61  GLY A N    1  
ATOM 891   C CA   . GLY A 1 61  ? -10.155 -8.681  -19.885 1.00 0.00 ? 61  GLY A CA   1  
ATOM 892   C C    . GLY A 1 61  ? -10.048 -7.415  -19.037 1.00 0.00 ? 61  GLY A C    1  
ATOM 893   O O    . GLY A 1 61  ? -10.253 -6.321  -19.524 1.00 0.00 ? 61  GLY A O    1  
ATOM 894   H H    . GLY A 1 61  ? -8.648  -10.018 -19.119 1.00 0.00 ? 61  GLY A H    1  
ATOM 895   H HA2  . GLY A 1 61  ? -9.591  -8.548  -20.797 1.00 0.00 ? 61  GLY A HA2  1  
ATOM 896   H HA3  . GLY A 1 61  ? -11.191 -8.861  -20.130 1.00 0.00 ? 61  GLY A HA3  1  
ATOM 897   N N    . THR A 1 62  ? -9.726  -7.593  -17.781 1.00 0.00 ? 62  THR A N    1  
ATOM 898   C CA   . THR A 1 62  ? -9.602  -6.417  -16.886 1.00 0.00 ? 62  THR A CA   1  
ATOM 899   C C    . THR A 1 62  ? -8.155  -5.953  -16.782 1.00 0.00 ? 62  THR A C    1  
ATOM 900   O O    . THR A 1 62  ? -7.241  -6.671  -17.140 1.00 0.00 ? 62  THR A O    1  
ATOM 901   C CB   . THR A 1 62  ? -10.092 -6.818  -15.493 1.00 0.00 ? 62  THR A CB   1  
ATOM 902   O OG1  . THR A 1 62  ? -9.410  -8.017  -15.185 1.00 0.00 ? 62  THR A OG1  1  
ATOM 903   C CG2  . THR A 1 62  ? -11.575 -7.214  -15.532 1.00 0.00 ? 62  THR A CG2  1  
ATOM 904   H H    . THR A 1 62  ? -9.569  -8.497  -17.435 1.00 0.00 ? 62  THR A H    1  
ATOM 905   H HA   . THR A 1 62  ? -10.206 -5.603  -17.286 1.00 0.00 ? 62  THR A HA   1  
ATOM 906   H HB   . THR A 1 62  ? -9.880  -6.049  -14.755 1.00 0.00 ? 62  THR A HB   1  
ATOM 907   H HG1  . THR A 1 62  ? -9.063  -8.380  -16.003 1.00 0.00 ? 62  THR A HG1  1  
ATOM 908   H HG21 . THR A 1 62  ? -12.068 -6.700  -16.344 1.00 0.00 ? 62  THR A HG21 1  
ATOM 909   H HG22 . THR A 1 62  ? -11.664 -8.280  -15.679 1.00 0.00 ? 62  THR A HG22 1  
ATOM 910   H HG23 . THR A 1 62  ? -12.049 -6.943  -14.600 1.00 0.00 ? 62  THR A HG23 1  
ATOM 911   N N    . ILE A 1 63  ? -7.984  -4.752  -16.289 1.00 0.00 ? 63  ILE A N    1  
ATOM 912   C CA   . ILE A 1 63  ? -6.614  -4.188  -16.140 1.00 0.00 ? 63  ILE A CA   1  
ATOM 913   C C    . ILE A 1 63  ? -6.237  -4.016  -14.666 1.00 0.00 ? 63  ILE A C    1  
ATOM 914   O O    . ILE A 1 63  ? -7.019  -3.527  -13.876 1.00 0.00 ? 63  ILE A O    1  
ATOM 915   C CB   . ILE A 1 63  ? -6.608  -2.813  -16.797 1.00 0.00 ? 63  ILE A CB   1  
ATOM 916   C CG1  . ILE A 1 63  ? -7.182  -2.905  -18.201 1.00 0.00 ? 63  ILE A CG1  1  
ATOM 917   C CG2  . ILE A 1 63  ? -5.160  -2.327  -16.897 1.00 0.00 ? 63  ILE A CG2  1  
ATOM 918   C CD1  . ILE A 1 63  ? -6.813  -1.637  -18.971 1.00 0.00 ? 63  ILE A CD1  1  
ATOM 919   H H    . ILE A 1 63  ? -8.757  -4.223  -16.023 1.00 0.00 ? 63  ILE A H    1  
ATOM 920   H HA   . ILE A 1 63  ? -5.896  -4.846  -16.618 1.00 0.00 ? 63  ILE A HA   1  
ATOM 921   H HB   . ILE A 1 63  ? -7.211  -2.127  -16.204 1.00 0.00 ? 63  ILE A HB   1  
ATOM 922   H HG12 . ILE A 1 63  ? -6.774  -3.769  -18.704 1.00 0.00 ? 63  ILE A HG12 1  
ATOM 923   H HG13 . ILE A 1 63  ? -8.257  -3.000  -18.148 1.00 0.00 ? 63  ILE A HG13 1  
ATOM 924   H HG21 . ILE A 1 63  ? -4.672  -2.449  -15.945 1.00 0.00 ? 63  ILE A HG21 1  
ATOM 925   H HG22 . ILE A 1 63  ? -4.636  -2.902  -17.644 1.00 0.00 ? 63  ILE A HG22 1  
ATOM 926   H HG23 . ILE A 1 63  ? -5.146  -1.285  -17.174 1.00 0.00 ? 63  ILE A HG23 1  
ATOM 927   H HD11 . ILE A 1 63  ? -6.938  -0.776  -18.333 1.00 0.00 ? 63  ILE A HD11 1  
ATOM 928   H HD12 . ILE A 1 63  ? -5.784  -1.693  -19.294 1.00 0.00 ? 63  ILE A HD12 1  
ATOM 929   H HD13 . ILE A 1 63  ? -7.453  -1.536  -19.834 1.00 0.00 ? 63  ILE A HD13 1  
ATOM 930   N N    . ASP A 1 64  ? -5.037  -4.419  -14.331 1.00 0.00 ? 64  ASP A N    1  
ATOM 931   C CA   . ASP A 1 64  ? -4.581  -4.290  -12.918 1.00 0.00 ? 64  ASP A CA   1  
ATOM 932   C C    . ASP A 1 64  ? -3.884  -2.939  -12.703 1.00 0.00 ? 64  ASP A C    1  
ATOM 933   O O    . ASP A 1 64  ? -3.623  -2.226  -13.652 1.00 0.00 ? 64  ASP A O    1  
ATOM 934   C CB   . ASP A 1 64  ? -3.597  -5.435  -12.625 1.00 0.00 ? 64  ASP A CB   1  
ATOM 935   C CG   . ASP A 1 64  ? -4.251  -6.768  -13.001 1.00 0.00 ? 64  ASP A CG   1  
ATOM 936   O OD1  . ASP A 1 64  ? -5.400  -6.713  -13.410 1.00 0.00 ? 64  ASP A OD1  1  
ATOM 937   O OD2  . ASP A 1 64  ? -3.565  -7.766  -12.856 1.00 0.00 ? 64  ASP A OD2  1  
ATOM 938   H H    . ASP A 1 64  ? -4.439  -4.803  -15.006 1.00 0.00 ? 64  ASP A H    1  
ATOM 939   H HA   . ASP A 1 64  ? -5.454  -4.346  -12.258 1.00 0.00 ? 64  ASP A HA   1  
ATOM 940   H HB2  . ASP A 1 64  ? -2.697  -5.302  -13.208 1.00 0.00 ? 64  ASP A HB2  1  
ATOM 941   H HB3  . ASP A 1 64  ? -3.348  -5.446  -11.576 1.00 0.00 ? 64  ASP A HB3  1  
ATOM 942   N N    . PHE A 1 65  ? -3.591  -2.605  -11.463 1.00 0.00 ? 65  PHE A N    1  
ATOM 943   C CA   . PHE A 1 65  ? -2.917  -1.298  -11.207 1.00 0.00 ? 65  PHE A CA   1  
ATOM 944   C C    . PHE A 1 65  ? -1.582  -1.137  -11.962 1.00 0.00 ? 65  PHE A C    1  
ATOM 945   O O    . PHE A 1 65  ? -1.346  -0.106  -12.534 1.00 0.00 ? 65  PHE A O    1  
ATOM 946   C CB   . PHE A 1 65  ? -2.678  -1.103  -9.685  1.00 0.00 ? 65  PHE A CB   1  
ATOM 947   C CG   . PHE A 1 65  ? -1.989  0.250   -9.460  1.00 0.00 ? 65  PHE A CG   1  
ATOM 948   C CD1  . PHE A 1 65  ? -2.565  1.416   -9.933  1.00 0.00 ? 65  PHE A CD1  1  
ATOM 949   C CD2  . PHE A 1 65  ? -0.777  0.323   -8.789  1.00 0.00 ? 65  PHE A CD2  1  
ATOM 950   C CE1  . PHE A 1 65  ? -1.941  2.633   -9.739  1.00 0.00 ? 65  PHE A CE1  1  
ATOM 951   C CE2  . PHE A 1 65  ? -0.156  1.544   -8.597  1.00 0.00 ? 65  PHE A CE2  1  
ATOM 952   C CZ   . PHE A 1 65  ? -0.740  2.697   -9.073  1.00 0.00 ? 65  PHE A CZ   1  
ATOM 953   H H    . PHE A 1 65  ? -3.812  -3.202  -10.723 1.00 0.00 ? 65  PHE A H    1  
ATOM 954   H HA   . PHE A 1 65  ? -3.586  -0.515  -11.571 1.00 0.00 ? 65  PHE A HA   1  
ATOM 955   H HB2  . PHE A 1 65  ? -3.622  -1.109  -9.162  1.00 0.00 ? 65  PHE A HB2  1  
ATOM 956   H HB3  . PHE A 1 65  ? -2.061  -1.879  -9.296  1.00 0.00 ? 65  PHE A HB3  1  
ATOM 957   H HD1  . PHE A 1 65  ? -3.509  1.376   -10.454 1.00 0.00 ? 65  PHE A HD1  1  
ATOM 958   H HD2  . PHE A 1 65  ? -0.315  -0.579  -8.414  1.00 0.00 ? 65  PHE A HD2  1  
ATOM 959   H HE1  . PHE A 1 65  ? -2.396  3.538   -10.113 1.00 0.00 ? 65  PHE A HE1  1  
ATOM 960   H HE2  . PHE A 1 65  ? 0.787   1.593   -8.073  1.00 0.00 ? 65  PHE A HE2  1  
ATOM 961   H HZ   . PHE A 1 65  ? -0.254  3.651   -8.925  1.00 0.00 ? 65  PHE A HZ   1  
ATOM 962   N N    . PRO A 1 66  ? -0.727  -2.154  -11.972 1.00 0.00 ? 66  PRO A N    1  
ATOM 963   C CA   . PRO A 1 66  ? 0.546   -2.033  -12.677 1.00 0.00 ? 66  PRO A CA   1  
ATOM 964   C C    . PRO A 1 66  ? 0.316   -1.817  -14.165 1.00 0.00 ? 66  PRO A C    1  
ATOM 965   O O    . PRO A 1 66  ? 0.804   -0.872  -14.742 1.00 0.00 ? 66  PRO A O    1  
ATOM 966   C CB   . PRO A 1 66  ? 1.262   -3.378  -12.452 1.00 0.00 ? 66  PRO A CB   1  
ATOM 967   C CG   . PRO A 1 66  ? 0.289   -4.290  -11.645 1.00 0.00 ? 66  PRO A CG   1  
ATOM 968   C CD   . PRO A 1 66  ? -0.970  -3.459  -11.339 1.00 0.00 ? 66  PRO A CD   1  
ATOM 969   H HA   . PRO A 1 66  ? 1.117   -1.202  -12.267 1.00 0.00 ? 66  PRO A HA   1  
ATOM 970   H HB2  . PRO A 1 66  ? 1.497   -3.836  -13.402 1.00 0.00 ? 66  PRO A HB2  1  
ATOM 971   H HB3  . PRO A 1 66  ? 2.173   -3.221  -11.891 1.00 0.00 ? 66  PRO A HB3  1  
ATOM 972   H HG2  . PRO A 1 66  ? 0.027   -5.158  -12.231 1.00 0.00 ? 66  PRO A HG2  1  
ATOM 973   H HG3  . PRO A 1 66  ? 0.757   -4.604  -10.725 1.00 0.00 ? 66  PRO A HG3  1  
ATOM 974   H HD2  . PRO A 1 66  ? -1.834  -3.920  -11.767 1.00 0.00 ? 66  PRO A HD2  1  
ATOM 975   H HD3  . PRO A 1 66  ? -1.088  -3.353  -10.287 1.00 0.00 ? 66  PRO A HD3  1  
ATOM 976   N N    . GLU A 1 67  ? -0.425  -2.704  -14.758 1.00 0.00 ? 67  GLU A N    1  
ATOM 977   C CA   . GLU A 1 67  ? -0.698  -2.566  -16.203 1.00 0.00 ? 67  GLU A CA   1  
ATOM 978   C C    . GLU A 1 67  ? -1.209  -1.163  -16.505 1.00 0.00 ? 67  GLU A C    1  
ATOM 979   O O    . GLU A 1 67  ? -0.892  -0.588  -17.531 1.00 0.00 ? 67  GLU A O    1  
ATOM 980   C CB   . GLU A 1 67  ? -1.778  -3.590  -16.590 1.00 0.00 ? 67  GLU A CB   1  
ATOM 981   C CG   . GLU A 1 67  ? -1.264  -5.000  -16.284 1.00 0.00 ? 67  GLU A CG   1  
ATOM 982   C CD   . GLU A 1 67  ? -0.170  -5.370  -17.288 1.00 0.00 ? 67  GLU A CD   1  
ATOM 983   O OE1  . GLU A 1 67  ? 0.050   -4.557  -18.171 1.00 0.00 ? 67  GLU A OE1  1  
ATOM 984   O OE2  . GLU A 1 67  ? 0.383   -6.443  -17.116 1.00 0.00 ? 67  GLU A OE2  1  
ATOM 985   H H    . GLU A 1 67  ? -0.797  -3.454  -14.252 1.00 0.00 ? 67  GLU A H    1  
ATOM 986   H HA   . GLU A 1 67  ? 0.225   -2.738  -16.763 1.00 0.00 ? 67  GLU A HA   1  
ATOM 987   H HB2  . GLU A 1 67  ? -2.677  -3.401  -16.024 1.00 0.00 ? 67  GLU A HB2  1  
ATOM 988   H HB3  . GLU A 1 67  ? -2.000  -3.505  -17.643 1.00 0.00 ? 67  GLU A HB3  1  
ATOM 989   H HG2  . GLU A 1 67  ? -0.855  -5.031  -15.285 1.00 0.00 ? 67  GLU A HG2  1  
ATOM 990   H HG3  . GLU A 1 67  ? -2.074  -5.711  -16.360 1.00 0.00 ? 67  GLU A HG3  1  
ATOM 991   N N    . PHE A 1 68  ? -1.990  -0.631  -15.596 1.00 0.00 ? 68  PHE A N    1  
ATOM 992   C CA   . PHE A 1 68  ? -2.528  0.729   -15.811 1.00 0.00 ? 68  PHE A CA   1  
ATOM 993   C C    . PHE A 1 68  ? -1.394  1.755   -15.790 1.00 0.00 ? 68  PHE A C    1  
ATOM 994   O O    . PHE A 1 68  ? -1.454  2.749   -16.475 1.00 0.00 ? 68  PHE A O    1  
ATOM 995   C CB   . PHE A 1 68  ? -3.539  1.036   -14.686 1.00 0.00 ? 68  PHE A CB   1  
ATOM 996   C CG   . PHE A 1 68  ? -3.819  2.538   -14.615 1.00 0.00 ? 68  PHE A CG   1  
ATOM 997   C CD1  . PHE A 1 68  ? -4.762  3.117   -15.446 1.00 0.00 ? 68  PHE A CD1  1  
ATOM 998   C CD2  . PHE A 1 68  ? -3.161  3.329   -13.691 1.00 0.00 ? 68  PHE A CD2  1  
ATOM 999   C CE1  . PHE A 1 68  ? -5.046  4.467   -15.349 1.00 0.00 ? 68  PHE A CE1  1  
ATOM 1000  C CE2  . PHE A 1 68  ? -3.444  4.680   -13.596 1.00 0.00 ? 68  PHE A CE2  1  
ATOM 1001  C CZ   . PHE A 1 68  ? -4.386  5.249   -14.425 1.00 0.00 ? 68  PHE A CZ   1  
ATOM 1002  H H    . PHE A 1 68  ? -2.214  -1.129  -14.780 1.00 0.00 ? 68  PHE A H    1  
ATOM 1003  H HA   . PHE A 1 68  ? -3.016  0.762   -16.790 1.00 0.00 ? 68  PHE A HA   1  
ATOM 1004  H HB2  . PHE A 1 68  ? -4.465  0.515   -14.882 1.00 0.00 ? 68  PHE A HB2  1  
ATOM 1005  H HB3  . PHE A 1 68  ? -3.146  0.707   -13.744 1.00 0.00 ? 68  PHE A HB3  1  
ATOM 1006  H HD1  . PHE A 1 68  ? -5.274  2.510   -16.179 1.00 0.00 ? 68  PHE A HD1  1  
ATOM 1007  H HD2  . PHE A 1 68  ? -2.427  2.886   -13.036 1.00 0.00 ? 68  PHE A HD2  1  
ATOM 1008  H HE1  . PHE A 1 68  ? -5.796  4.907   -15.989 1.00 0.00 ? 68  PHE A HE1  1  
ATOM 1009  H HE2  . PHE A 1 68  ? -2.927  5.289   -12.869 1.00 0.00 ? 68  PHE A HE2  1  
ATOM 1010  H HZ   . PHE A 1 68  ? -4.610  6.310   -14.348 1.00 0.00 ? 68  PHE A HZ   1  
ATOM 1011  N N    . LEU A 1 69  ? -0.368  1.493   -15.001 1.00 0.00 ? 69  LEU A N    1  
ATOM 1012  C CA   . LEU A 1 69  ? 0.766   2.462   -14.949 1.00 0.00 ? 69  LEU A CA   1  
ATOM 1013  C C    . LEU A 1 69  ? 1.436   2.510   -16.305 1.00 0.00 ? 69  LEU A C    1  
ATOM 1014  O O    . LEU A 1 69  ? 1.728   3.565   -16.829 1.00 0.00 ? 69  LEU A O    1  
ATOM 1015  C CB   . LEU A 1 69  ? 1.822   1.979   -13.926 1.00 0.00 ? 69  LEU A CB   1  
ATOM 1016  C CG   . LEU A 1 69  ? 1.244   2.001   -12.513 1.00 0.00 ? 69  LEU A CG   1  
ATOM 1017  C CD1  . LEU A 1 69  ? 2.364   1.716   -11.511 1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1018  C CD2  . LEU A 1 69  ? 0.653   3.376   -12.227 1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1019  H H    . LEU A 1 69  ? -0.351  0.674   -14.459 1.00 0.00 ? 69  LEU A H    1  
ATOM 1020  H HA   . LEU A 1 69  ? 0.389   3.452   -14.695 1.00 0.00 ? 69  LEU A HA   1  
ATOM 1021  H HB2  . LEU A 1 69  ? 2.130   0.976   -14.173 1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1022  H HB3  . LEU A 1 69  ? 2.685   2.627   -13.970 1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1023  H HG   . LEU A 1 69  ? 0.486   1.258   -12.422 1.00 0.00 ? 69  LEU A HG   1  
ATOM 1024  H HD11 . LEU A 1 69  ? 3.151   2.447   -11.625 1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1025  H HD12 . LEU A 1 69  ? 1.975   1.768   -10.504 1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1026  H HD13 . LEU A 1 69  ? 2.767   0.729   -11.686 1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1027  H HD21 . LEU A 1 69  ? 1.261   4.137   -12.688 1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1028  H HD22 . LEU A 1 69  ? -0.348  3.431   -12.623 1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1029  H HD23 . LEU A 1 69  ? 0.623   3.542   -11.160 1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1030  N N    . THR A 1 70  ? 1.665   1.346   -16.846 1.00 0.00 ? 70  THR A N    1  
ATOM 1031  C CA   . THR A 1 70  ? 2.314   1.258   -18.169 1.00 0.00 ? 70  THR A CA   1  
ATOM 1032  C C    . THR A 1 70  ? 1.603   2.139   -19.185 1.00 0.00 ? 70  THR A C    1  
ATOM 1033  O O    . THR A 1 70  ? 2.212   2.988   -19.805 1.00 0.00 ? 70  THR A O    1  
ATOM 1034  C CB   . THR A 1 70  ? 2.238   -0.203  -18.628 1.00 0.00 ? 70  THR A CB   1  
ATOM 1035  O OG1  . THR A 1 70  ? 3.483   -0.769  -18.273 1.00 0.00 ? 70  THR A OG1  1  
ATOM 1036  C CG2  . THR A 1 70  ? 2.192   -0.302  -20.156 1.00 0.00 ? 70  THR A CG2  1  
ATOM 1037  H H    . THR A 1 70  ? 1.403   0.529   -16.375 1.00 0.00 ? 70  THR A H    1  
ATOM 1038  H HA   . THR A 1 70  ? 3.345   1.580   -18.079 1.00 0.00 ? 70  THR A HA   1  
ATOM 1039  H HB   . THR A 1 70  ? 1.421   -0.734  -18.145 1.00 0.00 ? 70  THR A HB   1  
ATOM 1040  H HG1  . THR A 1 70  ? 3.395   -1.157  -17.399 1.00 0.00 ? 70  THR A HG1  1  
ATOM 1041  H HG21 . THR A 1 70  ? 2.984   0.290   -20.585 1.00 0.00 ? 70  THR A HG21 1  
ATOM 1042  H HG22 . THR A 1 70  ? 2.314   -1.333  -20.458 1.00 0.00 ? 70  THR A HG22 1  
ATOM 1043  H HG23 . THR A 1 70  ? 1.240   0.062   -20.515 1.00 0.00 ? 70  THR A HG23 1  
ATOM 1044  N N    . MET A 1 71  ? 0.330   1.925   -19.339 1.00 0.00 ? 71  MET A N    1  
ATOM 1045  C CA   . MET A 1 71  ? -0.429  2.749   -20.314 1.00 0.00 ? 71  MET A CA   1  
ATOM 1046  C C    . MET A 1 71  ? -0.428  4.214   -19.897 1.00 0.00 ? 71  MET A C    1  
ATOM 1047  O O    . MET A 1 71  ? -0.532  5.098   -20.723 1.00 0.00 ? 71  MET A O    1  
ATOM 1048  C CB   . MET A 1 71  ? -1.881  2.243   -20.357 1.00 0.00 ? 71  MET A CB   1  
ATOM 1049  C CG   . MET A 1 71  ? -2.034  1.088   -19.374 1.00 0.00 ? 71  MET A CG   1  
ATOM 1050  S SD   . MET A 1 71  ? -3.682  0.363   -19.194 1.00 0.00 ? 71  MET A SD   1  
ATOM 1051  C CE   . MET A 1 71  ? -4.249  0.686   -20.879 1.00 0.00 ? 71  MET A CE   1  
ATOM 1052  H H    . MET A 1 71  ? -0.122  1.227   -18.814 1.00 0.00 ? 71  MET A H    1  
ATOM 1053  H HA   . MET A 1 71  ? 0.042   2.660   -21.293 1.00 0.00 ? 71  MET A HA   1  
ATOM 1054  H HB2  . MET A 1 71  ? -2.555  3.042   -20.086 1.00 0.00 ? 71  MET A HB2  1  
ATOM 1055  H HB3  . MET A 1 71  ? -2.116  1.903   -21.354 1.00 0.00 ? 71  MET A HB3  1  
ATOM 1056  H HG2  . MET A 1 71  ? -1.360  0.299   -19.673 1.00 0.00 ? 71  MET A HG2  1  
ATOM 1057  H HG3  . MET A 1 71  ? -1.724  1.433   -18.404 1.00 0.00 ? 71  MET A HG3  1  
ATOM 1058  H HE1  . MET A 1 71  ? -3.563  0.237   -21.580 1.00 0.00 ? 71  MET A HE1  1  
ATOM 1059  H HE2  . MET A 1 71  ? -5.232  0.263   -21.016 1.00 0.00 ? 71  MET A HE2  1  
ATOM 1060  H HE3  . MET A 1 71  ? -4.289  1.753   -21.047 1.00 0.00 ? 71  MET A HE3  1  
ATOM 1061  N N    . MET A 1 72  ? -0.309  4.444   -18.618 1.00 0.00 ? 72  MET A N    1  
ATOM 1062  C CA   . MET A 1 72  ? -0.299  5.843   -18.125 1.00 0.00 ? 72  MET A CA   1  
ATOM 1063  C C    . MET A 1 72  ? 1.050   6.497   -18.389 1.00 0.00 ? 72  MET A C    1  
ATOM 1064  O O    . MET A 1 72  ? 1.136   7.695   -18.577 1.00 0.00 ? 72  MET A O    1  
ATOM 1065  C CB   . MET A 1 72  ? -0.546  5.819   -16.609 1.00 0.00 ? 72  MET A CB   1  
ATOM 1066  C CG   . MET A 1 72  ? -1.066  7.181   -16.164 1.00 0.00 ? 72  MET A CG   1  
ATOM 1067  S SD   . MET A 1 72  ? -2.496  7.847   -17.046 1.00 0.00 ? 72  MET A SD   1  
ATOM 1068  C CE   . MET A 1 72  ? -2.222  9.582   -16.632 1.00 0.00 ? 72  MET A CE   1  
ATOM 1069  H H    . MET A 1 72  ? -0.228  3.699   -17.989 1.00 0.00 ? 72  MET A H    1  
ATOM 1070  H HA   . MET A 1 72  ? -1.078  6.410   -18.637 1.00 0.00 ? 72  MET A HA   1  
ATOM 1071  H HB2  . MET A 1 72  ? -1.274  5.065   -16.373 1.00 0.00 ? 72  MET A HB2  1  
ATOM 1072  H HB3  . MET A 1 72  ? 0.376   5.596   -16.093 1.00 0.00 ? 72  MET A HB3  1  
ATOM 1073  H HG2  . MET A 1 72  ? -1.331  7.114   -15.120 1.00 0.00 ? 72  MET A HG2  1  
ATOM 1074  H HG3  . MET A 1 72  ? -0.262  7.896   -16.254 1.00 0.00 ? 72  MET A HG3  1  
ATOM 1075  H HE1  . MET A 1 72  ? -1.782  9.650   -15.648 1.00 0.00 ? 72  MET A HE1  1  
ATOM 1076  H HE2  . MET A 1 72  ? -1.554  10.023  -17.357 1.00 0.00 ? 72  MET A HE2  1  
ATOM 1077  H HE3  . MET A 1 72  ? -3.163  10.107  -16.642 1.00 0.00 ? 72  MET A HE3  1  
ATOM 1078  N N    . ALA A 1 73  ? 2.079   5.698   -18.400 1.00 0.00 ? 73  ALA A N    1  
ATOM 1079  C CA   . ALA A 1 73  ? 3.430   6.252   -18.649 1.00 0.00 ? 73  ALA A CA   1  
ATOM 1080  C C    . ALA A 1 73  ? 3.635   6.543   -20.130 1.00 0.00 ? 73  ALA A C    1  
ATOM 1081  O O    . ALA A 1 73  ? 4.413   7.401   -20.493 1.00 0.00 ? 73  ALA A O    1  
ATOM 1082  C CB   . ALA A 1 73  ? 4.466   5.213   -18.201 1.00 0.00 ? 73  ALA A CB   1  
ATOM 1083  H H    . ALA A 1 73  ? 1.960   4.739   -18.246 1.00 0.00 ? 73  ALA A H    1  
ATOM 1084  H HA   . ALA A 1 73  ? 3.541   7.177   -18.086 1.00 0.00 ? 73  ALA A HA   1  
ATOM 1085  H HB1  . ALA A 1 73  ? 4.319   4.978   -17.158 1.00 0.00 ? 73  ALA A HB1  1  
ATOM 1086  H HB2  . ALA A 1 73  ? 4.356   4.312   -18.787 1.00 0.00 ? 73  ALA A HB2  1  
ATOM 1087  H HB3  . ALA A 1 73  ? 5.462   5.608   -18.340 1.00 0.00 ? 73  ALA A HB3  1  
ATOM 1088  N N    . ARG A 1 74  ? 2.935   5.821   -20.959 1.00 0.00 ? 74  ARG A N    1  
ATOM 1089  C CA   . ARG A 1 74  ? 3.080   6.047   -22.418 1.00 0.00 ? 74  ARG A CA   1  
ATOM 1090  C C    . ARG A 1 74  ? 2.565   7.428   -22.799 1.00 0.00 ? 74  ARG A C    1  
ATOM 1091  O O    . ARG A 1 74  ? 3.080   8.061   -23.700 1.00 0.00 ? 74  ARG A O    1  
ATOM 1092  C CB   . ARG A 1 74  ? 2.252   4.982   -23.160 1.00 0.00 ? 74  ARG A CB   1  
ATOM 1093  C CG   . ARG A 1 74  ? 3.152   4.245   -24.153 1.00 0.00 ? 74  ARG A CG   1  
ATOM 1094  C CD   . ARG A 1 74  ? 2.424   2.997   -24.659 1.00 0.00 ? 74  ARG A CD   1  
ATOM 1095  N NE   . ARG A 1 74  ? 2.943   2.647   -26.010 1.00 0.00 ? 74  ARG A NE   1  
ATOM 1096  C CZ   . ARG A 1 74  ? 2.294   1.782   -26.741 1.00 0.00 ? 74  ARG A CZ   1  
ATOM 1097  N NH1  . ARG A 1 74  ? 1.247   2.182   -27.411 1.00 0.00 ? 74  ARG A NH1  1  
ATOM 1098  N NH2  . ARG A 1 74  ? 2.711   0.546   -26.777 1.00 0.00 ? 74  ARG A NH2  1  
ATOM 1099  H H    . ARG A 1 74  ? 2.318   5.138   -20.624 1.00 0.00 ? 74  ARG A H    1  
ATOM 1100  H HA   . ARG A 1 74  ? 4.134   5.976   -22.684 1.00 0.00 ? 74  ARG A HA   1  
ATOM 1101  H HB2  . ARG A 1 74  ? 1.846   4.279   -22.449 1.00 0.00 ? 74  ARG A HB2  1  
ATOM 1102  H HB3  . ARG A 1 74  ? 1.440   5.456   -23.691 1.00 0.00 ? 74  ARG A HB3  1  
ATOM 1103  H HG2  . ARG A 1 74  ? 3.383   4.893   -24.986 1.00 0.00 ? 74  ARG A HG2  1  
ATOM 1104  H HG3  . ARG A 1 74  ? 4.071   3.955   -23.665 1.00 0.00 ? 74  ARG A HG3  1  
ATOM 1105  H HD2  . ARG A 1 74  ? 2.597   2.171   -23.984 1.00 0.00 ? 74  ARG A HD2  1  
ATOM 1106  H HD3  . ARG A 1 74  ? 1.363   3.192   -24.722 1.00 0.00 ? 74  ARG A HD3  1  
ATOM 1107  H HE   . ARG A 1 74  ? 3.764   3.062   -26.348 1.00 0.00 ? 74  ARG A HE   1  
ATOM 1108  H HH11 . ARG A 1 74  ? 0.955   3.137   -27.358 1.00 0.00 ? 74  ARG A HH11 1  
ATOM 1109  H HH12 . ARG A 1 74  ? 0.737   1.533   -27.976 1.00 0.00 ? 74  ARG A HH12 1  
ATOM 1110  H HH21 . ARG A 1 74  ? 3.517   0.275   -26.250 1.00 0.00 ? 74  ARG A HH21 1  
ATOM 1111  H HH22 . ARG A 1 74  ? 2.226   -0.131  -27.332 1.00 0.00 ? 74  ARG A HH22 1  
ATOM 1112  N N    . LYS A 1 75  ? 1.556   7.873   -22.103 1.00 0.00 ? 75  LYS A N    1  
ATOM 1113  C CA   . LYS A 1 75  ? 0.992   9.208   -22.406 1.00 0.00 ? 75  LYS A CA   1  
ATOM 1114  C C    . LYS A 1 75  ? 1.853   10.302  -21.788 1.00 0.00 ? 75  LYS A C    1  
ATOM 1115  O O    . LYS A 1 75  ? 2.096   11.325  -22.397 1.00 0.00 ? 75  LYS A O    1  
ATOM 1116  C CB   . LYS A 1 75  ? -0.424  9.280   -21.801 1.00 0.00 ? 75  LYS A CB   1  
ATOM 1117  C CG   . LYS A 1 75  ? -1.231  10.382  -22.503 1.00 0.00 ? 75  LYS A CG   1  
ATOM 1118  C CD   . LYS A 1 75  ? -1.089  11.686  -21.717 1.00 0.00 ? 75  LYS A CD   1  
ATOM 1119  C CE   . LYS A 1 75  ? -1.954  12.764  -22.372 1.00 0.00 ? 75  LYS A CE   1  
ATOM 1120  N NZ   . LYS A 1 75  ? -1.280  14.092  -22.292 1.00 0.00 ? 75  LYS A NZ   1  
ATOM 1121  H H    . LYS A 1 75  ? 1.175   7.327   -21.385 1.00 0.00 ? 75  LYS A H    1  
ATOM 1122  H HA   . LYS A 1 75  ? 0.964   9.344   -23.484 1.00 0.00 ? 75  LYS A HA   1  
ATOM 1123  H HB2  . LYS A 1 75  ? -0.921  8.331   -21.930 1.00 0.00 ? 75  LYS A HB2  1  
ATOM 1124  H HB3  . LYS A 1 75  ? -0.355  9.501   -20.746 1.00 0.00 ? 75  LYS A HB3  1  
ATOM 1125  H HG2  . LYS A 1 75  ? -0.865  10.521  -23.508 1.00 0.00 ? 75  LYS A HG2  1  
ATOM 1126  H HG3  . LYS A 1 75  ? -2.272  10.097  -22.544 1.00 0.00 ? 75  LYS A HG3  1  
ATOM 1127  H HD2  . LYS A 1 75  ? -1.409  11.532  -20.698 1.00 0.00 ? 75  LYS A HD2  1  
ATOM 1128  H HD3  . LYS A 1 75  ? -0.056  11.999  -21.720 1.00 0.00 ? 75  LYS A HD3  1  
ATOM 1129  H HE2  . LYS A 1 75  ? -2.120  12.516  -23.409 1.00 0.00 ? 75  LYS A HE2  1  
ATOM 1130  H HE3  . LYS A 1 75  ? -2.906  12.821  -21.865 1.00 0.00 ? 75  LYS A HE3  1  
ATOM 1131  H HZ1  . LYS A 1 75  ? -0.255  13.968  -22.411 1.00 0.00 ? 75  LYS A HZ1  1  
ATOM 1132  H HZ2  . LYS A 1 75  ? -1.645  14.712  -23.043 1.00 0.00 ? 75  LYS A HZ2  1  
ATOM 1133  H HZ3  . LYS A 1 75  ? -1.472  14.522  -21.364 1.00 0.00 ? 75  LYS A HZ3  1  
ATOM 1134  N N    . MET A 1 76  ? 2.306   10.061  -20.588 1.00 0.00 ? 76  MET A N    1  
ATOM 1135  C CA   . MET A 1 76  ? 3.153   11.073  -19.911 1.00 0.00 ? 76  MET A CA   1  
ATOM 1136  C C    . MET A 1 76  ? 4.620   10.904  -20.298 1.00 0.00 ? 76  MET A C    1  
ATOM 1137  O O    . MET A 1 76  ? 5.438   11.760  -20.022 1.00 0.00 ? 76  MET A O    1  
ATOM 1138  C CB   . MET A 1 76  ? 3.015   10.882  -18.388 1.00 0.00 ? 76  MET A CB   1  
ATOM 1139  C CG   . MET A 1 76  ? 1.640   11.385  -17.933 1.00 0.00 ? 76  MET A CG   1  
ATOM 1140  S SD   . MET A 1 76  ? 1.568   12.309  -16.376 1.00 0.00 ? 76  MET A SD   1  
ATOM 1141  C CE   . MET A 1 76  ? 2.409   11.081  -15.342 1.00 0.00 ? 76  MET A CE   1  
ATOM 1142  H H    . MET A 1 76  ? 2.089   9.221   -20.140 1.00 0.00 ? 76  MET A H    1  
ATOM 1143  H HA   . MET A 1 76  ? 2.821   12.065  -20.209 1.00 0.00 ? 76  MET A HA   1  
ATOM 1144  H HB2  . MET A 1 76  ? 3.114   9.834   -18.144 1.00 0.00 ? 76  MET A HB2  1  
ATOM 1145  H HB3  . MET A 1 76  ? 3.789   11.439  -17.881 1.00 0.00 ? 76  MET A HB3  1  
ATOM 1146  H HG2  . MET A 1 76  ? 1.237   12.019  -18.708 1.00 0.00 ? 76  MET A HG2  1  
ATOM 1147  H HG3  . MET A 1 76  ? 0.986   10.532  -17.837 1.00 0.00 ? 76  MET A HG3  1  
ATOM 1148  H HE1  . MET A 1 76  ? 3.350   10.813  -15.796 1.00 0.00 ? 76  MET A HE1  1  
ATOM 1149  H HE2  . MET A 1 76  ? 2.588   11.499  -14.363 1.00 0.00 ? 76  MET A HE2  1  
ATOM 1150  H HE3  . MET A 1 76  ? 1.789   10.202  -15.250 1.00 0.00 ? 76  MET A HE3  1  
ATOM 1151  N N    . LYS A 1 77  ? 4.929   9.803   -20.929 1.00 0.00 ? 77  LYS A N    1  
ATOM 1152  C CA   . LYS A 1 77  ? 6.326   9.568   -21.336 1.00 0.00 ? 77  LYS A CA   1  
ATOM 1153  C C    . LYS A 1 77  ? 7.264   9.671   -20.136 1.00 0.00 ? 77  LYS A C    1  
ATOM 1154  O O    . LYS A 1 77  ? 8.245   10.390  -20.161 1.00 0.00 ? 77  LYS A O    1  
ATOM 1155  C CB   . LYS A 1 77  ? 6.705   10.630  -22.378 1.00 0.00 ? 77  LYS A CB   1  
ATOM 1156  C CG   . LYS A 1 77  ? 7.753   10.047  -23.326 1.00 0.00 ? 77  LYS A CG   1  
ATOM 1157  C CD   . LYS A 1 77  ? 7.096   9.722   -24.672 1.00 0.00 ? 77  LYS A CD   1  
ATOM 1158  C CE   . LYS A 1 77  ? 6.208   8.485   -24.513 1.00 0.00 ? 77  LYS A CE   1  
ATOM 1159  N NZ   . LYS A 1 77  ? 6.996   7.342   -23.968 1.00 0.00 ? 77  LYS A NZ   1  
ATOM 1160  H H    . LYS A 1 77  ? 4.245   9.141   -21.131 1.00 0.00 ? 77  LYS A H    1  
ATOM 1161  H HA   . LYS A 1 77  ? 6.403   8.567   -21.759 1.00 0.00 ? 77  LYS A HA   1  
ATOM 1162  H HB2  . LYS A 1 77  ? 5.828   10.915  -22.939 1.00 0.00 ? 77  LYS A HB2  1  
ATOM 1163  H HB3  . LYS A 1 77  ? 7.106   11.502  -21.884 1.00 0.00 ? 77  LYS A HB3  1  
ATOM 1164  H HG2  . LYS A 1 77  ? 8.543   10.764  -23.472 1.00 0.00 ? 77  LYS A HG2  1  
ATOM 1165  H HG3  . LYS A 1 77  ? 8.166   9.146   -22.899 1.00 0.00 ? 77  LYS A HG3  1  
ATOM 1166  H HD2  . LYS A 1 77  ? 6.497   10.561  -24.996 1.00 0.00 ? 77  LYS A HD2  1  
ATOM 1167  H HD3  . LYS A 1 77  ? 7.860   9.527   -25.410 1.00 0.00 ? 77  LYS A HD3  1  
ATOM 1168  H HE2  . LYS A 1 77  ? 5.395   8.707   -23.839 1.00 0.00 ? 77  LYS A HE2  1  
ATOM 1169  H HE3  . LYS A 1 77  ? 5.801   8.205   -25.475 1.00 0.00 ? 77  LYS A HE3  1  
ATOM 1170  H HZ1  . LYS A 1 77  ? 7.999   7.466   -24.209 1.00 0.00 ? 77  LYS A HZ1  1  
ATOM 1171  H HZ2  . LYS A 1 77  ? 6.889   7.310   -22.934 1.00 0.00 ? 77  LYS A HZ2  1  
ATOM 1172  H HZ3  . LYS A 1 77  ? 6.647   6.453   -24.380 1.00 0.00 ? 77  LYS A HZ3  1  
ATOM 1173  N N    . ASP A 1 78  ? 6.943   8.935   -19.111 1.00 0.00 ? 78  ASP A N    1  
ATOM 1174  C CA   . ASP A 1 78  ? 7.774   8.953   -17.900 1.00 0.00 ? 78  ASP A CA   1  
ATOM 1175  C C    . ASP A 1 78  ? 8.075   10.379  -17.443 1.00 0.00 ? 78  ASP A C    1  
ATOM 1176  O O    . ASP A 1 78  ? 7.504   11.330  -17.941 1.00 0.00 ? 78  ASP A O    1  
ATOM 1177  C CB   . ASP A 1 78  ? 9.083   8.254   -18.233 1.00 0.00 ? 78  ASP A CB   1  
ATOM 1178  C CG   . ASP A 1 78  ? 8.796   6.806   -18.637 1.00 0.00 ? 78  ASP A CG   1  
ATOM 1179  O OD1  . ASP A 1 78  ? 8.130   6.149   -17.855 1.00 0.00 ? 78  ASP A OD1  1  
ATOM 1180  O OD2  . ASP A 1 78  ? 9.259   6.440   -19.704 1.00 0.00 ? 78  ASP A OD2  1  
ATOM 1181  H H    . ASP A 1 78  ? 6.170   8.359   -19.150 1.00 0.00 ? 78  ASP A H    1  
ATOM 1182  H HA   . ASP A 1 78  ? 7.248   8.429   -17.106 1.00 0.00 ? 78  ASP A HA   1  
ATOM 1183  H HB2  . ASP A 1 78  ? 9.565   8.762   -19.052 1.00 0.00 ? 78  ASP A HB2  1  
ATOM 1184  H HB3  . ASP A 1 78  ? 9.728   8.263   -17.375 1.00 0.00 ? 78  ASP A HB3  1  
ATOM 1185  N N    . THR A 1 79  ? 8.971   10.488  -16.491 1.00 0.00 ? 79  THR A N    1  
ATOM 1186  C CA   . THR A 1 79  ? 9.344   11.823  -15.968 1.00 0.00 ? 79  THR A CA   1  
ATOM 1187  C C    . THR A 1 79  ? 10.721  12.228  -16.467 1.00 0.00 ? 79  THR A C    1  
ATOM 1188  O O    . THR A 1 79  ? 11.111  11.884  -17.565 1.00 0.00 ? 79  THR A O    1  
ATOM 1189  C CB   . THR A 1 79  ? 9.384   11.741  -14.439 1.00 0.00 ? 79  THR A CB   1  
ATOM 1190  O OG1  . THR A 1 79  ? 8.439   10.748  -14.095 1.00 0.00 ? 79  THR A OG1  1  
ATOM 1191  C CG2  . THR A 1 79  ? 8.837   13.028  -13.811 1.00 0.00 ? 79  THR A CG2  1  
ATOM 1192  H H    . THR A 1 79  ? 9.391   9.691   -16.124 1.00 0.00 ? 79  THR A H    1  
ATOM 1193  H HA   . THR A 1 79  ? 8.618   12.556  -16.296 1.00 0.00 ? 79  THR A HA   1  
ATOM 1194  H HB   . THR A 1 79  ? 10.374  11.478  -14.072 1.00 0.00 ? 79  THR A HB   1  
ATOM 1195  H HG1  . THR A 1 79  ? 8.575   10.517  -13.172 1.00 0.00 ? 79  THR A HG1  1  
ATOM 1196  H HG21 . THR A 1 79  ? 7.920   13.313  -14.305 1.00 0.00 ? 79  THR A HG21 1  
ATOM 1197  H HG22 . THR A 1 79  ? 8.639   12.867  -12.762 1.00 0.00 ? 79  THR A HG22 1  
ATOM 1198  H HG23 . THR A 1 79  ? 9.560   13.822  -13.919 1.00 0.00 ? 79  THR A HG23 1  
ATOM 1199  N N    . ASP A 1 80  ? 11.434  12.955  -15.654 1.00 0.00 ? 80  ASP A N    1  
ATOM 1200  C CA   . ASP A 1 80  ? 12.789  13.391  -16.067 1.00 0.00 ? 80  ASP A CA   1  
ATOM 1201  C C    . ASP A 1 80  ? 13.794  12.264  -15.901 1.00 0.00 ? 80  ASP A C    1  
ATOM 1202  O O    . ASP A 1 80  ? 14.988  12.469  -15.990 1.00 0.00 ? 80  ASP A O    1  
ATOM 1203  C CB   . ASP A 1 80  ? 13.211  14.571  -15.182 1.00 0.00 ? 80  ASP A CB   1  
ATOM 1204  C CG   . ASP A 1 80  ? 12.942  14.223  -13.716 1.00 0.00 ? 80  ASP A CG   1  
ATOM 1205  O OD1  . ASP A 1 80  ? 13.187  13.078  -13.377 1.00 0.00 ? 80  ASP A OD1  1  
ATOM 1206  O OD2  . ASP A 1 80  ? 12.504  15.124  -13.018 1.00 0.00 ? 80  ASP A OD2  1  
ATOM 1207  H H    . ASP A 1 80  ? 11.074  13.216  -14.781 1.00 0.00 ? 80  ASP A H    1  
ATOM 1208  H HA   . ASP A 1 80  ? 12.758  13.680  -17.109 1.00 0.00 ? 80  ASP A HA   1  
ATOM 1209  H HB2  . ASP A 1 80  ? 14.265  14.769  -15.313 1.00 0.00 ? 80  ASP A HB2  1  
ATOM 1210  H HB3  . ASP A 1 80  ? 12.646  15.450  -15.450 1.00 0.00 ? 80  ASP A HB3  1  
ATOM 1211  N N    . SER A 1 81  ? 13.286  11.095  -15.671 1.00 0.00 ? 81  SER A N    1  
ATOM 1212  C CA   . SER A 1 81  ? 14.181  9.917   -15.493 1.00 0.00 ? 81  SER A CA   1  
ATOM 1213  C C    . SER A 1 81  ? 14.958  9.988   -14.178 1.00 0.00 ? 81  SER A C    1  
ATOM 1214  O O    . SER A 1 81  ? 15.291  8.972   -13.600 1.00 0.00 ? 81  SER A O    1  
ATOM 1215  C CB   . SER A 1 81  ? 15.185  9.891   -16.655 1.00 0.00 ? 81  SER A CB   1  
ATOM 1216  O OG   . SER A 1 81  ? 15.314  8.512   -16.972 1.00 0.00 ? 81  SER A OG   1  
ATOM 1217  H H    . SER A 1 81  ? 12.316  10.991  -15.628 1.00 0.00 ? 81  SER A H    1  
ATOM 1218  H HA   . SER A 1 81  ? 13.572  9.013   -15.493 1.00 0.00 ? 81  SER A HA   1  
ATOM 1219  H HB2  . SER A 1 81  ? 14.804  10.436  -17.505 1.00 0.00 ? 81  SER A HB2  1  
ATOM 1220  H HB3  . SER A 1 81  ? 16.139  10.294  -16.345 1.00 0.00 ? 81  SER A HB3  1  
ATOM 1221  H HG   . SER A 1 81  ? 15.741  8.075   -16.230 1.00 0.00 ? 81  SER A HG   1  
ATOM 1222  N N    . GLU A 1 82  ? 15.236  11.180  -13.726 1.00 0.00 ? 82  GLU A N    1  
ATOM 1223  C CA   . GLU A 1 82  ? 15.992  11.316  -12.452 1.00 0.00 ? 82  GLU A CA   1  
ATOM 1224  C C    . GLU A 1 82  ? 15.433  10.384  -11.385 1.00 0.00 ? 82  GLU A C    1  
ATOM 1225  O O    . GLU A 1 82  ? 16.100  10.072  -10.417 1.00 0.00 ? 82  GLU A O    1  
ATOM 1226  C CB   . GLU A 1 82  ? 15.855  12.764  -11.961 1.00 0.00 ? 82  GLU A CB   1  
ATOM 1227  C CG   . GLU A 1 82  ? 16.432  13.707  -13.019 1.00 0.00 ? 82  GLU A CG   1  
ATOM 1228  C CD   . GLU A 1 82  ? 16.716  15.068  -12.383 1.00 0.00 ? 82  GLU A CD   1  
ATOM 1229  O OE1  . GLU A 1 82  ? 16.139  15.307  -11.335 1.00 0.00 ? 82  GLU A OE1  1  
ATOM 1230  O OE2  . GLU A 1 82  ? 17.494  15.793  -12.981 1.00 0.00 ? 82  GLU A OE2  1  
ATOM 1231  H H    . GLU A 1 82  ? 14.947  11.975  -14.215 1.00 0.00 ? 82  GLU A H    1  
ATOM 1232  H HA   . GLU A 1 82  ? 17.038  11.063  -12.630 1.00 0.00 ? 82  GLU A HA   1  
ATOM 1233  H HB2  . GLU A 1 82  ? 14.813  12.995  -11.797 1.00 0.00 ? 82  GLU A HB2  1  
ATOM 1234  H HB3  . GLU A 1 82  ? 16.394  12.884  -11.033 1.00 0.00 ? 82  GLU A HB3  1  
ATOM 1235  H HG2  . GLU A 1 82  ? 17.350  13.298  -13.412 1.00 0.00 ? 82  GLU A HG2  1  
ATOM 1236  H HG3  . GLU A 1 82  ? 15.723  13.830  -13.824 1.00 0.00 ? 82  GLU A HG3  1  
ATOM 1237  N N    . GLU A 1 83  ? 14.219  9.954   -11.579 1.00 0.00 ? 83  GLU A N    1  
ATOM 1238  C CA   . GLU A 1 83  ? 13.605  9.043   -10.585 1.00 0.00 ? 83  GLU A CA   1  
ATOM 1239  C C    . GLU A 1 83  ? 14.048  7.605   -10.816 1.00 0.00 ? 83  GLU A C    1  
ATOM 1240  O O    . GLU A 1 83  ? 14.556  6.959   -9.921  1.00 0.00 ? 83  GLU A O    1  
ATOM 1241  C CB   . GLU A 1 83  ? 12.078  9.121   -10.736 1.00 0.00 ? 83  GLU A CB   1  
ATOM 1242  C CG   . GLU A 1 83  ? 11.666  10.581  -10.943 1.00 0.00 ? 83  GLU A CG   1  
ATOM 1243  C CD   . GLU A 1 83  ? 11.956  11.375  -9.667  1.00 0.00 ? 83  GLU A CD   1  
ATOM 1244  O OE1  . GLU A 1 83  ? 11.900  10.755  -8.618  1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1245  O OE2  . GLU A 1 83  ? 12.218  12.558  -9.815  1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1246  H H    . GLU A 1 83  ? 13.717  10.228  -12.374 1.00 0.00 ? 83  GLU A H    1  
ATOM 1247  H HA   . GLU A 1 83  ? 13.914  9.351   -9.586  1.00 0.00 ? 83  GLU A HA   1  
ATOM 1248  H HB2  . GLU A 1 83  ? 11.768  8.534   -11.586 1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1249  H HB3  . GLU A 1 83  ? 11.605  8.733   -9.846  1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1250  H HG2  . GLU A 1 83  ? 12.224  11.006  -11.763 1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1251  H HG3  . GLU A 1 83  ? 10.610  10.635  -11.164 1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1252  N N    . GLU A 1 84  ? 13.850  7.127   -12.013 1.00 0.00 ? 84  GLU A N    1  
ATOM 1253  C CA   . GLU A 1 84  ? 14.256  5.734   -12.312 1.00 0.00 ? 84  GLU A CA   1  
ATOM 1254  C C    . GLU A 1 84  ? 15.727  5.528   -11.990 1.00 0.00 ? 84  GLU A C    1  
ATOM 1255  O O    . GLU A 1 84  ? 16.152  4.433   -11.681 1.00 0.00 ? 84  GLU A O    1  
ATOM 1256  C CB   . GLU A 1 84  ? 14.037  5.476   -13.810 1.00 0.00 ? 84  GLU A CB   1  
ATOM 1257  C CG   . GLU A 1 84  ? 12.547  5.608   -14.126 1.00 0.00 ? 84  GLU A CG   1  
ATOM 1258  C CD   . GLU A 1 84  ? 12.370  5.877   -15.621 1.00 0.00 ? 84  GLU A CD   1  
ATOM 1259  O OE1  . GLU A 1 84  ? 12.775  6.953   -16.027 1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1260  O OE2  . GLU A 1 84  ? 11.840  4.992   -16.270 1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1261  H H    . GLU A 1 84  ? 13.445  7.686   -12.709 1.00 0.00 ? 84  GLU A H    1  
ATOM 1262  H HA   . GLU A 1 84  ? 13.659  5.052   -11.707 1.00 0.00 ? 84  GLU A HA   1  
ATOM 1263  H HB2  . GLU A 1 84  ? 14.596  6.197   -14.389 1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1264  H HB3  . GLU A 1 84  ? 14.374  4.481   -14.059 1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1265  H HG2  . GLU A 1 84  ? 12.035  4.693   -13.864 1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1266  H HG3  . GLU A 1 84  ? 12.124  6.427   -13.562 1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1267  N N    . ILE A 1 85  ? 16.477  6.591   -12.062 1.00 0.00 ? 85  ILE A N    1  
ATOM 1268  C CA   . ILE A 1 85  ? 17.923  6.486   -11.765 1.00 0.00 ? 85  ILE A CA   1  
ATOM 1269  C C    . ILE A 1 85  ? 18.171  6.413   -10.262 1.00 0.00 ? 85  ILE A C    1  
ATOM 1270  O O    . ILE A 1 85  ? 18.750  5.461   -9.770  1.00 0.00 ? 85  ILE A O    1  
ATOM 1271  C CB   . ILE A 1 85  ? 18.612  7.733   -12.312 1.00 0.00 ? 85  ILE A CB   1  
ATOM 1272  C CG1  . ILE A 1 85  ? 18.542  7.740   -13.828 1.00 0.00 ? 85  ILE A CG1  1  
ATOM 1273  C CG2  . ILE A 1 85  ? 20.090  7.705   -11.889 1.00 0.00 ? 85  ILE A CG2  1  
ATOM 1274  C CD1  . ILE A 1 85  ? 19.359  8.918   -14.354 1.00 0.00 ? 85  ILE A CD1  1  
ATOM 1275  H H    . ILE A 1 85  ? 16.087  7.454   -12.314 1.00 0.00 ? 85  ILE A H    1  
ATOM 1276  H HA   . ILE A 1 85  ? 18.317  5.590   -12.235 1.00 0.00 ? 85  ILE A HA   1  
ATOM 1277  H HB   . ILE A 1 85  ? 18.112  8.619   -11.924 1.00 0.00 ? 85  ILE A HB   1  
ATOM 1278  H HG12 . ILE A 1 85  ? 18.947  6.817   -14.215 1.00 0.00 ? 85  ILE A HG12 1  
ATOM 1279  H HG13 . ILE A 1 85  ? 17.515  7.838   -14.145 1.00 0.00 ? 85  ILE A HG13 1  
ATOM 1280  H HG21 . ILE A 1 85  ? 20.566  6.816   -12.277 1.00 0.00 ? 85  ILE A HG21 1  
ATOM 1281  H HG22 . ILE A 1 85  ? 20.599  8.578   -12.275 1.00 0.00 ? 85  ILE A HG22 1  
ATOM 1282  H HG23 . ILE A 1 85  ? 20.158  7.703   -10.818 1.00 0.00 ? 85  ILE A HG23 1  
ATOM 1283  H HD11 . ILE A 1 85  ? 19.308  9.738   -13.652 1.00 0.00 ? 85  ILE A HD11 1  
ATOM 1284  H HD12 . ILE A 1 85  ? 20.390  8.621   -14.479 1.00 0.00 ? 85  ILE A HD12 1  
ATOM 1285  H HD13 . ILE A 1 85  ? 18.963  9.240   -15.305 1.00 0.00 ? 85  ILE A HD13 1  
ATOM 1286  N N    . ARG A 1 86  ? 17.726  7.421   -9.557  1.00 0.00 ? 86  ARG A N    1  
ATOM 1287  C CA   . ARG A 1 86  ? 17.928  7.424   -8.088  1.00 0.00 ? 86  ARG A CA   1  
ATOM 1288  C C    . ARG A 1 86  ? 17.610  6.060   -7.500  1.00 0.00 ? 86  ARG A C    1  
ATOM 1289  O O    . ARG A 1 86  ? 18.370  5.524   -6.717  1.00 0.00 ? 86  ARG A O    1  
ATOM 1290  C CB   . ARG A 1 86  ? 16.983  8.464   -7.472  1.00 0.00 ? 86  ARG A CB   1  
ATOM 1291  C CG   . ARG A 1 86  ? 17.238  8.551   -5.969  1.00 0.00 ? 86  ARG A CG   1  
ATOM 1292  C CD   . ARG A 1 86  ? 16.891  9.959   -5.489  1.00 0.00 ? 86  ARG A CD   1  
ATOM 1293  N NE   . ARG A 1 86  ? 17.680  10.946  -6.277  1.00 0.00 ? 86  ARG A NE   1  
ATOM 1294  C CZ   . ARG A 1 86  ? 17.147  12.097  -6.582  1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1295  N NH1  . ARG A 1 86  ? 16.255  12.147  -7.533  1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1296  N NH2  . ARG A 1 86  ? 17.524  13.159  -5.925  1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1297  H H    . ARG A 1 86  ? 17.255  8.164   -9.994  1.00 0.00 ? 86  ARG A H    1  
ATOM 1298  H HA   . ARG A 1 86  ? 18.969  7.670   -7.874  1.00 0.00 ? 86  ARG A HA   1  
ATOM 1299  H HB2  . ARG A 1 86  ? 17.160  9.429   -7.923  1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1300  H HB3  . ARG A 1 86  ? 15.959  8.173   -7.648  1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1301  H HG2  . ARG A 1 86  ? 16.622  7.827   -5.454  1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1302  H HG3  . ARG A 1 86  ? 18.278  8.341   -5.765  1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1303  H HD2  . ARG A 1 86  ? 15.837  10.147  -5.633  1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1304  H HD3  . ARG A 1 86  ? 17.133  10.061  -4.441  1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1305  H HE   . ARG A 1 86  ? 18.593  10.732  -6.565  1.00 0.00 ? 86  ARG A HE   1  
ATOM 1306  H HH11 . ARG A 1 86  ? 15.990  11.312  -8.015  1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1307  H HH12 . ARG A 1 86  ? 15.835  13.020  -7.780  1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1308  H HH21 . ARG A 1 86  ? 18.210  13.083  -5.202  1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1309  H HH22 . ARG A 1 86  ? 17.126  14.050  -6.146  1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1310  N N    . GLU A 1 87  ? 16.492  5.521   -7.887  1.00 0.00 ? 87  GLU A N    1  
ATOM 1311  C CA   . GLU A 1 87  ? 16.108  4.195   -7.362  1.00 0.00 ? 87  GLU A CA   1  
ATOM 1312  C C    . GLU A 1 87  ? 17.075  3.129   -7.848  1.00 0.00 ? 87  GLU A C    1  
ATOM 1313  O O    . GLU A 1 87  ? 17.433  2.232   -7.111  1.00 0.00 ? 87  GLU A O    1  
ATOM 1314  C CB   . GLU A 1 87  ? 14.696  3.863   -7.873  1.00 0.00 ? 87  GLU A CB   1  
ATOM 1315  C CG   . GLU A 1 87  ? 14.138  2.680   -7.081  1.00 0.00 ? 87  GLU A CG   1  
ATOM 1316  C CD   . GLU A 1 87  ? 14.329  1.397   -7.892  1.00 0.00 ? 87  GLU A CD   1  
ATOM 1317  O OE1  . GLU A 1 87  ? 13.968  1.435   -9.057  1.00 0.00 ? 87  GLU A OE1  1  
ATOM 1318  O OE2  . GLU A 1 87  ? 14.826  0.453   -7.301  1.00 0.00 ? 87  GLU A OE2  1  
ATOM 1319  H H    . GLU A 1 87  ? 15.907  5.992   -8.517  1.00 0.00 ? 87  GLU A H    1  
ATOM 1320  H HA   . GLU A 1 87  ? 16.135  4.223   -6.277  1.00 0.00 ? 87  GLU A HA   1  
ATOM 1321  H HB2  . GLU A 1 87  ? 14.053  4.720   -7.744  1.00 0.00 ? 87  GLU A HB2  1  
ATOM 1322  H HB3  . GLU A 1 87  ? 14.740  3.608   -8.921  1.00 0.00 ? 87  GLU A HB3  1  
ATOM 1323  H HG2  . GLU A 1 87  ? 14.660  2.589   -6.141  1.00 0.00 ? 87  GLU A HG2  1  
ATOM 1324  H HG3  . GLU A 1 87  ? 13.085  2.829   -6.893  1.00 0.00 ? 87  GLU A HG3  1  
ATOM 1325  N N    . ALA A 1 88  ? 17.483  3.242   -9.082  1.00 0.00 ? 88  ALA A N    1  
ATOM 1326  C CA   . ALA A 1 88  ? 18.427  2.239   -9.622  1.00 0.00 ? 88  ALA A CA   1  
ATOM 1327  C C    . ALA A 1 88  ? 19.585  2.033   -8.660  1.00 0.00 ? 88  ALA A C    1  
ATOM 1328  O O    . ALA A 1 88  ? 20.101  0.940   -8.532  1.00 0.00 ? 88  ALA A O    1  
ATOM 1329  C CB   . ALA A 1 88  ? 18.978  2.755   -10.959 1.00 0.00 ? 88  ALA A CB   1  
ATOM 1330  H H    . ALA A 1 88  ? 17.168  3.980   -9.643  1.00 0.00 ? 88  ALA A H    1  
ATOM 1331  H HA   . ALA A 1 88  ? 17.902  1.293   -9.755  1.00 0.00 ? 88  ALA A HA   1  
ATOM 1332  H HB1  . ALA A 1 88  ? 18.275  3.442   -11.403 1.00 0.00 ? 88  ALA A HB1  1  
ATOM 1333  H HB2  . ALA A 1 88  ? 19.916  3.264   -10.794 1.00 0.00 ? 88  ALA A HB2  1  
ATOM 1334  H HB3  . ALA A 1 88  ? 19.138  1.925   -11.631 1.00 0.00 ? 88  ALA A HB3  1  
ATOM 1335  N N    . PHE A 1 89  ? 19.977  3.090   -7.997  1.00 0.00 ? 89  PHE A N    1  
ATOM 1336  C CA   . PHE A 1 89  ? 21.102  2.967   -7.040  1.00 0.00 ? 89  PHE A CA   1  
ATOM 1337  C C    . PHE A 1 89  ? 20.625  2.351   -5.728  1.00 0.00 ? 89  PHE A C    1  
ATOM 1338  O O    . PHE A 1 89  ? 21.250  1.456   -5.200  1.00 0.00 ? 89  PHE A O    1  
ATOM 1339  C CB   . PHE A 1 89  ? 21.665  4.373   -6.756  1.00 0.00 ? 89  PHE A CB   1  
ATOM 1340  C CG   . PHE A 1 89  ? 22.314  4.928   -8.029  1.00 0.00 ? 89  PHE A CG   1  
ATOM 1341  C CD1  . PHE A 1 89  ? 23.303  4.214   -8.686  1.00 0.00 ? 89  PHE A CD1  1  
ATOM 1342  C CD2  . PHE A 1 89  ? 21.913  6.148   -8.548  1.00 0.00 ? 89  PHE A CD2  1  
ATOM 1343  C CE1  . PHE A 1 89  ? 23.875  4.711   -9.837  1.00 0.00 ? 89  PHE A CE1  1  
ATOM 1344  C CE2  . PHE A 1 89  ? 22.491  6.640   -9.701  1.00 0.00 ? 89  PHE A CE2  1  
ATOM 1345  C CZ   . PHE A 1 89  ? 23.468  5.921   -10.343 1.00 0.00 ? 89  PHE A CZ   1  
ATOM 1346  H H    . PHE A 1 89  ? 19.534  3.955   -8.135  1.00 0.00 ? 89  PHE A H    1  
ATOM 1347  H HA   . PHE A 1 89  ? 21.865  2.323   -7.475  1.00 0.00 ? 89  PHE A HA   1  
ATOM 1348  H HB2  . PHE A 1 89  ? 20.865  5.032   -6.447  1.00 0.00 ? 89  PHE A HB2  1  
ATOM 1349  H HB3  . PHE A 1 89  ? 22.406  4.319   -5.972  1.00 0.00 ? 89  PHE A HB3  1  
ATOM 1350  H HD1  . PHE A 1 89  ? 23.639  3.268   -8.289  1.00 0.00 ? 89  PHE A HD1  1  
ATOM 1351  H HD2  . PHE A 1 89  ? 21.143  6.717   -8.048  1.00 0.00 ? 89  PHE A HD2  1  
ATOM 1352  H HE1  . PHE A 1 89  ? 24.643  4.148   -10.344 1.00 0.00 ? 89  PHE A HE1  1  
ATOM 1353  H HE2  . PHE A 1 89  ? 22.184  7.596   -10.092 1.00 0.00 ? 89  PHE A HE2  1  
ATOM 1354  H HZ   . PHE A 1 89  ? 23.909  6.304   -11.249 1.00 0.00 ? 89  PHE A HZ   1  
ATOM 1355  N N    . ARG A 1 90  ? 19.525  2.844   -5.224  1.00 0.00 ? 90  ARG A N    1  
ATOM 1356  C CA   . ARG A 1 90  ? 19.000  2.292   -3.948  1.00 0.00 ? 90  ARG A CA   1  
ATOM 1357  C C    . ARG A 1 90  ? 18.918  0.770   -4.018  1.00 0.00 ? 90  ARG A C    1  
ATOM 1358  O O    . ARG A 1 90  ? 18.970  0.094   -3.009  1.00 0.00 ? 90  ARG A O    1  
ATOM 1359  C CB   . ARG A 1 90  ? 17.581  2.854   -3.726  1.00 0.00 ? 90  ARG A CB   1  
ATOM 1360  C CG   . ARG A 1 90  ? 17.585  3.819   -2.533  1.00 0.00 ? 90  ARG A CG   1  
ATOM 1361  C CD   . ARG A 1 90  ? 17.283  3.034   -1.255  1.00 0.00 ? 90  ARG A CD   1  
ATOM 1362  N NE   . ARG A 1 90  ? 15.849  2.633   -1.262  1.00 0.00 ? 90  ARG A NE   1  
ATOM 1363  C CZ   . ARG A 1 90  ? 14.979  3.347   -0.600  1.00 0.00 ? 90  ARG A CZ   1  
ATOM 1364  N NH1  . ARG A 1 90  ? 15.194  3.591   0.665   1.00 0.00 ? 90  ARG A NH1  1  
ATOM 1365  N NH2  . ARG A 1 90  ? 13.923  3.793   -1.224  1.00 0.00 ? 90  ARG A NH2  1  
ATOM 1366  H H    . ARG A 1 90  ? 19.049  3.572   -5.681  1.00 0.00 ? 90  ARG A H    1  
ATOM 1367  H HA   . ARG A 1 90  ? 19.666  2.574   -3.135  1.00 0.00 ? 90  ARG A HA   1  
ATOM 1368  H HB2  . ARG A 1 90  ? 17.260  3.379   -4.610  1.00 0.00 ? 90  ARG A HB2  1  
ATOM 1369  H HB3  . ARG A 1 90  ? 16.896  2.042   -3.531  1.00 0.00 ? 90  ARG A HB3  1  
ATOM 1370  H HG2  . ARG A 1 90  ? 18.549  4.298   -2.449  1.00 0.00 ? 90  ARG A HG2  1  
ATOM 1371  H HG3  . ARG A 1 90  ? 16.828  4.576   -2.678  1.00 0.00 ? 90  ARG A HG3  1  
ATOM 1372  H HD2  . ARG A 1 90  ? 17.902  2.150   -1.212  1.00 0.00 ? 90  ARG A HD2  1  
ATOM 1373  H HD3  . ARG A 1 90  ? 17.480  3.652   -0.390  1.00 0.00 ? 90  ARG A HD3  1  
ATOM 1374  H HE   . ARG A 1 90  ? 15.559  1.841   -1.761  1.00 0.00 ? 90  ARG A HE   1  
ATOM 1375  H HH11 . ARG A 1 90  ? 16.014  3.233   1.111   1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1376  H HH12 . ARG A 1 90  ? 14.538  4.137   1.188   1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1377  H HH21 . ARG A 1 90  ? 13.791  3.587   -2.194  1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1378  H HH22 . ARG A 1 90  ? 13.245  4.343   -0.733  1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1379  N N    . VAL A 1 91  ? 18.792  0.258   -5.214  1.00 0.00 ? 91  VAL A N    1  
ATOM 1380  C CA   . VAL A 1 91  ? 18.705  -1.214  -5.376  1.00 0.00 ? 91  VAL A CA   1  
ATOM 1381  C C    . VAL A 1 91  ? 19.935  -1.901  -4.794  1.00 0.00 ? 91  VAL A C    1  
ATOM 1382  O O    . VAL A 1 91  ? 20.009  -3.114  -4.757  1.00 0.00 ? 91  VAL A O    1  
ATOM 1383  C CB   . VAL A 1 91  ? 18.634  -1.528  -6.877  1.00 0.00 ? 91  VAL A CB   1  
ATOM 1384  C CG1  . VAL A 1 91  ? 18.745  -3.039  -7.082  1.00 0.00 ? 91  VAL A CG1  1  
ATOM 1385  C CG2  . VAL A 1 91  ? 17.293  -1.041  -7.431  1.00 0.00 ? 91  VAL A CG2  1  
ATOM 1386  H H    . VAL A 1 91  ? 18.755  0.845   -6.000  1.00 0.00 ? 91  VAL A H    1  
ATOM 1387  H HA   . VAL A 1 91  ? 17.819  -1.576  -4.863  1.00 0.00 ? 91  VAL A HA   1  
ATOM 1388  H HB   . VAL A 1 91  ? 19.441  -1.031  -7.389  1.00 0.00 ? 91  VAL A HB   1  
ATOM 1389  H HG11 . VAL A 1 91  ? 18.246  -3.555  -6.274  1.00 0.00 ? 91  VAL A HG11 1  
ATOM 1390  H HG12 . VAL A 1 91  ? 18.284  -3.316  -8.019  1.00 0.00 ? 91  VAL A HG12 1  
ATOM 1391  H HG13 . VAL A 1 91  ? 19.785  -3.329  -7.100  1.00 0.00 ? 91  VAL A HG13 1  
ATOM 1392  H HG21 . VAL A 1 91  ? 17.038  -0.093  -6.985  1.00 0.00 ? 91  VAL A HG21 1  
ATOM 1393  H HG22 . VAL A 1 91  ? 17.364  -0.922  -8.503  1.00 0.00 ? 91  VAL A HG22 1  
ATOM 1394  H HG23 . VAL A 1 91  ? 16.522  -1.761  -7.203  1.00 0.00 ? 91  VAL A HG23 1  
ATOM 1395  N N    . PHE A 1 92  ? 20.880  -1.106  -4.349  1.00 0.00 ? 92  PHE A N    1  
ATOM 1396  C CA   . PHE A 1 92  ? 22.122  -1.681  -3.761  1.00 0.00 ? 92  PHE A CA   1  
ATOM 1397  C C    . PHE A 1 92  ? 22.442  -1.031  -2.419  1.00 0.00 ? 92  PHE A C    1  
ATOM 1398  O O    . PHE A 1 92  ? 23.053  -1.641  -1.565  1.00 0.00 ? 92  PHE A O    1  
ATOM 1399  C CB   . PHE A 1 92  ? 23.282  -1.406  -4.731  1.00 0.00 ? 92  PHE A CB   1  
ATOM 1400  C CG   . PHE A 1 92  ? 22.929  -1.956  -6.115  1.00 0.00 ? 92  PHE A CG   1  
ATOM 1401  C CD1  . PHE A 1 92  ? 22.239  -1.175  -7.027  1.00 0.00 ? 92  PHE A CD1  1  
ATOM 1402  C CD2  . PHE A 1 92  ? 23.293  -3.242  -6.474  1.00 0.00 ? 92  PHE A CD2  1  
ATOM 1403  C CE1  . PHE A 1 92  ? 21.920  -1.672  -8.272  1.00 0.00 ? 92  PHE A CE1  1  
ATOM 1404  C CE2  . PHE A 1 92  ? 22.972  -3.736  -7.721  1.00 0.00 ? 92  PHE A CE2  1  
ATOM 1405  C CZ   . PHE A 1 92  ? 22.287  -2.951  -8.619  1.00 0.00 ? 92  PHE A CZ   1  
ATOM 1406  H H    . PHE A 1 92  ? 20.766  -0.136  -4.402  1.00 0.00 ? 92  PHE A H    1  
ATOM 1407  H HA   . PHE A 1 92  ? 21.989  -2.751  -3.612  1.00 0.00 ? 92  PHE A HA   1  
ATOM 1408  H HB2  . PHE A 1 92  ? 23.453  -0.342  -4.804  1.00 0.00 ? 92  PHE A HB2  1  
ATOM 1409  H HB3  . PHE A 1 92  ? 24.180  -1.888  -4.374  1.00 0.00 ? 92  PHE A HB3  1  
ATOM 1410  H HD1  . PHE A 1 92  ? 21.950  -0.169  -6.761  1.00 0.00 ? 92  PHE A HD1  1  
ATOM 1411  H HD2  . PHE A 1 92  ? 23.835  -3.860  -5.774  1.00 0.00 ? 92  PHE A HD2  1  
ATOM 1412  H HE1  . PHE A 1 92  ? 21.379  -1.057  -8.977  1.00 0.00 ? 92  PHE A HE1  1  
ATOM 1413  H HE2  . PHE A 1 92  ? 23.258  -4.741  -7.992  1.00 0.00 ? 92  PHE A HE2  1  
ATOM 1414  H HZ   . PHE A 1 92  ? 22.038  -3.339  -9.596  1.00 0.00 ? 92  PHE A HZ   1  
ATOM 1415  N N    . ASP A 1 93  ? 22.026  0.201   -2.261  1.00 0.00 ? 93  ASP A N    1  
ATOM 1416  C CA   . ASP A 1 93  ? 22.297  0.906   -0.982  1.00 0.00 ? 93  ASP A CA   1  
ATOM 1417  C C    . ASP A 1 93  ? 22.029  -0.016  0.198   1.00 0.00 ? 93  ASP A C    1  
ATOM 1418  O O    . ASP A 1 93  ? 20.916  -0.109  0.677   1.00 0.00 ? 93  ASP A O    1  
ATOM 1419  C CB   . ASP A 1 93  ? 21.357  2.120   -0.887  1.00 0.00 ? 93  ASP A CB   1  
ATOM 1420  C CG   . ASP A 1 93  ? 21.775  2.994   0.300   1.00 0.00 ? 93  ASP A CG   1  
ATOM 1421  O OD1  . ASP A 1 93  ? 22.614  2.525   1.050   1.00 0.00 ? 93  ASP A OD1  1  
ATOM 1422  O OD2  . ASP A 1 93  ? 21.229  4.082   0.389   1.00 0.00 ? 93  ASP A OD2  1  
ATOM 1423  H H    . ASP A 1 93  ? 21.541  0.653   -2.979  1.00 0.00 ? 93  ASP A H    1  
ATOM 1424  H HA   . ASP A 1 93  ? 23.341  1.222   -0.963  1.00 0.00 ? 93  ASP A HA   1  
ATOM 1425  H HB2  . ASP A 1 93  ? 21.418  2.700   -1.796  1.00 0.00 ? 93  ASP A HB2  1  
ATOM 1426  H HB3  . ASP A 1 93  ? 20.341  1.785   -0.743  1.00 0.00 ? 93  ASP A HB3  1  
ATOM 1427  N N    . LYS A 1 94  ? 23.054  -0.680  0.650   1.00 0.00 ? 94  LYS A N    1  
ATOM 1428  C CA   . LYS A 1 94  ? 22.886  -1.587  1.778   1.00 0.00 ? 94  LYS A CA   1  
ATOM 1429  C C    . LYS A 1 94  ? 23.033  -0.833  3.093   1.00 0.00 ? 94  LYS A C    1  
ATOM 1430  O O    . LYS A 1 94  ? 23.987  -1.019  3.824   1.00 0.00 ? 94  LYS A O    1  
ATOM 1431  C CB   . LYS A 1 94  ? 23.972  -2.668  1.669   1.00 0.00 ? 94  LYS A CB   1  
ATOM 1432  C CG   . LYS A 1 94  ? 24.012  -3.469  2.960   1.00 0.00 ? 94  LYS A CG   1  
ATOM 1433  C CD   . LYS A 1 94  ? 23.993  -4.966  2.635   1.00 0.00 ? 94  LYS A CD   1  
ATOM 1434  C CE   . LYS A 1 94  ? 23.923  -5.759  3.940   1.00 0.00 ? 94  LYS A CE   1  
ATOM 1435  N NZ   . LYS A 1 94  ? 25.260  -6.322  4.280   1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1436  H H    . LYS A 1 94  ? 23.928  -0.568  0.254   1.00 0.00 ? 94  LYS A H    1  
ATOM 1437  H HA   . LYS A 1 94  ? 21.892  -2.029  1.731   1.00 0.00 ? 94  LYS A HA   1  
ATOM 1438  H HB2  . LYS A 1 94  ? 23.747  -3.324  0.841   1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1439  H HB3  . LYS A 1 94  ? 24.931  -2.201  1.500   1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1440  H HG2  . LYS A 1 94  ? 24.911  -3.224  3.501   1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1441  H HG3  . LYS A 1 94  ? 23.156  -3.219  3.564   1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1442  H HD2  . LYS A 1 94  ? 23.130  -5.195  2.026   1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1443  H HD3  . LYS A 1 94  ? 24.890  -5.234  2.094   1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1444  H HE2  . LYS A 1 94  ? 23.602  -5.109  4.741   1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1445  H HE3  . LYS A 1 94  ? 23.215  -6.568  3.837   1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1446  H HZ1  . LYS A 1 94  ? 25.952  -6.027  3.563   1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1447  H HZ2  . LYS A 1 94  ? 25.556  -5.973  5.213   1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1448  H HZ3  . LYS A 1 94  ? 25.204  -7.360  4.300   1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1449  N N    . ASP A 1 95  ? 22.083  0.023   3.350   1.00 0.00 ? 95  ASP A N    1  
ATOM 1450  C CA   . ASP A 1 95  ? 22.114  0.820   4.605   1.00 0.00 ? 95  ASP A CA   1  
ATOM 1451  C C    . ASP A 1 95  ? 23.102  1.980   4.502   1.00 0.00 ? 95  ASP A C    1  
ATOM 1452  O O    . ASP A 1 95  ? 23.045  2.912   5.281   1.00 0.00 ? 95  ASP A O    1  
ATOM 1453  C CB   . ASP A 1 95  ? 22.537  -0.099  5.761   1.00 0.00 ? 95  ASP A CB   1  
ATOM 1454  C CG   . ASP A 1 95  ? 21.756  0.280   7.021   1.00 0.00 ? 95  ASP A CG   1  
ATOM 1455  O OD1  . ASP A 1 95  ? 22.132  1.278   7.612   1.00 0.00 ? 95  ASP A OD1  1  
ATOM 1456  O OD2  . ASP A 1 95  ? 20.827  -0.452  7.321   1.00 0.00 ? 95  ASP A OD2  1  
ATOM 1457  H H    . ASP A 1 95  ? 21.354  0.145   2.710   1.00 0.00 ? 95  ASP A H    1  
ATOM 1458  H HA   . ASP A 1 95  ? 21.117  1.227   4.783   1.00 0.00 ? 95  ASP A HA   1  
ATOM 1459  H HB2  . ASP A 1 95  ? 22.326  -1.127  5.506   1.00 0.00 ? 95  ASP A HB2  1  
ATOM 1460  H HB3  . ASP A 1 95  ? 23.593  0.013   5.948   1.00 0.00 ? 95  ASP A HB3  1  
ATOM 1461  N N    . GLY A 1 96  ? 23.992  1.910   3.547   1.00 0.00 ? 96  GLY A N    1  
ATOM 1462  C CA   . GLY A 1 96  ? 24.982  3.017   3.400   1.00 0.00 ? 96  GLY A CA   1  
ATOM 1463  C C    . GLY A 1 96  ? 24.256  4.361   3.450   1.00 0.00 ? 96  GLY A C    1  
ATOM 1464  O O    . GLY A 1 96  ? 24.761  5.330   3.984   1.00 0.00 ? 96  GLY A O    1  
ATOM 1465  H H    . GLY A 1 96  ? 24.008  1.143   2.937   1.00 0.00 ? 96  GLY A H    1  
ATOM 1466  H HA2  . GLY A 1 96  ? 25.701  2.966   4.204   1.00 0.00 ? 96  GLY A HA2  1  
ATOM 1467  H HA3  . GLY A 1 96  ? 25.494  2.919   2.454   1.00 0.00 ? 96  GLY A HA3  1  
ATOM 1468  N N    . ASN A 1 97  ? 23.080  4.386   2.886   1.00 0.00 ? 97  ASN A N    1  
ATOM 1469  C CA   . ASN A 1 97  ? 22.290  5.640   2.879   1.00 0.00 ? 97  ASN A CA   1  
ATOM 1470  C C    . ASN A 1 97  ? 23.122  6.831   2.416   1.00 0.00 ? 97  ASN A C    1  
ATOM 1471  O O    . ASN A 1 97  ? 23.288  7.787   3.148   1.00 0.00 ? 97  ASN A O    1  
ATOM 1472  C CB   . ASN A 1 97  ? 21.807  5.912   4.314   1.00 0.00 ? 97  ASN A CB   1  
ATOM 1473  C CG   . ASN A 1 97  ? 21.017  7.223   4.341   1.00 0.00 ? 97  ASN A CG   1  
ATOM 1474  O OD1  . ASN A 1 97  ? 20.407  7.612   3.365   1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1475  N ND2  . ASN A 1 97  ? 21.002  7.933   5.436   1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1476  H H    . ASN A 1 97  ? 22.721  3.576   2.468   1.00 0.00 ? 97  ASN A H    1  
ATOM 1477  H HA   . ASN A 1 97  ? 21.442  5.519   2.206   1.00 0.00 ? 97  ASN A HA   1  
ATOM 1478  H HB2  . ASN A 1 97  ? 21.171  5.104   4.645   1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1479  H HB3  . ASN A 1 97  ? 22.657  5.993   4.976   1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1480  H HD21 . ASN A 1 97  ? 21.492  7.624   6.227   1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1481  H HD22 . ASN A 1 97  ? 20.500  8.774   5.468   1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1482  N N    . GLY A 1 98  ? 23.630  6.761   1.210   1.00 0.00 ? 98  GLY A N    1  
ATOM 1483  C CA   . GLY A 1 98  ? 24.453  7.900   0.705   1.00 0.00 ? 98  GLY A CA   1  
ATOM 1484  C C    . GLY A 1 98  ? 25.602  7.416   -0.186  1.00 0.00 ? 98  GLY A C    1  
ATOM 1485  O O    . GLY A 1 98  ? 26.273  8.214   -0.809  1.00 0.00 ? 98  GLY A O    1  
ATOM 1486  H H    . GLY A 1 98  ? 23.469  5.974   0.647   1.00 0.00 ? 98  GLY A H    1  
ATOM 1487  H HA2  . GLY A 1 98  ? 23.821  8.566   0.135   1.00 0.00 ? 98  GLY A HA2  1  
ATOM 1488  H HA3  . GLY A 1 98  ? 24.864  8.439   1.544   1.00 0.00 ? 98  GLY A HA3  1  
ATOM 1489  N N    . TYR A 1 99  ? 25.811  6.128   -0.235  1.00 0.00 ? 99  TYR A N    1  
ATOM 1490  C CA   . TYR A 1 99  ? 26.918  5.622   -1.088  1.00 0.00 ? 99  TYR A CA   1  
ATOM 1491  C C    . TYR A 1 99  ? 26.686  4.184   -1.539  1.00 0.00 ? 99  TYR A C    1  
ATOM 1492  O O    . TYR A 1 99  ? 26.093  3.390   -0.833  1.00 0.00 ? 99  TYR A O    1  
ATOM 1493  C CB   . TYR A 1 99  ? 28.213  5.663   -0.263  1.00 0.00 ? 99  TYR A CB   1  
ATOM 1494  C CG   . TYR A 1 99  ? 28.819  7.068   -0.328  1.00 0.00 ? 99  TYR A CG   1  
ATOM 1495  C CD1  . TYR A 1 99  ? 28.463  8.028   0.597   1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1496  C CD2  . TYR A 1 99  ? 29.736  7.389   -1.306  1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1497  C CE1  . TYR A 1 99  ? 29.017  9.291   0.543   1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1498  C CE2  . TYR A 1 99  ? 30.290  8.651   -1.360  1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1499  C CZ   . TYR A 1 99  ? 29.934  9.613   -0.436  1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1500  O OH   . TYR A 1 99  ? 30.489  10.874  -0.491  1.00 0.00 ? 99  TYR A OH   1  
ATOM 1501  H H    . TYR A 1 99  ? 25.252  5.508   0.279   1.00 0.00 ? 99  TYR A H    1  
ATOM 1502  H HA   . TYR A 1 99  ? 27.003  6.257   -1.968  1.00 0.00 ? 99  TYR A HA   1  
ATOM 1503  H HB2  . TYR A 1 99  ? 27.999  5.415   0.766   1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1504  H HB3  . TYR A 1 99  ? 28.922  4.952   -0.662  1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1505  H HD1  . TYR A 1 99  ? 27.744  7.791   1.368   1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1506  H HD2  . TYR A 1 99  ? 30.021  6.648   -2.037  1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1507  H HE1  . TYR A 1 99  ? 28.729  10.034  1.272   1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1508  H HE2  . TYR A 1 99  ? 31.008  8.888   -2.131  1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1509  H HH   . TYR A 1 99  ? 31.181  10.924  0.173   1.00 0.00 ? 99  TYR A HH   1  
ATOM 1510  N N    . ILE A 1 100 ? 27.166  3.886   -2.722  1.00 0.00 ? 100 ILE A N    1  
ATOM 1511  C CA   . ILE A 1 100 ? 27.012  2.516   -3.276  1.00 0.00 ? 100 ILE A CA   1  
ATOM 1512  C C    . ILE A 1 100 ? 28.352  2.039   -3.827  1.00 0.00 ? 100 ILE A C    1  
ATOM 1513  O O    . ILE A 1 100 ? 29.281  2.815   -3.948  1.00 0.00 ? 100 ILE A O    1  
ATOM 1514  C CB   . ILE A 1 100 ? 26.002  2.559   -4.430  1.00 0.00 ? 100 ILE A CB   1  
ATOM 1515  C CG1  . ILE A 1 100 ? 26.484  3.540   -5.488  1.00 0.00 ? 100 ILE A CG1  1  
ATOM 1516  C CG2  . ILE A 1 100 ? 24.636  3.042   -3.891  1.00 0.00 ? 100 ILE A CG2  1  
ATOM 1517  C CD1  . ILE A 1 100 ? 25.501  3.543   -6.659  1.00 0.00 ? 100 ILE A CD1  1  
ATOM 1518  H H    . ILE A 1 100 ? 27.630  4.573   -3.246  1.00 0.00 ? 100 ILE A H    1  
ATOM 1519  H HA   . ILE A 1 100 ? 26.684  1.839   -2.488  1.00 0.00 ? 100 ILE A HA   1  
ATOM 1520  H HB   . ILE A 1 100 ? 25.919  1.563   -4.874  1.00 0.00 ? 100 ILE A HB   1  
ATOM 1521  H HG12 . ILE A 1 100 ? 26.547  4.529   -5.062  1.00 0.00 ? 100 ILE A HG12 1  
ATOM 1522  H HG13 . ILE A 1 100 ? 27.462  3.243   -5.838  1.00 0.00 ? 100 ILE A HG13 1  
ATOM 1523  H HG21 . ILE A 1 100 ? 24.387  2.502   -2.990  1.00 0.00 ? 100 ILE A HG21 1  
ATOM 1524  H HG22 . ILE A 1 100 ? 24.681  4.097   -3.673  1.00 0.00 ? 100 ILE A HG22 1  
ATOM 1525  H HG23 . ILE A 1 100 ? 23.868  2.867   -4.634  1.00 0.00 ? 100 ILE A HG23 1  
ATOM 1526  H HD11 . ILE A 1 100 ? 25.279  2.528   -6.949  1.00 0.00 ? 100 ILE A HD11 1  
ATOM 1527  H HD12 . ILE A 1 100 ? 24.587  4.036   -6.365  1.00 0.00 ? 100 ILE A HD12 1  
ATOM 1528  H HD13 . ILE A 1 100 ? 25.934  4.064   -7.498  1.00 0.00 ? 100 ILE A HD13 1  
ATOM 1529  N N    . SER A 1 101 ? 28.439  0.782   -4.153  1.00 0.00 ? 101 SER A N    1  
ATOM 1530  C CA   . SER A 1 101 ? 29.725  0.267   -4.694  1.00 0.00 ? 101 SER A CA   1  
ATOM 1531  C C    . SER A 1 101 ? 29.935  0.734   -6.130  1.00 0.00 ? 101 SER A C    1  
ATOM 1532  O O    . SER A 1 101 ? 28.990  0.883   -6.881  1.00 0.00 ? 101 SER A O    1  
ATOM 1533  C CB   . SER A 1 101 ? 29.683  -1.268  -4.675  1.00 0.00 ? 101 SER A CB   1  
ATOM 1534  O OG   . SER A 1 101 ? 30.884  -1.656  -5.325  1.00 0.00 ? 101 SER A OG   1  
ATOM 1535  H H    . SER A 1 101 ? 27.670  0.185   -4.045  1.00 0.00 ? 101 SER A H    1  
ATOM 1536  H HA   . SER A 1 101 ? 30.543  0.640   -4.078  1.00 0.00 ? 101 SER A HA   1  
ATOM 1537  H HB2  . SER A 1 101 ? 29.670  -1.639  -3.661  1.00 0.00 ? 101 SER A HB2  1  
ATOM 1538  H HB3  . SER A 1 101 ? 28.827  -1.635  -5.222  1.00 0.00 ? 101 SER A HB3  1  
ATOM 1539  H HG   . SER A 1 101 ? 30.694  -2.425  -5.866  1.00 0.00 ? 101 SER A HG   1  
ATOM 1540  N N    . ALA A 1 102 ? 31.174  0.959   -6.490  1.00 0.00 ? 102 ALA A N    1  
ATOM 1541  C CA   . ALA A 1 102 ? 31.454  1.417   -7.874  1.00 0.00 ? 102 ALA A CA   1  
ATOM 1542  C C    . ALA A 1 102 ? 31.223  0.290   -8.870  1.00 0.00 ? 102 ALA A C    1  
ATOM 1543  O O    . ALA A 1 102 ? 30.816  0.525   -9.989  1.00 0.00 ? 102 ALA A O    1  
ATOM 1544  C CB   . ALA A 1 102 ? 32.918  1.869   -7.959  1.00 0.00 ? 102 ALA A CB   1  
ATOM 1545  H H    . ALA A 1 102 ? 31.907  0.828   -5.852  1.00 0.00 ? 102 ALA A H    1  
ATOM 1546  H HA   . ALA A 1 102 ? 30.782  2.239   -8.112  1.00 0.00 ? 102 ALA A HA   1  
ATOM 1547  H HB1  . ALA A 1 102 ? 33.110  2.625   -7.211  1.00 0.00 ? 102 ALA A HB1  1  
ATOM 1548  H HB2  . ALA A 1 102 ? 33.571  1.028   -7.793  1.00 0.00 ? 102 ALA A HB2  1  
ATOM 1549  H HB3  . ALA A 1 102 ? 33.111  2.283   -8.938  1.00 0.00 ? 102 ALA A HB3  1  
ATOM 1550  N N    . ALA A 1 103 ? 31.502  -0.915  -8.460  1.00 0.00 ? 103 ALA A N    1  
ATOM 1551  C CA   . ALA A 1 103 ? 31.291  -2.049  -9.387  1.00 0.00 ? 103 ALA A CA   1  
ATOM 1552  C C    . ALA A 1 103 ? 29.812  -2.161  -9.697  1.00 0.00 ? 103 ALA A C    1  
ATOM 1553  O O    . ALA A 1 103 ? 29.393  -2.049  -10.837 1.00 0.00 ? 103 ALA A O    1  
ATOM 1554  C CB   . ALA A 1 103 ? 31.763  -3.342  -8.705  1.00 0.00 ? 103 ALA A CB   1  
ATOM 1555  H H    . ALA A 1 103 ? 31.845  -1.067  -7.555  1.00 0.00 ? 103 ALA A H    1  
ATOM 1556  H HA   . ALA A 1 103 ? 31.838  -1.864  -10.310 1.00 0.00 ? 103 ALA A HA   1  
ATOM 1557  H HB1  . ALA A 1 103 ? 31.490  -3.325  -7.660  1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1558  H HB2  . ALA A 1 103 ? 31.300  -4.194  -9.179  1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1559  H HB3  . ALA A 1 103 ? 32.837  -3.429  -8.790  1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1560  N N    . GLU A 1 104 ? 29.041  -2.376  -8.671  1.00 0.00 ? 104 GLU A N    1  
ATOM 1561  C CA   . GLU A 1 104 ? 27.587  -2.496  -8.876  1.00 0.00 ? 104 GLU A CA   1  
ATOM 1562  C C    . GLU A 1 104 ? 27.106  -1.302  -9.664  1.00 0.00 ? 104 GLU A C    1  
ATOM 1563  O O    . GLU A 1 104 ? 26.367  -1.430  -10.620 1.00 0.00 ? 104 GLU A O    1  
ATOM 1564  C CB   . GLU A 1 104 ? 26.899  -2.486  -7.505  1.00 0.00 ? 104 GLU A CB   1  
ATOM 1565  C CG   . GLU A 1 104 ? 27.220  -3.781  -6.768  1.00 0.00 ? 104 GLU A CG   1  
ATOM 1566  C CD   . GLU A 1 104 ? 28.717  -4.081  -6.884  1.00 0.00 ? 104 GLU A CD   1  
ATOM 1567  O OE1  . GLU A 1 104 ? 29.074  -4.662  -7.897  1.00 0.00 ? 104 GLU A OE1  1  
ATOM 1568  O OE2  . GLU A 1 104 ? 29.417  -3.714  -5.957  1.00 0.00 ? 104 GLU A OE2  1  
ATOM 1569  H H    . GLU A 1 104 ? 29.423  -2.460  -7.774  1.00 0.00 ? 104 GLU A H    1  
ATOM 1570  H HA   . GLU A 1 104 ? 27.368  -3.410  -9.427  1.00 0.00 ? 104 GLU A HA   1  
ATOM 1571  H HB2  . GLU A 1 104 ? 27.252  -1.644  -6.928  1.00 0.00 ? 104 GLU A HB2  1  
ATOM 1572  H HB3  . GLU A 1 104 ? 25.831  -2.401  -7.636  1.00 0.00 ? 104 GLU A HB3  1  
ATOM 1573  H HG2  . GLU A 1 104 ? 26.960  -3.680  -5.727  1.00 0.00 ? 104 GLU A HG2  1  
ATOM 1574  H HG3  . GLU A 1 104 ? 26.661  -4.592  -7.199  1.00 0.00 ? 104 GLU A HG3  1  
ATOM 1575  N N    . LEU A 1 105 ? 27.540  -0.151  -9.238  1.00 0.00 ? 105 LEU A N    1  
ATOM 1576  C CA   . LEU A 1 105 ? 27.132  1.083   -9.937  1.00 0.00 ? 105 LEU A CA   1  
ATOM 1577  C C    . LEU A 1 105 ? 27.316  0.918   -11.437 1.00 0.00 ? 105 LEU A C    1  
ATOM 1578  O O    . LEU A 1 105 ? 26.409  1.164   -12.201 1.00 0.00 ? 105 LEU A O    1  
ATOM 1579  C CB   . LEU A 1 105 ? 28.017  2.237   -9.444  1.00 0.00 ? 105 LEU A CB   1  
ATOM 1580  C CG   . LEU A 1 105 ? 27.898  3.415   -10.412 1.00 0.00 ? 105 LEU A CG   1  
ATOM 1581  C CD1  . LEU A 1 105 ? 27.826  4.712   -9.615  1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1582  C CD2  . LEU A 1 105 ? 29.127  3.454   -11.318 1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1583  H H    . LEU A 1 105 ? 28.128  -0.106  -8.452  1.00 0.00 ? 105 LEU A H    1  
ATOM 1584  H HA   . LEU A 1 105 ? 26.080  1.281   -9.727  1.00 0.00 ? 105 LEU A HA   1  
ATOM 1585  H HB2  . LEU A 1 105 ? 27.695  2.545   -8.460  1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1586  H HB3  . LEU A 1 105 ? 29.039  1.913   -9.393  1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1587  H HG   . LEU A 1 105 ? 27.008  3.306   -11.012 1.00 0.00 ? 105 LEU A HG   1  
ATOM 1588  H HD11 . LEU A 1 105 ? 28.402  4.611   -8.706  1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1589  H HD12 . LEU A 1 105 ? 28.229  5.522   -10.204 1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1590  H HD13 . LEU A 1 105 ? 26.800  4.929   -9.364  1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1591  H HD21 . LEU A 1 105 ? 30.022  3.351   -10.723 1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1592  H HD22 . LEU A 1 105 ? 29.078  2.647   -12.029 1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1593  H HD23 . LEU A 1 105 ? 29.159  4.393   -11.849 1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1594  N N    . ARG A 1 106 ? 28.489  0.501   -11.846 1.00 0.00 ? 106 ARG A N    1  
ATOM 1595  C CA   . ARG A 1 106 ? 28.700  0.329   -13.297 1.00 0.00 ? 106 ARG A CA   1  
ATOM 1596  C C    . ARG A 1 106 ? 27.561  -0.493  -13.863 1.00 0.00 ? 106 ARG A C    1  
ATOM 1597  O O    . ARG A 1 106 ? 27.157  -0.312  -14.995 1.00 0.00 ? 106 ARG A O    1  
ATOM 1598  C CB   . ARG A 1 106 ? 30.029  -0.406  -13.534 1.00 0.00 ? 106 ARG A CB   1  
ATOM 1599  C CG   . ARG A 1 106 ? 30.515  -0.109  -14.960 1.00 0.00 ? 106 ARG A CG   1  
ATOM 1600  C CD   . ARG A 1 106 ? 31.170  -1.367  -15.538 1.00 0.00 ? 106 ARG A CD   1  
ATOM 1601  N NE   . ARG A 1 106 ? 32.062  -0.981  -16.672 1.00 0.00 ? 106 ARG A NE   1  
ATOM 1602  C CZ   . ARG A 1 106 ? 31.535  -0.610  -17.807 1.00 0.00 ? 106 ARG A CZ   1  
ATOM 1603  N NH1  . ARG A 1 106 ? 31.020  0.584   -17.903 1.00 0.00 ? 106 ARG A NH1  1  
ATOM 1604  N NH2  . ARG A 1 106 ? 31.545  -1.446  -18.811 1.00 0.00 ? 106 ARG A NH2  1  
ATOM 1605  H H    . ARG A 1 106 ? 29.206  0.308   -11.206 1.00 0.00 ? 106 ARG A H    1  
ATOM 1606  H HA   . ARG A 1 106 ? 28.702  1.311   -13.776 1.00 0.00 ? 106 ARG A HA   1  
ATOM 1607  H HB2  . ARG A 1 106 ? 30.764  -0.065  -12.820 1.00 0.00 ? 106 ARG A HB2  1  
ATOM 1608  H HB3  . ARG A 1 106 ? 29.883  -1.469  -13.414 1.00 0.00 ? 106 ARG A HB3  1  
ATOM 1609  H HG2  . ARG A 1 106 ? 29.676  0.181   -15.578 1.00 0.00 ? 106 ARG A HG2  1  
ATOM 1610  H HG3  . ARG A 1 106 ? 31.236  0.699   -14.938 1.00 0.00 ? 106 ARG A HG3  1  
ATOM 1611  H HD2  . ARG A 1 106 ? 31.755  -1.859  -14.774 1.00 0.00 ? 106 ARG A HD2  1  
ATOM 1612  H HD3  . ARG A 1 106 ? 30.408  -2.044  -15.897 1.00 0.00 ? 106 ARG A HD3  1  
ATOM 1613  H HE   . ARG A 1 106 ? 33.036  -1.007  -16.564 1.00 0.00 ? 106 ARG A HE   1  
ATOM 1614  H HH11 . ARG A 1 106 ? 31.035  1.199   -17.115 1.00 0.00 ? 106 ARG A HH11 1  
ATOM 1615  H HH12 . ARG A 1 106 ? 30.613  0.885   -18.764 1.00 0.00 ? 106 ARG A HH12 1  
ATOM 1616  H HH21 . ARG A 1 106 ? 31.953  -2.352  -18.704 1.00 0.00 ? 106 ARG A HH21 1  
ATOM 1617  H HH22 . ARG A 1 106 ? 31.145  -1.178  -19.689 1.00 0.00 ? 106 ARG A HH22 1  
ATOM 1618  N N    . HIS A 1 107 ? 27.059  -1.392  -13.056 1.00 0.00 ? 107 HIS A N    1  
ATOM 1619  C CA   . HIS A 1 107 ? 25.940  -2.239  -13.519 1.00 0.00 ? 107 HIS A CA   1  
ATOM 1620  C C    . HIS A 1 107 ? 24.701  -1.377  -13.735 1.00 0.00 ? 107 HIS A C    1  
ATOM 1621  O O    . HIS A 1 107 ? 23.959  -1.567  -14.680 1.00 0.00 ? 107 HIS A O    1  
ATOM 1622  C CB   . HIS A 1 107 ? 25.637  -3.284  -12.429 1.00 0.00 ? 107 HIS A CB   1  
ATOM 1623  C CG   . HIS A 1 107 ? 25.122  -4.572  -13.081 1.00 0.00 ? 107 HIS A CG   1  
ATOM 1624  N ND1  . HIS A 1 107 ? 25.520  -5.721  -12.798 1.00 0.00 ? 107 HIS A ND1  1  
ATOM 1625  C CD2  . HIS A 1 107 ? 24.159  -4.746  -14.058 1.00 0.00 ? 107 HIS A CD2  1  
ATOM 1626  C CE1  . HIS A 1 107 ? 24.924  -6.603  -13.486 1.00 0.00 ? 107 HIS A CE1  1  
ATOM 1627  N NE2  . HIS A 1 107 ? 24.030  -6.077  -14.323 1.00 0.00 ? 107 HIS A NE2  1  
ATOM 1628  H H    . HIS A 1 107 ? 27.432  -1.510  -12.150 1.00 0.00 ? 107 HIS A H    1  
ATOM 1629  H HA   . HIS A 1 107 ? 26.216  -2.718  -14.459 1.00 0.00 ? 107 HIS A HA   1  
ATOM 1630  H HB2  . HIS A 1 107 ? 26.537  -3.502  -11.873 1.00 0.00 ? 107 HIS A HB2  1  
ATOM 1631  H HB3  . HIS A 1 107 ? 24.886  -2.899  -11.754 1.00 0.00 ? 107 HIS A HB3  1  
ATOM 1632  H HD1  . HIS A 1 107 ? 26.206  -5.917  -12.127 1.00 0.00 ? 107 HIS A HD1  1  
ATOM 1633  H HD2  . HIS A 1 107 ? 23.599  -3.955  -14.535 1.00 0.00 ? 107 HIS A HD2  1  
ATOM 1634  H HE1  . HIS A 1 107 ? 25.118  -7.662  -13.402 1.00 0.00 ? 107 HIS A HE1  1  
ATOM 1635  N N    . VAL A 1 108 ? 24.501  -0.432  -12.844 1.00 0.00 ? 108 VAL A N    1  
ATOM 1636  C CA   . VAL A 1 108 ? 23.323  0.456   -12.974 1.00 0.00 ? 108 VAL A CA   1  
ATOM 1637  C C    . VAL A 1 108 ? 23.349  1.171   -14.314 1.00 0.00 ? 108 VAL A C    1  
ATOM 1638  O O    . VAL A 1 108 ? 22.326  1.379   -14.929 1.00 0.00 ? 108 VAL A O    1  
ATOM 1639  C CB   . VAL A 1 108 ? 23.370  1.510   -11.849 1.00 0.00 ? 108 VAL A CB   1  
ATOM 1640  C CG1  . VAL A 1 108 ? 22.185  2.464   -11.996 1.00 0.00 ? 108 VAL A CG1  1  
ATOM 1641  C CG2  . VAL A 1 108 ? 23.288  0.808   -10.492 1.00 0.00 ? 108 VAL A CG2  1  
ATOM 1642  H H    . VAL A 1 108 ? 25.129  -0.314  -12.100 1.00 0.00 ? 108 VAL A H    1  
ATOM 1643  H HA   . VAL A 1 108 ? 22.418  -0.141  -12.907 1.00 0.00 ? 108 VAL A HA   1  
ATOM 1644  H HB   . VAL A 1 108 ? 24.285  2.067   -11.911 1.00 0.00 ? 108 VAL A HB   1  
ATOM 1645  H HG11 . VAL A 1 108 ? 21.279  1.898   -12.148 1.00 0.00 ? 108 VAL A HG11 1  
ATOM 1646  H HG12 . VAL A 1 108 ? 22.086  3.062   -11.102 1.00 0.00 ? 108 VAL A HG12 1  
ATOM 1647  H HG13 . VAL A 1 108 ? 22.345  3.114   -12.843 1.00 0.00 ? 108 VAL A HG13 1  
ATOM 1648  H HG21 . VAL A 1 108 ? 23.908  -0.077  -10.502 1.00 0.00 ? 108 VAL A HG21 1  
ATOM 1649  H HG22 . VAL A 1 108 ? 23.634  1.476   -9.715  1.00 0.00 ? 108 VAL A HG22 1  
ATOM 1650  H HG23 . VAL A 1 108 ? 22.267  0.526   -10.290 1.00 0.00 ? 108 VAL A HG23 1  
ATOM 1651  N N    . MET A 1 109 ? 24.527  1.525   -14.749 1.00 0.00 ? 109 MET A N    1  
ATOM 1652  C CA   . MET A 1 109 ? 24.638  2.226   -16.045 1.00 0.00 ? 109 MET A CA   1  
ATOM 1653  C C    . MET A 1 109 ? 24.228  1.302   -17.178 1.00 0.00 ? 109 MET A C    1  
ATOM 1654  O O    . MET A 1 109 ? 23.827  1.747   -18.235 1.00 0.00 ? 109 MET A O    1  
ATOM 1655  C CB   . MET A 1 109 ? 26.102  2.644   -16.243 1.00 0.00 ? 109 MET A CB   1  
ATOM 1656  C CG   . MET A 1 109 ? 26.350  3.943   -15.478 1.00 0.00 ? 109 MET A CG   1  
ATOM 1657  S SD   . MET A 1 109 ? 25.127  5.261   -15.676 1.00 0.00 ? 109 MET A SD   1  
ATOM 1658  C CE   . MET A 1 109 ? 24.323  5.073   -14.065 1.00 0.00 ? 109 MET A CE   1  
ATOM 1659  H H    . MET A 1 109 ? 25.329  1.322   -14.227 1.00 0.00 ? 109 MET A H    1  
ATOM 1660  H HA   . MET A 1 109 ? 23.982  3.097   -16.038 1.00 0.00 ? 109 MET A HA   1  
ATOM 1661  H HB2  . MET A 1 109 ? 26.756  1.870   -15.867 1.00 0.00 ? 109 MET A HB2  1  
ATOM 1662  H HB3  . MET A 1 109 ? 26.298  2.796   -17.293 1.00 0.00 ? 109 MET A HB3  1  
ATOM 1663  H HG2  . MET A 1 109 ? 26.411  3.709   -14.424 1.00 0.00 ? 109 MET A HG2  1  
ATOM 1664  H HG3  . MET A 1 109 ? 27.309  4.336   -15.781 1.00 0.00 ? 109 MET A HG3  1  
ATOM 1665  H HE1  . MET A 1 109 ? 24.113  4.029   -13.888 1.00 0.00 ? 109 MET A HE1  1  
ATOM 1666  H HE2  . MET A 1 109 ? 24.977  5.446   -13.290 1.00 0.00 ? 109 MET A HE2  1  
ATOM 1667  H HE3  . MET A 1 109 ? 23.400  5.633   -14.056 1.00 0.00 ? 109 MET A HE3  1  
ATOM 1668  N N    . THR A 1 110 ? 24.336  0.026   -16.934 1.00 0.00 ? 110 THR A N    1  
ATOM 1669  C CA   . THR A 1 110 ? 23.957  -0.948  -17.978 1.00 0.00 ? 110 THR A CA   1  
ATOM 1670  C C    . THR A 1 110 ? 22.443  -1.069  -18.064 1.00 0.00 ? 110 THR A C    1  
ATOM 1671  O O    . THR A 1 110 ? 21.893  -1.294  -19.124 1.00 0.00 ? 110 THR A O    1  
ATOM 1672  C CB   . THR A 1 110 ? 24.544  -2.312  -17.598 1.00 0.00 ? 110 THR A CB   1  
ATOM 1673  O OG1  . THR A 1 110 ? 25.564  -2.029  -16.660 1.00 0.00 ? 110 THR A OG1  1  
ATOM 1674  C CG2  . THR A 1 110 ? 25.278  -2.940  -18.788 1.00 0.00 ? 110 THR A CG2  1  
ATOM 1675  H H    . THR A 1 110 ? 24.667  -0.284  -16.066 1.00 0.00 ? 110 THR A H    1  
ATOM 1676  H HA   . THR A 1 110 ? 24.345  -0.611  -18.938 1.00 0.00 ? 110 THR A HA   1  
ATOM 1677  H HB   . THR A 1 110 ? 23.792  -2.970  -17.168 1.00 0.00 ? 110 THR A HB   1  
ATOM 1678  H HG1  . THR A 1 110 ? 25.698  -2.814  -16.122 1.00 0.00 ? 110 THR A HG1  1  
ATOM 1679  H HG21 . THR A 1 110 ? 26.000  -2.240  -19.182 1.00 0.00 ? 110 THR A HG21 1  
ATOM 1680  H HG22 . THR A 1 110 ? 25.788  -3.837  -18.471 1.00 0.00 ? 110 THR A HG22 1  
ATOM 1681  H HG23 . THR A 1 110 ? 24.568  -3.190  -19.563 1.00 0.00 ? 110 THR A HG23 1  
ATOM 1682  N N    . ASN A 1 111 ? 21.794  -0.917  -16.941 1.00 0.00 ? 111 ASN A N    1  
ATOM 1683  C CA   . ASN A 1 111 ? 20.314  -1.017  -16.933 1.00 0.00 ? 111 ASN A CA   1  
ATOM 1684  C C    . ASN A 1 111 ? 19.685  0.207   -17.594 1.00 0.00 ? 111 ASN A C    1  
ATOM 1685  O O    . ASN A 1 111 ? 18.790  0.084   -18.404 1.00 0.00 ? 111 ASN A O    1  
ATOM 1686  C CB   . ASN A 1 111 ? 19.840  -1.093  -15.472 1.00 0.00 ? 111 ASN A CB   1  
ATOM 1687  C CG   . ASN A 1 111 ? 20.177  -2.474  -14.900 1.00 0.00 ? 111 ASN A CG   1  
ATOM 1688  O OD1  . ASN A 1 111 ? 21.005  -2.608  -14.021 1.00 0.00 ? 111 ASN A OD1  1  
ATOM 1689  N ND2  . ASN A 1 111 ? 19.559  -3.524  -15.368 1.00 0.00 ? 111 ASN A ND2  1  
ATOM 1690  H H    . ASN A 1 111 ? 22.283  -0.741  -16.107 1.00 0.00 ? 111 ASN A H    1  
ATOM 1691  H HA   . ASN A 1 111 ? 20.017  -1.910  -17.484 1.00 0.00 ? 111 ASN A HA   1  
ATOM 1692  H HB2  . ASN A 1 111 ? 20.336  -0.333  -14.887 1.00 0.00 ? 111 ASN A HB2  1  
ATOM 1693  H HB3  . ASN A 1 111 ? 18.772  -0.938  -15.426 1.00 0.00 ? 111 ASN A HB3  1  
ATOM 1694  H HD21 . ASN A 1 111 ? 18.890  -3.423  -16.078 1.00 0.00 ? 111 ASN A HD21 1  
ATOM 1695  H HD22 . ASN A 1 111 ? 19.763  -4.413  -15.011 1.00 0.00 ? 111 ASN A HD22 1  
ATOM 1696  N N    . LEU A 1 112 ? 20.168  1.370   -17.236 1.00 0.00 ? 112 LEU A N    1  
ATOM 1697  C CA   . LEU A 1 112 ? 19.605  2.607   -17.839 1.00 0.00 ? 112 LEU A CA   1  
ATOM 1698  C C    . LEU A 1 112 ? 19.998  2.698   -19.293 1.00 0.00 ? 112 LEU A C    1  
ATOM 1699  O O    . LEU A 1 112 ? 19.163  2.839   -20.165 1.00 0.00 ? 112 LEU A O    1  
ATOM 1700  C CB   . LEU A 1 112 ? 20.192  3.833   -17.110 1.00 0.00 ? 112 LEU A CB   1  
ATOM 1701  C CG   . LEU A 1 112 ? 20.146  3.601   -15.604 1.00 0.00 ? 112 LEU A CG   1  
ATOM 1702  C CD1  . LEU A 1 112 ? 21.175  4.506   -14.925 1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1703  C CD2  . LEU A 1 112 ? 18.749  3.947   -15.085 1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1704  H H    . LEU A 1 112 ? 20.898  1.425   -16.582 1.00 0.00 ? 112 LEU A H    1  
ATOM 1705  H HA   . LEU A 1 112 ? 18.520  2.587   -17.759 1.00 0.00 ? 112 LEU A HA   1  
ATOM 1706  H HB2  . LEU A 1 112 ? 21.216  3.982   -17.421 1.00 0.00 ? 112 LEU A HB2  1  
ATOM 1707  H HB3  . LEU A 1 112 ? 19.617  4.712   -17.360 1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1708  H HG   . LEU A 1 112 ? 20.370  2.574   -15.392 1.00 0.00 ? 112 LEU A HG   1  
ATOM 1709  H HD11 . LEU A 1 112 ? 21.093  5.511   -15.313 1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1710  H HD12 . LEU A 1 112 ? 20.999  4.523   -13.859 1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1711  H HD13 . LEU A 1 112 ? 22.171  4.133   -15.114 1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1712  H HD21 . LEU A 1 112 ? 18.443  4.908   -15.472 1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1713  H HD22 . LEU A 1 112 ? 18.043  3.194   -15.406 1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1714  H HD23 . LEU A 1 112 ? 18.760  3.986   -14.006 1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1715  N N    . GLY A 1 113 ? 21.270  2.615   -19.524 1.00 0.00 ? 113 GLY A N    1  
ATOM 1716  C CA   . GLY A 1 113 ? 21.771  2.692   -20.924 1.00 0.00 ? 113 GLY A CA   1  
ATOM 1717  C C    . GLY A 1 113 ? 21.424  4.049   -21.537 1.00 0.00 ? 113 GLY A C    1  
ATOM 1718  O O    . GLY A 1 113 ? 20.628  4.136   -22.451 1.00 0.00 ? 113 GLY A O    1  
ATOM 1719  H H    . GLY A 1 113 ? 21.897  2.506   -18.774 1.00 0.00 ? 113 GLY A H    1  
ATOM 1720  H HA2  . GLY A 1 113 ? 22.842  2.563   -20.928 1.00 0.00 ? 113 GLY A HA2  1  
ATOM 1721  H HA3  . GLY A 1 113 ? 21.314  1.909   -21.510 1.00 0.00 ? 113 GLY A HA3  1  
ATOM 1722  N N    . GLU A 1 114 ? 22.031  5.080   -21.020 1.00 0.00 ? 114 GLU A N    1  
ATOM 1723  C CA   . GLU A 1 114 ? 21.752  6.432   -21.554 1.00 0.00 ? 114 GLU A CA   1  
ATOM 1724  C C    . GLU A 1 114 ? 22.537  6.678   -22.835 1.00 0.00 ? 114 GLU A C    1  
ATOM 1725  O O    . GLU A 1 114 ? 22.146  6.246   -23.900 1.00 0.00 ? 114 GLU A O    1  
ATOM 1726  C CB   . GLU A 1 114 ? 22.191  7.466   -20.505 1.00 0.00 ? 114 GLU A CB   1  
ATOM 1727  C CG   . GLU A 1 114 ? 21.032  7.737   -19.545 1.00 0.00 ? 114 GLU A CG   1  
ATOM 1728  C CD   . GLU A 1 114 ? 20.287  8.994   -19.995 1.00 0.00 ? 114 GLU A CD   1  
ATOM 1729  O OE1  . GLU A 1 114 ? 20.834  10.060  -19.763 1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1730  O OE2  . GLU A 1 114 ? 19.212  8.819   -20.543 1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1731  H H    . GLU A 1 114 ? 22.665  4.963   -20.284 1.00 0.00 ? 114 GLU A H    1  
ATOM 1732  H HA   . GLU A 1 114 ? 20.689  6.521   -21.765 1.00 0.00 ? 114 GLU A HA   1  
ATOM 1733  H HB2  . GLU A 1 114 ? 23.038  7.086   -19.953 1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1734  H HB3  . GLU A 1 114 ? 22.475  8.385   -20.997 1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1735  H HG2  . GLU A 1 114 ? 20.352  6.897   -19.547 1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1736  H HG3  . GLU A 1 114 ? 21.413  7.886   -18.545 1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1737  N N    . LYS A 1 115 ? 23.637  7.367   -22.702 1.00 0.00 ? 115 LYS A N    1  
ATOM 1738  C CA   . LYS A 1 115 ? 24.468  7.657   -23.890 1.00 0.00 ? 115 LYS A CA   1  
ATOM 1739  C C    . LYS A 1 115 ? 25.944  7.673   -23.513 1.00 0.00 ? 115 LYS A C    1  
ATOM 1740  O O    . LYS A 1 115 ? 26.768  8.212   -24.226 1.00 0.00 ? 115 LYS A O    1  
ATOM 1741  C CB   . LYS A 1 115 ? 24.068  9.046   -24.430 1.00 0.00 ? 115 LYS A CB   1  
ATOM 1742  C CG   . LYS A 1 115 ? 23.062  8.880   -25.574 1.00 0.00 ? 115 LYS A CG   1  
ATOM 1743  C CD   . LYS A 1 115 ? 23.795  9.013   -26.909 1.00 0.00 ? 115 LYS A CD   1  
ATOM 1744  C CE   . LYS A 1 115 ? 24.247  10.462  -27.092 1.00 0.00 ? 115 LYS A CE   1  
ATOM 1745  N NZ   . LYS A 1 115 ? 24.070  10.889  -28.509 1.00 0.00 ? 115 LYS A NZ   1  
ATOM 1746  H H    . LYS A 1 115 ? 23.913  7.687   -21.819 1.00 0.00 ? 115 LYS A H    1  
ATOM 1747  H HA   . LYS A 1 115 ? 24.304  6.885   -24.631 1.00 0.00 ? 115 LYS A HA   1  
ATOM 1748  H HB2  . LYS A 1 115 ? 23.618  9.624   -23.636 1.00 0.00 ? 115 LYS A HB2  1  
ATOM 1749  H HB3  . LYS A 1 115 ? 24.943  9.563   -24.791 1.00 0.00 ? 115 LYS A HB3  1  
ATOM 1750  H HG2  . LYS A 1 115 ? 22.594  7.911   -25.512 1.00 0.00 ? 115 LYS A HG2  1  
ATOM 1751  H HG3  . LYS A 1 115 ? 22.302  9.644   -25.502 1.00 0.00 ? 115 LYS A HG3  1  
ATOM 1752  H HD2  . LYS A 1 115 ? 24.656  8.360   -26.917 1.00 0.00 ? 115 LYS A HD2  1  
ATOM 1753  H HD3  . LYS A 1 115 ? 23.134  8.734   -27.717 1.00 0.00 ? 115 LYS A HD3  1  
ATOM 1754  H HE2  . LYS A 1 115 ? 23.662  11.107  -26.453 1.00 0.00 ? 115 LYS A HE2  1  
ATOM 1755  H HE3  . LYS A 1 115 ? 25.290  10.553  -26.824 1.00 0.00 ? 115 LYS A HE3  1  
ATOM 1756  H HZ1  . LYS A 1 115 ? 23.242  10.408  -28.914 1.00 0.00 ? 115 LYS A HZ1  1  
ATOM 1757  H HZ2  . LYS A 1 115 ? 23.926  11.918  -28.545 1.00 0.00 ? 115 LYS A HZ2  1  
ATOM 1758  H HZ3  . LYS A 1 115 ? 24.918  10.638  -29.055 1.00 0.00 ? 115 LYS A HZ3  1  
ATOM 1759  N N    . LEU A 1 116 ? 26.242  7.064   -22.398 1.00 0.00 ? 116 LEU A N    1  
ATOM 1760  C CA   . LEU A 1 116 ? 27.653  7.015   -21.928 1.00 0.00 ? 116 LEU A CA   1  
ATOM 1761  C C    . LEU A 1 116 ? 28.217  5.609   -22.055 1.00 0.00 ? 116 LEU A C    1  
ATOM 1762  O O    . LEU A 1 116 ? 28.119  4.811   -21.143 1.00 0.00 ? 116 LEU A O    1  
ATOM 1763  C CB   . LEU A 1 116 ? 27.676  7.432   -20.450 1.00 0.00 ? 116 LEU A CB   1  
ATOM 1764  C CG   . LEU A 1 116 ? 26.959  8.778   -20.306 1.00 0.00 ? 116 LEU A CG   1  
ATOM 1765  C CD1  . LEU A 1 116 ? 27.038  9.239   -18.851 1.00 0.00 ? 116 LEU A CD1  1  
ATOM 1766  C CD2  . LEU A 1 116 ? 27.647  9.814   -21.199 1.00 0.00 ? 116 LEU A CD2  1  
ATOM 1767  H H    . LEU A 1 116 ? 25.535  6.633   -21.877 1.00 0.00 ? 116 LEU A H    1  
ATOM 1768  H HA   . LEU A 1 116 ? 28.256  7.688   -22.523 1.00 0.00 ? 116 LEU A HA   1  
ATOM 1769  H HB2  . LEU A 1 116 ? 27.175  6.684   -19.852 1.00 0.00 ? 116 LEU A HB2  1  
ATOM 1770  H HB3  . LEU A 1 116 ? 28.699  7.527   -20.117 1.00 0.00 ? 116 LEU A HB3  1  
ATOM 1771  H HG   . LEU A 1 116 ? 25.925  8.674   -20.599 1.00 0.00 ? 116 LEU A HG   1  
ATOM 1772  H HD11 . LEU A 1 116 ? 28.057  9.173   -18.503 1.00 0.00 ? 116 LEU A HD11 1  
ATOM 1773  H HD12 . LEU A 1 116 ? 26.701  10.263  -18.775 1.00 0.00 ? 116 LEU A HD12 1  
ATOM 1774  H HD13 . LEU A 1 116 ? 26.410  8.611   -18.237 1.00 0.00 ? 116 LEU A HD13 1  
ATOM 1775  H HD21 . LEU A 1 116 ? 28.715  9.653   -21.189 1.00 0.00 ? 116 LEU A HD21 1  
ATOM 1776  H HD22 . LEU A 1 116 ? 27.283  9.722   -22.212 1.00 0.00 ? 116 LEU A HD22 1  
ATOM 1777  H HD23 . LEU A 1 116 ? 27.435  10.808  -20.834 1.00 0.00 ? 116 LEU A HD23 1  
ATOM 1778  N N    . THR A 1 117 ? 28.799  5.330   -23.190 1.00 0.00 ? 117 THR A N    1  
ATOM 1779  C CA   . THR A 1 117 ? 29.377  3.982   -23.400 1.00 0.00 ? 117 THR A CA   1  
ATOM 1780  C C    . THR A 1 117 ? 30.330  3.623   -22.266 1.00 0.00 ? 117 THR A C    1  
ATOM 1781  O O    . THR A 1 117 ? 30.758  4.478   -21.518 1.00 0.00 ? 117 THR A O    1  
ATOM 1782  C CB   . THR A 1 117 ? 30.155  3.993   -24.720 1.00 0.00 ? 117 THR A CB   1  
ATOM 1783  O OG1  . THR A 1 117 ? 31.200  3.056   -24.552 1.00 0.00 ? 117 THR A OG1  1  
ATOM 1784  C CG2  . THR A 1 117 ? 30.870  5.339   -24.921 1.00 0.00 ? 117 THR A CG2  1  
ATOM 1785  H H    . THR A 1 117 ? 28.856  6.007   -23.897 1.00 0.00 ? 117 THR A H    1  
ATOM 1786  H HA   . THR A 1 117 ? 28.570  3.251   -23.432 1.00 0.00 ? 117 THR A HA   1  
ATOM 1787  H HB   . THR A 1 117 ? 29.523  3.722   -25.564 1.00 0.00 ? 117 THR A HB   1  
ATOM 1788  H HG1  . THR A 1 117 ? 31.806  3.151   -25.290 1.00 0.00 ? 117 THR A HG1  1  
ATOM 1789  H HG21 . THR A 1 117 ? 31.361  5.630   -24.004 1.00 0.00 ? 117 THR A HG21 1  
ATOM 1790  H HG22 . THR A 1 117 ? 31.605  5.248   -25.706 1.00 0.00 ? 117 THR A HG22 1  
ATOM 1791  H HG23 . THR A 1 117 ? 30.150  6.097   -25.193 1.00 0.00 ? 117 THR A HG23 1  
ATOM 1792  N N    . ASP A 1 118 ? 30.646  2.362   -22.161 1.00 0.00 ? 118 ASP A N    1  
ATOM 1793  C CA   . ASP A 1 118 ? 31.567  1.932   -21.082 1.00 0.00 ? 118 ASP A CA   1  
ATOM 1794  C C    . ASP A 1 118 ? 32.756  2.876   -20.976 1.00 0.00 ? 118 ASP A C    1  
ATOM 1795  O O    . ASP A 1 118 ? 33.191  3.209   -19.891 1.00 0.00 ? 118 ASP A O    1  
ATOM 1796  C CB   . ASP A 1 118 ? 32.077  0.519   -21.413 1.00 0.00 ? 118 ASP A CB   1  
ATOM 1797  C CG   . ASP A 1 118 ? 30.901  -0.348  -21.869 1.00 0.00 ? 118 ASP A CG   1  
ATOM 1798  O OD1  . ASP A 1 118 ? 30.015  -0.531  -21.051 1.00 0.00 ? 118 ASP A OD1  1  
ATOM 1799  O OD2  . ASP A 1 118 ? 30.955  -0.776  -23.010 1.00 0.00 ? 118 ASP A OD2  1  
ATOM 1800  H H    . ASP A 1 118 ? 30.279  1.707   -22.790 1.00 0.00 ? 118 ASP A H    1  
ATOM 1801  H HA   . ASP A 1 118 ? 31.029  1.936   -20.137 1.00 0.00 ? 118 ASP A HA   1  
ATOM 1802  H HB2  . ASP A 1 118 ? 32.811  0.570   -22.204 1.00 0.00 ? 118 ASP A HB2  1  
ATOM 1803  H HB3  . ASP A 1 118 ? 32.526  0.077   -20.536 1.00 0.00 ? 118 ASP A HB3  1  
ATOM 1804  N N    . GLU A 1 119 ? 33.261  3.293   -22.100 1.00 0.00 ? 119 GLU A N    1  
ATOM 1805  C CA   . GLU A 1 119 ? 34.420  4.215   -22.079 1.00 0.00 ? 119 GLU A CA   1  
ATOM 1806  C C    . GLU A 1 119 ? 34.063  5.505   -21.354 1.00 0.00 ? 119 GLU A C    1  
ATOM 1807  O O    . GLU A 1 119 ? 34.835  6.011   -20.563 1.00 0.00 ? 119 GLU A O    1  
ATOM 1808  C CB   . GLU A 1 119 ? 34.803  4.541   -23.530 1.00 0.00 ? 119 GLU A CB   1  
ATOM 1809  C CG   . GLU A 1 119 ? 35.318  3.270   -24.209 1.00 0.00 ? 119 GLU A CG   1  
ATOM 1810  C CD   . GLU A 1 119 ? 36.843  3.334   -24.305 1.00 0.00 ? 119 GLU A CD   1  
ATOM 1811  O OE1  . GLU A 1 119 ? 37.438  3.627   -23.281 1.00 0.00 ? 119 GLU A OE1  1  
ATOM 1812  O OE2  . GLU A 1 119 ? 37.328  3.085   -25.397 1.00 0.00 ? 119 GLU A OE2  1  
ATOM 1813  H H    . GLU A 1 119 ? 32.879  2.998   -22.952 1.00 0.00 ? 119 GLU A H    1  
ATOM 1814  H HA   . GLU A 1 119 ? 35.245  3.734   -21.557 1.00 0.00 ? 119 GLU A HA   1  
ATOM 1815  H HB2  . GLU A 1 119 ? 33.937  4.910   -24.060 1.00 0.00 ? 119 GLU A HB2  1  
ATOM 1816  H HB3  . GLU A 1 119 ? 35.574  5.298   -23.541 1.00 0.00 ? 119 GLU A HB3  1  
ATOM 1817  H HG2  . GLU A 1 119 ? 35.033  2.405   -23.629 1.00 0.00 ? 119 GLU A HG2  1  
ATOM 1818  H HG3  . GLU A 1 119 ? 34.900  3.190   -25.202 1.00 0.00 ? 119 GLU A HG3  1  
ATOM 1819  N N    . GLU A 1 120 ? 32.899  6.016   -21.638 1.00 0.00 ? 120 GLU A N    1  
ATOM 1820  C CA   . GLU A 1 120 ? 32.474  7.271   -20.976 1.00 0.00 ? 120 GLU A CA   1  
ATOM 1821  C C    . GLU A 1 120 ? 32.235  7.029   -19.498 1.00 0.00 ? 120 GLU A C    1  
ATOM 1822  O O    . GLU A 1 120 ? 32.729  7.750   -18.655 1.00 0.00 ? 120 GLU A O    1  
ATOM 1823  C CB   . GLU A 1 120 ? 31.157  7.739   -21.615 1.00 0.00 ? 120 GLU A CB   1  
ATOM 1824  C CG   . GLU A 1 120 ? 31.460  8.426   -22.944 1.00 0.00 ? 120 GLU A CG   1  
ATOM 1825  C CD   . GLU A 1 120 ? 32.155  9.761   -22.676 1.00 0.00 ? 120 GLU A CD   1  
ATOM 1826  O OE1  . GLU A 1 120 ? 32.008  10.235  -21.561 1.00 0.00 ? 120 GLU A OE1  1  
ATOM 1827  O OE2  . GLU A 1 120 ? 32.795  10.233  -23.601 1.00 0.00 ? 120 GLU A OE2  1  
ATOM 1828  H H    . GLU A 1 120 ? 32.310  5.573   -22.284 1.00 0.00 ? 120 GLU A H    1  
ATOM 1829  H HA   . GLU A 1 120 ? 33.253  8.020   -21.093 1.00 0.00 ? 120 GLU A HA   1  
ATOM 1830  H HB2  . GLU A 1 120 ? 30.515  6.887   -21.784 1.00 0.00 ? 120 GLU A HB2  1  
ATOM 1831  H HB3  . GLU A 1 120 ? 30.659  8.433   -20.953 1.00 0.00 ? 120 GLU A HB3  1  
ATOM 1832  H HG2  . GLU A 1 120 ? 32.107  7.799   -23.540 1.00 0.00 ? 120 GLU A HG2  1  
ATOM 1833  H HG3  . GLU A 1 120 ? 30.540  8.603   -23.481 1.00 0.00 ? 120 GLU A HG3  1  
ATOM 1834  N N    . VAL A 1 121 ? 31.477  6.010   -19.213 1.00 0.00 ? 121 VAL A N    1  
ATOM 1835  C CA   . VAL A 1 121 ? 31.188  5.693   -17.800 1.00 0.00 ? 121 VAL A CA   1  
ATOM 1836  C C    . VAL A 1 121 ? 32.468  5.336   -17.066 1.00 0.00 ? 121 VAL A C    1  
ATOM 1837  O O    . VAL A 1 121 ? 32.554  5.470   -15.865 1.00 0.00 ? 121 VAL A O    1  
ATOM 1838  C CB   . VAL A 1 121 ? 30.238  4.497   -17.764 1.00 0.00 ? 121 VAL A CB   1  
ATOM 1839  C CG1  . VAL A 1 121 ? 30.134  3.969   -16.332 1.00 0.00 ? 121 VAL A CG1  1  
ATOM 1840  C CG2  . VAL A 1 121 ? 28.859  4.953   -18.238 1.00 0.00 ? 121 VAL A CG2  1  
ATOM 1841  H H    . VAL A 1 121 ? 31.104  5.457   -19.930 1.00 0.00 ? 121 VAL A H    1  
ATOM 1842  H HA   . VAL A 1 121 ? 30.735  6.563   -17.324 1.00 0.00 ? 121 VAL A HA   1  
ATOM 1843  H HB   . VAL A 1 121 ? 30.610  3.721   -18.415 1.00 0.00 ? 121 VAL A HB   1  
ATOM 1844  H HG11 . VAL A 1 121 ? 29.929  4.785   -15.656 1.00 0.00 ? 121 VAL A HG11 1  
ATOM 1845  H HG12 . VAL A 1 121 ? 29.334  3.244   -16.267 1.00 0.00 ? 121 VAL A HG12 1  
ATOM 1846  H HG13 . VAL A 1 121 ? 31.063  3.496   -16.049 1.00 0.00 ? 121 VAL A HG13 1  
ATOM 1847  H HG21 . VAL A 1 121 ? 28.966  5.611   -19.087 1.00 0.00 ? 121 VAL A HG21 1  
ATOM 1848  H HG22 . VAL A 1 121 ? 28.271  4.096   -18.526 1.00 0.00 ? 121 VAL A HG22 1  
ATOM 1849  H HG23 . VAL A 1 121 ? 28.356  5.479   -17.441 1.00 0.00 ? 121 VAL A HG23 1  
ATOM 1850  N N    . ASP A 1 122 ? 33.443  4.876   -17.803 1.00 0.00 ? 122 ASP A N    1  
ATOM 1851  C CA   . ASP A 1 122 ? 34.724  4.508   -17.160 1.00 0.00 ? 122 ASP A CA   1  
ATOM 1852  C C    . ASP A 1 122 ? 35.478  5.766   -16.759 1.00 0.00 ? 122 ASP A C    1  
ATOM 1853  O O    . ASP A 1 122 ? 35.853  5.930   -15.614 1.00 0.00 ? 122 ASP A O    1  
ATOM 1854  C CB   . ASP A 1 122 ? 35.568  3.713   -18.170 1.00 0.00 ? 122 ASP A CB   1  
ATOM 1855  C CG   . ASP A 1 122 ? 36.981  3.517   -17.610 1.00 0.00 ? 122 ASP A CG   1  
ATOM 1856  O OD1  . ASP A 1 122 ? 37.062  2.959   -16.528 1.00 0.00 ? 122 ASP A OD1  1  
ATOM 1857  O OD2  . ASP A 1 122 ? 37.898  3.936   -18.297 1.00 0.00 ? 122 ASP A OD2  1  
ATOM 1858  H H    . ASP A 1 122 ? 33.326  4.771   -18.773 1.00 0.00 ? 122 ASP A H    1  
ATOM 1859  H HA   . ASP A 1 122 ? 34.517  3.916   -16.267 1.00 0.00 ? 122 ASP A HA   1  
ATOM 1860  H HB2  . ASP A 1 122 ? 35.116  2.747   -18.343 1.00 0.00 ? 122 ASP A HB2  1  
ATOM 1861  H HB3  . ASP A 1 122 ? 35.626  4.252   -19.102 1.00 0.00 ? 122 ASP A HB3  1  
ATOM 1862  N N    . GLU A 1 123 ? 35.689  6.637   -17.710 1.00 0.00 ? 123 GLU A N    1  
ATOM 1863  C CA   . GLU A 1 123 ? 36.413  7.889   -17.398 1.00 0.00 ? 123 GLU A CA   1  
ATOM 1864  C C    . GLU A 1 123 ? 35.753  8.575   -16.213 1.00 0.00 ? 123 GLU A C    1  
ATOM 1865  O O    . GLU A 1 123 ? 36.391  9.284   -15.459 1.00 0.00 ? 123 GLU A O    1  
ATOM 1866  C CB   . GLU A 1 123 ? 36.333  8.815   -18.625 1.00 0.00 ? 123 GLU A CB   1  
ATOM 1867  C CG   . GLU A 1 123 ? 37.059  10.127  -18.321 1.00 0.00 ? 123 GLU A CG   1  
ATOM 1868  C CD   . GLU A 1 123 ? 38.481  9.825   -17.847 1.00 0.00 ? 123 GLU A CD   1  
ATOM 1869  O OE1  . GLU A 1 123 ? 39.108  9.009   -18.501 1.00 0.00 ? 123 GLU A OE1  1  
ATOM 1870  O OE2  . GLU A 1 123 ? 38.860  10.428  -16.856 1.00 0.00 ? 123 GLU A OE2  1  
ATOM 1871  H H    . GLU A 1 123 ? 35.370  6.463   -18.621 1.00 0.00 ? 123 GLU A H    1  
ATOM 1872  H HA   . GLU A 1 123 ? 37.448  7.653   -17.149 1.00 0.00 ? 123 GLU A HA   1  
ATOM 1873  H HB2  . GLU A 1 123 ? 36.795  8.333   -19.473 1.00 0.00 ? 123 GLU A HB2  1  
ATOM 1874  H HB3  . GLU A 1 123 ? 35.297  9.019   -18.856 1.00 0.00 ? 123 GLU A HB3  1  
ATOM 1875  H HG2  . GLU A 1 123 ? 37.102  10.734  -19.213 1.00 0.00 ? 123 GLU A HG2  1  
ATOM 1876  H HG3  . GLU A 1 123 ? 36.532  10.667  -17.548 1.00 0.00 ? 123 GLU A HG3  1  
ATOM 1877  N N    . MET A 1 124 ? 34.473  8.346   -16.076 1.00 0.00 ? 124 MET A N    1  
ATOM 1878  C CA   . MET A 1 124 ? 33.727  8.961   -14.956 1.00 0.00 ? 124 MET A CA   1  
ATOM 1879  C C    . MET A 1 124 ? 33.926  8.154   -13.686 1.00 0.00 ? 124 MET A C    1  
ATOM 1880  O O    . MET A 1 124 ? 34.492  8.632   -12.724 1.00 0.00 ? 124 MET A O    1  
ATOM 1881  C CB   . MET A 1 124 ? 32.227  8.946   -15.314 1.00 0.00 ? 124 MET A CB   1  
ATOM 1882  C CG   . MET A 1 124 ? 31.807  10.304  -15.895 1.00 0.00 ? 124 MET A CG   1  
ATOM 1883  S SD   . MET A 1 124 ? 30.783  11.368  -14.850 1.00 0.00 ? 124 MET A SD   1  
ATOM 1884  C CE   . MET A 1 124 ? 29.628  10.092  -14.290 1.00 0.00 ? 124 MET A CE   1  
ATOM 1885  H H    . MET A 1 124 ? 34.006  7.769   -16.718 1.00 0.00 ? 124 MET A H    1  
ATOM 1886  H HA   . MET A 1 124 ? 34.087  9.969   -14.793 1.00 0.00 ? 124 MET A HA   1  
ATOM 1887  H HB2  . MET A 1 124 ? 32.041  8.171   -16.043 1.00 0.00 ? 124 MET A HB2  1  
ATOM 1888  H HB3  . MET A 1 124 ? 31.649  8.739   -14.428 1.00 0.00 ? 124 MET A HB3  1  
ATOM 1889  H HG2  . MET A 1 124 ? 32.695  10.857  -16.158 1.00 0.00 ? 124 MET A HG2  1  
ATOM 1890  H HG3  . MET A 1 124 ? 31.258  10.121  -16.807 1.00 0.00 ? 124 MET A HG3  1  
ATOM 1891  H HE1  . MET A 1 124 ? 29.577  9.301   -15.028 1.00 0.00 ? 124 MET A HE1  1  
ATOM 1892  H HE2  . MET A 1 124 ? 29.970  9.684   -13.351 1.00 0.00 ? 124 MET A HE2  1  
ATOM 1893  H HE3  . MET A 1 124 ? 28.649  10.523  -14.159 1.00 0.00 ? 124 MET A HE3  1  
ATOM 1894  N N    . ILE A 1 125 ? 33.453  6.942   -13.705 1.00 0.00 ? 125 ILE A N    1  
ATOM 1895  C CA   . ILE A 1 125 ? 33.604  6.090   -12.512 1.00 0.00 ? 125 ILE A CA   1  
ATOM 1896  C C    . ILE A 1 125 ? 35.052  6.101   -12.038 1.00 0.00 ? 125 ILE A C    1  
ATOM 1897  O O    . ILE A 1 125 ? 35.340  5.799   -10.896 1.00 0.00 ? 125 ILE A O    1  
ATOM 1898  C CB   . ILE A 1 125 ? 33.216  4.662   -12.890 1.00 0.00 ? 125 ILE A CB   1  
ATOM 1899  C CG1  . ILE A 1 125 ? 31.702  4.512   -12.835 1.00 0.00 ? 125 ILE A CG1  1  
ATOM 1900  C CG2  . ILE A 1 125 ? 33.843  3.698   -11.869 1.00 0.00 ? 125 ILE A CG2  1  
ATOM 1901  C CD1  . ILE A 1 125 ? 31.326  3.077   -13.211 1.00 0.00 ? 125 ILE A CD1  1  
ATOM 1902  H H    . ILE A 1 125 ? 33.008  6.601   -14.503 1.00 0.00 ? 125 ILE A H    1  
ATOM 1903  H HA   . ILE A 1 125 ? 32.960  6.471   -11.719 1.00 0.00 ? 125 ILE A HA   1  
ATOM 1904  H HB   . ILE A 1 125 ? 33.567  4.448   -13.900 1.00 0.00 ? 125 ILE A HB   1  
ATOM 1905  H HG12 . ILE A 1 125 ? 31.352  4.729   -11.837 1.00 0.00 ? 125 ILE A HG12 1  
ATOM 1906  H HG13 . ILE A 1 125 ? 31.244  5.201   -13.530 1.00 0.00 ? 125 ILE A HG13 1  
ATOM 1907  H HG21 . ILE A 1 125 ? 33.655  4.054   -10.867 1.00 0.00 ? 125 ILE A HG21 1  
ATOM 1908  H HG22 . ILE A 1 125 ? 33.412  2.715   -11.984 1.00 0.00 ? 125 ILE A HG22 1  
ATOM 1909  H HG23 . ILE A 1 125 ? 34.910  3.640   -12.031 1.00 0.00 ? 125 ILE A HG23 1  
ATOM 1910  H HD11 . ILE A 1 125 ? 32.087  2.656   -13.850 1.00 0.00 ? 125 ILE A HD11 1  
ATOM 1911  H HD12 . ILE A 1 125 ? 31.241  2.476   -12.319 1.00 0.00 ? 125 ILE A HD12 1  
ATOM 1912  H HD13 . ILE A 1 125 ? 30.381  3.074   -13.735 1.00 0.00 ? 125 ILE A HD13 1  
ATOM 1913  N N    . ARG A 1 126 ? 35.939  6.452   -12.933 1.00 0.00 ? 126 ARG A N    1  
ATOM 1914  C CA   . ARG A 1 126 ? 37.376  6.493   -12.567 1.00 0.00 ? 126 ARG A CA   1  
ATOM 1915  C C    . ARG A 1 126 ? 37.624  7.512   -11.462 1.00 0.00 ? 126 ARG A C    1  
ATOM 1916  O O    . ARG A 1 126 ? 38.431  7.287   -10.580 1.00 0.00 ? 126 ARG A O    1  
ATOM 1917  C CB   . ARG A 1 126 ? 38.178  6.910   -13.811 1.00 0.00 ? 126 ARG A CB   1  
ATOM 1918  C CG   . ARG A 1 126 ? 39.672  6.920   -13.470 1.00 0.00 ? 126 ARG A CG   1  
ATOM 1919  C CD   . ARG A 1 126 ? 40.162  5.480   -13.295 1.00 0.00 ? 126 ARG A CD   1  
ATOM 1920  N NE   . ARG A 1 126 ? 39.587  4.635   -14.379 1.00 0.00 ? 126 ARG A NE   1  
ATOM 1921  C CZ   . ARG A 1 126 ? 39.332  3.377   -14.144 1.00 0.00 ? 126 ARG A CZ   1  
ATOM 1922  N NH1  . ARG A 1 126 ? 38.260  3.068   -13.466 1.00 0.00 ? 126 ARG A NH1  1  
ATOM 1923  N NH2  . ARG A 1 126 ? 40.158  2.472   -14.592 1.00 0.00 ? 126 ARG A NH2  1  
ATOM 1924  H H    . ARG A 1 126 ? 35.656  6.685   -13.841 1.00 0.00 ? 126 ARG A H    1  
ATOM 1925  H HA   . ARG A 1 126 ? 37.683  5.508   -12.218 1.00 0.00 ? 126 ARG A HA   1  
ATOM 1926  H HB2  . ARG A 1 126 ? 37.992  6.213   -14.613 1.00 0.00 ? 126 ARG A HB2  1  
ATOM 1927  H HB3  . ARG A 1 126 ? 37.873  7.898   -14.124 1.00 0.00 ? 126 ARG A HB3  1  
ATOM 1928  H HG2  . ARG A 1 126 ? 40.222  7.395   -14.269 1.00 0.00 ? 126 ARG A HG2  1  
ATOM 1929  H HG3  . ARG A 1 126 ? 39.831  7.470   -12.556 1.00 0.00 ? 126 ARG A HG3  1  
ATOM 1930  H HD2  . ARG A 1 126 ? 41.240  5.451   -13.352 1.00 0.00 ? 126 ARG A HD2  1  
ATOM 1931  H HD3  . ARG A 1 126 ? 39.843  5.098   -12.336 1.00 0.00 ? 126 ARG A HD3  1  
ATOM 1932  H HE   . ARG A 1 126 ? 39.401  5.020   -15.260 1.00 0.00 ? 126 ARG A HE   1  
ATOM 1933  H HH11 . ARG A 1 126 ? 37.649  3.789   -13.137 1.00 0.00 ? 126 ARG A HH11 1  
ATOM 1934  H HH12 . ARG A 1 126 ? 38.049  2.108   -13.276 1.00 0.00 ? 126 ARG A HH12 1  
ATOM 1935  H HH21 . ARG A 1 126 ? 40.970  2.748   -15.106 1.00 0.00 ? 126 ARG A HH21 1  
ATOM 1936  H HH22 . ARG A 1 126 ? 39.979  1.504   -14.422 1.00 0.00 ? 126 ARG A HH22 1  
ATOM 1937  N N    . GLU A 1 127 ? 36.925  8.621   -11.533 1.00 0.00 ? 127 GLU A N    1  
ATOM 1938  C CA   . GLU A 1 127 ? 37.104  9.671   -10.494 1.00 0.00 ? 127 GLU A CA   1  
ATOM 1939  C C    . GLU A 1 127 ? 35.761  10.253  -10.067 1.00 0.00 ? 127 GLU A C    1  
ATOM 1940  O O    . GLU A 1 127 ? 35.583  11.456  -10.039 1.00 0.00 ? 127 GLU A O    1  
ATOM 1941  C CB   . GLU A 1 127 ? 37.966  10.798  -11.088 1.00 0.00 ? 127 GLU A CB   1  
ATOM 1942  C CG   . GLU A 1 127 ? 37.457  11.140  -12.491 1.00 0.00 ? 127 GLU A CG   1  
ATOM 1943  C CD   . GLU A 1 127 ? 38.281  12.299  -13.061 1.00 0.00 ? 127 GLU A CD   1  
ATOM 1944  O OE1  . GLU A 1 127 ? 39.465  12.316  -12.769 1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1945  O OE2  . GLU A 1 127 ? 37.678  13.100  -13.758 1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1946  H H    . GLU A 1 127 ? 36.286  8.756   -12.267 1.00 0.00 ? 127 GLU A H    1  
ATOM 1947  H HA   . GLU A 1 127 ? 37.589  9.234   -9.624  1.00 0.00 ? 127 GLU A HA   1  
ATOM 1948  H HB2  . GLU A 1 127 ? 37.905  11.672  -10.457 1.00 0.00 ? 127 GLU A HB2  1  
ATOM 1949  H HB3  . GLU A 1 127 ? 38.995  10.475  -11.146 1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1950  H HG2  . GLU A 1 127 ? 37.557  10.280  -13.136 1.00 0.00 ? 127 GLU A HG2  1  
ATOM 1951  H HG3  . GLU A 1 127 ? 36.417  11.431  -12.442 1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1952  N N    . ALA A 1 128 ? 34.837  9.389   -9.738  1.00 0.00 ? 128 ALA A N    1  
ATOM 1953  C CA   . ALA A 1 128 ? 33.504  9.879   -9.310  1.00 0.00 ? 128 ALA A CA   1  
ATOM 1954  C C    . ALA A 1 128 ? 33.557  10.378  -7.872  1.00 0.00 ? 128 ALA A C    1  
ATOM 1955  O O    . ALA A 1 128 ? 32.622  10.203  -7.118  1.00 0.00 ? 128 ALA A O    1  
ATOM 1956  C CB   . ALA A 1 128 ? 32.505  8.712   -9.392  1.00 0.00 ? 128 ALA A CB   1  
ATOM 1957  H H    . ALA A 1 128 ? 35.023  8.429   -9.774  1.00 0.00 ? 128 ALA A H    1  
ATOM 1958  H HA   . ALA A 1 128 ? 33.201  10.697  -9.962  1.00 0.00 ? 128 ALA A HA   1  
ATOM 1959  H HB1  . ALA A 1 128 ? 32.594  8.223   -10.350 1.00 0.00 ? 128 ALA A HB1  1  
ATOM 1960  H HB2  . ALA A 1 128 ? 32.714  7.999   -8.608  1.00 0.00 ? 128 ALA A HB2  1  
ATOM 1961  H HB3  . ALA A 1 128 ? 31.498  9.086   -9.274  1.00 0.00 ? 128 ALA A HB3  1  
ATOM 1962  N N    . ASN A 1 129 ? 34.658  10.991  -7.520  1.00 0.00 ? 129 ASN A N    1  
ATOM 1963  C CA   . ASN A 1 129 ? 34.801  11.513  -6.137  1.00 0.00 ? 129 ASN A CA   1  
ATOM 1964  C C    . ASN A 1 129 ? 34.945  10.370  -5.136  1.00 0.00 ? 129 ASN A C    1  
ATOM 1965  O O    . ASN A 1 129 ? 34.310  10.362  -4.100  1.00 0.00 ? 129 ASN A O    1  
ATOM 1966  C CB   . ASN A 1 129 ? 33.547  12.332  -5.788  1.00 0.00 ? 129 ASN A CB   1  
ATOM 1967  C CG   . ASN A 1 129 ? 33.932  13.449  -4.816  1.00 0.00 ? 129 ASN A CG   1  
ATOM 1968  O OD1  . ASN A 1 129 ? 34.480  14.461  -5.202  1.00 0.00 ? 129 ASN A OD1  1  
ATOM 1969  N ND2  . ASN A 1 129 ? 33.664  13.303  -3.548  1.00 0.00 ? 129 ASN A ND2  1  
ATOM 1970  H H    . ASN A 1 129 ? 35.384  11.106  -8.167  1.00 0.00 ? 129 ASN A H    1  
ATOM 1971  H HA   . ASN A 1 129 ? 35.694  12.136  -6.088  1.00 0.00 ? 129 ASN A HA   1  
ATOM 1972  H HB2  . ASN A 1 129 ? 33.133  12.766  -6.685  1.00 0.00 ? 129 ASN A HB2  1  
ATOM 1973  H HB3  . ASN A 1 129 ? 32.808  11.697  -5.323  1.00 0.00 ? 129 ASN A HB3  1  
ATOM 1974  H HD21 . ASN A 1 129 ? 33.223  12.487  -3.230  1.00 0.00 ? 129 ASN A HD21 1  
ATOM 1975  H HD22 . ASN A 1 129 ? 33.905  14.008  -2.912  1.00 0.00 ? 129 ASN A HD22 1  
ATOM 1976  N N    . ILE A 1 130 ? 35.782  9.425   -5.466  1.00 0.00 ? 130 ILE A N    1  
ATOM 1977  C CA   . ILE A 1 130 ? 35.984  8.277   -4.550  1.00 0.00 ? 130 ILE A CA   1  
ATOM 1978  C C    . ILE A 1 130 ? 37.111  8.563   -3.567  1.00 0.00 ? 130 ILE A C    1  
ATOM 1979  O O    . ILE A 1 130 ? 37.871  9.493   -3.744  1.00 0.00 ? 130 ILE A O    1  
ATOM 1980  C CB   . ILE A 1 130 ? 36.362  7.057   -5.385  1.00 0.00 ? 130 ILE A CB   1  
ATOM 1981  C CG1  . ILE A 1 130 ? 35.310  6.819   -6.457  1.00 0.00 ? 130 ILE A CG1  1  
ATOM 1982  C CG2  . ILE A 1 130 ? 36.410  5.828   -4.461  1.00 0.00 ? 130 ILE A CG2  1  
ATOM 1983  C CD1  . ILE A 1 130 ? 35.958  6.113   -7.649  1.00 0.00 ? 130 ILE A CD1  1  
ATOM 1984  H H    . ILE A 1 130 ? 36.275  9.473   -6.311  1.00 0.00 ? 130 ILE A H    1  
ATOM 1985  H HA   . ILE A 1 130 ? 35.066  8.098   -3.997  1.00 0.00 ? 130 ILE A HA   1  
ATOM 1986  H HB   . ILE A 1 130 ? 37.328  7.228   -5.857  1.00 0.00 ? 130 ILE A HB   1  
ATOM 1987  H HG12 . ILE A 1 130 ? 34.517  6.204   -6.058  1.00 0.00 ? 130 ILE A HG12 1  
ATOM 1988  H HG13 . ILE A 1 130 ? 34.896  7.765   -6.776  1.00 0.00 ? 130 ILE A HG13 1  
ATOM 1989  H HG21 . ILE A 1 130 ? 35.567  5.848   -3.785  1.00 0.00 ? 130 ILE A HG21 1  
ATOM 1990  H HG22 . ILE A 1 130 ? 36.370  4.926   -5.052  1.00 0.00 ? 130 ILE A HG22 1  
ATOM 1991  H HG23 . ILE A 1 130 ? 37.325  5.838   -3.888  1.00 0.00 ? 130 ILE A HG23 1  
ATOM 1992  H HD11 . ILE A 1 130 ? 36.797  6.693   -8.003  1.00 0.00 ? 130 ILE A HD11 1  
ATOM 1993  H HD12 . ILE A 1 130 ? 36.303  5.135   -7.349  1.00 0.00 ? 130 ILE A HD12 1  
ATOM 1994  H HD13 . ILE A 1 130 ? 35.237  6.005   -8.446  1.00 0.00 ? 130 ILE A HD13 1  
ATOM 1995  N N    . ASP A 1 131 ? 37.201  7.755   -2.548  1.00 0.00 ? 131 ASP A N    1  
ATOM 1996  C CA   . ASP A 1 131 ? 38.272  7.969   -1.547  1.00 0.00 ? 131 ASP A CA   1  
ATOM 1997  C C    . ASP A 1 131 ? 38.578  6.681   -0.796  1.00 0.00 ? 131 ASP A C    1  
ATOM 1998  O O    . ASP A 1 131 ? 39.719  6.385   -0.504  1.00 0.00 ? 131 ASP A O    1  
ATOM 1999  C CB   . ASP A 1 131 ? 37.793  9.026   -0.543  1.00 0.00 ? 131 ASP A CB   1  
ATOM 2000  C CG   . ASP A 1 131 ? 38.985  9.515   0.284   1.00 0.00 ? 131 ASP A CG   1  
ATOM 2001  O OD1  . ASP A 1 131 ? 40.063  9.551   -0.289  1.00 0.00 ? 131 ASP A OD1  1  
ATOM 2002  O OD2  . ASP A 1 131 ? 38.750  9.823   1.439   1.00 0.00 ? 131 ASP A OD2  1  
ATOM 2003  H H    . ASP A 1 131 ? 36.567  7.015   -2.444  1.00 0.00 ? 131 ASP A H    1  
ATOM 2004  H HA   . ASP A 1 131 ? 39.174  8.302   -2.059  1.00 0.00 ? 131 ASP A HA   1  
ATOM 2005  H HB2  . ASP A 1 131 ? 37.358  9.862   -1.071  1.00 0.00 ? 131 ASP A HB2  1  
ATOM 2006  H HB3  . ASP A 1 131 ? 37.054  8.596   0.117   1.00 0.00 ? 131 ASP A HB3  1  
ATOM 2007  N N    . GLY A 1 132 ? 37.550  5.937   -0.494  1.00 0.00 ? 132 GLY A N    1  
ATOM 2008  C CA   . GLY A 1 132 ? 37.763  4.660   0.242   1.00 0.00 ? 132 GLY A CA   1  
ATOM 2009  C C    . GLY A 1 132 ? 38.214  3.559   -0.719  1.00 0.00 ? 132 GLY A C    1  
ATOM 2010  O O    . GLY A 1 132 ? 39.127  3.747   -1.499  1.00 0.00 ? 132 GLY A O    1  
ATOM 2011  H H    . GLY A 1 132 ? 36.648  6.216   -0.751  1.00 0.00 ? 132 GLY A H    1  
ATOM 2012  H HA2  . GLY A 1 132 ? 38.521  4.807   0.999   1.00 0.00 ? 132 GLY A HA2  1  
ATOM 2013  H HA3  . GLY A 1 132 ? 36.839  4.364   0.715   1.00 0.00 ? 132 GLY A HA3  1  
ATOM 2014  N N    . ASP A 1 133 ? 37.565  2.429   -0.642  1.00 0.00 ? 133 ASP A N    1  
ATOM 2015  C CA   . ASP A 1 133 ? 37.941  1.311   -1.539  1.00 0.00 ? 133 ASP A CA   1  
ATOM 2016  C C    . ASP A 1 133 ? 37.327  1.497   -2.922  1.00 0.00 ? 133 ASP A C    1  
ATOM 2017  O O    . ASP A 1 133 ? 38.029  1.608   -3.906  1.00 0.00 ? 133 ASP A O    1  
ATOM 2018  C CB   . ASP A 1 133 ? 37.410  0.004   -0.934  1.00 0.00 ? 133 ASP A CB   1  
ATOM 2019  C CG   . ASP A 1 133 ? 38.419  -1.118  -1.186  1.00 0.00 ? 133 ASP A CG   1  
ATOM 2020  O OD1  . ASP A 1 133 ? 39.082  -1.032  -2.206  1.00 0.00 ? 133 ASP A OD1  1  
ATOM 2021  O OD2  . ASP A 1 133 ? 38.469  -2.000  -0.343  1.00 0.00 ? 133 ASP A OD2  1  
ATOM 2022  H H    . ASP A 1 133 ? 36.834  2.322   0.003   1.00 0.00 ? 133 ASP A H    1  
ATOM 2023  H HA   . ASP A 1 133 ? 39.027  1.282   -1.634  1.00 0.00 ? 133 ASP A HA   1  
ATOM 2024  H HB2  . ASP A 1 133 ? 37.268  0.125   0.130   1.00 0.00 ? 133 ASP A HB2  1  
ATOM 2025  H HB3  . ASP A 1 133 ? 36.467  -0.254  -1.393  1.00 0.00 ? 133 ASP A HB3  1  
ATOM 2026  N N    . GLY A 1 134 ? 36.021  1.527   -2.970  1.00 0.00 ? 134 GLY A N    1  
ATOM 2027  C CA   . GLY A 1 134 ? 35.343  1.706   -4.286  1.00 0.00 ? 134 GLY A CA   1  
ATOM 2028  C C    . GLY A 1 134 ? 33.924  2.244   -4.087  1.00 0.00 ? 134 GLY A C    1  
ATOM 2029  O O    . GLY A 1 134 ? 33.023  1.923   -4.838  1.00 0.00 ? 134 GLY A O    1  
ATOM 2030  H H    . GLY A 1 134 ? 35.493  1.433   -2.149  1.00 0.00 ? 134 GLY A H    1  
ATOM 2031  H HA2  . GLY A 1 134 ? 35.908  2.404   -4.885  1.00 0.00 ? 134 GLY A HA2  1  
ATOM 2032  H HA3  . GLY A 1 134 ? 35.297  0.755   -4.795  1.00 0.00 ? 134 GLY A HA3  1  
ATOM 2033  N N    . GLN A 1 135 ? 33.754  3.051   -3.075  1.00 0.00 ? 135 GLN A N    1  
ATOM 2034  C CA   . GLN A 1 135 ? 32.409  3.619   -2.809  1.00 0.00 ? 135 GLN A CA   1  
ATOM 2035  C C    . GLN A 1 135 ? 32.100  4.758   -3.776  1.00 0.00 ? 135 GLN A C    1  
ATOM 2036  O O    . GLN A 1 135 ? 32.992  5.334   -4.364  1.00 0.00 ? 135 GLN A O    1  
ATOM 2037  C CB   . GLN A 1 135 ? 32.395  4.169   -1.376  1.00 0.00 ? 135 GLN A CB   1  
ATOM 2038  C CG   . GLN A 1 135 ? 33.106  3.178   -0.454  1.00 0.00 ? 135 GLN A CG   1  
ATOM 2039  C CD   . GLN A 1 135 ? 32.722  3.474   0.996   1.00 0.00 ? 135 GLN A CD   1  
ATOM 2040  O OE1  . GLN A 1 135 ? 33.361  4.255   1.671   1.00 0.00 ? 135 GLN A OE1  1  
ATOM 2041  N NE2  . GLN A 1 135 ? 31.684  2.873   1.512   1.00 0.00 ? 135 GLN A NE2  1  
ATOM 2042  H H    . GLN A 1 135 ? 34.509  3.279   -2.493  1.00 0.00 ? 135 GLN A H    1  
ATOM 2043  H HA   . GLN A 1 135 ? 31.661  2.834   -2.931  1.00 0.00 ? 135 GLN A HA   1  
ATOM 2044  H HB2  . GLN A 1 135 ? 32.905  5.121   -1.347  1.00 0.00 ? 135 GLN A HB2  1  
ATOM 2045  H HB3  . GLN A 1 135 ? 31.376  4.303   -1.047  1.00 0.00 ? 135 GLN A HB3  1  
ATOM 2046  H HG2  . GLN A 1 135 ? 32.810  2.170   -0.703  1.00 0.00 ? 135 GLN A HG2  1  
ATOM 2047  H HG3  . GLN A 1 135 ? 34.175  3.274   -0.567  1.00 0.00 ? 135 GLN A HG3  1  
ATOM 2048  H HE21 . GLN A 1 135 ? 31.165  2.240   0.973   1.00 0.00 ? 135 GLN A HE21 1  
ATOM 2049  H HE22 . GLN A 1 135 ? 31.426  3.054   2.441   1.00 0.00 ? 135 GLN A HE22 1  
ATOM 2050  N N    . VAL A 1 136 ? 30.840  5.063   -3.921  1.00 0.00 ? 136 VAL A N    1  
ATOM 2051  C CA   . VAL A 1 136 ? 30.456  6.159   -4.844  1.00 0.00 ? 136 VAL A CA   1  
ATOM 2052  C C    . VAL A 1 136 ? 29.200  6.865   -4.356  1.00 0.00 ? 136 VAL A C    1  
ATOM 2053  O O    . VAL A 1 136 ? 28.188  6.238   -4.118  1.00 0.00 ? 136 VAL A O    1  
ATOM 2054  C CB   . VAL A 1 136 ? 30.157  5.546   -6.221  1.00 0.00 ? 136 VAL A CB   1  
ATOM 2055  C CG1  . VAL A 1 136 ? 29.948  6.669   -7.238  1.00 0.00 ? 136 VAL A CG1  1  
ATOM 2056  C CG2  . VAL A 1 136 ? 31.337  4.685   -6.664  1.00 0.00 ? 136 VAL A CG2  1  
ATOM 2057  H H    . VAL A 1 136 ? 30.154  4.572   -3.424  1.00 0.00 ? 136 VAL A H    1  
ATOM 2058  H HA   . VAL A 1 136 ? 31.272  6.878   -4.910  1.00 0.00 ? 136 VAL A HA   1  
ATOM 2059  H HB   . VAL A 1 136 ? 29.269  4.943   -6.162  1.00 0.00 ? 136 VAL A HB   1  
ATOM 2060  H HG11 . VAL A 1 136 ? 30.810  7.321   -7.243  1.00 0.00 ? 136 VAL A HG11 1  
ATOM 2061  H HG12 . VAL A 1 136 ? 29.817  6.246   -8.224  1.00 0.00 ? 136 VAL A HG12 1  
ATOM 2062  H HG13 . VAL A 1 136 ? 29.071  7.239   -6.974  1.00 0.00 ? 136 VAL A HG13 1  
ATOM 2063  H HG21 . VAL A 1 136 ? 32.249  5.259   -6.607  1.00 0.00 ? 136 VAL A HG21 1  
ATOM 2064  H HG22 . VAL A 1 136 ? 31.419  3.821   -6.023  1.00 0.00 ? 136 VAL A HG22 1  
ATOM 2065  H HG23 . VAL A 1 136 ? 31.185  4.359   -7.682  1.00 0.00 ? 136 VAL A HG23 1  
ATOM 2066  N N    . ASN A 1 137 ? 29.283  8.159   -4.213  1.00 0.00 ? 137 ASN A N    1  
ATOM 2067  C CA   . ASN A 1 137 ? 28.094  8.909   -3.743  1.00 0.00 ? 137 ASN A CA   1  
ATOM 2068  C C    . ASN A 1 137 ? 27.032  8.911   -4.829  1.00 0.00 ? 137 ASN A C    1  
ATOM 2069  O O    . ASN A 1 137 ? 26.880  9.880   -5.548  1.00 0.00 ? 137 ASN A O    1  
ATOM 2070  C CB   . ASN A 1 137 ? 28.517  10.358  -3.451  1.00 0.00 ? 137 ASN A CB   1  
ATOM 2071  C CG   . ASN A 1 137 ? 27.419  11.053  -2.642  1.00 0.00 ? 137 ASN A CG   1  
ATOM 2072  O OD1  . ASN A 1 137 ? 27.586  12.161  -2.173  1.00 0.00 ? 137 ASN A OD1  1  
ATOM 2073  N ND2  . ASN A 1 137 ? 26.285  10.436  -2.454  1.00 0.00 ? 137 ASN A ND2  1  
ATOM 2074  H H    . ASN A 1 137 ? 30.117  8.630   -4.416  1.00 0.00 ? 137 ASN A H    1  
ATOM 2075  H HA   . ASN A 1 137 ? 27.696  8.428   -2.848  1.00 0.00 ? 137 ASN A HA   1  
ATOM 2076  H HB2  . ASN A 1 137 ? 29.435  10.364  -2.883  1.00 0.00 ? 137 ASN A HB2  1  
ATOM 2077  H HB3  . ASN A 1 137 ? 28.667  10.891  -4.379  1.00 0.00 ? 137 ASN A HB3  1  
ATOM 2078  H HD21 . ASN A 1 137 ? 26.146  9.540   -2.827  1.00 0.00 ? 137 ASN A HD21 1  
ATOM 2079  H HD22 . ASN A 1 137 ? 25.571  10.870  -1.941  1.00 0.00 ? 137 ASN A HD22 1  
ATOM 2080  N N    . TYR A 1 138 ? 26.318  7.819   -4.932  1.00 0.00 ? 138 TYR A N    1  
ATOM 2081  C CA   . TYR A 1 138 ? 25.258  7.726   -5.967  1.00 0.00 ? 138 TYR A CA   1  
ATOM 2082  C C    . TYR A 1 138 ? 24.491  9.041   -6.106  1.00 0.00 ? 138 TYR A C    1  
ATOM 2083  O O    . TYR A 1 138 ? 24.136  9.436   -7.198  1.00 0.00 ? 138 TYR A O    1  
ATOM 2084  C CB   . TYR A 1 138 ? 24.287  6.594   -5.574  1.00 0.00 ? 138 TYR A CB   1  
ATOM 2085  C CG   . TYR A 1 138 ? 23.121  7.153   -4.758  1.00 0.00 ? 138 TYR A CG   1  
ATOM 2086  C CD1  . TYR A 1 138 ? 22.134  7.895   -5.366  1.00 0.00 ? 138 TYR A CD1  1  
ATOM 2087  C CD2  . TYR A 1 138 ? 23.025  6.893   -3.404  1.00 0.00 ? 138 TYR A CD2  1  
ATOM 2088  C CE1  . TYR A 1 138 ? 21.065  8.371   -4.637  1.00 0.00 ? 138 TYR A CE1  1  
ATOM 2089  C CE2  . TYR A 1 138 ? 21.956  7.369   -2.675  1.00 0.00 ? 138 TYR A CE2  1  
ATOM 2090  C CZ   . TYR A 1 138 ? 20.968  8.112   -3.285  1.00 0.00 ? 138 TYR A CZ   1  
ATOM 2091  O OH   . TYR A 1 138 ? 19.895  8.581   -2.558  1.00 0.00 ? 138 TYR A OH   1  
ATOM 2092  H H    . TYR A 1 138 ? 26.481  7.066   -4.328  1.00 0.00 ? 138 TYR A H    1  
ATOM 2093  H HA   . TYR A 1 138 ? 25.737  7.499   -6.924  1.00 0.00 ? 138 TYR A HA   1  
ATOM 2094  H HB2  . TYR A 1 138 ? 23.900  6.121   -6.465  1.00 0.00 ? 138 TYR A HB2  1  
ATOM 2095  H HB3  . TYR A 1 138 ? 24.808  5.857   -4.983  1.00 0.00 ? 138 TYR A HB3  1  
ATOM 2096  H HD1  . TYR A 1 138 ? 22.199  8.106   -6.422  1.00 0.00 ? 138 TYR A HD1  1  
ATOM 2097  H HD2  . TYR A 1 138 ? 23.790  6.309   -2.916  1.00 0.00 ? 138 TYR A HD2  1  
ATOM 2098  H HE1  . TYR A 1 138 ? 20.295  8.944   -5.128  1.00 0.00 ? 138 TYR A HE1  1  
ATOM 2099  H HE2  . TYR A 1 138 ? 21.891  7.157   -1.618  1.00 0.00 ? 138 TYR A HE2  1  
ATOM 2100  H HH   . TYR A 1 138 ? 19.239  7.881   -2.511  1.00 0.00 ? 138 TYR A HH   1  
ATOM 2101  N N    . GLU A 1 139 ? 24.251  9.699   -5.004  1.00 0.00 ? 139 GLU A N    1  
ATOM 2102  C CA   . GLU A 1 139 ? 23.512  10.986  -5.077  1.00 0.00 ? 139 GLU A CA   1  
ATOM 2103  C C    . GLU A 1 139 ? 24.209  11.935  -6.040  1.00 0.00 ? 139 GLU A C    1  
ATOM 2104  O O    . GLU A 1 139 ? 23.574  12.565  -6.861  1.00 0.00 ? 139 GLU A O    1  
ATOM 2105  C CB   . GLU A 1 139 ? 23.491  11.614  -3.675  1.00 0.00 ? 139 GLU A CB   1  
ATOM 2106  C CG   . GLU A 1 139 ? 22.732  10.688  -2.722  1.00 0.00 ? 139 GLU A CG   1  
ATOM 2107  C CD   . GLU A 1 139 ? 21.244  11.046  -2.745  1.00 0.00 ? 139 GLU A CD   1  
ATOM 2108  O OE1  . GLU A 1 139 ? 20.623  10.715  -3.741  1.00 0.00 ? 139 GLU A OE1  1  
ATOM 2109  O OE2  . GLU A 1 139 ? 20.813  11.628  -1.763  1.00 0.00 ? 139 GLU A OE2  1  
ATOM 2110  H H    . GLU A 1 139 ? 24.554  9.348   -4.140  1.00 0.00 ? 139 GLU A H    1  
ATOM 2111  H HA   . GLU A 1 139 ? 22.498  10.796  -5.440  1.00 0.00 ? 139 GLU A HA   1  
ATOM 2112  H HB2  . GLU A 1 139 ? 24.504  11.746  -3.322  1.00 0.00 ? 139 GLU A HB2  1  
ATOM 2113  H HB3  . GLU A 1 139 ? 23.002  12.576  -3.715  1.00 0.00 ? 139 GLU A HB3  1  
ATOM 2114  H HG2  . GLU A 1 139 ? 22.855  9.661   -3.034  1.00 0.00 ? 139 GLU A HG2  1  
ATOM 2115  H HG3  . GLU A 1 139 ? 23.112  10.803  -1.718  1.00 0.00 ? 139 GLU A HG3  1  
ATOM 2116  N N    . GLU A 1 140 ? 25.505  12.027  -5.922  1.00 0.00 ? 140 GLU A N    1  
ATOM 2117  C CA   . GLU A 1 140 ? 26.248  12.929  -6.829  1.00 0.00 ? 140 GLU A CA   1  
ATOM 2118  C C    . GLU A 1 140 ? 26.238  12.351  -8.233  1.00 0.00 ? 140 GLU A C    1  
ATOM 2119  O O    . GLU A 1 140 ? 26.255  13.069  -9.207  1.00 0.00 ? 140 GLU A O    1  
ATOM 2120  C CB   . GLU A 1 140 ? 27.702  13.032  -6.343  1.00 0.00 ? 140 GLU A CB   1  
ATOM 2121  C CG   . GLU A 1 140 ? 27.746  13.849  -5.051  1.00 0.00 ? 140 GLU A CG   1  
ATOM 2122  C CD   . GLU A 1 140 ? 29.201  14.016  -4.608  1.00 0.00 ? 140 GLU A CD   1  
ATOM 2123  O OE1  . GLU A 1 140 ? 29.843  12.988  -4.464  1.00 0.00 ? 140 GLU A OE1  1  
ATOM 2124  O OE2  . GLU A 1 140 ? 29.589  15.160  -4.439  1.00 0.00 ? 140 GLU A OE2  1  
ATOM 2125  H H    . GLU A 1 140 ? 25.980  11.506  -5.241  1.00 0.00 ? 140 GLU A H    1  
ATOM 2126  H HA   . GLU A 1 140 ? 25.764  13.907  -6.839  1.00 0.00 ? 140 GLU A HA   1  
ATOM 2127  H HB2  . GLU A 1 140 ? 28.093  12.042  -6.161  1.00 0.00 ? 140 GLU A HB2  1  
ATOM 2128  H HB3  . GLU A 1 140 ? 28.304  13.516  -7.099  1.00 0.00 ? 140 GLU A HB3  1  
ATOM 2129  H HG2  . GLU A 1 140 ? 27.309  14.822  -5.218  1.00 0.00 ? 140 GLU A HG2  1  
ATOM 2130  H HG3  . GLU A 1 140 ? 27.193  13.339  -4.276  1.00 0.00 ? 140 GLU A HG3  1  
ATOM 2131  N N    . PHE A 1 141 ? 26.207  11.048  -8.300  1.00 0.00 ? 141 PHE A N    1  
ATOM 2132  C CA   . PHE A 1 141 ? 26.193  10.383  -9.622  1.00 0.00 ? 141 PHE A CA   1  
ATOM 2133  C C    . PHE A 1 141 ? 24.847  10.577  -10.295 1.00 0.00 ? 141 PHE A C    1  
ATOM 2134  O O    . PHE A 1 141 ? 24.742  10.538  -11.503 1.00 0.00 ? 141 PHE A O    1  
ATOM 2135  C CB   . PHE A 1 141 ? 26.417  8.880   -9.403  1.00 0.00 ? 141 PHE A CB   1  
ATOM 2136  C CG   . PHE A 1 141 ? 27.386  8.347   -10.456 1.00 0.00 ? 141 PHE A CG   1  
ATOM 2137  C CD1  . PHE A 1 141 ? 28.705  8.754   -10.461 1.00 0.00 ? 141 PHE A CD1  1  
ATOM 2138  C CD2  . PHE A 1 141 ? 26.961  7.430   -11.401 1.00 0.00 ? 141 PHE A CD2  1  
ATOM 2139  C CE1  . PHE A 1 141 ? 29.586  8.250   -11.394 1.00 0.00 ? 141 PHE A CE1  1  
ATOM 2140  C CE2  . PHE A 1 141 ? 27.843  6.928   -12.332 1.00 0.00 ? 141 PHE A CE2  1  
ATOM 2141  C CZ   . PHE A 1 141 ? 29.159  7.339   -12.327 1.00 0.00 ? 141 PHE A CZ   1  
ATOM 2142  H H    . PHE A 1 141 ? 26.193  10.514  -7.480  1.00 0.00 ? 141 PHE A H    1  
ATOM 2143  H HA   . PHE A 1 141 ? 26.975  10.808  -10.249 1.00 0.00 ? 141 PHE A HA   1  
ATOM 2144  H HB2  . PHE A 1 141 ? 26.833  8.713   -8.420  1.00 0.00 ? 141 PHE A HB2  1  
ATOM 2145  H HB3  . PHE A 1 141 ? 25.478  8.355   -9.485  1.00 0.00 ? 141 PHE A HB3  1  
ATOM 2146  H HD1  . PHE A 1 141 ? 29.047  9.475   -9.735  1.00 0.00 ? 141 PHE A HD1  1  
ATOM 2147  H HD2  . PHE A 1 141 ? 25.931  7.111   -11.413 1.00 0.00 ? 141 PHE A HD2  1  
ATOM 2148  H HE1  . PHE A 1 141 ? 30.611  8.576   -11.392 1.00 0.00 ? 141 PHE A HE1  1  
ATOM 2149  H HE2  . PHE A 1 141 ? 27.501  6.212   -13.067 1.00 0.00 ? 141 PHE A HE2  1  
ATOM 2150  H HZ   . PHE A 1 141 ? 29.858  6.937   -13.048 1.00 0.00 ? 141 PHE A HZ   1  
ATOM 2151  N N    . VAL A 1 142 ? 23.835  10.781  -9.495  1.00 0.00 ? 142 VAL A N    1  
ATOM 2152  C CA   . VAL A 1 142 ? 22.486  10.980  -10.066 1.00 0.00 ? 142 VAL A CA   1  
ATOM 2153  C C    . VAL A 1 142 ? 22.397  12.317  -10.802 1.00 0.00 ? 142 VAL A C    1  
ATOM 2154  O O    . VAL A 1 142 ? 21.803  12.407  -11.858 1.00 0.00 ? 142 VAL A O    1  
ATOM 2155  C CB   . VAL A 1 142 ? 21.467  10.971  -8.912  1.00 0.00 ? 142 VAL A CB   1  
ATOM 2156  C CG1  . VAL A 1 142 ? 20.147  11.560  -9.406  1.00 0.00 ? 142 VAL A CG1  1  
ATOM 2157  C CG2  . VAL A 1 142 ? 21.230  9.532   -8.457  1.00 0.00 ? 142 VAL A CG2  1  
ATOM 2158  H H    . VAL A 1 142 ? 23.970  10.802  -8.524  1.00 0.00 ? 142 VAL A H    1  
ATOM 2159  H HA   . VAL A 1 142 ? 22.279  10.177  -10.768 1.00 0.00 ? 142 VAL A HA   1  
ATOM 2160  H HB   . VAL A 1 142 ? 21.842  11.554  -8.085  1.00 0.00 ? 142 VAL A HB   1  
ATOM 2161  H HG11 . VAL A 1 142 ? 19.841  11.056  -10.310 1.00 0.00 ? 142 VAL A HG11 1  
ATOM 2162  H HG12 . VAL A 1 142 ? 19.387  11.431  -8.650  1.00 0.00 ? 142 VAL A HG12 1  
ATOM 2163  H HG13 . VAL A 1 142 ? 20.272  12.612  -9.610  1.00 0.00 ? 142 VAL A HG13 1  
ATOM 2164  H HG21 . VAL A 1 142 ? 22.168  9.003   -8.424  1.00 0.00 ? 142 VAL A HG21 1  
ATOM 2165  H HG22 . VAL A 1 142 ? 20.785  9.527   -7.472  1.00 0.00 ? 142 VAL A HG22 1  
ATOM 2166  H HG23 . VAL A 1 142 ? 20.566  9.036   -9.147  1.00 0.00 ? 142 VAL A HG23 1  
ATOM 2167  N N    . GLN A 1 143 ? 22.992  13.332  -10.231 1.00 0.00 ? 143 GLN A N    1  
ATOM 2168  C CA   . GLN A 1 143 ? 22.950  14.663  -10.885 1.00 0.00 ? 143 GLN A CA   1  
ATOM 2169  C C    . GLN A 1 143 ? 24.142  14.856  -11.820 1.00 0.00 ? 143 GLN A C    1  
ATOM 2170  O O    . GLN A 1 143 ? 24.016  15.441  -12.878 1.00 0.00 ? 143 GLN A O    1  
ATOM 2171  C CB   . GLN A 1 143 ? 22.993  15.742  -9.791  1.00 0.00 ? 143 GLN A CB   1  
ATOM 2172  C CG   . GLN A 1 143 ? 21.583  15.939  -9.228  1.00 0.00 ? 143 GLN A CG   1  
ATOM 2173  C CD   . GLN A 1 143 ? 20.656  16.423  -10.345 1.00 0.00 ? 143 GLN A CD   1  
ATOM 2174  O OE1  . GLN A 1 143 ? 19.559  15.927  -10.517 1.00 0.00 ? 143 GLN A OE1  1  
ATOM 2175  N NE2  . GLN A 1 143 ? 21.057  17.389  -11.128 1.00 0.00 ? 143 GLN A NE2  1  
ATOM 2176  H H    . GLN A 1 143 ? 23.460  13.215  -9.382  1.00 0.00 ? 143 GLN A H    1  
ATOM 2177  H HA   . GLN A 1 143 ? 22.034  14.739  -11.465 1.00 0.00 ? 143 GLN A HA   1  
ATOM 2178  H HB2  . GLN A 1 143 ? 23.660  15.432  -9.000  1.00 0.00 ? 143 GLN A HB2  1  
ATOM 2179  H HB3  . GLN A 1 143 ? 23.348  16.672  -10.211 1.00 0.00 ? 143 GLN A HB3  1  
ATOM 2180  H HG2  . GLN A 1 143 ? 21.211  15.004  -8.837  1.00 0.00 ? 143 GLN A HG2  1  
ATOM 2181  H HG3  . GLN A 1 143 ? 21.603  16.675  -8.437  1.00 0.00 ? 143 GLN A HG3  1  
ATOM 2182  H HE21 . GLN A 1 143 ? 21.940  17.792  -10.995 1.00 0.00 ? 143 GLN A HE21 1  
ATOM 2183  H HE22 . GLN A 1 143 ? 20.475  17.708  -11.849 1.00 0.00 ? 143 GLN A HE22 1  
ATOM 2184  N N    . MET A 1 144 ? 25.278  14.360  -11.413 1.00 0.00 ? 144 MET A N    1  
ATOM 2185  C CA   . MET A 1 144 ? 26.487  14.508  -12.265 1.00 0.00 ? 144 MET A CA   1  
ATOM 2186  C C    . MET A 1 144 ? 26.313  13.772  -13.585 1.00 0.00 ? 144 MET A C    1  
ATOM 2187  O O    . MET A 1 144 ? 27.117  13.910  -14.487 1.00 0.00 ? 144 MET A O    1  
ATOM 2188  C CB   . MET A 1 144 ? 27.691  13.911  -11.519 1.00 0.00 ? 144 MET A CB   1  
ATOM 2189  C CG   . MET A 1 144 ? 28.969  14.249  -12.288 1.00 0.00 ? 144 MET A CG   1  
ATOM 2190  S SD   . MET A 1 144 ? 30.528  14.214  -11.369 1.00 0.00 ? 144 MET A SD   1  
ATOM 2191  C CE   . MET A 1 144 ? 31.071  12.576  -11.913 1.00 0.00 ? 144 MET A CE   1  
ATOM 2192  H H    . MET A 1 144 ? 25.331  13.894  -10.558 1.00 0.00 ? 144 MET A H    1  
ATOM 2193  H HA   . MET A 1 144 ? 26.646  15.566  -12.470 1.00 0.00 ? 144 MET A HA   1  
ATOM 2194  H HB2  . MET A 1 144 ? 27.746  14.330  -10.525 1.00 0.00 ? 144 MET A HB2  1  
ATOM 2195  H HB3  . MET A 1 144 ? 27.581  12.839  -11.447 1.00 0.00 ? 144 MET A HB3  1  
ATOM 2196  H HG2  . MET A 1 144 ? 29.060  13.556  -13.111 1.00 0.00 ? 144 MET A HG2  1  
ATOM 2197  H HG3  . MET A 1 144 ? 28.859  15.239  -12.706 1.00 0.00 ? 144 MET A HG3  1  
ATOM 2198  H HE1  . MET A 1 144 ? 30.207  11.959  -12.114 1.00 0.00 ? 144 MET A HE1  1  
ATOM 2199  H HE2  . MET A 1 144 ? 31.662  12.671  -12.812 1.00 0.00 ? 144 MET A HE2  1  
ATOM 2200  H HE3  . MET A 1 144 ? 31.667  12.119  -11.137 1.00 0.00 ? 144 MET A HE3  1  
ATOM 2201  N N    . MET A 1 145 ? 25.266  13.001  -13.679 1.00 0.00 ? 145 MET A N    1  
ATOM 2202  C CA   . MET A 1 145 ? 25.027  12.252  -14.931 1.00 0.00 ? 145 MET A CA   1  
ATOM 2203  C C    . MET A 1 145 ? 24.424  13.180  -15.968 1.00 0.00 ? 145 MET A C    1  
ATOM 2204  O O    . MET A 1 145 ? 24.355  12.858  -17.139 1.00 0.00 ? 145 MET A O    1  
ATOM 2205  C CB   . MET A 1 145 ? 24.033  11.112  -14.629 1.00 0.00 ? 145 MET A CB   1  
ATOM 2206  C CG   . MET A 1 145 ? 24.658  9.763   -15.013 1.00 0.00 ? 145 MET A CG   1  
ATOM 2207  S SD   . MET A 1 145 ? 26.404  9.490   -14.619 1.00 0.00 ? 145 MET A SD   1  
ATOM 2208  C CE   . MET A 1 145 ? 26.454  7.732   -15.049 1.00 0.00 ? 145 MET A CE   1  
ATOM 2209  H H    . MET A 1 145 ? 24.632  12.936  -12.938 1.00 0.00 ? 145 MET A H    1  
ATOM 2210  H HA   . MET A 1 145 ? 25.972  11.864  -15.304 1.00 0.00 ? 145 MET A HA   1  
ATOM 2211  H HB2  . MET A 1 145 ? 23.794  11.112  -13.578 1.00 0.00 ? 145 MET A HB2  1  
ATOM 2212  H HB3  . MET A 1 145 ? 23.125  11.263  -15.196 1.00 0.00 ? 145 MET A HB3  1  
ATOM 2213  H HG2  . MET A 1 145 ? 24.093  8.983   -14.523 1.00 0.00 ? 145 MET A HG2  1  
ATOM 2214  H HG3  . MET A 1 145 ? 24.540  9.628   -16.076 1.00 0.00 ? 145 MET A HG3  1  
ATOM 2215  H HE1  . MET A 1 145 ? 25.970  7.581   -16.004 1.00 0.00 ? 145 MET A HE1  1  
ATOM 2216  H HE2  . MET A 1 145 ? 27.481  7.401   -15.110 1.00 0.00 ? 145 MET A HE2  1  
ATOM 2217  H HE3  . MET A 1 145 ? 25.938  7.163   -14.289 1.00 0.00 ? 145 MET A HE3  1  
ATOM 2218  N N    . THR A 1 146 ? 23.998  14.325  -15.501 1.00 0.00 ? 146 THR A N    1  
ATOM 2219  C CA   . THR A 1 146 ? 23.391  15.320  -16.404 1.00 0.00 ? 146 THR A CA   1  
ATOM 2220  C C    . THR A 1 146 ? 24.316  16.520  -16.569 1.00 0.00 ? 146 THR A C    1  
ATOM 2221  O O    . THR A 1 146 ? 24.492  17.029  -17.659 1.00 0.00 ? 146 THR A O    1  
ATOM 2222  C CB   . THR A 1 146 ? 22.089  15.788  -15.761 1.00 0.00 ? 146 THR A CB   1  
ATOM 2223  O OG1  . THR A 1 146 ? 21.276  14.635  -15.681 1.00 0.00 ? 146 THR A OG1  1  
ATOM 2224  C CG2  . THR A 1 146 ? 21.337  16.726  -16.695 1.00 0.00 ? 146 THR A CG2  1  
ATOM 2225  H H    . THR A 1 146 ? 24.077  14.523  -14.548 1.00 0.00 ? 146 THR A H    1  
ATOM 2226  H HA   . THR A 1 146 ? 23.205  14.870  -17.377 1.00 0.00 ? 146 THR A HA   1  
ATOM 2227  H HB   . THR A 1 146 ? 22.256  16.216  -14.775 1.00 0.00 ? 146 THR A HB   1  
ATOM 2228  H HG1  . THR A 1 146 ? 20.651  14.762  -14.963 1.00 0.00 ? 146 THR A HG1  1  
ATOM 2229  H HG21 . THR A 1 146 ? 22.040  17.266  -17.310 1.00 0.00 ? 146 THR A HG21 1  
ATOM 2230  H HG22 . THR A 1 146 ? 20.675  16.154  -17.326 1.00 0.00 ? 146 THR A HG22 1  
ATOM 2231  H HG23 . THR A 1 146 ? 20.759  17.428  -16.114 1.00 0.00 ? 146 THR A HG23 1  
ATOM 2232  N N    . ALA A 1 147 ? 24.892  16.951  -15.475 1.00 0.00 ? 147 ALA A N    1  
ATOM 2233  C CA   . ALA A 1 147 ? 25.811  18.114  -15.538 1.00 0.00 ? 147 ALA A CA   1  
ATOM 2234  C C    . ALA A 1 147 ? 25.188  19.259  -16.324 1.00 0.00 ? 147 ALA A C    1  
ATOM 2235  O O    . ALA A 1 147 ? 23.982  19.399  -16.372 1.00 0.00 ? 147 ALA A O    1  
ATOM 2236  C CB   . ALA A 1 147 ? 27.104  17.675  -16.242 1.00 0.00 ? 147 ALA A CB   1  
ATOM 2237  H H    . ALA A 1 147 ? 24.717  16.506  -14.619 1.00 0.00 ? 147 ALA A H    1  
ATOM 2238  H HA   . ALA A 1 147 ? 26.020  18.455  -14.523 1.00 0.00 ? 147 ALA A HA   1  
ATOM 2239  H HB1  . ALA A 1 147 ? 27.148  16.598  -16.284 1.00 0.00 ? 147 ALA A HB1  1  
ATOM 2240  H HB2  . ALA A 1 147 ? 27.124  18.073  -17.247 1.00 0.00 ? 147 ALA A HB2  1  
ATOM 2241  H HB3  . ALA A 1 147 ? 27.960  18.045  -15.697 1.00 0.00 ? 147 ALA A HB3  1  
ATOM 2242  N N    . LYS A 1 148 ? 26.022  20.060  -16.925 1.00 0.00 ? 148 LYS A N    1  
ATOM 2243  C CA   . LYS A 1 148 ? 25.497  21.200  -17.713 1.00 0.00 ? 148 LYS A CA   1  
ATOM 2244  C C    . LYS A 1 148 ? 24.359  20.752  -18.619 1.00 0.00 ? 148 LYS A C    1  
ATOM 2245  O O    . LYS A 1 148 ? 23.411  21.513  -18.712 1.00 0.00 ? 148 LYS A O    1  
ATOM 2246  C CB   . LYS A 1 148 ? 26.634  21.750  -18.585 1.00 0.00 ? 148 LYS A CB   1  
ATOM 2247  C CG   . LYS A 1 148 ? 26.240  23.130  -19.109 1.00 0.00 ? 148 LYS A CG   1  
ATOM 2248  C CD   . LYS A 1 148 ? 27.450  23.768  -19.791 1.00 0.00 ? 148 LYS A CD   1  
ATOM 2249  C CE   . LYS A 1 148 ? 26.968  24.838  -20.773 1.00 0.00 ? 148 LYS A CE   1  
ATOM 2250  N NZ   . LYS A 1 148 ? 28.120  25.634  -21.280 1.00 0.00 ? 148 LYS A NZ   1  
ATOM 2251  O OXT  . LYS A 1 148 ? 24.496  19.672  -19.168 1.00 0.00 ? 148 LYS A OXT  1  
ATOM 2252  H H    . LYS A 1 148 ? 26.989  19.910  -16.858 1.00 0.00 ? 148 LYS A H    1  
ATOM 2253  H HA   . LYS A 1 148 ? 25.129  21.963  -17.029 1.00 0.00 ? 148 LYS A HA   1  
ATOM 2254  H HB2  . LYS A 1 148 ? 27.537  21.829  -17.997 1.00 0.00 ? 148 LYS A HB2  1  
ATOM 2255  H HB3  . LYS A 1 148 ? 26.809  21.082  -19.415 1.00 0.00 ? 148 LYS A HB3  1  
ATOM 2256  H HG2  . LYS A 1 148 ? 25.432  23.032  -19.819 1.00 0.00 ? 148 LYS A HG2  1  
ATOM 2257  H HG3  . LYS A 1 148 ? 25.916  23.751  -18.287 1.00 0.00 ? 148 LYS A HG3  1  
ATOM 2258  H HD2  . LYS A 1 148 ? 28.089  24.221  -19.048 1.00 0.00 ? 148 LYS A HD2  1  
ATOM 2259  H HD3  . LYS A 1 148 ? 28.007  23.012  -20.324 1.00 0.00 ? 148 LYS A HD3  1  
ATOM 2260  H HE2  . LYS A 1 148 ? 26.471  24.366  -21.608 1.00 0.00 ? 148 LYS A HE2  1  
ATOM 2261  H HE3  . LYS A 1 148 ? 26.273  25.499  -20.276 1.00 0.00 ? 148 LYS A HE3  1  
ATOM 2262  H HZ1  . LYS A 1 148 ? 28.978  25.046  -21.272 1.00 0.00 ? 148 LYS A HZ1  1  
ATOM 2263  H HZ2  . LYS A 1 148 ? 27.925  25.948  -22.252 1.00 0.00 ? 148 LYS A HZ2  1  
ATOM 2264  H HZ3  . LYS A 1 148 ? 28.264  26.464  -20.670 1.00 0.00 ? 148 LYS A HZ3  1  
ATOM 2265  N N    . ALA A 1 1   ? 11.227  14.550  -12.463 1.00 0.00 ? 1   ALA A N    2  
ATOM 2266  C CA   . ALA A 1 1   ? 10.434  15.665  -13.031 1.00 0.00 ? 1   ALA A CA   2  
ATOM 2267  C C    . ALA A 1 1   ? 9.730   15.212  -14.304 1.00 0.00 ? 1   ALA A C    2  
ATOM 2268  O O    . ALA A 1 1   ? 9.514   15.994  -15.208 1.00 0.00 ? 1   ALA A O    2  
ATOM 2269  C CB   . ALA A 1 1   ? 11.359  16.843  -13.378 1.00 0.00 ? 1   ALA A CB   2  
ATOM 2270  H H1   . ALA A 1 1   ? 11.202  13.739  -13.114 1.00 0.00 ? 1   ALA A H1   2  
ATOM 2271  H H2   . ALA A 1 1   ? 12.211  14.857  -12.329 1.00 0.00 ? 1   ALA A H2   2  
ATOM 2272  H H3   . ALA A 1 1   ? 10.823  14.270  -11.545 1.00 0.00 ? 1   ALA A H3   2  
ATOM 2273  H HA   . ALA A 1 1   ? 9.679   15.966  -12.303 1.00 0.00 ? 1   ALA A HA   2  
ATOM 2274  H HB1  . ALA A 1 1   ? 12.018  17.046  -12.547 1.00 0.00 ? 1   ALA A HB1  2  
ATOM 2275  H HB2  . ALA A 1 1   ? 11.949  16.598  -14.249 1.00 0.00 ? 1   ALA A HB2  2  
ATOM 2276  H HB3  . ALA A 1 1   ? 10.767  17.722  -13.585 1.00 0.00 ? 1   ALA A HB3  2  
ATOM 2277  N N    . ASP A 1 2   ? 9.386   13.955  -14.353 1.00 0.00 ? 2   ASP A N    2  
ATOM 2278  C CA   . ASP A 1 2   ? 8.696   13.436  -15.559 1.00 0.00 ? 2   ASP A CA   2  
ATOM 2279  C C    . ASP A 1 2   ? 8.361   11.957  -15.402 1.00 0.00 ? 2   ASP A C    2  
ATOM 2280  O O    . ASP A 1 2   ? 7.356   11.491  -15.900 1.00 0.00 ? 2   ASP A O    2  
ATOM 2281  C CB   . ASP A 1 2   ? 9.634   13.606  -16.764 1.00 0.00 ? 2   ASP A CB   2  
ATOM 2282  C CG   . ASP A 1 2   ? 8.854   14.219  -17.930 1.00 0.00 ? 2   ASP A CG   2  
ATOM 2283  O OD1  . ASP A 1 2   ? 8.134   13.460  -18.558 1.00 0.00 ? 2   ASP A OD1  2  
ATOM 2284  O OD2  . ASP A 1 2   ? 9.022   15.411  -18.125 1.00 0.00 ? 2   ASP A OD2  2  
ATOM 2285  H H    . ASP A 1 2   ? 9.582   13.359  -13.601 1.00 0.00 ? 2   ASP A H    2  
ATOM 2286  H HA   . ASP A 1 2   ? 7.772   13.994  -15.707 1.00 0.00 ? 2   ASP A HA   2  
ATOM 2287  H HB2  . ASP A 1 2   ? 10.454  14.258  -16.502 1.00 0.00 ? 2   ASP A HB2  2  
ATOM 2288  H HB3  . ASP A 1 2   ? 10.025  12.643  -17.064 1.00 0.00 ? 2   ASP A HB3  2  
ATOM 2289  N N    . GLN A 1 3   ? 9.209   11.246  -14.710 1.00 0.00 ? 3   GLN A N    2  
ATOM 2290  C CA   . GLN A 1 3   ? 8.953   9.797   -14.511 1.00 0.00 ? 3   GLN A CA   2  
ATOM 2291  C C    . GLN A 1 3   ? 7.846   9.575   -13.486 1.00 0.00 ? 3   GLN A C    2  
ATOM 2292  O O    . GLN A 1 3   ? 7.429   10.494  -12.812 1.00 0.00 ? 3   GLN A O    2  
ATOM 2293  C CB   . GLN A 1 3   ? 10.244  9.143   -13.994 1.00 0.00 ? 3   GLN A CB   2  
ATOM 2294  C CG   . GLN A 1 3   ? 10.574  9.707   -12.608 1.00 0.00 ? 3   GLN A CG   2  
ATOM 2295  C CD   . GLN A 1 3   ? 11.962  10.349  -12.639 1.00 0.00 ? 3   GLN A CD   2  
ATOM 2296  O OE1  . GLN A 1 3   ? 12.786  10.114  -11.778 1.00 0.00 ? 3   GLN A OE1  2  
ATOM 2297  N NE2  . GLN A 1 3   ? 12.260  11.166  -13.612 1.00 0.00 ? 3   GLN A NE2  2  
ATOM 2298  H H    . GLN A 1 3   ? 10.009  11.664  -14.327 1.00 0.00 ? 3   GLN A H    2  
ATOM 2299  H HA   . GLN A 1 3   ? 8.651   9.356   -15.460 1.00 0.00 ? 3   GLN A HA   2  
ATOM 2300  H HB2  . GLN A 1 3   ? 10.105  8.073   -13.926 1.00 0.00 ? 3   GLN A HB2  2  
ATOM 2301  H HB3  . GLN A 1 3   ? 11.055  9.352   -14.676 1.00 0.00 ? 3   GLN A HB3  2  
ATOM 2302  H HG2  . GLN A 1 3   ? 9.842   10.451  -12.331 1.00 0.00 ? 3   GLN A HG2  2  
ATOM 2303  H HG3  . GLN A 1 3   ? 10.567  8.911   -11.879 1.00 0.00 ? 3   GLN A HG3  2  
ATOM 2304  H HE21 . GLN A 1 3   ? 11.598  11.360  -14.309 1.00 0.00 ? 3   GLN A HE21 2  
ATOM 2305  H HE22 . GLN A 1 3   ? 13.144  11.585  -13.646 1.00 0.00 ? 3   GLN A HE22 2  
ATOM 2306  N N    . LEU A 1 4   ? 7.388   8.355   -13.389 1.00 0.00 ? 4   LEU A N    2  
ATOM 2307  C CA   . LEU A 1 4   ? 6.310   8.056   -12.413 1.00 0.00 ? 4   LEU A CA   2  
ATOM 2308  C C    . LEU A 1 4   ? 6.867   7.974   -10.994 1.00 0.00 ? 4   LEU A C    2  
ATOM 2309  O O    . LEU A 1 4   ? 7.051   6.898   -10.459 1.00 0.00 ? 4   LEU A O    2  
ATOM 2310  C CB   . LEU A 1 4   ? 5.692   6.696   -12.779 1.00 0.00 ? 4   LEU A CB   2  
ATOM 2311  C CG   . LEU A 1 4   ? 4.818   6.854   -14.026 1.00 0.00 ? 4   LEU A CG   2  
ATOM 2312  C CD1  . LEU A 1 4   ? 4.754   5.516   -14.767 1.00 0.00 ? 4   LEU A CD1  2  
ATOM 2313  C CD2  . LEU A 1 4   ? 3.406   7.262   -13.600 1.00 0.00 ? 4   LEU A CD2  2  
ATOM 2314  H H    . LEU A 1 4   ? 7.754   7.644   -13.955 1.00 0.00 ? 4   LEU A H    2  
ATOM 2315  H HA   . LEU A 1 4   ? 5.561   8.846   -12.457 1.00 0.00 ? 4   LEU A HA   2  
ATOM 2316  H HB2  . LEU A 1 4   ? 6.477   5.981   -12.975 1.00 0.00 ? 4   LEU A HB2  2  
ATOM 2317  H HB3  . LEU A 1 4   ? 5.088   6.340   -11.957 1.00 0.00 ? 4   LEU A HB3  2  
ATOM 2318  H HG   . LEU A 1 4   ? 5.237   7.611   -14.677 1.00 0.00 ? 4   LEU A HG   2  
ATOM 2319  H HD11 . LEU A 1 4   ? 4.433   4.739   -14.089 1.00 0.00 ? 4   LEU A HD11 2  
ATOM 2320  H HD12 . LEU A 1 4   ? 4.051   5.585   -15.585 1.00 0.00 ? 4   LEU A HD12 2  
ATOM 2321  H HD13 . LEU A 1 4   ? 5.730   5.267   -15.156 1.00 0.00 ? 4   LEU A HD13 2  
ATOM 2322  H HD21 . LEU A 1 4   ? 3.457   8.121   -12.948 1.00 0.00 ? 4   LEU A HD21 2  
ATOM 2323  H HD22 . LEU A 1 4   ? 2.818   7.510   -14.470 1.00 0.00 ? 4   LEU A HD22 2  
ATOM 2324  H HD23 . LEU A 1 4   ? 2.935   6.445   -13.073 1.00 0.00 ? 4   LEU A HD23 2  
ATOM 2325  N N    . THR A 1 5   ? 7.121   9.114   -10.407 1.00 0.00 ? 5   THR A N    2  
ATOM 2326  C CA   . THR A 1 5   ? 7.667   9.116   -9.025  1.00 0.00 ? 5   THR A CA   2  
ATOM 2327  C C    . THR A 1 5   ? 6.662   8.521   -8.040  1.00 0.00 ? 5   THR A C    2  
ATOM 2328  O O    . THR A 1 5   ? 5.565   8.155   -8.413  1.00 0.00 ? 5   THR A O    2  
ATOM 2329  C CB   . THR A 1 5   ? 7.959   10.565  -8.620  1.00 0.00 ? 5   THR A CB   2  
ATOM 2330  O OG1  . THR A 1 5   ? 7.995   10.558  -7.207  1.00 0.00 ? 5   THR A OG1  2  
ATOM 2331  C CG2  . THR A 1 5   ? 6.779   11.482  -8.974  1.00 0.00 ? 5   THR A CG2  2  
ATOM 2332  H H    . THR A 1 5   ? 6.952   9.960   -10.874 1.00 0.00 ? 5   THR A H    2  
ATOM 2333  H HA   . THR A 1 5   ? 8.577   8.518   -9.004  1.00 0.00 ? 5   THR A HA   2  
ATOM 2334  H HB   . THR A 1 5   ? 8.904   10.916  -9.030  1.00 0.00 ? 5   THR A HB   2  
ATOM 2335  H HG1  . THR A 1 5   ? 7.090   10.527  -6.887  1.00 0.00 ? 5   THR A HG1  2  
ATOM 2336  H HG21 . THR A 1 5   ? 5.854   11.026  -8.655  1.00 0.00 ? 5   THR A HG21 2  
ATOM 2337  H HG22 . THR A 1 5   ? 6.895   12.435  -8.476  1.00 0.00 ? 5   THR A HG22 2  
ATOM 2338  H HG23 . THR A 1 5   ? 6.748   11.642  -10.041 1.00 0.00 ? 5   THR A HG23 2  
ATOM 2339  N N    . GLU A 1 6   ? 7.058   8.436   -6.796  1.00 0.00 ? 6   GLU A N    2  
ATOM 2340  C CA   . GLU A 1 6   ? 6.143   7.867   -5.772  1.00 0.00 ? 6   GLU A CA   2  
ATOM 2341  C C    . GLU A 1 6   ? 4.830   8.641   -5.720  1.00 0.00 ? 6   GLU A C    2  
ATOM 2342  O O    . GLU A 1 6   ? 3.767   8.065   -5.810  1.00 0.00 ? 6   GLU A O    2  
ATOM 2343  C CB   . GLU A 1 6   ? 6.827   7.963   -4.400  1.00 0.00 ? 6   GLU A CB   2  
ATOM 2344  C CG   . GLU A 1 6   ? 8.031   7.021   -4.371  1.00 0.00 ? 6   GLU A CG   2  
ATOM 2345  C CD   . GLU A 1 6   ? 8.728   7.136   -3.014  1.00 0.00 ? 6   GLU A CD   2  
ATOM 2346  O OE1  . GLU A 1 6   ? 8.724   8.242   -2.496  1.00 0.00 ? 6   GLU A OE1  2  
ATOM 2347  O OE2  . GLU A 1 6   ? 9.226   6.114   -2.572  1.00 0.00 ? 6   GLU A OE2  2  
ATOM 2348  H H    . GLU A 1 6   ? 7.954   8.744   -6.541  1.00 0.00 ? 6   GLU A H    2  
ATOM 2349  H HA   . GLU A 1 6   ? 5.930   6.829   -6.026  1.00 0.00 ? 6   GLU A HA   2  
ATOM 2350  H HB2  . GLU A 1 6   ? 7.154   8.978   -4.228  1.00 0.00 ? 6   GLU A HB2  2  
ATOM 2351  H HB3  . GLU A 1 6   ? 6.128   7.682   -3.627  1.00 0.00 ? 6   GLU A HB3  2  
ATOM 2352  H HG2  . GLU A 1 6   ? 7.702   6.003   -4.518  1.00 0.00 ? 6   GLU A HG2  2  
ATOM 2353  H HG3  . GLU A 1 6   ? 8.725   7.289   -5.155  1.00 0.00 ? 6   GLU A HG3  2  
ATOM 2354  N N    . GLU A 1 7   ? 4.921   9.931   -5.567  1.00 0.00 ? 7   GLU A N    2  
ATOM 2355  C CA   . GLU A 1 7   ? 3.675   10.733  -5.509  1.00 0.00 ? 7   GLU A CA   2  
ATOM 2356  C C    . GLU A 1 7   ? 2.814   10.456  -6.724  1.00 0.00 ? 7   GLU A C    2  
ATOM 2357  O O    . GLU A 1 7   ? 1.622   10.255  -6.609  1.00 0.00 ? 7   GLU A O    2  
ATOM 2358  C CB   . GLU A 1 7   ? 4.048   12.224  -5.485  1.00 0.00 ? 7   GLU A CB   2  
ATOM 2359  C CG   . GLU A 1 7   ? 3.892   12.757  -4.058  1.00 0.00 ? 7   GLU A CG   2  
ATOM 2360  C CD   . GLU A 1 7   ? 2.404   12.848  -3.713  1.00 0.00 ? 7   GLU A CD   2  
ATOM 2361  O OE1  . GLU A 1 7   ? 1.739   13.621  -4.384  1.00 0.00 ? 7   GLU A OE1  2  
ATOM 2362  O OE2  . GLU A 1 7   ? 2.016   12.142  -2.798  1.00 0.00 ? 7   GLU A OE2  2  
ATOM 2363  H H    . GLU A 1 7   ? 5.796   10.364  -5.492  1.00 0.00 ? 7   GLU A H    2  
ATOM 2364  H HA   . GLU A 1 7   ? 3.118   10.454  -4.619  1.00 0.00 ? 7   GLU A HA   2  
ATOM 2365  H HB2  . GLU A 1 7   ? 5.070   12.349  -5.809  1.00 0.00 ? 7   GLU A HB2  2  
ATOM 2366  H HB3  . GLU A 1 7   ? 3.396   12.772  -6.149  1.00 0.00 ? 7   GLU A HB3  2  
ATOM 2367  H HG2  . GLU A 1 7   ? 4.379   12.090  -3.362  1.00 0.00 ? 7   GLU A HG2  2  
ATOM 2368  H HG3  . GLU A 1 7   ? 4.337   13.739  -3.983  1.00 0.00 ? 7   GLU A HG3  2  
ATOM 2369  N N    . GLN A 1 8   ? 3.423   10.453  -7.869  1.00 0.00 ? 8   GLN A N    2  
ATOM 2370  C CA   . GLN A 1 8   ? 2.640   10.187  -9.091  1.00 0.00 ? 8   GLN A CA   2  
ATOM 2371  C C    . GLN A 1 8   ? 1.927   8.859   -8.951  1.00 0.00 ? 8   GLN A C    2  
ATOM 2372  O O    . GLN A 1 8   ? 0.789   8.711   -9.352  1.00 0.00 ? 8   GLN A O    2  
ATOM 2373  C CB   . GLN A 1 8   ? 3.602   10.116  -10.282 1.00 0.00 ? 8   GLN A CB   2  
ATOM 2374  C CG   . GLN A 1 8   ? 4.046   11.531  -10.645 1.00 0.00 ? 8   GLN A CG   2  
ATOM 2375  C CD   . GLN A 1 8   ? 2.919   12.237  -11.402 1.00 0.00 ? 8   GLN A CD   2  
ATOM 2376  O OE1  . GLN A 1 8   ? 2.370   13.219  -10.944 1.00 0.00 ? 8   GLN A OE1  2  
ATOM 2377  N NE2  . GLN A 1 8   ? 2.545   11.769  -12.560 1.00 0.00 ? 8   GLN A NE2  2  
ATOM 2378  H H    . GLN A 1 8   ? 4.384   10.623  -7.921  1.00 0.00 ? 8   GLN A H    2  
ATOM 2379  H HA   . GLN A 1 8   ? 1.902   10.978  -9.224  1.00 0.00 ? 8   GLN A HA   2  
ATOM 2380  H HB2  . GLN A 1 8   ? 4.464   9.521   -10.019 1.00 0.00 ? 8   GLN A HB2  2  
ATOM 2381  H HB3  . GLN A 1 8   ? 3.103   9.664   -11.126 1.00 0.00 ? 8   GLN A HB3  2  
ATOM 2382  H HG2  . GLN A 1 8   ? 4.273   12.084  -9.746  1.00 0.00 ? 8   GLN A HG2  2  
ATOM 2383  H HG3  . GLN A 1 8   ? 4.925   11.488  -11.270 1.00 0.00 ? 8   GLN A HG3  2  
ATOM 2384  H HE21 . GLN A 1 8   ? 2.984   10.978  -12.935 1.00 0.00 ? 8   GLN A HE21 2  
ATOM 2385  H HE22 . GLN A 1 8   ? 1.823   12.210  -13.057 1.00 0.00 ? 8   GLN A HE22 2  
ATOM 2386  N N    . ILE A 1 9   ? 2.615   7.910   -8.379  1.00 0.00 ? 9   ILE A N    2  
ATOM 2387  C CA   . ILE A 1 9   ? 2.000   6.583   -8.198  1.00 0.00 ? 9   ILE A CA   2  
ATOM 2388  C C    . ILE A 1 9   ? 0.920   6.652   -7.128  1.00 0.00 ? 9   ILE A C    2  
ATOM 2389  O O    . ILE A 1 9   ? -0.043  5.912   -7.169  1.00 0.00 ? 9   ILE A O    2  
ATOM 2390  C CB   . ILE A 1 9   ? 3.078   5.597   -7.758  1.00 0.00 ? 9   ILE A CB   2  
ATOM 2391  C CG1  . ILE A 1 9   ? 4.003   5.294   -8.927  1.00 0.00 ? 9   ILE A CG1  2  
ATOM 2392  C CG2  . ILE A 1 9   ? 2.391   4.296   -7.325  1.00 0.00 ? 9   ILE A CG2  2  
ATOM 2393  C CD1  . ILE A 1 9   ? 5.347   4.798   -8.389  1.00 0.00 ? 9   ILE A CD1  2  
ATOM 2394  H H    . ILE A 1 9   ? 3.532   8.078   -8.076  1.00 0.00 ? 9   ILE A H    2  
ATOM 2395  H HA   . ILE A 1 9   ? 1.548   6.268   -9.137  1.00 0.00 ? 9   ILE A HA   2  
ATOM 2396  H HB   . ILE A 1 9   ? 3.653   6.027   -6.943  1.00 0.00 ? 9   ILE A HB   2  
ATOM 2397  H HG12 . ILE A 1 9   ? 3.561   4.534   -9.553  1.00 0.00 ? 9   ILE A HG12 2  
ATOM 2398  H HG13 . ILE A 1 9   ? 4.156   6.189   -9.512  1.00 0.00 ? 9   ILE A HG13 2  
ATOM 2399  H HG21 . ILE A 1 9   ? 1.594   4.065   -8.009  1.00 0.00 ? 9   ILE A HG21 2  
ATOM 2400  H HG22 . ILE A 1 9   ? 3.104   3.487   -7.327  1.00 0.00 ? 9   ILE A HG22 2  
ATOM 2401  H HG23 . ILE A 1 9   ? 1.985   4.411   -6.332  1.00 0.00 ? 9   ILE A HG23 2  
ATOM 2402  H HD11 . ILE A 1 9   ? 5.184   4.132   -7.555  1.00 0.00 ? 9   ILE A HD11 2  
ATOM 2403  H HD12 . ILE A 1 9   ? 5.877   4.269   -9.167  1.00 0.00 ? 9   ILE A HD12 2  
ATOM 2404  H HD13 . ILE A 1 9   ? 5.941   5.637   -8.063  1.00 0.00 ? 9   ILE A HD13 2  
ATOM 2405  N N    . ALA A 1 10  ? 1.099   7.544   -6.179  1.00 0.00 ? 10  ALA A N    2  
ATOM 2406  C CA   . ALA A 1 10  ? 0.085   7.665   -5.108  1.00 0.00 ? 10  ALA A CA   2  
ATOM 2407  C C    . ALA A 1 10  ? -1.188  8.263   -5.680  1.00 0.00 ? 10  ALA A C    2  
ATOM 2408  O O    . ALA A 1 10  ? -2.275  7.788   -5.414  1.00 0.00 ? 10  ALA A O    2  
ATOM 2409  C CB   . ALA A 1 10  ? 0.632   8.592   -4.011  1.00 0.00 ? 10  ALA A CB   2  
ATOM 2410  H H    . ALA A 1 10  ? 1.897   8.127   -6.178  1.00 0.00 ? 10  ALA A H    2  
ATOM 2411  H HA   . ALA A 1 10  ? -0.135  6.673   -4.713  1.00 0.00 ? 10  ALA A HA   2  
ATOM 2412  H HB1  . ALA A 1 10  ? 1.190   9.400   -4.460  1.00 0.00 ? 10  ALA A HB1  2  
ATOM 2413  H HB2  . ALA A 1 10  ? -0.186  9.002   -3.437  1.00 0.00 ? 10  ALA A HB2  2  
ATOM 2414  H HB3  . ALA A 1 10  ? 1.283   8.035   -3.354  1.00 0.00 ? 10  ALA A HB3  2  
ATOM 2415  N N    . GLU A 1 11  ? -1.032  9.301   -6.458  1.00 0.00 ? 11  GLU A N    2  
ATOM 2416  C CA   . GLU A 1 11  ? -2.224  9.938   -7.056  1.00 0.00 ? 11  GLU A CA   2  
ATOM 2417  C C    . GLU A 1 11  ? -2.885  8.960   -8.007  1.00 0.00 ? 11  GLU A C    2  
ATOM 2418  O O    . GLU A 1 11  ? -4.091  8.953   -8.169  1.00 0.00 ? 11  GLU A O    2  
ATOM 2419  C CB   . GLU A 1 11  ? -1.771  11.178  -7.843  1.00 0.00 ? 11  GLU A CB   2  
ATOM 2420  C CG   . GLU A 1 11  ? -1.422  12.298  -6.860  1.00 0.00 ? 11  GLU A CG   2  
ATOM 2421  C CD   . GLU A 1 11  ? -2.704  12.817  -6.208  1.00 0.00 ? 11  GLU A CD   2  
ATOM 2422  O OE1  . GLU A 1 11  ? -3.752  12.353  -6.629  1.00 0.00 ? 11  GLU A OE1  2  
ATOM 2423  O OE2  . GLU A 1 11  ? -2.566  13.647  -5.326  1.00 0.00 ? 11  GLU A OE2  2  
ATOM 2424  H H    . GLU A 1 11  ? -0.134  9.651   -6.647  1.00 0.00 ? 11  GLU A H    2  
ATOM 2425  H HA   . GLU A 1 11  ? -2.927  10.205  -6.266  1.00 0.00 ? 11  GLU A HA   2  
ATOM 2426  H HB2  . GLU A 1 11  ? -0.901  10.934  -8.436  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 2427  H HB3  . GLU A 1 11  ? -2.565  11.503  -8.497  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 2428  H HG2  . GLU A 1 11  ? -0.760  11.920  -6.095  1.00 0.00 ? 11  GLU A HG2  2  
ATOM 2429  H HG3  . GLU A 1 11  ? -0.936  13.107  -7.385  1.00 0.00 ? 11  GLU A HG3  2  
ATOM 2430  N N    . PHE A 1 12  ? -2.070  8.143   -8.620  1.00 0.00 ? 12  PHE A N    2  
ATOM 2431  C CA   . PHE A 1 12  ? -2.607  7.146   -9.567  1.00 0.00 ? 12  PHE A CA   2  
ATOM 2432  C C    . PHE A 1 12  ? -3.469  6.145   -8.825  1.00 0.00 ? 12  PHE A C    2  
ATOM 2433  O O    . PHE A 1 12  ? -4.625  5.960   -9.142  1.00 0.00 ? 12  PHE A O    2  
ATOM 2434  C CB   . PHE A 1 12  ? -1.426  6.389   -10.193 1.00 0.00 ? 12  PHE A CB   2  
ATOM 2435  C CG   . PHE A 1 12  ? -0.983  7.084   -11.481 1.00 0.00 ? 12  PHE A CG   2  
ATOM 2436  C CD1  . PHE A 1 12  ? -1.077  8.458   -11.610 1.00 0.00 ? 12  PHE A CD1  2  
ATOM 2437  C CD2  . PHE A 1 12  ? -0.483  6.342   -12.536 1.00 0.00 ? 12  PHE A CD2  2  
ATOM 2438  C CE1  . PHE A 1 12  ? -0.676  9.078   -12.777 1.00 0.00 ? 12  PHE A CE1  2  
ATOM 2439  C CE2  . PHE A 1 12  ? -0.084  6.964   -13.698 1.00 0.00 ? 12  PHE A CE2  2  
ATOM 2440  C CZ   . PHE A 1 12  ? -0.180  8.330   -13.820 1.00 0.00 ? 12  PHE A CZ   2  
ATOM 2441  H H    . PHE A 1 12  ? -1.105  8.192   -8.451  1.00 0.00 ? 12  PHE A H    2  
ATOM 2442  H HA   . PHE A 1 12  ? -3.206  7.650   -10.327 1.00 0.00 ? 12  PHE A HA   2  
ATOM 2443  H HB2  . PHE A 1 12  ? -0.601  6.368   -9.500  1.00 0.00 ? 12  PHE A HB2  2  
ATOM 2444  H HB3  . PHE A 1 12  ? -1.723  5.376   -10.420 1.00 0.00 ? 12  PHE A HB3  2  
ATOM 2445  H HD1  . PHE A 1 12  ? -1.455  9.050   -10.791 1.00 0.00 ? 12  PHE A HD1  2  
ATOM 2446  H HD2  . PHE A 1 12  ? -0.396  5.269   -12.446 1.00 0.00 ? 12  PHE A HD2  2  
ATOM 2447  H HE1  . PHE A 1 12  ? -0.754  10.152  -12.872 1.00 0.00 ? 12  PHE A HE1  2  
ATOM 2448  H HE2  . PHE A 1 12  ? 0.305   6.377   -14.514 1.00 0.00 ? 12  PHE A HE2  2  
ATOM 2449  H HZ   . PHE A 1 12  ? 0.134   8.814   -14.732 1.00 0.00 ? 12  PHE A HZ   2  
ATOM 2450  N N    . LYS A 1 13  ? -2.882  5.511   -7.841  1.00 0.00 ? 13  LYS A N    2  
ATOM 2451  C CA   . LYS A 1 13  ? -3.648  4.516   -7.064  1.00 0.00 ? 13  LYS A CA   2  
ATOM 2452  C C    . LYS A 1 13  ? -4.916  5.146   -6.521  1.00 0.00 ? 13  LYS A C    2  
ATOM 2453  O O    . LYS A 1 13  ? -5.928  4.489   -6.383  1.00 0.00 ? 13  LYS A O    2  
ATOM 2454  C CB   . LYS A 1 13  ? -2.779  4.041   -5.893  1.00 0.00 ? 13  LYS A CB   2  
ATOM 2455  C CG   . LYS A 1 13  ? -3.485  2.896   -5.167  1.00 0.00 ? 13  LYS A CG   2  
ATOM 2456  C CD   . LYS A 1 13  ? -2.438  2.044   -4.442  1.00 0.00 ? 13  LYS A CD   2  
ATOM 2457  C CE   . LYS A 1 13  ? -3.143  1.095   -3.470  1.00 0.00 ? 13  LYS A CE   2  
ATOM 2458  N NZ   . LYS A 1 13  ? -3.070  1.623   -2.078  1.00 0.00 ? 13  LYS A NZ   2  
ATOM 2459  H H    . LYS A 1 13  ? -1.944  5.697   -7.618  1.00 0.00 ? 13  LYS A H    2  
ATOM 2460  H HA   . LYS A 1 13  ? -3.915  3.685   -7.714  1.00 0.00 ? 13  LYS A HA   2  
ATOM 2461  H HB2  . LYS A 1 13  ? -1.825  3.699   -6.267  1.00 0.00 ? 13  LYS A HB2  2  
ATOM 2462  H HB3  . LYS A 1 13  ? -2.616  4.858   -5.209  1.00 0.00 ? 13  LYS A HB3  2  
ATOM 2463  H HG2  . LYS A 1 13  ? -4.187  3.297   -4.452  1.00 0.00 ? 13  LYS A HG2  2  
ATOM 2464  H HG3  . LYS A 1 13  ? -4.018  2.286   -5.882  1.00 0.00 ? 13  LYS A HG3  2  
ATOM 2465  H HD2  . LYS A 1 13  ? -1.874  1.470   -5.164  1.00 0.00 ? 13  LYS A HD2  2  
ATOM 2466  H HD3  . LYS A 1 13  ? -1.762  2.686   -3.896  1.00 0.00 ? 13  LYS A HD3  2  
ATOM 2467  H HE2  . LYS A 1 13  ? -4.179  0.989   -3.754  1.00 0.00 ? 13  LYS A HE2  2  
ATOM 2468  H HE3  . LYS A 1 13  ? -2.667  0.126   -3.503  1.00 0.00 ? 13  LYS A HE3  2  
ATOM 2469  H HZ1  . LYS A 1 13  ? -2.392  2.411   -2.042  1.00 0.00 ? 13  LYS A HZ1  2  
ATOM 2470  H HZ2  . LYS A 1 13  ? -4.009  1.960   -1.786  1.00 0.00 ? 13  LYS A HZ2  2  
ATOM 2471  H HZ3  . LYS A 1 13  ? -2.756  0.868   -1.436  1.00 0.00 ? 13  LYS A HZ3  2  
ATOM 2472  N N    . GLU A 1 14  ? -4.842  6.416   -6.216  1.00 0.00 ? 14  GLU A N    2  
ATOM 2473  C CA   . GLU A 1 14  ? -6.041  7.094   -5.685  1.00 0.00 ? 14  GLU A CA   2  
ATOM 2474  C C    . GLU A 1 14  ? -7.176  6.944   -6.669  1.00 0.00 ? 14  GLU A C    2  
ATOM 2475  O O    . GLU A 1 14  ? -8.260  6.529   -6.316  1.00 0.00 ? 14  GLU A O    2  
ATOM 2476  C CB   . GLU A 1 14  ? -5.726  8.588   -5.495  1.00 0.00 ? 14  GLU A CB   2  
ATOM 2477  C CG   . GLU A 1 14  ? -6.774  9.209   -4.566  1.00 0.00 ? 14  GLU A CG   2  
ATOM 2478  C CD   . GLU A 1 14  ? -6.585  8.661   -3.149  1.00 0.00 ? 14  GLU A CD   2  
ATOM 2479  O OE1  . GLU A 1 14  ? -5.447  8.676   -2.710  1.00 0.00 ? 14  GLU A OE1  2  
ATOM 2480  O OE2  . GLU A 1 14  ? -7.590  8.261   -2.585  1.00 0.00 ? 14  GLU A OE2  2  
ATOM 2481  H H    . GLU A 1 14  ? -4.005  6.910   -6.340  1.00 0.00 ? 14  GLU A H    2  
ATOM 2482  H HA   . GLU A 1 14  ? -6.325  6.628   -4.745  1.00 0.00 ? 14  GLU A HA   2  
ATOM 2483  H HB2  . GLU A 1 14  ? -4.744  8.699   -5.061  1.00 0.00 ? 14  GLU A HB2  2  
ATOM 2484  H HB3  . GLU A 1 14  ? -5.748  9.087   -6.452  1.00 0.00 ? 14  GLU A HB3  2  
ATOM 2485  H HG2  . GLU A 1 14  ? -6.660  10.282  -4.552  1.00 0.00 ? 14  GLU A HG2  2  
ATOM 2486  H HG3  . GLU A 1 14  ? -7.765  8.960   -4.916  1.00 0.00 ? 14  GLU A HG3  2  
ATOM 2487  N N    . ALA A 1 15  ? -6.908  7.286   -7.897  1.00 0.00 ? 15  ALA A N    2  
ATOM 2488  C CA   . ALA A 1 15  ? -7.963  7.163   -8.919  1.00 0.00 ? 15  ALA A CA   2  
ATOM 2489  C C    . ALA A 1 15  ? -8.274  5.693   -9.128  1.00 0.00 ? 15  ALA A C    2  
ATOM 2490  O O    . ALA A 1 15  ? -9.413  5.275   -9.089  1.00 0.00 ? 15  ALA A O    2  
ATOM 2491  C CB   . ALA A 1 15  ? -7.437  7.759   -10.237 1.00 0.00 ? 15  ALA A CB   2  
ATOM 2492  H H    . ALA A 1 15  ? -6.014  7.619   -8.138  1.00 0.00 ? 15  ALA A H    2  
ATOM 2493  H HA   . ALA A 1 15  ? -8.861  7.679   -8.577  1.00 0.00 ? 15  ALA A HA   2  
ATOM 2494  H HB1  . ALA A 1 15  ? -6.465  7.342   -10.463 1.00 0.00 ? 15  ALA A HB1  2  
ATOM 2495  H HB2  . ALA A 1 15  ? -8.118  7.526   -11.042 1.00 0.00 ? 15  ALA A HB2  2  
ATOM 2496  H HB3  . ALA A 1 15  ? -7.350  8.831   -10.144 1.00 0.00 ? 15  ALA A HB3  2  
ATOM 2497  N N    . PHE A 1 16  ? -7.235  4.936   -9.331  1.00 0.00 ? 16  PHE A N    2  
ATOM 2498  C CA   . PHE A 1 16  ? -7.404  3.483   -9.547  1.00 0.00 ? 16  PHE A CA   2  
ATOM 2499  C C    . PHE A 1 16  ? -8.220  2.865   -8.417  1.00 0.00 ? 16  PHE A C    2  
ATOM 2500  O O    . PHE A 1 16  ? -8.880  1.862   -8.601  1.00 0.00 ? 16  PHE A O    2  
ATOM 2501  C CB   . PHE A 1 16  ? -6.004  2.847   -9.547  1.00 0.00 ? 16  PHE A CB   2  
ATOM 2502  C CG   . PHE A 1 16  ? -6.036  1.511   -10.284 1.00 0.00 ? 16  PHE A CG   2  
ATOM 2503  C CD1  . PHE A 1 16  ? -6.242  1.466   -11.651 1.00 0.00 ? 16  PHE A CD1  2  
ATOM 2504  C CD2  . PHE A 1 16  ? -5.846  0.329   -9.594  1.00 0.00 ? 16  PHE A CD2  2  
ATOM 2505  C CE1  . PHE A 1 16  ? -6.256  0.258   -12.315 1.00 0.00 ? 16  PHE A CE1  2  
ATOM 2506  C CE2  . PHE A 1 16  ? -5.859  -0.878  -10.256 1.00 0.00 ? 16  PHE A CE2  2  
ATOM 2507  C CZ   . PHE A 1 16  ? -6.067  -0.916  -11.619 1.00 0.00 ? 16  PHE A CZ   2  
ATOM 2508  H H    . PHE A 1 16  ? -6.342  5.330   -9.347  1.00 0.00 ? 16  PHE A H    2  
ATOM 2509  H HA   . PHE A 1 16  ? -7.913  3.313   -10.494 1.00 0.00 ? 16  PHE A HA   2  
ATOM 2510  H HB2  . PHE A 1 16  ? -5.303  3.507   -10.036 1.00 0.00 ? 16  PHE A HB2  2  
ATOM 2511  H HB3  . PHE A 1 16  ? -5.682  2.680   -8.529  1.00 0.00 ? 16  PHE A HB3  2  
ATOM 2512  H HD1  . PHE A 1 16  ? -6.387  2.383   -12.202 1.00 0.00 ? 16  PHE A HD1  2  
ATOM 2513  H HD2  . PHE A 1 16  ? -5.687  0.351   -8.527  1.00 0.00 ? 16  PHE A HD2  2  
ATOM 2514  H HE1  . PHE A 1 16  ? -6.410  0.233   -13.381 1.00 0.00 ? 16  PHE A HE1  2  
ATOM 2515  H HE2  . PHE A 1 16  ? -5.696  -1.793  -9.707  1.00 0.00 ? 16  PHE A HE2  2  
ATOM 2516  H HZ   . PHE A 1 16  ? -6.092  -1.868  -12.141 1.00 0.00 ? 16  PHE A HZ   2  
ATOM 2517  N N    . SER A 1 17  ? -8.155  3.477   -7.261  1.00 0.00 ? 17  SER A N    2  
ATOM 2518  C CA   . SER A 1 17  ? -8.918  2.940   -6.110  1.00 0.00 ? 17  SER A CA   2  
ATOM 2519  C C    . SER A 1 17  ? -10.331 3.509   -6.075  1.00 0.00 ? 17  SER A C    2  
ATOM 2520  O O    . SER A 1 17  ? -11.234 2.900   -5.537  1.00 0.00 ? 17  SER A O    2  
ATOM 2521  C CB   . SER A 1 17  ? -8.192  3.343   -4.817  1.00 0.00 ? 17  SER A CB   2  
ATOM 2522  O OG   . SER A 1 17  ? -6.899  2.772   -4.951  1.00 0.00 ? 17  SER A OG   2  
ATOM 2523  H H    . SER A 1 17  ? -7.606  4.285   -7.155  1.00 0.00 ? 17  SER A H    2  
ATOM 2524  H HA   . SER A 1 17  ? -8.975  1.857   -6.199  1.00 0.00 ? 17  SER A HA   2  
ATOM 2525  H HB2  . SER A 1 17  ? -8.121  4.417   -4.738  1.00 0.00 ? 17  SER A HB2  2  
ATOM 2526  H HB3  . SER A 1 17  ? -8.694  2.933   -3.953  1.00 0.00 ? 17  SER A HB3  2  
ATOM 2527  H HG   . SER A 1 17  ? -6.289  3.294   -4.425  1.00 0.00 ? 17  SER A HG   2  
ATOM 2528  N N    . LEU A 1 18  ? -10.500 4.670   -6.648  1.00 0.00 ? 18  LEU A N    2  
ATOM 2529  C CA   . LEU A 1 18  ? -11.847 5.287   -6.654  1.00 0.00 ? 18  LEU A CA   2  
ATOM 2530  C C    . LEU A 1 18  ? -12.804 4.490   -7.531  1.00 0.00 ? 18  LEU A C    2  
ATOM 2531  O O    . LEU A 1 18  ? -13.986 4.420   -7.255  1.00 0.00 ? 18  LEU A O    2  
ATOM 2532  C CB   . LEU A 1 18  ? -11.726 6.710   -7.219  1.00 0.00 ? 18  LEU A CB   2  
ATOM 2533  C CG   . LEU A 1 18  ? -11.339 7.665   -6.090  1.00 0.00 ? 18  LEU A CG   2  
ATOM 2534  C CD1  . LEU A 1 18  ? -11.176 9.079   -6.654  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2535  C CD2  . LEU A 1 18  ? -12.446 7.670   -5.034  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2536  H H    . LEU A 1 18  ? -9.743  5.129   -7.070  1.00 0.00 ? 18  LEU A H    2  
ATOM 2537  H HA   . LEU A 1 18  ? -12.232 5.306   -5.635  1.00 0.00 ? 18  LEU A HA   2  
ATOM 2538  H HB2  . LEU A 1 18  ? -10.971 6.732   -7.989  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2539  H HB3  . LEU A 1 18  ? -12.673 7.014   -7.642  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2540  H HG   . LEU A 1 18  ? -10.410 7.341   -5.644  1.00 0.00 ? 18  LEU A HG   2  
ATOM 2541  H HD11 . LEU A 1 18  ? -12.063 9.355   -7.208  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2542  H HD12 . LEU A 1 18  ? -11.029 9.780   -5.845  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2543  H HD13 . LEU A 1 18  ? -10.321 9.113   -7.313  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2544  H HD21 . LEU A 1 18  ? -13.355 7.272   -5.458  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2545  H HD22 . LEU A 1 18  ? -12.149 7.061   -4.193  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2546  H HD23 . LEU A 1 18  ? -12.622 8.680   -4.697  1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2547  N N    . PHE A 1 19  ? -12.270 3.903   -8.577  1.00 0.00 ? 19  PHE A N    2  
ATOM 2548  C CA   . PHE A 1 19  ? -13.121 3.102   -9.497  1.00 0.00 ? 19  PHE A CA   2  
ATOM 2549  C C    . PHE A 1 19  ? -12.855 1.616   -9.334  1.00 0.00 ? 19  PHE A C    2  
ATOM 2550  O O    . PHE A 1 19  ? -13.050 0.843   -10.250 1.00 0.00 ? 19  PHE A O    2  
ATOM 2551  C CB   . PHE A 1 19  ? -12.782 3.513   -10.933 1.00 0.00 ? 19  PHE A CB   2  
ATOM 2552  C CG   . PHE A 1 19  ? -12.869 5.032   -11.045 1.00 0.00 ? 19  PHE A CG   2  
ATOM 2553  C CD1  . PHE A 1 19  ? -14.098 5.662   -11.112 1.00 0.00 ? 19  PHE A CD1  2  
ATOM 2554  C CD2  . PHE A 1 19  ? -11.719 5.800   -11.068 1.00 0.00 ? 19  PHE A CD2  2  
ATOM 2555  C CE1  . PHE A 1 19  ? -14.174 7.036   -11.200 1.00 0.00 ? 19  PHE A CE1  2  
ATOM 2556  C CE2  . PHE A 1 19  ? -11.799 7.172   -11.156 1.00 0.00 ? 19  PHE A CE2  2  
ATOM 2557  C CZ   . PHE A 1 19  ? -13.026 7.789   -11.223 1.00 0.00 ? 19  PHE A CZ   2  
ATOM 2558  H H    . PHE A 1 19  ? -11.313 3.990   -8.751  1.00 0.00 ? 19  PHE A H    2  
ATOM 2559  H HA   . PHE A 1 19  ? -14.162 3.298   -9.277  1.00 0.00 ? 19  PHE A HA   2  
ATOM 2560  H HB2  . PHE A 1 19  ? -11.781 3.192   -11.180 1.00 0.00 ? 19  PHE A HB2  2  
ATOM 2561  H HB3  . PHE A 1 19  ? -13.484 3.062   -11.620 1.00 0.00 ? 19  PHE A HB3  2  
ATOM 2562  H HD1  . PHE A 1 19  ? -15.003 5.074   -11.092 1.00 0.00 ? 19  PHE A HD1  2  
ATOM 2563  H HD2  . PHE A 1 19  ? -10.753 5.321   -11.019 1.00 0.00 ? 19  PHE A HD2  2  
ATOM 2564  H HE1  . PHE A 1 19  ? -15.138 7.521   -11.251 1.00 0.00 ? 19  PHE A HE1  2  
ATOM 2565  H HE2  . PHE A 1 19  ? -10.900 7.763   -11.168 1.00 0.00 ? 19  PHE A HE2  2  
ATOM 2566  H HZ   . PHE A 1 19  ? -13.086 8.864   -11.295 1.00 0.00 ? 19  PHE A HZ   2  
ATOM 2567  N N    . ASP A 1 20  ? -12.413 1.244   -8.172  1.00 0.00 ? 20  ASP A N    2  
ATOM 2568  C CA   . ASP A 1 20  ? -12.128 -0.187  -7.924  1.00 0.00 ? 20  ASP A CA   2  
ATOM 2569  C C    . ASP A 1 20  ? -13.414 -0.945  -7.616  1.00 0.00 ? 20  ASP A C    2  
ATOM 2570  O O    . ASP A 1 20  ? -13.517 -1.615  -6.608  1.00 0.00 ? 20  ASP A O    2  
ATOM 2571  C CB   . ASP A 1 20  ? -11.191 -0.287  -6.710  1.00 0.00 ? 20  ASP A CB   2  
ATOM 2572  C CG   . ASP A 1 20  ? -11.860 0.365   -5.500  1.00 0.00 ? 20  ASP A CG   2  
ATOM 2573  O OD1  . ASP A 1 20  ? -12.940 0.896   -5.701  1.00 0.00 ? 20  ASP A OD1  2  
ATOM 2574  O OD2  . ASP A 1 20  ? -11.252 0.299   -4.445  1.00 0.00 ? 20  ASP A OD2  2  
ATOM 2575  H H    . ASP A 1 20  ? -12.268 1.905   -7.468  1.00 0.00 ? 20  ASP A H    2  
ATOM 2576  H HA   . ASP A 1 20  ? -11.663 -0.616  -8.811  1.00 0.00 ? 20  ASP A HA   2  
ATOM 2577  H HB2  . ASP A 1 20  ? -10.989 -1.323  -6.490  1.00 0.00 ? 20  ASP A HB2  2  
ATOM 2578  H HB3  . ASP A 1 20  ? -10.261 0.221   -6.921  1.00 0.00 ? 20  ASP A HB3  2  
ATOM 2579  N N    . LYS A 1 21  ? -14.375 -0.822  -8.493  1.00 0.00 ? 21  LYS A N    2  
ATOM 2580  C CA   . LYS A 1 21  ? -15.663 -1.527  -8.270  1.00 0.00 ? 21  LYS A CA   2  
ATOM 2581  C C    . LYS A 1 21  ? -15.479 -3.039  -8.335  1.00 0.00 ? 21  LYS A C    2  
ATOM 2582  O O    . LYS A 1 21  ? -16.438 -3.785  -8.309  1.00 0.00 ? 21  LYS A O    2  
ATOM 2583  C CB   . LYS A 1 21  ? -16.643 -1.098  -9.371  1.00 0.00 ? 21  LYS A CB   2  
ATOM 2584  C CG   . LYS A 1 21  ? -17.594 -0.039  -8.801  1.00 0.00 ? 21  LYS A CG   2  
ATOM 2585  C CD   . LYS A 1 21  ? -18.304 0.679   -9.951  1.00 0.00 ? 21  LYS A CD   2  
ATOM 2586  C CE   . LYS A 1 21  ? -19.598 -0.065  -10.292 1.00 0.00 ? 21  LYS A CE   2  
ATOM 2587  N NZ   . LYS A 1 21  ? -20.315 0.619   -11.406 1.00 0.00 ? 21  LYS A NZ   2  
ATOM 2588  H H    . LYS A 1 21  ? -14.247 -0.271  -9.293  1.00 0.00 ? 21  LYS A H    2  
ATOM 2589  H HA   . LYS A 1 21  ? -16.047 -1.258  -7.289  1.00 0.00 ? 21  LYS A HA   2  
ATOM 2590  H HB2  . LYS A 1 21  ? -16.094 -0.685  -10.203 1.00 0.00 ? 21  LYS A HB2  2  
ATOM 2591  H HB3  . LYS A 1 21  ? -17.210 -1.953  -9.708  1.00 0.00 ? 21  LYS A HB3  2  
ATOM 2592  H HG2  . LYS A 1 21  ? -18.327 -0.514  -8.165  1.00 0.00 ? 21  LYS A HG2  2  
ATOM 2593  H HG3  . LYS A 1 21  ? -17.032 0.676   -8.220  1.00 0.00 ? 21  LYS A HG3  2  
ATOM 2594  H HD2  . LYS A 1 21  ? -18.537 1.691   -9.653  1.00 0.00 ? 21  LYS A HD2  2  
ATOM 2595  H HD3  . LYS A 1 21  ? -17.661 0.704   -10.816 1.00 0.00 ? 21  LYS A HD3  2  
ATOM 2596  H HE2  . LYS A 1 21  ? -19.365 -1.076  -10.592 1.00 0.00 ? 21  LYS A HE2  2  
ATOM 2597  H HE3  . LYS A 1 21  ? -20.239 -0.093  -9.423  1.00 0.00 ? 21  LYS A HE3  2  
ATOM 2598  H HZ1  . LYS A 1 21  ? -19.741 1.414   -11.753 1.00 0.00 ? 21  LYS A HZ1  2  
ATOM 2599  H HZ2  . LYS A 1 21  ? -20.475 -0.055  -12.181 1.00 0.00 ? 21  LYS A HZ2  2  
ATOM 2600  H HZ3  . LYS A 1 21  ? -21.230 0.977   -11.062 1.00 0.00 ? 21  LYS A HZ3  2  
ATOM 2601  N N    . ASP A 1 22  ? -14.247 -3.466  -8.419  1.00 0.00 ? 22  ASP A N    2  
ATOM 2602  C CA   . ASP A 1 22  ? -13.984 -4.925  -8.485  1.00 0.00 ? 22  ASP A CA   2  
ATOM 2603  C C    . ASP A 1 22  ? -14.023 -5.547  -7.096  1.00 0.00 ? 22  ASP A C    2  
ATOM 2604  O O    . ASP A 1 22  ? -15.052 -6.016  -6.653  1.00 0.00 ? 22  ASP A O    2  
ATOM 2605  C CB   . ASP A 1 22  ? -12.588 -5.138  -9.085  1.00 0.00 ? 22  ASP A CB   2  
ATOM 2606  C CG   . ASP A 1 22  ? -12.241 -6.628  -9.040  1.00 0.00 ? 22  ASP A CG   2  
ATOM 2607  O OD1  . ASP A 1 22  ? -11.906 -7.073  -7.955  1.00 0.00 ? 22  ASP A OD1  2  
ATOM 2608  O OD2  . ASP A 1 22  ? -12.334 -7.237  -10.093 1.00 0.00 ? 22  ASP A OD2  2  
ATOM 2609  H H    . ASP A 1 22  ? -13.504 -2.828  -8.436  1.00 0.00 ? 22  ASP A H    2  
ATOM 2610  H HA   . ASP A 1 22  ? -14.748 -5.394  -9.106  1.00 0.00 ? 22  ASP A HA   2  
ATOM 2611  H HB2  . ASP A 1 22  ? -12.574 -4.800  -10.110 1.00 0.00 ? 22  ASP A HB2  2  
ATOM 2612  H HB3  . ASP A 1 22  ? -11.857 -4.584  -8.516  1.00 0.00 ? 22  ASP A HB3  2  
ATOM 2613  N N    . GLY A 1 23  ? -12.900 -5.543  -6.430  1.00 0.00 ? 23  GLY A N    2  
ATOM 2614  C CA   . GLY A 1 23  ? -12.860 -6.134  -5.061  1.00 0.00 ? 23  GLY A CA   2  
ATOM 2615  C C    . GLY A 1 23  ? -11.423 -6.193  -4.541  1.00 0.00 ? 23  GLY A C    2  
ATOM 2616  O O    . GLY A 1 23  ? -11.174 -6.703  -3.467  1.00 0.00 ? 23  GLY A O    2  
ATOM 2617  H H    . GLY A 1 23  ? -12.091 -5.156  -6.826  1.00 0.00 ? 23  GLY A H    2  
ATOM 2618  H HA2  . GLY A 1 23  ? -13.457 -5.530  -4.395  1.00 0.00 ? 23  GLY A HA2  2  
ATOM 2619  H HA3  . GLY A 1 23  ? -13.267 -7.134  -5.095  1.00 0.00 ? 23  GLY A HA3  2  
ATOM 2620  N N    . ASP A 1 24  ? -10.507 -5.668  -5.317  1.00 0.00 ? 24  ASP A N    2  
ATOM 2621  C CA   . ASP A 1 24  ? -9.082  -5.682  -4.889  1.00 0.00 ? 24  ASP A CA   2  
ATOM 2622  C C    . ASP A 1 24  ? -8.412  -4.359  -5.216  1.00 0.00 ? 24  ASP A C    2  
ATOM 2623  O O    . ASP A 1 24  ? -7.550  -3.899  -4.492  1.00 0.00 ? 24  ASP A O    2  
ATOM 2624  C CB   . ASP A 1 24  ? -8.358  -6.799  -5.655  1.00 0.00 ? 24  ASP A CB   2  
ATOM 2625  C CG   . ASP A 1 24  ? -7.253  -7.384  -4.773  1.00 0.00 ? 24  ASP A CG   2  
ATOM 2626  O OD1  . ASP A 1 24  ? -7.579  -7.717  -3.647  1.00 0.00 ? 24  ASP A OD1  2  
ATOM 2627  O OD2  . ASP A 1 24  ? -6.146  -7.465  -5.278  1.00 0.00 ? 24  ASP A OD2  2  
ATOM 2628  H H    . ASP A 1 24  ? -10.759 -5.270  -6.176  1.00 0.00 ? 24  ASP A H    2  
ATOM 2629  H HA   . ASP A 1 24  ? -9.029  -5.850  -3.814  1.00 0.00 ? 24  ASP A HA   2  
ATOM 2630  H HB2  . ASP A 1 24  ? -9.059  -7.578  -5.912  1.00 0.00 ? 24  ASP A HB2  2  
ATOM 2631  H HB3  . ASP A 1 24  ? -7.921  -6.399  -6.558  1.00 0.00 ? 24  ASP A HB3  2  
ATOM 2632  N N    . GLY A 1 25  ? -8.819  -3.770  -6.305  1.00 0.00 ? 25  GLY A N    2  
ATOM 2633  C CA   . GLY A 1 25  ? -8.216  -2.471  -6.703  1.00 0.00 ? 25  GLY A CA   2  
ATOM 2634  C C    . GLY A 1 25  ? -8.123  -2.374  -8.226  1.00 0.00 ? 25  GLY A C    2  
ATOM 2635  O O    . GLY A 1 25  ? -7.956  -1.303  -8.772  1.00 0.00 ? 25  GLY A O    2  
ATOM 2636  H H    . GLY A 1 25  ? -9.516  -4.181  -6.857  1.00 0.00 ? 25  GLY A H    2  
ATOM 2637  H HA2  . GLY A 1 25  ? -8.828  -1.663  -6.331  1.00 0.00 ? 25  GLY A HA2  2  
ATOM 2638  H HA3  . GLY A 1 25  ? -7.225  -2.392  -6.280  1.00 0.00 ? 25  GLY A HA3  2  
ATOM 2639  N N    . THR A 1 26  ? -8.241  -3.499  -8.884  1.00 0.00 ? 26  THR A N    2  
ATOM 2640  C CA   . THR A 1 26  ? -8.161  -3.483  -10.365 1.00 0.00 ? 26  THR A CA   2  
ATOM 2641  C C    . THR A 1 26  ? -9.416  -2.881  -10.976 1.00 0.00 ? 26  THR A C    2  
ATOM 2642  O O    . THR A 1 26  ? -10.397 -2.657  -10.293 1.00 0.00 ? 26  THR A O    2  
ATOM 2643  C CB   . THR A 1 26  ? -8.009  -4.918  -10.865 1.00 0.00 ? 26  THR A CB   2  
ATOM 2644  O OG1  . THR A 1 26  ? -9.300  -5.489  -10.769 1.00 0.00 ? 26  THR A OG1  2  
ATOM 2645  C CG2  . THR A 1 26  ? -7.139  -5.746  -9.906  1.00 0.00 ? 26  THR A CG2  2  
ATOM 2646  H H    . THR A 1 26  ? -8.385  -4.341  -8.404  1.00 0.00 ? 26  THR A H    2  
ATOM 2647  H HA   . THR A 1 26  ? -7.307  -2.886  -10.662 1.00 0.00 ? 26  THR A HA   2  
ATOM 2648  H HB   . THR A 1 26  ? -7.647  -4.944  -11.891 1.00 0.00 ? 26  THR A HB   2  
ATOM 2649  H HG1  . THR A 1 26  ? -9.206  -6.379  -10.422 1.00 0.00 ? 26  THR A HG1  2  
ATOM 2650  H HG21 . THR A 1 26  ? -6.352  -5.125  -9.501  1.00 0.00 ? 26  THR A HG21 2  
ATOM 2651  H HG22 . THR A 1 26  ? -7.745  -6.124  -9.097  1.00 0.00 ? 26  THR A HG22 2  
ATOM 2652  H HG23 . THR A 1 26  ? -6.699  -6.575  -10.439 1.00 0.00 ? 26  THR A HG23 2  
ATOM 2653  N N    . ILE A 1 27  ? -9.362  -2.636  -12.260 1.00 0.00 ? 27  ILE A N    2  
ATOM 2654  C CA   . ILE A 1 27  ? -10.533 -2.048  -12.951 1.00 0.00 ? 27  ILE A CA   2  
ATOM 2655  C C    . ILE A 1 27  ? -10.725 -2.699  -14.303 1.00 0.00 ? 27  ILE A C    2  
ATOM 2656  O O    . ILE A 1 27  ? -9.880  -3.443  -14.754 1.00 0.00 ? 27  ILE A O    2  
ATOM 2657  C CB   . ILE A 1 27  ? -10.264 -0.556  -13.169 1.00 0.00 ? 27  ILE A CB   2  
ATOM 2658  C CG1  . ILE A 1 27  ? -9.135  -0.386  -14.186 1.00 0.00 ? 27  ILE A CG1  2  
ATOM 2659  C CG2  . ILE A 1 27  ? -9.825  0.066   -11.828 1.00 0.00 ? 27  ILE A CG2  2  
ATOM 2660  C CD1  . ILE A 1 27  ? -8.849  1.100   -14.391 1.00 0.00 ? 27  ILE A CD1  2  
ATOM 2661  H H    . ILE A 1 27  ? -8.550  -2.851  -12.770 1.00 0.00 ? 27  ILE A H    2  
ATOM 2662  H HA   . ILE A 1 27  ? -11.426 -2.202  -12.349 1.00 0.00 ? 27  ILE A HA   2  
ATOM 2663  H HB   . ILE A 1 27  ? -11.170 -0.075  -13.549 1.00 0.00 ? 27  ILE A HB   2  
ATOM 2664  H HG12 . ILE A 1 27  ? -8.247  -0.880  -13.827 1.00 0.00 ? 27  ILE A HG12 2  
ATOM 2665  H HG13 . ILE A 1 27  ? -9.426  -0.826  -15.129 1.00 0.00 ? 27  ILE A HG13 2  
ATOM 2666  H HG21 . ILE A 1 27  ? -10.345 -0.416  -11.014 1.00 0.00 ? 27  ILE A HG21 2  
ATOM 2667  H HG22 . ILE A 1 27  ? -8.762  -0.064  -11.696 1.00 0.00 ? 27  ILE A HG22 2  
ATOM 2668  H HG23 . ILE A 1 27  ? -10.059 1.121   -11.820 1.00 0.00 ? 27  ILE A HG23 2  
ATOM 2669  H HD11 . ILE A 1 27  ? -8.659  1.570   -13.440 1.00 0.00 ? 27  ILE A HD11 2  
ATOM 2670  H HD12 . ILE A 1 27  ? -7.981  1.218   -15.025 1.00 0.00 ? 27  ILE A HD12 2  
ATOM 2671  H HD13 . ILE A 1 27  ? -9.697  1.570   -14.861 1.00 0.00 ? 27  ILE A HD13 2  
ATOM 2672  N N    . THR A 1 28  ? -11.833 -2.409  -14.926 1.00 0.00 ? 28  THR A N    2  
ATOM 2673  C CA   . THR A 1 28  ? -12.099 -3.003  -16.256 1.00 0.00 ? 28  THR A CA   2  
ATOM 2674  C C    . THR A 1 28  ? -11.809 -1.987  -17.349 1.00 0.00 ? 28  THR A C    2  
ATOM 2675  O O    . THR A 1 28  ? -12.056 -0.811  -17.182 1.00 0.00 ? 28  THR A O    2  
ATOM 2676  C CB   . THR A 1 28  ? -13.575 -3.392  -16.338 1.00 0.00 ? 28  THR A CB   2  
ATOM 2677  O OG1  . THR A 1 28  ? -14.277 -2.330  -15.726 1.00 0.00 ? 28  THR A OG1  2  
ATOM 2678  C CG2  . THR A 1 28  ? -13.877 -4.614  -15.457 1.00 0.00 ? 28  THR A CG2  2  
ATOM 2679  H H    . THR A 1 28  ? -12.483 -1.801  -14.517 1.00 0.00 ? 28  THR A H    2  
ATOM 2680  H HA   . THR A 1 28  ? -11.460 -3.874  -16.399 1.00 0.00 ? 28  THR A HA   2  
ATOM 2681  H HB   . THR A 1 28  ? -13.893 -3.526  -17.369 1.00 0.00 ? 28  THR A HB   2  
ATOM 2682  H HG1  . THR A 1 28  ? -15.083 -2.688  -15.346 1.00 0.00 ? 28  THR A HG1  2  
ATOM 2683  H HG21 . THR A 1 28  ? -13.065 -5.320  -15.522 1.00 0.00 ? 28  THR A HG21 2  
ATOM 2684  H HG22 . THR A 1 28  ? -13.995 -4.302  -14.429 1.00 0.00 ? 28  THR A HG22 2  
ATOM 2685  H HG23 . THR A 1 28  ? -14.789 -5.087  -15.792 1.00 0.00 ? 28  THR A HG23 2  
ATOM 2686  N N    . THR A 1 29  ? -11.279 -2.459  -18.440 1.00 0.00 ? 29  THR A N    2  
ATOM 2687  C CA   . THR A 1 29  ? -10.961 -1.536  -19.565 1.00 0.00 ? 29  THR A CA   2  
ATOM 2688  C C    . THR A 1 29  ? -12.053 -0.485  -19.745 1.00 0.00 ? 29  THR A C    2  
ATOM 2689  O O    . THR A 1 29  ? -11.786 0.622   -20.169 1.00 0.00 ? 29  THR A O    2  
ATOM 2690  C CB   . THR A 1 29  ? -10.869 -2.361  -20.849 1.00 0.00 ? 29  THR A CB   2  
ATOM 2691  O OG1  . THR A 1 29  ? -12.065 -3.112  -20.894 1.00 0.00 ? 29  THR A OG1  2  
ATOM 2692  C CG2  . THR A 1 29  ? -9.758  -3.410  -20.745 1.00 0.00 ? 29  THR A CG2  2  
ATOM 2693  H H    . THR A 1 29  ? -11.084 -3.414  -18.516 1.00 0.00 ? 29  THR A H    2  
ATOM 2694  H HA   . THR A 1 29  ? -10.014 -1.035  -19.357 1.00 0.00 ? 29  THR A HA   2  
ATOM 2695  H HB   . THR A 1 29  ? -10.776 -1.731  -21.728 1.00 0.00 ? 29  THR A HB   2  
ATOM 2696  H HG1  . THR A 1 29  ? -12.761 -2.586  -20.490 1.00 0.00 ? 29  THR A HG1  2  
ATOM 2697  H HG21 . THR A 1 29  ? -8.828  -2.930  -20.482 1.00 0.00 ? 29  THR A HG21 2  
ATOM 2698  H HG22 . THR A 1 29  ? -10.011 -4.135  -19.987 1.00 0.00 ? 29  THR A HG22 2  
ATOM 2699  H HG23 . THR A 1 29  ? -9.642  -3.913  -21.694 1.00 0.00 ? 29  THR A HG23 2  
ATOM 2700  N N    . LYS A 1 30  ? -13.264 -0.848  -19.417 1.00 0.00 ? 30  LYS A N    2  
ATOM 2701  C CA   . LYS A 1 30  ? -14.379 0.121   -19.565 1.00 0.00 ? 30  LYS A CA   2  
ATOM 2702  C C    . LYS A 1 30  ? -14.248 1.261   -18.563 1.00 0.00 ? 30  LYS A C    2  
ATOM 2703  O O    . LYS A 1 30  ? -14.449 2.411   -18.900 1.00 0.00 ? 30  LYS A O    2  
ATOM 2704  C CB   . LYS A 1 30  ? -15.707 -0.622  -19.322 1.00 0.00 ? 30  LYS A CB   2  
ATOM 2705  C CG   . LYS A 1 30  ? -16.044 -0.600  -17.828 1.00 0.00 ? 30  LYS A CG   2  
ATOM 2706  C CD   . LYS A 1 30  ? -17.241 -1.524  -17.579 1.00 0.00 ? 30  LYS A CD   2  
ATOM 2707  C CE   . LYS A 1 30  ? -17.485 -1.645  -16.073 1.00 0.00 ? 30  LYS A CE   2  
ATOM 2708  N NZ   . LYS A 1 30  ? -17.952 -0.345  -15.514 1.00 0.00 ? 30  LYS A NZ   2  
ATOM 2709  H H    . LYS A 1 30  ? -13.434 -1.751  -19.077 1.00 0.00 ? 30  LYS A H    2  
ATOM 2710  H HA   . LYS A 1 30  ? -14.351 0.534   -20.570 1.00 0.00 ? 30  LYS A HA   2  
ATOM 2711  H HB2  . LYS A 1 30  ? -16.496 -0.141  -19.878 1.00 0.00 ? 30  LYS A HB2  2  
ATOM 2712  H HB3  . LYS A 1 30  ? -15.614 -1.646  -19.656 1.00 0.00 ? 30  LYS A HB3  2  
ATOM 2713  H HG2  . LYS A 1 30  ? -15.196 -0.943  -17.258 1.00 0.00 ? 30  LYS A HG2  2  
ATOM 2714  H HG3  . LYS A 1 30  ? -16.292 0.406   -17.527 1.00 0.00 ? 30  LYS A HG3  2  
ATOM 2715  H HD2  . LYS A 1 30  ? -18.119 -1.115  -18.056 1.00 0.00 ? 30  LYS A HD2  2  
ATOM 2716  H HD3  . LYS A 1 30  ? -17.038 -2.501  -17.992 1.00 0.00 ? 30  LYS A HD3  2  
ATOM 2717  H HE2  . LYS A 1 30  ? -18.238 -2.397  -15.889 1.00 0.00 ? 30  LYS A HE2  2  
ATOM 2718  H HE3  . LYS A 1 30  ? -16.570 -1.933  -15.580 1.00 0.00 ? 30  LYS A HE3  2  
ATOM 2719  H HZ1  . LYS A 1 30  ? -17.352 0.423   -15.876 1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 2720  H HZ2  . LYS A 1 30  ? -18.938 -0.179  -15.799 1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 2721  H HZ3  . LYS A 1 30  ? -17.890 -0.373  -14.476 1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 2722  N N    . GLU A 1 31  ? -13.914 0.927   -17.349 1.00 0.00 ? 31  GLU A N    2  
ATOM 2723  C CA   . GLU A 1 31  ? -13.766 1.986   -16.320 1.00 0.00 ? 31  GLU A CA   2  
ATOM 2724  C C    . GLU A 1 31  ? -12.456 2.736   -16.514 1.00 0.00 ? 31  GLU A C    2  
ATOM 2725  O O    . GLU A 1 31  ? -12.224 3.757   -15.903 1.00 0.00 ? 31  GLU A O    2  
ATOM 2726  C CB   . GLU A 1 31  ? -13.750 1.323   -14.934 1.00 0.00 ? 31  GLU A CB   2  
ATOM 2727  C CG   . GLU A 1 31  ? -15.108 0.675   -14.672 1.00 0.00 ? 31  GLU A CG   2  
ATOM 2728  C CD   . GLU A 1 31  ? -15.301 0.493   -13.165 1.00 0.00 ? 31  GLU A CD   2  
ATOM 2729  O OE1  . GLU A 1 31  ? -14.376 0.851   -12.454 1.00 0.00 ? 31  GLU A OE1  2  
ATOM 2730  O OE2  . GLU A 1 31  ? -16.361 0.006   -12.809 1.00 0.00 ? 31  GLU A OE2  2  
ATOM 2731  H H    . GLU A 1 31  ? -13.763 -0.013  -17.119 1.00 0.00 ? 31  GLU A H    2  
ATOM 2732  H HA   . GLU A 1 31  ? -14.596 2.688   -16.406 1.00 0.00 ? 31  GLU A HA   2  
ATOM 2733  H HB2  . GLU A 1 31  ? -12.976 0.570   -14.900 1.00 0.00 ? 31  GLU A HB2  2  
ATOM 2734  H HB3  . GLU A 1 31  ? -13.552 2.069   -14.178 1.00 0.00 ? 31  GLU A HB3  2  
ATOM 2735  H HG2  . GLU A 1 31  ? -15.896 1.304   -15.059 1.00 0.00 ? 31  GLU A HG2  2  
ATOM 2736  H HG3  . GLU A 1 31  ? -15.153 -0.290  -15.156 1.00 0.00 ? 31  GLU A HG3  2  
ATOM 2737  N N    . LEU A 1 32  ? -11.623 2.213   -17.365 1.00 0.00 ? 32  LEU A N    2  
ATOM 2738  C CA   . LEU A 1 32  ? -10.325 2.869   -17.622 1.00 0.00 ? 32  LEU A CA   2  
ATOM 2739  C C    . LEU A 1 32  ? -10.502 4.358   -17.930 1.00 0.00 ? 32  LEU A C    2  
ATOM 2740  O O    . LEU A 1 32  ? -10.050 5.207   -17.188 1.00 0.00 ? 32  LEU A O    2  
ATOM 2741  C CB   . LEU A 1 32  ? -9.703  2.189   -18.840 1.00 0.00 ? 32  LEU A CB   2  
ATOM 2742  C CG   . LEU A 1 32  ? -8.227  2.543   -18.920 1.00 0.00 ? 32  LEU A CG   2  
ATOM 2743  C CD1  . LEU A 1 32  ? -7.472  1.829   -17.797 1.00 0.00 ? 32  LEU A CD1  2  
ATOM 2744  C CD2  . LEU A 1 32  ? -7.691  2.072   -20.265 1.00 0.00 ? 32  LEU A CD2  2  
ATOM 2745  H H    . LEU A 1 32  ? -11.852 1.384   -17.834 1.00 0.00 ? 32  LEU A H    2  
ATOM 2746  H HA   . LEU A 1 32  ? -9.687  2.755   -16.745 1.00 0.00 ? 32  LEU A HA   2  
ATOM 2747  H HB2  . LEU A 1 32  ? -9.815  1.118   -18.753 1.00 0.00 ? 32  LEU A HB2  2  
ATOM 2748  H HB3  . LEU A 1 32  ? -10.205 2.524   -19.735 1.00 0.00 ? 32  LEU A HB3  2  
ATOM 2749  H HG   . LEU A 1 32  ? -8.100  3.611   -18.828 1.00 0.00 ? 32  LEU A HG   2  
ATOM 2750  H HD11 . LEU A 1 32  ? -8.021  0.950   -17.490 1.00 0.00 ? 32  LEU A HD11 2  
ATOM 2751  H HD12 . LEU A 1 32  ? -6.495  1.533   -18.148 1.00 0.00 ? 32  LEU A HD12 2  
ATOM 2752  H HD13 . LEU A 1 32  ? -7.361  2.492   -16.953 1.00 0.00 ? 32  LEU A HD13 2  
ATOM 2753  H HD21 . LEU A 1 32  ? -8.419  2.275   -21.036 1.00 0.00 ? 32  LEU A HD21 2  
ATOM 2754  H HD22 . LEU A 1 32  ? -6.775  2.591   -20.493 1.00 0.00 ? 32  LEU A HD22 2  
ATOM 2755  H HD23 . LEU A 1 32  ? -7.503  1.010   -20.227 1.00 0.00 ? 32  LEU A HD23 2  
ATOM 2756  N N    . GLY A 1 33  ? -11.157 4.644   -19.023 1.00 0.00 ? 33  GLY A N    2  
ATOM 2757  C CA   . GLY A 1 33  ? -11.376 6.073   -19.403 1.00 0.00 ? 33  GLY A CA   2  
ATOM 2758  C C    . GLY A 1 33  ? -11.761 6.911   -18.186 1.00 0.00 ? 33  GLY A C    2  
ATOM 2759  O O    . GLY A 1 33  ? -11.331 8.040   -18.047 1.00 0.00 ? 33  GLY A O    2  
ATOM 2760  H H    . GLY A 1 33  ? -11.509 3.926   -19.590 1.00 0.00 ? 33  GLY A H    2  
ATOM 2761  H HA2  . GLY A 1 33  ? -10.468 6.470   -19.834 1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2762  H HA3  . GLY A 1 33  ? -12.168 6.129   -20.134 1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2763  N N    . THR A 1 34  ? -12.559 6.347   -17.327 1.00 0.00 ? 34  THR A N    2  
ATOM 2764  C CA   . THR A 1 34  ? -12.974 7.102   -16.123 1.00 0.00 ? 34  THR A CA   2  
ATOM 2765  C C    . THR A 1 34  ? -11.788 7.361   -15.202 1.00 0.00 ? 34  THR A C    2  
ATOM 2766  O O    . THR A 1 34  ? -11.609 8.457   -14.713 1.00 0.00 ? 34  THR A O    2  
ATOM 2767  C CB   . THR A 1 34  ? -14.037 6.279   -15.378 1.00 0.00 ? 34  THR A CB   2  
ATOM 2768  O OG1  . THR A 1 34  ? -15.271 6.871   -15.721 1.00 0.00 ? 34  THR A OG1  2  
ATOM 2769  C CG2  . THR A 1 34  ? -13.931 6.471   -13.858 1.00 0.00 ? 34  THR A CG2  2  
ATOM 2770  H H    . THR A 1 34  ? -12.878 5.430   -17.476 1.00 0.00 ? 34  THR A H    2  
ATOM 2771  H HA   . THR A 1 34  ? -13.381 8.059   -16.437 1.00 0.00 ? 34  THR A HA   2  
ATOM 2772  H HB   . THR A 1 34  ? -14.019 5.233   -15.672 1.00 0.00 ? 34  THR A HB   2  
ATOM 2773  H HG1  . THR A 1 34  ? -15.966 6.237   -15.534 1.00 0.00 ? 34  THR A HG1  2  
ATOM 2774  H HG21 . THR A 1 34  ? -13.678 7.497   -13.637 1.00 0.00 ? 34  THR A HG21 2  
ATOM 2775  H HG22 . THR A 1 34  ? -14.876 6.230   -13.395 1.00 0.00 ? 34  THR A HG22 2  
ATOM 2776  H HG23 . THR A 1 34  ? -13.163 5.823   -13.460 1.00 0.00 ? 34  THR A HG23 2  
ATOM 2777  N N    . VAL A 1 35  ? -10.998 6.352   -14.981 1.00 0.00 ? 35  VAL A N    2  
ATOM 2778  C CA   . VAL A 1 35  ? -9.825  6.538   -14.095 1.00 0.00 ? 35  VAL A CA   2  
ATOM 2779  C C    . VAL A 1 35  ? -8.861  7.555   -14.693 1.00 0.00 ? 35  VAL A C    2  
ATOM 2780  O O    . VAL A 1 35  ? -8.484  8.511   -14.045 1.00 0.00 ? 35  VAL A O    2  
ATOM 2781  C CB   . VAL A 1 35  ? -9.106  5.192   -13.951 1.00 0.00 ? 35  VAL A CB   2  
ATOM 2782  C CG1  . VAL A 1 35  ? -8.023  5.312   -12.875 1.00 0.00 ? 35  VAL A CG1  2  
ATOM 2783  C CG2  . VAL A 1 35  ? -10.116 4.124   -13.531 1.00 0.00 ? 35  VAL A CG2  2  
ATOM 2784  H H    . VAL A 1 35  ? -11.176 5.484   -15.395 1.00 0.00 ? 35  VAL A H    2  
ATOM 2785  H HA   . VAL A 1 35  ? -10.168 6.899   -13.128 1.00 0.00 ? 35  VAL A HA   2  
ATOM 2786  H HB   . VAL A 1 35  ? -8.656  4.919   -14.891 1.00 0.00 ? 35  VAL A HB   2  
ATOM 2787  H HG11 . VAL A 1 35  ? -7.339  6.105   -13.134 1.00 0.00 ? 35  VAL A HG11 2  
ATOM 2788  H HG12 . VAL A 1 35  ? -8.479  5.532   -11.922 1.00 0.00 ? 35  VAL A HG12 2  
ATOM 2789  H HG13 . VAL A 1 35  ? -7.478  4.383   -12.802 1.00 0.00 ? 35  VAL A HG13 2  
ATOM 2790  H HG21 . VAL A 1 35  ? -10.973 4.594   -13.073 1.00 0.00 ? 35  VAL A HG21 2  
ATOM 2791  H HG22 . VAL A 1 35  ? -10.436 3.570   -14.395 1.00 0.00 ? 35  VAL A HG22 2  
ATOM 2792  H HG23 . VAL A 1 35  ? -9.660  3.448   -12.824 1.00 0.00 ? 35  VAL A HG23 2  
ATOM 2793  N N    . MET A 1 36  ? -8.480  7.335   -15.922 1.00 0.00 ? 36  MET A N    2  
ATOM 2794  C CA   . MET A 1 36  ? -7.544  8.282   -16.570 1.00 0.00 ? 36  MET A CA   2  
ATOM 2795  C C    . MET A 1 36  ? -8.071  9.707   -16.470 1.00 0.00 ? 36  MET A C    2  
ATOM 2796  O O    . MET A 1 36  ? -7.308  10.644  -16.352 1.00 0.00 ? 36  MET A O    2  
ATOM 2797  C CB   . MET A 1 36  ? -7.409  7.904   -18.055 1.00 0.00 ? 36  MET A CB   2  
ATOM 2798  C CG   . MET A 1 36  ? -7.128  6.399   -18.175 1.00 0.00 ? 36  MET A CG   2  
ATOM 2799  S SD   . MET A 1 36  ? -5.641  5.902   -19.082 1.00 0.00 ? 36  MET A SD   2  
ATOM 2800  C CE   . MET A 1 36  ? -4.858  4.971   -17.741 1.00 0.00 ? 36  MET A CE   2  
ATOM 2801  H H    . MET A 1 36  ? -8.808  6.550   -16.411 1.00 0.00 ? 36  MET A H    2  
ATOM 2802  H HA   . MET A 1 36  ? -6.579  8.225   -16.067 1.00 0.00 ? 36  MET A HA   2  
ATOM 2803  H HB2  . MET A 1 36  ? -8.325  8.144   -18.575 1.00 0.00 ? 36  MET A HB2  2  
ATOM 2804  H HB3  . MET A 1 36  ? -6.597  8.461   -18.497 1.00 0.00 ? 36  MET A HB3  2  
ATOM 2805  H HG2  . MET A 1 36  ? -7.055  5.986   -17.179 1.00 0.00 ? 36  MET A HG2  2  
ATOM 2806  H HG3  . MET A 1 36  ? -7.975  5.937   -18.659 1.00 0.00 ? 36  MET A HG3  2  
ATOM 2807  H HE1  . MET A 1 36  ? -5.550  4.234   -17.362 1.00 0.00 ? 36  MET A HE1  2  
ATOM 2808  H HE2  . MET A 1 36  ? -3.974  4.476   -18.114 1.00 0.00 ? 36  MET A HE2  2  
ATOM 2809  H HE3  . MET A 1 36  ? -4.583  5.649   -16.945 1.00 0.00 ? 36  MET A HE3  2  
ATOM 2810  N N    . ARG A 1 37  ? -9.372  9.848   -16.512 1.00 0.00 ? 37  ARG A N    2  
ATOM 2811  C CA   . ARG A 1 37  ? -9.960  11.207  -16.420 1.00 0.00 ? 37  ARG A CA   2  
ATOM 2812  C C    . ARG A 1 37  ? -9.851  11.754  -15.002 1.00 0.00 ? 37  ARG A C    2  
ATOM 2813  O O    . ARG A 1 37  ? -9.737  12.945  -14.802 1.00 0.00 ? 37  ARG A O    2  
ATOM 2814  C CB   . ARG A 1 37  ? -11.447 11.122  -16.798 1.00 0.00 ? 37  ARG A CB   2  
ATOM 2815  C CG   . ARG A 1 37  ? -11.932 12.507  -17.229 1.00 0.00 ? 37  ARG A CG   2  
ATOM 2816  C CD   . ARG A 1 37  ? -13.403 12.422  -17.634 1.00 0.00 ? 37  ARG A CD   2  
ATOM 2817  N NE   . ARG A 1 37  ? -13.542 11.442  -18.745 1.00 0.00 ? 37  ARG A NE   2  
ATOM 2818  C CZ   . ARG A 1 37  ? -14.051 10.268  -18.499 1.00 0.00 ? 37  ARG A CZ   2  
ATOM 2819  N NH1  . ARG A 1 37  ? -15.242 10.196  -17.971 1.00 0.00 ? 37  ARG A NH1  2  
ATOM 2820  N NH2  . ARG A 1 37  ? -13.354 9.204   -18.793 1.00 0.00 ? 37  ARG A NH2  2  
ATOM 2821  H H    . ARG A 1 37  ? -9.955  9.061   -16.604 1.00 0.00 ? 37  ARG A H    2  
ATOM 2822  H HA   . ARG A 1 37  ? -9.426  11.871  -17.098 1.00 0.00 ? 37  ARG A HA   2  
ATOM 2823  H HB2  . ARG A 1 37  ? -11.577 10.421  -17.608 1.00 0.00 ? 37  ARG A HB2  2  
ATOM 2824  H HB3  . ARG A 1 37  ? -12.019 10.787  -15.944 1.00 0.00 ? 37  ARG A HB3  2  
ATOM 2825  H HG2  . ARG A 1 37  ? -11.819 13.201  -16.410 1.00 0.00 ? 37  ARG A HG2  2  
ATOM 2826  H HG3  . ARG A 1 37  ? -11.343 12.851  -18.067 1.00 0.00 ? 37  ARG A HG3  2  
ATOM 2827  H HD2  . ARG A 1 37  ? -13.998 12.097  -16.793 1.00 0.00 ? 37  ARG A HD2  2  
ATOM 2828  H HD3  . ARG A 1 37  ? -13.750 13.389  -17.965 1.00 0.00 ? 37  ARG A HD3  2  
ATOM 2829  H HE   . ARG A 1 37  ? -13.253 11.676  -19.651 1.00 0.00 ? 37  ARG A HE   2  
ATOM 2830  H HH11 . ARG A 1 37  ? -15.746 11.034  -17.761 1.00 0.00 ? 37  ARG A HH11 2  
ATOM 2831  H HH12 . ARG A 1 37  ? -15.648 9.305   -17.773 1.00 0.00 ? 37  ARG A HH12 2  
ATOM 2832  H HH21 . ARG A 1 37  ? -12.447 9.299   -19.200 1.00 0.00 ? 37  ARG A HH21 2  
ATOM 2833  H HH22 . ARG A 1 37  ? -13.729 8.296   -18.610 1.00 0.00 ? 37  ARG A HH22 2  
ATOM 2834  N N    . SER A 1 38  ? -9.887  10.873  -14.043 1.00 0.00 ? 38  SER A N    2  
ATOM 2835  C CA   . SER A 1 38  ? -9.787  11.327  -12.636 1.00 0.00 ? 38  SER A CA   2  
ATOM 2836  C C    . SER A 1 38  ? -8.356  11.703  -12.279 1.00 0.00 ? 38  SER A C    2  
ATOM 2837  O O    . SER A 1 38  ? -8.128  12.532  -11.420 1.00 0.00 ? 38  SER A O    2  
ATOM 2838  C CB   . SER A 1 38  ? -10.228 10.177  -11.726 1.00 0.00 ? 38  SER A CB   2  
ATOM 2839  O OG   . SER A 1 38  ? -10.167 10.727  -10.419 1.00 0.00 ? 38  SER A OG   2  
ATOM 2840  H H    . SER A 1 38  ? -9.979  9.919   -14.250 1.00 0.00 ? 38  SER A H    2  
ATOM 2841  H HA   . SER A 1 38  ? -10.428 12.196  -12.499 1.00 0.00 ? 38  SER A HA   2  
ATOM 2842  H HB2  . SER A 1 38  ? -11.238 9.870   -11.957 1.00 0.00 ? 38  SER A HB2  2  
ATOM 2843  H HB3  . SER A 1 38  ? -9.549  9.342   -11.813 1.00 0.00 ? 38  SER A HB3  2  
ATOM 2844  H HG   . SER A 1 38  ? -9.244  10.893  -10.210 1.00 0.00 ? 38  SER A HG   2  
ATOM 2845  N N    . LEU A 1 39  ? -7.416  11.089  -12.938 1.00 0.00 ? 39  LEU A N    2  
ATOM 2846  C CA   . LEU A 1 39  ? -6.001  11.406  -12.639 1.00 0.00 ? 39  LEU A CA   2  
ATOM 2847  C C    . LEU A 1 39  ? -5.742  12.905  -12.748 1.00 0.00 ? 39  LEU A C    2  
ATOM 2848  O O    . LEU A 1 39  ? -4.966  13.456  -11.994 1.00 0.00 ? 39  LEU A O    2  
ATOM 2849  C CB   . LEU A 1 39  ? -5.113  10.669  -13.643 1.00 0.00 ? 39  LEU A CB   2  
ATOM 2850  C CG   . LEU A 1 39  ? -4.634  9.360   -13.010 1.00 0.00 ? 39  LEU A CG   2  
ATOM 2851  C CD1  . LEU A 1 39  ? -5.806  8.378   -12.933 1.00 0.00 ? 39  LEU A CD1  2  
ATOM 2852  C CD2  . LEU A 1 39  ? -3.532  8.762   -13.875 1.00 0.00 ? 39  LEU A CD2  2  
ATOM 2853  H H    . LEU A 1 39  ? -7.642  10.426  -13.625 1.00 0.00 ? 39  LEU A H    2  
ATOM 2854  H HA   . LEU A 1 39  ? -5.777  11.086  -11.624 1.00 0.00 ? 39  LEU A HA   2  
ATOM 2855  H HB2  . LEU A 1 39  ? -5.676  10.454  -14.539 1.00 0.00 ? 39  LEU A HB2  2  
ATOM 2856  H HB3  . LEU A 1 39  ? -4.262  11.282  -13.897 1.00 0.00 ? 39  LEU A HB3  2  
ATOM 2857  H HG   . LEU A 1 39  ? -4.253  9.552   -12.017 1.00 0.00 ? 39  LEU A HG   2  
ATOM 2858  H HD11 . LEU A 1 39  ? -6.620  8.824   -12.381 1.00 0.00 ? 39  LEU A HD11 2  
ATOM 2859  H HD12 . LEU A 1 39  ? -6.142  8.134   -13.927 1.00 0.00 ? 39  LEU A HD12 2  
ATOM 2860  H HD13 . LEU A 1 39  ? -5.491  7.474   -12.433 1.00 0.00 ? 39  LEU A HD13 2  
ATOM 2861  H HD21 . LEU A 1 39  ? -2.770  9.504   -14.058 1.00 0.00 ? 39  LEU A HD21 2  
ATOM 2862  H HD22 . LEU A 1 39  ? -3.092  7.916   -13.369 1.00 0.00 ? 39  LEU A HD22 2  
ATOM 2863  H HD23 . LEU A 1 39  ? -3.946  8.437   -14.818 1.00 0.00 ? 39  LEU A HD23 2  
ATOM 2864  N N    . GLY A 1 40  ? -6.401  13.540  -13.687 1.00 0.00 ? 40  GLY A N    2  
ATOM 2865  C CA   . GLY A 1 40  ? -6.200  15.014  -13.855 1.00 0.00 ? 40  GLY A CA   2  
ATOM 2866  C C    . GLY A 1 40  ? -6.199  15.404  -15.338 1.00 0.00 ? 40  GLY A C    2  
ATOM 2867  O O    . GLY A 1 40  ? -6.227  16.574  -15.666 1.00 0.00 ? 40  GLY A O    2  
ATOM 2868  H H    . GLY A 1 40  ? -7.021  13.056  -14.270 1.00 0.00 ? 40  GLY A H    2  
ATOM 2869  H HA2  . GLY A 1 40  ? -6.996  15.539  -13.351 1.00 0.00 ? 40  GLY A HA2  2  
ATOM 2870  H HA3  . GLY A 1 40  ? -5.255  15.298  -13.415 1.00 0.00 ? 40  GLY A HA3  2  
ATOM 2871  N N    . GLN A 1 41  ? -6.171  14.416  -16.200 1.00 0.00 ? 41  GLN A N    2  
ATOM 2872  C CA   . GLN A 1 41  ? -6.167  14.711  -17.662 1.00 0.00 ? 41  GLN A CA   2  
ATOM 2873  C C    . GLN A 1 41  ? -7.533  14.432  -18.286 1.00 0.00 ? 41  GLN A C    2  
ATOM 2874  O O    . GLN A 1 41  ? -8.472  14.077  -17.599 1.00 0.00 ? 41  GLN A O    2  
ATOM 2875  C CB   . GLN A 1 41  ? -5.117  13.811  -18.333 1.00 0.00 ? 41  GLN A CB   2  
ATOM 2876  C CG   . GLN A 1 41  ? -5.351  12.361  -17.914 1.00 0.00 ? 41  GLN A CG   2  
ATOM 2877  C CD   . GLN A 1 41  ? -4.614  11.432  -18.882 1.00 0.00 ? 41  GLN A CD   2  
ATOM 2878  O OE1  . GLN A 1 41  ? -5.217  10.663  -19.603 1.00 0.00 ? 41  GLN A OE1  2  
ATOM 2879  N NE2  . GLN A 1 41  ? -3.312  11.476  -18.933 1.00 0.00 ? 41  GLN A NE2  2  
ATOM 2880  H H    . GLN A 1 41  ? -6.153  13.488  -15.884 1.00 0.00 ? 41  GLN A H    2  
ATOM 2881  H HA   . GLN A 1 41  ? -5.921  15.761  -17.814 1.00 0.00 ? 41  GLN A HA   2  
ATOM 2882  H HB2  . GLN A 1 41  ? -5.197  13.896  -19.405 1.00 0.00 ? 41  GLN A HB2  2  
ATOM 2883  H HB3  . GLN A 1 41  ? -4.129  14.121  -18.027 1.00 0.00 ? 41  GLN A HB3  2  
ATOM 2884  H HG2  . GLN A 1 41  ? -4.977  12.204  -16.913 1.00 0.00 ? 41  GLN A HG2  2  
ATOM 2885  H HG3  . GLN A 1 41  ? -6.406  12.139  -17.939 1.00 0.00 ? 41  GLN A HG3  2  
ATOM 2886  H HE21 . GLN A 1 41  ? -2.819  12.095  -18.355 1.00 0.00 ? 41  GLN A HE21 2  
ATOM 2887  H HE22 . GLN A 1 41  ? -2.826  10.887  -19.548 1.00 0.00 ? 41  GLN A HE22 2  
ATOM 2888  N N    . ASN A 1 42  ? -7.613  14.600  -19.585 1.00 0.00 ? 42  ASN A N    2  
ATOM 2889  C CA   . ASN A 1 42  ? -8.902  14.356  -20.292 1.00 0.00 ? 42  ASN A CA   2  
ATOM 2890  C C    . ASN A 1 42  ? -8.663  13.594  -21.599 1.00 0.00 ? 42  ASN A C    2  
ATOM 2891  O O    . ASN A 1 42  ? -8.586  14.180  -22.660 1.00 0.00 ? 42  ASN A O    2  
ATOM 2892  C CB   . ASN A 1 42  ? -9.523  15.723  -20.631 1.00 0.00 ? 42  ASN A CB   2  
ATOM 2893  C CG   . ASN A 1 42  ? -9.548  16.595  -19.372 1.00 0.00 ? 42  ASN A CG   2  
ATOM 2894  O OD1  . ASN A 1 42  ? -8.522  17.007  -18.870 1.00 0.00 ? 42  ASN A OD1  2  
ATOM 2895  N ND2  . ASN A 1 42  ? -10.698 16.897  -18.832 1.00 0.00 ? 42  ASN A ND2  2  
ATOM 2896  H H    . ASN A 1 42  ? -6.824  14.884  -20.091 1.00 0.00 ? 42  ASN A H    2  
ATOM 2897  H HA   . ASN A 1 42  ? -9.561  13.780  -19.652 1.00 0.00 ? 42  ASN A HA   2  
ATOM 2898  H HB2  . ASN A 1 42  ? -8.932  16.214  -21.391 1.00 0.00 ? 42  ASN A HB2  2  
ATOM 2899  H HB3  . ASN A 1 42  ? -10.531 15.588  -20.994 1.00 0.00 ? 42  ASN A HB3  2  
ATOM 2900  H HD21 . ASN A 1 42  ? -11.529 16.567  -19.232 1.00 0.00 ? 42  ASN A HD21 2  
ATOM 2901  H HD22 . ASN A 1 42  ? -10.730 17.454  -18.027 1.00 0.00 ? 42  ASN A HD22 2  
ATOM 2902  N N    . PRO A 1 43  ? -8.556  12.288  -21.488 1.00 0.00 ? 43  PRO A N    2  
ATOM 2903  C CA   . PRO A 1 43  ? -8.325  11.432  -22.650 1.00 0.00 ? 43  PRO A CA   2  
ATOM 2904  C C    . PRO A 1 43  ? -9.535  11.396  -23.576 1.00 0.00 ? 43  PRO A C    2  
ATOM 2905  O O    . PRO A 1 43  ? -10.613 11.825  -23.209 1.00 0.00 ? 43  PRO A O    2  
ATOM 2906  C CB   . PRO A 1 43  ? -8.090  10.026  -22.062 1.00 0.00 ? 43  PRO A CB   2  
ATOM 2907  C CG   . PRO A 1 43  ? -8.310  10.125  -20.521 1.00 0.00 ? 43  PRO A CG   2  
ATOM 2908  C CD   . PRO A 1 43  ? -8.653  11.588  -20.202 1.00 0.00 ? 43  PRO A CD   2  
ATOM 2909  H HA   . PRO A 1 43  ? -7.451  11.779  -23.195 1.00 0.00 ? 43  PRO A HA   2  
ATOM 2910  H HB2  . PRO A 1 43  ? -8.788  9.323   -22.491 1.00 0.00 ? 43  PRO A HB2  2  
ATOM 2911  H HB3  . PRO A 1 43  ? -7.081  9.703   -22.269 1.00 0.00 ? 43  PRO A HB3  2  
ATOM 2912  H HG2  . PRO A 1 43  ? -9.127  9.484   -20.224 1.00 0.00 ? 43  PRO A HG2  2  
ATOM 2913  H HG3  . PRO A 1 43  ? -7.413  9.835   -20.000 1.00 0.00 ? 43  PRO A HG3  2  
ATOM 2914  H HD2  . PRO A 1 43  ? -9.658  11.657  -19.815 1.00 0.00 ? 43  PRO A HD2  2  
ATOM 2915  H HD3  . PRO A 1 43  ? -7.949  12.001  -19.497 1.00 0.00 ? 43  PRO A HD3  2  
ATOM 2916  N N    . THR A 1 44  ? -9.325  10.882  -24.766 1.00 0.00 ? 44  THR A N    2  
ATOM 2917  C CA   . THR A 1 44  ? -10.428 10.795  -25.749 1.00 0.00 ? 44  THR A CA   2  
ATOM 2918  C C    . THR A 1 44  ? -10.811 9.339   -25.997 1.00 0.00 ? 44  THR A C    2  
ATOM 2919  O O    . THR A 1 44  ? -9.958  8.478   -26.097 1.00 0.00 ? 44  THR A O    2  
ATOM 2920  C CB   . THR A 1 44  ? -9.940  11.408  -27.058 1.00 0.00 ? 44  THR A CB   2  
ATOM 2921  O OG1  . THR A 1 44  ? -9.353  12.643  -26.696 1.00 0.00 ? 44  THR A OG1  2  
ATOM 2922  C CG2  . THR A 1 44  ? -11.122 11.792  -27.948 1.00 0.00 ? 44  THR A CG2  2  
ATOM 2923  H H    . THR A 1 44  ? -8.435  10.559  -25.008 1.00 0.00 ? 44  THR A H    2  
ATOM 2924  H HA   . THR A 1 44  ? -11.293 11.330  -25.370 1.00 0.00 ? 44  THR A HA   2  
ATOM 2925  H HB   . THR A 1 44  ? -9.223  10.769  -27.559 1.00 0.00 ? 44  THR A HB   2  
ATOM 2926  H HG1  . THR A 1 44  ? -8.505  12.460  -26.286 1.00 0.00 ? 44  THR A HG1  2  
ATOM 2927  H HG21 . THR A 1 44  ? -11.774 10.939  -28.072 1.00 0.00 ? 44  THR A HG21 2  
ATOM 2928  H HG22 . THR A 1 44  ? -11.674 12.600  -27.492 1.00 0.00 ? 44  THR A HG22 2  
ATOM 2929  H HG23 . THR A 1 44  ? -10.763 12.107  -28.914 1.00 0.00 ? 44  THR A HG23 2  
ATOM 2930  N N    . GLU A 1 45  ? -12.086 9.090   -26.091 1.00 0.00 ? 45  GLU A N    2  
ATOM 2931  C CA   . GLU A 1 45  ? -12.546 7.698   -26.332 1.00 0.00 ? 45  GLU A CA   2  
ATOM 2932  C C    . GLU A 1 45  ? -11.696 7.010   -27.395 1.00 0.00 ? 45  GLU A C    2  
ATOM 2933  O O    . GLU A 1 45  ? -11.622 5.799   -27.443 1.00 0.00 ? 45  GLU A O    2  
ATOM 2934  C CB   . GLU A 1 45  ? -13.997 7.752   -26.825 1.00 0.00 ? 45  GLU A CB   2  
ATOM 2935  C CG   . GLU A 1 45  ? -14.162 8.951   -27.761 1.00 0.00 ? 45  GLU A CG   2  
ATOM 2936  C CD   . GLU A 1 45  ? -15.620 9.045   -28.209 1.00 0.00 ? 45  GLU A CD   2  
ATOM 2937  O OE1  . GLU A 1 45  ? -15.979 8.243   -29.055 1.00 0.00 ? 45  GLU A OE1  2  
ATOM 2938  O OE2  . GLU A 1 45  ? -16.294 9.914   -27.680 1.00 0.00 ? 45  GLU A OE2  2  
ATOM 2939  H H    . GLU A 1 45  ? -12.738 9.816   -26.002 1.00 0.00 ? 45  GLU A H    2  
ATOM 2940  H HA   . GLU A 1 45  ? -12.474 7.136   -25.403 1.00 0.00 ? 45  GLU A HA   2  
ATOM 2941  H HB2  . GLU A 1 45  ? -14.234 6.841   -27.357 1.00 0.00 ? 45  GLU A HB2  2  
ATOM 2942  H HB3  . GLU A 1 45  ? -14.664 7.854   -25.982 1.00 0.00 ? 45  GLU A HB3  2  
ATOM 2943  H HG2  . GLU A 1 45  ? -13.888 9.858   -27.244 1.00 0.00 ? 45  GLU A HG2  2  
ATOM 2944  H HG3  . GLU A 1 45  ? -13.529 8.828   -28.627 1.00 0.00 ? 45  GLU A HG3  2  
ATOM 2945  N N    . ALA A 1 46  ? -11.067 7.794   -28.225 1.00 0.00 ? 46  ALA A N    2  
ATOM 2946  C CA   . ALA A 1 46  ? -10.222 7.195   -29.287 1.00 0.00 ? 46  ALA A CA   2  
ATOM 2947  C C    . ALA A 1 46  ? -8.912  6.702   -28.709 1.00 0.00 ? 46  ALA A C    2  
ATOM 2948  O O    . ALA A 1 46  ? -8.682  5.515   -28.627 1.00 0.00 ? 46  ALA A O    2  
ATOM 2949  C CB   . ALA A 1 46  ? -9.925  8.263   -30.343 1.00 0.00 ? 46  ALA A CB   2  
ATOM 2950  H H    . ALA A 1 46  ? -11.143 8.763   -28.141 1.00 0.00 ? 46  ALA A H    2  
ATOM 2951  H HA   . ALA A 1 46  ? -10.754 6.352   -29.729 1.00 0.00 ? 46  ALA A HA   2  
ATOM 2952  H HB1  . ALA A 1 46  ? -9.513  9.139   -29.868 1.00 0.00 ? 46  ALA A HB1  2  
ATOM 2953  H HB2  . ALA A 1 46  ? -9.215  7.879   -31.060 1.00 0.00 ? 46  ALA A HB2  2  
ATOM 2954  H HB3  . ALA A 1 46  ? -10.836 8.531   -30.855 1.00 0.00 ? 46  ALA A HB3  2  
ATOM 2955  N N    . GLU A 1 47  ? -8.064  7.619   -28.319 1.00 0.00 ? 47  GLU A N    2  
ATOM 2956  C CA   . GLU A 1 47  ? -6.770  7.191   -27.744 1.00 0.00 ? 47  GLU A CA   2  
ATOM 2957  C C    . GLU A 1 47  ? -7.016  6.106   -26.731 1.00 0.00 ? 47  GLU A C    2  
ATOM 2958  O O    . GLU A 1 47  ? -6.304  5.123   -26.675 1.00 0.00 ? 47  GLU A O    2  
ATOM 2959  C CB   . GLU A 1 47  ? -6.116  8.392   -27.046 1.00 0.00 ? 47  GLU A CB   2  
ATOM 2960  C CG   . GLU A 1 47  ? -5.883  9.503   -28.072 1.00 0.00 ? 47  GLU A CG   2  
ATOM 2961  C CD   . GLU A 1 47  ? -4.528  9.290   -28.750 1.00 0.00 ? 47  GLU A CD   2  
ATOM 2962  O OE1  . GLU A 1 47  ? -3.547  9.351   -28.028 1.00 0.00 ? 47  GLU A OE1  2  
ATOM 2963  O OE2  . GLU A 1 47  ? -4.552  9.079   -29.952 1.00 0.00 ? 47  GLU A OE2  2  
ATOM 2964  H H    . GLU A 1 47  ? -8.283  8.569   -28.401 1.00 0.00 ? 47  GLU A H    2  
ATOM 2965  H HA   . GLU A 1 47  ? -6.137  6.795   -28.537 1.00 0.00 ? 47  GLU A HA   2  
ATOM 2966  H HB2  . GLU A 1 47  ? -6.764  8.753   -26.262 1.00 0.00 ? 47  GLU A HB2  2  
ATOM 2967  H HB3  . GLU A 1 47  ? -5.172  8.092   -26.616 1.00 0.00 ? 47  GLU A HB3  2  
ATOM 2968  H HG2  . GLU A 1 47  ? -6.664  9.482   -28.818 1.00 0.00 ? 47  GLU A HG2  2  
ATOM 2969  H HG3  . GLU A 1 47  ? -5.887  10.463  -27.577 1.00 0.00 ? 47  GLU A HG3  2  
ATOM 2970  N N    . LEU A 1 48  ? -8.026  6.301   -25.939 1.00 0.00 ? 48  LEU A N    2  
ATOM 2971  C CA   . LEU A 1 48  ? -8.339  5.292   -24.927 1.00 0.00 ? 48  LEU A CA   2  
ATOM 2972  C C    . LEU A 1 48  ? -8.458  3.946   -25.607 1.00 0.00 ? 48  LEU A C    2  
ATOM 2973  O O    . LEU A 1 48  ? -7.909  2.964   -25.158 1.00 0.00 ? 48  LEU A O    2  
ATOM 2974  C CB   . LEU A 1 48  ? -9.691  5.652   -24.293 1.00 0.00 ? 48  LEU A CB   2  
ATOM 2975  C CG   . LEU A 1 48  ? -9.909  4.790   -23.047 1.00 0.00 ? 48  LEU A CG   2  
ATOM 2976  C CD1  . LEU A 1 48  ? -8.745  5.002   -22.079 1.00 0.00 ? 48  LEU A CD1  2  
ATOM 2977  C CD2  . LEU A 1 48  ? -11.209 5.211   -22.363 1.00 0.00 ? 48  LEU A CD2  2  
ATOM 2978  H H    . LEU A 1 48  ? -8.571  7.112   -26.019 1.00 0.00 ? 48  LEU A H    2  
ATOM 2979  H HA   . LEU A 1 48  ? -7.543  5.257   -24.182 1.00 0.00 ? 48  LEU A HA   2  
ATOM 2980  H HB2  . LEU A 1 48  ? -9.696  6.699   -24.019 1.00 0.00 ? 48  LEU A HB2  2  
ATOM 2981  H HB3  . LEU A 1 48  ? -10.485 5.471   -25.006 1.00 0.00 ? 48  LEU A HB3  2  
ATOM 2982  H HG   . LEU A 1 48  ? -9.965  3.749   -23.328 1.00 0.00 ? 48  LEU A HG   2  
ATOM 2983  H HD11 . LEU A 1 48  ? -8.309  5.977   -22.243 1.00 0.00 ? 48  LEU A HD11 2  
ATOM 2984  H HD12 . LEU A 1 48  ? -9.100  4.937   -21.062 1.00 0.00 ? 48  LEU A HD12 2  
ATOM 2985  H HD13 . LEU A 1 48  ? -7.993  4.245   -22.243 1.00 0.00 ? 48  LEU A HD13 2  
ATOM 2986  H HD21 . LEU A 1 48  ? -11.151 6.251   -22.080 1.00 0.00 ? 48  LEU A HD21 2  
ATOM 2987  H HD22 . LEU A 1 48  ? -12.038 5.073   -23.041 1.00 0.00 ? 48  LEU A HD22 2  
ATOM 2988  H HD23 . LEU A 1 48  ? -11.366 4.608   -21.482 1.00 0.00 ? 48  LEU A HD23 2  
ATOM 2989  N N    . GLN A 1 49  ? -9.168  3.938   -26.703 1.00 0.00 ? 49  GLN A N    2  
ATOM 2990  C CA   . GLN A 1 49  ? -9.350  2.678   -27.451 1.00 0.00 ? 49  GLN A CA   2  
ATOM 2991  C C    . GLN A 1 49  ? -8.007  2.125   -27.912 1.00 0.00 ? 49  GLN A C    2  
ATOM 2992  O O    . GLN A 1 49  ? -7.812  0.926   -27.966 1.00 0.00 ? 49  GLN A O    2  
ATOM 2993  C CB   . GLN A 1 49  ? -10.217 2.975   -28.686 1.00 0.00 ? 49  GLN A CB   2  
ATOM 2994  C CG   . GLN A 1 49  ? -10.678 1.661   -29.305 1.00 0.00 ? 49  GLN A CG   2  
ATOM 2995  C CD   . GLN A 1 49  ? -11.217 1.926   -30.712 1.00 0.00 ? 49  GLN A CD   2  
ATOM 2996  O OE1  . GLN A 1 49  ? -12.235 1.393   -31.109 1.00 0.00 ? 49  GLN A OE1  2  
ATOM 2997  N NE2  . GLN A 1 49  ? -10.568 2.742   -31.496 1.00 0.00 ? 49  GLN A NE2  2  
ATOM 2998  H H    . GLN A 1 49  ? -9.580  4.766   -27.028 1.00 0.00 ? 49  GLN A H    2  
ATOM 2999  H HA   . GLN A 1 49  ? -9.832  1.948   -26.804 1.00 0.00 ? 49  GLN A HA   2  
ATOM 3000  H HB2  . GLN A 1 49  ? -11.077 3.559   -28.393 1.00 0.00 ? 49  GLN A HB2  2  
ATOM 3001  H HB3  . GLN A 1 49  ? -9.641  3.529   -29.408 1.00 0.00 ? 49  GLN A HB3  2  
ATOM 3002  H HG2  . GLN A 1 49  ? -9.849  0.976   -29.366 1.00 0.00 ? 49  GLN A HG2  2  
ATOM 3003  H HG3  . GLN A 1 49  ? -11.458 1.227   -28.701 1.00 0.00 ? 49  GLN A HG3  2  
ATOM 3004  H HE21 . GLN A 1 49  ? -9.747  3.174   -31.181 1.00 0.00 ? 49  GLN A HE21 2  
ATOM 3005  H HE22 . GLN A 1 49  ? -10.900 2.921   -32.400 1.00 0.00 ? 49  GLN A HE22 2  
ATOM 3006  N N    . ASP A 1 50  ? -7.098  3.010   -28.236 1.00 0.00 ? 50  ASP A N    2  
ATOM 3007  C CA   . ASP A 1 50  ? -5.767  2.543   -28.693 1.00 0.00 ? 50  ASP A CA   2  
ATOM 3008  C C    . ASP A 1 50  ? -5.037  1.824   -27.569 1.00 0.00 ? 50  ASP A C    2  
ATOM 3009  O O    . ASP A 1 50  ? -4.203  0.973   -27.810 1.00 0.00 ? 50  ASP A O    2  
ATOM 3010  C CB   . ASP A 1 50  ? -4.942  3.766   -29.116 1.00 0.00 ? 50  ASP A CB   2  
ATOM 3011  C CG   . ASP A 1 50  ? -3.722  3.302   -29.914 1.00 0.00 ? 50  ASP A CG   2  
ATOM 3012  O OD1  . ASP A 1 50  ? -3.477  2.107   -29.881 1.00 0.00 ? 50  ASP A OD1  2  
ATOM 3013  O OD2  . ASP A 1 50  ? -3.103  4.168   -30.510 1.00 0.00 ? 50  ASP A OD2  2  
ATOM 3014  H H    . ASP A 1 50  ? -7.293  3.975   -28.176 1.00 0.00 ? 50  ASP A H    2  
ATOM 3015  H HA   . ASP A 1 50  ? -5.900  1.855   -29.529 1.00 0.00 ? 50  ASP A HA   2  
ATOM 3016  H HB2  . ASP A 1 50  ? -5.543  4.419   -29.731 1.00 0.00 ? 50  ASP A HB2  2  
ATOM 3017  H HB3  . ASP A 1 50  ? -4.611  4.305   -28.242 1.00 0.00 ? 50  ASP A HB3  2  
ATOM 3018  N N    . MET A 1 51  ? -5.363  2.177   -26.357 1.00 0.00 ? 51  MET A N    2  
ATOM 3019  C CA   . MET A 1 51  ? -4.698  1.526   -25.205 1.00 0.00 ? 51  MET A CA   2  
ATOM 3020  C C    . MET A 1 51  ? -5.349  0.186   -24.887 1.00 0.00 ? 51  MET A C    2  
ATOM 3021  O O    . MET A 1 51  ? -4.670  -0.790  -24.630 1.00 0.00 ? 51  MET A O    2  
ATOM 3022  C CB   . MET A 1 51  ? -4.833  2.448   -23.987 1.00 0.00 ? 51  MET A CB   2  
ATOM 3023  C CG   . MET A 1 51  ? -3.887  3.638   -24.157 1.00 0.00 ? 51  MET A CG   2  
ATOM 3024  S SD   . MET A 1 51  ? -3.453  4.573   -22.670 1.00 0.00 ? 51  MET A SD   2  
ATOM 3025  C CE   . MET A 1 51  ? -4.874  5.692   -22.684 1.00 0.00 ? 51  MET A CE   2  
ATOM 3026  H H    . MET A 1 51  ? -6.042  2.869   -26.210 1.00 0.00 ? 51  MET A H    2  
ATOM 3027  H HA   . MET A 1 51  ? -3.653  1.361   -25.450 1.00 0.00 ? 51  MET A HA   2  
ATOM 3028  H HB2  . MET A 1 51  ? -5.850  2.801   -23.909 1.00 0.00 ? 51  MET A HB2  2  
ATOM 3029  H HB3  . MET A 1 51  ? -4.577  1.905   -23.090 1.00 0.00 ? 51  MET A HB3  2  
ATOM 3030  H HG2  . MET A 1 51  ? -2.968  3.278   -24.596 1.00 0.00 ? 51  MET A HG2  2  
ATOM 3031  H HG3  . MET A 1 51  ? -4.335  4.327   -24.857 1.00 0.00 ? 51  MET A HG3  2  
ATOM 3032  H HE1  . MET A 1 51  ? -4.917  6.208   -23.633 1.00 0.00 ? 51  MET A HE1  2  
ATOM 3033  H HE2  . MET A 1 51  ? -5.782  5.124   -22.543 1.00 0.00 ? 51  MET A HE2  2  
ATOM 3034  H HE3  . MET A 1 51  ? -4.773  6.413   -21.887 1.00 0.00 ? 51  MET A HE3  2  
ATOM 3035  N N    . ILE A 1 52  ? -6.652  0.160   -24.907 1.00 0.00 ? 52  ILE A N    2  
ATOM 3036  C CA   . ILE A 1 52  ? -7.358  -1.112  -24.606 1.00 0.00 ? 52  ILE A CA   2  
ATOM 3037  C C    . ILE A 1 52  ? -6.871  -2.225  -25.526 1.00 0.00 ? 52  ILE A C    2  
ATOM 3038  O O    . ILE A 1 52  ? -6.703  -3.353  -25.106 1.00 0.00 ? 52  ILE A O    2  
ATOM 3039  C CB   . ILE A 1 52  ? -8.861  -0.898  -24.835 1.00 0.00 ? 52  ILE A CB   2  
ATOM 3040  C CG1  . ILE A 1 52  ? -9.510  -0.338  -23.575 1.00 0.00 ? 52  ILE A CG1  2  
ATOM 3041  C CG2  . ILE A 1 52  ? -9.515  -2.256  -25.151 1.00 0.00 ? 52  ILE A CG2  2  
ATOM 3042  C CD1  . ILE A 1 52  ? -9.324  1.176   -23.542 1.00 0.00 ? 52  ILE A CD1  2  
ATOM 3043  H H    . ILE A 1 52  ? -7.158  0.970   -25.118 1.00 0.00 ? 52  ILE A H    2  
ATOM 3044  H HA   . ILE A 1 52  ? -7.156  -1.392  -23.576 1.00 0.00 ? 52  ILE A HA   2  
ATOM 3045  H HB   . ILE A 1 52  ? -9.004  -0.196  -25.657 1.00 0.00 ? 52  ILE A HB   2  
ATOM 3046  H HG12 . ILE A 1 52  ? -10.563 -0.572  -23.577 1.00 0.00 ? 52  ILE A HG12 2  
ATOM 3047  H HG13 . ILE A 1 52  ? -9.053  -0.778  -22.701 1.00 0.00 ? 52  ILE A HG13 2  
ATOM 3048  H HG21 . ILE A 1 52  ? -9.200  -2.992  -24.423 1.00 0.00 ? 52  ILE A HG21 2  
ATOM 3049  H HG22 . ILE A 1 52  ? -10.590 -2.161  -25.115 1.00 0.00 ? 52  ILE A HG22 2  
ATOM 3050  H HG23 . ILE A 1 52  ? -9.220  -2.584  -26.137 1.00 0.00 ? 52  ILE A HG23 2  
ATOM 3051  H HD11 . ILE A 1 52  ? -9.696  1.607   -24.460 1.00 0.00 ? 52  ILE A HD11 2  
ATOM 3052  H HD12 . ILE A 1 52  ? -9.868  1.592   -22.708 1.00 0.00 ? 52  ILE A HD12 2  
ATOM 3053  H HD13 . ILE A 1 52  ? -8.276  1.411   -23.435 1.00 0.00 ? 52  ILE A HD13 2  
ATOM 3054  N N    . ASN A 1 53  ? -6.658  -1.889  -26.766 1.00 0.00 ? 53  ASN A N    2  
ATOM 3055  C CA   . ASN A 1 53  ? -6.183  -2.916  -27.724 1.00 0.00 ? 53  ASN A CA   2  
ATOM 3056  C C    . ASN A 1 53  ? -4.711  -3.232  -27.491 1.00 0.00 ? 53  ASN A C    2  
ATOM 3057  O O    . ASN A 1 53  ? -4.188  -4.191  -28.023 1.00 0.00 ? 53  ASN A O    2  
ATOM 3058  C CB   . ASN A 1 53  ? -6.354  -2.364  -29.148 1.00 0.00 ? 53  ASN A CB   2  
ATOM 3059  C CG   . ASN A 1 53  ? -6.196  -3.504  -30.157 1.00 0.00 ? 53  ASN A CG   2  
ATOM 3060  O OD1  . ASN A 1 53  ? -6.844  -4.527  -30.061 1.00 0.00 ? 53  ASN A OD1  2  
ATOM 3061  N ND2  . ASN A 1 53  ? -5.346  -3.368  -31.138 1.00 0.00 ? 53  ASN A ND2  2  
ATOM 3062  H H    . ASN A 1 53  ? -6.810  -0.969  -27.062 1.00 0.00 ? 53  ASN A H    2  
ATOM 3063  H HA   . ASN A 1 53  ? -6.767  -3.825  -27.589 1.00 0.00 ? 53  ASN A HA   2  
ATOM 3064  H HB2  . ASN A 1 53  ? -7.337  -1.928  -29.255 1.00 0.00 ? 53  ASN A HB2  2  
ATOM 3065  H HB3  . ASN A 1 53  ? -5.607  -1.609  -29.341 1.00 0.00 ? 53  ASN A HB3  2  
ATOM 3066  H HD21 . ASN A 1 53  ? -4.821  -2.545  -31.222 1.00 0.00 ? 53  ASN A HD21 2  
ATOM 3067  H HD22 . ASN A 1 53  ? -5.235  -4.090  -31.792 1.00 0.00 ? 53  ASN A HD22 2  
ATOM 3068  N N    . GLU A 1 54  ? -4.069  -2.421  -26.697 1.00 0.00 ? 54  GLU A N    2  
ATOM 3069  C CA   . GLU A 1 54  ? -2.636  -2.660  -26.420 1.00 0.00 ? 54  GLU A CA   2  
ATOM 3070  C C    . GLU A 1 54  ? -2.460  -3.647  -25.269 1.00 0.00 ? 54  GLU A C    2  
ATOM 3071  O O    . GLU A 1 54  ? -1.581  -4.486  -25.300 1.00 0.00 ? 54  GLU A O    2  
ATOM 3072  C CB   . GLU A 1 54  ? -1.987  -1.326  -26.037 1.00 0.00 ? 54  GLU A CB   2  
ATOM 3073  C CG   . GLU A 1 54  ? -0.481  -1.414  -26.291 1.00 0.00 ? 54  GLU A CG   2  
ATOM 3074  C CD   . GLU A 1 54  ? -0.196  -1.115  -27.765 1.00 0.00 ? 54  GLU A CD   2  
ATOM 3075  O OE1  . GLU A 1 54  ? -0.808  -1.783  -28.582 1.00 0.00 ? 54  GLU A OE1  2  
ATOM 3076  O OE2  . GLU A 1 54  ? 0.618   -0.234  -27.992 1.00 0.00 ? 54  GLU A OE2  2  
ATOM 3077  H H    . GLU A 1 54  ? -4.530  -1.660  -26.290 1.00 0.00 ? 54  GLU A H    2  
ATOM 3078  H HA   . GLU A 1 54  ? -2.171  -3.073  -27.313 1.00 0.00 ? 54  GLU A HA   2  
ATOM 3079  H HB2  . GLU A 1 54  ? -2.410  -0.531  -26.635 1.00 0.00 ? 54  GLU A HB2  2  
ATOM 3080  H HB3  . GLU A 1 54  ? -2.168  -1.119  -24.993 1.00 0.00 ? 54  GLU A HB3  2  
ATOM 3081  H HG2  . GLU A 1 54  ? 0.037   -0.696  -25.675 1.00 0.00 ? 54  GLU A HG2  2  
ATOM 3082  H HG3  . GLU A 1 54  ? -0.129  -2.409  -26.055 1.00 0.00 ? 54  GLU A HG3  2  
ATOM 3083  N N    . VAL A 1 55  ? -3.298  -3.531  -24.269 1.00 0.00 ? 55  VAL A N    2  
ATOM 3084  C CA   . VAL A 1 55  ? -3.188  -4.447  -23.129 1.00 0.00 ? 55  VAL A CA   2  
ATOM 3085  C C    . VAL A 1 55  ? -4.027  -5.687  -23.379 1.00 0.00 ? 55  VAL A C    2  
ATOM 3086  O O    . VAL A 1 55  ? -3.874  -6.348  -24.386 1.00 0.00 ? 55  VAL A O    2  
ATOM 3087  C CB   . VAL A 1 55  ? -3.721  -3.722  -21.876 1.00 0.00 ? 55  VAL A CB   2  
ATOM 3088  C CG1  . VAL A 1 55  ? -2.801  -2.545  -21.537 1.00 0.00 ? 55  VAL A CG1  2  
ATOM 3089  C CG2  . VAL A 1 55  ? -5.125  -3.191  -22.165 1.00 0.00 ? 55  VAL A CG2  2  
ATOM 3090  H H    . VAL A 1 55  ? -3.997  -2.853  -24.280 1.00 0.00 ? 55  VAL A H    2  
ATOM 3091  H HA   . VAL A 1 55  ? -2.145  -4.737  -22.999 1.00 0.00 ? 55  VAL A HA   2  
ATOM 3092  H HB   . VAL A 1 55  ? -3.758  -4.405  -21.045 1.00 0.00 ? 55  VAL A HB   2  
ATOM 3093  H HG11 . VAL A 1 55  ? -1.786  -2.897  -21.419 1.00 0.00 ? 55  VAL A HG11 2  
ATOM 3094  H HG12 . VAL A 1 55  ? -2.835  -1.815  -22.331 1.00 0.00 ? 55  VAL A HG12 2  
ATOM 3095  H HG13 . VAL A 1 55  ? -3.125  -2.084  -20.616 1.00 0.00 ? 55  VAL A HG13 2  
ATOM 3096  H HG21 . VAL A 1 55  ? -5.292  -3.169  -23.231 1.00 0.00 ? 55  VAL A HG21 2  
ATOM 3097  H HG22 . VAL A 1 55  ? -5.860  -3.832  -21.703 1.00 0.00 ? 55  VAL A HG22 2  
ATOM 3098  H HG23 . VAL A 1 55  ? -5.224  -2.191  -21.768 1.00 0.00 ? 55  VAL A HG23 2  
ATOM 3099  N N    . ASP A 1 56  ? -4.917  -5.954  -22.469 1.00 0.00 ? 56  ASP A N    2  
ATOM 3100  C CA   . ASP A 1 56  ? -5.801  -7.152  -22.608 1.00 0.00 ? 56  ASP A CA   2  
ATOM 3101  C C    . ASP A 1 56  ? -5.059  -8.319  -23.241 1.00 0.00 ? 56  ASP A C    2  
ATOM 3102  O O    . ASP A 1 56  ? -5.653  -9.162  -23.885 1.00 0.00 ? 56  ASP A O    2  
ATOM 3103  C CB   . ASP A 1 56  ? -6.987  -6.779  -23.510 1.00 0.00 ? 56  ASP A CB   2  
ATOM 3104  C CG   . ASP A 1 56  ? -8.231  -7.546  -23.054 1.00 0.00 ? 56  ASP A CG   2  
ATOM 3105  O OD1  . ASP A 1 56  ? -8.036  -8.633  -22.536 1.00 0.00 ? 56  ASP A OD1  2  
ATOM 3106  O OD2  . ASP A 1 56  ? -9.304  -7.001  -23.251 1.00 0.00 ? 56  ASP A OD2  2  
ATOM 3107  H H    . ASP A 1 56  ? -5.014  -5.360  -21.702 1.00 0.00 ? 56  ASP A H    2  
ATOM 3108  H HA   . ASP A 1 56  ? -6.147  -7.449  -21.620 1.00 0.00 ? 56  ASP A HA   2  
ATOM 3109  H HB2  . ASP A 1 56  ? -7.179  -5.718  -23.446 1.00 0.00 ? 56  ASP A HB2  2  
ATOM 3110  H HB3  . ASP A 1 56  ? -6.762  -7.041  -24.535 1.00 0.00 ? 56  ASP A HB3  2  
ATOM 3111  N N    . ALA A 1 57  ? -3.776  -8.350  -23.044 1.00 0.00 ? 57  ALA A N    2  
ATOM 3112  C CA   . ALA A 1 57  ? -2.977  -9.453  -23.627 1.00 0.00 ? 57  ALA A CA   2  
ATOM 3113  C C    . ALA A 1 57  ? -3.039  -10.701 -22.757 1.00 0.00 ? 57  ALA A C    2  
ATOM 3114  O O    . ALA A 1 57  ? -2.906  -11.805 -23.247 1.00 0.00 ? 57  ALA A O    2  
ATOM 3115  C CB   . ALA A 1 57  ? -1.516  -8.992  -23.725 1.00 0.00 ? 57  ALA A CB   2  
ATOM 3116  H H    . ALA A 1 57  ? -3.342  -7.648  -22.517 1.00 0.00 ? 57  ALA A H    2  
ATOM 3117  H HA   . ALA A 1 57  ? -3.372  -9.690  -24.613 1.00 0.00 ? 57  ALA A HA   2  
ATOM 3118  H HB1  . ALA A 1 57  ? -1.472  -8.013  -24.178 1.00 0.00 ? 57  ALA A HB1  2  
ATOM 3119  H HB2  . ALA A 1 57  ? -1.081  -8.948  -22.738 1.00 0.00 ? 57  ALA A HB2  2  
ATOM 3120  H HB3  . ALA A 1 57  ? -0.955  -9.688  -24.330 1.00 0.00 ? 57  ALA A HB3  2  
ATOM 3121  N N    . ASP A 1 58  ? -3.241  -10.511 -21.482 1.00 0.00 ? 58  ASP A N    2  
ATOM 3122  C CA   . ASP A 1 58  ? -3.311  -11.683 -20.578 1.00 0.00 ? 58  ASP A CA   2  
ATOM 3123  C C    . ASP A 1 58  ? -4.489  -12.575 -20.944 1.00 0.00 ? 58  ASP A C    2  
ATOM 3124  O O    . ASP A 1 58  ? -4.312  -13.700 -21.366 1.00 0.00 ? 58  ASP A O    2  
ATOM 3125  C CB   . ASP A 1 58  ? -3.498  -11.180 -19.139 1.00 0.00 ? 58  ASP A CB   2  
ATOM 3126  C CG   . ASP A 1 58  ? -3.516  -12.375 -18.185 1.00 0.00 ? 58  ASP A CG   2  
ATOM 3127  O OD1  . ASP A 1 58  ? -2.497  -13.044 -18.135 1.00 0.00 ? 58  ASP A OD1  2  
ATOM 3128  O OD2  . ASP A 1 58  ? -4.549  -12.553 -17.559 1.00 0.00 ? 58  ASP A OD2  2  
ATOM 3129  H H    . ASP A 1 58  ? -3.351  -9.604  -21.127 1.00 0.00 ? 58  ASP A H    2  
ATOM 3130  H HA   . ASP A 1 58  ? -2.390  -12.258 -20.671 1.00 0.00 ? 58  ASP A HA   2  
ATOM 3131  H HB2  . ASP A 1 58  ? -2.683  -10.521 -18.873 1.00 0.00 ? 58  ASP A HB2  2  
ATOM 3132  H HB3  . ASP A 1 58  ? -4.431  -10.642 -19.058 1.00 0.00 ? 58  ASP A HB3  2  
ATOM 3133  N N    . GLY A 1 59  ? -5.674  -12.052 -20.778 1.00 0.00 ? 59  GLY A N    2  
ATOM 3134  C CA   . GLY A 1 59  ? -6.889  -12.855 -21.111 1.00 0.00 ? 59  GLY A CA   2  
ATOM 3135  C C    . GLY A 1 59  ? -7.995  -12.593 -20.086 1.00 0.00 ? 59  GLY A C    2  
ATOM 3136  O O    . GLY A 1 59  ? -9.136  -12.960 -20.291 1.00 0.00 ? 59  GLY A O    2  
ATOM 3137  H H    . GLY A 1 59  ? -5.764  -11.135 -20.441 1.00 0.00 ? 59  GLY A H    2  
ATOM 3138  H HA2  . GLY A 1 59  ? -7.240  -12.580 -22.094 1.00 0.00 ? 59  GLY A HA2  2  
ATOM 3139  H HA3  . GLY A 1 59  ? -6.638  -13.905 -21.102 1.00 0.00 ? 59  GLY A HA3  2  
ATOM 3140  N N    . ASN A 1 60  ? -7.632  -11.965 -19.003 1.00 0.00 ? 60  ASN A N    2  
ATOM 3141  C CA   . ASN A 1 60  ? -8.641  -11.669 -17.957 1.00 0.00 ? 60  ASN A CA   2  
ATOM 3142  C C    . ASN A 1 60  ? -9.688  -10.691 -18.473 1.00 0.00 ? 60  ASN A C    2  
ATOM 3143  O O    . ASN A 1 60  ? -10.858 -10.816 -18.172 1.00 0.00 ? 60  ASN A O    2  
ATOM 3144  C CB   . ASN A 1 60  ? -7.920  -11.032 -16.760 1.00 0.00 ? 60  ASN A CB   2  
ATOM 3145  C CG   . ASN A 1 60  ? -6.914  -12.031 -16.188 1.00 0.00 ? 60  ASN A CG   2  
ATOM 3146  O OD1  . ASN A 1 60  ? -5.962  -11.664 -15.529 1.00 0.00 ? 60  ASN A OD1  2  
ATOM 3147  N ND2  . ASN A 1 60  ? -7.089  -13.303 -16.417 1.00 0.00 ? 60  ASN A ND2  2  
ATOM 3148  H H    . ASN A 1 60  ? -6.699  -11.694 -18.878 1.00 0.00 ? 60  ASN A H    2  
ATOM 3149  H HA   . ASN A 1 60  ? -9.133  -12.596 -17.665 1.00 0.00 ? 60  ASN A HA   2  
ATOM 3150  H HB2  . ASN A 1 60  ? -7.397  -10.142 -17.079 1.00 0.00 ? 60  ASN A HB2  2  
ATOM 3151  H HB3  . ASN A 1 60  ? -8.637  -10.770 -15.997 1.00 0.00 ? 60  ASN A HB3  2  
ATOM 3152  H HD21 . ASN A 1 60  ? -7.855  -13.604 -16.948 1.00 0.00 ? 60  ASN A HD21 2  
ATOM 3153  H HD22 . ASN A 1 60  ? -6.453  -13.958 -16.058 1.00 0.00 ? 60  ASN A HD22 2  
ATOM 3154  N N    . GLY A 1 61  ? -9.244  -9.735  -19.243 1.00 0.00 ? 61  GLY A N    2  
ATOM 3155  C CA   . GLY A 1 61  ? -10.197 -8.731  -19.793 1.00 0.00 ? 61  GLY A CA   2  
ATOM 3156  C C    . GLY A 1 61  ? -10.154 -7.454  -18.955 1.00 0.00 ? 61  GLY A C    2  
ATOM 3157  O O    . GLY A 1 61  ? -10.461 -6.383  -19.438 1.00 0.00 ? 61  GLY A O    2  
ATOM 3158  H H    . GLY A 1 61  ? -8.289  -9.677  -19.454 1.00 0.00 ? 61  GLY A H    2  
ATOM 3159  H HA2  . GLY A 1 61  ? -9.922  -8.499  -20.812 1.00 0.00 ? 61  GLY A HA2  2  
ATOM 3160  H HA3  . GLY A 1 61  ? -11.197 -9.137  -19.778 1.00 0.00 ? 61  GLY A HA3  2  
ATOM 3161  N N    . THR A 1 62  ? -9.775  -7.600  -17.709 1.00 0.00 ? 62  THR A N    2  
ATOM 3162  C CA   . THR A 1 62  ? -9.700  -6.412  -16.814 1.00 0.00 ? 62  THR A CA   2  
ATOM 3163  C C    . THR A 1 62  ? -8.257  -5.955  -16.655 1.00 0.00 ? 62  THR A C    2  
ATOM 3164  O O    . THR A 1 62  ? -7.340  -6.727  -16.862 1.00 0.00 ? 62  THR A O    2  
ATOM 3165  C CB   . THR A 1 62  ? -10.245 -6.810  -15.438 1.00 0.00 ? 62  THR A CB   2  
ATOM 3166  O OG1  . THR A 1 62  ? -9.414  -7.865  -14.998 1.00 0.00 ? 62  THR A OG1  2  
ATOM 3167  C CG2  . THR A 1 62  ? -11.638 -7.440  -15.565 1.00 0.00 ? 62  THR A CG2  2  
ATOM 3168  H H    . THR A 1 62  ? -9.541  -8.488  -17.366 1.00 0.00 ? 62  THR A H    2  
ATOM 3169  H HA   . THR A 1 62  ? -10.286 -5.600  -17.242 1.00 0.00 ? 62  THR A HA   2  
ATOM 3170  H HB   . THR A 1 62  ? -10.220 -5.978  -14.738 1.00 0.00 ? 62  THR A HB   2  
ATOM 3171  H HG1  . THR A 1 62  ? -8.930  -7.560  -14.226 1.00 0.00 ? 62  THR A HG1  2  
ATOM 3172  H HG21 . THR A 1 62  ? -12.126 -7.069  -16.454 1.00 0.00 ? 62  THR A HG21 2  
ATOM 3173  H HG22 . THR A 1 62  ? -11.547 -8.513  -15.634 1.00 0.00 ? 62  THR A HG22 2  
ATOM 3174  H HG23 . THR A 1 62  ? -12.233 -7.188  -14.700 1.00 0.00 ? 62  THR A HG23 2  
ATOM 3175  N N    . ILE A 1 63  ? -8.081  -4.707  -16.288 1.00 0.00 ? 63  ILE A N    2  
ATOM 3176  C CA   . ILE A 1 63  ? -6.701  -4.186  -16.112 1.00 0.00 ? 63  ILE A CA   2  
ATOM 3177  C C    . ILE A 1 63  ? -6.348  -4.077  -14.641 1.00 0.00 ? 63  ILE A C    2  
ATOM 3178  O O    . ILE A 1 63  ? -7.169  -3.697  -13.831 1.00 0.00 ? 63  ILE A O    2  
ATOM 3179  C CB   . ILE A 1 63  ? -6.610  -2.785  -16.709 1.00 0.00 ? 63  ILE A CB   2  
ATOM 3180  C CG1  . ILE A 1 63  ? -7.141  -2.763  -18.133 1.00 0.00 ? 63  ILE A CG1  2  
ATOM 3181  C CG2  . ILE A 1 63  ? -5.134  -2.387  -16.741 1.00 0.00 ? 63  ILE A CG2  2  
ATOM 3182  C CD1  . ILE A 1 63  ? -6.634  -1.488  -18.825 1.00 0.00 ? 63  ILE A CD1  2  
ATOM 3183  H H    . ILE A 1 63  ? -8.851  -4.125  -16.125 1.00 0.00 ? 63  ILE A H    2  
ATOM 3184  H HA   . ILE A 1 63  ? -5.996  -4.856  -16.595 1.00 0.00 ? 63  ILE A HA   2  
ATOM 3185  H HB   . ILE A 1 63  ? -7.185  -2.093  -16.097 1.00 0.00 ? 63  ILE A HB   2  
ATOM 3186  H HG12 . ILE A 1 63  ? -6.791  -3.633  -18.668 1.00 0.00 ? 63  ILE A HG12 2  
ATOM 3187  H HG13 . ILE A 1 63  ? -8.221  -2.764  -18.120 1.00 0.00 ? 63  ILE A HG13 2  
ATOM 3188  H HG21 . ILE A 1 63  ? -4.646  -2.739  -15.846 1.00 0.00 ? 63  ILE A HG21 2  
ATOM 3189  H HG22 . ILE A 1 63  ? -4.657  -2.830  -17.602 1.00 0.00 ? 63  ILE A HG22 2  
ATOM 3190  H HG23 . ILE A 1 63  ? -5.047  -1.315  -16.797 1.00 0.00 ? 63  ILE A HG23 2  
ATOM 3191  H HD11 . ILE A 1 63  ? -6.661  -0.660  -18.128 1.00 0.00 ? 63  ILE A HD11 2  
ATOM 3192  H HD12 . ILE A 1 63  ? -5.617  -1.633  -19.161 1.00 0.00 ? 63  ILE A HD12 2  
ATOM 3193  H HD13 . ILE A 1 63  ? -7.258  -1.257  -19.672 1.00 0.00 ? 63  ILE A HD13 2  
ATOM 3194  N N    . ASP A 1 64  ? -5.125  -4.407  -14.324 1.00 0.00 ? 64  ASP A N    2  
ATOM 3195  C CA   . ASP A 1 64  ? -4.685  -4.331  -12.910 1.00 0.00 ? 64  ASP A CA   2  
ATOM 3196  C C    . ASP A 1 64  ? -3.891  -3.043  -12.681 1.00 0.00 ? 64  ASP A C    2  
ATOM 3197  O O    . ASP A 1 64  ? -3.559  -2.349  -13.624 1.00 0.00 ? 64  ASP A O    2  
ATOM 3198  C CB   . ASP A 1 64  ? -3.811  -5.561  -12.609 1.00 0.00 ? 64  ASP A CB   2  
ATOM 3199  C CG   . ASP A 1 64  ? -2.546  -5.526  -13.466 1.00 0.00 ? 64  ASP A CG   2  
ATOM 3200  O OD1  . ASP A 1 64  ? -2.128  -4.427  -13.768 1.00 0.00 ? 64  ASP A OD1  2  
ATOM 3201  O OD2  . ASP A 1 64  ? -2.070  -6.607  -13.771 1.00 0.00 ? 64  ASP A OD2  2  
ATOM 3202  H H    . ASP A 1 64  ? -4.498  -4.703  -15.019 1.00 0.00 ? 64  ASP A H    2  
ATOM 3203  H HA   . ASP A 1 64  ? -5.566  -4.316  -12.265 1.00 0.00 ? 64  ASP A HA   2  
ATOM 3204  H HB2  . ASP A 1 64  ? -3.540  -5.571  -11.569 1.00 0.00 ? 64  ASP A HB2  2  
ATOM 3205  H HB3  . ASP A 1 64  ? -4.364  -6.459  -12.836 1.00 0.00 ? 64  ASP A HB3  2  
ATOM 3206  N N    . PHE A 1 65  ? -3.596  -2.737  -11.444 1.00 0.00 ? 65  PHE A N    2  
ATOM 3207  C CA   . PHE A 1 65  ? -2.830  -1.492  -11.177 1.00 0.00 ? 65  PHE A CA   2  
ATOM 3208  C C    . PHE A 1 65  ? -1.447  -1.456  -11.873 1.00 0.00 ? 65  PHE A C    2  
ATOM 3209  O O    . PHE A 1 65  ? -1.117  -0.476  -12.482 1.00 0.00 ? 65  PHE A O    2  
ATOM 3210  C CB   . PHE A 1 65  ? -2.651  -1.299  -9.658  1.00 0.00 ? 65  PHE A CB   2  
ATOM 3211  C CG   . PHE A 1 65  ? -1.994  0.062   -9.408  1.00 0.00 ? 65  PHE A CG   2  
ATOM 3212  C CD1  . PHE A 1 65  ? -2.605  1.227   -9.845  1.00 0.00 ? 65  PHE A CD1  2  
ATOM 3213  C CD2  . PHE A 1 65  ? -0.776  0.149   -8.755  1.00 0.00 ? 65  PHE A CD2  2  
ATOM 3214  C CE1  . PHE A 1 65  ? -2.009  2.453   -9.631  1.00 0.00 ? 65  PHE A CE1  2  
ATOM 3215  C CE2  . PHE A 1 65  ? -0.182  1.378   -8.543  1.00 0.00 ? 65  PHE A CE2  2  
ATOM 3216  C CZ   . PHE A 1 65  ? -0.801  2.528   -8.982  1.00 0.00 ? 65  PHE A CZ   2  
ATOM 3217  H H    . PHE A 1 65  ? -3.880  -3.314  -10.710 1.00 0.00 ? 65  PHE A H    2  
ATOM 3218  H HA   . PHE A 1 65  ? -3.414  -0.664  -11.581 1.00 0.00 ? 65  PHE A HA   2  
ATOM 3219  H HB2  . PHE A 1 65  ? -3.614  -1.322  -9.172  1.00 0.00 ? 65  PHE A HB2  2  
ATOM 3220  H HB3  . PHE A 1 65  ? -2.034  -2.067  -9.251  1.00 0.00 ? 65  PHE A HB3  2  
ATOM 3221  H HD1  . PHE A 1 65  ? -3.557  1.175   -10.353 1.00 0.00 ? 65  PHE A HD1  2  
ATOM 3222  H HD2  . PHE A 1 65  ? -0.288  -0.750  -8.408  1.00 0.00 ? 65  PHE A HD2  2  
ATOM 3223  H HE1  . PHE A 1 65  ? -2.493  3.355   -9.975  1.00 0.00 ? 65  PHE A HE1  2  
ATOM 3224  H HE2  . PHE A 1 65  ? 0.767   1.438   -8.031  1.00 0.00 ? 65  PHE A HE2  2  
ATOM 3225  H HZ   . PHE A 1 65  ? -0.335  3.490   -8.818  1.00 0.00 ? 65  PHE A HZ   2  
ATOM 3226  N N    . PRO A 1 66  ? -0.656  -2.521  -11.795 1.00 0.00 ? 66  PRO A N    2  
ATOM 3227  C CA   . PRO A 1 66  ? 0.650   -2.501  -12.444 1.00 0.00 ? 66  PRO A CA   2  
ATOM 3228  C C    . PRO A 1 66  ? 0.523   -2.097  -13.908 1.00 0.00 ? 66  PRO A C    2  
ATOM 3229  O O    . PRO A 1 66  ? 1.127   -1.138  -14.347 1.00 0.00 ? 66  PRO A O    2  
ATOM 3230  C CB   . PRO A 1 66  ? 1.179   -3.944  -12.331 1.00 0.00 ? 66  PRO A CB   2  
ATOM 3231  C CG   . PRO A 1 66  ? 0.132   -4.756  -11.510 1.00 0.00 ? 66  PRO A CG   2  
ATOM 3232  C CD   . PRO A 1 66  ? -1.007  -3.789  -11.136 1.00 0.00 ? 66  PRO A CD   2  
ATOM 3233  H HA   . PRO A 1 66  ? 1.300   -1.800  -11.927 1.00 0.00 ? 66  PRO A HA   2  
ATOM 3234  H HB2  . PRO A 1 66  ? 1.291   -4.375  -13.314 1.00 0.00 ? 66  PRO A HB2  2  
ATOM 3235  H HB3  . PRO A 1 66  ? 2.131   -3.950  -11.823 1.00 0.00 ? 66  PRO A HB3  2  
ATOM 3236  H HG2  . PRO A 1 66  ? -0.256  -5.568  -12.106 1.00 0.00 ? 66  PRO A HG2  2  
ATOM 3237  H HG3  . PRO A 1 66  ? 0.591   -5.152  -10.614 1.00 0.00 ? 66  PRO A HG3  2  
ATOM 3238  H HD2  . PRO A 1 66  ? -1.938  -4.155  -11.506 1.00 0.00 ? 66  PRO A HD2  2  
ATOM 3239  H HD3  . PRO A 1 66  ? -1.046  -3.666  -10.073 1.00 0.00 ? 66  PRO A HD3  2  
ATOM 3240  N N    . GLU A 1 67  ? -0.261  -2.833  -14.637 1.00 0.00 ? 67  GLU A N    2  
ATOM 3241  C CA   . GLU A 1 67  ? -0.439  -2.503  -16.069 1.00 0.00 ? 67  GLU A CA   2  
ATOM 3242  C C    . GLU A 1 67  ? -0.833  -1.042  -16.227 1.00 0.00 ? 67  GLU A C    2  
ATOM 3243  O O    . GLU A 1 67  ? -0.276  -0.330  -17.041 1.00 0.00 ? 67  GLU A O    2  
ATOM 3244  C CB   . GLU A 1 67  ? -1.558  -3.389  -16.638 1.00 0.00 ? 67  GLU A CB   2  
ATOM 3245  C CG   . GLU A 1 67  ? -1.062  -4.834  -16.710 1.00 0.00 ? 67  GLU A CG   2  
ATOM 3246  C CD   . GLU A 1 67  ? -2.243  -5.763  -17.003 1.00 0.00 ? 67  GLU A CD   2  
ATOM 3247  O OE1  . GLU A 1 67  ? -3.355  -5.283  -16.862 1.00 0.00 ? 67  GLU A OE1  2  
ATOM 3248  O OE2  . GLU A 1 67  ? -1.965  -6.898  -17.352 1.00 0.00 ? 67  GLU A OE2  2  
ATOM 3249  H H    . GLU A 1 67  ? -0.720  -3.596  -14.246 1.00 0.00 ? 67  GLU A H    2  
ATOM 3250  H HA   . GLU A 1 67  ? 0.501   -2.677  -16.595 1.00 0.00 ? 67  GLU A HA   2  
ATOM 3251  H HB2  . GLU A 1 67  ? -2.425  -3.334  -15.996 1.00 0.00 ? 67  GLU A HB2  2  
ATOM 3252  H HB3  . GLU A 1 67  ? -1.827  -3.047  -17.626 1.00 0.00 ? 67  GLU A HB3  2  
ATOM 3253  H HG2  . GLU A 1 67  ? -0.329  -4.931  -17.497 1.00 0.00 ? 67  GLU A HG2  2  
ATOM 3254  H HG3  . GLU A 1 67  ? -0.614  -5.115  -15.769 1.00 0.00 ? 67  GLU A HG3  2  
ATOM 3255  N N    . PHE A 1 68  ? -1.790  -0.614  -15.441 1.00 0.00 ? 68  PHE A N    2  
ATOM 3256  C CA   . PHE A 1 68  ? -2.224  0.798   -15.537 1.00 0.00 ? 68  PHE A CA   2  
ATOM 3257  C C    . PHE A 1 68  ? -0.998  1.711   -15.573 1.00 0.00 ? 68  PHE A C    2  
ATOM 3258  O O    . PHE A 1 68  ? -1.027  2.768   -16.169 1.00 0.00 ? 68  PHE A O    2  
ATOM 3259  C CB   . PHE A 1 68  ? -3.086  1.130   -14.302 1.00 0.00 ? 68  PHE A CB   2  
ATOM 3260  C CG   . PHE A 1 68  ? -3.651  2.544   -14.409 1.00 0.00 ? 68  PHE A CG   2  
ATOM 3261  C CD1  . PHE A 1 68  ? -2.901  3.628   -13.992 1.00 0.00 ? 68  PHE A CD1  2  
ATOM 3262  C CD2  . PHE A 1 68  ? -4.938  2.752   -14.872 1.00 0.00 ? 68  PHE A CD2  2  
ATOM 3263  C CE1  . PHE A 1 68  ? -3.431  4.902   -14.034 1.00 0.00 ? 68  PHE A CE1  2  
ATOM 3264  C CE2  . PHE A 1 68  ? -5.465  4.027   -14.914 1.00 0.00 ? 68  PHE A CE2  2  
ATOM 3265  C CZ   . PHE A 1 68  ? -4.712  5.100   -14.495 1.00 0.00 ? 68  PHE A CZ   2  
ATOM 3266  H H    . PHE A 1 68  ? -2.213  -1.220  -14.799 1.00 0.00 ? 68  PHE A H    2  
ATOM 3267  H HA   . PHE A 1 68  ? -2.796  0.925   -16.464 1.00 0.00 ? 68  PHE A HA   2  
ATOM 3268  H HB2  . PHE A 1 68  ? -3.903  0.427   -14.230 1.00 0.00 ? 68  PHE A HB2  2  
ATOM 3269  H HB3  . PHE A 1 68  ? -2.490  1.067   -13.417 1.00 0.00 ? 68  PHE A HB3  2  
ATOM 3270  H HD1  . PHE A 1 68  ? -1.896  3.477   -13.625 1.00 0.00 ? 68  PHE A HD1  2  
ATOM 3271  H HD2  . PHE A 1 68  ? -5.531  1.913   -15.207 1.00 0.00 ? 68  PHE A HD2  2  
ATOM 3272  H HE1  . PHE A 1 68  ? -2.841  5.743   -13.702 1.00 0.00 ? 68  PHE A HE1  2  
ATOM 3273  H HE2  . PHE A 1 68  ? -6.472  4.182   -15.273 1.00 0.00 ? 68  PHE A HE2  2  
ATOM 3274  H HZ   . PHE A 1 68  ? -5.131  6.098   -14.518 1.00 0.00 ? 68  PHE A HZ   2  
ATOM 3275  N N    . LEU A 1 69  ? 0.066   1.287   -14.916 1.00 0.00 ? 69  LEU A N    2  
ATOM 3276  C CA   . LEU A 1 69  ? 1.299   2.128   -14.916 1.00 0.00 ? 69  LEU A CA   2  
ATOM 3277  C C    . LEU A 1 69  ? 1.993   2.012   -16.263 1.00 0.00 ? 69  LEU A C    2  
ATOM 3278  O O    . LEU A 1 69  ? 2.471   2.985   -16.812 1.00 0.00 ? 69  LEU A O    2  
ATOM 3279  C CB   . LEU A 1 69  ? 2.288   1.614   -13.839 1.00 0.00 ? 69  LEU A CB   2  
ATOM 3280  C CG   . LEU A 1 69  ? 1.573   1.438   -12.504 1.00 0.00 ? 69  LEU A CG   2  
ATOM 3281  C CD1  . LEU A 1 69  ? 2.589   1.021   -11.437 1.00 0.00 ? 69  LEU A CD1  2  
ATOM 3282  C CD2  . LEU A 1 69  ? 0.931   2.756   -12.092 1.00 0.00 ? 69  LEU A CD2  2  
ATOM 3283  H H    . LEU A 1 69  ? 0.041   0.436   -14.421 1.00 0.00 ? 69  LEU A H    2  
ATOM 3284  H HA   . LEU A 1 69  ? 1.027   3.167   -14.739 1.00 0.00 ? 69  LEU A HA   2  
ATOM 3285  H HB2  . LEU A 1 69  ? 2.700   0.667   -14.152 1.00 0.00 ? 69  LEU A HB2  2  
ATOM 3286  H HB3  . LEU A 1 69  ? 3.093   2.324   -13.723 1.00 0.00 ? 69  LEU A HB3  2  
ATOM 3287  H HG   . LEU A 1 69  ? 0.826   0.686   -12.598 1.00 0.00 ? 69  LEU A HG   2  
ATOM 3288  H HD11 . LEU A 1 69  ? 3.059   0.092   -11.724 1.00 0.00 ? 69  LEU A HD11 2  
ATOM 3289  H HD12 . LEU A 1 69  ? 3.345   1.785   -11.336 1.00 0.00 ? 69  LEU A HD12 2  
ATOM 3290  H HD13 . LEU A 1 69  ? 2.089   0.889   -10.489 1.00 0.00 ? 69  LEU A HD13 2  
ATOM 3291  H HD21 . LEU A 1 69  ? 1.599   3.572   -12.321 1.00 0.00 ? 69  LEU A HD21 2  
ATOM 3292  H HD22 . LEU A 1 69  ? 0.004   2.893   -12.628 1.00 0.00 ? 69  LEU A HD22 2  
ATOM 3293  H HD23 . LEU A 1 69  ? 0.731   2.747   -11.030 1.00 0.00 ? 69  LEU A HD23 2  
ATOM 3294  N N    . THR A 1 70  ? 2.032   0.808   -16.771 1.00 0.00 ? 70  THR A N    2  
ATOM 3295  C CA   . THR A 1 70  ? 2.688   0.579   -18.080 1.00 0.00 ? 70  THR A CA   2  
ATOM 3296  C C    . THR A 1 70  ? 1.988   1.341   -19.199 1.00 0.00 ? 70  THR A C    2  
ATOM 3297  O O    . THR A 1 70  ? 2.634   1.937   -20.041 1.00 0.00 ? 70  THR A O    2  
ATOM 3298  C CB   . THR A 1 70  ? 2.624   -0.921  -18.389 1.00 0.00 ? 70  THR A CB   2  
ATOM 3299  O OG1  . THR A 1 70  ? 3.580   -1.518  -17.537 1.00 0.00 ? 70  THR A OG1  2  
ATOM 3300  C CG2  . THR A 1 70  ? 3.135   -1.210  -19.808 1.00 0.00 ? 70  THR A CG2  2  
ATOM 3301  H H    . THR A 1 70  ? 1.629   0.056   -16.284 1.00 0.00 ? 70  THR A H    2  
ATOM 3302  H HA   . THR A 1 70  ? 3.716   0.911   -18.019 1.00 0.00 ? 70  THR A HA   2  
ATOM 3303  H HB   . THR A 1 70  ? 1.635   -1.327  -18.205 1.00 0.00 ? 70  THR A HB   2  
ATOM 3304  H HG1  . THR A 1 70  ? 3.143   -2.215  -17.044 1.00 0.00 ? 70  THR A HG1  2  
ATOM 3305  H HG21 . THR A 1 70  ? 4.036   -0.645  -19.994 1.00 0.00 ? 70  THR A HG21 2  
ATOM 3306  H HG22 . THR A 1 70  ? 3.350   -2.264  -19.909 1.00 0.00 ? 70  THR A HG22 2  
ATOM 3307  H HG23 . THR A 1 70  ? 2.382   -0.930  -20.530 1.00 0.00 ? 70  THR A HG23 2  
ATOM 3308  N N    . MET A 1 71  ? 0.685   1.319   -19.194 1.00 0.00 ? 71  MET A N    2  
ATOM 3309  C CA   . MET A 1 71  ? -0.044  2.044   -20.261 1.00 0.00 ? 71  MET A CA   2  
ATOM 3310  C C    . MET A 1 71  ? 0.032   3.543   -20.039 1.00 0.00 ? 71  MET A C    2  
ATOM 3311  O O    . MET A 1 71  ? 0.013   4.314   -20.977 1.00 0.00 ? 71  MET A O    2  
ATOM 3312  C CB   . MET A 1 71  ? -1.510  1.597   -20.237 1.00 0.00 ? 71  MET A CB   2  
ATOM 3313  C CG   . MET A 1 71  ? -2.143  2.014   -18.917 1.00 0.00 ? 71  MET A CG   2  
ATOM 3314  S SD   . MET A 1 71  ? -3.874  1.553   -18.646 1.00 0.00 ? 71  MET A SD   2  
ATOM 3315  C CE   . MET A 1 71  ? -4.317  1.303   -20.383 1.00 0.00 ? 71  MET A CE   2  
ATOM 3316  H H    . MET A 1 71  ? 0.194   0.836   -18.492 1.00 0.00 ? 71  MET A H    2  
ATOM 3317  H HA   . MET A 1 71  ? 0.416   1.810   -21.220 1.00 0.00 ? 71  MET A HA   2  
ATOM 3318  H HB2  . MET A 1 71  ? -2.043  2.052   -21.056 1.00 0.00 ? 71  MET A HB2  2  
ATOM 3319  H HB3  . MET A 1 71  ? -1.556  0.522   -20.335 1.00 0.00 ? 71  MET A HB3  2  
ATOM 3320  H HG2  . MET A 1 71  ? -1.561  1.585   -18.121 1.00 0.00 ? 71  MET A HG2  2  
ATOM 3321  H HG3  . MET A 1 71  ? -2.074  3.088   -18.832 1.00 0.00 ? 71  MET A HG3  2  
ATOM 3322  H HE1  . MET A 1 71  ? -3.661  0.569   -20.821 1.00 0.00 ? 71  MET A HE1  2  
ATOM 3323  H HE2  . MET A 1 71  ? -5.333  0.954   -20.447 1.00 0.00 ? 71  MET A HE2  2  
ATOM 3324  H HE3  . MET A 1 71  ? -4.222  2.236   -20.917 1.00 0.00 ? 71  MET A HE3  2  
ATOM 3325  N N    . MET A 1 72  ? 0.118   3.935   -18.801 1.00 0.00 ? 72  MET A N    2  
ATOM 3326  C CA   . MET A 1 72  ? 0.201   5.380   -18.509 1.00 0.00 ? 72  MET A CA   2  
ATOM 3327  C C    . MET A 1 72  ? 1.602   5.881   -18.809 1.00 0.00 ? 72  MET A C    2  
ATOM 3328  O O    . MET A 1 72  ? 1.793   7.012   -19.208 1.00 0.00 ? 72  MET A O    2  
ATOM 3329  C CB   . MET A 1 72  ? -0.089  5.598   -17.019 1.00 0.00 ? 72  MET A CB   2  
ATOM 3330  C CG   . MET A 1 72  ? -1.596  5.756   -16.813 1.00 0.00 ? 72  MET A CG   2  
ATOM 3331  S SD   . MET A 1 72  ? -2.447  7.000   -17.811 1.00 0.00 ? 72  MET A SD   2  
ATOM 3332  C CE   . MET A 1 72  ? -1.942  8.447   -16.849 1.00 0.00 ? 72  MET A CE   2  
ATOM 3333  H H    . MET A 1 72  ? 0.128   3.281   -18.073 1.00 0.00 ? 72  MET A H    2  
ATOM 3334  H HA   . MET A 1 72  ? -0.514  5.916   -19.134 1.00 0.00 ? 72  MET A HA   2  
ATOM 3335  H HB2  . MET A 1 72  ? 0.269   4.753   -16.452 1.00 0.00 ? 72  MET A HB2  2  
ATOM 3336  H HB3  . MET A 1 72  ? 0.417   6.491   -16.682 1.00 0.00 ? 72  MET A HB3  2  
ATOM 3337  H HG2  . MET A 1 72  ? -2.063  4.803   -17.010 1.00 0.00 ? 72  MET A HG2  2  
ATOM 3338  H HG3  . MET A 1 72  ? -1.769  5.994   -15.774 1.00 0.00 ? 72  MET A HG3  2  
ATOM 3339  H HE1  . MET A 1 72  ? -1.898  8.186   -15.802 1.00 0.00 ? 72  MET A HE1  2  
ATOM 3340  H HE2  . MET A 1 72  ? -0.968  8.776   -17.181 1.00 0.00 ? 72  MET A HE2  2  
ATOM 3341  H HE3  . MET A 1 72  ? -2.657  9.242   -16.993 1.00 0.00 ? 72  MET A HE3  2  
ATOM 3342  N N    . ALA A 1 73  ? 2.562   5.016   -18.611 1.00 0.00 ? 73  ALA A N    2  
ATOM 3343  C CA   . ALA A 1 73  ? 3.963   5.408   -18.875 1.00 0.00 ? 73  ALA A CA   2  
ATOM 3344  C C    . ALA A 1 73  ? 4.164   5.711   -20.352 1.00 0.00 ? 73  ALA A C    2  
ATOM 3345  O O    . ALA A 1 73  ? 4.751   6.715   -20.706 1.00 0.00 ? 73  ALA A O    2  
ATOM 3346  C CB   . ALA A 1 73  ? 4.877   4.237   -18.478 1.00 0.00 ? 73  ALA A CB   2  
ATOM 3347  H H    . ALA A 1 73  ? 2.356   4.114   -18.290 1.00 0.00 ? 73  ALA A H    2  
ATOM 3348  H HA   . ALA A 1 73  ? 4.199   6.298   -18.294 1.00 0.00 ? 73  ALA A HA   2  
ATOM 3349  H HB1  . ALA A 1 73  ? 4.600   3.353   -19.032 1.00 0.00 ? 73  ALA A HB1  2  
ATOM 3350  H HB2  . ALA A 1 73  ? 5.905   4.487   -18.695 1.00 0.00 ? 73  ALA A HB2  2  
ATOM 3351  H HB3  . ALA A 1 73  ? 4.775   4.039   -17.421 1.00 0.00 ? 73  ALA A HB3  2  
ATOM 3352  N N    . ARG A 1 74  ? 3.673   4.838   -21.196 1.00 0.00 ? 74  ARG A N    2  
ATOM 3353  C CA   . ARG A 1 74  ? 3.836   5.077   -22.650 1.00 0.00 ? 74  ARG A CA   2  
ATOM 3354  C C    . ARG A 1 74  ? 3.321   6.458   -23.015 1.00 0.00 ? 74  ARG A C    2  
ATOM 3355  O O    . ARG A 1 74  ? 3.907   7.151   -23.823 1.00 0.00 ? 74  ARG A O    2  
ATOM 3356  C CB   . ARG A 1 74  ? 3.022   4.020   -23.414 1.00 0.00 ? 74  ARG A CB   2  
ATOM 3357  C CG   . ARG A 1 74  ? 3.863   2.751   -23.566 1.00 0.00 ? 74  ARG A CG   2  
ATOM 3358  C CD   . ARG A 1 74  ? 2.965   1.529   -23.369 1.00 0.00 ? 74  ARG A CD   2  
ATOM 3359  N NE   . ARG A 1 74  ? 3.589   0.354   -24.042 1.00 0.00 ? 74  ARG A NE   2  
ATOM 3360  C CZ   . ARG A 1 74  ? 2.833   -0.635  -24.438 1.00 0.00 ? 74  ARG A CZ   2  
ATOM 3361  N NH1  . ARG A 1 74  ? 2.301   -0.585  -25.627 1.00 0.00 ? 74  ARG A NH1  2  
ATOM 3362  N NH2  . ARG A 1 74  ? 2.634   -1.639  -23.628 1.00 0.00 ? 74  ARG A NH2  2  
ATOM 3363  H H    . ARG A 1 74  ? 3.201   4.037   -20.871 1.00 0.00 ? 74  ARG A H    2  
ATOM 3364  H HA   . ARG A 1 74  ? 4.892   5.016   -22.904 1.00 0.00 ? 74  ARG A HA   2  
ATOM 3365  H HB2  . ARG A 1 74  ? 2.118   3.794   -22.868 1.00 0.00 ? 74  ARG A HB2  2  
ATOM 3366  H HB3  . ARG A 1 74  ? 2.759   4.400   -24.390 1.00 0.00 ? 74  ARG A HB3  2  
ATOM 3367  H HG2  . ARG A 1 74  ? 4.306   2.724   -24.552 1.00 0.00 ? 74  ARG A HG2  2  
ATOM 3368  H HG3  . ARG A 1 74  ? 4.650   2.747   -22.826 1.00 0.00 ? 74  ARG A HG3  2  
ATOM 3369  H HD2  . ARG A 1 74  ? 2.853   1.320   -22.316 1.00 0.00 ? 74  ARG A HD2  2  
ATOM 3370  H HD3  . ARG A 1 74  ? 1.994   1.715   -23.803 1.00 0.00 ? 74  ARG A HD3  2  
ATOM 3371  H HE   . ARG A 1 74  ? 4.558   0.326   -24.189 1.00 0.00 ? 74  ARG A HE   2  
ATOM 3372  H HH11 . ARG A 1 74  ? 2.474   0.202   -26.219 1.00 0.00 ? 74  ARG A HH11 2  
ATOM 3373  H HH12 . ARG A 1 74  ? 1.721   -1.333  -25.948 1.00 0.00 ? 74  ARG A HH12 2  
ATOM 3374  H HH21 . ARG A 1 74  ? 3.056   -1.643  -22.722 1.00 0.00 ? 74  ARG A HH21 2  
ATOM 3375  H HH22 . ARG A 1 74  ? 2.060   -2.406  -23.915 1.00 0.00 ? 74  ARG A HH22 2  
ATOM 3376  N N    . LYS A 1 75  ? 2.229   6.836   -22.412 1.00 0.00 ? 75  LYS A N    2  
ATOM 3377  C CA   . LYS A 1 75  ? 1.660   8.170   -22.709 1.00 0.00 ? 75  LYS A CA   2  
ATOM 3378  C C    . LYS A 1 75  ? 2.510   9.251   -22.062 1.00 0.00 ? 75  LYS A C    2  
ATOM 3379  O O    . LYS A 1 75  ? 2.653   10.336  -22.591 1.00 0.00 ? 75  LYS A O    2  
ATOM 3380  C CB   . LYS A 1 75  ? 0.239   8.236   -22.125 1.00 0.00 ? 75  LYS A CB   2  
ATOM 3381  C CG   . LYS A 1 75  ? -0.630  9.132   -23.011 1.00 0.00 ? 75  LYS A CG   2  
ATOM 3382  C CD   . LYS A 1 75  ? -0.984  8.378   -24.293 1.00 0.00 ? 75  LYS A CD   2  
ATOM 3383  C CE   . LYS A 1 75  ? -0.788  9.308   -25.493 1.00 0.00 ? 75  LYS A CE   2  
ATOM 3384  N NZ   . LYS A 1 75  ? 0.642   9.325   -25.909 1.00 0.00 ? 75  LYS A NZ   2  
ATOM 3385  H H    . LYS A 1 75  ? 1.791   6.244   -21.768 1.00 0.00 ? 75  LYS A H    2  
ATOM 3386  H HA   . LYS A 1 75  ? 1.648   8.321   -23.788 1.00 0.00 ? 75  LYS A HA   2  
ATOM 3387  H HB2  . LYS A 1 75  ? -0.184  7.243   -22.090 1.00 0.00 ? 75  LYS A HB2  2  
ATOM 3388  H HB3  . LYS A 1 75  ? 0.276   8.641   -21.124 1.00 0.00 ? 75  LYS A HB3  2  
ATOM 3389  H HG2  . LYS A 1 75  ? -1.535  9.396   -22.485 1.00 0.00 ? 75  LYS A HG2  2  
ATOM 3390  H HG3  . LYS A 1 75  ? -0.087  10.034  -23.258 1.00 0.00 ? 75  LYS A HG3  2  
ATOM 3391  H HD2  . LYS A 1 75  ? -0.345  7.515   -24.395 1.00 0.00 ? 75  LYS A HD2  2  
ATOM 3392  H HD3  . LYS A 1 75  ? -2.013  8.055   -24.251 1.00 0.00 ? 75  LYS A HD3  2  
ATOM 3393  H HE2  . LYS A 1 75  ? -1.392  8.963   -26.320 1.00 0.00 ? 75  LYS A HE2  2  
ATOM 3394  H HE3  . LYS A 1 75  ? -1.091  10.310  -25.229 1.00 0.00 ? 75  LYS A HE3  2  
ATOM 3395  H HZ1  . LYS A 1 75  ? 1.103   8.445   -25.602 1.00 0.00 ? 75  LYS A HZ1  2  
ATOM 3396  H HZ2  . LYS A 1 75  ? 0.700   9.403   -26.944 1.00 0.00 ? 75  LYS A HZ2  2  
ATOM 3397  H HZ3  . LYS A 1 75  ? 1.120   10.137  -25.473 1.00 0.00 ? 75  LYS A HZ3  2  
ATOM 3398  N N    . MET A 1 76  ? 3.062   8.931   -20.922 1.00 0.00 ? 76  MET A N    2  
ATOM 3399  C CA   . MET A 1 76  ? 3.907   9.917   -20.217 1.00 0.00 ? 76  MET A CA   2  
ATOM 3400  C C    . MET A 1 76  ? 5.374   9.720   -20.576 1.00 0.00 ? 76  MET A C    2  
ATOM 3401  O O    . MET A 1 76  ? 6.249   10.266  -19.931 1.00 0.00 ? 76  MET A O    2  
ATOM 3402  C CB   . MET A 1 76  ? 3.742   9.707   -18.699 1.00 0.00 ? 76  MET A CB   2  
ATOM 3403  C CG   . MET A 1 76  ? 3.999   11.034  -17.979 1.00 0.00 ? 76  MET A CG   2  
ATOM 3404  S SD   . MET A 1 76  ? 3.506   11.146  -16.241 1.00 0.00 ? 76  MET A SD   2  
ATOM 3405  C CE   . MET A 1 76  ? 4.132   9.529   -15.723 1.00 0.00 ? 76  MET A CE   2  
ATOM 3406  H H    . MET A 1 76  ? 2.915   8.045   -20.536 1.00 0.00 ? 76  MET A H    2  
ATOM 3407  H HA   . MET A 1 76  ? 3.601   10.917  -20.508 1.00 0.00 ? 76  MET A HA   2  
ATOM 3408  H HB2  . MET A 1 76  ? 2.741   9.365   -18.485 1.00 0.00 ? 76  MET A HB2  2  
ATOM 3409  H HB3  . MET A 1 76  ? 4.450   8.966   -18.355 1.00 0.00 ? 76  MET A HB3  2  
ATOM 3410  H HG2  . MET A 1 76  ? 5.055   11.248  -18.034 1.00 0.00 ? 76  MET A HG2  2  
ATOM 3411  H HG3  . MET A 1 76  ? 3.479   11.814  -18.515 1.00 0.00 ? 76  MET A HG3  2  
ATOM 3412  H HE1  . MET A 1 76  ? 5.193   9.472   -15.922 1.00 0.00 ? 76  MET A HE1  2  
ATOM 3413  H HE2  . MET A 1 76  ? 3.956   9.396   -14.666 1.00 0.00 ? 76  MET A HE2  2  
ATOM 3414  H HE3  . MET A 1 76  ? 3.622   8.752   -16.273 1.00 0.00 ? 76  MET A HE3  2  
ATOM 3415  N N    . LYS A 1 77  ? 5.618   8.936   -21.596 1.00 0.00 ? 77  LYS A N    2  
ATOM 3416  C CA   . LYS A 1 77  ? 7.019   8.694   -22.009 1.00 0.00 ? 77  LYS A CA   2  
ATOM 3417  C C    . LYS A 1 77  ? 7.715   7.805   -20.993 1.00 0.00 ? 77  LYS A C    2  
ATOM 3418  O O    . LYS A 1 77  ? 8.004   8.229   -19.893 1.00 0.00 ? 77  LYS A O    2  
ATOM 3419  C CB   . LYS A 1 77  ? 7.754   10.044  -22.089 1.00 0.00 ? 77  LYS A CB   2  
ATOM 3420  C CG   . LYS A 1 77  ? 8.538   10.112  -23.403 1.00 0.00 ? 77  LYS A CG   2  
ATOM 3421  C CD   . LYS A 1 77  ? 9.739   9.168   -23.323 1.00 0.00 ? 77  LYS A CD   2  
ATOM 3422  C CE   . LYS A 1 77  ? 10.983  9.886   -23.850 1.00 0.00 ? 77  LYS A CE   2  
ATOM 3423  N NZ   . LYS A 1 77  ? 11.271  11.101  -23.035 1.00 0.00 ? 77  LYS A NZ   2  
ATOM 3424  H H    . LYS A 1 77  ? 4.883   8.497   -22.075 1.00 0.00 ? 77  LYS A H    2  
ATOM 3425  H HA   . LYS A 1 77  ? 7.021   8.192   -22.977 1.00 0.00 ? 77  LYS A HA   2  
ATOM 3426  H HB2  . LYS A 1 77  ? 7.037   10.851  -22.058 1.00 0.00 ? 77  LYS A HB2  2  
ATOM 3427  H HB3  . LYS A 1 77  ? 8.433   10.141  -21.255 1.00 0.00 ? 77  LYS A HB3  2  
ATOM 3428  H HG2  . LYS A 1 77  ? 7.898   9.817   -24.222 1.00 0.00 ? 77  LYS A HG2  2  
ATOM 3429  H HG3  . LYS A 1 77  ? 8.881   11.122  -23.569 1.00 0.00 ? 77  LYS A HG3  2  
ATOM 3430  H HD2  . LYS A 1 77  ? 9.899   8.870   -22.297 1.00 0.00 ? 77  LYS A HD2  2  
ATOM 3431  H HD3  . LYS A 1 77  ? 9.548   8.288   -23.921 1.00 0.00 ? 77  LYS A HD3  2  
ATOM 3432  H HE2  . LYS A 1 77  ? 11.832  9.221   -23.803 1.00 0.00 ? 77  LYS A HE2  2  
ATOM 3433  H HE3  . LYS A 1 77  ? 10.824  10.181  -24.876 1.00 0.00 ? 77  LYS A HE3  2  
ATOM 3434  H HZ1  . LYS A 1 77  ? 10.403  11.664  -22.932 1.00 0.00 ? 77  LYS A HZ1  2  
ATOM 3435  H HZ2  . LYS A 1 77  ? 11.611  10.814  -22.094 1.00 0.00 ? 77  LYS A HZ2  2  
ATOM 3436  H HZ3  . LYS A 1 77  ? 12.000  11.671  -23.508 1.00 0.00 ? 77  LYS A HZ3  2  
ATOM 3437  N N    . ASP A 1 78  ? 7.956   6.581   -21.386 1.00 0.00 ? 78  ASP A N    2  
ATOM 3438  C CA   . ASP A 1 78  ? 8.635   5.620   -20.470 1.00 0.00 ? 78  ASP A CA   2  
ATOM 3439  C C    . ASP A 1 78  ? 9.685   6.311   -19.608 1.00 0.00 ? 78  ASP A C    2  
ATOM 3440  O O    . ASP A 1 78  ? 10.405  7.173   -20.072 1.00 0.00 ? 78  ASP A O    2  
ATOM 3441  C CB   . ASP A 1 78  ? 9.329   4.553   -21.328 1.00 0.00 ? 78  ASP A CB   2  
ATOM 3442  C CG   . ASP A 1 78  ? 10.041  3.555   -20.413 1.00 0.00 ? 78  ASP A CG   2  
ATOM 3443  O OD1  . ASP A 1 78  ? 9.332   2.905   -19.663 1.00 0.00 ? 78  ASP A OD1  2  
ATOM 3444  O OD2  . ASP A 1 78  ? 11.256  3.498   -20.517 1.00 0.00 ? 78  ASP A OD2  2  
ATOM 3445  H H    . ASP A 1 78  ? 7.684   6.296   -22.283 1.00 0.00 ? 78  ASP A H    2  
ATOM 3446  H HA   . ASP A 1 78  ? 7.887   5.166   -19.821 1.00 0.00 ? 78  ASP A HA   2  
ATOM 3447  H HB2  . ASP A 1 78  ? 8.597   4.030   -21.925 1.00 0.00 ? 78  ASP A HB2  2  
ATOM 3448  H HB3  . ASP A 1 78  ? 10.053  5.019   -21.978 1.00 0.00 ? 78  ASP A HB3  2  
ATOM 3449  N N    . THR A 1 79  ? 9.752   5.920   -18.364 1.00 0.00 ? 79  THR A N    2  
ATOM 3450  C CA   . THR A 1 79  ? 10.742  6.538   -17.461 1.00 0.00 ? 79  THR A CA   2  
ATOM 3451  C C    . THR A 1 79  ? 12.125  6.548   -18.103 1.00 0.00 ? 79  THR A C    2  
ATOM 3452  O O    . THR A 1 79  ? 12.353  5.887   -19.097 1.00 0.00 ? 79  THR A O    2  
ATOM 3453  C CB   . THR A 1 79  ? 10.803  5.710   -16.177 1.00 0.00 ? 79  THR A CB   2  
ATOM 3454  O OG1  . THR A 1 79  ? 11.362  4.471   -16.560 1.00 0.00 ? 79  THR A OG1  2  
ATOM 3455  C CG2  . THR A 1 79  ? 9.392   5.362   -15.683 1.00 0.00 ? 79  THR A CG2  2  
ATOM 3456  H H    . THR A 1 79  ? 9.152   5.220   -18.032 1.00 0.00 ? 79  THR A H    2  
ATOM 3457  H HA   . THR A 1 79  ? 10.437  7.565   -17.247 1.00 0.00 ? 79  THR A HA   2  
ATOM 3458  H HB   . THR A 1 79  ? 11.408  6.189   -15.419 1.00 0.00 ? 79  THR A HB   2  
ATOM 3459  H HG1  . THR A 1 79  ? 11.797  4.591   -17.407 1.00 0.00 ? 79  THR A HG1  2  
ATOM 3460  H HG21 . THR A 1 79  ? 8.733   6.204   -15.837 1.00 0.00 ? 79  THR A HG21 2  
ATOM 3461  H HG22 . THR A 1 79  ? 9.015   4.510   -16.229 1.00 0.00 ? 79  THR A HG22 2  
ATOM 3462  H HG23 . THR A 1 79  ? 9.424   5.123   -14.630 1.00 0.00 ? 79  THR A HG23 2  
ATOM 3463  N N    . ASP A 1 80  ? 13.023  7.292   -17.521 1.00 0.00 ? 80  ASP A N    2  
ATOM 3464  C CA   . ASP A 1 80  ? 14.393  7.355   -18.084 1.00 0.00 ? 80  ASP A CA   2  
ATOM 3465  C C    . ASP A 1 80  ? 15.270  6.277   -17.503 1.00 0.00 ? 80  ASP A C    2  
ATOM 3466  O O    . ASP A 1 80  ? 15.638  5.330   -18.168 1.00 0.00 ? 80  ASP A O    2  
ATOM 3467  C CB   . ASP A 1 80  ? 14.996  8.723   -17.733 1.00 0.00 ? 80  ASP A CB   2  
ATOM 3468  C CG   . ASP A 1 80  ? 14.000  9.824   -18.105 1.00 0.00 ? 80  ASP A CG   2  
ATOM 3469  O OD1  . ASP A 1 80  ? 13.648  9.862   -19.272 1.00 0.00 ? 80  ASP A OD1  2  
ATOM 3470  O OD2  . ASP A 1 80  ? 13.648  10.563  -17.201 1.00 0.00 ? 80  ASP A OD2  2  
ATOM 3471  H H    . ASP A 1 80  ? 12.795  7.805   -16.720 1.00 0.00 ? 80  ASP A H    2  
ATOM 3472  H HA   . ASP A 1 80  ? 14.343  7.222   -19.132 1.00 0.00 ? 80  ASP A HA   2  
ATOM 3473  H HB2  . ASP A 1 80  ? 15.203  8.772   -16.674 1.00 0.00 ? 80  ASP A HB2  2  
ATOM 3474  H HB3  . ASP A 1 80  ? 15.914  8.872   -18.283 1.00 0.00 ? 80  ASP A HB3  2  
ATOM 3475  N N    . SER A 1 81  ? 15.583  6.447   -16.283 1.00 0.00 ? 81  SER A N    2  
ATOM 3476  C CA   . SER A 1 81  ? 16.444  5.455   -15.594 1.00 0.00 ? 81  SER A CA   2  
ATOM 3477  C C    . SER A 1 81  ? 16.792  5.935   -14.187 1.00 0.00 ? 81  SER A C    2  
ATOM 3478  O O    . SER A 1 81  ? 17.781  5.527   -13.610 1.00 0.00 ? 81  SER A O    2  
ATOM 3479  C CB   . SER A 1 81  ? 17.739  5.294   -16.414 1.00 0.00 ? 81  SER A CB   2  
ATOM 3480  O OG   . SER A 1 81  ? 17.866  6.527   -17.106 1.00 0.00 ? 81  SER A OG   2  
ATOM 3481  H H    . SER A 1 81  ? 15.253  7.229   -15.816 1.00 0.00 ? 81  SER A H    2  
ATOM 3482  H HA   . SER A 1 81  ? 15.908  4.508   -15.524 1.00 0.00 ? 81  SER A HA   2  
ATOM 3483  H HB2  . SER A 1 81  ? 18.589  5.138   -15.768 1.00 0.00 ? 81  SER A HB2  2  
ATOM 3484  H HB3  . SER A 1 81  ? 17.646  4.480   -17.116 1.00 0.00 ? 81  SER A HB3  2  
ATOM 3485  H HG   . SER A 1 81  ? 18.337  7.140   -16.538 1.00 0.00 ? 81  SER A HG   2  
ATOM 3486  N N    . GLU A 1 82  ? 15.961  6.792   -13.658 1.00 0.00 ? 82  GLU A N    2  
ATOM 3487  C CA   . GLU A 1 82  ? 16.219  7.315   -12.294 1.00 0.00 ? 82  GLU A CA   2  
ATOM 3488  C C    . GLU A 1 82  ? 16.496  6.182   -11.314 1.00 0.00 ? 82  GLU A C    2  
ATOM 3489  O O    . GLU A 1 82  ? 17.041  6.399   -10.250 1.00 0.00 ? 82  GLU A O    2  
ATOM 3490  C CB   . GLU A 1 82  ? 14.968  8.076   -11.825 1.00 0.00 ? 82  GLU A CB   2  
ATOM 3491  C CG   . GLU A 1 82  ? 13.812  7.087   -11.659 1.00 0.00 ? 82  GLU A CG   2  
ATOM 3492  C CD   . GLU A 1 82  ? 13.527  6.414   -13.002 1.00 0.00 ? 82  GLU A CD   2  
ATOM 3493  O OE1  . GLU A 1 82  ? 13.211  7.151   -13.920 1.00 0.00 ? 82  GLU A OE1  2  
ATOM 3494  O OE2  . GLU A 1 82  ? 13.640  5.198   -13.034 1.00 0.00 ? 82  GLU A OE2  2  
ATOM 3495  H H    . GLU A 1 82  ? 15.171  7.087   -14.159 1.00 0.00 ? 82  GLU A H    2  
ATOM 3496  H HA   . GLU A 1 82  ? 17.084  7.977   -12.325 1.00 0.00 ? 82  GLU A HA   2  
ATOM 3497  H HB2  . GLU A 1 82  ? 15.171  8.558   -10.881 1.00 0.00 ? 82  GLU A HB2  2  
ATOM 3498  H HB3  . GLU A 1 82  ? 14.703  8.825   -12.556 1.00 0.00 ? 82  GLU A HB3  2  
ATOM 3499  H HG2  . GLU A 1 82  ? 14.077  6.334   -10.931 1.00 0.00 ? 82  GLU A HG2  2  
ATOM 3500  H HG3  . GLU A 1 82  ? 12.927  7.610   -11.326 1.00 0.00 ? 82  GLU A HG3  2  
ATOM 3501  N N    . GLU A 1 83  ? 16.116  4.993   -11.686 1.00 0.00 ? 83  GLU A N    2  
ATOM 3502  C CA   . GLU A 1 83  ? 16.354  3.842   -10.780 1.00 0.00 ? 83  GLU A CA   2  
ATOM 3503  C C    . GLU A 1 83  ? 17.800  3.380   -10.858 1.00 0.00 ? 83  GLU A C    2  
ATOM 3504  O O    . GLU A 1 83  ? 18.461  3.235   -9.849  1.00 0.00 ? 83  GLU A O    2  
ATOM 3505  C CB   . GLU A 1 83  ? 15.435  2.682   -11.207 1.00 0.00 ? 83  GLU A CB   2  
ATOM 3506  C CG   . GLU A 1 83  ? 15.610  2.414   -12.706 1.00 0.00 ? 83  GLU A CG   2  
ATOM 3507  C CD   . GLU A 1 83  ? 14.487  1.493   -13.188 1.00 0.00 ? 83  GLU A CD   2  
ATOM 3508  O OE1  . GLU A 1 83  ? 14.385  0.419   -12.617 1.00 0.00 ? 83  GLU A OE1  2  
ATOM 3509  O OE2  . GLU A 1 83  ? 13.793  1.914   -14.099 1.00 0.00 ? 83  GLU A OE2  2  
ATOM 3510  H H    . GLU A 1 83  ? 15.678  4.861   -12.551 1.00 0.00 ? 83  GLU A H    2  
ATOM 3511  H HA   . GLU A 1 83  ? 16.140  4.150   -9.759  1.00 0.00 ? 83  GLU A HA   2  
ATOM 3512  H HB2  . GLU A 1 83  ? 15.693  1.794   -10.649 1.00 0.00 ? 83  GLU A HB2  2  
ATOM 3513  H HB3  . GLU A 1 83  ? 14.408  2.941   -11.002 1.00 0.00 ? 83  GLU A HB3  2  
ATOM 3514  H HG2  . GLU A 1 83  ? 15.567  3.344   -13.253 1.00 0.00 ? 83  GLU A HG2  2  
ATOM 3515  H HG3  . GLU A 1 83  ? 16.562  1.938   -12.885 1.00 0.00 ? 83  GLU A HG3  2  
ATOM 3516  N N    . GLU A 1 84  ? 18.268  3.158   -12.051 1.00 0.00 ? 84  GLU A N    2  
ATOM 3517  C CA   . GLU A 1 84  ? 19.667  2.707   -12.203 1.00 0.00 ? 84  GLU A CA   2  
ATOM 3518  C C    . GLU A 1 84  ? 20.613  3.729   -11.595 1.00 0.00 ? 84  GLU A C    2  
ATOM 3519  O O    . GLU A 1 84  ? 21.589  3.383   -10.956 1.00 0.00 ? 84  GLU A O    2  
ATOM 3520  C CB   . GLU A 1 84  ? 19.970  2.572   -13.704 1.00 0.00 ? 84  GLU A CB   2  
ATOM 3521  C CG   . GLU A 1 84  ? 21.134  1.599   -13.894 1.00 0.00 ? 84  GLU A CG   2  
ATOM 3522  C CD   . GLU A 1 84  ? 22.414  2.228   -13.343 1.00 0.00 ? 84  GLU A CD   2  
ATOM 3523  O OE1  . GLU A 1 84  ? 22.645  3.375   -13.690 1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3524  O OE2  . GLU A 1 84  ? 23.088  1.528   -12.606 1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3525  H H    . GLU A 1 84  ? 17.704  3.295   -12.840 1.00 0.00 ? 84  GLU A H    2  
ATOM 3526  H HA   . GLU A 1 84  ? 19.793  1.753   -11.691 1.00 0.00 ? 84  GLU A HA   2  
ATOM 3527  H HB2  . GLU A 1 84  ? 19.096  2.200   -14.218 1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3528  H HB3  . GLU A 1 84  ? 20.234  3.538   -14.108 1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3529  H HG2  . GLU A 1 84  ? 20.931  0.678   -13.365 1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3530  H HG3  . GLU A 1 84  ? 21.265  1.385   -14.944 1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3531  N N    . ILE A 1 85  ? 20.301  4.976   -11.801 1.00 0.00 ? 85  ILE A N    2  
ATOM 3532  C CA   . ILE A 1 85  ? 21.160  6.044   -11.251 1.00 0.00 ? 85  ILE A CA   2  
ATOM 3533  C C    . ILE A 1 85  ? 20.995  6.145   -9.740  1.00 0.00 ? 85  ILE A C    2  
ATOM 3534  O O    . ILE A 1 85  ? 21.965  6.119   -9.003  1.00 0.00 ? 85  ILE A O    2  
ATOM 3535  C CB   . ILE A 1 85  ? 20.732  7.365   -11.876 1.00 0.00 ? 85  ILE A CB   2  
ATOM 3536  C CG1  . ILE A 1 85  ? 21.124  7.395   -13.342 1.00 0.00 ? 85  ILE A CG1  2  
ATOM 3537  C CG2  . ILE A 1 85  ? 21.459  8.506   -11.155 1.00 0.00 ? 85  ILE A CG2  2  
ATOM 3538  C CD1  . ILE A 1 85  ? 20.672  8.725   -13.945 1.00 0.00 ? 85  ILE A CD1  2  
ATOM 3539  H H    . ILE A 1 85  ? 19.500  5.205   -12.317 1.00 0.00 ? 85  ILE A H    2  
ATOM 3540  H HA   . ILE A 1 85  ? 22.198  5.821   -11.483 1.00 0.00 ? 85  ILE A HA   2  
ATOM 3541  H HB   . ILE A 1 85  ? 19.652  7.473   -11.789 1.00 0.00 ? 85  ILE A HB   2  
ATOM 3542  H HG12 . ILE A 1 85  ? 22.196  7.298   -13.435 1.00 0.00 ? 85  ILE A HG12 2  
ATOM 3543  H HG13 . ILE A 1 85  ? 20.647  6.577   -13.863 1.00 0.00 ? 85  ILE A HG13 2  
ATOM 3544  H HG21 . ILE A 1 85  ? 22.524  8.336   -11.186 1.00 0.00 ? 85  ILE A HG21 2  
ATOM 3545  H HG22 . ILE A 1 85  ? 21.234  9.445   -11.638 1.00 0.00 ? 85  ILE A HG22 2  
ATOM 3546  H HG23 . ILE A 1 85  ? 21.136  8.548   -10.130 1.00 0.00 ? 85  ILE A HG23 2  
ATOM 3547  H HD11 . ILE A 1 85  ? 19.787  9.074   -13.433 1.00 0.00 ? 85  ILE A HD11 2  
ATOM 3548  H HD12 . ILE A 1 85  ? 21.458  9.458   -13.837 1.00 0.00 ? 85  ILE A HD12 2  
ATOM 3549  H HD13 . ILE A 1 85  ? 20.449  8.593   -14.991 1.00 0.00 ? 85  ILE A HD13 2  
ATOM 3550  N N    . ARG A 1 86  ? 19.765  6.262   -9.301  1.00 0.00 ? 86  ARG A N    2  
ATOM 3551  C CA   . ARG A 1 86  ? 19.521  6.365   -7.844  1.00 0.00 ? 86  ARG A CA   2  
ATOM 3552  C C    . ARG A 1 86  ? 20.367  5.349   -7.100  1.00 0.00 ? 86  ARG A C    2  
ATOM 3553  O O    . ARG A 1 86  ? 21.107  5.691   -6.201  1.00 0.00 ? 86  ARG A O    2  
ATOM 3554  C CB   . ARG A 1 86  ? 18.031  6.072   -7.579  1.00 0.00 ? 86  ARG A CB   2  
ATOM 3555  C CG   . ARG A 1 86  ? 17.848  5.602   -6.132  1.00 0.00 ? 86  ARG A CG   2  
ATOM 3556  C CD   . ARG A 1 86  ? 16.353  5.474   -5.832  1.00 0.00 ? 86  ARG A CD   2  
ATOM 3557  N NE   . ARG A 1 86  ? 15.992  4.029   -5.777  1.00 0.00 ? 86  ARG A NE   2  
ATOM 3558  C CZ   . ARG A 1 86  ? 14.737  3.677   -5.840  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 3559  N NH1  . ARG A 1 86  ? 13.819  4.605   -5.822  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 3560  N NH2  . ARG A 1 86  ? 14.442  2.408   -5.920  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 3561  H H    . ARG A 1 86  ? 19.011  6.273   -9.933  1.00 0.00 ? 86  ARG A H    2  
ATOM 3562  H HA   . ARG A 1 86  ? 19.790  7.370   -7.510  1.00 0.00 ? 86  ARG A HA   2  
ATOM 3563  H HB2  . ARG A 1 86  ? 17.451  6.970   -7.744  1.00 0.00 ? 86  ARG A HB2  2  
ATOM 3564  H HB3  . ARG A 1 86  ? 17.689  5.302   -8.255  1.00 0.00 ? 86  ARG A HB3  2  
ATOM 3565  H HG2  . ARG A 1 86  ? 18.324  4.642   -5.997  1.00 0.00 ? 86  ARG A HG2  2  
ATOM 3566  H HG3  . ARG A 1 86  ? 18.295  6.317   -5.457  1.00 0.00 ? 86  ARG A HG3  2  
ATOM 3567  H HD2  . ARG A 1 86  ? 16.128  5.936   -4.882  1.00 0.00 ? 86  ARG A HD2  2  
ATOM 3568  H HD3  . ARG A 1 86  ? 15.779  5.957   -6.610  1.00 0.00 ? 86  ARG A HD3  2  
ATOM 3569  H HE   . ARG A 1 86  ? 16.692  3.349   -5.693  1.00 0.00 ? 86  ARG A HE   2  
ATOM 3570  H HH11 . ARG A 1 86  ? 14.082  5.567   -5.763  1.00 0.00 ? 86  ARG A HH11 2  
ATOM 3571  H HH12 . ARG A 1 86  ? 12.853  4.352   -5.867  1.00 0.00 ? 86  ARG A HH12 2  
ATOM 3572  H HH21 . ARG A 1 86  ? 15.173  1.726   -5.935  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 3573  H HH22 . ARG A 1 86  ? 13.487  2.119   -5.967  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 3574  N N    . GLU A 1 87  ? 20.245  4.111   -7.491  1.00 0.00 ? 87  GLU A N    2  
ATOM 3575  C CA   . GLU A 1 87  ? 21.037  3.062   -6.818  1.00 0.00 ? 87  GLU A CA   2  
ATOM 3576  C C    . GLU A 1 87  ? 22.508  3.397   -6.900  1.00 0.00 ? 87  GLU A C    2  
ATOM 3577  O O    . GLU A 1 87  ? 23.240  3.250   -5.940  1.00 0.00 ? 87  GLU A O    2  
ATOM 3578  C CB   . GLU A 1 87  ? 20.792  1.725   -7.537  1.00 0.00 ? 87  GLU A CB   2  
ATOM 3579  C CG   . GLU A 1 87  ? 19.440  1.159   -7.105  1.00 0.00 ? 87  GLU A CG   2  
ATOM 3580  C CD   . GLU A 1 87  ? 19.608  0.402   -5.786  1.00 0.00 ? 87  GLU A CD   2  
ATOM 3581  O OE1  . GLU A 1 87  ? 20.416  -0.512  -5.787  1.00 0.00 ? 87  GLU A OE1  2  
ATOM 3582  O OE2  . GLU A 1 87  ? 18.919  0.779   -4.854  1.00 0.00 ? 87  GLU A OE2  2  
ATOM 3583  H H    . GLU A 1 87  ? 19.633  3.880   -8.221  1.00 0.00 ? 87  GLU A H    2  
ATOM 3584  H HA   . GLU A 1 87  ? 20.743  3.006   -5.773  1.00 0.00 ? 87  GLU A HA   2  
ATOM 3585  H HB2  . GLU A 1 87  ? 20.794  1.884   -8.606  1.00 0.00 ? 87  GLU A HB2  2  
ATOM 3586  H HB3  . GLU A 1 87  ? 21.576  1.027   -7.282  1.00 0.00 ? 87  GLU A HB3  2  
ATOM 3587  H HG2  . GLU A 1 87  ? 18.734  1.964   -6.966  1.00 0.00 ? 87  GLU A HG2  2  
ATOM 3588  H HG3  . GLU A 1 87  ? 19.068  0.484   -7.860  1.00 0.00 ? 87  GLU A HG3  2  
ATOM 3589  N N    . ALA A 1 88  ? 22.921  3.844   -8.050  1.00 0.00 ? 88  ALA A N    2  
ATOM 3590  C CA   . ALA A 1 88  ? 24.341  4.196   -8.218  1.00 0.00 ? 88  ALA A CA   2  
ATOM 3591  C C    . ALA A 1 88  ? 24.803  5.078   -7.069  1.00 0.00 ? 88  ALA A C    2  
ATOM 3592  O O    . ALA A 1 88  ? 25.958  5.062   -6.697  1.00 0.00 ? 88  ALA A O    2  
ATOM 3593  C CB   . ALA A 1 88  ? 24.496  4.969   -9.535  1.00 0.00 ? 88  ALA A CB   2  
ATOM 3594  H H    . ALA A 1 88  ? 22.292  3.945   -8.797  1.00 0.00 ? 88  ALA A H    2  
ATOM 3595  H HA   . ALA A 1 88  ? 24.936  3.283   -8.229  1.00 0.00 ? 88  ALA A HA   2  
ATOM 3596  H HB1  . ALA A 1 88  ? 23.730  4.660   -10.230 1.00 0.00 ? 88  ALA A HB1  2  
ATOM 3597  H HB2  . ALA A 1 88  ? 24.401  6.028   -9.350  1.00 0.00 ? 88  ALA A HB2  2  
ATOM 3598  H HB3  . ALA A 1 88  ? 25.466  4.768   -9.964  1.00 0.00 ? 88  ALA A HB3  2  
ATOM 3599  N N    . PHE A 1 89  ? 23.887  5.840   -6.527  1.00 0.00 ? 89  PHE A N    2  
ATOM 3600  C CA   . PHE A 1 89  ? 24.257  6.729   -5.399  1.00 0.00 ? 89  PHE A CA   2  
ATOM 3601  C C    . PHE A 1 89  ? 24.066  6.020   -4.056  1.00 0.00 ? 89  PHE A C    2  
ATOM 3602  O O    . PHE A 1 89  ? 24.925  6.074   -3.198  1.00 0.00 ? 89  PHE A O    2  
ATOM 3603  C CB   . PHE A 1 89  ? 23.346  7.970   -5.422  1.00 0.00 ? 89  PHE A CB   2  
ATOM 3604  C CG   . PHE A 1 89  ? 23.645  8.830   -6.658  1.00 0.00 ? 89  PHE A CG   2  
ATOM 3605  C CD1  . PHE A 1 89  ? 24.938  9.248   -6.942  1.00 0.00 ? 89  PHE A CD1  2  
ATOM 3606  C CD2  . PHE A 1 89  ? 22.616  9.219   -7.500  1.00 0.00 ? 89  PHE A CD2  2  
ATOM 3607  C CE1  . PHE A 1 89  ? 25.189  10.036  -8.045  1.00 0.00 ? 89  PHE A CE1  2  
ATOM 3608  C CE2  . PHE A 1 89  ? 22.875  10.007  -8.601  1.00 0.00 ? 89  PHE A CE2  2  
ATOM 3609  C CZ   . PHE A 1 89  ? 24.158  10.414  -8.874  1.00 0.00 ? 89  PHE A CZ   2  
ATOM 3610  H H    . PHE A 1 89  ? 22.965  5.826   -6.868  1.00 0.00 ? 89  PHE A H    2  
ATOM 3611  H HA   . PHE A 1 89  ? 25.303  7.012   -5.503  1.00 0.00 ? 89  PHE A HA   2  
ATOM 3612  H HB2  . PHE A 1 89  ? 22.312  7.661   -5.449  1.00 0.00 ? 89  PHE A HB2  2  
ATOM 3613  H HB3  . PHE A 1 89  ? 23.515  8.557   -4.532  1.00 0.00 ? 89  PHE A HB3  2  
ATOM 3614  H HD1  . PHE A 1 89  ? 25.751  8.963   -6.294  1.00 0.00 ? 89  PHE A HD1  2  
ATOM 3615  H HD2  . PHE A 1 89  ? 21.606  8.903   -7.292  1.00 0.00 ? 89  PHE A HD2  2  
ATOM 3616  H HE1  . PHE A 1 89  ? 26.196  10.357  -8.258  1.00 0.00 ? 89  PHE A HE1  2  
ATOM 3617  H HE2  . PHE A 1 89  ? 22.064  10.313  -9.244  1.00 0.00 ? 89  PHE A HE2  2  
ATOM 3618  H HZ   . PHE A 1 89  ? 24.357  11.029  -9.738  1.00 0.00 ? 89  PHE A HZ   2  
ATOM 3619  N N    . ARG A 1 90  ? 22.938  5.369   -3.893  1.00 0.00 ? 90  ARG A N    2  
ATOM 3620  C CA   . ARG A 1 90  ? 22.690  4.663   -2.617  1.00 0.00 ? 90  ARG A CA   2  
ATOM 3621  C C    . ARG A 1 90  ? 23.845  3.716   -2.321  1.00 0.00 ? 90  ARG A C    2  
ATOM 3622  O O    . ARG A 1 90  ? 24.154  3.445   -1.182  1.00 0.00 ? 90  ARG A O    2  
ATOM 3623  C CB   . ARG A 1 90  ? 21.339  3.890   -2.762  1.00 0.00 ? 90  ARG A CB   2  
ATOM 3624  C CG   . ARG A 1 90  ? 21.439  2.434   -2.249  1.00 0.00 ? 90  ARG A CG   2  
ATOM 3625  C CD   . ARG A 1 90  ? 21.386  2.414   -0.710  1.00 0.00 ? 90  ARG A CD   2  
ATOM 3626  N NE   . ARG A 1 90  ? 20.509  1.289   -0.274  1.00 0.00 ? 90  ARG A NE   2  
ATOM 3627  C CZ   . ARG A 1 90  ? 19.656  1.476   0.696   1.00 0.00 ? 90  ARG A CZ   2  
ATOM 3628  N NH1  . ARG A 1 90  ? 20.099  1.839   1.871   1.00 0.00 ? 90  ARG A NH1  2  
ATOM 3629  N NH2  . ARG A 1 90  ? 18.387  1.288   0.461   1.00 0.00 ? 90  ARG A NH2  2  
ATOM 3630  H H    . ARG A 1 90  ? 22.271  5.337   -4.610  1.00 0.00 ? 90  ARG A H    2  
ATOM 3631  H HA   . ARG A 1 90  ? 22.628  5.401   -1.818  1.00 0.00 ? 90  ARG A HA   2  
ATOM 3632  H HB2  . ARG A 1 90  ? 20.574  4.410   -2.206  1.00 0.00 ? 90  ARG A HB2  2  
ATOM 3633  H HB3  . ARG A 1 90  ? 21.054  3.878   -3.800  1.00 0.00 ? 90  ARG A HB3  2  
ATOM 3634  H HG2  . ARG A 1 90  ? 20.604  1.872   -2.637  1.00 0.00 ? 90  ARG A HG2  2  
ATOM 3635  H HG3  . ARG A 1 90  ? 22.347  1.975   -2.594  1.00 0.00 ? 90  ARG A HG3  2  
ATOM 3636  H HD2  . ARG A 1 90  ? 22.373  2.265   -0.308  1.00 0.00 ? 90  ARG A HD2  2  
ATOM 3637  H HD3  . ARG A 1 90  ? 20.986  3.346   -0.341  1.00 0.00 ? 90  ARG A HD3  2  
ATOM 3638  H HE   . ARG A 1 90  ? 20.574  0.416   -0.713  1.00 0.00 ? 90  ARG A HE   2  
ATOM 3639  H HH11 . ARG A 1 90  ? 21.079  1.969   2.018   1.00 0.00 ? 90  ARG A HH11 2  
ATOM 3640  H HH12 . ARG A 1 90  ? 19.456  1.986   2.624   1.00 0.00 ? 90  ARG A HH12 2  
ATOM 3641  H HH21 . ARG A 1 90  ? 18.084  1.004   -0.449  1.00 0.00 ? 90  ARG A HH21 2  
ATOM 3642  H HH22 . ARG A 1 90  ? 17.717  1.426   1.189   1.00 0.00 ? 90  ARG A HH22 2  
ATOM 3643  N N    . VAL A 1 91  ? 24.471  3.240   -3.359  1.00 0.00 ? 91  VAL A N    2  
ATOM 3644  C CA   . VAL A 1 91  ? 25.606  2.314   -3.159  1.00 0.00 ? 91  VAL A CA   2  
ATOM 3645  C C    . VAL A 1 91  ? 26.582  2.871   -2.128  1.00 0.00 ? 91  VAL A C    2  
ATOM 3646  O O    . VAL A 1 91  ? 27.470  2.174   -1.676  1.00 0.00 ? 91  VAL A O    2  
ATOM 3647  C CB   . VAL A 1 91  ? 26.336  2.158   -4.497  1.00 0.00 ? 91  VAL A CB   2  
ATOM 3648  C CG1  . VAL A 1 91  ? 27.617  1.352   -4.280  1.00 0.00 ? 91  VAL A CG1  2  
ATOM 3649  C CG2  . VAL A 1 91  ? 25.430  1.415   -5.480  1.00 0.00 ? 91  VAL A CG2  2  
ATOM 3650  H H    . VAL A 1 91  ? 24.193  3.493   -4.264  1.00 0.00 ? 91  VAL A H    2  
ATOM 3651  H HA   . VAL A 1 91  ? 25.228  1.356   -2.811  1.00 0.00 ? 91  VAL A HA   2  
ATOM 3652  H HB   . VAL A 1 91  ? 26.580  3.131   -4.892  1.00 0.00 ? 91  VAL A HB   2  
ATOM 3653  H HG11 . VAL A 1 91  ? 27.443  0.586   -3.539  1.00 0.00 ? 91  VAL A HG11 2  
ATOM 3654  H HG12 . VAL A 1 91  ? 27.918  0.889   -5.208  1.00 0.00 ? 91  VAL A HG12 2  
ATOM 3655  H HG13 . VAL A 1 91  ? 28.404  2.006   -3.935  1.00 0.00 ? 91  VAL A HG13 2  
ATOM 3656  H HG21 . VAL A 1 91  ? 24.421  1.381   -5.092  1.00 0.00 ? 91  VAL A HG21 2  
ATOM 3657  H HG22 . VAL A 1 91  ? 25.428  1.926   -6.432  1.00 0.00 ? 91  VAL A HG22 2  
ATOM 3658  H HG23 . VAL A 1 91  ? 25.790  0.407   -5.619  1.00 0.00 ? 91  VAL A HG23 2  
ATOM 3659  N N    . PHE A 1 92  ? 26.393  4.124   -1.777  1.00 0.00 ? 92  PHE A N    2  
ATOM 3660  C CA   . PHE A 1 92  ? 27.292  4.764   -0.775  1.00 0.00 ? 92  PHE A CA   2  
ATOM 3661  C C    . PHE A 1 92  ? 26.482  5.415   0.345   1.00 0.00 ? 92  PHE A C    2  
ATOM 3662  O O    . PHE A 1 92  ? 27.031  5.861   1.332   1.00 0.00 ? 92  PHE A O    2  
ATOM 3663  C CB   . PHE A 1 92  ? 28.103  5.863   -1.483  1.00 0.00 ? 92  PHE A CB   2  
ATOM 3664  C CG   . PHE A 1 92  ? 28.773  5.289   -2.735  1.00 0.00 ? 92  PHE A CG   2  
ATOM 3665  C CD1  . PHE A 1 92  ? 28.110  5.287   -3.948  1.00 0.00 ? 92  PHE A CD1  2  
ATOM 3666  C CD2  . PHE A 1 92  ? 30.059  4.780   -2.672  1.00 0.00 ? 92  PHE A CD2  2  
ATOM 3667  C CE1  . PHE A 1 92  ? 28.724  4.787   -5.080  1.00 0.00 ? 92  PHE A CE1  2  
ATOM 3668  C CE2  . PHE A 1 92  ? 30.670  4.282   -3.806  1.00 0.00 ? 92  PHE A CE2  2  
ATOM 3669  C CZ   . PHE A 1 92  ? 30.002  4.286   -5.006  1.00 0.00 ? 92  PHE A CZ   2  
ATOM 3670  H H    . PHE A 1 92  ? 25.659  4.638   -2.174  1.00 0.00 ? 92  PHE A H    2  
ATOM 3671  H HA   . PHE A 1 92  ? 27.951  4.011   -0.346  1.00 0.00 ? 92  PHE A HA   2  
ATOM 3672  H HB2  . PHE A 1 92  ? 27.446  6.672   -1.770  1.00 0.00 ? 92  PHE A HB2  2  
ATOM 3673  H HB3  . PHE A 1 92  ? 28.863  6.243   -0.815  1.00 0.00 ? 92  PHE A HB3  2  
ATOM 3674  H HD1  . PHE A 1 92  ? 27.107  5.680   -4.013  1.00 0.00 ? 92  PHE A HD1  2  
ATOM 3675  H HD2  . PHE A 1 92  ? 30.587  4.772   -1.731  1.00 0.00 ? 92  PHE A HD2  2  
ATOM 3676  H HE1  . PHE A 1 92  ? 28.202  4.790   -6.024  1.00 0.00 ? 92  PHE A HE1  2  
ATOM 3677  H HE2  . PHE A 1 92  ? 31.676  3.894   -3.751  1.00 0.00 ? 92  PHE A HE2  2  
ATOM 3678  H HZ   . PHE A 1 92  ? 30.479  3.893   -5.892  1.00 0.00 ? 92  PHE A HZ   2  
ATOM 3679  N N    . ASP A 1 93  ? 25.188  5.457   0.169   1.00 0.00 ? 93  ASP A N    2  
ATOM 3680  C CA   . ASP A 1 93  ? 24.328  6.074   1.210   1.00 0.00 ? 93  ASP A CA   2  
ATOM 3681  C C    . ASP A 1 93  ? 24.121  5.118   2.376   1.00 0.00 ? 93  ASP A C    2  
ATOM 3682  O O    . ASP A 1 93  ? 23.523  4.073   2.227   1.00 0.00 ? 93  ASP A O    2  
ATOM 3683  C CB   . ASP A 1 93  ? 22.961  6.392   0.583   1.00 0.00 ? 93  ASP A CB   2  
ATOM 3684  C CG   . ASP A 1 93  ? 22.140  7.232   1.559   1.00 0.00 ? 93  ASP A CG   2  
ATOM 3685  O OD1  . ASP A 1 93  ? 22.691  8.219   2.019   1.00 0.00 ? 93  ASP A OD1  2  
ATOM 3686  O OD2  . ASP A 1 93  ? 21.007  6.843   1.789   1.00 0.00 ? 93  ASP A OD2  2  
ATOM 3687  H H    . ASP A 1 93  ? 24.790  5.080   -0.636  1.00 0.00 ? 93  ASP A H    2  
ATOM 3688  H HA   . ASP A 1 93  ? 24.806  6.980   1.574   1.00 0.00 ? 93  ASP A HA   2  
ATOM 3689  H HB2  . ASP A 1 93  ? 23.100  6.945   -0.335  1.00 0.00 ? 93  ASP A HB2  2  
ATOM 3690  H HB3  . ASP A 1 93  ? 22.433  5.473   0.370   1.00 0.00 ? 93  ASP A HB3  2  
ATOM 3691  N N    . LYS A 1 94  ? 24.616  5.496   3.521   1.00 0.00 ? 94  LYS A N    2  
ATOM 3692  C CA   . LYS A 1 94  ? 24.457  4.622   4.703   1.00 0.00 ? 94  LYS A CA   2  
ATOM 3693  C C    . LYS A 1 94  ? 24.392  5.450   5.980   1.00 0.00 ? 94  LYS A C    2  
ATOM 3694  O O    . LYS A 1 94  ? 23.394  5.450   6.673   1.00 0.00 ? 94  LYS A O    2  
ATOM 3695  C CB   . LYS A 1 94  ? 25.673  3.680   4.773   1.00 0.00 ? 94  LYS A CB   2  
ATOM 3696  C CG   . LYS A 1 94  ? 25.466  2.507   3.805   1.00 0.00 ? 94  LYS A CG   2  
ATOM 3697  C CD   . LYS A 1 94  ? 26.253  1.294   4.308   1.00 0.00 ? 94  LYS A CD   2  
ATOM 3698  C CE   . LYS A 1 94  ? 26.848  0.552   3.109   1.00 0.00 ? 94  LYS A CE   2  
ATOM 3699  N NZ   . LYS A 1 94  ? 27.500  -0.713  3.548   1.00 0.00 ? 94  LYS A NZ   2  
ATOM 3700  H H    . LYS A 1 94  ? 25.089  6.349   3.597   1.00 0.00 ? 94  LYS A H    2  
ATOM 3701  H HA   . LYS A 1 94  ? 23.536  4.060   4.603   1.00 0.00 ? 94  LYS A HA   2  
ATOM 3702  H HB2  . LYS A 1 94  ? 26.566  4.223   4.497   1.00 0.00 ? 94  LYS A HB2  2  
ATOM 3703  H HB3  . LYS A 1 94  ? 25.784  3.306   5.778   1.00 0.00 ? 94  LYS A HB3  2  
ATOM 3704  H HG2  . LYS A 1 94  ? 24.418  2.260   3.751   1.00 0.00 ? 94  LYS A HG2  2  
ATOM 3705  H HG3  . LYS A 1 94  ? 25.815  2.784   2.821   1.00 0.00 ? 94  LYS A HG3  2  
ATOM 3706  H HD2  . LYS A 1 94  ? 27.046  1.621   4.963   1.00 0.00 ? 94  LYS A HD2  2  
ATOM 3707  H HD3  . LYS A 1 94  ? 25.592  0.634   4.851   1.00 0.00 ? 94  LYS A HD3  2  
ATOM 3708  H HE2  . LYS A 1 94  ? 26.065  0.319   2.402   1.00 0.00 ? 94  LYS A HE2  2  
ATOM 3709  H HE3  . LYS A 1 94  ? 27.584  1.178   2.625   1.00 0.00 ? 94  LYS A HE3  2  
ATOM 3710  H HZ1  . LYS A 1 94  ? 26.806  -1.306  4.046   1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 3711  H HZ2  . LYS A 1 94  ? 27.859  -1.225  2.716   1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 3712  H HZ3  . LYS A 1 94  ? 28.290  -0.493  4.187   1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 3713  N N    . ASP A 1 95  ? 25.458  6.142   6.269   1.00 0.00 ? 95  ASP A N    2  
ATOM 3714  C CA   . ASP A 1 95  ? 25.474  6.975   7.497   1.00 0.00 ? 95  ASP A CA   2  
ATOM 3715  C C    . ASP A 1 95  ? 25.016  8.395   7.187   1.00 0.00 ? 95  ASP A C    2  
ATOM 3716  O O    . ASP A 1 95  ? 24.501  9.086   8.042   1.00 0.00 ? 95  ASP A O    2  
ATOM 3717  C CB   . ASP A 1 95  ? 26.914  7.022   8.036   1.00 0.00 ? 95  ASP A CB   2  
ATOM 3718  C CG   . ASP A 1 95  ? 27.857  7.507   6.933   1.00 0.00 ? 95  ASP A CG   2  
ATOM 3719  O OD1  . ASP A 1 95  ? 28.301  6.651   6.186   1.00 0.00 ? 95  ASP A OD1  2  
ATOM 3720  O OD2  . ASP A 1 95  ? 28.081  8.705   6.900   1.00 0.00 ? 95  ASP A OD2  2  
ATOM 3721  H H    . ASP A 1 95  ? 26.238  6.113   5.679   1.00 0.00 ? 95  ASP A H    2  
ATOM 3722  H HA   . ASP A 1 95  ? 24.798  6.538   8.232   1.00 0.00 ? 95  ASP A HA   2  
ATOM 3723  H HB2  . ASP A 1 95  ? 26.968  7.700   8.876   1.00 0.00 ? 95  ASP A HB2  2  
ATOM 3724  H HB3  . ASP A 1 95  ? 27.216  6.036   8.356   1.00 0.00 ? 95  ASP A HB3  2  
ATOM 3725  N N    . GLY A 1 96  ? 25.211  8.801   5.961   1.00 0.00 ? 96  GLY A N    2  
ATOM 3726  C CA   . GLY A 1 96  ? 24.793  10.177  5.567   1.00 0.00 ? 96  GLY A CA   2  
ATOM 3727  C C    . GLY A 1 96  ? 23.277  10.230  5.380   1.00 0.00 ? 96  GLY A C    2  
ATOM 3728  O O    . GLY A 1 96  ? 22.679  11.286  5.448   1.00 0.00 ? 96  GLY A O    2  
ATOM 3729  H H    . GLY A 1 96  ? 25.629  8.206   5.305   1.00 0.00 ? 96  GLY A H    2  
ATOM 3730  H HA2  . GLY A 1 96  ? 25.083  10.874  6.337   1.00 0.00 ? 96  GLY A HA2  2  
ATOM 3731  H HA3  . GLY A 1 96  ? 25.278  10.444  4.641   1.00 0.00 ? 96  GLY A HA3  2  
ATOM 3732  N N    . ASN A 1 97  ? 22.696  9.082   5.148   1.00 0.00 ? 97  ASN A N    2  
ATOM 3733  C CA   . ASN A 1 97  ? 21.224  9.016   4.950   1.00 0.00 ? 97  ASN A CA   2  
ATOM 3734  C C    . ASN A 1 97  ? 20.711  10.211  4.153   1.00 0.00 ? 97  ASN A C    2  
ATOM 3735  O O    . ASN A 1 97  ? 20.220  11.169  4.713   1.00 0.00 ? 97  ASN A O    2  
ATOM 3736  C CB   . ASN A 1 97  ? 20.546  9.012   6.333   1.00 0.00 ? 97  ASN A CB   2  
ATOM 3737  C CG   . ASN A 1 97  ? 21.103  10.156  7.182   1.00 0.00 ? 97  ASN A CG   2  
ATOM 3738  O OD1  . ASN A 1 97  ? 22.161  10.049  7.773   1.00 0.00 ? 97  ASN A OD1  2  
ATOM 3739  N ND2  . ASN A 1 97  ? 20.423  11.268  7.269   1.00 0.00 ? 97  ASN A ND2  2  
ATOM 3740  H H    . ASN A 1 97  ? 23.231  8.263   5.103   1.00 0.00 ? 97  ASN A H    2  
ATOM 3741  H HA   . ASN A 1 97  ? 20.985  8.104   4.404   1.00 0.00 ? 97  ASN A HA   2  
ATOM 3742  H HB2  . ASN A 1 97  ? 19.481  9.143   6.218   1.00 0.00 ? 97  ASN A HB2  2  
ATOM 3743  H HB3  . ASN A 1 97  ? 20.737  8.073   6.833   1.00 0.00 ? 97  ASN A HB3  2  
ATOM 3744  H HD21 . ASN A 1 97  ? 19.571  11.359  6.795   1.00 0.00 ? 97  ASN A HD21 2  
ATOM 3745  H HD22 . ASN A 1 97  ? 20.767  12.011  7.809   1.00 0.00 ? 97  ASN A HD22 2  
ATOM 3746  N N    . GLY A 1 98  ? 20.839  10.135  2.855   1.00 0.00 ? 98  GLY A N    2  
ATOM 3747  C CA   . GLY A 1 98  ? 20.358  11.263  2.006   1.00 0.00 ? 98  GLY A CA   2  
ATOM 3748  C C    . GLY A 1 98  ? 21.484  12.267  1.721   1.00 0.00 ? 98  GLY A C    2  
ATOM 3749  O O    . GLY A 1 98  ? 21.238  13.447  1.573   1.00 0.00 ? 98  GLY A O    2  
ATOM 3750  H H    . GLY A 1 98  ? 21.246  9.344   2.443   1.00 0.00 ? 98  GLY A H    2  
ATOM 3751  H HA2  . GLY A 1 98  ? 19.990  10.870  1.069   1.00 0.00 ? 98  GLY A HA2  2  
ATOM 3752  H HA3  . GLY A 1 98  ? 19.553  11.770  2.516   1.00 0.00 ? 98  GLY A HA3  2  
ATOM 3753  N N    . TYR A 1 99  ? 22.695  11.782  1.648   1.00 0.00 ? 99  TYR A N    2  
ATOM 3754  C CA   . TYR A 1 99  ? 23.824  12.707  1.374   1.00 0.00 ? 99  TYR A CA   2  
ATOM 3755  C C    . TYR A 1 99  ? 25.114  11.937  1.095   1.00 0.00 ? 99  TYR A C    2  
ATOM 3756  O O    . TYR A 1 99  ? 25.750  11.439  2.004   1.00 0.00 ? 99  TYR A O    2  
ATOM 3757  C CB   . TYR A 1 99  ? 24.038  13.586  2.613   1.00 0.00 ? 99  TYR A CB   2  
ATOM 3758  C CG   . TYR A 1 99  ? 23.350  14.934  2.404   1.00 0.00 ? 99  TYR A CG   2  
ATOM 3759  C CD1  . TYR A 1 99  ? 23.654  15.715  1.307   1.00 0.00 ? 99  TYR A CD1  2  
ATOM 3760  C CD2  . TYR A 1 99  ? 22.422  15.392  3.315   1.00 0.00 ? 99  TYR A CD2  2  
ATOM 3761  C CE1  . TYR A 1 99  ? 23.039  16.936  1.126   1.00 0.00 ? 99  TYR A CE1  2  
ATOM 3762  C CE2  . TYR A 1 99  ? 21.806  16.612  3.133   1.00 0.00 ? 99  TYR A CE2  2  
ATOM 3763  C CZ   . TYR A 1 99  ? 22.109  17.395  2.038   1.00 0.00 ? 99  TYR A CZ   2  
ATOM 3764  O OH   . TYR A 1 99  ? 21.493  18.617  1.856   1.00 0.00 ? 99  TYR A OH   2  
ATOM 3765  H H    . TYR A 1 99  ? 22.856  10.825  1.777   1.00 0.00 ? 99  TYR A H    2  
ATOM 3766  H HA   . TYR A 1 99  ? 23.577  13.319  0.502   1.00 0.00 ? 99  TYR A HA   2  
ATOM 3767  H HB2  . TYR A 1 99  ? 23.615  13.102  3.482   1.00 0.00 ? 99  TYR A HB2  2  
ATOM 3768  H HB3  . TYR A 1 99  ? 25.093  13.746  2.772   1.00 0.00 ? 99  TYR A HB3  2  
ATOM 3769  H HD1  . TYR A 1 99  ? 24.379  15.368  0.586   1.00 0.00 ? 99  TYR A HD1  2  
ATOM 3770  H HD2  . TYR A 1 99  ? 22.172  14.787  4.175   1.00 0.00 ? 99  TYR A HD2  2  
ATOM 3771  H HE1  . TYR A 1 99  ? 23.286  17.539  0.264   1.00 0.00 ? 99  TYR A HE1  2  
ATOM 3772  H HE2  . TYR A 1 99  ? 21.080  16.959  3.857   1.00 0.00 ? 99  TYR A HE2  2  
ATOM 3773  H HH   . TYR A 1 99  ? 20.564  18.517  2.081   1.00 0.00 ? 99  TYR A HH   2  
ATOM 3774  N N    . ILE A 1 100 ? 25.477  11.854  -0.160  1.00 0.00 ? 100 ILE A N    2  
ATOM 3775  C CA   . ILE A 1 100 ? 26.721  11.123  -0.521  1.00 0.00 ? 100 ILE A CA   2  
ATOM 3776  C C    . ILE A 1 100 ? 27.879  12.101  -0.680  1.00 0.00 ? 100 ILE A C    2  
ATOM 3777  O O    . ILE A 1 100 ? 27.685  13.300  -0.682  1.00 0.00 ? 100 ILE A O    2  
ATOM 3778  C CB   . ILE A 1 100 ? 26.499  10.403  -1.857  1.00 0.00 ? 100 ILE A CB   2  
ATOM 3779  C CG1  . ILE A 1 100 ? 26.168  11.428  -2.941  1.00 0.00 ? 100 ILE A CG1  2  
ATOM 3780  C CG2  . ILE A 1 100 ? 25.306  9.429   -1.703  1.00 0.00 ? 100 ILE A CG2  2  
ATOM 3781  C CD1  . ILE A 1 100 ? 26.212  10.751  -4.318  1.00 0.00 ? 100 ILE A CD1  2  
ATOM 3782  H H    . ILE A 1 100 ? 24.931  12.273  -0.859  1.00 0.00 ? 100 ILE A H    2  
ATOM 3783  H HA   . ILE A 1 100 ? 26.961  10.412  0.269   1.00 0.00 ? 100 ILE A HA   2  
ATOM 3784  H HB   . ILE A 1 100 ? 27.410  9.867   -2.134  1.00 0.00 ? 100 ILE A HB   2  
ATOM 3785  H HG12 . ILE A 1 100 ? 25.187  11.833  -2.767  1.00 0.00 ? 100 ILE A HG12 2  
ATOM 3786  H HG13 . ILE A 1 100 ? 26.889  12.231  -2.910  1.00 0.00 ? 100 ILE A HG13 2  
ATOM 3787  H HG21 . ILE A 1 100 ? 24.882  9.521   -0.715  1.00 0.00 ? 100 ILE A HG21 2  
ATOM 3788  H HG22 . ILE A 1 100 ? 24.549  9.657   -2.436  1.00 0.00 ? 100 ILE A HG22 2  
ATOM 3789  H HG23 . ILE A 1 100 ? 25.645  8.412   -1.850  1.00 0.00 ? 100 ILE A HG23 2  
ATOM 3790  H HD11 . ILE A 1 100 ? 27.158  10.245  -4.445  1.00 0.00 ? 100 ILE A HD11 2  
ATOM 3791  H HD12 . ILE A 1 100 ? 25.411  10.034  -4.401  1.00 0.00 ? 100 ILE A HD12 2  
ATOM 3792  H HD13 . ILE A 1 100 ? 26.103  11.496  -5.092  1.00 0.00 ? 100 ILE A HD13 2  
ATOM 3793  N N    . SER A 1 101 ? 29.066  11.577  -0.805  1.00 0.00 ? 101 SER A N    2  
ATOM 3794  C CA   . SER A 1 101 ? 30.238  12.471  -0.965  1.00 0.00 ? 101 SER A CA   2  
ATOM 3795  C C    . SER A 1 101 ? 30.341  12.960  -2.410  1.00 0.00 ? 101 SER A C    2  
ATOM 3796  O O    . SER A 1 101 ? 30.184  12.192  -3.338  1.00 0.00 ? 101 SER A O    2  
ATOM 3797  C CB   . SER A 1 101 ? 31.505  11.672  -0.611  1.00 0.00 ? 101 SER A CB   2  
ATOM 3798  O OG   . SER A 1 101 ? 31.036  10.649  0.259   1.00 0.00 ? 101 SER A OG   2  
ATOM 3799  H H    . SER A 1 101 ? 29.182  10.604  -0.795  1.00 0.00 ? 101 SER A H    2  
ATOM 3800  H HA   . SER A 1 101 ? 30.122  13.332  -0.304  1.00 0.00 ? 101 SER A HA   2  
ATOM 3801  H HB2  . SER A 1 101 ? 31.944  11.237  -1.497  1.00 0.00 ? 101 SER A HB2  2  
ATOM 3802  H HB3  . SER A 1 101 ? 32.223  12.297  -0.101  1.00 0.00 ? 101 SER A HB3  2  
ATOM 3803  H HG   . SER A 1 101 ? 31.760  10.038  0.418   1.00 0.00 ? 101 SER A HG   2  
ATOM 3804  N N    . ALA A 1 102 ? 30.600  14.234  -2.576  1.00 0.00 ? 102 ALA A N    2  
ATOM 3805  C CA   . ALA A 1 102 ? 30.715  14.780  -3.953  1.00 0.00 ? 102 ALA A CA   2  
ATOM 3806  C C    . ALA A 1 102 ? 31.845  14.095  -4.704  1.00 0.00 ? 102 ALA A C    2  
ATOM 3807  O O    . ALA A 1 102 ? 31.781  13.921  -5.905  1.00 0.00 ? 102 ALA A O    2  
ATOM 3808  C CB   . ALA A 1 102 ? 31.014  16.282  -3.864  1.00 0.00 ? 102 ALA A CB   2  
ATOM 3809  H H    . ALA A 1 102 ? 30.720  14.816  -1.804  1.00 0.00 ? 102 ALA A H    2  
ATOM 3810  H HA   . ALA A 1 102 ? 29.778  14.604  -4.481  1.00 0.00 ? 102 ALA A HA   2  
ATOM 3811  H HB1  . ALA A 1 102 ? 31.915  16.440  -3.294  1.00 0.00 ? 102 ALA A HB1  2  
ATOM 3812  H HB2  . ALA A 1 102 ? 31.145  16.686  -4.857  1.00 0.00 ? 102 ALA A HB2  2  
ATOM 3813  H HB3  . ALA A 1 102 ? 30.193  16.790  -3.379  1.00 0.00 ? 102 ALA A HB3  2  
ATOM 3814  N N    . ALA A 1 103 ? 32.869  13.727  -3.984  1.00 0.00 ? 103 ALA A N    2  
ATOM 3815  C CA   . ALA A 1 103 ? 34.008  13.050  -4.638  1.00 0.00 ? 103 ALA A CA   2  
ATOM 3816  C C    . ALA A 1 103 ? 33.550  11.706  -5.171  1.00 0.00 ? 103 ALA A C    2  
ATOM 3817  O O    . ALA A 1 103 ? 33.577  11.455  -6.364  1.00 0.00 ? 103 ALA A O    2  
ATOM 3818  C CB   . ALA A 1 103 ? 35.112  12.827  -3.591  1.00 0.00 ? 103 ALA A CB   2  
ATOM 3819  H H    . ALA A 1 103 ? 32.881  13.896  -3.019  1.00 0.00 ? 103 ALA A H    2  
ATOM 3820  H HA   . ALA A 1 103 ? 34.365  13.663  -5.465  1.00 0.00 ? 103 ALA A HA   2  
ATOM 3821  H HB1  . ALA A 1 103 ? 34.716  12.263  -2.760  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3822  H HB2  . ALA A 1 103 ? 35.931  12.281  -4.034  1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3823  H HB3  . ALA A 1 103 ? 35.472  13.781  -3.232  1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3824  N N    . GLU A 1 104 ? 33.127  10.862  -4.274  1.00 0.00 ? 104 GLU A N    2  
ATOM 3825  C CA   . GLU A 1 104 ? 32.659  9.532   -4.702  1.00 0.00 ? 104 GLU A CA   2  
ATOM 3826  C C    . GLU A 1 104 ? 31.628  9.694   -5.799  1.00 0.00 ? 104 GLU A C    2  
ATOM 3827  O O    . GLU A 1 104 ? 31.588  8.929   -6.742  1.00 0.00 ? 104 GLU A O    2  
ATOM 3828  C CB   . GLU A 1 104 ? 32.005  8.830   -3.497  1.00 0.00 ? 104 GLU A CB   2  
ATOM 3829  C CG   . GLU A 1 104 ? 32.018  7.314   -3.719  1.00 0.00 ? 104 GLU A CG   2  
ATOM 3830  C CD   . GLU A 1 104 ? 32.065  6.607   -2.364  1.00 0.00 ? 104 GLU A CD   2  
ATOM 3831  O OE1  . GLU A 1 104 ? 31.303  7.027   -1.509  1.00 0.00 ? 104 GLU A OE1  2  
ATOM 3832  O OE2  . GLU A 1 104 ? 32.858  5.687   -2.261  1.00 0.00 ? 104 GLU A OE2  2  
ATOM 3833  H H    . GLU A 1 104 ? 33.122  11.108  -3.327  1.00 0.00 ? 104 GLU A H    2  
ATOM 3834  H HA   . GLU A 1 104 ? 33.504  8.960   -5.083  1.00 0.00 ? 104 GLU A HA   2  
ATOM 3835  H HB2  . GLU A 1 104 ? 32.553  9.069   -2.598  1.00 0.00 ? 104 GLU A HB2  2  
ATOM 3836  H HB3  . GLU A 1 104 ? 30.986  9.171   -3.390  1.00 0.00 ? 104 GLU A HB3  2  
ATOM 3837  H HG2  . GLU A 1 104 ? 31.124  7.014   -4.247  1.00 0.00 ? 104 GLU A HG2  2  
ATOM 3838  H HG3  . GLU A 1 104 ? 32.884  7.032   -4.297  1.00 0.00 ? 104 GLU A HG3  2  
ATOM 3839  N N    . LEU A 1 105 ? 30.804  10.700  -5.656  1.00 0.00 ? 105 LEU A N    2  
ATOM 3840  C CA   . LEU A 1 105 ? 29.768  10.938  -6.678  1.00 0.00 ? 105 LEU A CA   2  
ATOM 3841  C C    . LEU A 1 105 ? 30.430  11.158  -8.023  1.00 0.00 ? 105 LEU A C    2  
ATOM 3842  O O    . LEU A 1 105 ? 29.981  10.659  -9.028  1.00 0.00 ? 105 LEU A O    2  
ATOM 3843  C CB   . LEU A 1 105 ? 28.981  12.194  -6.281  1.00 0.00 ? 105 LEU A CB   2  
ATOM 3844  C CG   . LEU A 1 105 ? 28.300  12.795  -7.518  1.00 0.00 ? 105 LEU A CG   2  
ATOM 3845  C CD1  . LEU A 1 105 ? 26.910  13.289  -7.131  1.00 0.00 ? 105 LEU A CD1  2  
ATOM 3846  C CD2  . LEU A 1 105 ? 29.126  13.979  -8.029  1.00 0.00 ? 105 LEU A CD2  2  
ATOM 3847  H H    . LEU A 1 105 ? 30.878  11.294  -4.878  1.00 0.00 ? 105 LEU A H    2  
ATOM 3848  H HA   . LEU A 1 105 ? 29.111  10.065  -6.738  1.00 0.00 ? 105 LEU A HA   2  
ATOM 3849  H HB2  . LEU A 1 105 ? 28.233  11.929  -5.547  1.00 0.00 ? 105 LEU A HB2  2  
ATOM 3850  H HB3  . LEU A 1 105 ? 29.652  12.917  -5.852  1.00 0.00 ? 105 LEU A HB3  2  
ATOM 3851  H HG   . LEU A 1 105 ? 28.214  12.050  -8.291  1.00 0.00 ? 105 LEU A HG   2  
ATOM 3852  H HD11 . LEU A 1 105 ? 26.893  13.548  -6.084  1.00 0.00 ? 105 LEU A HD11 2  
ATOM 3853  H HD12 . LEU A 1 105 ? 26.661  14.157  -7.714  1.00 0.00 ? 105 LEU A HD12 2  
ATOM 3854  H HD13 . LEU A 1 105 ? 26.183  12.511  -7.316  1.00 0.00 ? 105 LEU A HD13 2  
ATOM 3855  H HD21 . LEU A 1 105 ? 29.259  14.701  -7.234  1.00 0.00 ? 105 LEU A HD21 2  
ATOM 3856  H HD22 . LEU A 1 105 ? 30.092  13.635  -8.358  1.00 0.00 ? 105 LEU A HD22 2  
ATOM 3857  H HD23 . LEU A 1 105 ? 28.616  14.451  -8.856  1.00 0.00 ? 105 LEU A HD23 2  
ATOM 3858  N N    . ARG A 1 106 ? 31.491  11.910  -8.023  1.00 0.00 ? 106 ARG A N    2  
ATOM 3859  C CA   . ARG A 1 106 ? 32.175  12.154  -9.298  1.00 0.00 ? 106 ARG A CA   2  
ATOM 3860  C C    . ARG A 1 106 ? 32.561  10.823  -9.899  1.00 0.00 ? 106 ARG A C    2  
ATOM 3861  O O    . ARG A 1 106 ? 32.667  10.679  -11.101 1.00 0.00 ? 106 ARG A O    2  
ATOM 3862  C CB   . ARG A 1 106 ? 33.442  12.979  -9.032  1.00 0.00 ? 106 ARG A CB   2  
ATOM 3863  C CG   . ARG A 1 106 ? 33.933  13.580  -10.352 1.00 0.00 ? 106 ARG A CG   2  
ATOM 3864  C CD   . ARG A 1 106 ? 35.406  13.973  -10.212 1.00 0.00 ? 106 ARG A CD   2  
ATOM 3865  N NE   . ARG A 1 106 ? 35.493  15.301  -9.539  1.00 0.00 ? 106 ARG A NE   2  
ATOM 3866  C CZ   . ARG A 1 106 ? 35.878  16.344  -10.225 1.00 0.00 ? 106 ARG A CZ   2  
ATOM 3867  N NH1  . ARG A 1 106 ? 37.049  16.324  -10.800 1.00 0.00 ? 106 ARG A NH1  2  
ATOM 3868  N NH2  . ARG A 1 106 ? 35.078  17.370  -10.313 1.00 0.00 ? 106 ARG A NH2  2  
ATOM 3869  H H    . ARG A 1 106 ? 31.827  12.303  -7.191  1.00 0.00 ? 106 ARG A H    2  
ATOM 3870  H HA   . ARG A 1 106 ? 31.496  12.672  -9.978  1.00 0.00 ? 106 ARG A HA   2  
ATOM 3871  H HB2  . ARG A 1 106 ? 33.218  13.771  -8.334  1.00 0.00 ? 106 ARG A HB2  2  
ATOM 3872  H HB3  . ARG A 1 106 ? 34.206  12.342  -8.613  1.00 0.00 ? 106 ARG A HB3  2  
ATOM 3873  H HG2  . ARG A 1 106 ? 33.825  12.852  -11.143 1.00 0.00 ? 106 ARG A HG2  2  
ATOM 3874  H HG3  . ARG A 1 106 ? 33.346  14.454  -10.593 1.00 0.00 ? 106 ARG A HG3  2  
ATOM 3875  H HD2  . ARG A 1 106 ? 35.930  13.237  -9.620  1.00 0.00 ? 106 ARG A HD2  2  
ATOM 3876  H HD3  . ARG A 1 106 ? 35.862  14.036  -11.189 1.00 0.00 ? 106 ARG A HD3  2  
ATOM 3877  H HE   . ARG A 1 106 ? 35.264  15.390  -8.590  1.00 0.00 ? 106 ARG A HE   2  
ATOM 3878  H HH11 . ARG A 1 106 ? 37.636  15.520  -10.711 1.00 0.00 ? 106 ARG A HH11 2  
ATOM 3879  H HH12 . ARG A 1 106 ? 37.360  17.114  -11.330 1.00 0.00 ? 106 ARG A HH12 2  
ATOM 3880  H HH21 . ARG A 1 106 ? 34.187  17.351  -9.860  1.00 0.00 ? 106 ARG A HH21 2  
ATOM 3881  H HH22 . ARG A 1 106 ? 35.356  18.177  -10.834 1.00 0.00 ? 106 ARG A HH22 2  
ATOM 3882  N N    . HIS A 1 107 ? 32.768  9.863   -9.036  1.00 0.00 ? 107 HIS A N    2  
ATOM 3883  C CA   . HIS A 1 107 ? 33.146  8.522   -9.515  1.00 0.00 ? 107 HIS A CA   2  
ATOM 3884  C C    . HIS A 1 107 ? 31.913  7.792   -10.029 1.00 0.00 ? 107 HIS A C    2  
ATOM 3885  O O    . HIS A 1 107 ? 32.003  6.959   -10.911 1.00 0.00 ? 107 HIS A O    2  
ATOM 3886  C CB   . HIS A 1 107 ? 33.743  7.731   -8.340  1.00 0.00 ? 107 HIS A CB   2  
ATOM 3887  C CG   . HIS A 1 107 ? 34.917  6.884   -8.842  1.00 0.00 ? 107 HIS A CG   2  
ATOM 3888  N ND1  . HIS A 1 107 ? 36.041  7.332   -9.150  1.00 0.00 ? 107 HIS A ND1  2  
ATOM 3889  C CD2  . HIS A 1 107 ? 34.997  5.518   -9.046  1.00 0.00 ? 107 HIS A CD2  2  
ATOM 3890  C CE1  . HIS A 1 107 ? 36.824  6.406   -9.525  1.00 0.00 ? 107 HIS A CE1  2  
ATOM 3891  N NE2  . HIS A 1 107 ? 36.245  5.206   -9.492  1.00 0.00 ? 107 HIS A NE2  2  
ATOM 3892  H H    . HIS A 1 107 ? 32.681  10.039  -8.073  1.00 0.00 ? 107 HIS A H    2  
ATOM 3893  H HA   . HIS A 1 107 ? 33.868  8.624   -10.327 1.00 0.00 ? 107 HIS A HA   2  
ATOM 3894  H HB2  . HIS A 1 107 ? 34.095  8.414   -7.581  1.00 0.00 ? 107 HIS A HB2  2  
ATOM 3895  H HB3  . HIS A 1 107 ? 32.992  7.084   -7.917  1.00 0.00 ? 107 HIS A HB3  2  
ATOM 3896  H HD1  . HIS A 1 107 ? 36.287  8.279   -9.111  1.00 0.00 ? 107 HIS A HD1  2  
ATOM 3897  H HD2  . HIS A 1 107 ? 34.197  4.813   -8.876  1.00 0.00 ? 107 HIS A HD2  2  
ATOM 3898  H HE1  . HIS A 1 107 ? 37.846  6.572   -9.832  1.00 0.00 ? 107 HIS A HE1  2  
ATOM 3899  N N    . VAL A 1 108 ? 30.771  8.116   -9.462  1.00 0.00 ? 108 VAL A N    2  
ATOM 3900  C CA   . VAL A 1 108 ? 29.529  7.445   -9.914  1.00 0.00 ? 108 VAL A CA   2  
ATOM 3901  C C    . VAL A 1 108 ? 29.263  7.780   -11.369 1.00 0.00 ? 108 VAL A C    2  
ATOM 3902  O O    . VAL A 1 108 ? 28.869  6.935   -12.141 1.00 0.00 ? 108 VAL A O    2  
ATOM 3903  C CB   . VAL A 1 108 ? 28.333  7.952   -9.082  1.00 0.00 ? 108 VAL A CB   2  
ATOM 3904  C CG1  . VAL A 1 108 ? 27.037  7.476   -9.747  1.00 0.00 ? 108 VAL A CG1  2  
ATOM 3905  C CG2  . VAL A 1 108 ? 28.416  7.393   -7.662  1.00 0.00 ? 108 VAL A CG2  2  
ATOM 3906  H H    . VAL A 1 108 ? 30.741  8.793   -8.753  1.00 0.00 ? 108 VAL A H    2  
ATOM 3907  H HA   . VAL A 1 108 ? 29.646  6.368   -9.811  1.00 0.00 ? 108 VAL A HA   2  
ATOM 3908  H HB   . VAL A 1 108 ? 28.342  9.021   -9.047  1.00 0.00 ? 108 VAL A HB   2  
ATOM 3909  H HG11 . VAL A 1 108 ? 27.086  6.412   -9.920  1.00 0.00 ? 108 VAL A HG11 2  
ATOM 3910  H HG12 . VAL A 1 108 ? 26.196  7.695   -9.108  1.00 0.00 ? 108 VAL A HG12 2  
ATOM 3911  H HG13 . VAL A 1 108 ? 26.906  7.982   -10.693 1.00 0.00 ? 108 VAL A HG13 2  
ATOM 3912  H HG21 . VAL A 1 108 ? 29.407  7.557   -7.262  1.00 0.00 ? 108 VAL A HG21 2  
ATOM 3913  H HG22 . VAL A 1 108 ? 27.692  7.893   -7.032  1.00 0.00 ? 108 VAL A HG22 2  
ATOM 3914  H HG23 . VAL A 1 108 ? 28.207  6.336   -7.673  1.00 0.00 ? 108 VAL A HG23 2  
ATOM 3915  N N    . MET A 1 109 ? 29.497  9.020   -11.718 1.00 0.00 ? 109 MET A N    2  
ATOM 3916  C CA   . MET A 1 109 ? 29.265  9.438   -13.116 1.00 0.00 ? 109 MET A CA   2  
ATOM 3917  C C    . MET A 1 109 ? 30.095  8.585   -14.054 1.00 0.00 ? 109 MET A C    2  
ATOM 3918  O O    . MET A 1 109 ? 29.693  8.293   -15.162 1.00 0.00 ? 109 MET A O    2  
ATOM 3919  C CB   . MET A 1 109 ? 29.689  10.910  -13.261 1.00 0.00 ? 109 MET A CB   2  
ATOM 3920  C CG   . MET A 1 109 ? 28.902  11.773  -12.260 1.00 0.00 ? 109 MET A CG   2  
ATOM 3921  S SD   . MET A 1 109 ? 27.979  10.922  -10.954 1.00 0.00 ? 109 MET A SD   2  
ATOM 3922  C CE   . MET A 1 109 ? 26.431  10.718  -11.866 1.00 0.00 ? 109 MET A CE   2  
ATOM 3923  H H    . MET A 1 109 ? 29.838  9.665   -11.058 1.00 0.00 ? 109 MET A H    2  
ATOM 3924  H HA   . MET A 1 109 ? 28.211  9.308   -13.358 1.00 0.00 ? 109 MET A HA   2  
ATOM 3925  H HB2  . MET A 1 109 ? 30.747  11.003  -13.063 1.00 0.00 ? 109 MET A HB2  2  
ATOM 3926  H HB3  . MET A 1 109 ? 29.488  11.249  -14.267 1.00 0.00 ? 109 MET A HB3  2  
ATOM 3927  H HG2  . MET A 1 109 ? 29.596  12.447  -11.780 1.00 0.00 ? 109 MET A HG2  2  
ATOM 3928  H HG3  . MET A 1 109 ? 28.197  12.372  -12.816 1.00 0.00 ? 109 MET A HG3  2  
ATOM 3929  H HE1  . MET A 1 109 ? 26.617  10.837  -12.922 1.00 0.00 ? 109 MET A HE1  2  
ATOM 3930  H HE2  . MET A 1 109 ? 26.030  9.735   -11.679 1.00 0.00 ? 109 MET A HE2  2  
ATOM 3931  H HE3  . MET A 1 109 ? 25.722  11.464  -11.540 1.00 0.00 ? 109 MET A HE3  2  
ATOM 3932  N N    . THR A 1 110 ? 31.246  8.202   -13.587 1.00 0.00 ? 110 THR A N    2  
ATOM 3933  C CA   . THR A 1 110 ? 32.129  7.367   -14.421 1.00 0.00 ? 110 THR A CA   2  
ATOM 3934  C C    . THR A 1 110 ? 31.507  5.986   -14.610 1.00 0.00 ? 110 THR A C    2  
ATOM 3935  O O    . THR A 1 110 ? 31.555  5.417   -15.681 1.00 0.00 ? 110 THR A O    2  
ATOM 3936  C CB   . THR A 1 110 ? 33.474  7.227   -13.686 1.00 0.00 ? 110 THR A CB   2  
ATOM 3937  O OG1  . THR A 1 110 ? 34.403  7.950   -14.464 1.00 0.00 ? 110 THR A OG1  2  
ATOM 3938  C CG2  . THR A 1 110 ? 33.989  5.778   -13.721 1.00 0.00 ? 110 THR A CG2  2  
ATOM 3939  H H    . THR A 1 110 ? 31.525  8.469   -12.686 1.00 0.00 ? 110 THR A H    2  
ATOM 3940  H HA   . THR A 1 110 ? 32.259  7.838   -15.393 1.00 0.00 ? 110 THR A HA   2  
ATOM 3941  H HB   . THR A 1 110 ? 33.420  7.628   -12.676 1.00 0.00 ? 110 THR A HB   2  
ATOM 3942  H HG1  . THR A 1 110 ? 35.078  7.338   -14.766 1.00 0.00 ? 110 THR A HG1  2  
ATOM 3943  H HG21 . THR A 1 110 ? 33.911  5.390   -14.724 1.00 0.00 ? 110 THR A HG21 2  
ATOM 3944  H HG22 . THR A 1 110 ? 35.021  5.751   -13.406 1.00 0.00 ? 110 THR A HG22 2  
ATOM 3945  H HG23 . THR A 1 110 ? 33.396  5.166   -13.055 1.00 0.00 ? 110 THR A HG23 2  
ATOM 3946  N N    . ASN A 1 111 ? 30.935  5.481   -13.553 1.00 0.00 ? 111 ASN A N    2  
ATOM 3947  C CA   . ASN A 1 111 ? 30.299  4.142   -13.628 1.00 0.00 ? 111 ASN A CA   2  
ATOM 3948  C C    . ASN A 1 111 ? 29.191  4.116   -14.679 1.00 0.00 ? 111 ASN A C    2  
ATOM 3949  O O    . ASN A 1 111 ? 29.131  3.219   -15.495 1.00 0.00 ? 111 ASN A O    2  
ATOM 3950  C CB   . ASN A 1 111 ? 29.689  3.820   -12.255 1.00 0.00 ? 111 ASN A CB   2  
ATOM 3951  C CG   . ASN A 1 111 ? 29.457  2.312   -12.145 1.00 0.00 ? 111 ASN A CG   2  
ATOM 3952  O OD1  . ASN A 1 111 ? 29.955  1.536   -12.937 1.00 0.00 ? 111 ASN A OD1  2  
ATOM 3953  N ND2  . ASN A 1 111 ? 28.706  1.857   -11.180 1.00 0.00 ? 111 ASN A ND2  2  
ATOM 3954  H H    . ASN A 1 111 ? 30.930  5.984   -12.711 1.00 0.00 ? 111 ASN A H    2  
ATOM 3955  H HA   . ASN A 1 111 ? 31.056  3.406   -13.897 1.00 0.00 ? 111 ASN A HA   2  
ATOM 3956  H HB2  . ASN A 1 111 ? 30.366  4.135   -11.473 1.00 0.00 ? 111 ASN A HB2  2  
ATOM 3957  H HB3  . ASN A 1 111 ? 28.749  4.336   -12.143 1.00 0.00 ? 111 ASN A HB3  2  
ATOM 3958  H HD21 . ASN A 1 111 ? 28.303  2.478   -10.538 1.00 0.00 ? 111 ASN A HD21 2  
ATOM 3959  H HD22 . ASN A 1 111 ? 28.546  0.894   -11.095 1.00 0.00 ? 111 ASN A HD22 2  
ATOM 3960  N N    . LEU A 1 112 ? 28.332  5.103   -14.645 1.00 0.00 ? 112 LEU A N    2  
ATOM 3961  C CA   . LEU A 1 112 ? 27.230  5.134   -15.642 1.00 0.00 ? 112 LEU A CA   2  
ATOM 3962  C C    . LEU A 1 112 ? 27.791  5.291   -17.035 1.00 0.00 ? 112 LEU A C    2  
ATOM 3963  O O    . LEU A 1 112 ? 27.474  4.535   -17.931 1.00 0.00 ? 112 LEU A O    2  
ATOM 3964  C CB   . LEU A 1 112 ? 26.322  6.340   -15.340 1.00 0.00 ? 112 LEU A CB   2  
ATOM 3965  C CG   . LEU A 1 112 ? 26.025  6.370   -13.854 1.00 0.00 ? 112 LEU A CG   2  
ATOM 3966  C CD1  . LEU A 1 112 ? 25.333  7.689   -13.504 1.00 0.00 ? 112 LEU A CD1  2  
ATOM 3967  C CD2  . LEU A 1 112 ? 25.098  5.203   -13.504 1.00 0.00 ? 112 LEU A CD2  2  
ATOM 3968  H H    . LEU A 1 112 ? 28.420  5.818   -13.978 1.00 0.00 ? 112 LEU A H    2  
ATOM 3969  H HA   . LEU A 1 112 ? 26.672  4.203   -15.586 1.00 0.00 ? 112 LEU A HA   2  
ATOM 3970  H HB2  . LEU A 1 112 ? 26.821  7.254   -15.627 1.00 0.00 ? 112 LEU A HB2  2  
ATOM 3971  H HB3  . LEU A 1 112 ? 25.400  6.250   -15.892 1.00 0.00 ? 112 LEU A HB3  2  
ATOM 3972  H HG   . LEU A 1 112 ? 26.946  6.285   -13.306 1.00 0.00 ? 112 LEU A HG   2  
ATOM 3973  H HD11 . LEU A 1 112 ? 24.559  7.899   -14.229 1.00 0.00 ? 112 LEU A HD11 2  
ATOM 3974  H HD12 . LEU A 1 112 ? 24.891  7.620   -12.521 1.00 0.00 ? 112 LEU A HD12 2  
ATOM 3975  H HD13 . LEU A 1 112 ? 26.055  8.494   -13.513 1.00 0.00 ? 112 LEU A HD13 2  
ATOM 3976  H HD21 . LEU A 1 112 ? 24.262  5.183   -14.191 1.00 0.00 ? 112 LEU A HD21 2  
ATOM 3977  H HD22 . LEU A 1 112 ? 25.640  4.271   -13.578 1.00 0.00 ? 112 LEU A HD22 2  
ATOM 3978  H HD23 . LEU A 1 112 ? 24.728  5.319   -12.498 1.00 0.00 ? 112 LEU A HD23 2  
ATOM 3979  N N    . GLY A 1 113 ? 28.619  6.273   -17.192 1.00 0.00 ? 113 GLY A N    2  
ATOM 3980  C CA   . GLY A 1 113 ? 29.225  6.508   -18.530 1.00 0.00 ? 113 GLY A CA   2  
ATOM 3981  C C    . GLY A 1 113 ? 28.148  6.930   -19.527 1.00 0.00 ? 113 GLY A C    2  
ATOM 3982  O O    . GLY A 1 113 ? 27.567  6.101   -20.201 1.00 0.00 ? 113 GLY A O    2  
ATOM 3983  H H    . GLY A 1 113 ? 28.838  6.858   -16.430 1.00 0.00 ? 113 GLY A H    2  
ATOM 3984  H HA2  . GLY A 1 113 ? 29.970  7.287   -18.454 1.00 0.00 ? 113 GLY A HA2  2  
ATOM 3985  H HA3  . GLY A 1 113 ? 29.694  5.598   -18.875 1.00 0.00 ? 113 GLY A HA3  2  
ATOM 3986  N N    . GLU A 1 114 ? 27.906  8.213   -19.593 1.00 0.00 ? 114 GLU A N    2  
ATOM 3987  C CA   . GLU A 1 114 ? 26.877  8.729   -20.529 1.00 0.00 ? 114 GLU A CA   2  
ATOM 3988  C C    . GLU A 1 114 ? 27.428  9.885   -21.332 1.00 0.00 ? 114 GLU A C    2  
ATOM 3989  O O    . GLU A 1 114 ? 26.688  10.722  -21.814 1.00 0.00 ? 114 GLU A O    2  
ATOM 3990  C CB   . GLU A 1 114 ? 25.696  9.230   -19.708 1.00 0.00 ? 114 GLU A CB   2  
ATOM 3991  C CG   . GLU A 1 114 ? 25.450  8.267   -18.548 1.00 0.00 ? 114 GLU A CG   2  
ATOM 3992  C CD   . GLU A 1 114 ? 24.009  8.423   -18.058 1.00 0.00 ? 114 GLU A CD   2  
ATOM 3993  O OE1  . GLU A 1 114 ? 23.349  9.301   -18.588 1.00 0.00 ? 114 GLU A OE1  2  
ATOM 3994  O OE2  . GLU A 1 114 ? 23.650  7.655   -17.180 1.00 0.00 ? 114 GLU A OE2  2  
ATOM 3995  H H    . GLU A 1 114 ? 28.405  8.833   -19.028 1.00 0.00 ? 114 GLU A H    2  
ATOM 3996  H HA   . GLU A 1 114 ? 26.575  7.938   -21.206 1.00 0.00 ? 114 GLU A HA   2  
ATOM 3997  H HB2  . GLU A 1 114 ? 25.919  10.214  -19.323 1.00 0.00 ? 114 GLU A HB2  2  
ATOM 3998  H HB3  . GLU A 1 114 ? 24.820  9.280   -20.332 1.00 0.00 ? 114 GLU A HB3  2  
ATOM 3999  H HG2  . GLU A 1 114 ? 25.607  7.250   -18.878 1.00 0.00 ? 114 GLU A HG2  2  
ATOM 4000  H HG3  . GLU A 1 114 ? 26.130  8.489   -17.738 1.00 0.00 ? 114 GLU A HG3  2  
ATOM 4001  N N    . LYS A 1 115 ? 28.719  9.913   -21.445 1.00 0.00 ? 115 LYS A N    2  
ATOM 4002  C CA   . LYS A 1 115 ? 29.378  11.001  -22.211 1.00 0.00 ? 115 LYS A CA   2  
ATOM 4003  C C    . LYS A 1 115 ? 29.427  12.285  -21.395 1.00 0.00 ? 115 LYS A C    2  
ATOM 4004  O O    . LYS A 1 115 ? 29.313  13.370  -21.932 1.00 0.00 ? 115 LYS A O    2  
ATOM 4005  C CB   . LYS A 1 115 ? 28.575  11.253  -23.497 1.00 0.00 ? 115 LYS A CB   2  
ATOM 4006  C CG   . LYS A 1 115 ? 29.543  11.565  -24.638 1.00 0.00 ? 115 LYS A CG   2  
ATOM 4007  C CD   . LYS A 1 115 ? 28.744  11.839  -25.912 1.00 0.00 ? 115 LYS A CD   2  
ATOM 4008  C CE   . LYS A 1 115 ? 29.653  12.523  -26.934 1.00 0.00 ? 115 LYS A CE   2  
ATOM 4009  N NZ   . LYS A 1 115 ? 29.595  14.002  -26.772 1.00 0.00 ? 115 LYS A NZ   2  
ATOM 4010  H H    . LYS A 1 115 ? 29.255  9.223   -21.014 1.00 0.00 ? 115 LYS A H    2  
ATOM 4011  H HA   . LYS A 1 115 ? 30.397  10.697  -22.449 1.00 0.00 ? 115 LYS A HA   2  
ATOM 4012  H HB2  . LYS A 1 115 ? 27.999  10.372  -23.743 1.00 0.00 ? 115 LYS A HB2  2  
ATOM 4013  H HB3  . LYS A 1 115 ? 27.904  12.086  -23.350 1.00 0.00 ? 115 LYS A HB3  2  
ATOM 4014  H HG2  . LYS A 1 115 ? 30.133  12.434  -24.386 1.00 0.00 ? 115 LYS A HG2  2  
ATOM 4015  H HG3  . LYS A 1 115 ? 30.201  10.723  -24.797 1.00 0.00 ? 115 LYS A HG3  2  
ATOM 4016  H HD2  . LYS A 1 115 ? 28.377  10.908  -26.318 1.00 0.00 ? 115 LYS A HD2  2  
ATOM 4017  H HD3  . LYS A 1 115 ? 27.907  12.481  -25.682 1.00 0.00 ? 115 LYS A HD3  2  
ATOM 4018  H HE2  . LYS A 1 115 ? 30.671  12.192  -26.792 1.00 0.00 ? 115 LYS A HE2  2  
ATOM 4019  H HE3  . LYS A 1 115 ? 29.333  12.265  -27.932 1.00 0.00 ? 115 LYS A HE3  2  
ATOM 4020  H HZ1  . LYS A 1 115 ? 29.861  14.255  -25.798 1.00 0.00 ? 115 LYS A HZ1  2  
ATOM 4021  H HZ2  . LYS A 1 115 ? 30.255  14.451  -27.439 1.00 0.00 ? 115 LYS A HZ2  2  
ATOM 4022  H HZ3  . LYS A 1 115 ? 28.629  14.335  -26.965 1.00 0.00 ? 115 LYS A HZ3  2  
ATOM 4023  N N    . LEU A 1 116 ? 29.595  12.139  -20.109 1.00 0.00 ? 116 LEU A N    2  
ATOM 4024  C CA   . LEU A 1 116 ? 29.655  13.339  -19.239 1.00 0.00 ? 116 LEU A CA   2  
ATOM 4025  C C    . LEU A 1 116 ? 31.099  13.786  -19.038 1.00 0.00 ? 116 LEU A C    2  
ATOM 4026  O O    . LEU A 1 116 ? 31.800  13.266  -18.192 1.00 0.00 ? 116 LEU A O    2  
ATOM 4027  C CB   . LEU A 1 116 ? 29.057  12.977  -17.870 1.00 0.00 ? 116 LEU A CB   2  
ATOM 4028  C CG   . LEU A 1 116 ? 27.602  13.449  -17.814 1.00 0.00 ? 116 LEU A CG   2  
ATOM 4029  C CD1  . LEU A 1 116 ? 26.975  12.985  -16.499 1.00 0.00 ? 116 LEU A CD1  2  
ATOM 4030  C CD2  . LEU A 1 116 ? 27.563  14.976  -17.877 1.00 0.00 ? 116 LEU A CD2  2  
ATOM 4031  H H    . LEU A 1 116 ? 29.680  11.243  -19.721 1.00 0.00 ? 116 LEU A H    2  
ATOM 4032  H HA   . LEU A 1 116 ? 29.094  14.147  -19.705 1.00 0.00 ? 116 LEU A HA   2  
ATOM 4033  H HB2  . LEU A 1 116 ? 29.099  11.907  -17.728 1.00 0.00 ? 116 LEU A HB2  2  
ATOM 4034  H HB3  . LEU A 1 116 ? 29.625  13.459  -17.089 1.00 0.00 ? 116 LEU A HB3  2  
ATOM 4035  H HG   . LEU A 1 116 ? 27.052  13.035  -18.647 1.00 0.00 ? 116 LEU A HG   2  
ATOM 4036  H HD11 . LEU A 1 116 ? 27.528  13.398  -15.668 1.00 0.00 ? 116 LEU A HD11 2  
ATOM 4037  H HD12 . LEU A 1 116 ? 25.950  13.319  -16.446 1.00 0.00 ? 116 LEU A HD12 2  
ATOM 4038  H HD13 . LEU A 1 116 ? 27.001  11.906  -16.442 1.00 0.00 ? 116 LEU A HD13 2  
ATOM 4039  H HD21 . LEU A 1 116 ? 28.549  15.374  -17.689 1.00 0.00 ? 116 LEU A HD21 2  
ATOM 4040  H HD22 . LEU A 1 116 ? 27.232  15.293  -18.854 1.00 0.00 ? 116 LEU A HD22 2  
ATOM 4041  H HD23 . LEU A 1 116 ? 26.878  15.354  -17.130 1.00 0.00 ? 116 LEU A HD23 2  
ATOM 4042  N N    . THR A 1 117 ? 31.518  14.743  -19.819 1.00 0.00 ? 117 THR A N    2  
ATOM 4043  C CA   . THR A 1 117 ? 32.913  15.235  -19.687 1.00 0.00 ? 117 THR A CA   2  
ATOM 4044  C C    . THR A 1 117 ? 33.218  15.624  -18.245 1.00 0.00 ? 117 THR A C    2  
ATOM 4045  O O    . THR A 1 117 ? 32.323  15.789  -17.441 1.00 0.00 ? 117 THR A O    2  
ATOM 4046  C CB   . THR A 1 117 ? 33.073  16.472  -20.571 1.00 0.00 ? 117 THR A CB   2  
ATOM 4047  O OG1  . THR A 1 117 ? 32.388  16.167  -21.769 1.00 0.00 ? 117 THR A OG1  2  
ATOM 4048  C CG2  . THR A 1 117 ? 34.536  16.657  -20.998 1.00 0.00 ? 117 THR A CG2  2  
ATOM 4049  H H    . THR A 1 117 ? 30.919  15.133  -20.489 1.00 0.00 ? 117 THR A H    2  
ATOM 4050  H HA   . THR A 1 117 ? 33.598  14.449  -19.995 1.00 0.00 ? 117 THR A HA   2  
ATOM 4051  H HB   . THR A 1 117 ? 32.656  17.357  -20.102 1.00 0.00 ? 117 THR A HB   2  
ATOM 4052  H HG1  . THR A 1 117 ? 33.030  15.834  -22.400 1.00 0.00 ? 117 THR A HG1  2  
ATOM 4053  H HG21 . THR A 1 117 ? 34.959  15.701  -21.273 1.00 0.00 ? 117 THR A HG21 2  
ATOM 4054  H HG22 . THR A 1 117 ? 34.586  17.324  -21.846 1.00 0.00 ? 117 THR A HG22 2  
ATOM 4055  H HG23 . THR A 1 117 ? 35.105  17.075  -20.182 1.00 0.00 ? 117 THR A HG23 2  
ATOM 4056  N N    . ASP A 1 118 ? 34.483  15.761  -17.945 1.00 0.00 ? 118 ASP A N    2  
ATOM 4057  C CA   . ASP A 1 118 ? 34.867  16.137  -16.562 1.00 0.00 ? 118 ASP A CA   2  
ATOM 4058  C C    . ASP A 1 118 ? 34.460  17.573  -16.263 1.00 0.00 ? 118 ASP A C    2  
ATOM 4059  O O    . ASP A 1 118 ? 33.924  17.864  -15.213 1.00 0.00 ? 118 ASP A O    2  
ATOM 4060  C CB   . ASP A 1 118 ? 36.394  16.022  -16.435 1.00 0.00 ? 118 ASP A CB   2  
ATOM 4061  C CG   . ASP A 1 118 ? 36.834  14.617  -16.852 1.00 0.00 ? 118 ASP A CG   2  
ATOM 4062  O OD1  . ASP A 1 118 ? 36.556  13.712  -16.084 1.00 0.00 ? 118 ASP A OD1  2  
ATOM 4063  O OD2  . ASP A 1 118 ? 37.423  14.529  -17.918 1.00 0.00 ? 118 ASP A OD2  2  
ATOM 4064  H H    . ASP A 1 118 ? 35.171  15.616  -18.627 1.00 0.00 ? 118 ASP A H    2  
ATOM 4065  H HA   . ASP A 1 118 ? 34.367  15.474  -15.861 1.00 0.00 ? 118 ASP A HA   2  
ATOM 4066  H HB2  . ASP A 1 118 ? 36.870  16.750  -17.075 1.00 0.00 ? 118 ASP A HB2  2  
ATOM 4067  H HB3  . ASP A 1 118 ? 36.690  16.200  -15.412 1.00 0.00 ? 118 ASP A HB3  2  
ATOM 4068  N N    . GLU A 1 119 ? 34.723  18.447  -17.196 1.00 0.00 ? 119 GLU A N    2  
ATOM 4069  C CA   . GLU A 1 119 ? 34.357  19.869  -16.985 1.00 0.00 ? 119 GLU A CA   2  
ATOM 4070  C C    . GLU A 1 119 ? 32.856  20.008  -16.770 1.00 0.00 ? 119 GLU A C    2  
ATOM 4071  O O    . GLU A 1 119 ? 32.411  20.810  -15.974 1.00 0.00 ? 119 GLU A O    2  
ATOM 4072  C CB   . GLU A 1 119 ? 34.755  20.667  -18.239 1.00 0.00 ? 119 GLU A CB   2  
ATOM 4073  C CG   . GLU A 1 119 ? 36.276  20.617  -18.410 1.00 0.00 ? 119 GLU A CG   2  
ATOM 4074  C CD   . GLU A 1 119 ? 36.771  21.974  -18.917 1.00 0.00 ? 119 GLU A CD   2  
ATOM 4075  O OE1  . GLU A 1 119 ? 35.965  22.645  -19.542 1.00 0.00 ? 119 GLU A OE1  2  
ATOM 4076  O OE2  . GLU A 1 119 ? 37.927  22.262  -18.653 1.00 0.00 ? 119 GLU A OE2  2  
ATOM 4077  H H    . GLU A 1 119 ? 35.156  18.165  -18.027 1.00 0.00 ? 119 GLU A H    2  
ATOM 4078  H HA   . GLU A 1 119 ? 34.877  20.242  -16.105 1.00 0.00 ? 119 GLU A HA   2  
ATOM 4079  H HB2  . GLU A 1 119 ? 34.279  20.238  -19.107 1.00 0.00 ? 119 GLU A HB2  2  
ATOM 4080  H HB3  . GLU A 1 119 ? 34.437  21.693  -18.131 1.00 0.00 ? 119 GLU A HB3  2  
ATOM 4081  H HG2  . GLU A 1 119 ? 36.744  20.398  -17.462 1.00 0.00 ? 119 GLU A HG2  2  
ATOM 4082  H HG3  . GLU A 1 119 ? 36.538  19.850  -19.125 1.00 0.00 ? 119 GLU A HG3  2  
ATOM 4083  N N    . GLU A 1 120 ? 32.102  19.221  -17.488 1.00 0.00 ? 120 GLU A N    2  
ATOM 4084  C CA   . GLU A 1 120 ? 30.627  19.289  -17.343 1.00 0.00 ? 120 GLU A CA   2  
ATOM 4085  C C    . GLU A 1 120 ? 30.204  18.801  -15.969 1.00 0.00 ? 120 GLU A C    2  
ATOM 4086  O O    . GLU A 1 120 ? 29.422  19.438  -15.291 1.00 0.00 ? 120 GLU A O    2  
ATOM 4087  C CB   . GLU A 1 120 ? 29.996  18.378  -18.407 1.00 0.00 ? 120 GLU A CB   2  
ATOM 4088  C CG   . GLU A 1 120 ? 30.252  18.972  -19.792 1.00 0.00 ? 120 GLU A CG   2  
ATOM 4089  C CD   . GLU A 1 120 ? 29.508  20.302  -19.918 1.00 0.00 ? 120 GLU A CD   2  
ATOM 4090  O OE1  . GLU A 1 120 ? 30.093  21.291  -19.507 1.00 0.00 ? 120 GLU A OE1  2  
ATOM 4091  O OE2  . GLU A 1 120 ? 28.396  20.256  -20.418 1.00 0.00 ? 120 GLU A OE2  2  
ATOM 4092  H H    . GLU A 1 120 ? 32.508  18.589  -18.116 1.00 0.00 ? 120 GLU A H    2  
ATOM 4093  H HA   . GLU A 1 120 ? 30.305  20.319  -17.471 1.00 0.00 ? 120 GLU A HA   2  
ATOM 4094  H HB2  . GLU A 1 120 ? 30.435  17.393  -18.348 1.00 0.00 ? 120 GLU A HB2  2  
ATOM 4095  H HB3  . GLU A 1 120 ? 28.933  18.303  -18.235 1.00 0.00 ? 120 GLU A HB3  2  
ATOM 4096  H HG2  . GLU A 1 120 ? 31.310  19.140  -19.929 1.00 0.00 ? 120 GLU A HG2  2  
ATOM 4097  H HG3  . GLU A 1 120 ? 29.898  18.292  -20.553 1.00 0.00 ? 120 GLU A HG3  2  
ATOM 4098  N N    . VAL A 1 121 ? 30.729  17.673  -15.581 1.00 0.00 ? 121 VAL A N    2  
ATOM 4099  C CA   . VAL A 1 121 ? 30.373  17.120  -14.254 1.00 0.00 ? 121 VAL A CA   2  
ATOM 4100  C C    . VAL A 1 121 ? 30.905  18.013  -13.141 1.00 0.00 ? 121 VAL A C    2  
ATOM 4101  O O    . VAL A 1 121 ? 30.319  18.109  -12.082 1.00 0.00 ? 121 VAL A O    2  
ATOM 4102  C CB   . VAL A 1 121 ? 31.018  15.732  -14.123 1.00 0.00 ? 121 VAL A CB   2  
ATOM 4103  C CG1  . VAL A 1 121 ? 31.166  15.384  -12.640 1.00 0.00 ? 121 VAL A CG1  2  
ATOM 4104  C CG2  . VAL A 1 121 ? 30.122  14.691  -14.800 1.00 0.00 ? 121 VAL A CG2  2  
ATOM 4105  H H    . VAL A 1 121 ? 31.352  17.196  -16.165 1.00 0.00 ? 121 VAL A H    2  
ATOM 4106  H HA   . VAL A 1 121 ? 29.289  17.055  -14.172 1.00 0.00 ? 121 VAL A HA   2  
ATOM 4107  H HB   . VAL A 1 121 ? 31.989  15.738  -14.596 1.00 0.00 ? 121 VAL A HB   2  
ATOM 4108  H HG11 . VAL A 1 121 ? 30.280  15.687  -12.104 1.00 0.00 ? 121 VAL A HG11 2  
ATOM 4109  H HG12 . VAL A 1 121 ? 31.303  14.318  -12.527 1.00 0.00 ? 121 VAL A HG12 2  
ATOM 4110  H HG13 . VAL A 1 121 ? 32.022  15.897  -12.229 1.00 0.00 ? 121 VAL A HG13 2  
ATOM 4111  H HG21 . VAL A 1 121 ? 29.583  15.148  -15.617 1.00 0.00 ? 121 VAL A HG21 2  
ATOM 4112  H HG22 . VAL A 1 121 ? 30.727  13.881  -15.181 1.00 0.00 ? 121 VAL A HG22 2  
ATOM 4113  H HG23 . VAL A 1 121 ? 29.414  14.298  -14.084 1.00 0.00 ? 121 VAL A HG23 2  
ATOM 4114  N N    . ASP A 1 122 ? 32.015  18.652  -13.402 1.00 0.00 ? 122 ASP A N    2  
ATOM 4115  C CA   . ASP A 1 122 ? 32.601  19.543  -12.373 1.00 0.00 ? 122 ASP A CA   2  
ATOM 4116  C C    . ASP A 1 122 ? 31.764  20.803  -12.218 1.00 0.00 ? 122 ASP A C    2  
ATOM 4117  O O    . ASP A 1 122 ? 31.454  21.214  -11.117 1.00 0.00 ? 122 ASP A O    2  
ATOM 4118  C CB   . ASP A 1 122 ? 34.013  19.943  -12.825 1.00 0.00 ? 122 ASP A CB   2  
ATOM 4119  C CG   . ASP A 1 122 ? 34.461  21.178  -12.042 1.00 0.00 ? 122 ASP A CG   2  
ATOM 4120  O OD1  . ASP A 1 122 ? 34.627  21.029  -10.842 1.00 0.00 ? 122 ASP A OD1  2  
ATOM 4121  O OD2  . ASP A 1 122 ? 34.609  22.202  -12.687 1.00 0.00 ? 122 ASP A OD2  2  
ATOM 4122  H H    . ASP A 1 122 ? 32.455  18.544  -14.271 1.00 0.00 ? 122 ASP A H    2  
ATOM 4123  H HA   . ASP A 1 122 ? 32.632  19.016  -11.421 1.00 0.00 ? 122 ASP A HA   2  
ATOM 4124  H HB2  . ASP A 1 122 ? 34.701  19.132  -12.635 1.00 0.00 ? 122 ASP A HB2  2  
ATOM 4125  H HB3  . ASP A 1 122 ? 34.009  20.171  -13.880 1.00 0.00 ? 122 ASP A HB3  2  
ATOM 4126  N N    . GLU A 1 123 ? 31.414  21.396  -13.326 1.00 0.00 ? 123 GLU A N    2  
ATOM 4127  C CA   . GLU A 1 123 ? 30.599  22.628  -13.261 1.00 0.00 ? 123 GLU A CA   2  
ATOM 4128  C C    . GLU A 1 123 ? 29.248  22.336  -12.630 1.00 0.00 ? 123 GLU A C    2  
ATOM 4129  O O    . GLU A 1 123 ? 28.644  23.197  -12.023 1.00 0.00 ? 123 GLU A O    2  
ATOM 4130  C CB   . GLU A 1 123 ? 30.376  23.141  -14.691 1.00 0.00 ? 123 GLU A CB   2  
ATOM 4131  C CG   . GLU A 1 123 ? 29.450  24.358  -14.644 1.00 0.00 ? 123 GLU A CG   2  
ATOM 4132  C CD   . GLU A 1 123 ? 28.002  23.886  -14.492 1.00 0.00 ? 123 GLU A CD   2  
ATOM 4133  O OE1  . GLU A 1 123 ? 27.705  22.854  -15.071 1.00 0.00 ? 123 GLU A OE1  2  
ATOM 4134  O OE2  . GLU A 1 123 ? 27.275  24.585  -13.806 1.00 0.00 ? 123 GLU A OE2  2  
ATOM 4135  H H    . GLU A 1 123 ? 31.687  21.028  -14.192 1.00 0.00 ? 123 GLU A H    2  
ATOM 4136  H HA   . GLU A 1 123 ? 31.123  23.369  -12.659 1.00 0.00 ? 123 GLU A HA   2  
ATOM 4137  H HB2  . GLU A 1 123 ? 31.324  23.422  -15.129 1.00 0.00 ? 123 GLU A HB2  2  
ATOM 4138  H HB3  . GLU A 1 123 ? 29.925  22.363  -15.290 1.00 0.00 ? 123 GLU A HB3  2  
ATOM 4139  H HG2  . GLU A 1 123 ? 29.711  24.983  -13.803 1.00 0.00 ? 123 GLU A HG2  2  
ATOM 4140  H HG3  . GLU A 1 123 ? 29.547  24.927  -15.556 1.00 0.00 ? 123 GLU A HG3  2  
ATOM 4141  N N    . MET A 1 124 ? 28.795  21.122  -12.785 1.00 0.00 ? 124 MET A N    2  
ATOM 4142  C CA   . MET A 1 124 ? 27.487  20.757  -12.201 1.00 0.00 ? 124 MET A CA   2  
ATOM 4143  C C    . MET A 1 124 ? 27.635  20.421  -10.728 1.00 0.00 ? 124 MET A C    2  
ATOM 4144  O O    . MET A 1 124 ? 26.872  20.877  -9.903  1.00 0.00 ? 124 MET A O    2  
ATOM 4145  C CB   . MET A 1 124 ? 26.950  19.524  -12.940 1.00 0.00 ? 124 MET A CB   2  
ATOM 4146  C CG   . MET A 1 124 ? 25.422  19.555  -12.910 1.00 0.00 ? 124 MET A CG   2  
ATOM 4147  S SD   . MET A 1 124 ? 24.550  17.995  -13.202 1.00 0.00 ? 124 MET A SD   2  
ATOM 4148  C CE   . MET A 1 124 ? 25.187  17.103  -11.762 1.00 0.00 ? 124 MET A CE   2  
ATOM 4149  H H    . MET A 1 124 ? 29.317  20.459  -13.282 1.00 0.00 ? 124 MET A H    2  
ATOM 4150  H HA   . MET A 1 124 ? 26.809  21.599  -12.306 1.00 0.00 ? 124 MET A HA   2  
ATOM 4151  H HB2  . MET A 1 124 ? 27.293  19.536  -13.964 1.00 0.00 ? 124 MET A HB2  2  
ATOM 4152  H HB3  . MET A 1 124 ? 27.305  18.627  -12.457 1.00 0.00 ? 124 MET A HB3  2  
ATOM 4153  H HG2  . MET A 1 124 ? 25.113  19.927  -11.945 1.00 0.00 ? 124 MET A HG2  2  
ATOM 4154  H HG3  . MET A 1 124 ? 25.086  20.261  -13.654 1.00 0.00 ? 124 MET A HG3  2  
ATOM 4155  H HE1  . MET A 1 124 ? 25.397  17.804  -10.967 1.00 0.00 ? 124 MET A HE1  2  
ATOM 4156  H HE2  . MET A 1 124 ? 24.450  16.390  -11.426 1.00 0.00 ? 124 MET A HE2  2  
ATOM 4157  H HE3  . MET A 1 124 ? 26.095  16.583  -12.032 1.00 0.00 ? 124 MET A HE3  2  
ATOM 4158  N N    . ILE A 1 125 ? 28.617  19.628  -10.423 1.00 0.00 ? 125 ILE A N    2  
ATOM 4159  C CA   . ILE A 1 125 ? 28.831  19.251  -9.009  1.00 0.00 ? 125 ILE A CA   2  
ATOM 4160  C C    . ILE A 1 125 ? 29.053  20.492  -8.155  1.00 0.00 ? 125 ILE A C    2  
ATOM 4161  O O    . ILE A 1 125 ? 28.785  20.489  -6.970  1.00 0.00 ? 125 ILE A O    2  
ATOM 4162  C CB   . ILE A 1 125 ? 30.070  18.355  -8.935  1.00 0.00 ? 125 ILE A CB   2  
ATOM 4163  C CG1  . ILE A 1 125 ? 29.665  16.908  -9.187  1.00 0.00 ? 125 ILE A CG1  2  
ATOM 4164  C CG2  . ILE A 1 125 ? 30.677  18.456  -7.524  1.00 0.00 ? 125 ILE A CG2  2  
ATOM 4165  C CD1  . ILE A 1 125 ? 30.908  16.014  -9.127  1.00 0.00 ? 125 ILE A CD1  2  
ATOM 4166  H H    . ILE A 1 125 ? 29.206  19.280  -11.124 1.00 0.00 ? 125 ILE A H    2  
ATOM 4167  H HA   . ILE A 1 125 ? 27.951  18.726  -8.646  1.00 0.00 ? 125 ILE A HA   2  
ATOM 4168  H HB   . ILE A 1 125 ? 30.788  18.668  -9.695  1.00 0.00 ? 125 ILE A HB   2  
ATOM 4169  H HG12 . ILE A 1 125 ? 28.957  16.593  -8.435  1.00 0.00 ? 125 ILE A HG12 2  
ATOM 4170  H HG13 . ILE A 1 125 ? 29.206  16.825  -10.162 1.00 0.00 ? 125 ILE A HG13 2  
ATOM 4171  H HG21 . ILE A 1 125 ? 29.900  18.338  -6.784  1.00 0.00 ? 125 ILE A HG21 2  
ATOM 4172  H HG22 . ILE A 1 125 ? 31.418  17.683  -7.391  1.00 0.00 ? 125 ILE A HG22 2  
ATOM 4173  H HG23 . ILE A 1 125 ? 31.145  19.422  -7.398  1.00 0.00 ? 125 ILE A HG23 2  
ATOM 4174  H HD11 . ILE A 1 125 ? 31.778  16.582  -9.414  1.00 0.00 ? 125 ILE A HD11 2  
ATOM 4175  H HD12 . ILE A 1 125 ? 31.041  15.642  -8.122  1.00 0.00 ? 125 ILE A HD12 2  
ATOM 4176  H HD13 . ILE A 1 125 ? 30.788  15.179  -9.802  1.00 0.00 ? 125 ILE A HD13 2  
ATOM 4177  N N    . ARG A 1 126 ? 29.541  21.532  -8.772  1.00 0.00 ? 126 ARG A N    2  
ATOM 4178  C CA   . ARG A 1 126 ? 29.783  22.776  -8.010  1.00 0.00 ? 126 ARG A CA   2  
ATOM 4179  C C    . ARG A 1 126 ? 28.464  23.400  -7.577  1.00 0.00 ? 126 ARG A C    2  
ATOM 4180  O O    . ARG A 1 126 ? 28.324  23.844  -6.454  1.00 0.00 ? 126 ARG A O    2  
ATOM 4181  C CB   . ARG A 1 126 ? 30.527  23.765  -8.916  1.00 0.00 ? 126 ARG A CB   2  
ATOM 4182  C CG   . ARG A 1 126 ? 31.579  24.500  -8.086  1.00 0.00 ? 126 ARG A CG   2  
ATOM 4183  C CD   . ARG A 1 126 ? 32.170  25.638  -8.915  1.00 0.00 ? 126 ARG A CD   2  
ATOM 4184  N NE   . ARG A 1 126 ? 32.899  26.567  -8.007  1.00 0.00 ? 126 ARG A NE   2  
ATOM 4185  C CZ   . ARG A 1 126 ? 32.425  27.765  -7.796  1.00 0.00 ? 126 ARG A CZ   2  
ATOM 4186  N NH1  . ARG A 1 126 ? 31.189  27.894  -7.398  1.00 0.00 ? 126 ARG A NH1  2  
ATOM 4187  N NH2  . ARG A 1 126 ? 33.204  28.793  -7.990  1.00 0.00 ? 126 ARG A NH2  2  
ATOM 4188  H H    . ARG A 1 126 ? 29.747  21.489  -9.729  1.00 0.00 ? 126 ARG A H    2  
ATOM 4189  H HA   . ARG A 1 126 ? 30.374  22.541  -7.126  1.00 0.00 ? 126 ARG A HA   2  
ATOM 4190  H HB2  . ARG A 1 126 ? 31.008  23.230  -9.723  1.00 0.00 ? 126 ARG A HB2  2  
ATOM 4191  H HB3  . ARG A 1 126 ? 29.827  24.477  -9.330  1.00 0.00 ? 126 ARG A HB3  2  
ATOM 4192  H HG2  . ARG A 1 126 ? 31.120  24.901  -7.194  1.00 0.00 ? 126 ARG A HG2  2  
ATOM 4193  H HG3  . ARG A 1 126 ? 32.362  23.813  -7.804  1.00 0.00 ? 126 ARG A HG3  2  
ATOM 4194  H HD2  . ARG A 1 126 ? 32.855  25.240  -9.648  1.00 0.00 ? 126 ARG A HD2  2  
ATOM 4195  H HD3  . ARG A 1 126 ? 31.380  26.175  -9.418  1.00 0.00 ? 126 ARG A HD3  2  
ATOM 4196  H HE   . ARG A 1 126 ? 33.728  26.280  -7.569  1.00 0.00 ? 126 ARG A HE   2  
ATOM 4197  H HH11 . ARG A 1 126 ? 30.622  27.082  -7.259  1.00 0.00 ? 126 ARG A HH11 2  
ATOM 4198  H HH12 . ARG A 1 126 ? 30.810  28.803  -7.231  1.00 0.00 ? 126 ARG A HH12 2  
ATOM 4199  H HH21 . ARG A 1 126 ? 34.147  28.656  -8.293  1.00 0.00 ? 126 ARG A HH21 2  
ATOM 4200  H HH22 . ARG A 1 126 ? 32.858  29.718  -7.834  1.00 0.00 ? 126 ARG A HH22 2  
ATOM 4201  N N    . GLU A 1 127 ? 27.513  23.421  -8.477  1.00 0.00 ? 127 GLU A N    2  
ATOM 4202  C CA   . GLU A 1 127 ? 26.198  24.014  -8.130  1.00 0.00 ? 127 GLU A CA   2  
ATOM 4203  C C    . GLU A 1 127 ? 25.269  22.965  -7.523  1.00 0.00 ? 127 GLU A C    2  
ATOM 4204  O O    . GLU A 1 127 ? 24.069  23.155  -7.467  1.00 0.00 ? 127 GLU A O    2  
ATOM 4205  C CB   . GLU A 1 127 ? 25.557  24.582  -9.415  1.00 0.00 ? 127 GLU A CB   2  
ATOM 4206  C CG   . GLU A 1 127 ? 24.753  23.487  -10.125 1.00 0.00 ? 127 GLU A CG   2  
ATOM 4207  C CD   . GLU A 1 127 ? 24.775  23.746  -11.634 1.00 0.00 ? 127 GLU A CD   2  
ATOM 4208  O OE1  . GLU A 1 127 ? 25.070  24.876  -11.985 1.00 0.00 ? 127 GLU A OE1  2  
ATOM 4209  O OE2  . GLU A 1 127 ? 24.495  22.798  -12.349 1.00 0.00 ? 127 GLU A OE2  2  
ATOM 4210  H H    . GLU A 1 127 ? 27.670  23.052  -9.372  1.00 0.00 ? 127 GLU A H    2  
ATOM 4211  H HA   . GLU A 1 127 ? 26.355  24.806  -7.397  1.00 0.00 ? 127 GLU A HA   2  
ATOM 4212  H HB2  . GLU A 1 127 ? 24.900  25.400  -9.158  1.00 0.00 ? 127 GLU A HB2  2  
ATOM 4213  H HB3  . GLU A 1 127 ? 26.331  24.947  -10.074 1.00 0.00 ? 127 GLU A HB3  2  
ATOM 4214  H HG2  . GLU A 1 127 ? 25.187  22.522  -9.923  1.00 0.00 ? 127 GLU A HG2  2  
ATOM 4215  H HG3  . GLU A 1 127 ? 23.732  23.498  -9.776  1.00 0.00 ? 127 GLU A HG3  2  
ATOM 4216  N N    . ALA A 1 128 ? 25.838  21.872  -7.083  1.00 0.00 ? 128 ALA A N    2  
ATOM 4217  C CA   . ALA A 1 128 ? 24.997  20.808  -6.478  1.00 0.00 ? 128 ALA A CA   2  
ATOM 4218  C C    . ALA A 1 128 ? 24.514  21.232  -5.094  1.00 0.00 ? 128 ALA A C    2  
ATOM 4219  O O    . ALA A 1 128 ? 24.314  20.410  -4.222  1.00 0.00 ? 128 ALA A O    2  
ATOM 4220  C CB   . ALA A 1 128 ? 25.846  19.533  -6.339  1.00 0.00 ? 128 ALA A CB   2  
ATOM 4221  H H    . ALA A 1 128 ? 26.809  21.752  -7.157  1.00 0.00 ? 128 ALA A H    2  
ATOM 4222  H HA   . ALA A 1 128 ? 24.135  20.633  -7.116  1.00 0.00 ? 128 ALA A HA   2  
ATOM 4223  H HB1  . ALA A 1 128 ? 26.596  19.509  -7.114  1.00 0.00 ? 128 ALA A HB1  2  
ATOM 4224  H HB2  . ALA A 1 128 ? 26.331  19.521  -5.374  1.00 0.00 ? 128 ALA A HB2  2  
ATOM 4225  H HB3  . ALA A 1 128 ? 25.213  18.662  -6.429  1.00 0.00 ? 128 ALA A HB3  2  
ATOM 4226  N N    . ASN A 1 129 ? 24.333  22.513  -4.924  1.00 0.00 ? 129 ASN A N    2  
ATOM 4227  C CA   . ASN A 1 129 ? 23.865  23.020  -3.614  1.00 0.00 ? 129 ASN A CA   2  
ATOM 4228  C C    . ASN A 1 129 ? 24.600  22.336  -2.467  1.00 0.00 ? 129 ASN A C    2  
ATOM 4229  O O    . ASN A 1 129 ? 23.989  21.734  -1.608  1.00 0.00 ? 129 ASN A O    2  
ATOM 4230  C CB   . ASN A 1 129 ? 22.368  22.722  -3.493  1.00 0.00 ? 129 ASN A CB   2  
ATOM 4231  C CG   . ASN A 1 129 ? 21.608  23.502  -4.568  1.00 0.00 ? 129 ASN A CG   2  
ATOM 4232  O OD1  . ASN A 1 129 ? 21.567  23.114  -5.719  1.00 0.00 ? 129 ASN A OD1  2  
ATOM 4233  N ND2  . ASN A 1 129 ? 20.992  24.604  -4.236  1.00 0.00 ? 129 ASN A ND2  2  
ATOM 4234  H H    . ASN A 1 129 ? 24.496  23.133  -5.658  1.00 0.00 ? 129 ASN A H    2  
ATOM 4235  H HA   . ASN A 1 129 ? 24.051  24.093  -3.564  1.00 0.00 ? 129 ASN A HA   2  
ATOM 4236  H HB2  . ASN A 1 129 ? 22.196  21.665  -3.630  1.00 0.00 ? 129 ASN A HB2  2  
ATOM 4237  H HB3  . ASN A 1 129 ? 22.016  23.020  -2.519  1.00 0.00 ? 129 ASN A HB3  2  
ATOM 4238  H HD21 . ASN A 1 129 ? 21.021  24.921  -3.310  1.00 0.00 ? 129 ASN A HD21 2  
ATOM 4239  H HD22 . ASN A 1 129 ? 20.502  25.114  -4.914  1.00 0.00 ? 129 ASN A HD22 2  
ATOM 4240  N N    . ILE A 1 130 ? 25.902  22.439  -2.476  1.00 0.00 ? 130 ILE A N    2  
ATOM 4241  C CA   . ILE A 1 130 ? 26.691  21.799  -1.391  1.00 0.00 ? 130 ILE A CA   2  
ATOM 4242  C C    . ILE A 1 130 ? 26.720  22.682  -0.147  1.00 0.00 ? 130 ILE A C    2  
ATOM 4243  O O    . ILE A 1 130 ? 26.321  23.829  -0.188  1.00 0.00 ? 130 ILE A O    2  
ATOM 4244  C CB   . ILE A 1 130 ? 28.122  21.603  -1.886  1.00 0.00 ? 130 ILE A CB   2  
ATOM 4245  C CG1  . ILE A 1 130 ? 28.126  20.679  -3.097  1.00 0.00 ? 130 ILE A CG1  2  
ATOM 4246  C CG2  . ILE A 1 130 ? 28.945  20.948  -0.764  1.00 0.00 ? 130 ILE A CG2  2  
ATOM 4247  C CD1  . ILE A 1 130 ? 29.548  20.584  -3.654  1.00 0.00 ? 130 ILE A CD1  2  
ATOM 4248  H H    . ILE A 1 130 ? 26.353  22.928  -3.194  1.00 0.00 ? 130 ILE A H    2  
ATOM 4249  H HA   . ILE A 1 130 ? 26.235  20.845  -1.138  1.00 0.00 ? 130 ILE A HA   2  
ATOM 4250  H HB   . ILE A 1 130 ? 28.541  22.568  -2.165  1.00 0.00 ? 130 ILE A HB   2  
ATOM 4251  H HG12 . ILE A 1 130 ? 27.785  19.697  -2.806  1.00 0.00 ? 130 ILE A HG12 2  
ATOM 4252  H HG13 . ILE A 1 130 ? 27.466  21.072  -3.855  1.00 0.00 ? 130 ILE A HG13 2  
ATOM 4253  H HG21 . ILE A 1 130 ? 28.347  20.201  -0.261  1.00 0.00 ? 130 ILE A HG21 2  
ATOM 4254  H HG22 . ILE A 1 130 ? 29.822  20.477  -1.183  1.00 0.00 ? 130 ILE A HG22 2  
ATOM 4255  H HG23 . ILE A 1 130 ? 29.252  21.698  -0.050  1.00 0.00 ? 130 ILE A HG23 2  
ATOM 4256  H HD11 . ILE A 1 130 ? 30.167  21.348  -3.209  1.00 0.00 ? 130 ILE A HD11 2  
ATOM 4257  H HD12 . ILE A 1 130 ? 29.964  19.614  -3.427  1.00 0.00 ? 130 ILE A HD12 2  
ATOM 4258  H HD13 . ILE A 1 130 ? 29.530  20.720  -4.725  1.00 0.00 ? 130 ILE A HD13 2  
ATOM 4259  N N    . ASP A 1 131 ? 27.198  22.126  0.940   1.00 0.00 ? 131 ASP A N    2  
ATOM 4260  C CA   . ASP A 1 131 ? 27.266  22.910  2.202   1.00 0.00 ? 131 ASP A CA   2  
ATOM 4261  C C    . ASP A 1 131 ? 28.670  23.456  2.427   1.00 0.00 ? 131 ASP A C    2  
ATOM 4262  O O    . ASP A 1 131 ? 29.094  24.376  1.758   1.00 0.00 ? 131 ASP A O    2  
ATOM 4263  C CB   . ASP A 1 131 ? 26.909  21.977  3.371   1.00 0.00 ? 131 ASP A CB   2  
ATOM 4264  C CG   . ASP A 1 131 ? 27.759  20.706  3.286   1.00 0.00 ? 131 ASP A CG   2  
ATOM 4265  O OD1  . ASP A 1 131 ? 27.646  20.046  2.266   1.00 0.00 ? 131 ASP A OD1  2  
ATOM 4266  O OD2  . ASP A 1 131 ? 28.474  20.469  4.245   1.00 0.00 ? 131 ASP A OD2  2  
ATOM 4267  H H    . ASP A 1 131 ? 27.512  21.199  0.919   1.00 0.00 ? 131 ASP A H    2  
ATOM 4268  H HA   . ASP A 1 131 ? 26.565  23.742  2.145   1.00 0.00 ? 131 ASP A HA   2  
ATOM 4269  H HB2  . ASP A 1 131 ? 27.105  22.475  4.309   1.00 0.00 ? 131 ASP A HB2  2  
ATOM 4270  H HB3  . ASP A 1 131 ? 25.864  21.710  3.321   1.00 0.00 ? 131 ASP A HB3  2  
ATOM 4271  N N    . GLY A 1 132 ? 29.367  22.878  3.369   1.00 0.00 ? 132 GLY A N    2  
ATOM 4272  C CA   . GLY A 1 132 ? 30.752  23.351  3.655   1.00 0.00 ? 132 GLY A CA   2  
ATOM 4273  C C    . GLY A 1 132 ? 31.649  22.170  4.027   1.00 0.00 ? 132 GLY A C    2  
ATOM 4274  O O    . GLY A 1 132 ? 32.465  22.264  4.923   1.00 0.00 ? 132 GLY A O    2  
ATOM 4275  H H    . GLY A 1 132 ? 28.982  22.138  3.884   1.00 0.00 ? 132 GLY A H    2  
ATOM 4276  H HA2  . GLY A 1 132 ? 31.151  23.839  2.778   1.00 0.00 ? 132 GLY A HA2  2  
ATOM 4277  H HA3  . GLY A 1 132 ? 30.728  24.054  4.475   1.00 0.00 ? 132 GLY A HA3  2  
ATOM 4278  N N    . ASP A 1 133 ? 31.477  21.079  3.331   1.00 0.00 ? 133 ASP A N    2  
ATOM 4279  C CA   . ASP A 1 133 ? 32.305  19.884  3.627   1.00 0.00 ? 133 ASP A CA   2  
ATOM 4280  C C    . ASP A 1 133 ? 32.550  19.073  2.363   1.00 0.00 ? 133 ASP A C    2  
ATOM 4281  O O    . ASP A 1 133 ? 33.677  18.887  1.949   1.00 0.00 ? 133 ASP A O    2  
ATOM 4282  C CB   . ASP A 1 133 ? 31.551  19.006  4.635   1.00 0.00 ? 133 ASP A CB   2  
ATOM 4283  C CG   . ASP A 1 133 ? 32.541  18.067  5.326   1.00 0.00 ? 133 ASP A CG   2  
ATOM 4284  O OD1  . ASP A 1 133 ? 33.029  17.191  4.632   1.00 0.00 ? 133 ASP A OD1  2  
ATOM 4285  O OD2  . ASP A 1 133 ? 32.752  18.279  6.509   1.00 0.00 ? 133 ASP A OD2  2  
ATOM 4286  H H    . ASP A 1 133 ? 30.805  21.050  2.617   1.00 0.00 ? 133 ASP A H    2  
ATOM 4287  H HA   . ASP A 1 133 ? 33.263  20.208  4.033   1.00 0.00 ? 133 ASP A HA   2  
ATOM 4288  H HB2  . ASP A 1 133 ? 31.071  19.628  5.375   1.00 0.00 ? 133 ASP A HB2  2  
ATOM 4289  H HB3  . ASP A 1 133 ? 30.803  18.421  4.121   1.00 0.00 ? 133 ASP A HB3  2  
ATOM 4290  N N    . GLY A 1 134 ? 31.486  18.604  1.771   1.00 0.00 ? 134 GLY A N    2  
ATOM 4291  C CA   . GLY A 1 134 ? 31.636  17.799  0.530   1.00 0.00 ? 134 GLY A CA   2  
ATOM 4292  C C    . GLY A 1 134 ? 30.451  16.846  0.360   1.00 0.00 ? 134 GLY A C    2  
ATOM 4293  O O    . GLY A 1 134 ? 30.556  15.838  -0.303  1.00 0.00 ? 134 GLY A O    2  
ATOM 4294  H H    . GLY A 1 134 ? 30.596  18.783  2.140   1.00 0.00 ? 134 GLY A H    2  
ATOM 4295  H HA2  . GLY A 1 134 ? 31.684  18.462  -0.320  1.00 0.00 ? 134 GLY A HA2  2  
ATOM 4296  H HA3  . GLY A 1 134 ? 32.550  17.225  0.584   1.00 0.00 ? 134 GLY A HA3  2  
ATOM 4297  N N    . GLN A 1 135 ? 29.346  17.183  0.968   1.00 0.00 ? 135 GLN A N    2  
ATOM 4298  C CA   . GLN A 1 135 ? 28.155  16.305  0.846   1.00 0.00 ? 135 GLN A CA   2  
ATOM 4299  C C    . GLN A 1 135 ? 27.288  16.739  -0.332  1.00 0.00 ? 135 GLN A C    2  
ATOM 4300  O O    . GLN A 1 135 ? 27.374  17.862  -0.787  1.00 0.00 ? 135 GLN A O    2  
ATOM 4301  C CB   . GLN A 1 135 ? 27.326  16.423  2.136   1.00 0.00 ? 135 GLN A CB   2  
ATOM 4302  C CG   . GLN A 1 135 ? 28.109  15.808  3.298   1.00 0.00 ? 135 GLN A CG   2  
ATOM 4303  C CD   . GLN A 1 135 ? 28.222  14.297  3.089   1.00 0.00 ? 135 GLN A CD   2  
ATOM 4304  O OE1  . GLN A 1 135 ? 29.141  13.814  2.459   1.00 0.00 ? 135 GLN A OE1  2  
ATOM 4305  N NE2  . GLN A 1 135 ? 27.309  13.517  3.601   1.00 0.00 ? 135 GLN A NE2  2  
ATOM 4306  H H    . GLN A 1 135 ? 29.304  18.004  1.500   1.00 0.00 ? 135 GLN A H    2  
ATOM 4307  H HA   . GLN A 1 135 ? 28.483  15.277  0.687   1.00 0.00 ? 135 GLN A HA   2  
ATOM 4308  H HB2  . GLN A 1 135 ? 27.125  17.465  2.345   1.00 0.00 ? 135 GLN A HB2  2  
ATOM 4309  H HB3  . GLN A 1 135 ? 26.388  15.901  2.014   1.00 0.00 ? 135 GLN A HB3  2  
ATOM 4310  H HG2  . GLN A 1 135 ? 29.098  16.238  3.342   1.00 0.00 ? 135 GLN A HG2  2  
ATOM 4311  H HG3  . GLN A 1 135 ? 27.595  16.002  4.228   1.00 0.00 ? 135 GLN A HG3  2  
ATOM 4312  H HE21 . GLN A 1 135 ? 26.565  13.900  4.110   1.00 0.00 ? 135 GLN A HE21 2  
ATOM 4313  H HE22 . GLN A 1 135 ? 27.367  12.546  3.475   1.00 0.00 ? 135 GLN A HE22 2  
ATOM 4314  N N    . VAL A 1 136 ? 26.467  15.841  -0.804  1.00 0.00 ? 136 VAL A N    2  
ATOM 4315  C CA   . VAL A 1 136 ? 25.590  16.188  -1.951  1.00 0.00 ? 136 VAL A CA   2  
ATOM 4316  C C    . VAL A 1 136 ? 24.270  15.437  -1.871  1.00 0.00 ? 136 VAL A C    2  
ATOM 4317  O O    . VAL A 1 136 ? 24.249  14.232  -1.715  1.00 0.00 ? 136 VAL A O    2  
ATOM 4318  C CB   . VAL A 1 136 ? 26.298  15.777  -3.251  1.00 0.00 ? 136 VAL A CB   2  
ATOM 4319  C CG1  . VAL A 1 136 ? 25.529  16.346  -4.448  1.00 0.00 ? 136 VAL A CG1  2  
ATOM 4320  C CG2  . VAL A 1 136 ? 27.717  16.337  -3.258  1.00 0.00 ? 136 VAL A CG2  2  
ATOM 4321  H H    . VAL A 1 136 ? 26.430  14.946  -0.408  1.00 0.00 ? 136 VAL A H    2  
ATOM 4322  H HA   . VAL A 1 136 ? 25.392  17.258  -1.940  1.00 0.00 ? 136 VAL A HA   2  
ATOM 4323  H HB   . VAL A 1 136 ? 26.331  14.702  -3.319  1.00 0.00 ? 136 VAL A HB   2  
ATOM 4324  H HG11 . VAL A 1 136 ? 24.467  16.277  -4.265  1.00 0.00 ? 136 VAL A HG11 2  
ATOM 4325  H HG12 . VAL A 1 136 ? 25.797  17.383  -4.592  1.00 0.00 ? 136 VAL A HG12 2  
ATOM 4326  H HG13 . VAL A 1 136 ? 25.775  15.788  -5.339  1.00 0.00 ? 136 VAL A HG13 2  
ATOM 4327  H HG21 . VAL A 1 136 ? 27.688  17.402  -3.086  1.00 0.00 ? 136 VAL A HG21 2  
ATOM 4328  H HG22 . VAL A 1 136 ? 28.298  15.865  -2.480  1.00 0.00 ? 136 VAL A HG22 2  
ATOM 4329  H HG23 . VAL A 1 136 ? 28.179  16.143  -4.215  1.00 0.00 ? 136 VAL A HG23 2  
ATOM 4330  N N    . ASN A 1 137 ? 23.189  16.157  -1.978  1.00 0.00 ? 137 ASN A N    2  
ATOM 4331  C CA   . ASN A 1 137 ? 21.871  15.490  -1.911  1.00 0.00 ? 137 ASN A CA   2  
ATOM 4332  C C    . ASN A 1 137 ? 21.666  14.650  -3.160  1.00 0.00 ? 137 ASN A C    2  
ATOM 4333  O O    . ASN A 1 137 ? 20.993  15.060  -4.085  1.00 0.00 ? 137 ASN A O    2  
ATOM 4334  C CB   . ASN A 1 137 ? 20.777  16.569  -1.852  1.00 0.00 ? 137 ASN A CB   2  
ATOM 4335  C CG   . ASN A 1 137 ? 20.459  16.893  -0.393  1.00 0.00 ? 137 ASN A CG   2  
ATOM 4336  O OD1  . ASN A 1 137 ? 20.431  16.024  0.457   1.00 0.00 ? 137 ASN A OD1  2  
ATOM 4337  N ND2  . ASN A 1 137 ? 20.212  18.130  -0.059  1.00 0.00 ? 137 ASN A ND2  2  
ATOM 4338  H H    . ASN A 1 137 ? 23.249  17.126  -2.103  1.00 0.00 ? 137 ASN A H    2  
ATOM 4339  H HA   . ASN A 1 137 ? 21.839  14.843  -1.031  1.00 0.00 ? 137 ASN A HA   2  
ATOM 4340  H HB2  . ASN A 1 137 ? 21.120  17.464  -2.351  1.00 0.00 ? 137 ASN A HB2  2  
ATOM 4341  H HB3  . ASN A 1 137 ? 19.883  16.211  -2.340  1.00 0.00 ? 137 ASN A HB3  2  
ATOM 4342  H HD21 . ASN A 1 137 ? 20.232  18.835  -0.740  1.00 0.00 ? 137 ASN A HD21 2  
ATOM 4343  H HD22 . ASN A 1 137 ? 20.008  18.354  0.872   1.00 0.00 ? 137 ASN A HD22 2  
ATOM 4344  N N    . TYR A 1 138 ? 22.259  13.489  -3.164  1.00 0.00 ? 138 TYR A N    2  
ATOM 4345  C CA   . TYR A 1 138 ? 22.123  12.596  -4.337  1.00 0.00 ? 138 TYR A CA   2  
ATOM 4346  C C    . TYR A 1 138 ? 20.701  12.611  -4.897  1.00 0.00 ? 138 TYR A C    2  
ATOM 4347  O O    . TYR A 1 138 ? 20.502  12.433  -6.083  1.00 0.00 ? 138 TYR A O    2  
ATOM 4348  C CB   . TYR A 1 138 ? 22.491  11.167  -3.902  1.00 0.00 ? 138 TYR A CB   2  
ATOM 4349  C CG   . TYR A 1 138 ? 21.231  10.384  -3.533  1.00 0.00 ? 138 TYR A CG   2  
ATOM 4350  C CD1  . TYR A 1 138 ? 20.423  9.860   -4.516  1.00 0.00 ? 138 TYR A CD1  2  
ATOM 4351  C CD2  . TYR A 1 138 ? 20.899  10.178  -2.211  1.00 0.00 ? 138 TYR A CD2  2  
ATOM 4352  C CE1  . TYR A 1 138 ? 19.296  9.138   -4.184  1.00 0.00 ? 138 TYR A CE1  2  
ATOM 4353  C CE2  . TYR A 1 138 ? 19.774  9.457   -1.877  1.00 0.00 ? 138 TYR A CE2  2  
ATOM 4354  C CZ   . TYR A 1 138 ? 18.962  8.930   -2.861  1.00 0.00 ? 138 TYR A CZ   2  
ATOM 4355  O OH   . TYR A 1 138 ? 17.837  8.207   -2.529  1.00 0.00 ? 138 TYR A OH   2  
ATOM 4356  H H    . TYR A 1 138 ? 22.792  13.207  -2.392  1.00 0.00 ? 138 TYR A H    2  
ATOM 4357  H HA   . TYR A 1 138 ? 22.808  12.946  -5.115  1.00 0.00 ? 138 TYR A HA   2  
ATOM 4358  H HB2  . TYR A 1 138 ? 22.998  10.663  -4.710  1.00 0.00 ? 138 TYR A HB2  2  
ATOM 4359  H HB3  . TYR A 1 138 ? 23.140  11.206  -3.048  1.00 0.00 ? 138 TYR A HB3  2  
ATOM 4360  H HD1  . TYR A 1 138 ? 20.674  10.016  -5.553  1.00 0.00 ? 138 TYR A HD1  2  
ATOM 4361  H HD2  . TYR A 1 138 ? 21.526  10.585  -1.431  1.00 0.00 ? 138 TYR A HD2  2  
ATOM 4362  H HE1  . TYR A 1 138 ? 18.672  8.730   -4.966  1.00 0.00 ? 138 TYR A HE1  2  
ATOM 4363  H HE2  . TYR A 1 138 ? 19.528  9.299   -0.837  1.00 0.00 ? 138 TYR A HE2  2  
ATOM 4364  H HH   . TYR A 1 138 ? 18.062  7.275   -2.568  1.00 0.00 ? 138 TYR A HH   2  
ATOM 4365  N N    . GLU A 1 139 ? 19.734  12.823  -4.041  1.00 0.00 ? 139 GLU A N    2  
ATOM 4366  C CA   . GLU A 1 139 ? 18.336  12.849  -4.532  1.00 0.00 ? 139 GLU A CA   2  
ATOM 4367  C C    . GLU A 1 139 ? 18.160  13.995  -5.504  1.00 0.00 ? 139 GLU A C    2  
ATOM 4368  O O    . GLU A 1 139 ? 17.788  13.798  -6.643  1.00 0.00 ? 139 GLU A O    2  
ATOM 4369  C CB   . GLU A 1 139 ? 17.394  13.059  -3.335  1.00 0.00 ? 139 GLU A CB   2  
ATOM 4370  C CG   . GLU A 1 139 ? 17.225  11.735  -2.588  1.00 0.00 ? 139 GLU A CG   2  
ATOM 4371  C CD   . GLU A 1 139 ? 16.334  10.799  -3.407  1.00 0.00 ? 139 GLU A CD   2  
ATOM 4372  O OE1  . GLU A 1 139 ? 16.035  11.177  -4.528  1.00 0.00 ? 139 GLU A OE1  2  
ATOM 4373  O OE2  . GLU A 1 139 ? 16.002  9.758   -2.865  1.00 0.00 ? 139 GLU A OE2  2  
ATOM 4374  H H    . GLU A 1 139 ? 19.931  12.977  -3.094  1.00 0.00 ? 139 GLU A H    2  
ATOM 4375  H HA   . GLU A 1 139 ? 18.119  11.909  -5.044  1.00 0.00 ? 139 GLU A HA   2  
ATOM 4376  H HB2  . GLU A 1 139 ? 17.812  13.800  -2.671  1.00 0.00 ? 139 GLU A HB2  2  
ATOM 4377  H HB3  . GLU A 1 139 ? 16.432  13.404  -3.688  1.00 0.00 ? 139 GLU A HB3  2  
ATOM 4378  H HG2  . GLU A 1 139 ? 18.190  11.274  -2.442  1.00 0.00 ? 139 GLU A HG2  2  
ATOM 4379  H HG3  . GLU A 1 139 ? 16.766  11.915  -1.627  1.00 0.00 ? 139 GLU A HG3  2  
ATOM 4380  N N    . GLU A 1 140 ? 18.436  15.178  -5.037  1.00 0.00 ? 140 GLU A N    2  
ATOM 4381  C CA   . GLU A 1 140 ? 18.294  16.354  -5.915  1.00 0.00 ? 140 GLU A CA   2  
ATOM 4382  C C    . GLU A 1 140 ? 19.237  16.211  -7.096  1.00 0.00 ? 140 GLU A C    2  
ATOM 4383  O O    . GLU A 1 140 ? 19.033  16.790  -8.146  1.00 0.00 ? 140 GLU A O    2  
ATOM 4384  C CB   . GLU A 1 140 ? 18.679  17.608  -5.113  1.00 0.00 ? 140 GLU A CB   2  
ATOM 4385  C CG   . GLU A 1 140 ? 17.607  17.883  -4.050  1.00 0.00 ? 140 GLU A CG   2  
ATOM 4386  C CD   . GLU A 1 140 ? 17.126  16.563  -3.447  1.00 0.00 ? 140 GLU A CD   2  
ATOM 4387  O OE1  . GLU A 1 140 ? 16.354  15.909  -4.127  1.00 0.00 ? 140 GLU A OE1  2  
ATOM 4388  O OE2  . GLU A 1 140 ? 17.558  16.284  -2.341  1.00 0.00 ? 140 GLU A OE2  2  
ATOM 4389  H H    . GLU A 1 140 ? 18.738  15.286  -4.111  1.00 0.00 ? 140 GLU A H    2  
ATOM 4390  H HA   . GLU A 1 140 ? 17.268  16.414  -6.277  1.00 0.00 ? 140 GLU A HA   2  
ATOM 4391  H HB2  . GLU A 1 140 ? 19.634  17.452  -4.632  1.00 0.00 ? 140 GLU A HB2  2  
ATOM 4392  H HB3  . GLU A 1 140 ? 18.755  18.454  -5.779  1.00 0.00 ? 140 GLU A HB3  2  
ATOM 4393  H HG2  . GLU A 1 140 ? 18.021  18.500  -3.267  1.00 0.00 ? 140 GLU A HG2  2  
ATOM 4394  H HG3  . GLU A 1 140 ? 16.771  18.394  -4.500  1.00 0.00 ? 140 GLU A HG3  2  
ATOM 4395  N N    . PHE A 1 141 ? 20.262  15.430  -6.893  1.00 0.00 ? 141 PHE A N    2  
ATOM 4396  C CA   . PHE A 1 141 ? 21.252  15.210  -7.967  1.00 0.00 ? 141 PHE A CA   2  
ATOM 4397  C C    . PHE A 1 141 ? 20.720  14.207  -8.981  1.00 0.00 ? 141 PHE A C    2  
ATOM 4398  O O    . PHE A 1 141 ? 21.062  14.254  -10.146 1.00 0.00 ? 141 PHE A O    2  
ATOM 4399  C CB   . PHE A 1 141 ? 22.521  14.632  -7.325  1.00 0.00 ? 141 PHE A CB   2  
ATOM 4400  C CG   . PHE A 1 141 ? 23.752  15.101  -8.098  1.00 0.00 ? 141 PHE A CG   2  
ATOM 4401  C CD1  . PHE A 1 141 ? 24.319  16.334  -7.833  1.00 0.00 ? 141 PHE A CD1  2  
ATOM 4402  C CD2  . PHE A 1 141 ? 24.329  14.289  -9.062  1.00 0.00 ? 141 PHE A CD2  2  
ATOM 4403  C CE1  . PHE A 1 141 ? 25.444  16.747  -8.516  1.00 0.00 ? 141 PHE A CE1  2  
ATOM 4404  C CE2  . PHE A 1 141 ? 25.453  14.706  -9.742  1.00 0.00 ? 141 PHE A CE2  2  
ATOM 4405  C CZ   . PHE A 1 141 ? 26.008  15.935  -9.469  1.00 0.00 ? 141 PHE A CZ   2  
ATOM 4406  H H    . PHE A 1 141 ? 20.377  14.991  -6.025  1.00 0.00 ? 141 PHE A H    2  
ATOM 4407  H HA   . PHE A 1 141 ? 21.459  16.155  -8.468  1.00 0.00 ? 141 PHE A HA   2  
ATOM 4408  H HB2  . PHE A 1 141 ? 22.596  14.966  -6.301  1.00 0.00 ? 141 PHE A HB2  2  
ATOM 4409  H HB3  . PHE A 1 141 ? 22.480  13.554  -7.344  1.00 0.00 ? 141 PHE A HB3  2  
ATOM 4410  H HD1  . PHE A 1 141 ? 23.879  16.977  -7.085  1.00 0.00 ? 141 PHE A HD1  2  
ATOM 4411  H HD2  . PHE A 1 141 ? 23.895  13.324  -9.280  1.00 0.00 ? 141 PHE A HD2  2  
ATOM 4412  H HE1  . PHE A 1 141 ? 25.884  17.706  -8.297  1.00 0.00 ? 141 PHE A HE1  2  
ATOM 4413  H HE2  . PHE A 1 141 ? 25.906  14.062  -10.480 1.00 0.00 ? 141 PHE A HE2  2  
ATOM 4414  H HZ   . PHE A 1 141 ? 26.888  16.262  -10.002 1.00 0.00 ? 141 PHE A HZ   2  
ATOM 4415  N N    . VAL A 1 142 ? 19.884  13.316  -8.516  1.00 0.00 ? 142 VAL A N    2  
ATOM 4416  C CA   . VAL A 1 142 ? 19.316  12.300  -9.433  1.00 0.00 ? 142 VAL A CA   2  
ATOM 4417  C C    . VAL A 1 142 ? 18.331  12.933  -10.410 1.00 0.00 ? 142 VAL A C    2  
ATOM 4418  O O    . VAL A 1 142 ? 18.184  12.478  -11.526 1.00 0.00 ? 142 VAL A O    2  
ATOM 4419  C CB   . VAL A 1 142 ? 18.569  11.249  -8.593  1.00 0.00 ? 142 VAL A CB   2  
ATOM 4420  C CG1  . VAL A 1 142 ? 17.597  10.490  -9.495  1.00 0.00 ? 142 VAL A CG1  2  
ATOM 4421  C CG2  . VAL A 1 142 ? 19.570  10.260  -8.004  1.00 0.00 ? 142 VAL A CG2  2  
ATOM 4422  H H    . VAL A 1 142 ? 19.633  13.322  -7.568  1.00 0.00 ? 142 VAL A H    2  
ATOM 4423  H HA   . VAL A 1 142 ? 20.125  11.839  -9.995  1.00 0.00 ? 142 VAL A HA   2  
ATOM 4424  H HB   . VAL A 1 142 ? 18.025  11.735  -7.796  1.00 0.00 ? 142 VAL A HB   2  
ATOM 4425  H HG11 . VAL A 1 142 ? 18.103  10.188  -10.400 1.00 0.00 ? 142 VAL A HG11 2  
ATOM 4426  H HG12 . VAL A 1 142 ? 17.233  9.612   -8.981  1.00 0.00 ? 142 VAL A HG12 2  
ATOM 4427  H HG13 . VAL A 1 142 ? 16.763  11.126  -9.748  1.00 0.00 ? 142 VAL A HG13 2  
ATOM 4428  H HG21 . VAL A 1 142 ? 20.492  10.770  -7.766  1.00 0.00 ? 142 VAL A HG21 2  
ATOM 4429  H HG22 . VAL A 1 142 ? 19.162  9.821   -7.108  1.00 0.00 ? 142 VAL A HG22 2  
ATOM 4430  H HG23 . VAL A 1 142 ? 19.771  9.480   -8.718  1.00 0.00 ? 142 VAL A HG23 2  
ATOM 4431  N N    . GLN A 1 143 ? 17.675  13.972  -9.973  1.00 0.00 ? 143 GLN A N    2  
ATOM 4432  C CA   . GLN A 1 143 ? 16.699  14.641  -10.864 1.00 0.00 ? 143 GLN A CA   2  
ATOM 4433  C C    . GLN A 1 143 ? 17.370  15.737  -11.681 1.00 0.00 ? 143 GLN A C    2  
ATOM 4434  O O    . GLN A 1 143 ? 16.914  16.080  -12.754 1.00 0.00 ? 143 GLN A O    2  
ATOM 4435  C CB   . GLN A 1 143 ? 15.607  15.277  -9.993  1.00 0.00 ? 143 GLN A CB   2  
ATOM 4436  C CG   . GLN A 1 143 ? 14.682  14.180  -9.462  1.00 0.00 ? 143 GLN A CG   2  
ATOM 4437  C CD   . GLN A 1 143 ? 15.208  13.683  -8.115  1.00 0.00 ? 143 GLN A CD   2  
ATOM 4438  O OE1  . GLN A 1 143 ? 15.420  14.453  -7.200  1.00 0.00 ? 143 GLN A OE1  2  
ATOM 4439  N NE2  . GLN A 1 143 ? 15.428  12.407  -7.953  1.00 0.00 ? 143 GLN A NE2  2  
ATOM 4440  H H    . GLN A 1 143 ? 17.825  14.306  -9.068  1.00 0.00 ? 143 GLN A H    2  
ATOM 4441  H HA   . GLN A 1 143 ? 16.275  13.903  -11.540 1.00 0.00 ? 143 GLN A HA   2  
ATOM 4442  H HB2  . GLN A 1 143 ? 16.062  15.800  -9.164  1.00 0.00 ? 143 GLN A HB2  2  
ATOM 4443  H HB3  . GLN A 1 143 ? 15.036  15.978  -10.582 1.00 0.00 ? 143 GLN A HB3  2  
ATOM 4444  H HG2  . GLN A 1 143 ? 13.685  14.571  -9.332  1.00 0.00 ? 143 GLN A HG2  2  
ATOM 4445  H HG3  . GLN A 1 143 ? 14.655  13.356  -10.159 1.00 0.00 ? 143 GLN A HG3  2  
ATOM 4446  H HE21 . GLN A 1 143 ? 15.256  11.782  -8.688  1.00 0.00 ? 143 GLN A HE21 2  
ATOM 4447  H HE22 . GLN A 1 143 ? 15.768  12.073  -7.097  1.00 0.00 ? 143 GLN A HE22 2  
ATOM 4448  N N    . MET A 1 144 ? 18.440  16.266  -11.162 1.00 0.00 ? 144 MET A N    2  
ATOM 4449  C CA   . MET A 1 144 ? 19.145  17.338  -11.897 1.00 0.00 ? 144 MET A CA   2  
ATOM 4450  C C    . MET A 1 144 ? 20.046  16.762  -12.983 1.00 0.00 ? 144 MET A C    2  
ATOM 4451  O O    . MET A 1 144 ? 20.564  17.487  -13.809 1.00 0.00 ? 144 MET A O    2  
ATOM 4452  C CB   . MET A 1 144 ? 20.012  18.119  -10.900 1.00 0.00 ? 144 MET A CB   2  
ATOM 4453  C CG   . MET A 1 144 ? 20.460  19.439  -11.539 1.00 0.00 ? 144 MET A CG   2  
ATOM 4454  S SD   . MET A 1 144 ? 22.221  19.627  -11.907 1.00 0.00 ? 144 MET A SD   2  
ATOM 4455  C CE   . MET A 1 144 ? 22.708  20.316  -10.308 1.00 0.00 ? 144 MET A CE   2  
ATOM 4456  H H    . MET A 1 144 ? 18.772  15.960  -10.293 1.00 0.00 ? 144 MET A H    2  
ATOM 4457  H HA   . MET A 1 144 ? 18.407  17.991  -12.360 1.00 0.00 ? 144 MET A HA   2  
ATOM 4458  H HB2  . MET A 1 144 ? 19.441  18.324  -10.006 1.00 0.00 ? 144 MET A HB2  2  
ATOM 4459  H HB3  . MET A 1 144 ? 20.880  17.531  -10.637 1.00 0.00 ? 144 MET A HB3  2  
ATOM 4460  H HG2  . MET A 1 144 ? 19.918  19.572  -12.464 1.00 0.00 ? 144 MET A HG2  2  
ATOM 4461  H HG3  . MET A 1 144 ? 20.178  20.245  -10.878 1.00 0.00 ? 144 MET A HG3  2  
ATOM 4462  H HE1  . MET A 1 144 ? 22.034  19.960  -9.542  1.00 0.00 ? 144 MET A HE1  2  
ATOM 4463  H HE2  . MET A 1 144 ? 23.715  20.005  -10.073 1.00 0.00 ? 144 MET A HE2  2  
ATOM 4464  H HE3  . MET A 1 144 ? 22.665  21.394  -10.354 1.00 0.00 ? 144 MET A HE3  2  
ATOM 4465  N N    . MET A 1 145 ? 20.214  15.469  -12.969 1.00 0.00 ? 145 MET A N    2  
ATOM 4466  C CA   . MET A 1 145 ? 21.078  14.843  -13.996 1.00 0.00 ? 145 MET A CA   2  
ATOM 4467  C C    . MET A 1 145 ? 20.297  14.607  -15.283 1.00 0.00 ? 145 MET A C    2  
ATOM 4468  O O    . MET A 1 145 ? 20.837  14.715  -16.367 1.00 0.00 ? 145 MET A O    2  
ATOM 4469  C CB   . MET A 1 145 ? 21.570  13.489  -13.456 1.00 0.00 ? 145 MET A CB   2  
ATOM 4470  C CG   . MET A 1 145 ? 23.062  13.588  -13.130 1.00 0.00 ? 145 MET A CG   2  
ATOM 4471  S SD   . MET A 1 145 ? 24.212  13.733  -14.519 1.00 0.00 ? 145 MET A SD   2  
ATOM 4472  C CE   . MET A 1 145 ? 25.740  13.598  -13.558 1.00 0.00 ? 145 MET A CE   2  
ATOM 4473  H H    . MET A 1 145 ? 19.773  14.918  -12.291 1.00 0.00 ? 145 MET A H    2  
ATOM 4474  H HA   . MET A 1 145 ? 21.916  15.504  -14.204 1.00 0.00 ? 145 MET A HA   2  
ATOM 4475  H HB2  . MET A 1 145 ? 21.020  13.234  -12.561 1.00 0.00 ? 145 MET A HB2  2  
ATOM 4476  H HB3  . MET A 1 145 ? 21.411  12.722  -14.199 1.00 0.00 ? 145 MET A HB3  2  
ATOM 4477  H HG2  . MET A 1 145 ? 23.211  14.448  -12.492 1.00 0.00 ? 145 MET A HG2  2  
ATOM 4478  H HG3  . MET A 1 145 ? 23.342  12.711  -12.566 1.00 0.00 ? 145 MET A HG3  2  
ATOM 4479  H HE1  . MET A 1 145 ? 25.497  13.418  -12.523 1.00 0.00 ? 145 MET A HE1  2  
ATOM 4480  H HE2  . MET A 1 145 ? 26.332  12.778  -13.935 1.00 0.00 ? 145 MET A HE2  2  
ATOM 4481  H HE3  . MET A 1 145 ? 26.302  14.516  -13.641 1.00 0.00 ? 145 MET A HE3  2  
ATOM 4482  N N    . THR A 1 146 ? 19.038  14.291  -15.136 1.00 0.00 ? 146 THR A N    2  
ATOM 4483  C CA   . THR A 1 146 ? 18.195  14.042  -16.335 1.00 0.00 ? 146 THR A CA   2  
ATOM 4484  C C    . THR A 1 146 ? 17.386  15.286  -16.692 1.00 0.00 ? 146 THR A C    2  
ATOM 4485  O O    . THR A 1 146 ? 17.665  15.949  -17.671 1.00 0.00 ? 146 THR A O    2  
ATOM 4486  C CB   . THR A 1 146 ? 17.232  12.888  -16.012 1.00 0.00 ? 146 THR A CB   2  
ATOM 4487  O OG1  . THR A 1 146 ? 17.828  11.737  -16.576 1.00 0.00 ? 146 THR A OG1  2  
ATOM 4488  C CG2  . THR A 1 146 ? 15.903  13.039  -16.772 1.00 0.00 ? 146 THR A CG2  2  
ATOM 4489  H H    . THR A 1 146 ? 18.650  14.221  -14.239 1.00 0.00 ? 146 THR A H    2  
ATOM 4490  H HA   . THR A 1 146 ? 18.838  13.786  -17.175 1.00 0.00 ? 146 THR A HA   2  
ATOM 4491  H HB   . THR A 1 146 ? 17.093  12.765  -14.940 1.00 0.00 ? 146 THR A HB   2  
ATOM 4492  H HG1  . THR A 1 146 ? 18.122  11.172  -15.857 1.00 0.00 ? 146 THR A HG1  2  
ATOM 4493  H HG21 . THR A 1 146 ? 16.081  13.503  -17.731 1.00 0.00 ? 146 THR A HG21 2  
ATOM 4494  H HG22 . THR A 1 146 ? 15.459  12.067  -16.925 1.00 0.00 ? 146 THR A HG22 2  
ATOM 4495  H HG23 . THR A 1 146 ? 15.224  13.654  -16.200 1.00 0.00 ? 146 THR A HG23 2  
ATOM 4496  N N    . ALA A 1 147 ? 16.401  15.582  -15.890 1.00 0.00 ? 147 ALA A N    2  
ATOM 4497  C CA   . ALA A 1 147 ? 15.566  16.778  -16.170 1.00 0.00 ? 147 ALA A CA   2  
ATOM 4498  C C    . ALA A 1 147 ? 15.022  16.738  -17.594 1.00 0.00 ? 147 ALA A C    2  
ATOM 4499  O O    . ALA A 1 147 ? 14.943  15.689  -18.201 1.00 0.00 ? 147 ALA A O    2  
ATOM 4500  C CB   . ALA A 1 147 ? 16.442  18.034  -16.008 1.00 0.00 ? 147 ALA A CB   2  
ATOM 4501  H H    . ALA A 1 147 ? 16.211  15.018  -15.112 1.00 0.00 ? 147 ALA A H    2  
ATOM 4502  H HA   . ALA A 1 147 ? 14.730  16.797  -15.471 1.00 0.00 ? 147 ALA A HA   2  
ATOM 4503  H HB1  . ALA A 1 147 ? 17.147  17.886  -15.203 1.00 0.00 ? 147 ALA A HB1  2  
ATOM 4504  H HB2  . ALA A 1 147 ? 16.983  18.221  -16.924 1.00 0.00 ? 147 ALA A HB2  2  
ATOM 4505  H HB3  . ALA A 1 147 ? 15.819  18.886  -15.782 1.00 0.00 ? 147 ALA A HB3  2  
ATOM 4506  N N    . LYS A 1 148 ? 14.656  17.884  -18.100 1.00 0.00 ? 148 LYS A N    2  
ATOM 4507  C CA   . LYS A 1 148 ? 14.116  17.932  -19.482 1.00 0.00 ? 148 LYS A CA   2  
ATOM 4508  C C    . LYS A 1 148 ? 15.102  17.328  -20.475 1.00 0.00 ? 148 LYS A C    2  
ATOM 4509  O O    . LYS A 1 148 ? 14.771  16.275  -20.995 1.00 0.00 ? 148 LYS A O    2  
ATOM 4510  C CB   . LYS A 1 148 ? 13.878  19.402  -19.857 1.00 0.00 ? 148 LYS A CB   2  
ATOM 4511  C CG   . LYS A 1 148 ? 12.832  20.000  -18.911 1.00 0.00 ? 148 LYS A CG   2  
ATOM 4512  C CD   . LYS A 1 148 ? 12.292  21.297  -19.519 1.00 0.00 ? 148 LYS A CD   2  
ATOM 4513  C CE   . LYS A 1 148 ? 11.573  22.102  -18.432 1.00 0.00 ? 148 LYS A CE   2  
ATOM 4514  N NZ   . LYS A 1 148 ? 12.511  23.065  -17.790 1.00 0.00 ? 148 LYS A NZ   2  
ATOM 4515  O OXT  . LYS A 1 148 ? 16.134  17.952  -20.660 1.00 0.00 ? 148 LYS A OXT  2  
ATOM 4516  H H    . LYS A 1 148 ? 14.737  18.705  -17.573 1.00 0.00 ? 148 LYS A H    2  
ATOM 4517  H HA   . LYS A 1 148 ? 13.185  17.368  -19.519 1.00 0.00 ? 148 LYS A HA   2  
ATOM 4518  H HB2  . LYS A 1 148 ? 14.804  19.952  -19.769 1.00 0.00 ? 148 LYS A HB2  2  
ATOM 4519  H HB3  . LYS A 1 148 ? 13.525  19.464  -20.875 1.00 0.00 ? 148 LYS A HB3  2  
ATOM 4520  H HG2  . LYS A 1 148 ? 12.022  19.299  -18.775 1.00 0.00 ? 148 LYS A HG2  2  
ATOM 4521  H HG3  . LYS A 1 148 ? 13.285  20.208  -17.953 1.00 0.00 ? 148 LYS A HG3  2  
ATOM 4522  H HD2  . LYS A 1 148 ? 13.110  21.877  -19.919 1.00 0.00 ? 148 LYS A HD2  2  
ATOM 4523  H HD3  . LYS A 1 148 ? 11.602  21.064  -20.315 1.00 0.00 ? 148 LYS A HD3  2  
ATOM 4524  H HE2  . LYS A 1 148 ? 10.753  22.649  -18.872 1.00 0.00 ? 148 LYS A HE2  2  
ATOM 4525  H HE3  . LYS A 1 148 ? 11.187  21.431  -17.680 1.00 0.00 ? 148 LYS A HE3  2  
ATOM 4526  H HZ1  . LYS A 1 148 ? 13.471  22.667  -17.789 1.00 0.00 ? 148 LYS A HZ1  2  
ATOM 4527  H HZ2  . LYS A 1 148 ? 12.507  23.959  -18.321 1.00 0.00 ? 148 LYS A HZ2  2  
ATOM 4528  H HZ3  . LYS A 1 148 ? 12.208  23.242  -16.810 1.00 0.00 ? 148 LYS A HZ3  2  
ATOM 4529  N N    . ALA A 1 1   ? 13.192  16.077  -18.640 1.00 0.00 ? 1   ALA A N    3  
ATOM 4530  C CA   . ALA A 1 1   ? 13.116  16.675  -17.285 1.00 0.00 ? 1   ALA A CA   3  
ATOM 4531  C C    . ALA A 1 1   ? 12.438  15.707  -16.323 1.00 0.00 ? 1   ALA A C    3  
ATOM 4532  O O    . ALA A 1 1   ? 12.017  14.636  -16.710 1.00 0.00 ? 1   ALA A O    3  
ATOM 4533  C CB   . ALA A 1 1   ? 12.294  17.973  -17.331 1.00 0.00 ? 1   ALA A CB   3  
ATOM 4534  H H1   . ALA A 1 1   ? 13.131  15.042  -18.566 1.00 0.00 ? 1   ALA A H1   3  
ATOM 4535  H H2   . ALA A 1 1   ? 12.405  16.430  -19.220 1.00 0.00 ? 1   ALA A H2   3  
ATOM 4536  H H3   . ALA A 1 1   ? 14.095  16.340  -19.084 1.00 0.00 ? 1   ALA A H3   3  
ATOM 4537  H HA   . ALA A 1 1   ? 14.129  16.871  -16.930 1.00 0.00 ? 1   ALA A HA   3  
ATOM 4538  H HB1  . ALA A 1 1   ? 12.688  18.626  -18.095 1.00 0.00 ? 1   ALA A HB1  3  
ATOM 4539  H HB2  . ALA A 1 1   ? 11.263  17.743  -17.556 1.00 0.00 ? 1   ALA A HB2  3  
ATOM 4540  H HB3  . ALA A 1 1   ? 12.347  18.472  -16.375 1.00 0.00 ? 1   ALA A HB3  3  
ATOM 4541  N N    . ASP A 1 2   ? 12.342  16.105  -15.084 1.00 0.00 ? 2   ASP A N    3  
ATOM 4542  C CA   . ASP A 1 2   ? 11.696  15.222  -14.082 1.00 0.00 ? 2   ASP A CA   3  
ATOM 4543  C C    . ASP A 1 2   ? 10.346  14.729  -14.584 1.00 0.00 ? 2   ASP A C    3  
ATOM 4544  O O    . ASP A 1 2   ? 9.716   15.364  -15.405 1.00 0.00 ? 2   ASP A O    3  
ATOM 4545  C CB   . ASP A 1 2   ? 11.480  16.030  -12.793 1.00 0.00 ? 2   ASP A CB   3  
ATOM 4546  C CG   . ASP A 1 2   ? 12.834  16.317  -12.142 1.00 0.00 ? 2   ASP A CG   3  
ATOM 4547  O OD1  . ASP A 1 2   ? 13.812  15.844  -12.697 1.00 0.00 ? 2   ASP A OD1  3  
ATOM 4548  O OD2  . ASP A 1 2   ? 12.814  16.993  -11.127 1.00 0.00 ? 2   ASP A OD2  3  
ATOM 4549  H H    . ASP A 1 2   ? 12.697  16.979  -14.817 1.00 0.00 ? 2   ASP A H    3  
ATOM 4550  H HA   . ASP A 1 2   ? 12.341  14.364  -13.896 1.00 0.00 ? 2   ASP A HA   3  
ATOM 4551  H HB2  . ASP A 1 2   ? 10.990  16.965  -13.025 1.00 0.00 ? 2   ASP A HB2  3  
ATOM 4552  H HB3  . ASP A 1 2   ? 10.865  15.466  -12.106 1.00 0.00 ? 2   ASP A HB3  3  
ATOM 4553  N N    . GLN A 1 3   ? 9.924   13.600  -14.079 1.00 0.00 ? 3   GLN A N    3  
ATOM 4554  C CA   . GLN A 1 3   ? 8.618   13.052  -14.516 1.00 0.00 ? 3   GLN A CA   3  
ATOM 4555  C C    . GLN A 1 3   ? 8.266   11.794  -13.732 1.00 0.00 ? 3   GLN A C    3  
ATOM 4556  O O    . GLN A 1 3   ? 9.129   11.009  -13.393 1.00 0.00 ? 3   GLN A O    3  
ATOM 4557  C CB   . GLN A 1 3   ? 8.721   12.690  -16.006 1.00 0.00 ? 3   GLN A CB   3  
ATOM 4558  C CG   . GLN A 1 3   ? 10.033  11.938  -16.251 1.00 0.00 ? 3   GLN A CG   3  
ATOM 4559  C CD   . GLN A 1 3   ? 10.041  11.384  -17.677 1.00 0.00 ? 3   GLN A CD   3  
ATOM 4560  O OE1  . GLN A 1 3   ? 11.039  11.435  -18.369 1.00 0.00 ? 3   GLN A OE1  3  
ATOM 4561  N NE2  . GLN A 1 3   ? 8.952   10.848  -18.154 1.00 0.00 ? 3   GLN A NE2  3  
ATOM 4562  H H    . GLN A 1 3   ? 10.467  13.119  -13.420 1.00 0.00 ? 3   GLN A H    3  
ATOM 4563  H HA   . GLN A 1 3   ? 7.845   13.801  -14.353 1.00 0.00 ? 3   GLN A HA   3  
ATOM 4564  H HB2  . GLN A 1 3   ? 7.888   12.063  -16.286 1.00 0.00 ? 3   GLN A HB2  3  
ATOM 4565  H HB3  . GLN A 1 3   ? 8.703   13.591  -16.600 1.00 0.00 ? 3   GLN A HB3  3  
ATOM 4566  H HG2  . GLN A 1 3   ? 10.868  12.611  -16.124 1.00 0.00 ? 3   GLN A HG2  3  
ATOM 4567  H HG3  . GLN A 1 3   ? 10.122  11.122  -15.550 1.00 0.00 ? 3   GLN A HG3  3  
ATOM 4568  H HE21 . GLN A 1 3   ? 8.145   10.805  -17.601 1.00 0.00 ? 3   GLN A HE21 3  
ATOM 4569  H HE22 . GLN A 1 3   ? 8.942   10.490  -19.066 1.00 0.00 ? 3   GLN A HE22 3  
ATOM 4570  N N    . LEU A 1 4   ? 6.998   11.632  -13.453 1.00 0.00 ? 4   LEU A N    3  
ATOM 4571  C CA   . LEU A 1 4   ? 6.551   10.434  -12.690 1.00 0.00 ? 4   LEU A CA   3  
ATOM 4572  C C    . LEU A 1 4   ? 7.274   10.321  -11.347 1.00 0.00 ? 4   LEU A C    3  
ATOM 4573  O O    . LEU A 1 4   ? 8.395   9.857   -11.281 1.00 0.00 ? 4   LEU A O    3  
ATOM 4574  C CB   . LEU A 1 4   ? 6.860   9.178   -13.525 1.00 0.00 ? 4   LEU A CB   3  
ATOM 4575  C CG   . LEU A 1 4   ? 5.604   8.753   -14.289 1.00 0.00 ? 4   LEU A CG   3  
ATOM 4576  C CD1  . LEU A 1 4   ? 5.919   7.501   -15.112 1.00 0.00 ? 4   LEU A CD1  3  
ATOM 4577  C CD2  . LEU A 1 4   ? 4.488   8.432   -13.290 1.00 0.00 ? 4   LEU A CD2  3  
ATOM 4578  H H    . LEU A 1 4   ? 6.342   12.299  -13.748 1.00 0.00 ? 4   LEU A H    3  
ATOM 4579  H HA   . LEU A 1 4   ? 5.480   10.518  -12.505 1.00 0.00 ? 4   LEU A HA   3  
ATOM 4580  H HB2  . LEU A 1 4   ? 7.651   9.392   -14.227 1.00 0.00 ? 4   LEU A HB2  3  
ATOM 4581  H HB3  . LEU A 1 4   ? 7.175   8.377   -12.871 1.00 0.00 ? 4   LEU A HB3  3  
ATOM 4582  H HG   . LEU A 1 4   ? 5.288   9.552   -14.945 1.00 0.00 ? 4   LEU A HG   3  
ATOM 4583  H HD11 . LEU A 1 4   ? 6.240   6.705   -14.457 1.00 0.00 ? 4   LEU A HD11 3  
ATOM 4584  H HD12 . LEU A 1 4   ? 5.038   7.184   -15.649 1.00 0.00 ? 4   LEU A HD12 3  
ATOM 4585  H HD13 . LEU A 1 4   ? 6.706   7.719   -15.819 1.00 0.00 ? 4   LEU A HD13 3  
ATOM 4586  H HD21 . LEU A 1 4   ? 4.907   8.312   -12.302 1.00 0.00 ? 4   LEU A HD21 3  
ATOM 4587  H HD22 . LEU A 1 4   ? 3.769   9.238   -13.275 1.00 0.00 ? 4   LEU A HD22 3  
ATOM 4588  H HD23 . LEU A 1 4   ? 3.991   7.518   -13.579 1.00 0.00 ? 4   LEU A HD23 3  
ATOM 4589  N N    . THR A 1 5   ? 6.602   10.745  -10.299 1.00 0.00 ? 5   THR A N    3  
ATOM 4590  C CA   . THR A 1 5   ? 7.216   10.679  -8.939  1.00 0.00 ? 5   THR A CA   3  
ATOM 4591  C C    . THR A 1 5   ? 6.428   9.728   -8.044  1.00 0.00 ? 5   THR A C    3  
ATOM 4592  O O    . THR A 1 5   ? 5.280   9.436   -8.308  1.00 0.00 ? 5   THR A O    3  
ATOM 4593  C CB   . THR A 1 5   ? 7.169   12.082  -8.321  1.00 0.00 ? 5   THR A CB   3  
ATOM 4594  O OG1  . THR A 1 5   ? 5.795   12.372  -8.160  1.00 0.00 ? 5   THR A OG1  3  
ATOM 4595  C CG2  . THR A 1 5   ? 7.671   13.136  -9.318  1.00 0.00 ? 5   THR A CG2  3  
ATOM 4596  H H    . THR A 1 5   ? 5.698   11.106  -10.410 1.00 0.00 ? 5   THR A H    3  
ATOM 4597  H HA   . THR A 1 5   ? 8.241   10.324  -9.019  1.00 0.00 ? 5   THR A HA   3  
ATOM 4598  H HB   . THR A 1 5   ? 7.688   12.120  -7.366  1.00 0.00 ? 5   THR A HB   3  
ATOM 4599  H HG1  . THR A 1 5   ? 5.431   11.748  -7.526  1.00 0.00 ? 5   THR A HG1  3  
ATOM 4600  H HG21 . THR A 1 5   ? 7.154   13.024  -10.259 1.00 0.00 ? 5   THR A HG21 3  
ATOM 4601  H HG22 . THR A 1 5   ? 7.484   14.125  -8.927  1.00 0.00 ? 5   THR A HG22 3  
ATOM 4602  H HG23 . THR A 1 5   ? 8.732   13.011  -9.477  1.00 0.00 ? 5   THR A HG23 3  
ATOM 4603  N N    . GLU A 1 6   ? 7.057   9.260   -6.998  1.00 0.00 ? 6   GLU A N    3  
ATOM 4604  C CA   . GLU A 1 6   ? 6.348   8.329   -6.082  1.00 0.00 ? 6   GLU A CA   3  
ATOM 4605  C C    . GLU A 1 6   ? 4.967   8.865   -5.742  1.00 0.00 ? 6   GLU A C    3  
ATOM 4606  O O    . GLU A 1 6   ? 4.000   8.133   -5.741  1.00 0.00 ? 6   GLU A O    3  
ATOM 4607  C CB   . GLU A 1 6   ? 7.162   8.198   -4.788  1.00 0.00 ? 6   GLU A CB   3  
ATOM 4608  C CG   . GLU A 1 6   ? 8.645   8.054   -5.140  1.00 0.00 ? 6   GLU A CG   3  
ATOM 4609  C CD   . GLU A 1 6   ? 9.439   7.744   -3.869  1.00 0.00 ? 6   GLU A CD   3  
ATOM 4610  O OE1  . GLU A 1 6   ? 9.200   6.677   -3.328  1.00 0.00 ? 6   GLU A OE1  3  
ATOM 4611  O OE2  . GLU A 1 6   ? 10.241  8.590   -3.513  1.00 0.00 ? 6   GLU A OE2  3  
ATOM 4612  H H    . GLU A 1 6   ? 7.984   9.522   -6.818  1.00 0.00 ? 6   GLU A H    3  
ATOM 4613  H HA   . GLU A 1 6   ? 6.239   7.358   -6.575  1.00 0.00 ? 6   GLU A HA   3  
ATOM 4614  H HB2  . GLU A 1 6   ? 7.017   9.077   -4.178  1.00 0.00 ? 6   GLU A HB2  3  
ATOM 4615  H HB3  . GLU A 1 6   ? 6.833   7.327   -4.240  1.00 0.00 ? 6   GLU A HB3  3  
ATOM 4616  H HG2  . GLU A 1 6   ? 8.776   7.249   -5.848  1.00 0.00 ? 6   GLU A HG2  3  
ATOM 4617  H HG3  . GLU A 1 6   ? 9.009   8.973   -5.573  1.00 0.00 ? 6   GLU A HG3  3  
ATOM 4618  N N    . GLU A 1 7   ? 4.893   10.133  -5.451  1.00 0.00 ? 7   GLU A N    3  
ATOM 4619  C CA   . GLU A 1 7   ? 3.575   10.708  -5.116  1.00 0.00 ? 7   GLU A CA   3  
ATOM 4620  C C    . GLU A 1 7   ? 2.637   10.539  -6.291  1.00 0.00 ? 7   GLU A C    3  
ATOM 4621  O O    . GLU A 1 7   ? 1.446   10.372  -6.121  1.00 0.00 ? 7   GLU A O    3  
ATOM 4622  C CB   . GLU A 1 7   ? 3.748   12.204  -4.817  1.00 0.00 ? 7   GLU A CB   3  
ATOM 4623  C CG   . GLU A 1 7   ? 4.156   12.379  -3.352  1.00 0.00 ? 7   GLU A CG   3  
ATOM 4624  C CD   . GLU A 1 7   ? 4.278   13.870  -3.034  1.00 0.00 ? 7   GLU A CD   3  
ATOM 4625  O OE1  . GLU A 1 7   ? 4.253   14.630  -3.988  1.00 0.00 ? 7   GLU A OE1  3  
ATOM 4626  O OE2  . GLU A 1 7   ? 4.387   14.164  -1.855  1.00 0.00 ? 7   GLU A OE2  3  
ATOM 4627  H H    . GLU A 1 7   ? 5.697   10.694  -5.455  1.00 0.00 ? 7   GLU A H    3  
ATOM 4628  H HA   . GLU A 1 7   ? 3.162   10.176  -4.257  1.00 0.00 ? 7   GLU A HA   3  
ATOM 4629  H HB2  . GLU A 1 7   ? 4.512   12.617  -5.459  1.00 0.00 ? 7   GLU A HB2  3  
ATOM 4630  H HB3  . GLU A 1 7   ? 2.816   12.720  -4.998  1.00 0.00 ? 7   GLU A HB3  3  
ATOM 4631  H HG2  . GLU A 1 7   ? 3.411   11.936  -2.709  1.00 0.00 ? 7   GLU A HG2  3  
ATOM 4632  H HG3  . GLU A 1 7   ? 5.108   11.899  -3.178  1.00 0.00 ? 7   GLU A HG3  3  
ATOM 4633  N N    . GLN A 1 8   ? 3.192   10.586  -7.470  1.00 0.00 ? 8   GLN A N    3  
ATOM 4634  C CA   . GLN A 1 8   ? 2.357   10.427  -8.663  1.00 0.00 ? 8   GLN A CA   3  
ATOM 4635  C C    . GLN A 1 8   ? 1.748   9.046   -8.646  1.00 0.00 ? 8   GLN A C    3  
ATOM 4636  O O    . GLN A 1 8   ? 0.595   8.857   -8.982  1.00 0.00 ? 8   GLN A O    3  
ATOM 4637  C CB   . GLN A 1 8   ? 3.253   10.569  -9.896  1.00 0.00 ? 8   GLN A CB   3  
ATOM 4638  C CG   . GLN A 1 8   ? 2.440   11.165  -11.034 1.00 0.00 ? 8   GLN A CG   3  
ATOM 4639  C CD   . GLN A 1 8   ? 2.013   12.585  -10.661 1.00 0.00 ? 8   GLN A CD   3  
ATOM 4640  O OE1  . GLN A 1 8   ? 2.533   13.180  -9.738  1.00 0.00 ? 8   GLN A OE1  3  
ATOM 4641  N NE2  . GLN A 1 8   ? 1.068   13.164  -11.351 1.00 0.00 ? 8   GLN A NE2  3  
ATOM 4642  H H    . GLN A 1 8   ? 4.157   10.717  -7.561  1.00 0.00 ? 8   GLN A H    3  
ATOM 4643  H HA   . GLN A 1 8   ? 1.565   11.177  -8.655  1.00 0.00 ? 8   GLN A HA   3  
ATOM 4644  H HB2  . GLN A 1 8   ? 4.086   11.217  -9.667  1.00 0.00 ? 8   GLN A HB2  3  
ATOM 4645  H HB3  . GLN A 1 8   ? 3.628   9.600   -10.186 1.00 0.00 ? 8   GLN A HB3  3  
ATOM 4646  H HG2  . GLN A 1 8   ? 3.039   11.196  -11.929 1.00 0.00 ? 8   GLN A HG2  3  
ATOM 4647  H HG3  . GLN A 1 8   ? 1.565   10.562  -11.208 1.00 0.00 ? 8   GLN A HG3  3  
ATOM 4648  H HE21 . GLN A 1 8   ? 0.644   12.690  -12.095 1.00 0.00 ? 8   GLN A HE21 3  
ATOM 4649  H HE22 . GLN A 1 8   ? 0.782   14.073  -11.123 1.00 0.00 ? 8   GLN A HE22 3  
ATOM 4650  N N    . ILE A 1 9   ? 2.547   8.095   -8.248  1.00 0.00 ? 9   ILE A N    3  
ATOM 4651  C CA   . ILE A 1 9   ? 2.060   6.709   -8.188  1.00 0.00 ? 9   ILE A CA   3  
ATOM 4652  C C    . ILE A 1 9   ? 1.025   6.581   -7.085  1.00 0.00 ? 9   ILE A C    3  
ATOM 4653  O O    . ILE A 1 9   ? 0.126   5.769   -7.163  1.00 0.00 ? 9   ILE A O    3  
ATOM 4654  C CB   . ILE A 1 9   ? 3.242   5.795   -7.876  1.00 0.00 ? 9   ILE A CB   3  
ATOM 4655  C CG1  . ILE A 1 9   ? 4.001   5.491   -9.155  1.00 0.00 ? 9   ILE A CG1  3  
ATOM 4656  C CG2  . ILE A 1 9   ? 2.706   4.480   -7.301  1.00 0.00 ? 9   ILE A CG2  3  
ATOM 4657  C CD1  . ILE A 1 9   ? 4.877   6.689   -9.511  1.00 0.00 ? 9   ILE A CD1  3  
ATOM 4658  H H    . ILE A 1 9   ? 3.469   8.306   -7.993  1.00 0.00 ? 9   ILE A H    3  
ATOM 4659  H HA   . ILE A 1 9   ? 1.603   6.445   -9.142  1.00 0.00 ? 9   ILE A HA   3  
ATOM 4660  H HB   . ILE A 1 9   ? 3.906   6.289   -7.173  1.00 0.00 ? 9   ILE A HB   3  
ATOM 4661  H HG12 . ILE A 1 9   ? 4.620   4.621   -9.010  1.00 0.00 ? 9   ILE A HG12 3  
ATOM 4662  H HG13 . ILE A 1 9   ? 3.303   5.301   -9.955  1.00 0.00 ? 9   ILE A HG13 3  
ATOM 4663  H HG21 . ILE A 1 9   ? 1.860   4.146   -7.883  1.00 0.00 ? 9   ILE A HG21 3  
ATOM 4664  H HG22 . ILE A 1 9   ? 3.479   3.727   -7.332  1.00 0.00 ? 9   ILE A HG22 3  
ATOM 4665  H HG23 . ILE A 1 9   ? 2.397   4.631   -6.278  1.00 0.00 ? 9   ILE A HG23 3  
ATOM 4666  H HD11 . ILE A 1 9   ? 4.258   7.562   -9.655  1.00 0.00 ? 9   ILE A HD11 3  
ATOM 4667  H HD12 . ILE A 1 9   ? 5.579   6.877   -8.712  1.00 0.00 ? 9   ILE A HD12 3  
ATOM 4668  H HD13 . ILE A 1 9   ? 5.421   6.484   -10.420 1.00 0.00 ? 9   ILE A HD13 3  
ATOM 4669  N N    . ALA A 1 10  ? 1.171   7.391   -6.060  1.00 0.00 ? 10  ALA A N    3  
ATOM 4670  C CA   . ALA A 1 10  ? 0.197   7.324   -4.954  1.00 0.00 ? 10  ALA A CA   3  
ATOM 4671  C C    . ALA A 1 10  ? -1.138  7.858   -5.433  1.00 0.00 ? 10  ALA A C    3  
ATOM 4672  O O    . ALA A 1 10  ? -2.175  7.279   -5.174  1.00 0.00 ? 10  ALA A O    3  
ATOM 4673  C CB   . ALA A 1 10  ? 0.704   8.196   -3.796  1.00 0.00 ? 10  ALA A CB   3  
ATOM 4674  H H    . ALA A 1 10  ? 1.918   8.035   -6.030  1.00 0.00 ? 10  ALA A H    3  
ATOM 4675  H HA   . ALA A 1 10  ? 0.077   6.285   -4.644  1.00 0.00 ? 10  ALA A HA   3  
ATOM 4676  H HB1  . ALA A 1 10  ? 1.768   8.057   -3.674  1.00 0.00 ? 10  ALA A HB1  3  
ATOM 4677  H HB2  . ALA A 1 10  ? 0.505   9.236   -4.007  1.00 0.00 ? 10  ALA A HB2  3  
ATOM 4678  H HB3  . ALA A 1 10  ? 0.202   7.916   -2.882  1.00 0.00 ? 10  ALA A HB3  3  
ATOM 4679  N N    . GLU A 1 11  ? -1.090  8.964   -6.131  1.00 0.00 ? 11  GLU A N    3  
ATOM 4680  C CA   . GLU A 1 11  ? -2.343  9.550   -6.640  1.00 0.00 ? 11  GLU A CA   3  
ATOM 4681  C C    . GLU A 1 11  ? -2.946  8.614   -7.665  1.00 0.00 ? 11  GLU A C    3  
ATOM 4682  O O    . GLU A 1 11  ? -4.147  8.539   -7.821  1.00 0.00 ? 11  GLU A O    3  
ATOM 4683  C CB   . GLU A 1 11  ? -2.020  10.891  -7.314  1.00 0.00 ? 11  GLU A CB   3  
ATOM 4684  C CG   . GLU A 1 11  ? -2.247  12.022  -6.310  1.00 0.00 ? 11  GLU A CG   3  
ATOM 4685  C CD   . GLU A 1 11  ? -1.361  11.794  -5.084  1.00 0.00 ? 11  GLU A CD   3  
ATOM 4686  O OE1  . GLU A 1 11  ? -1.504  10.729  -4.505  1.00 0.00 ? 11  GLU A OE1  3  
ATOM 4687  O OE2  . GLU A 1 11  ? -0.592  12.695  -4.796  1.00 0.00 ? 11  GLU A OE2  3  
ATOM 4688  H H    . GLU A 1 11  ? -0.230  9.396   -6.315  1.00 0.00 ? 11  GLU A H    3  
ATOM 4689  H HA   . GLU A 1 11  ? -3.043  9.681   -5.813  1.00 0.00 ? 11  GLU A HA   3  
ATOM 4690  H HB2  . GLU A 1 11  ? -0.991  10.895  -7.640  1.00 0.00 ? 11  GLU A HB2  3  
ATOM 4691  H HB3  . GLU A 1 11  ? -2.664  11.029  -8.170  1.00 0.00 ? 11  GLU A HB3  3  
ATOM 4692  H HG2  . GLU A 1 11  ? -1.993  12.969  -6.763  1.00 0.00 ? 11  GLU A HG2  3  
ATOM 4693  H HG3  . GLU A 1 11  ? -3.282  12.038  -6.006  1.00 0.00 ? 11  GLU A HG3  3  
ATOM 4694  N N    . PHE A 1 12  ? -2.087  7.915   -8.358  1.00 0.00 ? 12  PHE A N    3  
ATOM 4695  C CA   . PHE A 1 12  ? -2.575  6.971   -9.381  1.00 0.00 ? 12  PHE A CA   3  
ATOM 4696  C C    . PHE A 1 12  ? -3.375  5.875   -8.713  1.00 0.00 ? 12  PHE A C    3  
ATOM 4697  O O    . PHE A 1 12  ? -4.509  5.629   -9.061  1.00 0.00 ? 12  PHE A O    3  
ATOM 4698  C CB   . PHE A 1 12  ? -1.363  6.330   -10.072 1.00 0.00 ? 12  PHE A CB   3  
ATOM 4699  C CG   . PHE A 1 12  ? -0.903  7.200   -11.236 1.00 0.00 ? 12  PHE A CG   3  
ATOM 4700  C CD1  . PHE A 1 12  ? -1.098  8.568   -11.217 1.00 0.00 ? 12  PHE A CD1  3  
ATOM 4701  C CD2  . PHE A 1 12  ? -0.275  6.626   -12.327 1.00 0.00 ? 12  PHE A CD2  3  
ATOM 4702  C CE1  . PHE A 1 12  ? -0.672  9.349   -12.272 1.00 0.00 ? 12  PHE A CE1  3  
ATOM 4703  C CE2  . PHE A 1 12  ? 0.149   7.407   -13.380 1.00 0.00 ? 12  PHE A CE2  3  
ATOM 4704  C CZ   . PHE A 1 12  ? -0.049  8.766   -13.353 1.00 0.00 ? 12  PHE A CZ   3  
ATOM 4705  H H    . PHE A 1 12  ? -1.126  8.018   -8.201  1.00 0.00 ? 12  PHE A H    3  
ATOM 4706  H HA   . PHE A 1 12  ? -3.211  7.503   -10.095 1.00 0.00 ? 12  PHE A HA   3  
ATOM 4707  H HB2  . PHE A 1 12  ? -0.557  6.229   -9.367  1.00 0.00 ? 12  PHE A HB2  3  
ATOM 4708  H HB3  . PHE A 1 12  ? -1.631  5.354   -10.446 1.00 0.00 ? 12  PHE A HB3  3  
ATOM 4709  H HD1  . PHE A 1 12  ? -1.586  9.029   -10.370 1.00 0.00 ? 12  PHE A HD1  3  
ATOM 4710  H HD2  . PHE A 1 12  ? -0.114  5.558   -12.353 1.00 0.00 ? 12  PHE A HD2  3  
ATOM 4711  H HE1  . PHE A 1 12  ? -0.824  10.418  -12.250 1.00 0.00 ? 12  PHE A HE1  3  
ATOM 4712  H HE2  . PHE A 1 12  ? 0.640   6.950   -14.226 1.00 0.00 ? 12  PHE A HE2  3  
ATOM 4713  H HZ   . PHE A 1 12  ? 0.275   9.374   -14.183 1.00 0.00 ? 12  PHE A HZ   3  
ATOM 4714  N N    . LYS A 1 13  ? -2.763  5.226   -7.755  1.00 0.00 ? 13  LYS A N    3  
ATOM 4715  C CA   . LYS A 1 13  ? -3.476  4.144   -7.054  1.00 0.00 ? 13  LYS A CA   3  
ATOM 4716  C C    . LYS A 1 13  ? -4.779  4.675   -6.495  1.00 0.00 ? 13  LYS A C    3  
ATOM 4717  O O    . LYS A 1 13  ? -5.775  3.980   -6.463  1.00 0.00 ? 13  LYS A O    3  
ATOM 4718  C CB   . LYS A 1 13  ? -2.601  3.643   -5.899  1.00 0.00 ? 13  LYS A CB   3  
ATOM 4719  C CG   . LYS A 1 13  ? -3.361  2.560   -5.130  1.00 0.00 ? 13  LYS A CG   3  
ATOM 4720  C CD   . LYS A 1 13  ? -2.382  1.465   -4.704  1.00 0.00 ? 13  LYS A CD   3  
ATOM 4721  C CE   . LYS A 1 13  ? -1.296  2.079   -3.815  1.00 0.00 ? 13  LYS A CE   3  
ATOM 4722  N NZ   . LYS A 1 13  ? -1.907  2.921   -2.747  1.00 0.00 ? 13  LYS A NZ   3  
ATOM 4723  H H    . LYS A 1 13  ? -1.841  5.458   -7.506  1.00 0.00 ? 13  LYS A H    3  
ATOM 4724  H HA   . LYS A 1 13  ? -3.690  3.342   -7.759  1.00 0.00 ? 13  LYS A HA   3  
ATOM 4725  H HB2  . LYS A 1 13  ? -1.683  3.231   -6.291  1.00 0.00 ? 13  LYS A HB2  3  
ATOM 4726  H HB3  . LYS A 1 13  ? -2.369  4.462   -5.237  1.00 0.00 ? 13  LYS A HB3  3  
ATOM 4727  H HG2  . LYS A 1 13  ? -3.826  2.994   -4.256  1.00 0.00 ? 13  LYS A HG2  3  
ATOM 4728  H HG3  . LYS A 1 13  ? -4.127  2.136   -5.764  1.00 0.00 ? 13  LYS A HG3  3  
ATOM 4729  H HD2  . LYS A 1 13  ? -2.910  0.700   -4.156  1.00 0.00 ? 13  LYS A HD2  3  
ATOM 4730  H HD3  . LYS A 1 13  ? -1.928  1.025   -5.579  1.00 0.00 ? 13  LYS A HD3  3  
ATOM 4731  H HE2  . LYS A 1 13  ? -0.718  1.291   -3.356  1.00 0.00 ? 13  LYS A HE2  3  
ATOM 4732  H HE3  . LYS A 1 13  ? -0.640  2.692   -4.416  1.00 0.00 ? 13  LYS A HE3  3  
ATOM 4733  H HZ1  . LYS A 1 13  ? -2.852  2.555   -2.515  1.00 0.00 ? 13  LYS A HZ1  3  
ATOM 4734  H HZ2  . LYS A 1 13  ? -1.306  2.893   -1.898  1.00 0.00 ? 13  LYS A HZ2  3  
ATOM 4735  H HZ3  . LYS A 1 13  ? -1.987  3.903   -3.083  1.00 0.00 ? 13  LYS A HZ3  3  
ATOM 4736  N N    . GLU A 1 14  ? -4.753  5.910   -6.059  1.00 0.00 ? 14  GLU A N    3  
ATOM 4737  C CA   . GLU A 1 14  ? -5.986  6.497   -5.503  1.00 0.00 ? 14  GLU A CA   3  
ATOM 4738  C C    . GLU A 1 14  ? -7.100  6.371   -6.512  1.00 0.00 ? 14  GLU A C    3  
ATOM 4739  O O    . GLU A 1 14  ? -8.117  5.773   -6.243  1.00 0.00 ? 14  GLU A O    3  
ATOM 4740  C CB   . GLU A 1 14  ? -5.742  7.986   -5.210  1.00 0.00 ? 14  GLU A CB   3  
ATOM 4741  C CG   . GLU A 1 14  ? -6.825  8.494   -4.256  1.00 0.00 ? 14  GLU A CG   3  
ATOM 4742  C CD   . GLU A 1 14  ? -6.729  7.734   -2.932  1.00 0.00 ? 14  GLU A CD   3  
ATOM 4743  O OE1  . GLU A 1 14  ? -5.836  8.076   -2.176  1.00 0.00 ? 14  GLU A OE1  3  
ATOM 4744  O OE2  . GLU A 1 14  ? -7.556  6.855   -2.751  1.00 0.00 ? 14  GLU A OE2  3  
ATOM 4745  H H    . GLU A 1 14  ? -3.928  6.436   -6.103  1.00 0.00 ? 14  GLU A H    3  
ATOM 4746  H HA   . GLU A 1 14  ? -6.262  5.959   -4.600  1.00 0.00 ? 14  GLU A HA   3  
ATOM 4747  H HB2  . GLU A 1 14  ? -4.770  8.114   -4.758  1.00 0.00 ? 14  GLU A HB2  3  
ATOM 4748  H HB3  . GLU A 1 14  ? -5.781  8.547   -6.131  1.00 0.00 ? 14  GLU A HB3  3  
ATOM 4749  H HG2  . GLU A 1 14  ? -6.688  9.549   -4.074  1.00 0.00 ? 14  GLU A HG2  3  
ATOM 4750  H HG3  . GLU A 1 14  ? -7.800  8.331   -4.691  1.00 0.00 ? 14  GLU A HG3  3  
ATOM 4751  N N    . ALA A 1 15  ? -6.888  6.931   -7.670  1.00 0.00 ? 15  ALA A N    3  
ATOM 4752  C CA   . ALA A 1 15  ? -7.935  6.843   -8.707  1.00 0.00 ? 15  ALA A CA   3  
ATOM 4753  C C    . ALA A 1 15  ? -8.197  5.386   -9.019  1.00 0.00 ? 15  ALA A C    3  
ATOM 4754  O O    . ALA A 1 15  ? -9.321  4.929   -9.005  1.00 0.00 ? 15  ALA A O    3  
ATOM 4755  C CB   . ALA A 1 15  ? -7.427  7.540   -9.982  1.00 0.00 ? 15  ALA A CB   3  
ATOM 4756  H H    . ALA A 1 15  ? -6.040  7.396   -7.853  1.00 0.00 ? 15  ALA A H    3  
ATOM 4757  H HA   . ALA A 1 15  ? -8.850  7.305   -8.337  1.00 0.00 ? 15  ALA A HA   3  
ATOM 4758  H HB1  . ALA A 1 15  ? -6.485  7.103   -10.288 1.00 0.00 ? 15  ALA A HB1  3  
ATOM 4759  H HB2  . ALA A 1 15  ? -8.148  7.417   -10.778 1.00 0.00 ? 15  ALA A HB2  3  
ATOM 4760  H HB3  . ALA A 1 15  ? -7.284  8.592   -9.793  1.00 0.00 ? 15  ALA A HB3  3  
ATOM 4761  N N    . PHE A 1 16  ? -7.139  4.683   -9.288  1.00 0.00 ? 16  PHE A N    3  
ATOM 4762  C CA   . PHE A 1 16  ? -7.265  3.249   -9.607  1.00 0.00 ? 16  PHE A CA   3  
ATOM 4763  C C    . PHE A 1 16  ? -8.077  2.526   -8.533  1.00 0.00 ? 16  PHE A C    3  
ATOM 4764  O O    . PHE A 1 16  ? -8.695  1.512   -8.795  1.00 0.00 ? 16  PHE A O    3  
ATOM 4765  C CB   . PHE A 1 16  ? -5.844  2.655   -9.645  1.00 0.00 ? 16  PHE A CB   3  
ATOM 4766  C CG   . PHE A 1 16  ? -5.855  1.346   -10.424 1.00 0.00 ? 16  PHE A CG   3  
ATOM 4767  C CD1  . PHE A 1 16  ? -6.150  1.332   -11.774 1.00 0.00 ? 16  PHE A CD1  3  
ATOM 4768  C CD2  . PHE A 1 16  ? -5.582  0.154   -9.784  1.00 0.00 ? 16  PHE A CD2  3  
ATOM 4769  C CE1  . PHE A 1 16  ? -6.174  0.142   -12.470 1.00 0.00 ? 16  PHE A CE1  3  
ATOM 4770  C CE2  . PHE A 1 16  ? -5.606  -1.031  -10.480 1.00 0.00 ? 16  PHE A CE2  3  
ATOM 4771  C CZ   . PHE A 1 16  ? -5.907  -1.042  -11.819 1.00 0.00 ? 16  PHE A CZ   3  
ATOM 4772  H H    . PHE A 1 16  ? -6.258  5.108   -9.283  1.00 0.00 ? 16  PHE A H    3  
ATOM 4773  H HA   . PHE A 1 16  ? -7.763  3.138   -10.571 1.00 0.00 ? 16  PHE A HA   3  
ATOM 4774  H HB2  . PHE A 1 16  ? -5.171  3.349   -10.126 1.00 0.00 ? 16  PHE A HB2  3  
ATOM 4775  H HB3  . PHE A 1 16  ? -5.502  2.467   -8.640  1.00 0.00 ? 16  PHE A HB3  3  
ATOM 4776  H HD1  . PHE A 1 16  ? -6.359  2.260   -12.286 1.00 0.00 ? 16  PHE A HD1  3  
ATOM 4777  H HD2  . PHE A 1 16  ? -5.345  0.153   -8.731  1.00 0.00 ? 16  PHE A HD2  3  
ATOM 4778  H HE1  . PHE A 1 16  ? -6.381  0.142   -13.525 1.00 0.00 ? 16  PHE A HE1  3  
ATOM 4779  H HE2  . PHE A 1 16  ? -5.359  -1.945  -9.982  1.00 0.00 ? 16  PHE A HE2  3  
ATOM 4780  H HZ   . PHE A 1 16  ? -5.978  -1.986  -12.350 1.00 0.00 ? 16  PHE A HZ   3  
ATOM 4781  N N    . SER A 1 17  ? -8.059  3.062   -7.339  1.00 0.00 ? 17  SER A N    3  
ATOM 4782  C CA   . SER A 1 17  ? -8.821  2.420   -6.237  1.00 0.00 ? 17  SER A CA   3  
ATOM 4783  C C    . SER A 1 17  ? -10.243 2.971   -6.156  1.00 0.00 ? 17  SER A C    3  
ATOM 4784  O O    . SER A 1 17  ? -11.175 2.249   -5.862  1.00 0.00 ? 17  SER A O    3  
ATOM 4785  C CB   . SER A 1 17  ? -8.102  2.721   -4.914  1.00 0.00 ? 17  SER A CB   3  
ATOM 4786  O OG   . SER A 1 17  ? -9.042  2.350   -3.916  1.00 0.00 ? 17  SER A OG   3  
ATOM 4787  H H    . SER A 1 17  ? -7.541  3.876   -7.170  1.00 0.00 ? 17  SER A H    3  
ATOM 4788  H HA   . SER A 1 17  ? -8.866  1.351   -6.418  1.00 0.00 ? 17  SER A HA   3  
ATOM 4789  H HB2  . SER A 1 17  ? -7.206  2.127   -4.823  1.00 0.00 ? 17  SER A HB2  3  
ATOM 4790  H HB3  . SER A 1 17  ? -7.869  3.773   -4.836  1.00 0.00 ? 17  SER A HB3  3  
ATOM 4791  H HG   . SER A 1 17  ? -9.586  3.117   -3.721  1.00 0.00 ? 17  SER A HG   3  
ATOM 4792  N N    . LEU A 1 18  ? -10.384 4.240   -6.421  1.00 0.00 ? 18  LEU A N    3  
ATOM 4793  C CA   . LEU A 1 18  ? -11.736 4.851   -6.361  1.00 0.00 ? 18  LEU A CA   3  
ATOM 4794  C C    . LEU A 1 18  ? -12.685 4.162   -7.325  1.00 0.00 ? 18  LEU A C    3  
ATOM 4795  O O    . LEU A 1 18  ? -13.863 4.033   -7.053  1.00 0.00 ? 18  LEU A O    3  
ATOM 4796  C CB   . LEU A 1 18  ? -11.622 6.329   -6.760  1.00 0.00 ? 18  LEU A CB   3  
ATOM 4797  C CG   . LEU A 1 18  ? -10.990 7.109   -5.609  1.00 0.00 ? 18  LEU A CG   3  
ATOM 4798  C CD1  . LEU A 1 18  ? -10.658 8.526   -6.079  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 4799  C CD2  . LEU A 1 18  ? -11.981 7.182   -4.444  1.00 0.00 ? 18  LEU A CD2  3  
ATOM 4800  H H    . LEU A 1 18  ? -9.608  4.783   -6.660  1.00 0.00 ? 18  LEU A H    3  
ATOM 4801  H HA   . LEU A 1 18  ? -12.123 4.754   -5.348  1.00 0.00 ? 18  LEU A HA   3  
ATOM 4802  H HB2  . LEU A 1 18  ? -11.008 6.422   -7.643  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 4803  H HB3  . LEU A 1 18  ? -12.605 6.724   -6.968  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 4804  H HG   . LEU A 1 18  ? -10.090 6.612   -5.288  1.00 0.00 ? 18  LEU A HG   3  
ATOM 4805  H HD11 . LEU A 1 18  ? -10.326 8.500   -7.107  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 4806  H HD12 . LEU A 1 18  ? -11.538 9.149   -6.005  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 4807  H HD13 . LEU A 1 18  ? -9.875  8.941   -5.463  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 4808  H HD21 . LEU A 1 18  ? -12.990 7.220   -4.827  1.00 0.00 ? 18  LEU A HD21 3  
ATOM 4809  H HD22 . LEU A 1 18  ? -11.871 6.309   -3.818  1.00 0.00 ? 18  LEU A HD22 3  
ATOM 4810  H HD23 . LEU A 1 18  ? -11.788 8.067   -3.857  1.00 0.00 ? 18  LEU A HD23 3  
ATOM 4811  N N    . PHE A 1 19  ? -12.157 3.732   -8.440  1.00 0.00 ? 19  PHE A N    3  
ATOM 4812  C CA   . PHE A 1 19  ? -13.013 3.050   -9.435  1.00 0.00 ? 19  PHE A CA   3  
ATOM 4813  C C    . PHE A 1 19  ? -12.966 1.543   -9.255  1.00 0.00 ? 19  PHE A C    3  
ATOM 4814  O O    . PHE A 1 19  ? -13.336 0.794   -10.136 1.00 0.00 ? 19  PHE A O    3  
ATOM 4815  C CB   . PHE A 1 19  ? -12.500 3.410   -10.834 1.00 0.00 ? 19  PHE A CB   3  
ATOM 4816  C CG   . PHE A 1 19  ? -12.693 4.912   -11.060 1.00 0.00 ? 19  PHE A CG   3  
ATOM 4817  C CD1  . PHE A 1 19  ? -13.959 5.435   -11.256 1.00 0.00 ? 19  PHE A CD1  3  
ATOM 4818  C CD2  . PHE A 1 19  ? -11.606 5.769   -11.055 1.00 0.00 ? 19  PHE A CD2  3  
ATOM 4819  C CE1  . PHE A 1 19  ? -14.133 6.791   -11.440 1.00 0.00 ? 19  PHE A CE1  3  
ATOM 4820  C CE2  . PHE A 1 19  ? -11.784 7.123   -11.239 1.00 0.00 ? 19  PHE A CE2  3  
ATOM 4821  C CZ   . PHE A 1 19  ? -13.046 7.633   -11.432 1.00 0.00 ? 19  PHE A CZ   3  
ATOM 4822  H H    . PHE A 1 19  ? -11.204 3.861   -8.616  1.00 0.00 ? 19  PHE A H    3  
ATOM 4823  H HA   . PHE A 1 19  ? -14.032 3.383   -9.301  1.00 0.00 ? 19  PHE A HA   3  
ATOM 4824  H HB2  . PHE A 1 19  ? -11.451 3.169   -10.914 1.00 0.00 ? 19  PHE A HB2  3  
ATOM 4825  H HB3  . PHE A 1 19  ? -13.054 2.861   -11.581 1.00 0.00 ? 19  PHE A HB3  3  
ATOM 4826  H HD1  . PHE A 1 19  ? -14.815 4.777   -11.265 1.00 0.00 ? 19  PHE A HD1  3  
ATOM 4827  H HD2  . PHE A 1 19  ? -10.613 5.374   -10.913 1.00 0.00 ? 19  PHE A HD2  3  
ATOM 4828  H HE1  . PHE A 1 19  ? -15.124 7.191   -11.590 1.00 0.00 ? 19  PHE A HE1  3  
ATOM 4829  H HE2  . PHE A 1 19  ? -10.931 7.785   -11.226 1.00 0.00 ? 19  PHE A HE2  3  
ATOM 4830  H HZ   . PHE A 1 19  ? -13.183 8.694   -11.577 1.00 0.00 ? 19  PHE A HZ   3  
ATOM 4831  N N    . ASP A 1 20  ? -12.512 1.128   -8.115  1.00 0.00 ? 20  ASP A N    3  
ATOM 4832  C CA   . ASP A 1 20  ? -12.430 -0.326  -7.845  1.00 0.00 ? 20  ASP A CA   3  
ATOM 4833  C C    . ASP A 1 20  ? -13.796 -0.858  -7.425  1.00 0.00 ? 20  ASP A C    3  
ATOM 4834  O O    . ASP A 1 20  ? -14.783 -0.154  -7.496  1.00 0.00 ? 20  ASP A O    3  
ATOM 4835  C CB   . ASP A 1 20  ? -11.432 -0.550  -6.698  1.00 0.00 ? 20  ASP A CB   3  
ATOM 4836  C CG   . ASP A 1 20  ? -11.177 -2.049  -6.534  1.00 0.00 ? 20  ASP A CG   3  
ATOM 4837  O OD1  . ASP A 1 20  ? -10.384 -2.552  -7.313  1.00 0.00 ? 20  ASP A OD1  3  
ATOM 4838  O OD2  . ASP A 1 20  ? -11.791 -2.608  -5.640  1.00 0.00 ? 20  ASP A OD2  3  
ATOM 4839  H H    . ASP A 1 20  ? -12.223 1.773   -7.441  1.00 0.00 ? 20  ASP A H    3  
ATOM 4840  H HA   . ASP A 1 20  ? -12.107 -0.839  -8.751  1.00 0.00 ? 20  ASP A HA   3  
ATOM 4841  H HB2  . ASP A 1 20  ? -10.500 -0.052  -6.922  1.00 0.00 ? 20  ASP A HB2  3  
ATOM 4842  H HB3  . ASP A 1 20  ? -11.837 -0.154  -5.779  1.00 0.00 ? 20  ASP A HB3  3  
ATOM 4843  N N    . LYS A 1 21  ? -13.833 -2.090  -6.994  1.00 0.00 ? 21  LYS A N    3  
ATOM 4844  C CA   . LYS A 1 21  ? -15.135 -2.667  -6.569  1.00 0.00 ? 21  LYS A CA   3  
ATOM 4845  C C    . LYS A 1 21  ? -14.942 -3.788  -5.567  1.00 0.00 ? 21  LYS A C    3  
ATOM 4846  O O    . LYS A 1 21  ? -15.245 -4.931  -5.844  1.00 0.00 ? 21  LYS A O    3  
ATOM 4847  C CB   . LYS A 1 21  ? -15.827 -3.246  -7.789  1.00 0.00 ? 21  LYS A CB   3  
ATOM 4848  C CG   . LYS A 1 21  ? -16.201 -2.112  -8.747  1.00 0.00 ? 21  LYS A CG   3  
ATOM 4849  C CD   . LYS A 1 21  ? -17.118 -2.666  -9.841  1.00 0.00 ? 21  LYS A CD   3  
ATOM 4850  C CE   . LYS A 1 21  ? -17.110 -1.710  -11.036 1.00 0.00 ? 21  LYS A CE   3  
ATOM 4851  N NZ   . LYS A 1 21  ? -17.489 -0.334  -10.606 1.00 0.00 ? 21  LYS A NZ   3  
ATOM 4852  H H    . LYS A 1 21  ? -13.014 -2.626  -6.948  1.00 0.00 ? 21  LYS A H    3  
ATOM 4853  H HA   . LYS A 1 21  ? -15.741 -1.885  -6.115  1.00 0.00 ? 21  LYS A HA   3  
ATOM 4854  H HB2  . LYS A 1 21  ? -15.163 -3.935  -8.280  1.00 0.00 ? 21  LYS A HB2  3  
ATOM 4855  H HB3  . LYS A 1 21  ? -16.716 -3.769  -7.476  1.00 0.00 ? 21  LYS A HB3  3  
ATOM 4856  H HG2  . LYS A 1 21  ? -16.714 -1.331  -8.204  1.00 0.00 ? 21  LYS A HG2  3  
ATOM 4857  H HG3  . LYS A 1 21  ? -15.308 -1.706  -9.194  1.00 0.00 ? 21  LYS A HG3  3  
ATOM 4858  H HD2  . LYS A 1 21  ? -16.765 -3.637  -10.151 1.00 0.00 ? 21  LYS A HD2  3  
ATOM 4859  H HD3  . LYS A 1 21  ? -18.123 -2.760  -9.458  1.00 0.00 ? 21  LYS A HD3  3  
ATOM 4860  H HE2  . LYS A 1 21  ? -16.123 -1.684  -11.472 1.00 0.00 ? 21  LYS A HE2  3  
ATOM 4861  H HE3  . LYS A 1 21  ? -17.815 -2.054  -11.778 1.00 0.00 ? 21  LYS A HE3  3  
ATOM 4862  H HZ1  . LYS A 1 21  ? -17.668 -0.328  -9.582  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM 4863  H HZ2  . LYS A 1 21  ? -16.715 0.324   -10.828 1.00 0.00 ? 21  LYS A HZ2  3  
ATOM 4864  H HZ3  . LYS A 1 21  ? -18.350 -0.039  -11.110 1.00 0.00 ? 21  LYS A HZ3  3  
ATOM 4865  N N    . ASP A 1 22  ? -14.449 -3.436  -4.426  1.00 0.00 ? 22  ASP A N    3  
ATOM 4866  C CA   . ASP A 1 22  ? -14.218 -4.456  -3.367  1.00 0.00 ? 22  ASP A CA   3  
ATOM 4867  C C    . ASP A 1 22  ? -13.691 -5.758  -3.957  1.00 0.00 ? 22  ASP A C    3  
ATOM 4868  O O    . ASP A 1 22  ? -14.443 -6.681  -4.200  1.00 0.00 ? 22  ASP A O    3  
ATOM 4869  C CB   . ASP A 1 22  ? -15.557 -4.739  -2.666  1.00 0.00 ? 22  ASP A CB   3  
ATOM 4870  C CG   . ASP A 1 22  ? -16.022 -3.479  -1.934  1.00 0.00 ? 22  ASP A CG   3  
ATOM 4871  O OD1  . ASP A 1 22  ? -15.214 -2.962  -1.180  1.00 0.00 ? 22  ASP A OD1  3  
ATOM 4872  O OD2  . ASP A 1 22  ? -17.158 -3.105  -2.170  1.00 0.00 ? 22  ASP A OD2  3  
ATOM 4873  H H    . ASP A 1 22  ? -14.235 -2.503  -4.266  1.00 0.00 ? 22  ASP A H    3  
ATOM 4874  H HA   . ASP A 1 22  ? -13.486 -4.068  -2.657  1.00 0.00 ? 22  ASP A HA   3  
ATOM 4875  H HB2  . ASP A 1 22  ? -16.299 -5.022  -3.398  1.00 0.00 ? 22  ASP A HB2  3  
ATOM 4876  H HB3  . ASP A 1 22  ? -15.434 -5.540  -1.953  1.00 0.00 ? 22  ASP A HB3  3  
ATOM 4877  N N    . GLY A 1 23  ? -12.409 -5.811  -4.179  1.00 0.00 ? 23  GLY A N    3  
ATOM 4878  C CA   . GLY A 1 23  ? -11.816 -7.051  -4.755  1.00 0.00 ? 23  GLY A CA   3  
ATOM 4879  C C    . GLY A 1 23  ? -10.359 -7.194  -4.316  1.00 0.00 ? 23  GLY A C    3  
ATOM 4880  O O    . GLY A 1 23  ? -10.075 -7.730  -3.263  1.00 0.00 ? 23  GLY A O    3  
ATOM 4881  H H    . GLY A 1 23  ? -11.839 -5.041  -3.968  1.00 0.00 ? 23  GLY A H    3  
ATOM 4882  H HA2  . GLY A 1 23  ? -12.379 -7.908  -4.414  1.00 0.00 ? 23  GLY A HA2  3  
ATOM 4883  H HA3  . GLY A 1 23  ? -11.861 -7.000  -5.833  1.00 0.00 ? 23  GLY A HA3  3  
ATOM 4884  N N    . ASP A 1 24  ? -9.470  -6.711  -5.140  1.00 0.00 ? 24  ASP A N    3  
ATOM 4885  C CA   . ASP A 1 24  ? -8.027  -6.800  -4.804  1.00 0.00 ? 24  ASP A CA   3  
ATOM 4886  C C    . ASP A 1 24  ? -7.313  -5.519  -5.202  1.00 0.00 ? 24  ASP A C    3  
ATOM 4887  O O    . ASP A 1 24  ? -6.225  -5.241  -4.734  1.00 0.00 ? 24  ASP A O    3  
ATOM 4888  C CB   . ASP A 1 24  ? -7.417  -7.973  -5.589  1.00 0.00 ? 24  ASP A CB   3  
ATOM 4889  C CG   . ASP A 1 24  ? -7.264  -7.574  -7.057  1.00 0.00 ? 24  ASP A CG   3  
ATOM 4890  O OD1  . ASP A 1 24  ? -6.331  -6.832  -7.321  1.00 0.00 ? 24  ASP A OD1  3  
ATOM 4891  O OD2  . ASP A 1 24  ? -8.086  -8.032  -7.831  1.00 0.00 ? 24  ASP A OD2  3  
ATOM 4892  H H    . ASP A 1 24  ? -9.753  -6.290  -5.978  1.00 0.00 ? 24  ASP A H    3  
ATOM 4893  H HA   . ASP A 1 24  ? -7.916  -6.950  -3.731  1.00 0.00 ? 24  ASP A HA   3  
ATOM 4894  H HB2  . ASP A 1 24  ? -6.448  -8.220  -5.183  1.00 0.00 ? 24  ASP A HB2  3  
ATOM 4895  H HB3  . ASP A 1 24  ? -8.064  -8.836  -5.519  1.00 0.00 ? 24  ASP A HB3  3  
ATOM 4896  N N    . GLY A 1 25  ? -7.947  -4.759  -6.067  1.00 0.00 ? 25  GLY A N    3  
ATOM 4897  C CA   . GLY A 1 25  ? -7.335  -3.477  -6.525  1.00 0.00 ? 25  GLY A CA   3  
ATOM 4898  C C    . GLY A 1 25  ? -7.139  -3.484  -8.041  1.00 0.00 ? 25  GLY A C    3  
ATOM 4899  O O    . GLY A 1 25  ? -6.031  -3.575  -8.514  1.00 0.00 ? 25  GLY A O    3  
ATOM 4900  H H    . GLY A 1 25  ? -8.821  -5.036  -6.412  1.00 0.00 ? 25  GLY A H    3  
ATOM 4901  H HA2  . GLY A 1 25  ? -7.987  -2.658  -6.257  1.00 0.00 ? 25  GLY A HA2  3  
ATOM 4902  H HA3  . GLY A 1 25  ? -6.380  -3.339  -6.045  1.00 0.00 ? 25  GLY A HA3  3  
ATOM 4903  N N    . THR A 1 26  ? -8.230  -3.404  -8.766  1.00 0.00 ? 26  THR A N    3  
ATOM 4904  C CA   . THR A 1 26  ? -8.139  -3.401  -10.258 1.00 0.00 ? 26  THR A CA   3  
ATOM 4905  C C    . THR A 1 26  ? -9.358  -2.703  -10.862 1.00 0.00 ? 26  THR A C    3  
ATOM 4906  O O    . THR A 1 26  ? -10.309 -2.405  -10.165 1.00 0.00 ? 26  THR A O    3  
ATOM 4907  C CB   . THR A 1 26  ? -8.103  -4.844  -10.779 1.00 0.00 ? 26  THR A CB   3  
ATOM 4908  O OG1  . THR A 1 26  ? -9.405  -5.350  -10.576 1.00 0.00 ? 26  THR A OG1  3  
ATOM 4909  C CG2  . THR A 1 26  ? -7.202  -5.738  -9.912  1.00 0.00 ? 26  THR A CG2  3  
ATOM 4910  H H    . THR A 1 26  ? -9.105  -3.346  -8.329  1.00 0.00 ? 26  THR A H    3  
ATOM 4911  H HA   . THR A 1 26  ? -7.240  -2.861  -10.559 1.00 0.00 ? 26  THR A HA   3  
ATOM 4912  H HB   . THR A 1 26  ? -7.835  -4.876  -11.833 1.00 0.00 ? 26  THR A HB   3  
ATOM 4913  H HG1  . THR A 1 26  ? -9.971  -4.619  -10.318 1.00 0.00 ? 26  THR A HG1  3  
ATOM 4914  H HG21 . THR A 1 26  ? -7.536  -5.712  -8.888  1.00 0.00 ? 26  THR A HG21 3  
ATOM 4915  H HG22 . THR A 1 26  ? -7.248  -6.755  -10.272 1.00 0.00 ? 26  THR A HG22 3  
ATOM 4916  H HG23 . THR A 1 26  ? -6.182  -5.392  -9.967  1.00 0.00 ? 26  THR A HG23 3  
ATOM 4917  N N    . ILE A 1 27  ? -9.308  -2.459  -12.149 1.00 0.00 ? 27  ILE A N    3  
ATOM 4918  C CA   . ILE A 1 27  ? -10.455 -1.782  -12.822 1.00 0.00 ? 27  ILE A CA   3  
ATOM 4919  C C    . ILE A 1 27  ? -10.729 -2.417  -14.173 1.00 0.00 ? 27  ILE A C    3  
ATOM 4920  O O    . ILE A 1 27  ? -9.957  -3.229  -14.639 1.00 0.00 ? 27  ILE A O    3  
ATOM 4921  C CB   . ILE A 1 27  ? -10.082 -0.323  -13.053 1.00 0.00 ? 27  ILE A CB   3  
ATOM 4922  C CG1  . ILE A 1 27  ? -9.018  -0.253  -14.149 1.00 0.00 ? 27  ILE A CG1  3  
ATOM 4923  C CG2  . ILE A 1 27  ? -9.511  0.253   -11.740 1.00 0.00 ? 27  ILE A CG2  3  
ATOM 4924  C CD1  . ILE A 1 27  ? -8.484  1.175   -14.270 1.00 0.00 ? 27  ILE A CD1  3  
ATOM 4925  H H    . ILE A 1 27  ? -8.522  -2.728  -12.670 1.00 0.00 ? 27  ILE A H    3  
ATOM 4926  H HA   . ILE A 1 27  ? -11.344 -1.865  -12.200 1.00 0.00 ? 27  ILE A HA   3  
ATOM 4927  H HB   . ILE A 1 27  ? -10.969 0.232   -13.374 1.00 0.00 ? 27  ILE A HB   3  
ATOM 4928  H HG12 . ILE A 1 27  ? -8.212  -0.925  -13.909 1.00 0.00 ? 27  ILE A HG12 3  
ATOM 4929  H HG13 . ILE A 1 27  ? -9.453  -0.552  -15.091 1.00 0.00 ? 27  ILE A HG13 3  
ATOM 4930  H HG21 . ILE A 1 27  ? -10.031 -0.180  -10.896 1.00 0.00 ? 27  ILE A HG21 3  
ATOM 4931  H HG22 . ILE A 1 27  ? -8.462  0.020   -11.664 1.00 0.00 ? 27  ILE A HG22 3  
ATOM 4932  H HG23 . ILE A 1 27  ? -9.640  1.324   -11.722 1.00 0.00 ? 27  ILE A HG23 3  
ATOM 4933  H HD11 . ILE A 1 27  ? -8.148  1.526   -13.309 1.00 0.00 ? 27  ILE A HD11 3  
ATOM 4934  H HD12 . ILE A 1 27  ? -7.656  1.195   -14.964 1.00 0.00 ? 27  ILE A HD12 3  
ATOM 4935  H HD13 . ILE A 1 27  ? -9.262  1.821   -14.632 1.00 0.00 ? 27  ILE A HD13 3  
ATOM 4936  N N    . THR A 1 28  ? -11.825 -2.034  -14.781 1.00 0.00 ? 28  THR A N    3  
ATOM 4937  C CA   . THR A 1 28  ? -12.160 -2.610  -16.108 1.00 0.00 ? 28  THR A CA   3  
ATOM 4938  C C    . THR A 1 28  ? -11.786 -1.654  -17.230 1.00 0.00 ? 28  THR A C    3  
ATOM 4939  O O    . THR A 1 28  ? -11.929 -0.454  -17.109 1.00 0.00 ? 28  THR A O    3  
ATOM 4940  C CB   . THR A 1 28  ? -13.660 -2.869  -16.166 1.00 0.00 ? 28  THR A CB   3  
ATOM 4941  O OG1  . THR A 1 28  ? -14.264 -1.725  -15.598 1.00 0.00 ? 28  THR A OG1  3  
ATOM 4942  C CG2  . THR A 1 28  ? -14.047 -4.020  -15.230 1.00 0.00 ? 28  THR A CG2  3  
ATOM 4943  H H    . THR A 1 28  ? -12.416 -1.374  -14.364 1.00 0.00 ? 28  THR A H    3  
ATOM 4944  H HA   . THR A 1 28  ? -11.609 -3.535  -16.240 1.00 0.00 ? 28  THR A HA   3  
ATOM 4945  H HB   . THR A 1 28  ? -13.999 -3.023  -17.188 1.00 0.00 ? 28  THR A HB   3  
ATOM 4946  H HG1  . THR A 1 28  ? -14.033 -0.968  -16.140 1.00 0.00 ? 28  THR A HG1  3  
ATOM 4947  H HG21 . THR A 1 28  ? -13.159 -4.555  -14.924 1.00 0.00 ? 28  THR A HG21 3  
ATOM 4948  H HG22 . THR A 1 28  ? -14.544 -3.628  -14.356 1.00 0.00 ? 28  THR A HG22 3  
ATOM 4949  H HG23 . THR A 1 28  ? -14.711 -4.700  -15.744 1.00 0.00 ? 28  THR A HG23 3  
ATOM 4950  N N    . THR A 1 29  ? -11.314 -2.213  -18.305 1.00 0.00 ? 29  THR A N    3  
ATOM 4951  C CA   . THR A 1 29  ? -10.917 -1.375  -19.465 1.00 0.00 ? 29  THR A CA   3  
ATOM 4952  C C    . THR A 1 29  ? -11.915 -0.259  -19.717 1.00 0.00 ? 29  THR A C    3  
ATOM 4953  O O    . THR A 1 29  ? -11.556 0.798   -20.192 1.00 0.00 ? 29  THR A O    3  
ATOM 4954  C CB   . THR A 1 29  ? -10.869 -2.269  -20.697 1.00 0.00 ? 29  THR A CB   3  
ATOM 4955  O OG1  . THR A 1 29  ? -12.113 -2.941  -20.717 1.00 0.00 ? 29  THR A OG1  3  
ATOM 4956  C CG2  . THR A 1 29  ? -9.831  -3.378  -20.516 1.00 0.00 ? 29  THR A CG2  3  
ATOM 4957  H H    . THR A 1 29  ? -11.219 -3.186  -18.347 1.00 0.00 ? 29  THR A H    3  
ATOM 4958  H HA   . THR A 1 29  ? -9.939  -0.937  -19.268 1.00 0.00 ? 29  THR A HA   3  
ATOM 4959  H HB   . THR A 1 29  ? -10.723 -1.696  -21.608 1.00 0.00 ? 29  THR A HB   3  
ATOM 4960  H HG1  . THR A 1 29  ? -12.754 -2.395  -20.250 1.00 0.00 ? 29  THR A HG1  3  
ATOM 4961  H HG21 . THR A 1 29  ? -9.732  -3.615  -19.467 1.00 0.00 ? 29  THR A HG21 3  
ATOM 4962  H HG22 . THR A 1 29  ? -10.144 -4.260  -21.052 1.00 0.00 ? 29  THR A HG22 3  
ATOM 4963  H HG23 . THR A 1 29  ? -8.878  -3.050  -20.897 1.00 0.00 ? 29  THR A HG23 3  
ATOM 4964  N N    . LYS A 1 30  ? -13.150 -0.505  -19.404 1.00 0.00 ? 30  LYS A N    3  
ATOM 4965  C CA   . LYS A 1 30  ? -14.162 0.537   -19.625 1.00 0.00 ? 30  LYS A CA   3  
ATOM 4966  C C    . LYS A 1 30  ? -13.956 1.677   -18.640 1.00 0.00 ? 30  LYS A C    3  
ATOM 4967  O O    . LYS A 1 30  ? -13.844 2.825   -19.022 1.00 0.00 ? 30  LYS A O    3  
ATOM 4968  C CB   . LYS A 1 30  ? -15.553 -0.093  -19.406 1.00 0.00 ? 30  LYS A CB   3  
ATOM 4969  C CG   . LYS A 1 30  ? -16.474 0.930   -18.744 1.00 0.00 ? 30  LYS A CG   3  
ATOM 4970  C CD   . LYS A 1 30  ? -17.937 0.505   -18.937 1.00 0.00 ? 30  LYS A CD   3  
ATOM 4971  C CE   . LYS A 1 30  ? -18.833 1.748   -18.908 1.00 0.00 ? 30  LYS A CE   3  
ATOM 4972  N NZ   . LYS A 1 30  ? -20.168 1.440   -19.494 1.00 0.00 ? 30  LYS A NZ   3  
ATOM 4973  H H    . LYS A 1 30  ? -13.405 -1.367  -19.019 1.00 0.00 ? 30  LYS A H    3  
ATOM 4974  H HA   . LYS A 1 30  ? -14.063 0.919   -20.639 1.00 0.00 ? 30  LYS A HA   3  
ATOM 4975  H HB2  . LYS A 1 30  ? -15.966 -0.394  -20.357 1.00 0.00 ? 30  LYS A HB2  3  
ATOM 4976  H HB3  . LYS A 1 30  ? -15.461 -0.961  -18.770 1.00 0.00 ? 30  LYS A HB3  3  
ATOM 4977  H HG2  . LYS A 1 30  ? -16.245 0.987   -17.690 1.00 0.00 ? 30  LYS A HG2  3  
ATOM 4978  H HG3  . LYS A 1 30  ? -16.312 1.898   -19.192 1.00 0.00 ? 30  LYS A HG3  3  
ATOM 4979  H HD2  . LYS A 1 30  ? -18.050 0.002   -19.886 1.00 0.00 ? 30  LYS A HD2  3  
ATOM 4980  H HD3  . LYS A 1 30  ? -18.226 -0.167  -18.143 1.00 0.00 ? 30  LYS A HD3  3  
ATOM 4981  H HE2  . LYS A 1 30  ? -18.963 2.076   -17.887 1.00 0.00 ? 30  LYS A HE2  3  
ATOM 4982  H HE3  . LYS A 1 30  ? -18.374 2.542   -19.479 1.00 0.00 ? 30  LYS A HE3  3  
ATOM 4983  H HZ1  . LYS A 1 30  ? -20.396 0.439   -19.330 1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 4984  H HZ2  . LYS A 1 30  ? -20.890 2.039   -19.044 1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 4985  H HZ3  . LYS A 1 30  ? -20.149 1.628   -20.517 1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 4986  N N    . GLU A 1 31  ? -13.908 1.335   -17.388 1.00 0.00 ? 31  GLU A N    3  
ATOM 4987  C CA   . GLU A 1 31  ? -13.710 2.376   -16.357 1.00 0.00 ? 31  GLU A CA   3  
ATOM 4988  C C    . GLU A 1 31  ? -12.357 3.031   -16.536 1.00 0.00 ? 31  GLU A C    3  
ATOM 4989  O O    . GLU A 1 31  ? -12.051 4.022   -15.909 1.00 0.00 ? 31  GLU A O    3  
ATOM 4990  C CB   . GLU A 1 31  ? -13.762 1.705   -14.976 1.00 0.00 ? 31  GLU A CB   3  
ATOM 4991  C CG   . GLU A 1 31  ? -15.163 1.879   -14.388 1.00 0.00 ? 31  GLU A CG   3  
ATOM 4992  C CD   . GLU A 1 31  ? -16.172 1.107   -15.241 1.00 0.00 ? 31  GLU A CD   3  
ATOM 4993  O OE1  . GLU A 1 31  ? -15.800 0.030   -15.675 1.00 0.00 ? 31  GLU A OE1  3  
ATOM 4994  O OE2  . GLU A 1 31  ? -17.257 1.638   -15.408 1.00 0.00 ? 31  GLU A OE2  3  
ATOM 4995  H H    . GLU A 1 31  ? -13.989 0.391   -17.132 1.00 0.00 ? 31  GLU A H    3  
ATOM 4996  H HA   . GLU A 1 31  ? -14.489 3.134   -16.454 1.00 0.00 ? 31  GLU A HA   3  
ATOM 4997  H HB2  . GLU A 1 31  ? -13.540 0.652   -15.076 1.00 0.00 ? 31  GLU A HB2  3  
ATOM 4998  H HB3  . GLU A 1 31  ? -13.035 2.161   -14.322 1.00 0.00 ? 31  GLU A HB3  3  
ATOM 4999  H HG2  . GLU A 1 31  ? -15.186 1.499   -13.378 1.00 0.00 ? 31  GLU A HG2  3  
ATOM 5000  H HG3  . GLU A 1 31  ? -15.430 2.925   -14.382 1.00 0.00 ? 31  GLU A HG3  3  
ATOM 5001  N N    . LEU A 1 32  ? -11.569 2.464   -17.398 1.00 0.00 ? 32  LEU A N    3  
ATOM 5002  C CA   . LEU A 1 32  ? -10.229 3.028   -17.642 1.00 0.00 ? 32  LEU A CA   3  
ATOM 5003  C C    . LEU A 1 32  ? -10.313 4.513   -17.975 1.00 0.00 ? 32  LEU A C    3  
ATOM 5004  O O    . LEU A 1 32  ? -9.784  5.344   -17.265 1.00 0.00 ? 32  LEU A O    3  
ATOM 5005  C CB   . LEU A 1 32  ? -9.628  2.291   -18.835 1.00 0.00 ? 32  LEU A CB   3  
ATOM 5006  C CG   . LEU A 1 32  ? -8.143  2.601   -18.923 1.00 0.00 ? 32  LEU A CG   3  
ATOM 5007  C CD1  . LEU A 1 32  ? -7.408  1.893   -17.783 1.00 0.00 ? 32  LEU A CD1  3  
ATOM 5008  C CD2  . LEU A 1 32  ? -7.619  2.087   -20.255 1.00 0.00 ? 32  LEU A CD2  3  
ATOM 5009  H H    . LEU A 1 32  ? -11.868 1.669   -17.894 1.00 0.00 ? 32  LEU A H    3  
ATOM 5010  H HA   . LEU A 1 32  ? -9.615  2.892   -16.751 1.00 0.00 ? 32  LEU A HA   3  
ATOM 5011  H HB2  . LEU A 1 32  ? -9.770  1.228   -18.713 1.00 0.00 ? 32  LEU A HB2  3  
ATOM 5012  H HB3  . LEU A 1 32  ? -10.119 2.611   -19.742 1.00 0.00 ? 32  LEU A HB3  3  
ATOM 5013  H HG   . LEU A 1 32  ? -7.987  3.667   -18.854 1.00 0.00 ? 32  LEU A HG   3  
ATOM 5014  H HD11 . LEU A 1 32  ? -7.980  1.037   -17.457 1.00 0.00 ? 32  LEU A HD11 3  
ATOM 5015  H HD12 . LEU A 1 32  ? -6.438  1.562   -18.125 1.00 0.00 ? 32  LEU A HD12 3  
ATOM 5016  H HD13 . LEU A 1 32  ? -7.281  2.572   -16.954 1.00 0.00 ? 32  LEU A HD13 3  
ATOM 5017  H HD21 . LEU A 1 32  ? -8.180  2.533   -21.063 1.00 0.00 ? 32  LEU A HD21 3  
ATOM 5018  H HD22 . LEU A 1 32  ? -6.578  2.344   -20.361 1.00 0.00 ? 32  LEU A HD22 3  
ATOM 5019  H HD23 . LEU A 1 32  ? -7.728  1.013   -20.298 1.00 0.00 ? 32  LEU A HD23 3  
ATOM 5020  N N    . GLY A 1 33  ? -10.979 4.817   -19.054 1.00 0.00 ? 33  GLY A N    3  
ATOM 5021  C CA   . GLY A 1 33  ? -11.112 6.245   -19.457 1.00 0.00 ? 33  GLY A CA   3  
ATOM 5022  C C    . GLY A 1 33  ? -11.522 7.110   -18.262 1.00 0.00 ? 33  GLY A C    3  
ATOM 5023  O O    . GLY A 1 33  ? -11.013 8.198   -18.078 1.00 0.00 ? 33  GLY A O    3  
ATOM 5024  H H    . GLY A 1 33  ? -11.388 4.111   -19.597 1.00 0.00 ? 33  GLY A H    3  
ATOM 5025  H HA2  . GLY A 1 33  ? -10.167 6.595   -19.843 1.00 0.00 ? 33  GLY A HA2  3  
ATOM 5026  H HA3  . GLY A 1 33  ? -11.864 6.327   -20.229 1.00 0.00 ? 33  GLY A HA3  3  
ATOM 5027  N N    . THR A 1 34  ? -12.431 6.608   -17.473 1.00 0.00 ? 34  THR A N    3  
ATOM 5028  C CA   . THR A 1 34  ? -12.880 7.386   -16.295 1.00 0.00 ? 34  THR A CA   3  
ATOM 5029  C C    . THR A 1 34  ? -11.730 7.609   -15.316 1.00 0.00 ? 34  THR A C    3  
ATOM 5030  O O    . THR A 1 34  ? -11.553 8.697   -14.803 1.00 0.00 ? 34  THR A O    3  
ATOM 5031  C CB   . THR A 1 34  ? -14.000 6.607   -15.599 1.00 0.00 ? 34  THR A CB   3  
ATOM 5032  O OG1  . THR A 1 34  ? -15.098 6.666   -16.486 1.00 0.00 ? 34  THR A OG1  3  
ATOM 5033  C CG2  . THR A 1 34  ? -14.482 7.343   -14.343 1.00 0.00 ? 34  THR A CG2  3  
ATOM 5034  H H    . THR A 1 34  ? -12.815 5.727   -17.659 1.00 0.00 ? 34  THR A H    3  
ATOM 5035  H HA   . THR A 1 34  ? -13.239 8.354   -16.633 1.00 0.00 ? 34  THR A HA   3  
ATOM 5036  H HB   . THR A 1 34  ? -13.718 5.579   -15.405 1.00 0.00 ? 34  THR A HB   3  
ATOM 5037  H HG1  . THR A 1 34  ? -14.797 7.067   -17.304 1.00 0.00 ? 34  THR A HG1  3  
ATOM 5038  H HG21 . THR A 1 34  ? -13.635 7.719   -13.793 1.00 0.00 ? 34  THR A HG21 3  
ATOM 5039  H HG22 . THR A 1 34  ? -15.118 8.169   -14.627 1.00 0.00 ? 34  THR A HG22 3  
ATOM 5040  H HG23 . THR A 1 34  ? -15.040 6.665   -13.716 1.00 0.00 ? 34  THR A HG23 3  
ATOM 5041  N N    . VAL A 1 35  ? -10.968 6.578   -15.071 1.00 0.00 ? 35  VAL A N    3  
ATOM 5042  C CA   . VAL A 1 35  ? -9.830  6.731   -14.128 1.00 0.00 ? 35  VAL A CA   3  
ATOM 5043  C C    . VAL A 1 35  ? -8.824  7.724   -14.677 1.00 0.00 ? 35  VAL A C    3  
ATOM 5044  O O    . VAL A 1 35  ? -8.368  8.607   -13.980 1.00 0.00 ? 35  VAL A O    3  
ATOM 5045  C CB   . VAL A 1 35  ? -9.131  5.375   -13.965 1.00 0.00 ? 35  VAL A CB   3  
ATOM 5046  C CG1  . VAL A 1 35  ? -8.041  5.498   -12.899 1.00 0.00 ? 35  VAL A CG1  3  
ATOM 5047  C CG2  . VAL A 1 35  ? -10.149 4.329   -13.523 1.00 0.00 ? 35  VAL A CG2  3  
ATOM 5048  H H    . VAL A 1 35  ? -11.143 5.719   -15.503 1.00 0.00 ? 35  VAL A H    3  
ATOM 5049  H HA   . VAL A 1 35  ? -10.203 7.094   -13.173 1.00 0.00 ? 35  VAL A HA   3  
ATOM 5050  H HB   . VAL A 1 35  ? -8.691  5.081   -14.903 1.00 0.00 ? 35  VAL A HB   3  
ATOM 5051  H HG11 . VAL A 1 35  ? -7.570  6.468   -12.968 1.00 0.00 ? 35  VAL A HG11 3  
ATOM 5052  H HG12 . VAL A 1 35  ? -8.477  5.383   -11.917 1.00 0.00 ? 35  VAL A HG12 3  
ATOM 5053  H HG13 . VAL A 1 35  ? -7.296  4.729   -13.048 1.00 0.00 ? 35  VAL A HG13 3  
ATOM 5054  H HG21 . VAL A 1 35  ? -11.062 4.814   -13.225 1.00 0.00 ? 35  VAL A HG21 3  
ATOM 5055  H HG22 . VAL A 1 35  ? -10.355 3.658   -14.337 1.00 0.00 ? 35  VAL A HG22 3  
ATOM 5056  H HG23 . VAL A 1 35  ? -9.755  3.766   -12.689 1.00 0.00 ? 35  VAL A HG23 3  
ATOM 5057  N N    . MET A 1 36  ? -8.495  7.556   -15.927 1.00 0.00 ? 36  MET A N    3  
ATOM 5058  C CA   . MET A 1 36  ? -7.521  8.472   -16.556 1.00 0.00 ? 36  MET A CA   3  
ATOM 5059  C C    . MET A 1 36  ? -7.938  9.926   -16.357 1.00 0.00 ? 36  MET A C    3  
ATOM 5060  O O    . MET A 1 36  ? -7.104  10.793  -16.188 1.00 0.00 ? 36  MET A O    3  
ATOM 5061  C CB   . MET A 1 36  ? -7.482  8.168   -18.062 1.00 0.00 ? 36  MET A CB   3  
ATOM 5062  C CG   . MET A 1 36  ? -6.665  6.898   -18.296 1.00 0.00 ? 36  MET A CG   3  
ATOM 5063  S SD   . MET A 1 36  ? -4.915  7.098   -18.710 1.00 0.00 ? 36  MET A SD   3  
ATOM 5064  C CE   . MET A 1 36  ? -4.334  5.552   -17.972 1.00 0.00 ? 36  MET A CE   3  
ATOM 5065  H H    . MET A 1 36  ? -8.892  6.827   -16.448 1.00 0.00 ? 36  MET A H    3  
ATOM 5066  H HA   . MET A 1 36  ? -6.542  8.316   -16.103 1.00 0.00 ? 36  MET A HA   3  
ATOM 5067  H HB2  . MET A 1 36  ? -8.487  8.024   -18.429 1.00 0.00 ? 36  MET A HB2  3  
ATOM 5068  H HB3  . MET A 1 36  ? -7.027  8.995   -18.588 1.00 0.00 ? 36  MET A HB3  3  
ATOM 5069  H HG2  . MET A 1 36  ? -6.723  6.292   -17.404 1.00 0.00 ? 36  MET A HG2  3  
ATOM 5070  H HG3  . MET A 1 36  ? -7.129  6.344   -19.098 1.00 0.00 ? 36  MET A HG3  3  
ATOM 5071  H HE1  . MET A 1 36  ? -5.038  4.763   -18.187 1.00 0.00 ? 36  MET A HE1  3  
ATOM 5072  H HE2  . MET A 1 36  ? -3.369  5.297   -18.385 1.00 0.00 ? 36  MET A HE2  3  
ATOM 5073  H HE3  . MET A 1 36  ? -4.247  5.675   -16.904 1.00 0.00 ? 36  MET A HE3  3  
ATOM 5074  N N    . ARG A 1 37  ? -9.223  10.166  -16.377 1.00 0.00 ? 37  ARG A N    3  
ATOM 5075  C CA   . ARG A 1 37  ? -9.705  11.558  -16.190 1.00 0.00 ? 37  ARG A CA   3  
ATOM 5076  C C    . ARG A 1 37  ? -9.584  11.987  -14.733 1.00 0.00 ? 37  ARG A C    3  
ATOM 5077  O O    . ARG A 1 37  ? -9.373  13.147  -14.441 1.00 0.00 ? 37  ARG A O    3  
ATOM 5078  C CB   . ARG A 1 37  ? -11.184 11.620  -16.597 1.00 0.00 ? 37  ARG A CB   3  
ATOM 5079  C CG   . ARG A 1 37  ? -11.475 12.989  -17.215 1.00 0.00 ? 37  ARG A CG   3  
ATOM 5080  C CD   . ARG A 1 37  ? -12.933 13.364  -16.936 1.00 0.00 ? 37  ARG A CD   3  
ATOM 5081  N NE   . ARG A 1 37  ? -13.787 12.159  -17.131 1.00 0.00 ? 37  ARG A NE   3  
ATOM 5082  C CZ   . ARG A 1 37  ? -15.048 12.205  -16.795 1.00 0.00 ? 37  ARG A CZ   3  
ATOM 5083  N NH1  . ARG A 1 37  ? -15.417 13.010  -15.838 1.00 0.00 ? 37  ARG A NH1  3  
ATOM 5084  N NH2  . ARG A 1 37  ? -15.899 11.445  -17.430 1.00 0.00 ? 37  ARG A NH2  3  
ATOM 5085  H H    . ARG A 1 37  ? -9.864  9.433   -16.512 1.00 0.00 ? 37  ARG A H    3  
ATOM 5086  H HA   . ARG A 1 37  ? -9.106  12.226  -16.808 1.00 0.00 ? 37  ARG A HA   3  
ATOM 5087  H HB2  . ARG A 1 37  ? -11.397 10.844  -17.318 1.00 0.00 ? 37  ARG A HB2  3  
ATOM 5088  H HB3  . ARG A 1 37  ? -11.808 11.475  -15.727 1.00 0.00 ? 37  ARG A HB3  3  
ATOM 5089  H HG2  . ARG A 1 37  ? -10.820 13.729  -16.779 1.00 0.00 ? 37  ARG A HG2  3  
ATOM 5090  H HG3  . ARG A 1 37  ? -11.307 12.950  -18.280 1.00 0.00 ? 37  ARG A HG3  3  
ATOM 5091  H HD2  . ARG A 1 37  ? -13.034 13.715  -15.920 1.00 0.00 ? 37  ARG A HD2  3  
ATOM 5092  H HD3  . ARG A 1 37  ? -13.248 14.141  -17.617 1.00 0.00 ? 37  ARG A HD3  3  
ATOM 5093  H HE   . ARG A 1 37  ? -13.406 11.338  -17.507 1.00 0.00 ? 37  ARG A HE   3  
ATOM 5094  H HH11 . ARG A 1 37  ? -14.737 13.580  -15.375 1.00 0.00 ? 37  ARG A HH11 3  
ATOM 5095  H HH12 . ARG A 1 37  ? -16.377 13.059  -15.567 1.00 0.00 ? 37  ARG A HH12 3  
ATOM 5096  H HH21 . ARG A 1 37  ? -15.581 10.841  -18.161 1.00 0.00 ? 37  ARG A HH21 3  
ATOM 5097  H HH22 . ARG A 1 37  ? -16.868 11.466  -17.187 1.00 0.00 ? 37  ARG A HH22 3  
ATOM 5098  N N    . SER A 1 38  ? -9.718  11.043  -13.844 1.00 0.00 ? 38  SER A N    3  
ATOM 5099  C CA   . SER A 1 38  ? -9.613  11.383  -12.405 1.00 0.00 ? 38  SER A CA   3  
ATOM 5100  C C    . SER A 1 38  ? -8.179  11.739  -12.030 1.00 0.00 ? 38  SER A C    3  
ATOM 5101  O O    . SER A 1 38  ? -7.948  12.519  -11.127 1.00 0.00 ? 38  SER A O    3  
ATOM 5102  C CB   . SER A 1 38  ? -10.048 10.158  -11.586 1.00 0.00 ? 38  SER A CB   3  
ATOM 5103  O OG   . SER A 1 38  ? -9.915  10.579  -10.236 1.00 0.00 ? 38  SER A OG   3  
ATOM 5104  H H    . SER A 1 38  ? -9.887  10.120  -14.124 1.00 0.00 ? 38  SER A H    3  
ATOM 5105  H HA   . SER A 1 38  ? -10.257 12.237  -12.195 1.00 0.00 ? 38  SER A HA   3  
ATOM 5106  H HB2  . SER A 1 38  ? -11.076 9.902   -11.798 1.00 0.00 ? 38  SER A HB2  3  
ATOM 5107  H HB3  . SER A 1 38  ? -9.400  9.316   -11.781 1.00 0.00 ? 38  SER A HB3  3  
ATOM 5108  H HG   . SER A 1 38  ? -9.465  9.884   -9.752  1.00 0.00 ? 38  SER A HG   3  
ATOM 5109  N N    . LEU A 1 39  ? -7.238  11.166  -12.732 1.00 0.00 ? 39  LEU A N    3  
ATOM 5110  C CA   . LEU A 1 39  ? -5.819  11.466  -12.423 1.00 0.00 ? 39  LEU A CA   3  
ATOM 5111  C C    . LEU A 1 39  ? -5.538  12.961  -12.556 1.00 0.00 ? 39  LEU A C    3  
ATOM 5112  O O    . LEU A 1 39  ? -4.825  13.531  -11.755 1.00 0.00 ? 39  LEU A O    3  
ATOM 5113  C CB   . LEU A 1 39  ? -4.931  10.699  -13.413 1.00 0.00 ? 39  LEU A CB   3  
ATOM 5114  C CG   . LEU A 1 39  ? -4.534  9.350   -12.795 1.00 0.00 ? 39  LEU A CG   3  
ATOM 5115  C CD1  . LEU A 1 39  ? -5.711  8.380   -12.905 1.00 0.00 ? 39  LEU A CD1  3  
ATOM 5116  C CD2  . LEU A 1 39  ? -3.347  8.781   -13.562 1.00 0.00 ? 39  LEU A CD2  3  
ATOM 5117  H H    . LEU A 1 39  ? -7.467  10.545  -13.454 1.00 0.00 ? 39  LEU A H    3  
ATOM 5118  H HA   . LEU A 1 39  ? -5.610  11.160  -11.402 1.00 0.00 ? 39  LEU A HA   3  
ATOM 5119  H HB2  . LEU A 1 39  ? -5.473  10.532  -14.332 1.00 0.00 ? 39  LEU A HB2  3  
ATOM 5120  H HB3  . LEU A 1 39  ? -4.044  11.276  -13.627 1.00 0.00 ? 39  LEU A HB3  3  
ATOM 5121  H HG   . LEU A 1 39  ? -4.265  9.482   -11.755 1.00 0.00 ? 39  LEU A HG   3  
ATOM 5122  H HD11 . LEU A 1 39  ? -6.570  8.790   -12.398 1.00 0.00 ? 39  LEU A HD11 3  
ATOM 5123  H HD12 . LEU A 1 39  ? -5.955  8.218   -13.945 1.00 0.00 ? 39  LEU A HD12 3  
ATOM 5124  H HD13 . LEU A 1 39  ? -5.447  7.435   -12.451 1.00 0.00 ? 39  LEU A HD13 3  
ATOM 5125  H HD21 . LEU A 1 39  ? -2.630  9.565   -13.754 1.00 0.00 ? 39  LEU A HD21 3  
ATOM 5126  H HD22 . LEU A 1 39  ? -2.876  8.004   -12.977 1.00 0.00 ? 39  LEU A HD22 3  
ATOM 5127  H HD23 . LEU A 1 39  ? -3.685  8.367   -14.499 1.00 0.00 ? 39  LEU A HD23 3  
ATOM 5128  N N    . GLY A 1 40  ? -6.107  13.570  -13.569 1.00 0.00 ? 40  GLY A N    3  
ATOM 5129  C CA   . GLY A 1 40  ? -5.880  15.038  -13.766 1.00 0.00 ? 40  GLY A CA   3  
ATOM 5130  C C    . GLY A 1 40  ? -5.728  15.373  -15.255 1.00 0.00 ? 40  GLY A C    3  
ATOM 5131  O O    . GLY A 1 40  ? -6.012  16.477  -15.675 1.00 0.00 ? 40  GLY A O    3  
ATOM 5132  H H    . GLY A 1 40  ? -6.674  13.069  -14.189 1.00 0.00 ? 40  GLY A H    3  
ATOM 5133  H HA2  . GLY A 1 40  ? -6.722  15.583  -13.364 1.00 0.00 ? 40  GLY A HA2  3  
ATOM 5134  H HA3  . GLY A 1 40  ? -4.983  15.335  -13.244 1.00 0.00 ? 40  GLY A HA3  3  
ATOM 5135  N N    . GLN A 1 41  ? -5.283  14.416  -16.020 1.00 0.00 ? 41  GLN A N    3  
ATOM 5136  C CA   . GLN A 1 41  ? -5.110  14.667  -17.475 1.00 0.00 ? 41  GLN A CA   3  
ATOM 5137  C C    . GLN A 1 41  ? -6.410  14.415  -18.234 1.00 0.00 ? 41  GLN A C    3  
ATOM 5138  O O    . GLN A 1 41  ? -7.361  13.901  -17.681 1.00 0.00 ? 41  GLN A O    3  
ATOM 5139  C CB   . GLN A 1 41  ? -4.032  13.705  -18.004 1.00 0.00 ? 41  GLN A CB   3  
ATOM 5140  C CG   . GLN A 1 41  ? -3.344  14.332  -19.222 1.00 0.00 ? 41  GLN A CG   3  
ATOM 5141  C CD   . GLN A 1 41  ? -2.007  14.941  -18.794 1.00 0.00 ? 41  GLN A CD   3  
ATOM 5142  O OE1  . GLN A 1 41  ? -1.613  15.992  -19.262 1.00 0.00 ? 41  GLN A OE1  3  
ATOM 5143  N NE2  . GLN A 1 41  ? -1.278  14.316  -17.911 1.00 0.00 ? 41  GLN A NE2  3  
ATOM 5144  H H    . GLN A 1 41  ? -5.066  13.538  -15.640 1.00 0.00 ? 41  GLN A H    3  
ATOM 5145  H HA   . GLN A 1 41  ? -4.808  15.704  -17.622 1.00 0.00 ? 41  GLN A HA   3  
ATOM 5146  H HB2  . GLN A 1 41  ? -3.301  13.519  -17.232 1.00 0.00 ? 41  GLN A HB2  3  
ATOM 5147  H HB3  . GLN A 1 41  ? -4.491  12.770  -18.290 1.00 0.00 ? 41  GLN A HB3  3  
ATOM 5148  H HG2  . GLN A 1 41  ? -3.168  13.575  -19.972 1.00 0.00 ? 41  GLN A HG2  3  
ATOM 5149  H HG3  . GLN A 1 41  ? -3.971  15.107  -19.636 1.00 0.00 ? 41  GLN A HG3  3  
ATOM 5150  H HE21 . GLN A 1 41  ? -1.589  13.468  -17.530 1.00 0.00 ? 41  GLN A HE21 3  
ATOM 5151  H HE22 . GLN A 1 41  ? -0.419  14.695  -17.626 1.00 0.00 ? 41  GLN A HE22 3  
ATOM 5152  N N    . ASN A 1 42  ? -6.421  14.793  -19.493 1.00 0.00 ? 42  ASN A N    3  
ATOM 5153  C CA   . ASN A 1 42  ? -7.642  14.592  -20.326 1.00 0.00 ? 42  ASN A CA   3  
ATOM 5154  C C    . ASN A 1 42  ? -7.402  13.461  -21.349 1.00 0.00 ? 42  ASN A C    3  
ATOM 5155  O O    . ASN A 1 42  ? -6.690  13.648  -22.317 1.00 0.00 ? 42  ASN A O    3  
ATOM 5156  C CB   . ASN A 1 42  ? -7.909  15.896  -21.094 1.00 0.00 ? 42  ASN A CB   3  
ATOM 5157  C CG   . ASN A 1 42  ? -9.212  15.761  -21.883 1.00 0.00 ? 42  ASN A CG   3  
ATOM 5158  O OD1  . ASN A 1 42  ? -10.290 15.738  -21.325 1.00 0.00 ? 42  ASN A OD1  3  
ATOM 5159  N ND2  . ASN A 1 42  ? -9.156  15.669  -23.185 1.00 0.00 ? 42  ASN A ND2  3  
ATOM 5160  H H    . ASN A 1 42  ? -5.629  15.212  -19.883 1.00 0.00 ? 42  ASN A H    3  
ATOM 5161  H HA   . ASN A 1 42  ? -8.477  14.346  -19.683 1.00 0.00 ? 42  ASN A HA   3  
ATOM 5162  H HB2  . ASN A 1 42  ? -7.998  16.718  -20.397 1.00 0.00 ? 42  ASN A HB2  3  
ATOM 5163  H HB3  . ASN A 1 42  ? -7.096  16.094  -21.776 1.00 0.00 ? 42  ASN A HB3  3  
ATOM 5164  H HD21 . ASN A 1 42  ? -8.289  15.685  -23.641 1.00 0.00 ? 42  ASN A HD21 3  
ATOM 5165  H HD22 . ASN A 1 42  ? -9.982  15.585  -23.706 1.00 0.00 ? 42  ASN A HD22 3  
ATOM 5166  N N    . PRO A 1 43  ? -8.006  12.300  -21.117 1.00 0.00 ? 43  PRO A N    3  
ATOM 5167  C CA   . PRO A 1 43  ? -7.844  11.164  -22.022 1.00 0.00 ? 43  PRO A CA   3  
ATOM 5168  C C    . PRO A 1 43  ? -8.554  11.380  -23.354 1.00 0.00 ? 43  PRO A C    3  
ATOM 5169  O O    . PRO A 1 43  ? -9.279  12.339  -23.532 1.00 0.00 ? 43  PRO A O    3  
ATOM 5170  C CB   . PRO A 1 43  ? -8.508  9.979   -21.290 1.00 0.00 ? 43  PRO A CB   3  
ATOM 5171  C CG   . PRO A 1 43  ? -9.219  10.555  -20.030 1.00 0.00 ? 43  PRO A CG   3  
ATOM 5172  C CD   . PRO A 1 43  ? -8.867  12.047  -19.951 1.00 0.00 ? 43  PRO A CD   3  
ATOM 5173  H HA   . PRO A 1 43  ? -6.791  10.975  -22.191 1.00 0.00 ? 43  PRO A HA   3  
ATOM 5174  H HB2  . PRO A 1 43  ? -9.230  9.503   -21.936 1.00 0.00 ? 43  PRO A HB2  3  
ATOM 5175  H HB3  . PRO A 1 43  ? -7.757  9.261   -20.994 1.00 0.00 ? 43  PRO A HB3  3  
ATOM 5176  H HG2  . PRO A 1 43  ? -10.288 10.431  -20.121 1.00 0.00 ? 43  PRO A HG2  3  
ATOM 5177  H HG3  . PRO A 1 43  ? -8.872  10.048  -19.145 1.00 0.00 ? 43  PRO A HG3  3  
ATOM 5178  H HD2  . PRO A 1 43  ? -9.764  12.648  -20.013 1.00 0.00 ? 43  PRO A HD2  3  
ATOM 5179  H HD3  . PRO A 1 43  ? -8.334  12.261  -19.040 1.00 0.00 ? 43  PRO A HD3  3  
ATOM 5180  N N    . THR A 1 44  ? -8.318  10.468  -24.263 1.00 0.00 ? 44  THR A N    3  
ATOM 5181  C CA   . THR A 1 44  ? -8.949  10.560  -25.601 1.00 0.00 ? 44  THR A CA   3  
ATOM 5182  C C    . THR A 1 44  ? -9.562  9.219   -25.970 1.00 0.00 ? 44  THR A C    3  
ATOM 5183  O O    . THR A 1 44  ? -8.859  8.249   -26.155 1.00 0.00 ? 44  THR A O    3  
ATOM 5184  C CB   . THR A 1 44  ? -7.864  10.906  -26.625 1.00 0.00 ? 44  THR A CB   3  
ATOM 5185  O OG1  . THR A 1 44  ? -6.684  11.097  -25.872 1.00 0.00 ? 44  THR A OG1  3  
ATOM 5186  C CG2  . THR A 1 44  ? -8.137  12.271  -27.268 1.00 0.00 ? 44  THR A CG2  3  
ATOM 5187  H H    . THR A 1 44  ? -7.717  9.724   -24.061 1.00 0.00 ? 44  THR A H    3  
ATOM 5188  H HA   . THR A 1 44  ? -9.729  11.319  -25.583 1.00 0.00 ? 44  THR A HA   3  
ATOM 5189  H HB   . THR A 1 44  ? -7.733  10.113  -27.359 1.00 0.00 ? 44  THR A HB   3  
ATOM 5190  H HG1  . THR A 1 44  ? -6.012  11.453  -26.458 1.00 0.00 ? 44  THR A HG1  3  
ATOM 5191  H HG21 . THR A 1 44  ? -9.115  12.269  -27.727 1.00 0.00 ? 44  THR A HG21 3  
ATOM 5192  H HG22 . THR A 1 44  ? -8.101  13.043  -26.515 1.00 0.00 ? 44  THR A HG22 3  
ATOM 5193  H HG23 . THR A 1 44  ? -7.391  12.476  -28.022 1.00 0.00 ? 44  THR A HG23 3  
ATOM 5194  N N    . GLU A 1 45  ? -10.863 9.185   -26.061 1.00 0.00 ? 45  GLU A N    3  
ATOM 5195  C CA   . GLU A 1 45  ? -11.544 7.910   -26.417 1.00 0.00 ? 45  GLU A CA   3  
ATOM 5196  C C    . GLU A 1 45  ? -10.775 7.138   -27.489 1.00 0.00 ? 45  GLU A C    3  
ATOM 5197  O O    . GLU A 1 45  ? -10.816 5.924   -27.531 1.00 0.00 ? 45  GLU A O    3  
ATOM 5198  C CB   . GLU A 1 45  ? -12.941 8.246   -26.961 1.00 0.00 ? 45  GLU A CB   3  
ATOM 5199  C CG   . GLU A 1 45  ? -13.645 9.184   -25.981 1.00 0.00 ? 45  GLU A CG   3  
ATOM 5200  C CD   . GLU A 1 45  ? -13.531 8.616   -24.566 1.00 0.00 ? 45  GLU A CD   3  
ATOM 5201  O OE1  . GLU A 1 45  ? -14.262 7.677   -24.299 1.00 0.00 ? 45  GLU A OE1  3  
ATOM 5202  O OE2  . GLU A 1 45  ? -12.718 9.154   -23.832 1.00 0.00 ? 45  GLU A OE2  3  
ATOM 5203  H H    . GLU A 1 45  ? -11.389 9.995   -25.898 1.00 0.00 ? 45  GLU A H    3  
ATOM 5204  H HA   . GLU A 1 45  ? -11.619 7.291   -25.524 1.00 0.00 ? 45  GLU A HA   3  
ATOM 5205  H HB2  . GLU A 1 45  ? -12.850 8.727   -27.923 1.00 0.00 ? 45  GLU A HB2  3  
ATOM 5206  H HB3  . GLU A 1 45  ? -13.516 7.338   -27.071 1.00 0.00 ? 45  GLU A HB3  3  
ATOM 5207  H HG2  . GLU A 1 45  ? -13.183 10.160  -26.013 1.00 0.00 ? 45  GLU A HG2  3  
ATOM 5208  H HG3  . GLU A 1 45  ? -14.688 9.274   -26.247 1.00 0.00 ? 45  GLU A HG3  3  
ATOM 5209  N N    . ALA A 1 46  ? -10.071 7.851   -28.323 1.00 0.00 ? 46  ALA A N    3  
ATOM 5210  C CA   . ALA A 1 46  ? -9.300  7.163   -29.391 1.00 0.00 ? 46  ALA A CA   3  
ATOM 5211  C C    . ALA A 1 46  ? -8.054  6.509   -28.825 1.00 0.00 ? 46  ALA A C    3  
ATOM 5212  O O    . ALA A 1 46  ? -7.972  5.301   -28.741 1.00 0.00 ? 46  ALA A O    3  
ATOM 5213  C CB   . ALA A 1 46  ? -8.876  8.201   -30.434 1.00 0.00 ? 46  ALA A CB   3  
ATOM 5214  H H    . ALA A 1 46  ? -10.042 8.823   -28.236 1.00 0.00 ? 46  ALA A H    3  
ATOM 5215  H HA   . ALA A 1 46  ? -9.927  6.396   -29.843 1.00 0.00 ? 46  ALA A HA   3  
ATOM 5216  H HB1  . ALA A 1 46  ? -8.325  8.995   -29.952 1.00 0.00 ? 46  ALA A HB1  3  
ATOM 5217  H HB2  . ALA A 1 46  ? -8.250  7.734   -31.178 1.00 0.00 ? 46  ALA A HB2  3  
ATOM 5218  H HB3  . ALA A 1 46  ? -9.751  8.614   -30.912 1.00 0.00 ? 46  ALA A HB3  3  
ATOM 5219  N N    . GLU A 1 47  ? -7.096  7.313   -28.444 1.00 0.00 ? 47  GLU A N    3  
ATOM 5220  C CA   . GLU A 1 47  ? -5.861  6.725   -27.884 1.00 0.00 ? 47  GLU A CA   3  
ATOM 5221  C C    . GLU A 1 47  ? -6.233  5.712   -26.834 1.00 0.00 ? 47  GLU A C    3  
ATOM 5222  O O    . GLU A 1 47  ? -5.707  4.618   -26.804 1.00 0.00 ? 47  GLU A O    3  
ATOM 5223  C CB   . GLU A 1 47  ? -5.026  7.842   -27.239 1.00 0.00 ? 47  GLU A CB   3  
ATOM 5224  C CG   . GLU A 1 47  ? -4.627  8.857   -28.312 1.00 0.00 ? 47  GLU A CG   3  
ATOM 5225  C CD   . GLU A 1 47  ? -3.776  9.959   -27.676 1.00 0.00 ? 47  GLU A CD   3  
ATOM 5226  O OE1  . GLU A 1 47  ? -2.729  9.603   -27.160 1.00 0.00 ? 47  GLU A OE1  3  
ATOM 5227  O OE2  . GLU A 1 47  ? -4.221  11.093  -27.743 1.00 0.00 ? 47  GLU A OE2  3  
ATOM 5228  H H    . GLU A 1 47  ? -7.195  8.284   -28.527 1.00 0.00 ? 47  GLU A H    3  
ATOM 5229  H HA   . GLU A 1 47  ? -5.310  6.224   -28.680 1.00 0.00 ? 47  GLU A HA   3  
ATOM 5230  H HB2  . GLU A 1 47  ? -5.607  8.333   -26.473 1.00 0.00 ? 47  GLU A HB2  3  
ATOM 5231  H HB3  . GLU A 1 47  ? -4.138  7.419   -26.793 1.00 0.00 ? 47  GLU A HB3  3  
ATOM 5232  H HG2  . GLU A 1 47  ? -4.055  8.366   -29.085 1.00 0.00 ? 47  GLU A HG2  3  
ATOM 5233  H HG3  . GLU A 1 47  ? -5.513  9.297   -28.748 1.00 0.00 ? 47  GLU A HG3  3  
ATOM 5234  N N    . LEU A 1 48  ? -7.139  6.094   -25.984 1.00 0.00 ? 48  LEU A N    3  
ATOM 5235  C CA   . LEU A 1 48  ? -7.565  5.168   -24.930 1.00 0.00 ? 48  LEU A CA   3  
ATOM 5236  C C    . LEU A 1 48  ? -7.856  3.822   -25.557 1.00 0.00 ? 48  LEU A C    3  
ATOM 5237  O O    . LEU A 1 48  ? -7.490  2.791   -25.035 1.00 0.00 ? 48  LEU A O    3  
ATOM 5238  C CB   . LEU A 1 48  ? -8.854  5.718   -24.303 1.00 0.00 ? 48  LEU A CB   3  
ATOM 5239  C CG   . LEU A 1 48  ? -9.110  5.010   -22.971 1.00 0.00 ? 48  LEU A CG   3  
ATOM 5240  C CD1  . LEU A 1 48  ? -8.172  5.584   -21.908 1.00 0.00 ? 48  LEU A CD1  3  
ATOM 5241  C CD2  . LEU A 1 48  ? -10.559 5.251   -22.545 1.00 0.00 ? 48  LEU A CD2  3  
ATOM 5242  H H    . LEU A 1 48  ? -7.531  6.987   -26.046 1.00 0.00 ? 48  LEU A H    3  
ATOM 5243  H HA   . LEU A 1 48  ? -6.772  5.064   -24.190 1.00 0.00 ? 48  LEU A HA   3  
ATOM 5244  H HB2  . LEU A 1 48  ? -8.751  6.781   -24.136 1.00 0.00 ? 48  LEU A HB2  3  
ATOM 5245  H HB3  . LEU A 1 48  ? -9.686  5.545   -24.973 1.00 0.00 ? 48  LEU A HB3  3  
ATOM 5246  H HG   . LEU A 1 48  ? -8.933  3.950   -23.081 1.00 0.00 ? 48  LEU A HG   3  
ATOM 5247  H HD11 . LEU A 1 48  ? -8.114  6.657   -22.015 1.00 0.00 ? 48  LEU A HD11 3  
ATOM 5248  H HD12 . LEU A 1 48  ? -8.548  5.345   -20.924 1.00 0.00 ? 48  LEU A HD12 3  
ATOM 5249  H HD13 . LEU A 1 48  ? -7.187  5.160   -22.025 1.00 0.00 ? 48  LEU A HD13 3  
ATOM 5250  H HD21 . LEU A 1 48  ? -10.739 6.311   -22.446 1.00 0.00 ? 48  LEU A HD21 3  
ATOM 5251  H HD22 . LEU A 1 48  ? -11.230 4.844   -23.289 1.00 0.00 ? 48  LEU A HD22 3  
ATOM 5252  H HD23 . LEU A 1 48  ? -10.746 4.768   -21.598 1.00 0.00 ? 48  LEU A HD23 3  
ATOM 5253  N N    . GLN A 1 49  ? -8.508  3.867   -26.688 1.00 0.00 ? 49  GLN A N    3  
ATOM 5254  C CA   . GLN A 1 49  ? -8.847  2.616   -27.393 1.00 0.00 ? 49  GLN A CA   3  
ATOM 5255  C C    . GLN A 1 49  ? -7.587  1.848   -27.770 1.00 0.00 ? 49  GLN A C    3  
ATOM 5256  O O    . GLN A 1 49  ? -7.524  0.644   -27.624 1.00 0.00 ? 49  GLN A O    3  
ATOM 5257  C CB   . GLN A 1 49  ? -9.598  2.988   -28.678 1.00 0.00 ? 49  GLN A CB   3  
ATOM 5258  C CG   . GLN A 1 49  ? -10.501 1.831   -29.083 1.00 0.00 ? 49  GLN A CG   3  
ATOM 5259  C CD   . GLN A 1 49  ? -10.967 2.033   -30.526 1.00 0.00 ? 49  GLN A CD   3  
ATOM 5260  O OE1  . GLN A 1 49  ? -10.422 2.833   -31.259 1.00 0.00 ? 49  GLN A OE1  3  
ATOM 5261  N NE2  . GLN A 1 49  ? -11.972 1.329   -30.970 1.00 0.00 ? 49  GLN A NE2  3  
ATOM 5262  H H    . GLN A 1 49  ? -8.781  4.735   -27.066 1.00 0.00 ? 49  GLN A H    3  
ATOM 5263  H HA   . GLN A 1 49  ? -9.463  1.996   -26.748 1.00 0.00 ? 49  GLN A HA   3  
ATOM 5264  H HB2  . GLN A 1 49  ? -10.196 3.870   -28.505 1.00 0.00 ? 49  GLN A HB2  3  
ATOM 5265  H HB3  . GLN A 1 49  ? -8.890  3.189   -29.466 1.00 0.00 ? 49  GLN A HB3  3  
ATOM 5266  H HG2  . GLN A 1 49  ? -9.957  0.904   -29.011 1.00 0.00 ? 49  GLN A HG2  3  
ATOM 5267  H HG3  . GLN A 1 49  ? -11.360 1.795   -28.432 1.00 0.00 ? 49  GLN A HG3  3  
ATOM 5268  H HE21 . GLN A 1 49  ? -12.414 0.681   -30.383 1.00 0.00 ? 49  GLN A HE21 3  
ATOM 5269  H HE22 . GLN A 1 49  ? -12.282 1.446   -31.892 1.00 0.00 ? 49  GLN A HE22 3  
ATOM 5270  N N    . ASP A 1 50  ? -6.602  2.559   -28.250 1.00 0.00 ? 50  ASP A N    3  
ATOM 5271  C CA   . ASP A 1 50  ? -5.340  1.881   -28.641 1.00 0.00 ? 50  ASP A CA   3  
ATOM 5272  C C    . ASP A 1 50  ? -4.782  1.060   -27.484 1.00 0.00 ? 50  ASP A C    3  
ATOM 5273  O O    . ASP A 1 50  ? -4.227  -0.002  -27.684 1.00 0.00 ? 50  ASP A O    3  
ATOM 5274  C CB   . ASP A 1 50  ? -4.312  2.952   -29.028 1.00 0.00 ? 50  ASP A CB   3  
ATOM 5275  C CG   . ASP A 1 50  ? -4.880  3.817   -30.154 1.00 0.00 ? 50  ASP A CG   3  
ATOM 5276  O OD1  . ASP A 1 50  ? -5.784  3.327   -30.809 1.00 0.00 ? 50  ASP A OD1  3  
ATOM 5277  O OD2  . ASP A 1 50  ? -4.379  4.921   -30.295 1.00 0.00 ? 50  ASP A OD2  3  
ATOM 5278  H H    . ASP A 1 50  ? -6.693  3.535   -28.349 1.00 0.00 ? 50  ASP A H    3  
ATOM 5279  H HA   . ASP A 1 50  ? -5.541  1.217   -29.480 1.00 0.00 ? 50  ASP A HA   3  
ATOM 5280  H HB2  . ASP A 1 50  ? -4.093  3.576   -28.174 1.00 0.00 ? 50  ASP A HB2  3  
ATOM 5281  H HB3  . ASP A 1 50  ? -3.401  2.480   -29.367 1.00 0.00 ? 50  ASP A HB3  3  
ATOM 5282  N N    . MET A 1 51  ? -4.939  1.566   -26.292 1.00 0.00 ? 51  MET A N    3  
ATOM 5283  C CA   . MET A 1 51  ? -4.422  0.828   -25.113 1.00 0.00 ? 51  MET A CA   3  
ATOM 5284  C C    . MET A 1 51  ? -5.248  -0.423  -24.841 1.00 0.00 ? 51  MET A C    3  
ATOM 5285  O O    . MET A 1 51  ? -4.709  -1.492  -24.629 1.00 0.00 ? 51  MET A O    3  
ATOM 5286  C CB   . MET A 1 51  ? -4.509  1.755   -23.890 1.00 0.00 ? 51  MET A CB   3  
ATOM 5287  C CG   . MET A 1 51  ? -3.834  3.092   -24.221 1.00 0.00 ? 51  MET A CG   3  
ATOM 5288  S SD   . MET A 1 51  ? -2.771  3.822   -22.952 1.00 0.00 ? 51  MET A SD   3  
ATOM 5289  C CE   . MET A 1 51  ? -3.975  5.011   -22.309 1.00 0.00 ? 51  MET A CE   3  
ATOM 5290  H H    . MET A 1 51  ? -5.393  2.427   -26.177 1.00 0.00 ? 51  MET A H    3  
ATOM 5291  H HA   . MET A 1 51  ? -3.392  0.536   -25.302 1.00 0.00 ? 51  MET A HA   3  
ATOM 5292  H HB2  . MET A 1 51  ? -5.545  1.924   -23.637 1.00 0.00 ? 51  MET A HB2  3  
ATOM 5293  H HB3  . MET A 1 51  ? -4.010  1.294   -23.050 1.00 0.00 ? 51  MET A HB3  3  
ATOM 5294  H HG2  . MET A 1 51  ? -3.236  2.958   -25.111 1.00 0.00 ? 51  MET A HG2  3  
ATOM 5295  H HG3  . MET A 1 51  ? -4.607  3.809   -24.451 1.00 0.00 ? 51  MET A HG3  3  
ATOM 5296  H HE1  . MET A 1 51  ? -4.884  4.494   -22.043 1.00 0.00 ? 51  MET A HE1  3  
ATOM 5297  H HE2  . MET A 1 51  ? -3.568  5.498   -21.436 1.00 0.00 ? 51  MET A HE2  3  
ATOM 5298  H HE3  . MET A 1 51  ? -4.189  5.752   -23.066 1.00 0.00 ? 51  MET A HE3  3  
ATOM 5299  N N    . ILE A 1 52  ? -6.541  -0.271  -24.852 1.00 0.00 ? 52  ILE A N    3  
ATOM 5300  C CA   . ILE A 1 52  ? -7.416  -1.443  -24.594 1.00 0.00 ? 52  ILE A CA   3  
ATOM 5301  C C    . ILE A 1 52  ? -7.084  -2.593  -25.540 1.00 0.00 ? 52  ILE A C    3  
ATOM 5302  O O    . ILE A 1 52  ? -6.945  -3.725  -25.121 1.00 0.00 ? 52  ILE A O    3  
ATOM 5303  C CB   . ILE A 1 52  ? -8.876  -1.015  -24.823 1.00 0.00 ? 52  ILE A CB   3  
ATOM 5304  C CG1  . ILE A 1 52  ? -9.450  -0.394  -23.549 1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5305  C CG2  . ILE A 1 52  ? -9.712  -2.262  -25.174 1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5306  C CD1  . ILE A 1 52  ? -9.155  1.106   -23.543 1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5307  H H    . ILE A 1 52  ? -6.931  0.610   -25.030 1.00 0.00 ? 52  ILE A H    3  
ATOM 5308  H HA   . ILE A 1 52  ? -7.264  -1.777  -23.574 1.00 0.00 ? 52  ILE A HA   3  
ATOM 5309  H HB   . ILE A 1 52  ? -8.912  -0.282  -25.628 1.00 0.00 ? 52  ILE A HB   3  
ATOM 5310  H HG12 . ILE A 1 52  ? -10.518 -0.553  -23.519 1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5311  H HG13 . ILE A 1 52  ? -9.002  -0.856  -22.682 1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5312  H HG21 . ILE A 1 52  ? -9.511  -3.048  -24.462 1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5313  H HG22 . ILE A 1 52  ? -10.763 -2.015  -25.143 1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5314  H HG23 . ILE A 1 52  ? -9.455  -2.605  -26.165 1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5315  H HD11 . ILE A 1 52  ? -9.408  1.531   -24.502 1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5316  H HD12 . ILE A 1 52  ? -9.739  1.590   -22.774 1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5317  H HD13 . ILE A 1 52  ? -8.105  1.270   -23.346 1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5318  N N    . ASN A 1 53  ? -6.963  -2.284  -26.798 1.00 0.00 ? 53  ASN A N    3  
ATOM 5319  C CA   . ASN A 1 53  ? -6.641  -3.348  -27.782 1.00 0.00 ? 53  ASN A CA   3  
ATOM 5320  C C    . ASN A 1 53  ? -5.257  -3.937  -27.521 1.00 0.00 ? 53  ASN A C    3  
ATOM 5321  O O    . ASN A 1 53  ? -4.887  -4.934  -28.108 1.00 0.00 ? 53  ASN A O    3  
ATOM 5322  C CB   . ASN A 1 53  ? -6.657  -2.727  -29.189 1.00 0.00 ? 53  ASN A CB   3  
ATOM 5323  C CG   . ASN A 1 53  ? -6.708  -3.845  -30.235 1.00 0.00 ? 53  ASN A CG   3  
ATOM 5324  O OD1  . ASN A 1 53  ? -7.762  -4.223  -30.705 1.00 0.00 ? 53  ASN A OD1  3  
ATOM 5325  N ND2  . ASN A 1 53  ? -5.592  -4.397  -30.627 1.00 0.00 ? 53  ASN A ND2  3  
ATOM 5326  H H    . ASN A 1 53  ? -7.082  -1.357  -27.093 1.00 0.00 ? 53  ASN A H    3  
ATOM 5327  H HA   . ASN A 1 53  ? -7.383  -4.140  -27.701 1.00 0.00 ? 53  ASN A HA   3  
ATOM 5328  H HB2  . ASN A 1 53  ? -7.527  -2.096  -29.300 1.00 0.00 ? 53  ASN A HB2  3  
ATOM 5329  H HB3  . ASN A 1 53  ? -5.765  -2.137  -29.339 1.00 0.00 ? 53  ASN A HB3  3  
ATOM 5330  H HD21 . ASN A 1 53  ? -4.738  -4.096  -30.253 1.00 0.00 ? 53  ASN A HD21 3  
ATOM 5331  H HD22 . ASN A 1 53  ? -5.608  -5.112  -31.298 1.00 0.00 ? 53  ASN A HD22 3  
ATOM 5332  N N    . GLU A 1 54  ? -4.518  -3.311  -26.647 1.00 0.00 ? 54  GLU A N    3  
ATOM 5333  C CA   . GLU A 1 54  ? -3.161  -3.827  -26.344 1.00 0.00 ? 54  GLU A CA   3  
ATOM 5334  C C    . GLU A 1 54  ? -3.200  -4.853  -25.216 1.00 0.00 ? 54  GLU A C    3  
ATOM 5335  O O    . GLU A 1 54  ? -2.575  -5.892  -25.300 1.00 0.00 ? 54  GLU A O    3  
ATOM 5336  C CB   . GLU A 1 54  ? -2.281  -2.648  -25.905 1.00 0.00 ? 54  GLU A CB   3  
ATOM 5337  C CG   . GLU A 1 54  ? -0.811  -3.024  -26.096 1.00 0.00 ? 54  GLU A CG   3  
ATOM 5338  C CD   . GLU A 1 54  ? 0.060   -1.784  -25.887 1.00 0.00 ? 54  GLU A CD   3  
ATOM 5339  O OE1  . GLU A 1 54  ? 0.085   -0.980  -26.805 1.00 0.00 ? 54  GLU A OE1  3  
ATOM 5340  O OE2  . GLU A 1 54  ? 0.650   -1.710  -24.822 1.00 0.00 ? 54  GLU A OE2  3  
ATOM 5341  H H    . GLU A 1 54  ? -4.854  -2.511  -26.196 1.00 0.00 ? 54  GLU A H    3  
ATOM 5342  H HA   . GLU A 1 54  ? -2.757  -4.298  -27.237 1.00 0.00 ? 54  GLU A HA   3  
ATOM 5343  H HB2  . GLU A 1 54  ? -2.514  -1.779  -26.503 1.00 0.00 ? 54  GLU A HB2  3  
ATOM 5344  H HB3  . GLU A 1 54  ? -2.467  -2.422  -24.866 1.00 0.00 ? 54  GLU A HB3  3  
ATOM 5345  H HG2  . GLU A 1 54  ? -0.531  -3.782  -25.379 1.00 0.00 ? 54  GLU A HG2  3  
ATOM 5346  H HG3  . GLU A 1 54  ? -0.657  -3.404  -27.095 1.00 0.00 ? 54  GLU A HG3  3  
ATOM 5347  N N    . VAL A 1 55  ? -3.933  -4.548  -24.180 1.00 0.00 ? 55  VAL A N    3  
ATOM 5348  C CA   . VAL A 1 55  ? -4.019  -5.493  -23.048 1.00 0.00 ? 55  VAL A CA   3  
ATOM 5349  C C    . VAL A 1 55  ? -5.089  -6.544  -23.309 1.00 0.00 ? 55  VAL A C    3  
ATOM 5350  O O    . VAL A 1 55  ? -4.953  -7.364  -24.194 1.00 0.00 ? 55  VAL A O    3  
ATOM 5351  C CB   . VAL A 1 55  ? -4.393  -4.693  -21.790 1.00 0.00 ? 55  VAL A CB   3  
ATOM 5352  C CG1  . VAL A 1 55  ? -3.161  -3.935  -21.294 1.00 0.00 ? 55  VAL A CG1  3  
ATOM 5353  C CG2  . VAL A 1 55  ? -5.492  -3.689  -22.143 1.00 0.00 ? 55  VAL A CG2  3  
ATOM 5354  H H    . VAL A 1 55  ? -4.427  -3.704  -24.152 1.00 0.00 ? 55  VAL A H    3  
ATOM 5355  H HA   . VAL A 1 55  ? -3.056  -5.987  -22.924 1.00 0.00 ? 55  VAL A HA   3  
ATOM 5356  H HB   . VAL A 1 55  ? -4.744  -5.360  -21.018 1.00 0.00 ? 55  VAL A HB   3  
ATOM 5357  H HG11 . VAL A 1 55  ? -2.364  -4.632  -21.083 1.00 0.00 ? 55  VAL A HG11 3  
ATOM 5358  H HG12 . VAL A 1 55  ? -2.833  -3.237  -22.050 1.00 0.00 ? 55  VAL A HG12 3  
ATOM 5359  H HG13 . VAL A 1 55  ? -3.406  -3.392  -20.393 1.00 0.00 ? 55  VAL A HG13 3  
ATOM 5360  H HG21 . VAL A 1 55  ? -6.294  -4.194  -22.662 1.00 0.00 ? 55  VAL A HG21 3  
ATOM 5361  H HG22 . VAL A 1 55  ? -5.881  -3.240  -21.241 1.00 0.00 ? 55  VAL A HG22 3  
ATOM 5362  H HG23 . VAL A 1 55  ? -5.089  -2.916  -22.780 1.00 0.00 ? 55  VAL A HG23 3  
ATOM 5363  N N    . ASP A 1 56  ? -6.138  -6.492  -22.537 1.00 0.00 ? 56  ASP A N    3  
ATOM 5364  C CA   . ASP A 1 56  ? -7.236  -7.480  -22.719 1.00 0.00 ? 56  ASP A CA   3  
ATOM 5365  C C    . ASP A 1 56  ? -6.682  -8.875  -22.991 1.00 0.00 ? 56  ASP A C    3  
ATOM 5366  O O    . ASP A 1 56  ? -7.286  -9.657  -23.698 1.00 0.00 ? 56  ASP A O    3  
ATOM 5367  C CB   . ASP A 1 56  ? -8.084  -7.042  -23.924 1.00 0.00 ? 56  ASP A CB   3  
ATOM 5368  C CG   . ASP A 1 56  ? -9.470  -7.682  -23.825 1.00 0.00 ? 56  ASP A CG   3  
ATOM 5369  O OD1  . ASP A 1 56  ? -9.552  -8.850  -24.168 1.00 0.00 ? 56  ASP A OD1  3  
ATOM 5370  O OD2  . ASP A 1 56  ? -10.367 -6.967  -23.412 1.00 0.00 ? 56  ASP A OD2  3  
ATOM 5371  H H    . ASP A 1 56  ? -6.205  -5.801  -21.847 1.00 0.00 ? 56  ASP A H    3  
ATOM 5372  H HA   . ASP A 1 56  ? -7.838  -7.509  -21.812 1.00 0.00 ? 56  ASP A HA   3  
ATOM 5373  H HB2  . ASP A 1 56  ? -8.186  -5.967  -23.929 1.00 0.00 ? 56  ASP A HB2  3  
ATOM 5374  H HB3  . ASP A 1 56  ? -7.608  -7.360  -24.840 1.00 0.00 ? 56  ASP A HB3  3  
ATOM 5375  N N    . ALA A 1 57  ? -5.538  -9.158  -22.421 1.00 0.00 ? 57  ALA A N    3  
ATOM 5376  C CA   . ALA A 1 57  ? -4.922  -10.494 -22.631 1.00 0.00 ? 57  ALA A CA   3  
ATOM 5377  C C    . ALA A 1 57  ? -5.204  -11.422 -21.454 1.00 0.00 ? 57  ALA A C    3  
ATOM 5378  O O    . ALA A 1 57  ? -4.975  -12.612 -21.532 1.00 0.00 ? 57  ALA A O    3  
ATOM 5379  C CB   . ALA A 1 57  ? -3.403  -10.308 -22.753 1.00 0.00 ? 57  ALA A CB   3  
ATOM 5380  H H    . ALA A 1 57  ? -5.092  -8.494  -21.862 1.00 0.00 ? 57  ALA A H    3  
ATOM 5381  H HA   . ALA A 1 57  ? -5.329  -10.935 -23.536 1.00 0.00 ? 57  ALA A HA   3  
ATOM 5382  H HB1  . ALA A 1 57  ? -3.024  -9.816  -21.870 1.00 0.00 ? 57  ALA A HB1  3  
ATOM 5383  H HB2  . ALA A 1 57  ? -2.924  -11.271 -22.856 1.00 0.00 ? 57  ALA A HB2  3  
ATOM 5384  H HB3  . ALA A 1 57  ? -3.177  -9.705  -23.620 1.00 0.00 ? 57  ALA A HB3  3  
ATOM 5385  N N    . ASP A 1 58  ? -5.696  -10.861 -20.384 1.00 0.00 ? 58  ASP A N    3  
ATOM 5386  C CA   . ASP A 1 58  ? -5.995  -11.701 -19.197 1.00 0.00 ? 58  ASP A CA   3  
ATOM 5387  C C    . ASP A 1 58  ? -7.231  -12.562 -19.432 1.00 0.00 ? 58  ASP A C    3  
ATOM 5388  O O    . ASP A 1 58  ? -7.514  -13.465 -18.670 1.00 0.00 ? 58  ASP A O    3  
ATOM 5389  C CB   . ASP A 1 58  ? -6.259  -10.771 -18.002 1.00 0.00 ? 58  ASP A CB   3  
ATOM 5390  C CG   . ASP A 1 58  ? -6.504  -11.614 -16.748 1.00 0.00 ? 58  ASP A CG   3  
ATOM 5391  O OD1  . ASP A 1 58  ? -5.955  -12.704 -16.715 1.00 0.00 ? 58  ASP A OD1  3  
ATOM 5392  O OD2  . ASP A 1 58  ? -7.225  -11.122 -15.897 1.00 0.00 ? 58  ASP A OD2  3  
ATOM 5393  H H    . ASP A 1 58  ? -5.866  -9.896  -20.363 1.00 0.00 ? 58  ASP A H    3  
ATOM 5394  H HA   . ASP A 1 58  ? -5.144  -12.349 -19.000 1.00 0.00 ? 58  ASP A HA   3  
ATOM 5395  H HB2  . ASP A 1 58  ? -5.404  -10.132 -17.840 1.00 0.00 ? 58  ASP A HB2  3  
ATOM 5396  H HB3  . ASP A 1 58  ? -7.130  -10.161 -18.197 1.00 0.00 ? 58  ASP A HB3  3  
ATOM 5397  N N    . GLY A 1 59  ? -7.946  -12.270 -20.484 1.00 0.00 ? 59  GLY A N    3  
ATOM 5398  C CA   . GLY A 1 59  ? -9.169  -13.069 -20.779 1.00 0.00 ? 59  GLY A CA   3  
ATOM 5399  C C    . GLY A 1 59  ? -10.387 -12.447 -20.095 1.00 0.00 ? 59  GLY A C    3  
ATOM 5400  O O    . GLY A 1 59  ? -11.496 -12.552 -20.580 1.00 0.00 ? 59  GLY A O    3  
ATOM 5401  H H    . GLY A 1 59  ? -7.682  -11.533 -21.072 1.00 0.00 ? 59  GLY A H    3  
ATOM 5402  H HA2  . GLY A 1 59  ? -9.332  -13.091 -21.847 1.00 0.00 ? 59  GLY A HA2  3  
ATOM 5403  H HA3  . GLY A 1 59  ? -9.032  -14.077 -20.419 1.00 0.00 ? 59  GLY A HA3  3  
ATOM 5404  N N    . ASN A 1 60  ? -10.155 -11.811 -18.979 1.00 0.00 ? 60  ASN A N    3  
ATOM 5405  C CA   . ASN A 1 60  ? -11.282 -11.179 -18.251 1.00 0.00 ? 60  ASN A CA   3  
ATOM 5406  C C    . ASN A 1 60  ? -11.618 -9.821  -18.855 1.00 0.00 ? 60  ASN A C    3  
ATOM 5407  O O    . ASN A 1 60  ? -12.734 -9.354  -18.760 1.00 0.00 ? 60  ASN A O    3  
ATOM 5408  C CB   . ASN A 1 60  ? -10.862 -10.981 -16.786 1.00 0.00 ? 60  ASN A CB   3  
ATOM 5409  C CG   . ASN A 1 60  ? -11.027 -12.303 -16.033 1.00 0.00 ? 60  ASN A CG   3  
ATOM 5410  O OD1  . ASN A 1 60  ? -10.796 -12.387 -14.843 1.00 0.00 ? 60  ASN A OD1  3  
ATOM 5411  N ND2  . ASN A 1 60  ? -11.425 -13.357 -16.690 1.00 0.00 ? 60  ASN A ND2  3  
ATOM 5412  H H    . ASN A 1 60  ? -9.242  -11.752 -18.625 1.00 0.00 ? 60  ASN A H    3  
ATOM 5413  H HA   . ASN A 1 60  ? -12.157 -11.825 -18.321 1.00 0.00 ? 60  ASN A HA   3  
ATOM 5414  H HB2  . ASN A 1 60  ? -9.829  -10.671 -16.739 1.00 0.00 ? 60  ASN A HB2  3  
ATOM 5415  H HB3  . ASN A 1 60  ? -11.483 -10.227 -16.325 1.00 0.00 ? 60  ASN A HB3  3  
ATOM 5416  H HD21 . ASN A 1 60  ? -11.612 -13.296 -17.649 1.00 0.00 ? 60  ASN A HD21 3  
ATOM 5417  H HD22 . ASN A 1 60  ? -11.537 -14.212 -16.223 1.00 0.00 ? 60  ASN A HD22 3  
ATOM 5418  N N    . GLY A 1 61  ? -10.640 -9.210  -19.467 1.00 0.00 ? 61  GLY A N    3  
ATOM 5419  C CA   . GLY A 1 61  ? -10.882 -7.877  -20.087 1.00 0.00 ? 61  GLY A CA   3  
ATOM 5420  C C    . GLY A 1 61  ? -10.686 -6.766  -19.053 1.00 0.00 ? 61  GLY A C    3  
ATOM 5421  O O    . GLY A 1 61  ? -10.980 -5.618  -19.315 1.00 0.00 ? 61  GLY A O    3  
ATOM 5422  H H    . GLY A 1 61  ? -9.753  -9.625  -19.519 1.00 0.00 ? 61  GLY A H    3  
ATOM 5423  H HA2  . GLY A 1 61  ? -10.189 -7.732  -20.902 1.00 0.00 ? 61  GLY A HA2  3  
ATOM 5424  H HA3  . GLY A 1 61  ? -11.892 -7.838  -20.466 1.00 0.00 ? 61  GLY A HA3  3  
ATOM 5425  N N    . THR A 1 62  ? -10.191 -7.136  -17.897 1.00 0.00 ? 62  THR A N    3  
ATOM 5426  C CA   . THR A 1 62  ? -9.965  -6.123  -16.830 1.00 0.00 ? 62  THR A CA   3  
ATOM 5427  C C    . THR A 1 62  ? -8.488  -5.770  -16.719 1.00 0.00 ? 62  THR A C    3  
ATOM 5428  O O    . THR A 1 62  ? -7.636  -6.569  -17.056 1.00 0.00 ? 62  THR A O    3  
ATOM 5429  C CB   . THR A 1 62  ? -10.427 -6.720  -15.499 1.00 0.00 ? 62  THR A CB   3  
ATOM 5430  O OG1  . THR A 1 62  ? -9.726  -7.940  -15.370 1.00 0.00 ? 62  THR A OG1  3  
ATOM 5431  C CG2  . THR A 1 62  ? -11.906 -7.126  -15.570 1.00 0.00 ? 62  THR A CG2  3  
ATOM 5432  H H    . THR A 1 62  ? -9.970  -8.078  -17.737 1.00 0.00 ? 62  THR A H    3  
ATOM 5433  H HA   . THR A 1 62  ? -10.529 -5.223  -17.065 1.00 0.00 ? 62  THR A HA   3  
ATOM 5434  H HB   . THR A 1 62  ? -10.211 -6.059  -14.663 1.00 0.00 ? 62  THR A HB   3  
ATOM 5435  H HG1  . THR A 1 62  ? -9.264  -8.105  -16.195 1.00 0.00 ? 62  THR A HG1  3  
ATOM 5436  H HG21 . THR A 1 62  ? -12.480 -6.332  -16.024 1.00 0.00 ? 62  THR A HG21 3  
ATOM 5437  H HG22 . THR A 1 62  ? -12.008 -8.023  -16.162 1.00 0.00 ? 62  THR A HG22 3  
ATOM 5438  H HG23 . THR A 1 62  ? -12.281 -7.312  -14.575 1.00 0.00 ? 62  THR A HG23 3  
ATOM 5439  N N    . ILE A 1 63  ? -8.211  -4.573  -16.244 1.00 0.00 ? 63  ILE A N    3  
ATOM 5440  C CA   . ILE A 1 63  ? -6.794  -4.145  -16.101 1.00 0.00 ? 63  ILE A CA   3  
ATOM 5441  C C    . ILE A 1 63  ? -6.396  -4.047  -14.640 1.00 0.00 ? 63  ILE A C    3  
ATOM 5442  O O    . ILE A 1 63  ? -7.210  -3.740  -13.792 1.00 0.00 ? 63  ILE A O    3  
ATOM 5443  C CB   . ILE A 1 63  ? -6.626  -2.764  -16.720 1.00 0.00 ? 63  ILE A CB   3  
ATOM 5444  C CG1  . ILE A 1 63  ? -7.364  -2.677  -18.042 1.00 0.00 ? 63  ILE A CG1  3  
ATOM 5445  C CG2  . ILE A 1 63  ? -5.134  -2.549  -16.983 1.00 0.00 ? 63  ILE A CG2  3  
ATOM 5446  C CD1  . ILE A 1 63  ? -6.853  -1.451  -18.806 1.00 0.00 ? 63  ILE A CD1  3  
ATOM 5447  H H    . ILE A 1 63  ? -8.936  -3.969  -15.983 1.00 0.00 ? 63  ILE A H    3  
ATOM 5448  H HA   . ILE A 1 63  ? -6.147  -4.866  -16.593 1.00 0.00 ? 63  ILE A HA   3  
ATOM 5449  H HB   . ILE A 1 63  ? -7.014  -2.012  -16.036 1.00 0.00 ? 63  ILE A HB   3  
ATOM 5450  H HG12 . ILE A 1 63  ? -7.182  -3.571  -18.621 1.00 0.00 ? 63  ILE A HG12 3  
ATOM 5451  H HG13 . ILE A 1 63  ? -8.425  -2.580  -17.861 1.00 0.00 ? 63  ILE A HG13 3  
ATOM 5452  H HG21 . ILE A 1 63  ? -4.561  -2.934  -16.153 1.00 0.00 ? 63  ILE A HG21 3  
ATOM 5453  H HG22 . ILE A 1 63  ? -4.845  -3.067  -17.885 1.00 0.00 ? 63  ILE A HG22 3  
ATOM 5454  H HG23 . ILE A 1 63  ? -4.932  -1.497  -17.096 1.00 0.00 ? 63  ILE A HG23 3  
ATOM 5455  H HD11 . ILE A 1 63  ? -6.680  -0.637  -18.114 1.00 0.00 ? 63  ILE A HD11 3  
ATOM 5456  H HD12 . ILE A 1 63  ? -5.927  -1.693  -19.308 1.00 0.00 ? 63  ILE A HD12 3  
ATOM 5457  H HD13 . ILE A 1 63  ? -7.584  -1.145  -19.538 1.00 0.00 ? 63  ILE A HD13 3  
ATOM 5458  N N    . ASP A 1 64  ? -5.139  -4.301  -14.379 1.00 0.00 ? 64  ASP A N    3  
ATOM 5459  C CA   . ASP A 1 64  ? -4.638  -4.234  -12.981 1.00 0.00 ? 64  ASP A CA   3  
ATOM 5460  C C    . ASP A 1 64  ? -3.802  -2.958  -12.779 1.00 0.00 ? 64  ASP A C    3  
ATOM 5461  O O    . ASP A 1 64  ? -3.492  -2.269  -13.729 1.00 0.00 ? 64  ASP A O    3  
ATOM 5462  C CB   . ASP A 1 64  ? -3.775  -5.482  -12.740 1.00 0.00 ? 64  ASP A CB   3  
ATOM 5463  C CG   . ASP A 1 64  ? -2.570  -5.469  -13.685 1.00 0.00 ? 64  ASP A CG   3  
ATOM 5464  O OD1  . ASP A 1 64  ? -2.255  -4.386  -14.148 1.00 0.00 ? 64  ASP A OD1  3  
ATOM 5465  O OD2  . ASP A 1 64  ? -2.033  -6.545  -13.893 1.00 0.00 ? 64  ASP A OD2  3  
ATOM 5466  H H    . ASP A 1 64  ? -4.527  -4.537  -15.106 1.00 0.00 ? 64  ASP A H    3  
ATOM 5467  H HA   . ASP A 1 64  ? -5.491  -4.211  -12.294 1.00 0.00 ? 64  ASP A HA   3  
ATOM 5468  H HB2  . ASP A 1 64  ? -3.435  -5.502  -11.718 1.00 0.00 ? 64  ASP A HB2  3  
ATOM 5469  H HB3  . ASP A 1 64  ? -4.361  -6.367  -12.933 1.00 0.00 ? 64  ASP A HB3  3  
ATOM 5470  N N    . PHE A 1 65  ? -3.454  -2.662  -11.546 1.00 0.00 ? 65  PHE A N    3  
ATOM 5471  C CA   . PHE A 1 65  ? -2.646  -1.429  -11.296 1.00 0.00 ? 65  PHE A CA   3  
ATOM 5472  C C    . PHE A 1 65  ? -1.315  -1.386  -12.089 1.00 0.00 ? 65  PHE A C    3  
ATOM 5473  O O    . PHE A 1 65  ? -0.987  -0.368  -12.643 1.00 0.00 ? 65  PHE A O    3  
ATOM 5474  C CB   . PHE A 1 65  ? -2.359  -1.288  -9.782  1.00 0.00 ? 65  PHE A CB   3  
ATOM 5475  C CG   . PHE A 1 65  ? -1.717  0.081   -9.518  1.00 0.00 ? 65  PHE A CG   3  
ATOM 5476  C CD1  . PHE A 1 65  ? -2.406  1.248   -9.809  1.00 0.00 ? 65  PHE A CD1  3  
ATOM 5477  C CD2  . PHE A 1 65  ? -0.438  0.170   -8.994  1.00 0.00 ? 65  PHE A CD2  3  
ATOM 5478  C CE1  . PHE A 1 65  ? -1.824  2.480   -9.580  1.00 0.00 ? 65  PHE A CE1  3  
ATOM 5479  C CE2  . PHE A 1 65  ? 0.140   1.405   -8.766  1.00 0.00 ? 65  PHE A CE2  3  
ATOM 5480  C CZ   . PHE A 1 65  ? -0.552  2.557   -9.060  1.00 0.00 ? 65  PHE A CZ   3  
ATOM 5481  H H    . PHE A 1 65  ? -3.721  -3.240  -10.802 1.00 0.00 ? 65  PHE A H    3  
ATOM 5482  H HA   . PHE A 1 65  ? -3.245  -0.582  -11.631 1.00 0.00 ? 65  PHE A HA   3  
ATOM 5483  H HB2  . PHE A 1 65  ? -3.284  -1.358  -9.227  1.00 0.00 ? 65  PHE A HB2  3  
ATOM 5484  H HB3  . PHE A 1 65  ? -1.693  -2.055  -9.453  1.00 0.00 ? 65  PHE A HB3  3  
ATOM 5485  H HD1  . PHE A 1 65  ? -3.404  1.194   -10.219 1.00 0.00 ? 65  PHE A HD1  3  
ATOM 5486  H HD2  . PHE A 1 65  ? 0.111   -0.730  -8.763  1.00 0.00 ? 65  PHE A HD2  3  
ATOM 5487  H HE1  . PHE A 1 65  ? -2.368  3.384   -9.807  1.00 0.00 ? 65  PHE A HE1  3  
ATOM 5488  H HE2  . PHE A 1 65  ? 1.138   1.465   -8.358  1.00 0.00 ? 65  PHE A HE2  3  
ATOM 5489  H HZ   . PHE A 1 65  ? -0.094  3.526   -8.883  1.00 0.00 ? 65  PHE A HZ   3  
ATOM 5490  N N    . PRO A 1 66  ? -0.562  -2.478  -12.139 1.00 0.00 ? 66  PRO A N    3  
ATOM 5491  C CA   . PRO A 1 66  ? 0.697   -2.463  -12.879 1.00 0.00 ? 66  PRO A CA   3  
ATOM 5492  C C    . PRO A 1 66  ? 0.479   -2.054  -14.332 1.00 0.00 ? 66  PRO A C    3  
ATOM 5493  O O    . PRO A 1 66  ? 1.041   -1.086  -14.794 1.00 0.00 ? 66  PRO A O    3  
ATOM 5494  C CB   . PRO A 1 66  ? 1.220   -3.912  -12.813 1.00 0.00 ? 66  PRO A CB   3  
ATOM 5495  C CG   . PRO A 1 66  ? 0.202   -4.733  -11.966 1.00 0.00 ? 66  PRO A CG   3  
ATOM 5496  C CD   . PRO A 1 66  ? -0.901  -3.760  -11.509 1.00 0.00 ? 66  PRO A CD   3  
ATOM 5497  H HA   . PRO A 1 66  ? 1.389   -1.771  -12.406 1.00 0.00 ? 66  PRO A HA   3  
ATOM 5498  H HB2  . PRO A 1 66  ? 1.290   -4.326  -13.810 1.00 0.00 ? 66  PRO A HB2  3  
ATOM 5499  H HB3  . PRO A 1 66  ? 2.192   -3.932  -12.345 1.00 0.00 ? 66  PRO A HB3  3  
ATOM 5500  H HG2  . PRO A 1 66  ? -0.226  -5.523  -12.565 1.00 0.00 ? 66  PRO A HG2  3  
ATOM 5501  H HG3  . PRO A 1 66  ? 0.697   -5.159  -11.107 1.00 0.00 ? 66  PRO A HG3  3  
ATOM 5502  H HD2  . PRO A 1 66  ? -1.848  -4.095  -11.843 1.00 0.00 ? 66  PRO A HD2  3  
ATOM 5503  H HD3  . PRO A 1 66  ? -0.891  -3.673  -10.444 1.00 0.00 ? 66  PRO A HD3  3  
ATOM 5504  N N    . GLU A 1 67  ? -0.328  -2.796  -15.027 1.00 0.00 ? 67  GLU A N    3  
ATOM 5505  C CA   . GLU A 1 67  ? -0.581  -2.449  -16.446 1.00 0.00 ? 67  GLU A CA   3  
ATOM 5506  C C    . GLU A 1 67  ? -1.021  -0.993  -16.567 1.00 0.00 ? 67  GLU A C    3  
ATOM 5507  O O    . GLU A 1 67  ? -0.593  -0.287  -17.459 1.00 0.00 ? 67  GLU A O    3  
ATOM 5508  C CB   . GLU A 1 67  ? -1.694  -3.360  -16.981 1.00 0.00 ? 67  GLU A CB   3  
ATOM 5509  C CG   . GLU A 1 67  ? -1.093  -4.719  -17.348 1.00 0.00 ? 67  GLU A CG   3  
ATOM 5510  C CD   . GLU A 1 67  ? -2.014  -5.426  -18.344 1.00 0.00 ? 67  GLU A CD   3  
ATOM 5511  O OE1  . GLU A 1 67  ? -3.210  -5.242  -18.199 1.00 0.00 ? 67  GLU A OE1  3  
ATOM 5512  O OE2  . GLU A 1 67  ? -1.467  -6.109  -19.195 1.00 0.00 ? 67  GLU A OE2  3  
ATOM 5513  H H    . GLU A 1 67  ? -0.761  -3.572  -14.619 1.00 0.00 ? 67  GLU A H    3  
ATOM 5514  H HA   . GLU A 1 67  ? 0.343   -2.586  -17.016 1.00 0.00 ? 67  GLU A HA   3  
ATOM 5515  H HB2  . GLU A 1 67  ? -2.449  -3.492  -16.222 1.00 0.00 ? 67  GLU A HB2  3  
ATOM 5516  H HB3  . GLU A 1 67  ? -2.143  -2.912  -17.855 1.00 0.00 ? 67  GLU A HB3  3  
ATOM 5517  H HG2  . GLU A 1 67  ? -0.121  -4.580  -17.798 1.00 0.00 ? 67  GLU A HG2  3  
ATOM 5518  H HG3  . GLU A 1 67  ? -0.992  -5.327  -16.461 1.00 0.00 ? 67  GLU A HG3  3  
ATOM 5519  N N    . PHE A 1 68  ? -1.872  -0.563  -15.666 1.00 0.00 ? 68  PHE A N    3  
ATOM 5520  C CA   . PHE A 1 68  ? -2.336  0.845   -15.730 1.00 0.00 ? 68  PHE A CA   3  
ATOM 5521  C C    . PHE A 1 68  ? -1.122  1.780   -15.778 1.00 0.00 ? 68  PHE A C    3  
ATOM 5522  O O    . PHE A 1 68  ? -1.161  2.815   -16.411 1.00 0.00 ? 68  PHE A O    3  
ATOM 5523  C CB   . PHE A 1 68  ? -3.184  1.139   -14.471 1.00 0.00 ? 68  PHE A CB   3  
ATOM 5524  C CG   . PHE A 1 68  ? -3.668  2.595   -14.471 1.00 0.00 ? 68  PHE A CG   3  
ATOM 5525  C CD1  . PHE A 1 68  ? -4.780  2.975   -15.209 1.00 0.00 ? 68  PHE A CD1  3  
ATOM 5526  C CD2  . PHE A 1 68  ? -3.023  3.544   -13.694 1.00 0.00 ? 68  PHE A CD2  3  
ATOM 5527  C CE1  . PHE A 1 68  ? -5.234  4.281   -15.165 1.00 0.00 ? 68  PHE A CE1  3  
ATOM 5528  C CE2  . PHE A 1 68  ? -3.481  4.846   -13.653 1.00 0.00 ? 68  PHE A CE2  3  
ATOM 5529  C CZ   . PHE A 1 68  ? -4.583  5.215   -14.386 1.00 0.00 ? 68  PHE A CZ   3  
ATOM 5530  H H    . PHE A 1 68  ? -2.197  -1.162  -14.961 1.00 0.00 ? 68  PHE A H    3  
ATOM 5531  H HA   . PHE A 1 68  ? -2.928  0.978   -16.644 1.00 0.00 ? 68  PHE A HA   3  
ATOM 5532  H HB2  . PHE A 1 68  ? -4.043  0.482   -14.452 1.00 0.00 ? 68  PHE A HB2  3  
ATOM 5533  H HB3  . PHE A 1 68  ? -2.597  0.970   -13.592 1.00 0.00 ? 68  PHE A HB3  3  
ATOM 5534  H HD1  . PHE A 1 68  ? -5.297  2.247   -15.818 1.00 0.00 ? 68  PHE A HD1  3  
ATOM 5535  H HD2  . PHE A 1 68  ? -2.161  3.261   -13.112 1.00 0.00 ? 68  PHE A HD2  3  
ATOM 5536  H HE1  . PHE A 1 68  ? -6.098  4.571   -15.743 1.00 0.00 ? 68  PHE A HE1  3  
ATOM 5537  H HE2  . PHE A 1 68  ? -2.970  5.577   -13.043 1.00 0.00 ? 68  PHE A HE2  3  
ATOM 5538  H HZ   . PHE A 1 68  ? -4.945  6.236   -14.343 1.00 0.00 ? 68  PHE A HZ   3  
ATOM 5539  N N    . LEU A 1 69  ? -0.054  1.393   -15.096 1.00 0.00 ? 69  LEU A N    3  
ATOM 5540  C CA   . LEU A 1 69  ? 1.164   2.259   -15.108 1.00 0.00 ? 69  LEU A CA   3  
ATOM 5541  C C    . LEU A 1 69  ? 1.752   2.268   -16.504 1.00 0.00 ? 69  LEU A C    3  
ATOM 5542  O O    . LEU A 1 69  ? 2.016   3.307   -17.072 1.00 0.00 ? 69  LEU A O    3  
ATOM 5543  C CB   . LEU A 1 69  ? 2.238   1.672   -14.159 1.00 0.00 ? 69  LEU A CB   3  
ATOM 5544  C CG   . LEU A 1 69  ? 1.697   1.569   -12.738 1.00 0.00 ? 69  LEU A CG   3  
ATOM 5545  C CD1  . LEU A 1 69  ? 2.869   1.388   -11.772 1.00 0.00 ? 69  LEU A CD1  3  
ATOM 5546  C CD2  . LEU A 1 69  ? 0.952   2.848   -12.383 1.00 0.00 ? 69  LEU A CD2  3  
ATOM 5547  H H    . LEU A 1 69  ? -0.064  0.553   -14.588 1.00 0.00 ? 69  LEU A H    3  
ATOM 5548  H HA   . LEU A 1 69  ? 0.892   3.274   -14.822 1.00 0.00 ? 69  LEU A HA   3  
ATOM 5549  H HB2  . LEU A 1 69  ? 2.529   0.695   -14.507 1.00 0.00 ? 69  LEU A HB2  3  
ATOM 5550  H HB3  . LEU A 1 69  ? 3.106   2.314   -14.165 1.00 0.00 ? 69  LEU A HB3  3  
ATOM 5551  H HG   . LEU A 1 69  ? 1.037   0.730   -12.663 1.00 0.00 ? 69  LEU A HG   3  
ATOM 5552  H HD11 . LEU A 1 69  ? 3.602   2.163   -11.939 1.00 0.00 ? 69  LEU A HD11 3  
ATOM 5553  H HD12 . LEU A 1 69  ? 2.515   1.446   -10.753 1.00 0.00 ? 69  LEU A HD12 3  
ATOM 5554  H HD13 . LEU A 1 69  ? 3.328   0.423   -11.934 1.00 0.00 ? 69  LEU A HD13 3  
ATOM 5555  H HD21 . LEU A 1 69  ? 1.520   3.703   -12.714 1.00 0.00 ? 69  LEU A HD21 3  
ATOM 5556  H HD22 . LEU A 1 69  ? -0.013  2.853   -12.864 1.00 0.00 ? 69  LEU A HD22 3  
ATOM 5557  H HD23 . LEU A 1 69  ? 0.817   2.904   -11.313 1.00 0.00 ? 69  LEU A HD23 3  
ATOM 5558  N N    . THR A 1 70  ? 1.953   1.090   -17.029 1.00 0.00 ? 70  THR A N    3  
ATOM 5559  C CA   . THR A 1 70  ? 2.522   0.973   -18.385 1.00 0.00 ? 70  THR A CA   3  
ATOM 5560  C C    . THR A 1 70  ? 1.730   1.814   -19.372 1.00 0.00 ? 70  THR A C    3  
ATOM 5561  O O    . THR A 1 70  ? 2.295   2.511   -20.195 1.00 0.00 ? 70  THR A O    3  
ATOM 5562  C CB   . THR A 1 70  ? 2.443   -0.495  -18.800 1.00 0.00 ? 70  THR A CB   3  
ATOM 5563  O OG1  . THR A 1 70  ? 3.301   -1.181  -17.912 1.00 0.00 ? 70  THR A OG1  3  
ATOM 5564  C CG2  . THR A 1 70  ? 3.068   -0.713  -20.183 1.00 0.00 ? 70  THR A CG2  3  
ATOM 5565  H H    . THR A 1 70  ? 1.724   0.282   -16.522 1.00 0.00 ? 70  THR A H    3  
ATOM 5566  H HA   . THR A 1 70  ? 3.549   1.317   -18.369 1.00 0.00 ? 70  THR A HA   3  
ATOM 5567  H HB   . THR A 1 70  ? 1.432   -0.878  -18.731 1.00 0.00 ? 70  THR A HB   3  
ATOM 5568  H HG1  . THR A 1 70  ? 4.206   -0.957  -18.140 1.00 0.00 ? 70  THR A HG1  3  
ATOM 5569  H HG21 . THR A 1 70  ? 3.942   -0.089  -20.290 1.00 0.00 ? 70  THR A HG21 3  
ATOM 5570  H HG22 . THR A 1 70  ? 3.354   -1.749  -20.294 1.00 0.00 ? 70  THR A HG22 3  
ATOM 5571  H HG23 . THR A 1 70  ? 2.353   -0.459  -20.950 1.00 0.00 ? 70  THR A HG23 3  
ATOM 5572  N N    . MET A 1 71  ? 0.434   1.737   -19.276 1.00 0.00 ? 71  MET A N    3  
ATOM 5573  C CA   . MET A 1 71  ? -0.405  2.526   -20.203 1.00 0.00 ? 71  MET A CA   3  
ATOM 5574  C C    . MET A 1 71  ? -0.240  4.010   -19.925 1.00 0.00 ? 71  MET A C    3  
ATOM 5575  O O    . MET A 1 71  ? -0.274  4.821   -20.829 1.00 0.00 ? 71  MET A O    3  
ATOM 5576  C CB   . MET A 1 71  ? -1.873  2.132   -19.988 1.00 0.00 ? 71  MET A CB   3  
ATOM 5577  C CG   . MET A 1 71  ? -2.060  0.673   -20.410 1.00 0.00 ? 71  MET A CG   3  
ATOM 5578  S SD   . MET A 1 71  ? -3.376  -0.264  -19.598 1.00 0.00 ? 71  MET A SD   3  
ATOM 5579  C CE   . MET A 1 71  ? -4.750  0.384   -20.577 1.00 0.00 ? 71  MET A CE   3  
ATOM 5580  H H    . MET A 1 71  ? 0.020   1.166   -18.595 1.00 0.00 ? 71  MET A H    3  
ATOM 5581  H HA   . MET A 1 71  ? -0.092  2.321   -21.227 1.00 0.00 ? 71  MET A HA   3  
ATOM 5582  H HB2  . MET A 1 71  ? -2.131  2.246   -18.945 1.00 0.00 ? 71  MET A HB2  3  
ATOM 5583  H HB3  . MET A 1 71  ? -2.511  2.767   -20.584 1.00 0.00 ? 71  MET A HB3  3  
ATOM 5584  H HG2  . MET A 1 71  ? -2.252  0.653   -21.472 1.00 0.00 ? 71  MET A HG2  3  
ATOM 5585  H HG3  . MET A 1 71  ? -1.132  0.151   -20.235 1.00 0.00 ? 71  MET A HG3  3  
ATOM 5586  H HE1  . MET A 1 71  ? -4.520  1.390   -20.901 1.00 0.00 ? 71  MET A HE1  3  
ATOM 5587  H HE2  . MET A 1 71  ? -4.905  -0.245  -21.441 1.00 0.00 ? 71  MET A HE2  3  
ATOM 5588  H HE3  . MET A 1 71  ? -5.645  0.396   -19.976 1.00 0.00 ? 71  MET A HE3  3  
ATOM 5589  N N    . MET A 1 72  ? -0.061  4.343   -18.674 1.00 0.00 ? 72  MET A N    3  
ATOM 5590  C CA   . MET A 1 72  ? 0.108   5.771   -18.326 1.00 0.00 ? 72  MET A CA   3  
ATOM 5591  C C    . MET A 1 72  ? 1.421   6.288   -18.888 1.00 0.00 ? 72  MET A C    3  
ATOM 5592  O O    . MET A 1 72  ? 1.484   7.378   -19.417 1.00 0.00 ? 72  MET A O    3  
ATOM 5593  C CB   . MET A 1 72  ? 0.132   5.908   -16.794 1.00 0.00 ? 72  MET A CB   3  
ATOM 5594  C CG   . MET A 1 72  ? -1.298  6.085   -16.278 1.00 0.00 ? 72  MET A CG   3  
ATOM 5595  S SD   . MET A 1 72  ? -2.345  7.297   -17.123 1.00 0.00 ? 72  MET A SD   3  
ATOM 5596  C CE   . MET A 1 72  ? -1.615  8.774   -16.382 1.00 0.00 ? 72  MET A CE   3  
ATOM 5597  H H    . MET A 1 72  ? -0.040  3.657   -17.977 1.00 0.00 ? 72  MET A H    3  
ATOM 5598  H HA   . MET A 1 72  ? -0.710  6.342   -18.759 1.00 0.00 ? 72  MET A HA   3  
ATOM 5599  H HB2  . MET A 1 72  ? 0.567   5.023   -16.357 1.00 0.00 ? 72  MET A HB2  3  
ATOM 5600  H HB3  . MET A 1 72  ? 0.726   6.767   -16.516 1.00 0.00 ? 72  MET A HB3  3  
ATOM 5601  H HG2  . MET A 1 72  ? -1.795  5.129   -16.333 1.00 0.00 ? 72  MET A HG2  3  
ATOM 5602  H HG3  . MET A 1 72  ? -1.246  6.367   -15.236 1.00 0.00 ? 72  MET A HG3  3  
ATOM 5603  H HE1  . MET A 1 72  ? -1.445  8.599   -15.333 1.00 0.00 ? 72  MET A HE1  3  
ATOM 5604  H HE2  . MET A 1 72  ? -0.676  8.994   -16.867 1.00 0.00 ? 72  MET A HE2  3  
ATOM 5605  H HE3  . MET A 1 72  ? -2.288  9.608   -16.504 1.00 0.00 ? 72  MET A HE3  3  
ATOM 5606  N N    . ALA A 1 73  ? 2.452   5.491   -18.766 1.00 0.00 ? 73  ALA A N    3  
ATOM 5607  C CA   . ALA A 1 73  ? 3.763   5.926   -19.290 1.00 0.00 ? 73  ALA A CA   3  
ATOM 5608  C C    . ALA A 1 73  ? 3.632   6.292   -20.756 1.00 0.00 ? 73  ALA A C    3  
ATOM 5609  O O    . ALA A 1 73  ? 4.143   7.304   -21.196 1.00 0.00 ? 73  ALA A O    3  
ATOM 5610  C CB   . ALA A 1 73  ? 4.758   4.763   -19.150 1.00 0.00 ? 73  ALA A CB   3  
ATOM 5611  H H    . ALA A 1 73  ? 2.356   4.618   -18.335 1.00 0.00 ? 73  ALA A H    3  
ATOM 5612  H HA   . ALA A 1 73  ? 4.100   6.799   -18.733 1.00 0.00 ? 73  ALA A HA   3  
ATOM 5613  H HB1  . ALA A 1 73  ? 4.313   3.856   -19.531 1.00 0.00 ? 73  ALA A HB1  3  
ATOM 5614  H HB2  . ALA A 1 73  ? 5.656   4.982   -19.708 1.00 0.00 ? 73  ALA A HB2  3  
ATOM 5615  H HB3  . ALA A 1 73  ? 5.011   4.625   -18.109 1.00 0.00 ? 73  ALA A HB3  3  
ATOM 5616  N N    . ARG A 1 74  ? 2.945   5.459   -21.495 1.00 0.00 ? 74  ARG A N    3  
ATOM 5617  C CA   . ARG A 1 74  ? 2.771   5.750   -22.933 1.00 0.00 ? 74  ARG A CA   3  
ATOM 5618  C C    . ARG A 1 74  ? 2.090   7.090   -23.095 1.00 0.00 ? 74  ARG A C    3  
ATOM 5619  O O    . ARG A 1 74  ? 2.566   7.953   -23.801 1.00 0.00 ? 74  ARG A O    3  
ATOM 5620  C CB   . ARG A 1 74  ? 1.882   4.658   -23.550 1.00 0.00 ? 74  ARG A CB   3  
ATOM 5621  C CG   . ARG A 1 74  ? 2.278   4.455   -25.012 1.00 0.00 ? 74  ARG A CG   3  
ATOM 5622  C CD   . ARG A 1 74  ? 1.539   3.235   -25.568 1.00 0.00 ? 74  ARG A CD   3  
ATOM 5623  N NE   . ARG A 1 74  ? 1.292   3.441   -27.023 1.00 0.00 ? 74  ARG A NE   3  
ATOM 5624  C CZ   . ARG A 1 74  ? 0.081   3.302   -27.492 1.00 0.00 ? 74  ARG A CZ   3  
ATOM 5625  N NH1  . ARG A 1 74  ? -0.932  3.579   -26.717 1.00 0.00 ? 74  ARG A NH1  3  
ATOM 5626  N NH2  . ARG A 1 74  ? -0.076  2.892   -28.721 1.00 0.00 ? 74  ARG A NH2  3  
ATOM 5627  H H    . ARG A 1 74  ? 2.548   4.652   -21.098 1.00 0.00 ? 74  ARG A H    3  
ATOM 5628  H HA   . ARG A 1 74  ? 3.745   5.783   -23.413 1.00 0.00 ? 74  ARG A HA   3  
ATOM 5629  H HB2  . ARG A 1 74  ? 2.013   3.734   -23.006 1.00 0.00 ? 74  ARG A HB2  3  
ATOM 5630  H HB3  . ARG A 1 74  ? 0.845   4.960   -23.492 1.00 0.00 ? 74  ARG A HB3  3  
ATOM 5631  H HG2  . ARG A 1 74  ? 2.012   5.332   -25.586 1.00 0.00 ? 74  ARG A HG2  3  
ATOM 5632  H HG3  . ARG A 1 74  ? 3.343   4.296   -25.082 1.00 0.00 ? 74  ARG A HG3  3  
ATOM 5633  H HD2  . ARG A 1 74  ? 2.139   2.348   -25.428 1.00 0.00 ? 74  ARG A HD2  3  
ATOM 5634  H HD3  . ARG A 1 74  ? 0.595   3.115   -25.058 1.00 0.00 ? 74  ARG A HD3  3  
ATOM 5635  H HE   . ARG A 1 74  ? 2.029   3.676   -27.622 1.00 0.00 ? 74  ARG A HE   3  
ATOM 5636  H HH11 . ARG A 1 74  ? -0.772  3.890   -25.779 1.00 0.00 ? 74  ARG A HH11 3  
ATOM 5637  H HH12 . ARG A 1 74  ? -1.865  3.480   -27.059 1.00 0.00 ? 74  ARG A HH12 3  
ATOM 5638  H HH21 . ARG A 1 74  ? 0.724   2.688   -29.287 1.00 0.00 ? 74  ARG A HH21 3  
ATOM 5639  H HH22 . ARG A 1 74  ? -0.996  2.781   -29.097 1.00 0.00 ? 74  ARG A HH22 3  
ATOM 5640  N N    . LYS A 1 75  ? 0.979   7.239   -22.433 1.00 0.00 ? 75  LYS A N    3  
ATOM 5641  C CA   . LYS A 1 75  ? 0.247   8.515   -22.527 1.00 0.00 ? 75  LYS A CA   3  
ATOM 5642  C C    . LYS A 1 75  ? 1.139   9.643   -22.044 1.00 0.00 ? 75  LYS A C    3  
ATOM 5643  O O    . LYS A 1 75  ? 0.980   10.783  -22.434 1.00 0.00 ? 75  LYS A O    3  
ATOM 5644  C CB   . LYS A 1 75  ? -0.991  8.432   -21.617 1.00 0.00 ? 75  LYS A CB   3  
ATOM 5645  C CG   . LYS A 1 75  ? -1.799  9.726   -21.745 1.00 0.00 ? 75  LYS A CG   3  
ATOM 5646  C CD   . LYS A 1 75  ? -3.240  9.384   -22.131 1.00 0.00 ? 75  LYS A CD   3  
ATOM 5647  C CE   . LYS A 1 75  ? -4.134  10.600  -21.874 1.00 0.00 ? 75  LYS A CE   3  
ATOM 5648  N NZ   . LYS A 1 75  ? -5.131  10.302  -20.808 1.00 0.00 ? 75  LYS A NZ   3  
ATOM 5649  H H    . LYS A 1 75  ? 0.634   6.510   -21.878 1.00 0.00 ? 75  LYS A H    3  
ATOM 5650  H HA   . LYS A 1 75  ? -0.036  8.694   -23.564 1.00 0.00 ? 75  LYS A HA   3  
ATOM 5651  H HB2  . LYS A 1 75  ? -1.601  7.590   -21.911 1.00 0.00 ? 75  LYS A HB2  3  
ATOM 5652  H HB3  . LYS A 1 75  ? -0.678  8.300   -20.592 1.00 0.00 ? 75  LYS A HB3  3  
ATOM 5653  H HG2  . LYS A 1 75  ? -1.792  10.253  -20.802 1.00 0.00 ? 75  LYS A HG2  3  
ATOM 5654  H HG3  . LYS A 1 75  ? -1.360  10.356  -22.504 1.00 0.00 ? 75  LYS A HG3  3  
ATOM 5655  H HD2  . LYS A 1 75  ? -3.282  9.117   -23.177 1.00 0.00 ? 75  LYS A HD2  3  
ATOM 5656  H HD3  . LYS A 1 75  ? -3.586  8.549   -21.539 1.00 0.00 ? 75  LYS A HD3  3  
ATOM 5657  H HE2  . LYS A 1 75  ? -3.526  11.439  -21.565 1.00 0.00 ? 75  LYS A HE2  3  
ATOM 5658  H HE3  . LYS A 1 75  ? -4.657  10.861  -22.782 1.00 0.00 ? 75  LYS A HE3  3  
ATOM 5659  H HZ1  . LYS A 1 75  ? -5.711  9.487   -21.094 1.00 0.00 ? 75  LYS A HZ1  3  
ATOM 5660  H HZ2  . LYS A 1 75  ? -4.634  10.078  -19.922 1.00 0.00 ? 75  LYS A HZ2  3  
ATOM 5661  H HZ3  . LYS A 1 75  ? -5.743  11.129  -20.663 1.00 0.00 ? 75  LYS A HZ3  3  
ATOM 5662  N N    . MET A 1 76  ? 2.071   9.290   -21.197 1.00 0.00 ? 76  MET A N    3  
ATOM 5663  C CA   . MET A 1 76  ? 3.002   10.300  -20.656 1.00 0.00 ? 76  MET A CA   3  
ATOM 5664  C C    . MET A 1 76  ? 4.333   10.248  -21.404 1.00 0.00 ? 76  MET A C    3  
ATOM 5665  O O    . MET A 1 76  ? 5.342   10.696  -20.904 1.00 0.00 ? 76  MET A O    3  
ATOM 5666  C CB   . MET A 1 76  ? 3.245   9.981   -19.170 1.00 0.00 ? 76  MET A CB   3  
ATOM 5667  C CG   . MET A 1 76  ? 2.149   10.640  -18.329 1.00 0.00 ? 76  MET A CG   3  
ATOM 5668  S SD   . MET A 1 76  ? 2.250   10.448  -16.533 1.00 0.00 ? 76  MET A SD   3  
ATOM 5669  C CE   . MET A 1 76  ? 3.202   8.907   -16.519 1.00 0.00 ? 76  MET A CE   3  
ATOM 5670  H H    . MET A 1 76  ? 2.152   8.356   -20.920 1.00 0.00 ? 76  MET A H    3  
ATOM 5671  H HA   . MET A 1 76  ? 2.564   11.287  -20.775 1.00 0.00 ? 76  MET A HA   3  
ATOM 5672  H HB2  . MET A 1 76  ? 3.222   8.914   -19.020 1.00 0.00 ? 76  MET A HB2  3  
ATOM 5673  H HB3  . MET A 1 76  ? 4.208   10.360  -18.868 1.00 0.00 ? 76  MET A HB3  3  
ATOM 5674  H HG2  . MET A 1 76  ? 2.153   11.698  -18.545 1.00 0.00 ? 76  MET A HG2  3  
ATOM 5675  H HG3  . MET A 1 76  ? 1.196   10.245  -18.648 1.00 0.00 ? 76  MET A HG3  3  
ATOM 5676  H HE1  . MET A 1 76  ? 2.653   8.140   -17.044 1.00 0.00 ? 76  MET A HE1  3  
ATOM 5677  H HE2  . MET A 1 76  ? 4.154   9.067   -17.006 1.00 0.00 ? 76  MET A HE2  3  
ATOM 5678  H HE3  . MET A 1 76  ? 3.367   8.597   -15.499 1.00 0.00 ? 76  MET A HE3  3  
ATOM 5679  N N    . LYS A 1 77  ? 4.300   9.679   -22.590 1.00 0.00 ? 77  LYS A N    3  
ATOM 5680  C CA   . LYS A 1 77  ? 5.526   9.573   -23.404 1.00 0.00 ? 77  LYS A CA   3  
ATOM 5681  C C    . LYS A 1 77  ? 6.546   8.683   -22.724 1.00 0.00 ? 77  LYS A C    3  
ATOM 5682  O O    . LYS A 1 77  ? 7.194   9.089   -21.782 1.00 0.00 ? 77  LYS A O    3  
ATOM 5683  C CB   . LYS A 1 77  ? 6.108   10.972  -23.607 1.00 0.00 ? 77  LYS A CB   3  
ATOM 5684  C CG   . LYS A 1 77  ? 4.966   11.944  -23.912 1.00 0.00 ? 77  LYS A CG   3  
ATOM 5685  C CD   . LYS A 1 77  ? 4.064   11.330  -24.987 1.00 0.00 ? 77  LYS A CD   3  
ATOM 5686  C CE   . LYS A 1 77  ? 3.128   12.408  -25.539 1.00 0.00 ? 77  LYS A CE   3  
ATOM 5687  N NZ   . LYS A 1 77  ? 3.910   13.585  -26.013 1.00 0.00 ? 77  LYS A NZ   3  
ATOM 5688  H H    . LYS A 1 77  ? 3.476   9.312   -22.927 1.00 0.00 ? 77  LYS A H    3  
ATOM 5689  H HA   . LYS A 1 77  ? 5.265   9.127   -24.364 1.00 0.00 ? 77  LYS A HA   3  
ATOM 5690  H HB2  . LYS A 1 77  ? 6.628   11.285  -22.722 1.00 0.00 ? 77  LYS A HB2  3  
ATOM 5691  H HB3  . LYS A 1 77  ? 6.794   10.955  -24.435 1.00 0.00 ? 77  LYS A HB3  3  
ATOM 5692  H HG2  . LYS A 1 77  ? 4.393   12.124  -23.015 1.00 0.00 ? 77  LYS A HG2  3  
ATOM 5693  H HG3  . LYS A 1 77  ? 5.369   12.881  -24.268 1.00 0.00 ? 77  LYS A HG3  3  
ATOM 5694  H HD2  . LYS A 1 77  ? 4.671   10.934  -25.787 1.00 0.00 ? 77  LYS A HD2  3  
ATOM 5695  H HD3  . LYS A 1 77  ? 3.480   10.530  -24.557 1.00 0.00 ? 77  LYS A HD3  3  
ATOM 5696  H HE2  . LYS A 1 77  ? 2.562   12.005  -26.367 1.00 0.00 ? 77  LYS A HE2  3  
ATOM 5697  H HE3  . LYS A 1 77  ? 2.444   12.726  -24.767 1.00 0.00 ? 77  LYS A HE3  3  
ATOM 5698  H HZ1  . LYS A 1 77  ? 4.913   13.323  -26.097 1.00 0.00 ? 77  LYS A HZ1  3  
ATOM 5699  H HZ2  . LYS A 1 77  ? 3.551   13.889  -26.940 1.00 0.00 ? 77  LYS A HZ2  3  
ATOM 5700  H HZ3  . LYS A 1 77  ? 3.811   14.363  -25.330 1.00 0.00 ? 77  LYS A HZ3  3  
ATOM 5701  N N    . ASP A 1 78  ? 6.645   7.471   -23.243 1.00 0.00 ? 78  ASP A N    3  
ATOM 5702  C CA   . ASP A 1 78  ? 7.600   6.445   -22.705 1.00 0.00 ? 78  ASP A CA   3  
ATOM 5703  C C    . ASP A 1 78  ? 8.467   6.959   -21.559 1.00 0.00 ? 78  ASP A C    3  
ATOM 5704  O O    . ASP A 1 78  ? 9.345   7.775   -21.755 1.00 0.00 ? 78  ASP A O    3  
ATOM 5705  C CB   . ASP A 1 78  ? 8.523   6.007   -23.853 1.00 0.00 ? 78  ASP A CB   3  
ATOM 5706  C CG   . ASP A 1 78  ? 9.363   7.202   -24.309 1.00 0.00 ? 78  ASP A CG   3  
ATOM 5707  O OD1  . ASP A 1 78  ? 8.808   8.007   -25.039 1.00 0.00 ? 78  ASP A OD1  3  
ATOM 5708  O OD2  . ASP A 1 78  ? 10.513  7.242   -23.903 1.00 0.00 ? 78  ASP A OD2  3  
ATOM 5709  H H    . ASP A 1 78  ? 6.075   7.235   -24.005 1.00 0.00 ? 78  ASP A H    3  
ATOM 5710  H HA   . ASP A 1 78  ? 7.019   5.601   -22.346 1.00 0.00 ? 78  ASP A HA   3  
ATOM 5711  H HB2  . ASP A 1 78  ? 9.179   5.219   -23.514 1.00 0.00 ? 78  ASP A HB2  3  
ATOM 5712  H HB3  . ASP A 1 78  ? 7.932   5.649   -24.683 1.00 0.00 ? 78  ASP A HB3  3  
ATOM 5713  N N    . THR A 1 79  ? 8.205   6.461   -20.382 1.00 0.00 ? 79  THR A N    3  
ATOM 5714  C CA   . THR A 1 79  ? 8.997   6.900   -19.211 1.00 0.00 ? 79  THR A CA   3  
ATOM 5715  C C    . THR A 1 79  ? 10.280  6.081   -19.108 1.00 0.00 ? 79  THR A C    3  
ATOM 5716  O O    . THR A 1 79  ? 10.764  5.561   -20.094 1.00 0.00 ? 79  THR A O    3  
ATOM 5717  C CB   . THR A 1 79  ? 8.157   6.670   -17.948 1.00 0.00 ? 79  THR A CB   3  
ATOM 5718  O OG1  . THR A 1 79  ? 8.886   7.270   -16.897 1.00 0.00 ? 79  THR A OG1  3  
ATOM 5719  C CG2  . THR A 1 79  ? 8.112   5.177   -17.585 1.00 0.00 ? 79  THR A CG2  3  
ATOM 5720  H H    . THR A 1 79  ? 7.490   5.802   -20.273 1.00 0.00 ? 79  THR A H    3  
ATOM 5721  H HA   . THR A 1 79  ? 9.250   7.951   -19.326 1.00 0.00 ? 79  THR A HA   3  
ATOM 5722  H HB   . THR A 1 79  ? 7.167   7.113   -18.036 1.00 0.00 ? 79  THR A HB   3  
ATOM 5723  H HG1  . THR A 1 79  ? 9.337   8.040   -17.252 1.00 0.00 ? 79  THR A HG1  3  
ATOM 5724  H HG21 . THR A 1 79  ? 8.013   4.587   -18.483 1.00 0.00 ? 79  THR A HG21 3  
ATOM 5725  H HG22 . THR A 1 79  ? 9.020   4.898   -17.073 1.00 0.00 ? 79  THR A HG22 3  
ATOM 5726  H HG23 . THR A 1 79  ? 7.267   4.984   -16.939 1.00 0.00 ? 79  THR A HG23 3  
ATOM 5727  N N    . ASP A 1 80  ? 10.810  5.980   -17.922 1.00 0.00 ? 80  ASP A N    3  
ATOM 5728  C CA   . ASP A 1 80  ? 12.056  5.197   -17.750 1.00 0.00 ? 80  ASP A CA   3  
ATOM 5729  C C    . ASP A 1 80  ? 11.745  3.703   -17.701 1.00 0.00 ? 80  ASP A C    3  
ATOM 5730  O O    . ASP A 1 80  ? 11.618  3.125   -16.639 1.00 0.00 ? 80  ASP A O    3  
ATOM 5731  C CB   . ASP A 1 80  ? 12.717  5.618   -16.426 1.00 0.00 ? 80  ASP A CB   3  
ATOM 5732  C CG   . ASP A 1 80  ? 14.181  5.177   -16.429 1.00 0.00 ? 80  ASP A CG   3  
ATOM 5733  O OD1  . ASP A 1 80  ? 14.978  5.953   -16.929 1.00 0.00 ? 80  ASP A OD1  3  
ATOM 5734  O OD2  . ASP A 1 80  ? 14.419  4.091   -15.928 1.00 0.00 ? 80  ASP A OD2  3  
ATOM 5735  H H    . ASP A 1 80  ? 10.391  6.415   -17.153 1.00 0.00 ? 80  ASP A H    3  
ATOM 5736  H HA   . ASP A 1 80  ? 12.716  5.394   -18.594 1.00 0.00 ? 80  ASP A HA   3  
ATOM 5737  H HB2  . ASP A 1 80  ? 12.667  6.692   -16.320 1.00 0.00 ? 80  ASP A HB2  3  
ATOM 5738  H HB3  . ASP A 1 80  ? 12.204  5.155   -15.597 1.00 0.00 ? 80  ASP A HB3  3  
ATOM 5739  N N    . SER A 1 81  ? 11.627  3.106   -18.857 1.00 0.00 ? 81  SER A N    3  
ATOM 5740  C CA   . SER A 1 81  ? 11.323  1.653   -18.902 1.00 0.00 ? 81  SER A CA   3  
ATOM 5741  C C    . SER A 1 81  ? 12.510  0.822   -18.425 1.00 0.00 ? 81  SER A C    3  
ATOM 5742  O O    . SER A 1 81  ? 12.362  -0.334  -18.084 1.00 0.00 ? 81  SER A O    3  
ATOM 5743  C CB   . SER A 1 81  ? 11.009  1.271   -20.358 1.00 0.00 ? 81  SER A CB   3  
ATOM 5744  O OG   . SER A 1 81  ? 9.787   1.940   -20.636 1.00 0.00 ? 81  SER A OG   3  
ATOM 5745  H H    . SER A 1 81  ? 11.737  3.614   -19.688 1.00 0.00 ? 81  SER A H    3  
ATOM 5746  H HA   . SER A 1 81  ? 10.468  1.450   -18.259 1.00 0.00 ? 81  SER A HA   3  
ATOM 5747  H HB2  . SER A 1 81  ? 11.786  1.621   -21.021 1.00 0.00 ? 81  SER A HB2  3  
ATOM 5748  H HB3  . SER A 1 81  ? 10.882  0.204   -20.455 1.00 0.00 ? 81  SER A HB3  3  
ATOM 5749  H HG   . SER A 1 81  ? 9.592   2.521   -19.897 1.00 0.00 ? 81  SER A HG   3  
ATOM 5750  N N    . GLU A 1 82  ? 13.667  1.422   -18.409 1.00 0.00 ? 82  GLU A N    3  
ATOM 5751  C CA   . GLU A 1 82  ? 14.867  0.674   -17.956 1.00 0.00 ? 82  GLU A CA   3  
ATOM 5752  C C    . GLU A 1 82  ? 14.585  -0.074  -16.658 1.00 0.00 ? 82  GLU A C    3  
ATOM 5753  O O    . GLU A 1 82  ? 15.058  -1.175  -16.458 1.00 0.00 ? 82  GLU A O    3  
ATOM 5754  C CB   . GLU A 1 82  ? 16.001  1.682   -17.707 1.00 0.00 ? 82  GLU A CB   3  
ATOM 5755  C CG   . GLU A 1 82  ? 16.189  2.545   -18.957 1.00 0.00 ? 82  GLU A CG   3  
ATOM 5756  C CD   . GLU A 1 82  ? 17.156  3.688   -18.643 1.00 0.00 ? 82  GLU A CD   3  
ATOM 5757  O OE1  . GLU A 1 82  ? 16.802  4.472   -17.777 1.00 0.00 ? 82  GLU A OE1  3  
ATOM 5758  O OE2  . GLU A 1 82  ? 18.192  3.712   -19.285 1.00 0.00 ? 82  GLU A OE2  3  
ATOM 5759  H H    . GLU A 1 82  ? 13.745  2.355   -18.695 1.00 0.00 ? 82  GLU A H    3  
ATOM 5760  H HA   . GLU A 1 82  ? 15.150  -0.046  -18.724 1.00 0.00 ? 82  GLU A HA   3  
ATOM 5761  H HB2  . GLU A 1 82  ? 15.748  2.312   -16.867 1.00 0.00 ? 82  GLU A HB2  3  
ATOM 5762  H HB3  . GLU A 1 82  ? 16.917  1.154   -17.490 1.00 0.00 ? 82  GLU A HB3  3  
ATOM 5763  H HG2  . GLU A 1 82  ? 16.594  1.945   -19.758 1.00 0.00 ? 82  GLU A HG2  3  
ATOM 5764  H HG3  . GLU A 1 82  ? 15.238  2.956   -19.265 1.00 0.00 ? 82  GLU A HG3  3  
ATOM 5765  N N    . GLU A 1 83  ? 13.819  0.536   -15.799 1.00 0.00 ? 83  GLU A N    3  
ATOM 5766  C CA   . GLU A 1 83  ? 13.497  -0.131  -14.513 1.00 0.00 ? 83  GLU A CA   3  
ATOM 5767  C C    . GLU A 1 83  ? 12.401  -1.170  -14.704 1.00 0.00 ? 83  GLU A C    3  
ATOM 5768  O O    . GLU A 1 83  ? 12.467  -2.254  -14.158 1.00 0.00 ? 83  GLU A O    3  
ATOM 5769  C CB   . GLU A 1 83  ? 13.006  0.935   -13.522 1.00 0.00 ? 83  GLU A CB   3  
ATOM 5770  C CG   . GLU A 1 83  ? 14.112  1.969   -13.309 1.00 0.00 ? 83  GLU A CG   3  
ATOM 5771  C CD   . GLU A 1 83  ? 13.493  3.270   -12.791 1.00 0.00 ? 83  GLU A CD   3  
ATOM 5772  O OE1  . GLU A 1 83  ? 13.065  3.250   -11.649 1.00 0.00 ? 83  GLU A OE1  3  
ATOM 5773  O OE2  . GLU A 1 83  ? 13.484  4.211   -13.568 1.00 0.00 ? 83  GLU A OE2  3  
ATOM 5774  H H    . GLU A 1 83  ? 13.458  1.423   -15.999 1.00 0.00 ? 83  GLU A H    3  
ATOM 5775  H HA   . GLU A 1 83  ? 14.393  -0.628  -14.139 1.00 0.00 ? 83  GLU A HA   3  
ATOM 5776  H HB2  . GLU A 1 83  ? 12.126  1.420   -13.918 1.00 0.00 ? 83  GLU A HB2  3  
ATOM 5777  H HB3  . GLU A 1 83  ? 12.760  0.468   -12.579 1.00 0.00 ? 83  GLU A HB3  3  
ATOM 5778  H HG2  . GLU A 1 83  ? 14.824  1.601   -12.586 1.00 0.00 ? 83  GLU A HG2  3  
ATOM 5779  H HG3  . GLU A 1 83  ? 14.619  2.162   -14.243 1.00 0.00 ? 83  GLU A HG3  3  
ATOM 5780  N N    . GLU A 1 84  ? 11.410  -0.822  -15.479 1.00 0.00 ? 84  GLU A N    3  
ATOM 5781  C CA   . GLU A 1 84  ? 10.304  -1.781  -15.714 1.00 0.00 ? 84  GLU A CA   3  
ATOM 5782  C C    . GLU A 1 84  ? 10.838  -3.036  -16.382 1.00 0.00 ? 84  GLU A C    3  
ATOM 5783  O O    . GLU A 1 84  ? 10.277  -4.106  -16.248 1.00 0.00 ? 84  GLU A O    3  
ATOM 5784  C CB   . GLU A 1 84  ? 9.281   -1.119  -16.651 1.00 0.00 ? 84  GLU A CB   3  
ATOM 5785  C CG   . GLU A 1 84  ? 7.984   -1.928  -16.634 1.00 0.00 ? 84  GLU A CG   3  
ATOM 5786  C CD   . GLU A 1 84  ? 7.233   -1.704  -17.948 1.00 0.00 ? 84  GLU A CD   3  
ATOM 5787  O OE1  . GLU A 1 84  ? 6.632   -0.647  -18.054 1.00 0.00 ? 84  GLU A OE1  3  
ATOM 5788  O OE2  . GLU A 1 84  ? 7.302   -2.602  -18.771 1.00 0.00 ? 84  GLU A OE2  3  
ATOM 5789  H H    . GLU A 1 84  ? 11.398  0.061   -15.903 1.00 0.00 ? 84  GLU A H    3  
ATOM 5790  H HA   . GLU A 1 84  ? 9.850   -2.046  -14.761 1.00 0.00 ? 84  GLU A HA   3  
ATOM 5791  H HB2  . GLU A 1 84  ? 9.085   -0.110  -16.318 1.00 0.00 ? 84  GLU A HB2  3  
ATOM 5792  H HB3  . GLU A 1 84  ? 9.677   -1.088  -17.656 1.00 0.00 ? 84  GLU A HB3  3  
ATOM 5793  H HG2  . GLU A 1 84  ? 8.209   -2.979  -16.526 1.00 0.00 ? 84  GLU A HG2  3  
ATOM 5794  H HG3  . GLU A 1 84  ? 7.364   -1.609  -15.809 1.00 0.00 ? 84  GLU A HG3  3  
ATOM 5795  N N    . ILE A 1 85  ? 11.919  -2.878  -17.090 1.00 0.00 ? 85  ILE A N    3  
ATOM 5796  C CA   . ILE A 1 85  ? 12.518  -4.037  -17.779 1.00 0.00 ? 85  ILE A CA   3  
ATOM 5797  C C    . ILE A 1 85  ? 13.333  -4.884  -16.805 1.00 0.00 ? 85  ILE A C    3  
ATOM 5798  O O    . ILE A 1 85  ? 13.054  -6.056  -16.606 1.00 0.00 ? 85  ILE A O    3  
ATOM 5799  C CB   . ILE A 1 85  ? 13.443  -3.509  -18.875 1.00 0.00 ? 85  ILE A CB   3  
ATOM 5800  C CG1  . ILE A 1 85  ? 12.631  -3.167  -20.114 1.00 0.00 ? 85  ILE A CG1  3  
ATOM 5801  C CG2  . ILE A 1 85  ? 14.445  -4.607  -19.238 1.00 0.00 ? 85  ILE A CG2  3  
ATOM 5802  C CD1  . ILE A 1 85  ? 13.567  -2.595  -21.181 1.00 0.00 ? 85  ILE A CD1  3  
ATOM 5803  H H    . ILE A 1 85  ? 12.334  -1.994  -17.163 1.00 0.00 ? 85  ILE A H    3  
ATOM 5804  H HA   . ILE A 1 85  ? 11.723  -4.647  -18.203 1.00 0.00 ? 85  ILE A HA   3  
ATOM 5805  H HB   . ILE A 1 85  ? 13.954  -2.614  -18.517 1.00 0.00 ? 85  ILE A HB   3  
ATOM 5806  H HG12 . ILE A 1 85  ? 12.151  -4.058  -20.492 1.00 0.00 ? 85  ILE A HG12 3  
ATOM 5807  H HG13 . ILE A 1 85  ? 11.876  -2.437  -19.864 1.00 0.00 ? 85  ILE A HG13 3  
ATOM 5808  H HG21 . ILE A 1 85  ? 13.938  -5.558  -19.276 1.00 0.00 ? 85  ILE A HG21 3  
ATOM 5809  H HG22 . ILE A 1 85  ? 14.884  -4.399  -20.203 1.00 0.00 ? 85  ILE A HG22 3  
ATOM 5810  H HG23 . ILE A 1 85  ? 15.226  -4.648  -18.494 1.00 0.00 ? 85  ILE A HG23 3  
ATOM 5811  H HD11 . ILE A 1 85  ? 14.483  -2.256  -20.719 1.00 0.00 ? 85  ILE A HD11 3  
ATOM 5812  H HD12 . ILE A 1 85  ? 13.799  -3.359  -21.909 1.00 0.00 ? 85  ILE A HD12 3  
ATOM 5813  H HD13 . ILE A 1 85  ? 13.090  -1.764  -21.678 1.00 0.00 ? 85  ILE A HD13 3  
ATOM 5814  N N    . ARG A 1 86  ? 14.328  -4.275  -16.214 1.00 0.00 ? 86  ARG A N    3  
ATOM 5815  C CA   . ARG A 1 86  ? 15.173  -5.022  -15.252 1.00 0.00 ? 86  ARG A CA   3  
ATOM 5816  C C    . ARG A 1 86  ? 14.312  -5.875  -14.331 1.00 0.00 ? 86  ARG A C    3  
ATOM 5817  O O    . ARG A 1 86  ? 14.681  -6.977  -13.975 1.00 0.00 ? 86  ARG A O    3  
ATOM 5818  C CB   . ARG A 1 86  ? 15.952  -4.004  -14.406 1.00 0.00 ? 86  ARG A CB   3  
ATOM 5819  C CG   . ARG A 1 86  ? 16.441  -4.684  -13.127 1.00 0.00 ? 86  ARG A CG   3  
ATOM 5820  C CD   . ARG A 1 86  ? 17.766  -4.048  -12.697 1.00 0.00 ? 86  ARG A CD   3  
ATOM 5821  N NE   . ARG A 1 86  ? 17.673  -2.570  -12.867 1.00 0.00 ? 86  ARG A NE   3  
ATOM 5822  C CZ   . ARG A 1 86  ? 17.113  -1.851  -11.934 1.00 0.00 ? 86  ARG A CZ   3  
ATOM 5823  N NH1  . ARG A 1 86  ? 17.299  -2.182  -10.685 1.00 0.00 ? 86  ARG A NH1  3  
ATOM 5824  N NH2  . ARG A 1 86  ? 16.387  -0.824  -12.280 1.00 0.00 ? 86  ARG A NH2  3  
ATOM 5825  H H    . ARG A 1 86  ? 14.512  -3.331  -16.404 1.00 0.00 ? 86  ARG A H    3  
ATOM 5826  H HA   . ARG A 1 86  ? 15.853  -5.670  -15.805 1.00 0.00 ? 86  ARG A HA   3  
ATOM 5827  H HB2  . ARG A 1 86  ? 16.797  -3.635  -14.967 1.00 0.00 ? 86  ARG A HB2  3  
ATOM 5828  H HB3  . ARG A 1 86  ? 15.307  -3.176  -14.152 1.00 0.00 ? 86  ARG A HB3  3  
ATOM 5829  H HG2  . ARG A 1 86  ? 15.708  -4.557  -12.345 1.00 0.00 ? 86  ARG A HG2  3  
ATOM 5830  H HG3  . ARG A 1 86  ? 16.586  -5.738  -13.309 1.00 0.00 ? 86  ARG A HG3  3  
ATOM 5831  H HD2  . ARG A 1 86  ? 17.964  -4.277  -11.660 1.00 0.00 ? 86  ARG A HD2  3  
ATOM 5832  H HD3  . ARG A 1 86  ? 18.571  -4.429  -13.308 1.00 0.00 ? 86  ARG A HD3  3  
ATOM 5833  H HE   . ARG A 1 86  ? 18.032  -2.142  -13.673 1.00 0.00 ? 86  ARG A HE   3  
ATOM 5834  H HH11 . ARG A 1 86  ? 17.864  -2.975  -10.458 1.00 0.00 ? 86  ARG A HH11 3  
ATOM 5835  H HH12 . ARG A 1 86  ? 16.876  -1.644  -9.956  1.00 0.00 ? 86  ARG A HH12 3  
ATOM 5836  H HH21 . ARG A 1 86  ? 16.268  -0.598  -13.248 1.00 0.00 ? 86  ARG A HH21 3  
ATOM 5837  H HH22 . ARG A 1 86  ? 15.948  -0.262  -11.579 1.00 0.00 ? 86  ARG A HH22 3  
ATOM 5838  N N    . GLU A 1 87  ? 13.176  -5.350  -13.961 1.00 0.00 ? 87  GLU A N    3  
ATOM 5839  C CA   . GLU A 1 87  ? 12.280  -6.117  -13.066 1.00 0.00 ? 87  GLU A CA   3  
ATOM 5840  C C    . GLU A 1 87  ? 11.625  -7.257  -13.824 1.00 0.00 ? 87  GLU A C    3  
ATOM 5841  O O    . GLU A 1 87  ? 11.586  -8.376  -13.353 1.00 0.00 ? 87  GLU A O    3  
ATOM 5842  C CB   . GLU A 1 87  ? 11.186  -5.173  -12.543 1.00 0.00 ? 87  GLU A CB   3  
ATOM 5843  C CG   . GLU A 1 87  ? 10.489  -5.824  -11.348 1.00 0.00 ? 87  GLU A CG   3  
ATOM 5844  C CD   . GLU A 1 87  ? 10.947  -5.136  -10.061 1.00 0.00 ? 87  GLU A CD   3  
ATOM 5845  O OE1  . GLU A 1 87  ? 12.121  -5.278  -9.761  1.00 0.00 ? 87  GLU A OE1  3  
ATOM 5846  O OE2  . GLU A 1 87  ? 10.098  -4.507  -9.451  1.00 0.00 ? 87  GLU A OE2  3  
ATOM 5847  H H    . GLU A 1 87  ? 12.917  -4.457  -14.273 1.00 0.00 ? 87  GLU A H    3  
ATOM 5848  H HA   . GLU A 1 87  ? 12.865  -6.528  -12.247 1.00 0.00 ? 87  GLU A HA   3  
ATOM 5849  H HB2  . GLU A 1 87  ? 11.630  -4.237  -12.238 1.00 0.00 ? 87  GLU A HB2  3  
ATOM 5850  H HB3  . GLU A 1 87  ? 10.466  -4.984  -13.325 1.00 0.00 ? 87  GLU A HB3  3  
ATOM 5851  H HG2  . GLU A 1 87  ? 9.418   -5.718  -11.448 1.00 0.00 ? 87  GLU A HG2  3  
ATOM 5852  H HG3  . GLU A 1 87  ? 10.741  -6.872  -11.303 1.00 0.00 ? 87  GLU A HG3  3  
ATOM 5853  N N    . ALA A 1 88  ? 11.122  -6.953  -14.989 1.00 0.00 ? 88  ALA A N    3  
ATOM 5854  C CA   . ALA A 1 88  ? 10.466  -8.008  -15.796 1.00 0.00 ? 88  ALA A CA   3  
ATOM 5855  C C    . ALA A 1 88  ? 11.296  -9.282  -15.776 1.00 0.00 ? 88  ALA A C    3  
ATOM 5856  O O    . ALA A 1 88  ? 10.769  -10.372 -15.878 1.00 0.00 ? 88  ALA A O    3  
ATOM 5857  C CB   . ALA A 1 88  ? 10.352  -7.507  -17.245 1.00 0.00 ? 88  ALA A CB   3  
ATOM 5858  H H    . ALA A 1 88  ? 11.178  -6.034  -15.325 1.00 0.00 ? 88  ALA A H    3  
ATOM 5859  H HA   . ALA A 1 88  ? 9.483   -8.220  -15.377 1.00 0.00 ? 88  ALA A HA   3  
ATOM 5860  H HB1  . ALA A 1 88  ? 10.309  -6.428  -17.254 1.00 0.00 ? 88  ALA A HB1  3  
ATOM 5861  H HB2  . ALA A 1 88  ? 11.209  -7.833  -17.812 1.00 0.00 ? 88  ALA A HB2  3  
ATOM 5862  H HB3  . ALA A 1 88  ? 9.454   -7.901  -17.696 1.00 0.00 ? 88  ALA A HB3  3  
ATOM 5863  N N    . PHE A 1 89  ? 12.585  -9.121  -15.646 1.00 0.00 ? 89  PHE A N    3  
ATOM 5864  C CA   . PHE A 1 89  ? 13.466  -10.311 -15.613 1.00 0.00 ? 89  PHE A CA   3  
ATOM 5865  C C    . PHE A 1 89  ? 13.544  -10.875 -14.195 1.00 0.00 ? 89  PHE A C    3  
ATOM 5866  O O    . PHE A 1 89  ? 13.401  -12.062 -13.984 1.00 0.00 ? 89  PHE A O    3  
ATOM 5867  C CB   . PHE A 1 89  ? 14.876  -9.883  -16.047 1.00 0.00 ? 89  PHE A CB   3  
ATOM 5868  C CG   . PHE A 1 89  ? 14.858  -9.459  -17.517 1.00 0.00 ? 89  PHE A CG   3  
ATOM 5869  C CD1  . PHE A 1 89  ? 14.405  -10.328 -18.494 1.00 0.00 ? 89  PHE A CD1  3  
ATOM 5870  C CD2  . PHE A 1 89  ? 15.301  -8.202  -17.889 1.00 0.00 ? 89  PHE A CD2  3  
ATOM 5871  C CE1  . PHE A 1 89  ? 14.400  -9.944  -19.818 1.00 0.00 ? 89  PHE A CE1  3  
ATOM 5872  C CE2  . PHE A 1 89  ? 15.295  -7.824  -19.215 1.00 0.00 ? 89  PHE A CE2  3  
ATOM 5873  C CZ   . PHE A 1 89  ? 14.843  -8.694  -20.176 1.00 0.00 ? 89  PHE A CZ   3  
ATOM 5874  H H    . PHE A 1 89  ? 12.969  -8.219  -15.575 1.00 0.00 ? 89  PHE A H    3  
ATOM 5875  H HA   . PHE A 1 89  ? 13.062  -11.072 -16.284 1.00 0.00 ? 89  PHE A HA   3  
ATOM 5876  H HB2  . PHE A 1 89  ? 15.207  -9.051  -15.444 1.00 0.00 ? 89  PHE A HB2  3  
ATOM 5877  H HB3  . PHE A 1 89  ? 15.562  -10.706 -15.922 1.00 0.00 ? 89  PHE A HB3  3  
ATOM 5878  H HD1  . PHE A 1 89  ? 14.057  -11.312 -18.220 1.00 0.00 ? 89  PHE A HD1  3  
ATOM 5879  H HD2  . PHE A 1 89  ? 15.646  -7.510  -17.137 1.00 0.00 ? 89  PHE A HD2  3  
ATOM 5880  H HE1  . PHE A 1 89  ? 14.048  -10.627 -20.575 1.00 0.00 ? 89  PHE A HE1  3  
ATOM 5881  H HE2  . PHE A 1 89  ? 15.658  -6.848  -19.498 1.00 0.00 ? 89  PHE A HE2  3  
ATOM 5882  H HZ   . PHE A 1 89  ? 14.830  -8.393  -21.213 1.00 0.00 ? 89  PHE A HZ   3  
ATOM 5883  N N    . ARG A 1 90  ? 13.773  -9.998  -13.249 1.00 0.00 ? 90  ARG A N    3  
ATOM 5884  C CA   . ARG A 1 90  ? 13.869  -10.443 -11.831 1.00 0.00 ? 90  ARG A CA   3  
ATOM 5885  C C    . ARG A 1 90  ? 12.701  -11.346 -11.452 1.00 0.00 ? 90  ARG A C    3  
ATOM 5886  O O    . ARG A 1 90  ? 12.841  -12.237 -10.638 1.00 0.00 ? 90  ARG A O    3  
ATOM 5887  C CB   . ARG A 1 90  ? 13.831  -9.195  -10.941 1.00 0.00 ? 90  ARG A CB   3  
ATOM 5888  C CG   . ARG A 1 90  ? 14.992  -9.250  -9.953  1.00 0.00 ? 90  ARG A CG   3  
ATOM 5889  C CD   . ARG A 1 90  ? 14.805  -8.153  -8.909  1.00 0.00 ? 90  ARG A CD   3  
ATOM 5890  N NE   . ARG A 1 90  ? 14.463  -6.876  -9.602  1.00 0.00 ? 90  ARG A NE   3  
ATOM 5891  C CZ   . ARG A 1 90  ? 15.287  -5.864  -9.529  1.00 0.00 ? 90  ARG A CZ   3  
ATOM 5892  N NH1  . ARG A 1 90  ? 16.541  -6.091  -9.247  1.00 0.00 ? 90  ARG A NH1  3  
ATOM 5893  N NH2  . ARG A 1 90  ? 14.830  -4.660  -9.743  1.00 0.00 ? 90  ARG A NH2  3  
ATOM 5894  H H    . ARG A 1 90  ? 13.883  -9.052  -13.472 1.00 0.00 ? 90  ARG A H    3  
ATOM 5895  H HA   . ARG A 1 90  ? 14.798  -10.986 -11.690 1.00 0.00 ? 90  ARG A HA   3  
ATOM 5896  H HB2  . ARG A 1 90  ? 13.921  -8.312  -11.552 1.00 0.00 ? 90  ARG A HB2  3  
ATOM 5897  H HB3  . ARG A 1 90  ? 12.896  -9.158  -10.401 1.00 0.00 ? 90  ARG A HB3  3  
ATOM 5898  H HG2  . ARG A 1 90  ? 15.011  -10.215 -9.468  1.00 0.00 ? 90  ARG A HG2  3  
ATOM 5899  H HG3  . ARG A 1 90  ? 15.923  -9.098  -10.477 1.00 0.00 ? 90  ARG A HG3  3  
ATOM 5900  H HD2  . ARG A 1 90  ? 14.002  -8.422  -8.238  1.00 0.00 ? 90  ARG A HD2  3  
ATOM 5901  H HD3  . ARG A 1 90  ? 15.715  -8.024  -8.346  1.00 0.00 ? 90  ARG A HD3  3  
ATOM 5902  H HE   . ARG A 1 90  ? 13.628  -6.797  -10.109 1.00 0.00 ? 90  ARG A HE   3  
ATOM 5903  H HH11 . ARG A 1 90  ? 16.857  -7.025  -9.090  1.00 0.00 ? 90  ARG A HH11 3  
ATOM 5904  H HH12 . ARG A 1 90  ? 17.185  -5.329  -9.186  1.00 0.00 ? 90  ARG A HH12 3  
ATOM 5905  H HH21 . ARG A 1 90  ? 13.863  -4.523  -9.959  1.00 0.00 ? 90  ARG A HH21 3  
ATOM 5906  H HH22 . ARG A 1 90  ? 15.447  -3.874  -9.691  1.00 0.00 ? 90  ARG A HH22 3  
ATOM 5907  N N    . VAL A 1 91  ? 11.569  -11.096 -12.046 1.00 0.00 ? 91  VAL A N    3  
ATOM 5908  C CA   . VAL A 1 91  ? 10.381  -11.926 -11.735 1.00 0.00 ? 91  VAL A CA   3  
ATOM 5909  C C    . VAL A 1 91  ? 10.746  -13.404 -11.665 1.00 0.00 ? 91  VAL A C    3  
ATOM 5910  O O    . VAL A 1 91  ? 10.080  -14.174 -10.998 1.00 0.00 ? 91  VAL A O    3  
ATOM 5911  C CB   . VAL A 1 91  ? 9.351   -11.719 -12.856 1.00 0.00 ? 91  VAL A CB   3  
ATOM 5912  C CG1  . VAL A 1 91  ? 8.133   -12.604 -12.596 1.00 0.00 ? 91  VAL A CG1  3  
ATOM 5913  C CG2  . VAL A 1 91  ? 8.912   -10.253 -12.869 1.00 0.00 ? 91  VAL A CG2  3  
ATOM 5914  H H    . VAL A 1 91  ? 11.503  -10.366 -12.694 1.00 0.00 ? 91  VAL A H    3  
ATOM 5915  H HA   . VAL A 1 91  ? 9.974   -11.615 -10.777 1.00 0.00 ? 91  VAL A HA   3  
ATOM 5916  H HB   . VAL A 1 91  ? 9.792   -11.976 -13.804 1.00 0.00 ? 91  VAL A HB   3  
ATOM 5917  H HG11 . VAL A 1 91  ? 7.695   -12.350 -11.643 1.00 0.00 ? 91  VAL A HG11 3  
ATOM 5918  H HG12 . VAL A 1 91  ? 7.400   -12.451 -13.375 1.00 0.00 ? 91  VAL A HG12 3  
ATOM 5919  H HG13 . VAL A 1 91  ? 8.430   -13.640 -12.587 1.00 0.00 ? 91  VAL A HG13 3  
ATOM 5920  H HG21 . VAL A 1 91  ? 9.737   -9.622  -12.576 1.00 0.00 ? 91  VAL A HG21 3  
ATOM 5921  H HG22 . VAL A 1 91  ? 8.590   -9.978  -13.863 1.00 0.00 ? 91  VAL A HG22 3  
ATOM 5922  H HG23 . VAL A 1 91  ? 8.094   -10.111 -12.179 1.00 0.00 ? 91  VAL A HG23 3  
ATOM 5923  N N    . PHE A 1 92  ? 11.810  -13.768 -12.347 1.00 0.00 ? 92  PHE A N    3  
ATOM 5924  C CA   . PHE A 1 92  ? 12.245  -15.195 -12.341 1.00 0.00 ? 92  PHE A CA   3  
ATOM 5925  C C    . PHE A 1 92  ? 13.611  -15.360 -11.674 1.00 0.00 ? 92  PHE A C    3  
ATOM 5926  O O    . PHE A 1 92  ? 14.041  -16.465 -11.407 1.00 0.00 ? 92  PHE A O    3  
ATOM 5927  C CB   . PHE A 1 92  ? 12.346  -15.668 -13.799 1.00 0.00 ? 92  PHE A CB   3  
ATOM 5928  C CG   . PHE A 1 92  ? 11.125  -15.166 -14.584 1.00 0.00 ? 92  PHE A CG   3  
ATOM 5929  C CD1  . PHE A 1 92  ? 9.854   -15.217 -14.029 1.00 0.00 ? 92  PHE A CD1  3  
ATOM 5930  C CD2  . PHE A 1 92  ? 11.275  -14.664 -15.864 1.00 0.00 ? 92  PHE A CD2  3  
ATOM 5931  C CE1  . PHE A 1 92  ? 8.760   -14.776 -14.749 1.00 0.00 ? 92  PHE A CE1  3  
ATOM 5932  C CE2  . PHE A 1 92  ? 10.178  -14.225 -16.576 1.00 0.00 ? 92  PHE A CE2  3  
ATOM 5933  C CZ   . PHE A 1 92  ? 8.926   -14.281 -16.019 1.00 0.00 ? 92  PHE A CZ   3  
ATOM 5934  H H    . PHE A 1 92  ? 12.317  -13.102 -12.856 1.00 0.00 ? 92  PHE A H    3  
ATOM 5935  H HA   . PHE A 1 92  ? 11.520  -15.791 -11.795 1.00 0.00 ? 92  PHE A HA   3  
ATOM 5936  H HB2  . PHE A 1 92  ? 13.245  -15.276 -14.250 1.00 0.00 ? 92  PHE A HB2  3  
ATOM 5937  H HB3  . PHE A 1 92  ? 12.371  -16.747 -13.833 1.00 0.00 ? 92  PHE A HB3  3  
ATOM 5938  H HD1  . PHE A 1 92  ? 9.718   -15.600 -13.031 1.00 0.00 ? 92  PHE A HD1  3  
ATOM 5939  H HD2  . PHE A 1 92  ? 12.257  -14.608 -16.308 1.00 0.00 ? 92  PHE A HD2  3  
ATOM 5940  H HE1  . PHE A 1 92  ? 7.773   -14.820 -14.314 1.00 0.00 ? 92  PHE A HE1  3  
ATOM 5941  H HE2  . PHE A 1 92  ? 10.304  -13.842 -17.571 1.00 0.00 ? 92  PHE A HE2  3  
ATOM 5942  H HZ   . PHE A 1 92  ? 8.069   -13.939 -16.582 1.00 0.00 ? 92  PHE A HZ   3  
ATOM 5943  N N    . ASP A 1 93  ? 14.269  -14.262 -11.417 1.00 0.00 ? 93  ASP A N    3  
ATOM 5944  C CA   . ASP A 1 93  ? 15.601  -14.350 -10.770 1.00 0.00 ? 93  ASP A CA   3  
ATOM 5945  C C    . ASP A 1 93  ? 15.445  -14.738 -9.309  1.00 0.00 ? 93  ASP A C    3  
ATOM 5946  O O    . ASP A 1 93  ? 15.606  -13.922 -8.423  1.00 0.00 ? 93  ASP A O    3  
ATOM 5947  C CB   . ASP A 1 93  ? 16.279  -12.978 -10.846 1.00 0.00 ? 93  ASP A CB   3  
ATOM 5948  C CG   . ASP A 1 93  ? 17.736  -13.115 -10.399 1.00 0.00 ? 93  ASP A CG   3  
ATOM 5949  O OD1  . ASP A 1 93  ? 17.954  -12.963 -9.209  1.00 0.00 ? 93  ASP A OD1  3  
ATOM 5950  O OD2  . ASP A 1 93  ? 18.548  -13.368 -11.275 1.00 0.00 ? 93  ASP A OD2  3  
ATOM 5951  H H    . ASP A 1 93  ? 13.887  -13.397 -11.641 1.00 0.00 ? 93  ASP A H    3  
ATOM 5952  H HA   . ASP A 1 93  ? 16.197  -15.106 -11.280 1.00 0.00 ? 93  ASP A HA   3  
ATOM 5953  H HB2  . ASP A 1 93  ? 16.252  -12.612 -11.861 1.00 0.00 ? 93  ASP A HB2  3  
ATOM 5954  H HB3  . ASP A 1 93  ? 15.770  -12.280 -10.198 1.00 0.00 ? 93  ASP A HB3  3  
ATOM 5955  N N    . LYS A 1 94  ? 15.132  -15.979 -9.084  1.00 0.00 ? 94  LYS A N    3  
ATOM 5956  C CA   . LYS A 1 94  ? 14.957  -16.448 -7.693  1.00 0.00 ? 94  LYS A CA   3  
ATOM 5957  C C    . LYS A 1 94  ? 16.292  -16.852 -7.077  1.00 0.00 ? 94  LYS A C    3  
ATOM 5958  O O    . LYS A 1 94  ? 16.383  -17.083 -5.887  1.00 0.00 ? 94  LYS A O    3  
ATOM 5959  C CB   . LYS A 1 94  ? 14.031  -17.671 -7.725  1.00 0.00 ? 94  LYS A CB   3  
ATOM 5960  C CG   . LYS A 1 94  ? 12.627  -17.256 -7.279  1.00 0.00 ? 94  LYS A CG   3  
ATOM 5961  C CD   . LYS A 1 94  ? 11.645  -18.396 -7.581  1.00 0.00 ? 94  LYS A CD   3  
ATOM 5962  C CE   . LYS A 1 94  ? 10.337  -17.807 -8.115  1.00 0.00 ? 94  LYS A CE   3  
ATOM 5963  N NZ   . LYS A 1 94  ? 9.478   -18.881 -8.689  1.00 0.00 ? 94  LYS A NZ   3  
ATOM 5964  H H    . LYS A 1 94  ? 15.016  -16.601 -9.830  1.00 0.00 ? 94  LYS A H    3  
ATOM 5965  H HA   . LYS A 1 94  ? 14.518  -15.648 -7.102  1.00 0.00 ? 94  LYS A HA   3  
ATOM 5966  H HB2  . LYS A 1 94  ? 13.989  -18.064 -8.732  1.00 0.00 ? 94  LYS A HB2  3  
ATOM 5967  H HB3  . LYS A 1 94  ? 14.413  -18.431 -7.065  1.00 0.00 ? 94  LYS A HB3  3  
ATOM 5968  H HG2  . LYS A 1 94  ? 12.629  -17.050 -6.219  1.00 0.00 ? 94  LYS A HG2  3  
ATOM 5969  H HG3  . LYS A 1 94  ? 12.325  -16.367 -7.812  1.00 0.00 ? 94  LYS A HG3  3  
ATOM 5970  H HD2  . LYS A 1 94  ? 12.073  -19.058 -8.319  1.00 0.00 ? 94  LYS A HD2  3  
ATOM 5971  H HD3  . LYS A 1 94  ? 11.449  -18.953 -6.677  1.00 0.00 ? 94  LYS A HD3  3  
ATOM 5972  H HE2  . LYS A 1 94  ? 9.804   -17.322 -7.312  1.00 0.00 ? 94  LYS A HE2  3  
ATOM 5973  H HE3  . LYS A 1 94  ? 10.553  -17.080 -8.885  1.00 0.00 ? 94  LYS A HE3  3  
ATOM 5974  H HZ1  . LYS A 1 94  ? 9.314   -19.614 -7.970  1.00 0.00 ? 94  LYS A HZ1  3  
ATOM 5975  H HZ2  . LYS A 1 94  ? 8.568   -18.476 -8.985  1.00 0.00 ? 94  LYS A HZ2  3  
ATOM 5976  H HZ3  . LYS A 1 94  ? 9.953   -19.302 -9.512  1.00 0.00 ? 94  LYS A HZ3  3  
ATOM 5977  N N    . ASP A 1 95  ? 17.306  -16.930 -7.896  1.00 0.00 ? 95  ASP A N    3  
ATOM 5978  C CA   . ASP A 1 95  ? 18.639  -17.317 -7.371  1.00 0.00 ? 95  ASP A CA   3  
ATOM 5979  C C    . ASP A 1 95  ? 19.333  -16.127 -6.717  1.00 0.00 ? 95  ASP A C    3  
ATOM 5980  O O    . ASP A 1 95  ? 19.904  -16.249 -5.651  1.00 0.00 ? 95  ASP A O    3  
ATOM 5981  C CB   . ASP A 1 95  ? 19.501  -17.803 -8.549  1.00 0.00 ? 95  ASP A CB   3  
ATOM 5982  C CG   . ASP A 1 95  ? 20.473  -18.878 -8.054  1.00 0.00 ? 95  ASP A CG   3  
ATOM 5983  O OD1  . ASP A 1 95  ? 20.725  -18.874 -6.861  1.00 0.00 ? 95  ASP A OD1  3  
ATOM 5984  O OD2  . ASP A 1 95  ? 20.909  -19.643 -8.899  1.00 0.00 ? 95  ASP A OD2  3  
ATOM 5985  H H    . ASP A 1 95  ? 17.186  -16.736 -8.849  1.00 0.00 ? 95  ASP A H    3  
ATOM 5986  H HA   . ASP A 1 95  ? 18.514  -18.105 -6.631  1.00 0.00 ? 95  ASP A HA   3  
ATOM 5987  H HB2  . ASP A 1 95  ? 18.870  -18.220 -9.318  1.00 0.00 ? 95  ASP A HB2  3  
ATOM 5988  H HB3  . ASP A 1 95  ? 20.064  -16.975 -8.957  1.00 0.00 ? 95  ASP A HB3  3  
ATOM 5989  N N    . GLY A 1 96  ? 19.270  -14.996 -7.371  1.00 0.00 ? 96  GLY A N    3  
ATOM 5990  C CA   . GLY A 1 96  ? 19.921  -13.779 -6.802  1.00 0.00 ? 96  GLY A CA   3  
ATOM 5991  C C    . GLY A 1 96  ? 21.278  -13.547 -7.468  1.00 0.00 ? 96  GLY A C    3  
ATOM 5992  O O    . GLY A 1 96  ? 22.008  -12.648 -7.101  1.00 0.00 ? 96  GLY A O    3  
ATOM 5993  H H    . GLY A 1 96  ? 18.798  -14.948 -8.229  1.00 0.00 ? 96  GLY A H    3  
ATOM 5994  H HA2  . GLY A 1 96  ? 19.288  -12.920 -6.977  1.00 0.00 ? 96  GLY A HA2  3  
ATOM 5995  H HA3  . GLY A 1 96  ? 20.062  -13.909 -5.740  1.00 0.00 ? 96  GLY A HA3  3  
ATOM 5996  N N    . ASN A 1 97  ? 21.586  -14.367 -8.436  1.00 0.00 ? 97  ASN A N    3  
ATOM 5997  C CA   . ASN A 1 97  ? 22.883  -14.213 -9.137  1.00 0.00 ? 97  ASN A CA   3  
ATOM 5998  C C    . ASN A 1 97  ? 22.803  -13.118 -10.181 1.00 0.00 ? 97  ASN A C    3  
ATOM 5999  O O    . ASN A 1 97  ? 23.406  -12.074 -10.039 1.00 0.00 ? 97  ASN A O    3  
ATOM 6000  C CB   . ASN A 1 97  ? 23.217  -15.539 -9.837  1.00 0.00 ? 97  ASN A CB   3  
ATOM 6001  C CG   . ASN A 1 97  ? 23.724  -16.544 -8.801  1.00 0.00 ? 97  ASN A CG   3  
ATOM 6002  O OD1  . ASN A 1 97  ? 23.006  -16.950 -7.910  1.00 0.00 ? 97  ASN A OD1  3  
ATOM 6003  N ND2  . ASN A 1 97  ? 24.956  -16.970 -8.884  1.00 0.00 ? 97  ASN A ND2  3  
ATOM 6004  H H    . ASN A 1 97  ? 20.965  -15.078 -8.698  1.00 0.00 ? 97  ASN A H    3  
ATOM 6005  H HA   . ASN A 1 97  ? 23.647  -13.956 -8.416  1.00 0.00 ? 97  ASN A HA   3  
ATOM 6006  H HB2  . ASN A 1 97  ? 22.333  -15.933 -10.314 1.00 0.00 ? 97  ASN A HB2  3  
ATOM 6007  H HB3  . ASN A 1 97  ? 23.981  -15.376 -10.582 1.00 0.00 ? 97  ASN A HB3  3  
ATOM 6008  H HD21 . ASN A 1 97  ? 25.540  -16.646 -9.601  1.00 0.00 ? 97  ASN A HD21 3  
ATOM 6009  H HD22 . ASN A 1 97  ? 25.296  -17.614 -8.227  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 6010  N N    . GLY A 1 98  ? 22.060  -13.376 -11.213 1.00 0.00 ? 98  GLY A N    3  
ATOM 6011  C CA   . GLY A 1 98  ? 21.924  -12.359 -12.282 1.00 0.00 ? 98  GLY A CA   3  
ATOM 6012  C C    . GLY A 1 98  ? 21.757  -13.040 -13.636 1.00 0.00 ? 98  GLY A C    3  
ATOM 6013  O O    . GLY A 1 98  ? 22.126  -12.491 -14.655 1.00 0.00 ? 98  GLY A O    3  
ATOM 6014  H H    . GLY A 1 98  ? 21.591  -14.235 -11.284 1.00 0.00 ? 98  GLY A H    3  
ATOM 6015  H HA2  . GLY A 1 98  ? 21.064  -11.747 -12.082 1.00 0.00 ? 98  GLY A HA2  3  
ATOM 6016  H HA3  . GLY A 1 98  ? 22.808  -11.739 -12.300 1.00 0.00 ? 98  GLY A HA3  3  
ATOM 6017  N N    . TYR A 1 99  ? 21.209  -14.229 -13.613 1.00 0.00 ? 99  TYR A N    3  
ATOM 6018  C CA   . TYR A 1 99  ? 21.005  -14.970 -14.890 1.00 0.00 ? 99  TYR A CA   3  
ATOM 6019  C C    . TYR A 1 99  ? 19.629  -15.630 -14.943 1.00 0.00 ? 99  TYR A C    3  
ATOM 6020  O O    . TYR A 1 99  ? 19.222  -16.299 -14.013 1.00 0.00 ? 99  TYR A O    3  
ATOM 6021  C CB   . TYR A 1 99  ? 22.076  -16.069 -14.985 1.00 0.00 ? 99  TYR A CB   3  
ATOM 6022  C CG   . TYR A 1 99  ? 23.325  -15.503 -15.663 1.00 0.00 ? 99  TYR A CG   3  
ATOM 6023  C CD1  . TYR A 1 99  ? 24.286  -14.847 -14.922 1.00 0.00 ? 99  TYR A CD1  3  
ATOM 6024  C CD2  . TYR A 1 99  ? 23.510  -15.644 -17.023 1.00 0.00 ? 99  TYR A CD2  3  
ATOM 6025  C CE1  . TYR A 1 99  ? 25.415  -14.338 -15.531 1.00 0.00 ? 99  TYR A CE1  3  
ATOM 6026  C CE2  . TYR A 1 99  ? 24.639  -15.136 -17.632 1.00 0.00 ? 99  TYR A CE2  3  
ATOM 6027  C CZ   . TYR A 1 99  ? 25.600  -14.479 -16.891 1.00 0.00 ? 99  TYR A CZ   3  
ATOM 6028  O OH   . TYR A 1 99  ? 26.726  -13.966 -17.499 1.00 0.00 ? 99  TYR A OH   3  
ATOM 6029  H H    . TYR A 1 99  ? 20.945  -14.634 -12.754 1.00 0.00 ? 99  TYR A H    3  
ATOM 6030  H HA   . TYR A 1 99  ? 21.092  -14.277 -15.725 1.00 0.00 ? 99  TYR A HA   3  
ATOM 6031  H HB2  . TYR A 1 99  ? 22.332  -16.416 -13.996 1.00 0.00 ? 99  TYR A HB2  3  
ATOM 6032  H HB3  . TYR A 1 99  ? 21.698  -16.897 -15.568 1.00 0.00 ? 99  TYR A HB3  3  
ATOM 6033  H HD1  . TYR A 1 99  ? 24.153  -14.728 -13.857 1.00 0.00 ? 99  TYR A HD1  3  
ATOM 6034  H HD2  . TYR A 1 99  ? 22.765  -16.156 -17.616 1.00 0.00 ? 99  TYR A HD2  3  
ATOM 6035  H HE1  . TYR A 1 99  ? 26.159  -13.828 -14.940 1.00 0.00 ? 99  TYR A HE1  3  
ATOM 6036  H HE2  . TYR A 1 99  ? 24.772  -15.253 -18.697 1.00 0.00 ? 99  TYR A HE2  3  
ATOM 6037  H HH   . TYR A 1 99  ? 27.464  -14.542 -17.293 1.00 0.00 ? 99  TYR A HH   3  
ATOM 6038  N N    . ILE A 1 100 ? 18.940  -15.420 -16.044 1.00 0.00 ? 100 ILE A N    3  
ATOM 6039  C CA   . ILE A 1 100 ? 17.581  -16.016 -16.211 1.00 0.00 ? 100 ILE A CA   3  
ATOM 6040  C C    . ILE A 1 100 ? 17.571  -16.938 -17.424 1.00 0.00 ? 100 ILE A C    3  
ATOM 6041  O O    . ILE A 1 100 ? 18.378  -16.790 -18.314 1.00 0.00 ? 100 ILE A O    3  
ATOM 6042  C CB   . ILE A 1 100 ? 16.568  -14.886 -16.456 1.00 0.00 ? 100 ILE A CB   3  
ATOM 6043  C CG1  . ILE A 1 100 ? 16.870  -14.207 -17.788 1.00 0.00 ? 100 ILE A CG1  3  
ATOM 6044  C CG2  . ILE A 1 100 ? 16.695  -13.841 -15.328 1.00 0.00 ? 100 ILE A CG2  3  
ATOM 6045  C CD1  . ILE A 1 100 ? 15.828  -13.116 -18.045 1.00 0.00 ? 100 ILE A CD1  3  
ATOM 6046  H H    . ILE A 1 100 ? 19.322  -14.872 -16.760 1.00 0.00 ? 100 ILE A H    3  
ATOM 6047  H HA   . ILE A 1 100 ? 17.321  -16.591 -15.323 1.00 0.00 ? 100 ILE A HA   3  
ATOM 6048  H HB   . ILE A 1 100 ? 15.561  -15.308 -16.489 1.00 0.00 ? 100 ILE A HB   3  
ATOM 6049  H HG12 . ILE A 1 100 ? 17.857  -13.767 -17.758 1.00 0.00 ? 100 ILE A HG12 3  
ATOM 6050  H HG13 . ILE A 1 100 ? 16.832  -14.934 -18.585 1.00 0.00 ? 100 ILE A HG13 3  
ATOM 6051  H HG21 . ILE A 1 100 ? 16.744  -14.339 -14.372 1.00 0.00 ? 100 ILE A HG21 3  
ATOM 6052  H HG22 . ILE A 1 100 ? 17.590  -13.255 -15.470 1.00 0.00 ? 100 ILE A HG22 3  
ATOM 6053  H HG23 . ILE A 1 100 ? 15.833  -13.183 -15.340 1.00 0.00 ? 100 ILE A HG23 3  
ATOM 6054  H HD11 . ILE A 1 100 ? 14.837  -13.513 -17.884 1.00 0.00 ? 100 ILE A HD11 3  
ATOM 6055  H HD12 . ILE A 1 100 ? 15.993  -12.290 -17.373 1.00 0.00 ? 100 ILE A HD12 3  
ATOM 6056  H HD13 . ILE A 1 100 ? 15.908  -12.767 -19.063 1.00 0.00 ? 100 ILE A HD13 3  
ATOM 6057  N N    . SER A 1 101 ? 16.661  -17.866 -17.451 1.00 0.00 ? 101 SER A N    3  
ATOM 6058  C CA   . SER A 1 101 ? 16.612  -18.788 -18.615 1.00 0.00 ? 101 SER A CA   3  
ATOM 6059  C C    . SER A 1 101 ? 16.151  -18.048 -19.866 1.00 0.00 ? 101 SER A C    3  
ATOM 6060  O O    . SER A 1 101 ? 15.257  -17.228 -19.809 1.00 0.00 ? 101 SER A O    3  
ATOM 6061  C CB   . SER A 1 101 ? 15.614  -19.912 -18.307 1.00 0.00 ? 101 SER A CB   3  
ATOM 6062  O OG   . SER A 1 101 ? 16.410  -20.932 -17.721 1.00 0.00 ? 101 SER A OG   3  
ATOM 6063  H H    . SER A 1 101 ? 16.016  -17.955 -16.716 1.00 0.00 ? 101 SER A H    3  
ATOM 6064  H HA   . SER A 1 101 ? 17.613  -19.190 -18.790 1.00 0.00 ? 101 SER A HA   3  
ATOM 6065  H HB2  . SER A 1 101 ? 14.863  -19.577 -17.608 1.00 0.00 ? 101 SER A HB2  3  
ATOM 6066  H HB3  . SER A 1 101 ? 15.152  -20.273 -19.214 1.00 0.00 ? 101 SER A HB3  3  
ATOM 6067  H HG   . SER A 1 101 ? 15.997  -21.193 -16.896 1.00 0.00 ? 101 SER A HG   3  
ATOM 6068  N N    . ALA A 1 102 ? 16.771  -18.352 -20.976 1.00 0.00 ? 102 ALA A N    3  
ATOM 6069  C CA   . ALA A 1 102 ? 16.380  -17.673 -22.236 1.00 0.00 ? 102 ALA A CA   3  
ATOM 6070  C C    . ALA A 1 102 ? 14.916  -17.939 -22.568 1.00 0.00 ? 102 ALA A C    3  
ATOM 6071  O O    . ALA A 1 102 ? 14.263  -17.128 -23.193 1.00 0.00 ? 102 ALA A O    3  
ATOM 6072  C CB   . ALA A 1 102 ? 17.255  -18.215 -23.373 1.00 0.00 ? 102 ALA A CB   3  
ATOM 6073  H H    . ALA A 1 102 ? 17.486  -19.021 -20.975 1.00 0.00 ? 102 ALA A H    3  
ATOM 6074  H HA   . ALA A 1 102 ? 16.525  -16.600 -22.116 1.00 0.00 ? 102 ALA A HA   3  
ATOM 6075  H HB1  . ALA A 1 102 ? 18.229  -18.479 -22.989 1.00 0.00 ? 102 ALA A HB1  3  
ATOM 6076  H HB2  . ALA A 1 102 ? 16.792  -19.089 -23.804 1.00 0.00 ? 102 ALA A HB2  3  
ATOM 6077  H HB3  . ALA A 1 102 ? 17.368  -17.459 -24.137 1.00 0.00 ? 102 ALA A HB3  3  
ATOM 6078  N N    . ALA A 1 103 ? 14.424  -19.073 -22.149 1.00 0.00 ? 103 ALA A N    3  
ATOM 6079  C CA   . ALA A 1 103 ? 13.006  -19.393 -22.435 1.00 0.00 ? 103 ALA A CA   3  
ATOM 6080  C C    . ALA A 1 103 ? 12.095  -18.393 -21.736 1.00 0.00 ? 103 ALA A C    3  
ATOM 6081  O O    . ALA A 1 103 ? 11.376  -17.637 -22.375 1.00 0.00 ? 103 ALA A O    3  
ATOM 6082  C CB   . ALA A 1 103 ? 12.706  -20.803 -21.899 1.00 0.00 ? 103 ALA A CB   3  
ATOM 6083  H H    . ALA A 1 103 ? 14.985  -19.704 -21.651 1.00 0.00 ? 103 ALA A H    3  
ATOM 6084  H HA   . ALA A 1 103 ? 12.838  -19.339 -23.508 1.00 0.00 ? 103 ALA A HA   3  
ATOM 6085  H HB1  . ALA A 1 103 ? 12.887  -20.834 -20.835 1.00 0.00 ? 103 ALA A HB1  3  
ATOM 6086  H HB2  . ALA A 1 103 ? 11.674  -21.055 -22.091 1.00 0.00 ? 103 ALA A HB2  3  
ATOM 6087  H HB3  . ALA A 1 103 ? 13.346  -21.523 -22.389 1.00 0.00 ? 103 ALA A HB3  3  
ATOM 6088  N N    . GLU A 1 104 ? 12.144  -18.402 -20.436 1.00 0.00 ? 104 GLU A N    3  
ATOM 6089  C CA   . GLU A 1 104 ? 11.296  -17.464 -19.676 1.00 0.00 ? 104 GLU A CA   3  
ATOM 6090  C C    . GLU A 1 104 ? 11.515  -16.048 -20.175 1.00 0.00 ? 104 GLU A C    3  
ATOM 6091  O O    . GLU A 1 104 ? 10.604  -15.248 -20.209 1.00 0.00 ? 104 GLU A O    3  
ATOM 6092  C CB   . GLU A 1 104 ? 11.699  -17.534 -18.195 1.00 0.00 ? 104 GLU A CB   3  
ATOM 6093  C CG   . GLU A 1 104 ? 11.576  -18.979 -17.709 1.00 0.00 ? 104 GLU A CG   3  
ATOM 6094  C CD   . GLU A 1 104 ? 10.098  -19.361 -17.629 1.00 0.00 ? 104 GLU A CD   3  
ATOM 6095  O OE1  . GLU A 1 104 ? 9.403   -18.681 -16.892 1.00 0.00 ? 104 GLU A OE1  3  
ATOM 6096  O OE2  . GLU A 1 104 ? 9.746   -20.311 -18.309 1.00 0.00 ? 104 GLU A OE2  3  
ATOM 6097  H H    . GLU A 1 104 ? 12.740  -19.021 -19.969 1.00 0.00 ? 104 GLU A H    3  
ATOM 6098  H HA   . GLU A 1 104 ? 10.249  -17.735 -19.809 1.00 0.00 ? 104 GLU A HA   3  
ATOM 6099  H HB2  . GLU A 1 104 ? 12.720  -17.199 -18.081 1.00 0.00 ? 104 GLU A HB2  3  
ATOM 6100  H HB3  . GLU A 1 104 ? 11.051  -16.898 -17.611 1.00 0.00 ? 104 GLU A HB3  3  
ATOM 6101  H HG2  . GLU A 1 104 ? 12.080  -19.641 -18.399 1.00 0.00 ? 104 GLU A HG2  3  
ATOM 6102  H HG3  . GLU A 1 104 ? 12.023  -19.076 -16.731 1.00 0.00 ? 104 GLU A HG3  3  
ATOM 6103  N N    . LEU A 1 105 ? 12.731  -15.762 -20.558 1.00 0.00 ? 105 LEU A N    3  
ATOM 6104  C CA   . LEU A 1 105 ? 13.033  -14.406 -21.060 1.00 0.00 ? 105 LEU A CA   3  
ATOM 6105  C C    . LEU A 1 105 ? 12.227  -14.114 -22.313 1.00 0.00 ? 105 LEU A C    3  
ATOM 6106  O O    . LEU A 1 105 ? 11.656  -13.058 -22.451 1.00 0.00 ? 105 LEU A O    3  
ATOM 6107  C CB   . LEU A 1 105 ? 14.526  -14.335 -21.397 1.00 0.00 ? 105 LEU A CB   3  
ATOM 6108  C CG   . LEU A 1 105 ? 14.785  -13.122 -22.297 1.00 0.00 ? 105 LEU A CG   3  
ATOM 6109  C CD1  . LEU A 1 105 ? 16.116  -12.481 -21.914 1.00 0.00 ? 105 LEU A CD1  3  
ATOM 6110  C CD2  . LEU A 1 105 ? 14.859  -13.578 -23.749 1.00 0.00 ? 105 LEU A CD2  3  
ATOM 6111  H H    . LEU A 1 105 ? 13.436  -16.443 -20.513 1.00 0.00 ? 105 LEU A H    3  
ATOM 6112  H HA   . LEU A 1 105 ? 12.774  -13.674 -20.292 1.00 0.00 ? 105 LEU A HA   3  
ATOM 6113  H HB2  . LEU A 1 105 ? 15.096  -14.240 -20.485 1.00 0.00 ? 105 LEU A HB2  3  
ATOM 6114  H HB3  . LEU A 1 105 ? 14.824  -15.235 -21.908 1.00 0.00 ? 105 LEU A HB3  3  
ATOM 6115  H HG   . LEU A 1 105 ? 13.987  -12.406 -22.184 1.00 0.00 ? 105 LEU A HG   3  
ATOM 6116  H HD11 . LEU A 1 105 ? 16.751  -13.212 -21.440 1.00 0.00 ? 105 LEU A HD11 3  
ATOM 6117  H HD12 . LEU A 1 105 ? 16.607  -12.110 -22.797 1.00 0.00 ? 105 LEU A HD12 3  
ATOM 6118  H HD13 . LEU A 1 105 ? 15.943  -11.662 -21.232 1.00 0.00 ? 105 LEU A HD13 3  
ATOM 6119  H HD21 . LEU A 1 105 ? 15.538  -14.415 -23.834 1.00 0.00 ? 105 LEU A HD21 3  
ATOM 6120  H HD22 . LEU A 1 105 ? 13.885  -13.876 -24.085 1.00 0.00 ? 105 LEU A HD22 3  
ATOM 6121  H HD23 . LEU A 1 105 ? 15.213  -12.766 -24.366 1.00 0.00 ? 105 LEU A HD23 3  
ATOM 6122  N N    . ARG A 1 106 ? 12.195  -15.055 -23.215 1.00 0.00 ? 106 ARG A N    3  
ATOM 6123  C CA   . ARG A 1 106 ? 11.423  -14.817 -24.449 1.00 0.00 ? 106 ARG A CA   3  
ATOM 6124  C C    . ARG A 1 106 ? 10.017  -14.394 -24.088 1.00 0.00 ? 106 ARG A C    3  
ATOM 6125  O O    . ARG A 1 106 ? 9.413   -13.585 -24.763 1.00 0.00 ? 106 ARG A O    3  
ATOM 6126  C CB   . ARG A 1 106 ? 11.365  -16.119 -25.261 1.00 0.00 ? 106 ARG A CB   3  
ATOM 6127  C CG   . ARG A 1 106 ? 11.099  -15.779 -26.732 1.00 0.00 ? 106 ARG A CG   3  
ATOM 6128  C CD   . ARG A 1 106 ? 10.937  -17.078 -27.525 1.00 0.00 ? 106 ARG A CD   3  
ATOM 6129  N NE   . ARG A 1 106 ? 10.017  -17.985 -26.784 1.00 0.00 ? 106 ARG A NE   3  
ATOM 6130  C CZ   . ARG A 1 106 ? 9.744   -19.162 -27.276 1.00 0.00 ? 106 ARG A CZ   3  
ATOM 6131  N NH1  . ARG A 1 106 ? 10.718  -19.892 -27.743 1.00 0.00 ? 106 ARG A NH1  3  
ATOM 6132  N NH2  . ARG A 1 106 ? 8.504   -19.567 -27.286 1.00 0.00 ? 106 ARG A NH2  3  
ATOM 6133  H H    . ARG A 1 106 ? 12.672  -15.899 -23.077 1.00 0.00 ? 106 ARG A H    3  
ATOM 6134  H HA   . ARG A 1 106 ? 11.897  -14.018 -25.018 1.00 0.00 ? 106 ARG A HA   3  
ATOM 6135  H HB2  . ARG A 1 106 ? 12.304  -16.644 -25.173 1.00 0.00 ? 106 ARG A HB2  3  
ATOM 6136  H HB3  . ARG A 1 106 ? 10.571  -16.747 -24.884 1.00 0.00 ? 106 ARG A HB3  3  
ATOM 6137  H HG2  . ARG A 1 106 ? 10.197  -15.189 -26.812 1.00 0.00 ? 106 ARG A HG2  3  
ATOM 6138  H HG3  . ARG A 1 106 ? 11.928  -15.212 -27.129 1.00 0.00 ? 106 ARG A HG3  3  
ATOM 6139  H HD2  . ARG A 1 106 ? 10.519  -16.864 -28.499 1.00 0.00 ? 106 ARG A HD2  3  
ATOM 6140  H HD3  . ARG A 1 106 ? 11.897  -17.558 -27.644 1.00 0.00 ? 106 ARG A HD3  3  
ATOM 6141  H HE   . ARG A 1 106 ? 9.622   -17.702 -25.933 1.00 0.00 ? 106 ARG A HE   3  
ATOM 6142  H HH11 . ARG A 1 106 ? 11.657  -19.548 -27.719 1.00 0.00 ? 106 ARG A HH11 3  
ATOM 6143  H HH12 . ARG A 1 106 ? 10.527  -20.797 -28.124 1.00 0.00 ? 106 ARG A HH12 3  
ATOM 6144  H HH21 . ARG A 1 106 ? 7.783   -18.980 -26.919 1.00 0.00 ? 106 ARG A HH21 3  
ATOM 6145  H HH22 . ARG A 1 106 ? 8.274   -20.465 -27.662 1.00 0.00 ? 106 ARG A HH22 3  
ATOM 6146  N N    . HIS A 1 107 ? 9.513   -14.952 -23.018 1.00 0.00 ? 107 HIS A N    3  
ATOM 6147  C CA   . HIS A 1 107 ? 8.143   -14.588 -22.598 1.00 0.00 ? 107 HIS A CA   3  
ATOM 6148  C C    . HIS A 1 107 ? 8.110   -13.147 -22.107 1.00 0.00 ? 107 HIS A C    3  
ATOM 6149  O O    . HIS A 1 107 ? 7.136   -12.447 -22.295 1.00 0.00 ? 107 HIS A O    3  
ATOM 6150  C CB   . HIS A 1 107 ? 7.707   -15.511 -21.451 1.00 0.00 ? 107 HIS A CB   3  
ATOM 6151  C CG   . HIS A 1 107 ? 6.220   -15.285 -21.170 1.00 0.00 ? 107 HIS A CG   3  
ATOM 6152  N ND1  . HIS A 1 107 ? 5.315   -15.344 -22.029 1.00 0.00 ? 107 HIS A ND1  3  
ATOM 6153  C CD2  . HIS A 1 107 ? 5.582   -14.975 -19.983 1.00 0.00 ? 107 HIS A CD2  3  
ATOM 6154  C CE1  . HIS A 1 107 ? 4.176   -15.106 -21.523 1.00 0.00 ? 107 HIS A CE1  3  
ATOM 6155  N NE2  . HIS A 1 107 ? 4.245   -14.855 -20.214 1.00 0.00 ? 107 HIS A NE2  3  
ATOM 6156  H H    . HIS A 1 107 ? 10.038  -15.610 -22.503 1.00 0.00 ? 107 HIS A H    3  
ATOM 6157  H HA   . HIS A 1 107 ? 7.474   -14.687 -23.451 1.00 0.00 ? 107 HIS A HA   3  
ATOM 6158  H HB2  . HIS A 1 107 ? 7.867   -16.542 -21.730 1.00 0.00 ? 107 HIS A HB2  3  
ATOM 6159  H HB3  . HIS A 1 107 ? 8.276   -15.287 -20.563 1.00 0.00 ? 107 HIS A HB3  3  
ATOM 6160  H HD1  . HIS A 1 107 ? 5.465   -15.550 -22.975 1.00 0.00 ? 107 HIS A HD1  3  
ATOM 6161  H HD2  . HIS A 1 107 ? 6.066   -14.844 -19.028 1.00 0.00 ? 107 HIS A HD2  3  
ATOM 6162  H HE1  . HIS A 1 107 ? 3.257   -15.100 -22.088 1.00 0.00 ? 107 HIS A HE1  3  
ATOM 6163  N N    . VAL A 1 108 ? 9.180   -12.726 -21.474 1.00 0.00 ? 108 VAL A N    3  
ATOM 6164  C CA   . VAL A 1 108 ? 9.216   -11.332 -20.972 1.00 0.00 ? 108 VAL A CA   3  
ATOM 6165  C C    . VAL A 1 108 ? 9.007   -10.365 -22.120 1.00 0.00 ? 108 VAL A C    3  
ATOM 6166  O O    . VAL A 1 108 ? 8.237   -9.433  -22.021 1.00 0.00 ? 108 VAL A O    3  
ATOM 6167  C CB   . VAL A 1 108 ? 10.594  -11.057 -20.345 1.00 0.00 ? 108 VAL A CB   3  
ATOM 6168  C CG1  . VAL A 1 108 ? 10.648  -9.611  -19.860 1.00 0.00 ? 108 VAL A CG1  3  
ATOM 6169  C CG2  . VAL A 1 108 ? 10.804  -11.991 -19.163 1.00 0.00 ? 108 VAL A CG2  3  
ATOM 6170  H H    . VAL A 1 108 ? 9.944   -13.325 -21.335 1.00 0.00 ? 108 VAL A H    3  
ATOM 6171  H HA   . VAL A 1 108 ? 8.421   -11.197 -20.239 1.00 0.00 ? 108 VAL A HA   3  
ATOM 6172  H HB   . VAL A 1 108 ? 11.364  -11.218 -21.070 1.00 0.00 ? 108 VAL A HB   3  
ATOM 6173  H HG11 . VAL A 1 108 ? 9.767   -9.388  -19.281 1.00 0.00 ? 108 VAL A HG11 3  
ATOM 6174  H HG12 . VAL A 1 108 ? 11.524  -9.466  -19.245 1.00 0.00 ? 108 VAL A HG12 3  
ATOM 6175  H HG13 . VAL A 1 108 ? 10.694  -8.944  -20.709 1.00 0.00 ? 108 VAL A HG13 3  
ATOM 6176  H HG21 . VAL A 1 108 ? 9.998   -11.867 -18.454 1.00 0.00 ? 108 VAL A HG21 3  
ATOM 6177  H HG22 . VAL A 1 108 ? 10.822  -13.012 -19.509 1.00 0.00 ? 108 VAL A HG22 3  
ATOM 6178  H HG23 . VAL A 1 108 ? 11.741  -11.764 -18.679 1.00 0.00 ? 108 VAL A HG23 3  
ATOM 6179  N N    . MET A 1 109 ? 9.697   -10.614 -23.201 1.00 0.00 ? 109 MET A N    3  
ATOM 6180  C CA   . MET A 1 109 ? 9.558   -9.724  -24.372 1.00 0.00 ? 109 MET A CA   3  
ATOM 6181  C C    . MET A 1 109 ? 8.106   -9.652  -24.802 1.00 0.00 ? 109 MET A C    3  
ATOM 6182  O O    . MET A 1 109 ? 7.659   -8.655  -25.333 1.00 0.00 ? 109 MET A O    3  
ATOM 6183  C CB   . MET A 1 109 ? 10.396  -10.305 -25.524 1.00 0.00 ? 109 MET A CB   3  
ATOM 6184  C CG   . MET A 1 109 ? 11.870  -10.380 -25.098 1.00 0.00 ? 109 MET A CG   3  
ATOM 6185  S SD   . MET A 1 109 ? 12.237  -10.308 -23.325 1.00 0.00 ? 109 MET A SD   3  
ATOM 6186  C CE   . MET A 1 109 ? 12.564  -8.531  -23.230 1.00 0.00 ? 109 MET A CE   3  
ATOM 6187  H H    . MET A 1 109 ? 10.296  -11.391 -23.239 1.00 0.00 ? 109 MET A H    3  
ATOM 6188  H HA   . MET A 1 109 ? 9.901   -8.726  -24.103 1.00 0.00 ? 109 MET A HA   3  
ATOM 6189  H HB2  . MET A 1 109 ? 10.039  -11.295 -25.769 1.00 0.00 ? 109 MET A HB2  3  
ATOM 6190  H HB3  . MET A 1 109 ? 10.303  -9.672  -26.394 1.00 0.00 ? 109 MET A HB3  3  
ATOM 6191  H HG2  . MET A 1 109 ? 12.281  -11.304 -25.478 1.00 0.00 ? 109 MET A HG2  3  
ATOM 6192  H HG3  . MET A 1 109 ? 12.398  -9.568  -25.573 1.00 0.00 ? 109 MET A HG3  3  
ATOM 6193  H HE1  . MET A 1 109 ? 11.986  -8.019  -23.985 1.00 0.00 ? 109 MET A HE1  3  
ATOM 6194  H HE2  . MET A 1 109 ? 12.285  -8.166  -22.253 1.00 0.00 ? 109 MET A HE2  3  
ATOM 6195  H HE3  . MET A 1 109 ? 13.615  -8.350  -23.397 1.00 0.00 ? 109 MET A HE3  3  
ATOM 6196  N N    . THR A 1 110 ? 7.393   -10.715 -24.564 1.00 0.00 ? 110 THR A N    3  
ATOM 6197  C CA   . THR A 1 110 ? 5.966   -10.732 -24.947 1.00 0.00 ? 110 THR A CA   3  
ATOM 6198  C C    . THR A 1 110 ? 5.164   -9.857  -23.998 1.00 0.00 ? 110 THR A C    3  
ATOM 6199  O O    . THR A 1 110 ? 4.218   -9.205  -24.396 1.00 0.00 ? 110 THR A O    3  
ATOM 6200  C CB   . THR A 1 110 ? 5.460   -12.172 -24.847 1.00 0.00 ? 110 THR A CB   3  
ATOM 6201  O OG1  . THR A 1 110 ? 6.611   -12.954 -24.614 1.00 0.00 ? 110 THR A OG1  3  
ATOM 6202  C CG2  . THR A 1 110 ? 4.932   -12.665 -26.200 1.00 0.00 ? 110 THR A CG2  3  
ATOM 6203  H H    . THR A 1 110 ? 7.798   -11.497 -24.134 1.00 0.00 ? 110 THR A H    3  
ATOM 6204  H HA   . THR A 1 110 ? 5.864   -10.349 -25.961 1.00 0.00 ? 110 THR A HA   3  
ATOM 6205  H HB   . THR A 1 110 ? 4.740   -12.293 -24.041 1.00 0.00 ? 110 THR A HB   3  
ATOM 6206  H HG1  . THR A 1 110 ? 7.243   -12.767 -25.312 1.00 0.00 ? 110 THR A HG1  3  
ATOM 6207  H HG21 . THR A 1 110 ? 5.660   -12.462 -26.972 1.00 0.00 ? 110 THR A HG21 3  
ATOM 6208  H HG22 . THR A 1 110 ? 4.749   -13.728 -26.156 1.00 0.00 ? 110 THR A HG22 3  
ATOM 6209  H HG23 . THR A 1 110 ? 4.011   -12.155 -26.440 1.00 0.00 ? 110 THR A HG23 3  
ATOM 6210  N N    . ASN A 1 111 ? 5.559   -9.859  -22.753 1.00 0.00 ? 111 ASN A N    3  
ATOM 6211  C CA   . ASN A 1 111 ? 4.835   -9.034  -21.758 1.00 0.00 ? 111 ASN A CA   3  
ATOM 6212  C C    . ASN A 1 111 ? 5.012   -7.554  -22.070 1.00 0.00 ? 111 ASN A C    3  
ATOM 6213  O O    . ASN A 1 111 ? 4.060   -6.800  -22.068 1.00 0.00 ? 111 ASN A O    3  
ATOM 6214  C CB   . ASN A 1 111 ? 5.419   -9.321  -20.365 1.00 0.00 ? 111 ASN A CB   3  
ATOM 6215  C CG   . ASN A 1 111 ? 4.496   -8.725  -19.300 1.00 0.00 ? 111 ASN A CG   3  
ATOM 6216  O OD1  . ASN A 1 111 ? 4.043   -7.603  -19.412 1.00 0.00 ? 111 ASN A OD1  3  
ATOM 6217  N ND2  . ASN A 1 111 ? 4.190   -9.442  -18.252 1.00 0.00 ? 111 ASN A ND2  3  
ATOM 6218  H H    . ASN A 1 111 ? 6.326   -10.403 -22.479 1.00 0.00 ? 111 ASN A H    3  
ATOM 6219  H HA   . ASN A 1 111 ? 3.775   -9.282  -21.794 1.00 0.00 ? 111 ASN A HA   3  
ATOM 6220  H HB2  . ASN A 1 111 ? 5.498   -10.387 -20.214 1.00 0.00 ? 111 ASN A HB2  3  
ATOM 6221  H HB3  . ASN A 1 111 ? 6.399   -8.874  -20.280 1.00 0.00 ? 111 ASN A HB3  3  
ATOM 6222  H HD21 . ASN A 1 111 ? 4.552   -10.348 -18.157 1.00 0.00 ? 111 ASN A HD21 3  
ATOM 6223  H HD22 . ASN A 1 111 ? 3.599   -9.074  -17.562 1.00 0.00 ? 111 ASN A HD22 3  
ATOM 6224  N N    . LEU A 1 112 ? 6.233   -7.161  -22.334 1.00 0.00 ? 112 LEU A N    3  
ATOM 6225  C CA   . LEU A 1 112 ? 6.484   -5.732  -22.649 1.00 0.00 ? 112 LEU A CA   3  
ATOM 6226  C C    . LEU A 1 112 ? 5.913   -5.410  -24.012 1.00 0.00 ? 112 LEU A C    3  
ATOM 6227  O O    . LEU A 1 112 ? 5.214   -4.432  -24.190 1.00 0.00 ? 112 LEU A O    3  
ATOM 6228  C CB   . LEU A 1 112 ? 8.009   -5.485  -22.691 1.00 0.00 ? 112 LEU A CB   3  
ATOM 6229  C CG   . LEU A 1 112 ? 8.682   -6.210  -21.528 1.00 0.00 ? 112 LEU A CG   3  
ATOM 6230  C CD1  . LEU A 1 112 ? 10.171  -6.375  -21.835 1.00 0.00 ? 112 LEU A CD1  3  
ATOM 6231  C CD2  . LEU A 1 112 ? 8.519   -5.380  -20.255 1.00 0.00 ? 112 LEU A CD2  3  
ATOM 6232  H H    . LEU A 1 112 ? 6.973   -7.807  -22.329 1.00 0.00 ? 112 LEU A H    3  
ATOM 6233  H HA   . LEU A 1 112 ? 6.004   -5.106  -21.898 1.00 0.00 ? 112 LEU A HA   3  
ATOM 6234  H HB2  . LEU A 1 112 ? 8.409   -5.851  -23.624 1.00 0.00 ? 112 LEU A HB2  3  
ATOM 6235  H HB3  . LEU A 1 112 ? 8.205   -4.426  -22.616 1.00 0.00 ? 112 LEU A HB3  3  
ATOM 6236  H HG   . LEU A 1 112 ? 8.232   -7.176  -21.394 1.00 0.00 ? 112 LEU A HG   3  
ATOM 6237  H HD11 . LEU A 1 112 ? 10.571  -5.445  -22.212 1.00 0.00 ? 112 LEU A HD11 3  
ATOM 6238  H HD12 . LEU A 1 112 ? 10.701  -6.653  -20.936 1.00 0.00 ? 112 LEU A HD12 3  
ATOM 6239  H HD13 . LEU A 1 112 ? 10.305  -7.147  -22.579 1.00 0.00 ? 112 LEU A HD13 3  
ATOM 6240  H HD21 . LEU A 1 112 ? 7.480   -5.120  -20.119 1.00 0.00 ? 112 LEU A HD21 3  
ATOM 6241  H HD22 . LEU A 1 112 ? 8.857   -5.950  -19.403 1.00 0.00 ? 112 LEU A HD22 3  
ATOM 6242  H HD23 . LEU A 1 112 ? 9.105   -4.475  -20.332 1.00 0.00 ? 112 LEU A HD23 3  
ATOM 6243  N N    . GLY A 1 113 ? 6.227   -6.250  -24.951 1.00 0.00 ? 113 GLY A N    3  
ATOM 6244  C CA   . GLY A 1 113 ? 5.723   -6.041  -26.338 1.00 0.00 ? 113 GLY A CA   3  
ATOM 6245  C C    . GLY A 1 113 ? 5.942   -4.597  -26.795 1.00 0.00 ? 113 GLY A C    3  
ATOM 6246  O O    . GLY A 1 113 ? 5.084   -3.754  -26.620 1.00 0.00 ? 113 GLY A O    3  
ATOM 6247  H H    . GLY A 1 113 ? 6.800   -7.022  -24.744 1.00 0.00 ? 113 GLY A H    3  
ATOM 6248  H HA2  . GLY A 1 113 ? 6.246   -6.708  -27.009 1.00 0.00 ? 113 GLY A HA2  3  
ATOM 6249  H HA3  . GLY A 1 113 ? 4.667   -6.265  -26.368 1.00 0.00 ? 113 GLY A HA3  3  
ATOM 6250  N N    . GLU A 1 114 ? 7.088   -4.348  -27.380 1.00 0.00 ? 114 GLU A N    3  
ATOM 6251  C CA   . GLU A 1 114 ? 7.396   -2.976  -27.862 1.00 0.00 ? 114 GLU A CA   3  
ATOM 6252  C C    . GLU A 1 114 ? 7.376   -2.939  -29.382 1.00 0.00 ? 114 GLU A C    3  
ATOM 6253  O O    . GLU A 1 114 ? 6.338   -2.750  -29.987 1.00 0.00 ? 114 GLU A O    3  
ATOM 6254  C CB   . GLU A 1 114 ? 8.806   -2.597  -27.377 1.00 0.00 ? 114 GLU A CB   3  
ATOM 6255  C CG   . GLU A 1 114 ? 8.765   -2.329  -25.872 1.00 0.00 ? 114 GLU A CG   3  
ATOM 6256  C CD   . GLU A 1 114 ? 9.429   -3.492  -25.133 1.00 0.00 ? 114 GLU A CD   3  
ATOM 6257  O OE1  . GLU A 1 114 ? 9.090   -4.614  -25.474 1.00 0.00 ? 114 GLU A OE1  3  
ATOM 6258  O OE2  . GLU A 1 114 ? 10.240  -3.194  -24.271 1.00 0.00 ? 114 GLU A OE2  3  
ATOM 6259  H H    . GLU A 1 114 ? 7.741   -5.064  -27.500 1.00 0.00 ? 114 GLU A H    3  
ATOM 6260  H HA   . GLU A 1 114 ? 6.656   -2.284  -27.478 1.00 0.00 ? 114 GLU A HA   3  
ATOM 6261  H HB2  . GLU A 1 114 ? 9.490   -3.407  -27.583 1.00 0.00 ? 114 GLU A HB2  3  
ATOM 6262  H HB3  . GLU A 1 114 ? 9.142   -1.710  -27.895 1.00 0.00 ? 114 GLU A HB3  3  
ATOM 6263  H HG2  . GLU A 1 114 ? 9.294   -1.415  -25.648 1.00 0.00 ? 114 GLU A HG2  3  
ATOM 6264  H HG3  . GLU A 1 114 ? 7.739   -2.237  -25.544 1.00 0.00 ? 114 GLU A HG3  3  
ATOM 6265  N N    . LYS A 1 115 ? 8.530   -3.121  -29.971 1.00 0.00 ? 115 LYS A N    3  
ATOM 6266  C CA   . LYS A 1 115 ? 8.619   -3.105  -31.451 1.00 0.00 ? 115 LYS A CA   3  
ATOM 6267  C C    . LYS A 1 115 ? 9.533   -4.223  -31.928 1.00 0.00 ? 115 LYS A C    3  
ATOM 6268  O O    . LYS A 1 115 ? 10.151  -4.126  -32.971 1.00 0.00 ? 115 LYS A O    3  
ATOM 6269  C CB   . LYS A 1 115 ? 9.207   -1.754  -31.898 1.00 0.00 ? 115 LYS A CB   3  
ATOM 6270  C CG   . LYS A 1 115 ? 8.537   -0.626  -31.109 1.00 0.00 ? 115 LYS A CG   3  
ATOM 6271  C CD   . LYS A 1 115 ? 8.509   0.643   -31.965 1.00 0.00 ? 115 LYS A CD   3  
ATOM 6272  C CE   . LYS A 1 115 ? 8.848   1.846   -31.084 1.00 0.00 ? 115 LYS A CE   3  
ATOM 6273  N NZ   . LYS A 1 115 ? 10.324  2.028   -30.999 1.00 0.00 ? 115 LYS A NZ   3  
ATOM 6274  H H    . LYS A 1 115 ? 9.333   -3.271  -29.434 1.00 0.00 ? 115 LYS A H    3  
ATOM 6275  H HA   . LYS A 1 115 ? 7.629   -3.258  -31.869 1.00 0.00 ? 115 LYS A HA   3  
ATOM 6276  H HB2  . LYS A 1 115 ? 10.272  -1.743  -31.713 1.00 0.00 ? 115 LYS A HB2  3  
ATOM 6277  H HB3  . LYS A 1 115 ? 9.030   -1.614  -32.953 1.00 0.00 ? 115 LYS A HB3  3  
ATOM 6278  H HG2  . LYS A 1 115 ? 7.529   -0.911  -30.853 1.00 0.00 ? 115 LYS A HG2  3  
ATOM 6279  H HG3  . LYS A 1 115 ? 9.092   -0.438  -30.202 1.00 0.00 ? 115 LYS A HG3  3  
ATOM 6280  H HD2  . LYS A 1 115 ? 9.232   0.562   -32.763 1.00 0.00 ? 115 LYS A HD2  3  
ATOM 6281  H HD3  . LYS A 1 115 ? 7.524   0.772   -32.391 1.00 0.00 ? 115 LYS A HD3  3  
ATOM 6282  H HE2  . LYS A 1 115 ? 8.406   2.738   -31.503 1.00 0.00 ? 115 LYS A HE2  3  
ATOM 6283  H HE3  . LYS A 1 115 ? 8.454   1.689   -30.091 1.00 0.00 ? 115 LYS A HE3  3  
ATOM 6284  H HZ1  . LYS A 1 115 ? 10.740  1.939   -31.948 1.00 0.00 ? 115 LYS A HZ1  3  
ATOM 6285  H HZ2  . LYS A 1 115 ? 10.535  2.971   -30.615 1.00 0.00 ? 115 LYS A HZ2  3  
ATOM 6286  H HZ3  . LYS A 1 115 ? 10.729  1.301   -30.374 1.00 0.00 ? 115 LYS A HZ3  3  
ATOM 6287  N N    . LEU A 1 116 ? 9.596   -5.270  -31.141 1.00 0.00 ? 116 LEU A N    3  
ATOM 6288  C CA   . LEU A 1 116 ? 10.458  -6.428  -31.502 1.00 0.00 ? 116 LEU A CA   3  
ATOM 6289  C C    . LEU A 1 116 ? 9.614   -7.632  -31.896 1.00 0.00 ? 116 LEU A C    3  
ATOM 6290  O O    . LEU A 1 116 ? 9.287   -8.460  -31.072 1.00 0.00 ? 116 LEU A O    3  
ATOM 6291  C CB   . LEU A 1 116 ? 11.296  -6.794  -30.269 1.00 0.00 ? 116 LEU A CB   3  
ATOM 6292  C CG   . LEU A 1 116 ? 11.964  -5.528  -29.730 1.00 0.00 ? 116 LEU A CG   3  
ATOM 6293  C CD1  . LEU A 1 116 ? 12.737  -5.868  -28.455 1.00 0.00 ? 116 LEU A CD1  3  
ATOM 6294  C CD2  . LEU A 1 116 ? 12.938  -4.989  -30.781 1.00 0.00 ? 116 LEU A CD2  3  
ATOM 6295  H H    . LEU A 1 116 ? 9.069   -5.291  -30.315 1.00 0.00 ? 116 LEU A H    3  
ATOM 6296  H HA   . LEU A 1 116 ? 11.098  -6.156  -32.335 1.00 0.00 ? 116 LEU A HA   3  
ATOM 6297  H HB2  . LEU A 1 116 ? 10.657  -7.220  -29.510 1.00 0.00 ? 116 LEU A HB2  3  
ATOM 6298  H HB3  . LEU A 1 116 ? 12.049  -7.515  -30.541 1.00 0.00 ? 116 LEU A HB3  3  
ATOM 6299  H HG   . LEU A 1 116 ? 11.214  -4.783  -29.513 1.00 0.00 ? 116 LEU A HG   3  
ATOM 6300  H HD11 . LEU A 1 116 ? 13.083  -6.890  -28.501 1.00 0.00 ? 116 LEU A HD11 3  
ATOM 6301  H HD12 . LEU A 1 116 ? 13.587  -5.208  -28.356 1.00 0.00 ? 116 LEU A HD12 3  
ATOM 6302  H HD13 . LEU A 1 116 ? 12.094  -5.748  -27.595 1.00 0.00 ? 116 LEU A HD13 3  
ATOM 6303  H HD21 . LEU A 1 116 ? 13.545  -5.795  -31.164 1.00 0.00 ? 116 LEU A HD21 3  
ATOM 6304  H HD22 . LEU A 1 116 ? 12.385  -4.541  -31.594 1.00 0.00 ? 116 LEU A HD22 3  
ATOM 6305  H HD23 . LEU A 1 116 ? 13.578  -4.242  -30.334 1.00 0.00 ? 116 LEU A HD23 3  
ATOM 6306  N N    . THR A 1 117 ? 9.275   -7.705  -33.153 1.00 0.00 ? 117 THR A N    3  
ATOM 6307  C CA   . THR A 1 117 ? 8.453   -8.845  -33.620 1.00 0.00 ? 117 THR A CA   3  
ATOM 6308  C C    . THR A 1 117 ? 8.976   -10.160 -33.052 1.00 0.00 ? 117 THR A C    3  
ATOM 6309  O O    . THR A 1 117 ? 10.145  -10.288 -32.751 1.00 0.00 ? 117 THR A O    3  
ATOM 6310  C CB   . THR A 1 117 ? 8.535   -8.901  -35.146 1.00 0.00 ? 117 THR A CB   3  
ATOM 6311  O OG1  . THR A 1 117 ? 8.800   -7.573  -35.555 1.00 0.00 ? 117 THR A OG1  3  
ATOM 6312  C CG2  . THR A 1 117 ? 7.164   -9.224  -35.753 1.00 0.00 ? 117 THR A CG2  3  
ATOM 6313  H H    . THR A 1 117 ? 9.561   -7.010  -33.783 1.00 0.00 ? 117 THR A H    3  
ATOM 6314  H HA   . THR A 1 117 ? 7.426   -8.701  -33.292 1.00 0.00 ? 117 THR A HA   3  
ATOM 6315  H HB   . THR A 1 117 ? 9.317   -9.575  -35.484 1.00 0.00 ? 117 THR A HB   3  
ATOM 6316  H HG1  . THR A 1 117 ? 9.748   -7.485  -35.680 1.00 0.00 ? 117 THR A HG1  3  
ATOM 6317  H HG21 . THR A 1 117 ? 6.412   -8.583  -35.318 1.00 0.00 ? 117 THR A HG21 3  
ATOM 6318  H HG22 . THR A 1 117 ? 7.191   -9.066  -36.821 1.00 0.00 ? 117 THR A HG22 3  
ATOM 6319  H HG23 . THR A 1 117 ? 6.911   -10.254 -35.552 1.00 0.00 ? 117 THR A HG23 3  
ATOM 6320  N N    . ASP A 1 118 ? 8.096   -11.115 -32.919 1.00 0.00 ? 118 ASP A N    3  
ATOM 6321  C CA   . ASP A 1 118 ? 8.522   -12.428 -32.373 1.00 0.00 ? 118 ASP A CA   3  
ATOM 6322  C C    . ASP A 1 118 ? 9.734   -12.963 -33.125 1.00 0.00 ? 118 ASP A C    3  
ATOM 6323  O O    . ASP A 1 118 ? 10.523  -13.712 -32.583 1.00 0.00 ? 118 ASP A O    3  
ATOM 6324  C CB   . ASP A 1 118 ? 7.360   -13.419 -32.539 1.00 0.00 ? 118 ASP A CB   3  
ATOM 6325  C CG   . ASP A 1 118 ? 6.059   -12.755 -32.086 1.00 0.00 ? 118 ASP A CG   3  
ATOM 6326  O OD1  . ASP A 1 118 ? 6.142   -11.591 -31.730 1.00 0.00 ? 118 ASP A OD1  3  
ATOM 6327  O OD2  . ASP A 1 118 ? 5.056   -13.448 -32.122 1.00 0.00 ? 118 ASP A OD2  3  
ATOM 6328  H H    . ASP A 1 118 ? 7.162   -10.967 -33.175 1.00 0.00 ? 118 ASP A H    3  
ATOM 6329  H HA   . ASP A 1 118 ? 8.780   -12.307 -31.321 1.00 0.00 ? 118 ASP A HA   3  
ATOM 6330  H HB2  . ASP A 1 118 ? 7.270   -13.709 -33.576 1.00 0.00 ? 118 ASP A HB2  3  
ATOM 6331  H HB3  . ASP A 1 118 ? 7.539   -14.298 -31.937 1.00 0.00 ? 118 ASP A HB3  3  
ATOM 6332  N N    . GLU A 1 119 ? 9.864   -12.570 -34.363 1.00 0.00 ? 119 GLU A N    3  
ATOM 6333  C CA   . GLU A 1 119 ? 11.018  -13.047 -35.161 1.00 0.00 ? 119 GLU A CA   3  
ATOM 6334  C C    . GLU A 1 119 ? 12.285  -12.289 -34.790 1.00 0.00 ? 119 GLU A C    3  
ATOM 6335  O O    . GLU A 1 119 ? 13.367  -12.841 -34.803 1.00 0.00 ? 119 GLU A O    3  
ATOM 6336  C CB   . GLU A 1 119 ? 10.714  -12.806 -36.648 1.00 0.00 ? 119 GLU A CB   3  
ATOM 6337  C CG   . GLU A 1 119 ? 9.711   -13.853 -37.135 1.00 0.00 ? 119 GLU A CG   3  
ATOM 6338  C CD   . GLU A 1 119 ? 9.157   -13.429 -38.497 1.00 0.00 ? 119 GLU A CD   3  
ATOM 6339  O OE1  . GLU A 1 119 ? 9.897   -12.756 -39.197 1.00 0.00 ? 119 GLU A OE1  3  
ATOM 6340  O OE2  . GLU A 1 119 ? 8.026   -13.801 -38.761 1.00 0.00 ? 119 GLU A OE2  3  
ATOM 6341  H H    . GLU A 1 119 ? 9.203   -11.966 -34.761 1.00 0.00 ? 119 GLU A H    3  
ATOM 6342  H HA   . GLU A 1 119 ? 11.171  -14.106 -34.964 1.00 0.00 ? 119 GLU A HA   3  
ATOM 6343  H HB2  . GLU A 1 119 ? 10.297  -11.818 -36.777 1.00 0.00 ? 119 GLU A HB2  3  
ATOM 6344  H HB3  . GLU A 1 119 ? 11.626  -12.883 -37.222 1.00 0.00 ? 119 GLU A HB3  3  
ATOM 6345  H HG2  . GLU A 1 119 ? 10.201  -14.811 -37.231 1.00 0.00 ? 119 GLU A HG2  3  
ATOM 6346  H HG3  . GLU A 1 119 ? 8.898   -13.937 -36.429 1.00 0.00 ? 119 GLU A HG3  3  
ATOM 6347  N N    . GLU A 1 120 ? 12.130  -11.037 -34.467 1.00 0.00 ? 120 GLU A N    3  
ATOM 6348  C CA   . GLU A 1 120 ? 13.303  -10.238 -34.096 1.00 0.00 ? 120 GLU A CA   3  
ATOM 6349  C C    . GLU A 1 120 ? 13.762  -10.611 -32.687 1.00 0.00 ? 120 GLU A C    3  
ATOM 6350  O O    . GLU A 1 120 ? 14.939  -10.595 -32.385 1.00 0.00 ? 120 GLU A O    3  
ATOM 6351  C CB   . GLU A 1 120 ? 12.884  -8.753  -34.144 1.00 0.00 ? 120 GLU A CB   3  
ATOM 6352  C CG   . GLU A 1 120 ? 13.639  -7.964  -33.084 1.00 0.00 ? 120 GLU A CG   3  
ATOM 6353  C CD   . GLU A 1 120 ? 15.142  -8.160  -33.283 1.00 0.00 ? 120 GLU A CD   3  
ATOM 6354  O OE1  . GLU A 1 120 ? 15.523  -8.279  -34.436 1.00 0.00 ? 120 GLU A OE1  3  
ATOM 6355  O OE2  . GLU A 1 120 ? 15.824  -8.181  -32.273 1.00 0.00 ? 120 GLU A OE2  3  
ATOM 6356  H H    . GLU A 1 120 ? 11.241  -10.629 -34.464 1.00 0.00 ? 120 GLU A H    3  
ATOM 6357  H HA   . GLU A 1 120 ? 14.109  -10.440 -34.801 1.00 0.00 ? 120 GLU A HA   3  
ATOM 6358  H HB2  . GLU A 1 120 ? 13.106  -8.347  -35.120 1.00 0.00 ? 120 GLU A HB2  3  
ATOM 6359  H HB3  . GLU A 1 120 ? 11.822  -8.672  -33.965 1.00 0.00 ? 120 GLU A HB3  3  
ATOM 6360  H HG2  . GLU A 1 120 ? 13.400  -6.918  -33.176 1.00 0.00 ? 120 GLU A HG2  3  
ATOM 6361  H HG3  . GLU A 1 120 ? 13.357  -8.309  -32.102 1.00 0.00 ? 120 GLU A HG3  3  
ATOM 6362  N N    . VAL A 1 121 ? 12.816  -10.952 -31.854 1.00 0.00 ? 121 VAL A N    3  
ATOM 6363  C CA   . VAL A 1 121 ? 13.168  -11.330 -30.465 1.00 0.00 ? 121 VAL A CA   3  
ATOM 6364  C C    . VAL A 1 121 ? 13.896  -12.666 -30.440 1.00 0.00 ? 121 VAL A C    3  
ATOM 6365  O O    . VAL A 1 121 ? 14.848  -12.845 -29.707 1.00 0.00 ? 121 VAL A O    3  
ATOM 6366  C CB   . VAL A 1 121 ? 11.869  -11.458 -29.657 1.00 0.00 ? 121 VAL A CB   3  
ATOM 6367  C CG1  . VAL A 1 121 ? 12.115  -12.355 -28.441 1.00 0.00 ? 121 VAL A CG1  3  
ATOM 6368  C CG2  . VAL A 1 121 ? 11.437  -10.072 -29.179 1.00 0.00 ? 121 VAL A CG2  3  
ATOM 6369  H H    . VAL A 1 121 ? 11.881  -10.959 -32.145 1.00 0.00 ? 121 VAL A H    3  
ATOM 6370  H HA   . VAL A 1 121 ? 13.815  -10.564 -30.039 1.00 0.00 ? 121 VAL A HA   3  
ATOM 6371  H HB   . VAL A 1 121 ? 11.097  -11.887 -30.275 1.00 0.00 ? 121 VAL A HB   3  
ATOM 6372  H HG11 . VAL A 1 121 ? 13.019  -12.044 -27.937 1.00 0.00 ? 121 VAL A HG11 3  
ATOM 6373  H HG12 . VAL A 1 121 ? 11.283  -12.279 -27.758 1.00 0.00 ? 121 VAL A HG12 3  
ATOM 6374  H HG13 . VAL A 1 121 ? 12.221  -13.381 -28.761 1.00 0.00 ? 121 VAL A HG13 3  
ATOM 6375  H HG21 . VAL A 1 121 ? 12.251  -9.600  -28.649 1.00 0.00 ? 121 VAL A HG21 3  
ATOM 6376  H HG22 . VAL A 1 121 ? 11.164  -9.463  -30.028 1.00 0.00 ? 121 VAL A HG22 3  
ATOM 6377  H HG23 . VAL A 1 121 ? 10.587  -10.163 -28.519 1.00 0.00 ? 121 VAL A HG23 3  
ATOM 6378  N N    . ASP A 1 122 ? 13.435  -13.583 -31.246 1.00 0.00 ? 122 ASP A N    3  
ATOM 6379  C CA   . ASP A 1 122 ? 14.090  -14.912 -31.283 1.00 0.00 ? 122 ASP A CA   3  
ATOM 6380  C C    . ASP A 1 122 ? 15.475  -14.804 -31.899 1.00 0.00 ? 122 ASP A C    3  
ATOM 6381  O O    . ASP A 1 122 ? 16.385  -15.512 -31.519 1.00 0.00 ? 122 ASP A O    3  
ATOM 6382  C CB   . ASP A 1 122 ? 13.233  -15.850 -32.146 1.00 0.00 ? 122 ASP A CB   3  
ATOM 6383  C CG   . ASP A 1 122 ? 13.616  -17.302 -31.848 1.00 0.00 ? 122 ASP A CG   3  
ATOM 6384  O OD1  . ASP A 1 122 ? 14.807  -17.564 -31.876 1.00 0.00 ? 122 ASP A OD1  3  
ATOM 6385  O OD2  . ASP A 1 122 ? 12.695  -18.066 -31.612 1.00 0.00 ? 122 ASP A OD2  3  
ATOM 6386  H H    . ASP A 1 122 ? 12.664  -13.393 -31.823 1.00 0.00 ? 122 ASP A H    3  
ATOM 6387  H HA   . ASP A 1 122 ? 14.180  -15.292 -30.265 1.00 0.00 ? 122 ASP A HA   3  
ATOM 6388  H HB2  . ASP A 1 122 ? 12.187  -15.703 -31.919 1.00 0.00 ? 122 ASP A HB2  3  
ATOM 6389  H HB3  . ASP A 1 122 ? 13.404  -15.644 -33.192 1.00 0.00 ? 122 ASP A HB3  3  
ATOM 6390  N N    . GLU A 1 123 ? 15.608  -13.916 -32.846 1.00 0.00 ? 123 GLU A N    3  
ATOM 6391  C CA   . GLU A 1 123 ? 16.924  -13.742 -33.504 1.00 0.00 ? 123 GLU A CA   3  
ATOM 6392  C C    . GLU A 1 123 ? 17.934  -13.153 -32.529 1.00 0.00 ? 123 GLU A C    3  
ATOM 6393  O O    . GLU A 1 123 ? 19.086  -13.537 -32.516 1.00 0.00 ? 123 GLU A O    3  
ATOM 6394  C CB   . GLU A 1 123 ? 16.748  -12.773 -34.682 1.00 0.00 ? 123 GLU A CB   3  
ATOM 6395  C CG   . GLU A 1 123 ? 18.017  -12.783 -35.535 1.00 0.00 ? 123 GLU A CG   3  
ATOM 6396  C CD   . GLU A 1 123 ? 17.814  -13.713 -36.733 1.00 0.00 ? 123 GLU A CD   3  
ATOM 6397  O OE1  . GLU A 1 123 ? 17.041  -13.325 -37.594 1.00 0.00 ? 123 GLU A OE1  3  
ATOM 6398  O OE2  . GLU A 1 123 ? 18.444  -14.758 -36.720 1.00 0.00 ? 123 GLU A OE2  3  
ATOM 6399  H H    . GLU A 1 123 ? 14.843  -13.367 -33.119 1.00 0.00 ? 123 GLU A H    3  
ATOM 6400  H HA   . GLU A 1 123 ? 17.282  -14.712 -33.847 1.00 0.00 ? 123 GLU A HA   3  
ATOM 6401  H HB2  . GLU A 1 123 ? 15.905  -13.080 -35.282 1.00 0.00 ? 123 GLU A HB2  3  
ATOM 6402  H HB3  . GLU A 1 123 ? 16.572  -11.776 -34.307 1.00 0.00 ? 123 GLU A HB3  3  
ATOM 6403  H HG2  . GLU A 1 123 ? 18.228  -11.786 -35.889 1.00 0.00 ? 123 GLU A HG2  3  
ATOM 6404  H HG3  . GLU A 1 123 ? 18.851  -13.137 -34.946 1.00 0.00 ? 123 GLU A HG3  3  
ATOM 6405  N N    . MET A 1 124 ? 17.480  -12.227 -31.729 1.00 0.00 ? 124 MET A N    3  
ATOM 6406  C CA   . MET A 1 124 ? 18.395  -11.597 -30.746 1.00 0.00 ? 124 MET A CA   3  
ATOM 6407  C C    . MET A 1 124 ? 18.714  -12.565 -29.620 1.00 0.00 ? 124 MET A C    3  
ATOM 6408  O O    . MET A 1 124 ? 19.852  -12.701 -29.216 1.00 0.00 ? 124 MET A O    3  
ATOM 6409  C CB   . MET A 1 124 ? 17.692  -10.366 -30.156 1.00 0.00 ? 124 MET A CB   3  
ATOM 6410  C CG   . MET A 1 124 ? 18.742  -9.343  -29.729 1.00 0.00 ? 124 MET A CG   3  
ATOM 6411  S SD   . MET A 1 124 ? 18.223  -8.056  -28.565 1.00 0.00 ? 124 MET A SD   3  
ATOM 6412  C CE   . MET A 1 124 ? 17.485  -9.154  -27.328 1.00 0.00 ? 124 MET A CE   3  
ATOM 6413  H H    . MET A 1 124 ? 16.541  -11.950 -31.775 1.00 0.00 ? 124 MET A H    3  
ATOM 6414  H HA   . MET A 1 124 ? 19.319  -11.318 -31.246 1.00 0.00 ? 124 MET A HA   3  
ATOM 6415  H HB2  . MET A 1 124 ? 17.040  -9.929  -30.898 1.00 0.00 ? 124 MET A HB2  3  
ATOM 6416  H HB3  . MET A 1 124 ? 17.104  -10.661 -29.299 1.00 0.00 ? 124 MET A HB3  3  
ATOM 6417  H HG2  . MET A 1 124 ? 19.567  -9.875  -29.282 1.00 0.00 ? 124 MET A HG2  3  
ATOM 6418  H HG3  . MET A 1 124 ? 19.113  -8.851  -30.616 1.00 0.00 ? 124 MET A HG3  3  
ATOM 6419  H HE1  . MET A 1 124 ? 18.023  -10.092 -27.313 1.00 0.00 ? 124 MET A HE1  3  
ATOM 6420  H HE2  . MET A 1 124 ? 17.543  -8.689  -26.356 1.00 0.00 ? 124 MET A HE2  3  
ATOM 6421  H HE3  . MET A 1 124 ? 16.449  -9.336  -27.579 1.00 0.00 ? 124 MET A HE3  3  
ATOM 6422  N N    . ILE A 1 125 ? 17.702  -13.222 -29.135 1.00 0.00 ? 125 ILE A N    3  
ATOM 6423  C CA   . ILE A 1 125 ? 17.922  -14.187 -28.036 1.00 0.00 ? 125 ILE A CA   3  
ATOM 6424  C C    . ILE A 1 125 ? 18.929  -15.248 -28.449 1.00 0.00 ? 125 ILE A C    3  
ATOM 6425  O O    . ILE A 1 125 ? 19.796  -15.618 -27.681 1.00 0.00 ? 125 ILE A O    3  
ATOM 6426  C CB   . ILE A 1 125 ? 16.587  -14.857 -27.715 1.00 0.00 ? 125 ILE A CB   3  
ATOM 6427  C CG1  . ILE A 1 125 ? 15.814  -13.987 -26.736 1.00 0.00 ? 125 ILE A CG1  3  
ATOM 6428  C CG2  . ILE A 1 125 ? 16.861  -16.224 -27.058 1.00 0.00 ? 125 ILE A CG2  3  
ATOM 6429  C CD1  . ILE A 1 125 ? 14.437  -14.603 -26.482 1.00 0.00 ? 125 ILE A CD1  3  
ATOM 6430  H H    . ILE A 1 125 ? 16.804  -13.079 -29.497 1.00 0.00 ? 125 ILE A H    3  
ATOM 6431  H HA   . ILE A 1 125 ? 18.305  -13.653 -27.169 1.00 0.00 ? 125 ILE A HA   3  
ATOM 6432  H HB   . ILE A 1 125 ? 16.009  -14.970 -28.633 1.00 0.00 ? 125 ILE A HB   3  
ATOM 6433  H HG12 . ILE A 1 125 ? 16.359  -13.922 -25.809 1.00 0.00 ? 125 ILE A HG12 3  
ATOM 6434  H HG13 . ILE A 1 125 ? 15.697  -12.995 -27.148 1.00 0.00 ? 125 ILE A HG13 3  
ATOM 6435  H HG21 . ILE A 1 125 ? 17.627  -16.118 -26.303 1.00 0.00 ? 125 ILE A HG21 3  
ATOM 6436  H HG22 . ILE A 1 125 ? 15.960  -16.598 -26.599 1.00 0.00 ? 125 ILE A HG22 3  
ATOM 6437  H HG23 . ILE A 1 125 ? 17.197  -16.927 -27.807 1.00 0.00 ? 125 ILE A HG23 3  
ATOM 6438  H HD11 . ILE A 1 125 ? 14.112  -15.141 -27.360 1.00 0.00 ? 125 ILE A HD11 3  
ATOM 6439  H HD12 . ILE A 1 125 ? 14.489  -15.285 -25.647 1.00 0.00 ? 125 ILE A HD12 3  
ATOM 6440  H HD13 . ILE A 1 125 ? 13.724  -13.823 -26.260 1.00 0.00 ? 125 ILE A HD13 3  
ATOM 6441  N N    . ARG A 1 126 ? 18.797  -15.718 -29.653 1.00 0.00 ? 126 ARG A N    3  
ATOM 6442  C CA   . ARG A 1 126 ? 19.738  -16.752 -30.132 1.00 0.00 ? 126 ARG A CA   3  
ATOM 6443  C C    . ARG A 1 126 ? 21.157  -16.201 -30.149 1.00 0.00 ? 126 ARG A C    3  
ATOM 6444  O O    . ARG A 1 126 ? 22.108  -16.934 -30.338 1.00 0.00 ? 126 ARG A O    3  
ATOM 6445  C CB   . ARG A 1 126 ? 19.335  -17.146 -31.562 1.00 0.00 ? 126 ARG A CB   3  
ATOM 6446  C CG   . ARG A 1 126 ? 20.149  -18.365 -32.000 1.00 0.00 ? 126 ARG A CG   3  
ATOM 6447  C CD   . ARG A 1 126 ? 19.330  -19.179 -33.007 1.00 0.00 ? 126 ARG A CD   3  
ATOM 6448  N NE   . ARG A 1 126 ? 20.119  -20.374 -33.422 1.00 0.00 ? 126 ARG A NE   3  
ATOM 6449  C CZ   . ARG A 1 126 ? 19.976  -21.494 -32.769 1.00 0.00 ? 126 ARG A CZ   3  
ATOM 6450  N NH1  . ARG A 1 126 ? 18.796  -22.053 -32.725 1.00 0.00 ? 126 ARG A NH1  3  
ATOM 6451  N NH2  . ARG A 1 126 ? 21.018  -22.021 -32.187 1.00 0.00 ? 126 ARG A NH2  3  
ATOM 6452  H H    . ARG A 1 126 ? 18.083  -15.390 -30.237 1.00 0.00 ? 126 ARG A H    3  
ATOM 6453  H HA   . ARG A 1 126 ? 19.696  -17.612 -29.463 1.00 0.00 ? 126 ARG A HA   3  
ATOM 6454  H HB2  . ARG A 1 126 ? 18.283  -17.385 -31.589 1.00 0.00 ? 126 ARG A HB2  3  
ATOM 6455  H HB3  . ARG A 1 126 ? 19.527  -16.321 -32.232 1.00 0.00 ? 126 ARG A HB3  3  
ATOM 6456  H HG2  . ARG A 1 126 ? 21.071  -18.039 -32.461 1.00 0.00 ? 126 ARG A HG2  3  
ATOM 6457  H HG3  . ARG A 1 126 ? 20.380  -18.976 -31.140 1.00 0.00 ? 126 ARG A HG3  3  
ATOM 6458  H HD2  . ARG A 1 126 ? 18.404  -19.501 -32.553 1.00 0.00 ? 126 ARG A HD2  3  
ATOM 6459  H HD3  . ARG A 1 126 ? 19.112  -18.575 -33.876 1.00 0.00 ? 126 ARG A HD3  3  
ATOM 6460  H HE   . ARG A 1 126 ? 20.739  -20.319 -34.179 1.00 0.00 ? 126 ARG A HE   3  
ATOM 6461  H HH11 . ARG A 1 126 ? 18.022  -21.623 -33.189 1.00 0.00 ? 126 ARG A HH11 3  
ATOM 6462  H HH12 . ARG A 1 126 ? 18.668  -22.909 -32.224 1.00 0.00 ? 126 ARG A HH12 3  
ATOM 6463  H HH21 . ARG A 1 126 ? 21.906  -21.568 -32.247 1.00 0.00 ? 126 ARG A HH21 3  
ATOM 6464  H HH22 . ARG A 1 126 ? 20.927  -22.879 -31.681 1.00 0.00 ? 126 ARG A HH22 3  
ATOM 6465  N N    . GLU A 1 127 ? 21.265  -14.906 -29.949 1.00 0.00 ? 127 GLU A N    3  
ATOM 6466  C CA   . GLU A 1 127 ? 22.605  -14.261 -29.945 1.00 0.00 ? 127 GLU A CA   3  
ATOM 6467  C C    . GLU A 1 127 ? 22.766  -13.356 -28.721 1.00 0.00 ? 127 GLU A C    3  
ATOM 6468  O O    . GLU A 1 127 ? 23.424  -12.336 -28.780 1.00 0.00 ? 127 GLU A O    3  
ATOM 6469  C CB   . GLU A 1 127 ? 22.723  -13.405 -31.220 1.00 0.00 ? 127 GLU A CB   3  
ATOM 6470  C CG   . GLU A 1 127 ? 24.099  -13.625 -31.850 1.00 0.00 ? 127 GLU A CG   3  
ATOM 6471  C CD   . GLU A 1 127 ? 24.089  -13.095 -33.286 1.00 0.00 ? 127 GLU A CD   3  
ATOM 6472  O OE1  . GLU A 1 127 ? 23.630  -11.976 -33.446 1.00 0.00 ? 127 GLU A OE1  3  
ATOM 6473  O OE2  . GLU A 1 127 ? 24.539  -13.839 -34.141 1.00 0.00 ? 127 GLU A OE2  3  
ATOM 6474  H H    . GLU A 1 127 ? 20.460  -14.362 -29.809 1.00 0.00 ? 127 GLU A H    3  
ATOM 6475  H HA   . GLU A 1 127 ? 23.375  -15.030 -29.920 1.00 0.00 ? 127 GLU A HA   3  
ATOM 6476  H HB2  . GLU A 1 127 ? 21.953  -13.696 -31.921 1.00 0.00 ? 127 GLU A HB2  3  
ATOM 6477  H HB3  . GLU A 1 127 ? 22.599  -12.363 -30.974 1.00 0.00 ? 127 GLU A HB3  3  
ATOM 6478  H HG2  . GLU A 1 127 ? 24.850  -13.098 -31.281 1.00 0.00 ? 127 GLU A HG2  3  
ATOM 6479  H HG3  . GLU A 1 127 ? 24.335  -14.679 -31.861 1.00 0.00 ? 127 GLU A HG3  3  
ATOM 6480  N N    . ALA A 1 128 ? 22.163  -13.753 -27.629 1.00 0.00 ? 128 ALA A N    3  
ATOM 6481  C CA   . ALA A 1 128 ? 22.269  -12.930 -26.394 1.00 0.00 ? 128 ALA A CA   3  
ATOM 6482  C C    . ALA A 1 128 ? 23.612  -13.144 -25.709 1.00 0.00 ? 128 ALA A C    3  
ATOM 6483  O O    . ALA A 1 128 ? 23.670  -13.357 -24.513 1.00 0.00 ? 128 ALA A O    3  
ATOM 6484  C CB   . ALA A 1 128 ? 21.153  -13.360 -25.424 1.00 0.00 ? 128 ALA A CB   3  
ATOM 6485  H H    . ALA A 1 128 ? 21.647  -14.585 -27.624 1.00 0.00 ? 128 ALA A H    3  
ATOM 6486  H HA   . ALA A 1 128 ? 22.168  -11.879 -26.658 1.00 0.00 ? 128 ALA A HA   3  
ATOM 6487  H HB1  . ALA A 1 128 ? 20.243  -13.547 -25.973 1.00 0.00 ? 128 ALA A HB1  3  
ATOM 6488  H HB2  . ALA A 1 128 ? 21.448  -14.260 -24.904 1.00 0.00 ? 128 ALA A HB2  3  
ATOM 6489  H HB3  . ALA A 1 128 ? 20.977  -12.577 -24.700 1.00 0.00 ? 128 ALA A HB3  3  
ATOM 6490  N N    . ASN A 1 129 ? 24.673  -13.081 -26.482 1.00 0.00 ? 129 ASN A N    3  
ATOM 6491  C CA   . ASN A 1 129 ? 26.028  -13.277 -25.900 1.00 0.00 ? 129 ASN A CA   3  
ATOM 6492  C C    . ASN A 1 129 ? 26.010  -14.378 -24.842 1.00 0.00 ? 129 ASN A C    3  
ATOM 6493  O O    . ASN A 1 129 ? 26.519  -14.210 -23.752 1.00 0.00 ? 129 ASN A O    3  
ATOM 6494  C CB   . ASN A 1 129 ? 26.473  -11.954 -25.249 1.00 0.00 ? 129 ASN A CB   3  
ATOM 6495  C CG   . ASN A 1 129 ? 25.290  -11.324 -24.510 1.00 0.00 ? 129 ASN A CG   3  
ATOM 6496  O OD1  . ASN A 1 129 ? 24.463  -10.656 -25.097 1.00 0.00 ? 129 ASN A OD1  3  
ATOM 6497  N ND2  . ASN A 1 129 ? 25.174  -11.512 -23.224 1.00 0.00 ? 129 ASN A ND2  3  
ATOM 6498  H H    . ASN A 1 129 ? 24.571  -12.907 -27.441 1.00 0.00 ? 129 ASN A H    3  
ATOM 6499  H HA   . ASN A 1 129 ? 26.714  -13.565 -26.696 1.00 0.00 ? 129 ASN A HA   3  
ATOM 6500  H HB2  . ASN A 1 129 ? 27.273  -12.138 -24.549 1.00 0.00 ? 129 ASN A HB2  3  
ATOM 6501  H HB3  . ASN A 1 129 ? 26.819  -11.271 -26.011 1.00 0.00 ? 129 ASN A HB3  3  
ATOM 6502  H HD21 . ASN A 1 129 ? 25.839  -12.048 -22.745 1.00 0.00 ? 129 ASN A HD21 3  
ATOM 6503  H HD22 . ASN A 1 129 ? 24.420  -11.116 -22.738 1.00 0.00 ? 129 ASN A HD22 3  
ATOM 6504  N N    . ILE A 1 130 ? 25.418  -15.488 -25.189 1.00 0.00 ? 130 ILE A N    3  
ATOM 6505  C CA   . ILE A 1 130 ? 25.352  -16.610 -24.226 1.00 0.00 ? 130 ILE A CA   3  
ATOM 6506  C C    . ILE A 1 130 ? 26.596  -17.472 -24.309 1.00 0.00 ? 130 ILE A C    3  
ATOM 6507  O O    . ILE A 1 130 ? 27.702  -16.971 -24.373 1.00 0.00 ? 130 ILE A O    3  
ATOM 6508  C CB   . ILE A 1 130 ? 24.140  -17.472 -24.572 1.00 0.00 ? 130 ILE A CB   3  
ATOM 6509  C CG1  . ILE A 1 130 ? 22.925  -16.587 -24.808 1.00 0.00 ? 130 ILE A CG1  3  
ATOM 6510  C CG2  . ILE A 1 130 ? 23.845  -18.400 -23.381 1.00 0.00 ? 130 ILE A CG2  3  
ATOM 6511  C CD1  . ILE A 1 130 ? 21.747  -17.460 -25.248 1.00 0.00 ? 130 ILE A CD1  3  
ATOM 6512  H H    . ILE A 1 130 ? 25.020  -15.577 -26.081 1.00 0.00 ? 130 ILE A H    3  
ATOM 6513  H HA   . ILE A 1 130 ? 25.266  -16.217 -23.223 1.00 0.00 ? 130 ILE A HA   3  
ATOM 6514  H HB   . ILE A 1 130 ? 24.350  -18.047 -25.473 1.00 0.00 ? 130 ILE A HB   3  
ATOM 6515  H HG12 . ILE A 1 130 ? 22.671  -16.067 -23.895 1.00 0.00 ? 130 ILE A HG12 3  
ATOM 6516  H HG13 . ILE A 1 130 ? 23.148  -15.863 -25.577 1.00 0.00 ? 130 ILE A HG13 3  
ATOM 6517  H HG21 . ILE A 1 130 ? 24.705  -18.441 -22.729 1.00 0.00 ? 130 ILE A HG21 3  
ATOM 6518  H HG22 . ILE A 1 130 ? 22.997  -18.027 -22.828 1.00 0.00 ? 130 ILE A HG22 3  
ATOM 6519  H HG23 . ILE A 1 130 ? 23.625  -19.395 -23.740 1.00 0.00 ? 130 ILE A HG23 3  
ATOM 6520  H HD11 . ILE A 1 130 ? 21.902  -18.476 -24.916 1.00 0.00 ? 130 ILE A HD11 3  
ATOM 6521  H HD12 . ILE A 1 130 ? 20.832  -17.080 -24.818 1.00 0.00 ? 130 ILE A HD12 3  
ATOM 6522  H HD13 . ILE A 1 130 ? 21.666  -17.446 -26.325 1.00 0.00 ? 130 ILE A HD13 3  
ATOM 6523  N N    . ASP A 1 131 ? 26.387  -18.755 -24.295 1.00 0.00 ? 131 ASP A N    3  
ATOM 6524  C CA   . ASP A 1 131 ? 27.534  -19.697 -24.372 1.00 0.00 ? 131 ASP A CA   3  
ATOM 6525  C C    . ASP A 1 131 ? 28.251  -19.787 -23.032 1.00 0.00 ? 131 ASP A C    3  
ATOM 6526  O O    . ASP A 1 131 ? 29.250  -20.465 -22.903 1.00 0.00 ? 131 ASP A O    3  
ATOM 6527  C CB   . ASP A 1 131 ? 28.524  -19.184 -25.433 1.00 0.00 ? 131 ASP A CB   3  
ATOM 6528  C CG   . ASP A 1 131 ? 29.100  -20.374 -26.203 1.00 0.00 ? 131 ASP A CG   3  
ATOM 6529  O OD1  . ASP A 1 131 ? 29.975  -21.010 -25.638 1.00 0.00 ? 131 ASP A OD1  3  
ATOM 6530  O OD2  . ASP A 1 131 ? 28.634  -20.579 -27.312 1.00 0.00 ? 131 ASP A OD2  3  
ATOM 6531  H H    . ASP A 1 131 ? 25.474  -19.097 -24.226 1.00 0.00 ? 131 ASP A H    3  
ATOM 6532  H HA   . ASP A 1 131 ? 27.161  -20.685 -24.638 1.00 0.00 ? 131 ASP A HA   3  
ATOM 6533  H HB2  . ASP A 1 131 ? 28.015  -18.528 -26.123 1.00 0.00 ? 131 ASP A HB2  3  
ATOM 6534  H HB3  . ASP A 1 131 ? 29.328  -18.646 -24.953 1.00 0.00 ? 131 ASP A HB3  3  
ATOM 6535  N N    . GLY A 1 132 ? 27.726  -19.099 -22.055 1.00 0.00 ? 132 GLY A N    3  
ATOM 6536  C CA   . GLY A 1 132 ? 28.368  -19.135 -20.712 1.00 0.00 ? 132 GLY A CA   3  
ATOM 6537  C C    . GLY A 1 132 ? 27.978  -20.418 -19.975 1.00 0.00 ? 132 GLY A C    3  
ATOM 6538  O O    . GLY A 1 132 ? 28.816  -21.244 -19.673 1.00 0.00 ? 132 GLY A O    3  
ATOM 6539  H H    . GLY A 1 132 ? 26.920  -18.562 -22.204 1.00 0.00 ? 132 GLY A H    3  
ATOM 6540  H HA2  . GLY A 1 132 ? 29.441  -19.101 -20.826 1.00 0.00 ? 132 GLY A HA2  3  
ATOM 6541  H HA3  . GLY A 1 132 ? 28.042  -18.280 -20.137 1.00 0.00 ? 132 GLY A HA3  3  
ATOM 6542  N N    . ASP A 1 133 ? 26.710  -20.558 -19.702 1.00 0.00 ? 133 ASP A N    3  
ATOM 6543  C CA   . ASP A 1 133 ? 26.246  -21.772 -18.992 1.00 0.00 ? 133 ASP A CA   3  
ATOM 6544  C C    . ASP A 1 133 ? 24.847  -22.161 -19.448 1.00 0.00 ? 133 ASP A C    3  
ATOM 6545  O O    . ASP A 1 133 ? 24.220  -23.023 -18.863 1.00 0.00 ? 133 ASP A O    3  
ATOM 6546  C CB   . ASP A 1 133 ? 26.207  -21.462 -17.489 1.00 0.00 ? 133 ASP A CB   3  
ATOM 6547  C CG   . ASP A 1 133 ? 25.645  -20.054 -17.278 1.00 0.00 ? 133 ASP A CG   3  
ATOM 6548  O OD1  . ASP A 1 133 ? 24.466  -19.896 -17.542 1.00 0.00 ? 133 ASP A OD1  3  
ATOM 6549  O OD2  . ASP A 1 133 ? 26.428  -19.215 -16.864 1.00 0.00 ? 133 ASP A OD2  3  
ATOM 6550  H H    . ASP A 1 133 ? 26.069  -19.865 -19.962 1.00 0.00 ? 133 ASP A H    3  
ATOM 6551  H HA   . ASP A 1 133 ? 26.932  -22.591 -19.201 1.00 0.00 ? 133 ASP A HA   3  
ATOM 6552  H HB2  . ASP A 1 133 ? 25.573  -22.178 -16.986 1.00 0.00 ? 133 ASP A HB2  3  
ATOM 6553  H HB3  . ASP A 1 133 ? 27.203  -21.513 -17.079 1.00 0.00 ? 133 ASP A HB3  3  
ATOM 6554  N N    . GLY A 1 134 ? 24.384  -21.516 -20.491 1.00 0.00 ? 134 GLY A N    3  
ATOM 6555  C CA   . GLY A 1 134 ? 23.020  -21.829 -21.013 1.00 0.00 ? 134 GLY A CA   3  
ATOM 6556  C C    . GLY A 1 134 ? 22.033  -20.724 -20.626 1.00 0.00 ? 134 GLY A C    3  
ATOM 6557  O O    . GLY A 1 134 ? 21.092  -20.447 -21.344 1.00 0.00 ? 134 GLY A O    3  
ATOM 6558  H H    . GLY A 1 134 ? 24.932  -20.830 -20.927 1.00 0.00 ? 134 GLY A H    3  
ATOM 6559  H HA2  . GLY A 1 134 ? 23.061  -21.909 -22.089 1.00 0.00 ? 134 GLY A HA2  3  
ATOM 6560  H HA3  . GLY A 1 134 ? 22.682  -22.767 -20.601 1.00 0.00 ? 134 GLY A HA3  3  
ATOM 6561  N N    . GLN A 1 135 ? 22.270  -20.114 -19.496 1.00 0.00 ? 135 GLN A N    3  
ATOM 6562  C CA   . GLN A 1 135 ? 21.362  -19.028 -19.047 1.00 0.00 ? 135 GLN A CA   3  
ATOM 6563  C C    . GLN A 1 135 ? 21.666  -17.721 -19.777 1.00 0.00 ? 135 GLN A C    3  
ATOM 6564  O O    . GLN A 1 135 ? 22.631  -17.627 -20.509 1.00 0.00 ? 135 GLN A O    3  
ATOM 6565  C CB   . GLN A 1 135 ? 21.578  -18.813 -17.540 1.00 0.00 ? 135 GLN A CB   3  
ATOM 6566  C CG   . GLN A 1 135 ? 21.549  -20.170 -16.830 1.00 0.00 ? 135 GLN A CG   3  
ATOM 6567  C CD   . GLN A 1 135 ? 21.547  -19.951 -15.315 1.00 0.00 ? 135 GLN A CD   3  
ATOM 6568  O OE1  . GLN A 1 135 ? 20.513  -19.953 -14.678 1.00 0.00 ? 135 GLN A OE1  3  
ATOM 6569  N NE2  . GLN A 1 135 ? 22.682  -19.760 -14.701 1.00 0.00 ? 135 GLN A NE2  3  
ATOM 6570  H H    . GLN A 1 135 ? 23.040  -20.372 -18.948 1.00 0.00 ? 135 GLN A H    3  
ATOM 6571  H HA   . GLN A 1 135 ? 20.329  -19.319 -19.251 1.00 0.00 ? 135 GLN A HA   3  
ATOM 6572  H HB2  . GLN A 1 135 ? 22.535  -18.339 -17.374 1.00 0.00 ? 135 GLN A HB2  3  
ATOM 6573  H HB3  . GLN A 1 135 ? 20.797  -18.181 -17.146 1.00 0.00 ? 135 GLN A HB3  3  
ATOM 6574  H HG2  . GLN A 1 135 ? 20.657  -20.710 -17.112 1.00 0.00 ? 135 GLN A HG2  3  
ATOM 6575  H HG3  . GLN A 1 135 ? 22.418  -20.747 -17.106 1.00 0.00 ? 135 GLN A HG3  3  
ATOM 6576  H HE21 . GLN A 1 135 ? 23.520  -19.759 -15.209 1.00 0.00 ? 135 GLN A HE21 3  
ATOM 6577  H HE22 . GLN A 1 135 ? 22.697  -19.618 -13.731 1.00 0.00 ? 135 GLN A HE22 3  
ATOM 6578  N N    . VAL A 1 136 ? 20.825  -16.738 -19.555 1.00 0.00 ? 136 VAL A N    3  
ATOM 6579  C CA   . VAL A 1 136 ? 21.023  -15.415 -20.215 1.00 0.00 ? 136 VAL A CA   3  
ATOM 6580  C C    . VAL A 1 136 ? 21.180  -14.316 -19.181 1.00 0.00 ? 136 VAL A C    3  
ATOM 6581  O O    . VAL A 1 136 ? 20.318  -14.124 -18.345 1.00 0.00 ? 136 VAL A O    3  
ATOM 6582  C CB   . VAL A 1 136 ? 19.775  -15.095 -21.050 1.00 0.00 ? 136 VAL A CB   3  
ATOM 6583  C CG1  . VAL A 1 136 ? 19.990  -13.772 -21.787 1.00 0.00 ? 136 VAL A CG1  3  
ATOM 6584  C CG2  . VAL A 1 136 ? 19.545  -16.203 -22.070 1.00 0.00 ? 136 VAL A CG2  3  
ATOM 6585  H H    . VAL A 1 136 ? 20.070  -16.873 -18.953 1.00 0.00 ? 136 VAL A H    3  
ATOM 6586  H HA   . VAL A 1 136 ? 21.910  -15.444 -20.842 1.00 0.00 ? 136 VAL A HA   3  
ATOM 6587  H HB   . VAL A 1 136 ? 18.920  -15.015 -20.402 1.00 0.00 ? 136 VAL A HB   3  
ATOM 6588  H HG11 . VAL A 1 136 ? 20.877  -13.834 -22.400 1.00 0.00 ? 136 VAL A HG11 3  
ATOM 6589  H HG12 . VAL A 1 136 ? 19.137  -13.562 -22.416 1.00 0.00 ? 136 VAL A HG12 3  
ATOM 6590  H HG13 . VAL A 1 136 ? 20.109  -12.971 -21.071 1.00 0.00 ? 136 VAL A HG13 3  
ATOM 6591  H HG21 . VAL A 1 136 ? 20.445  -16.361 -22.643 1.00 0.00 ? 136 VAL A HG21 3  
ATOM 6592  H HG22 . VAL A 1 136 ? 19.280  -17.115 -21.560 1.00 0.00 ? 136 VAL A HG22 3  
ATOM 6593  H HG23 . VAL A 1 136 ? 18.743  -15.920 -22.736 1.00 0.00 ? 136 VAL A HG23 3  
ATOM 6594  N N    . ASN A 1 137 ? 22.268  -13.608 -19.248 1.00 0.00 ? 137 ASN A N    3  
ATOM 6595  C CA   . ASN A 1 137 ? 22.470  -12.524 -18.269 1.00 0.00 ? 137 ASN A CA   3  
ATOM 6596  C C    . ASN A 1 137 ? 21.485  -11.403 -18.557 1.00 0.00 ? 137 ASN A C    3  
ATOM 6597  O O    . ASN A 1 137 ? 21.805  -10.447 -19.237 1.00 0.00 ? 137 ASN A O    3  
ATOM 6598  C CB   . ASN A 1 137 ? 23.906  -11.990 -18.411 1.00 0.00 ? 137 ASN A CB   3  
ATOM 6599  C CG   . ASN A 1 137 ? 24.458  -12.384 -19.783 1.00 0.00 ? 137 ASN A CG   3  
ATOM 6600  O OD1  . ASN A 1 137 ? 23.876  -12.086 -20.806 1.00 0.00 ? 137 ASN A OD1  3  
ATOM 6601  N ND2  . ASN A 1 137 ? 25.576  -13.054 -19.847 1.00 0.00 ? 137 ASN A ND2  3  
ATOM 6602  H H    . ASN A 1 137 ? 22.941  -13.791 -19.936 1.00 0.00 ? 137 ASN A H    3  
ATOM 6603  H HA   . ASN A 1 137 ? 22.291  -12.910 -17.265 1.00 0.00 ? 137 ASN A HA   3  
ATOM 6604  H HB2  . ASN A 1 137 ? 23.909  -10.915 -18.320 1.00 0.00 ? 137 ASN A HB2  3  
ATOM 6605  H HB3  . ASN A 1 137 ? 24.532  -12.414 -17.640 1.00 0.00 ? 137 ASN A HB3  3  
ATOM 6606  H HD21 . ASN A 1 137 ? 26.050  -13.296 -19.024 1.00 0.00 ? 137 ASN A HD21 3  
ATOM 6607  H HD22 . ASN A 1 137 ? 25.942  -13.314 -20.717 1.00 0.00 ? 137 ASN A HD22 3  
ATOM 6608  N N    . TYR A 1 138 ? 20.289  -11.553 -18.046 1.00 0.00 ? 138 TYR A N    3  
ATOM 6609  C CA   . TYR A 1 138 ? 19.258  -10.514 -18.274 1.00 0.00 ? 138 TYR A CA   3  
ATOM 6610  C C    . TYR A 1 138 ? 19.856  -9.113  -18.167 1.00 0.00 ? 138 TYR A C    3  
ATOM 6611  O O    . TYR A 1 138 ? 19.318  -8.166  -18.701 1.00 0.00 ? 138 TYR A O    3  
ATOM 6612  C CB   . TYR A 1 138 ? 18.144  -10.689 -17.224 1.00 0.00 ? 138 TYR A CB   3  
ATOM 6613  C CG   . TYR A 1 138 ? 18.464  -9.876  -15.971 1.00 0.00 ? 138 TYR A CG   3  
ATOM 6614  C CD1  . TYR A 1 138 ? 18.172  -8.533  -15.919 1.00 0.00 ? 138 TYR A CD1  3  
ATOM 6615  C CD2  . TYR A 1 138 ? 19.026  -10.479 -14.867 1.00 0.00 ? 138 TYR A CD2  3  
ATOM 6616  C CE1  . TYR A 1 138 ? 18.436  -7.801  -14.782 1.00 0.00 ? 138 TYR A CE1  3  
ATOM 6617  C CE2  . TYR A 1 138 ? 19.290  -9.747  -13.728 1.00 0.00 ? 138 TYR A CE2  3  
ATOM 6618  C CZ   . TYR A 1 138 ? 18.996  -8.402  -13.678 1.00 0.00 ? 138 TYR A CZ   3  
ATOM 6619  O OH   . TYR A 1 138 ? 19.267  -7.668  -12.544 1.00 0.00 ? 138 TYR A OH   3  
ATOM 6620  H H    . TYR A 1 138 ? 20.075  -12.352 -17.518 1.00 0.00 ? 138 TYR A H    3  
ATOM 6621  H HA   . TYR A 1 138 ? 18.856  -10.646 -19.282 1.00 0.00 ? 138 TYR A HA   3  
ATOM 6622  H HB2  . TYR A 1 138 ? 17.201  -10.353 -17.634 1.00 0.00 ? 138 TYR A HB2  3  
ATOM 6623  H HB3  . TYR A 1 138 ? 18.063  -11.729 -16.957 1.00 0.00 ? 138 TYR A HB3  3  
ATOM 6624  H HD1  . TYR A 1 138 ? 17.726  -8.054  -16.773 1.00 0.00 ? 138 TYR A HD1  3  
ATOM 6625  H HD2  . TYR A 1 138 ? 19.262  -11.533 -14.894 1.00 0.00 ? 138 TYR A HD2  3  
ATOM 6626  H HE1  . TYR A 1 138 ? 18.198  -6.753  -14.754 1.00 0.00 ? 138 TYR A HE1  3  
ATOM 6627  H HE2  . TYR A 1 138 ? 19.718  -10.234 -12.867 1.00 0.00 ? 138 TYR A HE2  3  
ATOM 6628  H HH   . TYR A 1 138 ? 18.927  -8.152  -11.790 1.00 0.00 ? 138 TYR A HH   3  
ATOM 6629  N N    . GLU A 1 139 ? 20.965  -9.008  -17.480 1.00 0.00 ? 139 GLU A N    3  
ATOM 6630  C CA   . GLU A 1 139 ? 21.604  -7.673  -17.338 1.00 0.00 ? 139 GLU A CA   3  
ATOM 6631  C C    . GLU A 1 139 ? 22.138  -7.224  -18.684 1.00 0.00 ? 139 GLU A C    3  
ATOM 6632  O O    . GLU A 1 139 ? 21.658  -6.261  -19.253 1.00 0.00 ? 139 GLU A O    3  
ATOM 6633  C CB   . GLU A 1 139 ? 22.775  -7.790  -16.351 1.00 0.00 ? 139 GLU A CB   3  
ATOM 6634  C CG   . GLU A 1 139 ? 22.254  -8.338  -15.021 1.00 0.00 ? 139 GLU A CG   3  
ATOM 6635  C CD   . GLU A 1 139 ? 23.409  -8.412  -14.019 1.00 0.00 ? 139 GLU A CD   3  
ATOM 6636  O OE1  . GLU A 1 139 ? 24.176  -9.351  -14.146 1.00 0.00 ? 139 GLU A OE1  3  
ATOM 6637  O OE2  . GLU A 1 139 ? 23.458  -7.523  -13.184 1.00 0.00 ? 139 GLU A OE2  3  
ATOM 6638  H H    . GLU A 1 139 ? 21.368  -9.798  -17.065 1.00 0.00 ? 139 GLU A H    3  
ATOM 6639  H HA   . GLU A 1 139 ? 20.860  -6.950  -16.990 1.00 0.00 ? 139 GLU A HA   3  
ATOM 6640  H HB2  . GLU A 1 139 ? 23.522  -8.459  -16.752 1.00 0.00 ? 139 GLU A HB2  3  
ATOM 6641  H HB3  . GLU A 1 139 ? 23.216  -6.818  -16.195 1.00 0.00 ? 139 GLU A HB3  3  
ATOM 6642  H HG2  . GLU A 1 139 ? 21.486  -7.687  -14.632 1.00 0.00 ? 139 GLU A HG2  3  
ATOM 6643  H HG3  . GLU A 1 139 ? 21.845  -9.328  -15.167 1.00 0.00 ? 139 GLU A HG3  3  
ATOM 6644  N N    . GLU A 1 140 ? 23.130  -7.924  -19.178 1.00 0.00 ? 140 GLU A N    3  
ATOM 6645  C CA   . GLU A 1 140 ? 23.692  -7.538  -20.489 1.00 0.00 ? 140 GLU A CA   3  
ATOM 6646  C C    . GLU A 1 140 ? 22.551  -7.326  -21.457 1.00 0.00 ? 140 GLU A C    3  
ATOM 6647  O O    . GLU A 1 140 ? 22.615  -6.498  -22.344 1.00 0.00 ? 140 GLU A O    3  
ATOM 6648  C CB   . GLU A 1 140 ? 24.580  -8.683  -21.003 1.00 0.00 ? 140 GLU A CB   3  
ATOM 6649  C CG   . GLU A 1 140 ? 25.908  -8.676  -20.237 1.00 0.00 ? 140 GLU A CG   3  
ATOM 6650  C CD   . GLU A 1 140 ? 27.067  -8.590  -21.234 1.00 0.00 ? 140 GLU A CD   3  
ATOM 6651  O OE1  . GLU A 1 140 ? 26.989  -7.715  -22.080 1.00 0.00 ? 140 GLU A OE1  3  
ATOM 6652  O OE2  . GLU A 1 140 ? 27.963  -9.406  -21.093 1.00 0.00 ? 140 GLU A OE2  3  
ATOM 6653  H H    . GLU A 1 140 ? 23.491  -8.691  -18.688 1.00 0.00 ? 140 GLU A H    3  
ATOM 6654  H HA   . GLU A 1 140 ? 24.256  -6.611  -20.383 1.00 0.00 ? 140 GLU A HA   3  
ATOM 6655  H HB2  . GLU A 1 140 ? 24.078  -9.627  -20.849 1.00 0.00 ? 140 GLU A HB2  3  
ATOM 6656  H HB3  . GLU A 1 140 ? 24.768  -8.550  -22.058 1.00 0.00 ? 140 GLU A HB3  3  
ATOM 6657  H HG2  . GLU A 1 140 ? 25.944  -7.823  -19.573 1.00 0.00 ? 140 GLU A HG2  3  
ATOM 6658  H HG3  . GLU A 1 140 ? 26.001  -9.584  -19.659 1.00 0.00 ? 140 GLU A HG3  3  
ATOM 6659  N N    . PHE A 1 141 ? 21.513  -8.094  -21.257 1.00 0.00 ? 141 PHE A N    3  
ATOM 6660  C CA   . PHE A 1 141 ? 20.333  -7.983  -22.131 1.00 0.00 ? 141 PHE A CA   3  
ATOM 6661  C C    . PHE A 1 141 ? 19.704  -6.609  -21.959 1.00 0.00 ? 141 PHE A C    3  
ATOM 6662  O O    . PHE A 1 141 ? 19.371  -5.946  -22.917 1.00 0.00 ? 141 PHE A O    3  
ATOM 6663  C CB   . PHE A 1 141 ? 19.317  -9.051  -21.681 1.00 0.00 ? 141 PHE A CB   3  
ATOM 6664  C CG   . PHE A 1 141 ? 18.591  -9.637  -22.894 1.00 0.00 ? 141 PHE A CG   3  
ATOM 6665  C CD1  . PHE A 1 141 ? 19.288  -10.320 -23.876 1.00 0.00 ? 141 PHE A CD1  3  
ATOM 6666  C CD2  . PHE A 1 141 ? 17.218  -9.513  -23.010 1.00 0.00 ? 141 PHE A CD2  3  
ATOM 6667  C CE1  . PHE A 1 141 ? 18.619  -10.868 -24.952 1.00 0.00 ? 141 PHE A CE1  3  
ATOM 6668  C CE2  . PHE A 1 141 ? 16.554  -10.062 -24.085 1.00 0.00 ? 141 PHE A CE2  3  
ATOM 6669  C CZ   . PHE A 1 141 ? 17.253  -10.738 -25.055 1.00 0.00 ? 141 PHE A CZ   3  
ATOM 6670  H H    . PHE A 1 141 ? 21.521  -8.745  -20.525 1.00 0.00 ? 141 PHE A H    3  
ATOM 6671  H HA   . PHE A 1 141 ? 20.629  -8.125  -23.168 1.00 0.00 ? 141 PHE A HA   3  
ATOM 6672  H HB2  . PHE A 1 141 ? 19.832  -9.844  -21.159 1.00 0.00 ? 141 PHE A HB2  3  
ATOM 6673  H HB3  . PHE A 1 141 ? 18.592  -8.606  -21.018 1.00 0.00 ? 141 PHE A HB3  3  
ATOM 6674  H HD1  . PHE A 1 141 ? 20.360  -10.429 -23.798 1.00 0.00 ? 141 PHE A HD1  3  
ATOM 6675  H HD2  . PHE A 1 141 ? 16.665  -8.986  -22.251 1.00 0.00 ? 141 PHE A HD2  3  
ATOM 6676  H HE1  . PHE A 1 141 ? 19.167  -11.401 -25.711 1.00 0.00 ? 141 PHE A HE1  3  
ATOM 6677  H HE2  . PHE A 1 141 ? 15.480  -9.973  -24.157 1.00 0.00 ? 141 PHE A HE2  3  
ATOM 6678  H HZ   . PHE A 1 141 ? 16.732  -11.168 -25.896 1.00 0.00 ? 141 PHE A HZ   3  
ATOM 6679  N N    . VAL A 1 142 ? 19.568  -6.205  -20.724 1.00 0.00 ? 142 VAL A N    3  
ATOM 6680  C CA   . VAL A 1 142 ? 18.967  -4.881  -20.442 1.00 0.00 ? 142 VAL A CA   3  
ATOM 6681  C C    . VAL A 1 142 ? 19.776  -3.757  -21.082 1.00 0.00 ? 142 VAL A C    3  
ATOM 6682  O O    . VAL A 1 142 ? 19.291  -2.653  -21.236 1.00 0.00 ? 142 VAL A O    3  
ATOM 6683  C CB   . VAL A 1 142 ? 18.970  -4.671  -18.920 1.00 0.00 ? 142 VAL A CB   3  
ATOM 6684  C CG1  . VAL A 1 142 ? 18.420  -3.281  -18.607 1.00 0.00 ? 142 VAL A CG1  3  
ATOM 6685  C CG2  . VAL A 1 142 ? 18.083  -5.722  -18.259 1.00 0.00 ? 142 VAL A CG2  3  
ATOM 6686  H H    . VAL A 1 142 ? 19.861  -6.781  -19.985 1.00 0.00 ? 142 VAL A H    3  
ATOM 6687  H HA   . VAL A 1 142 ? 17.954  -4.860  -20.831 1.00 0.00 ? 142 VAL A HA   3  
ATOM 6688  H HB   . VAL A 1 142 ? 19.980  -4.761  -18.542 1.00 0.00 ? 142 VAL A HB   3  
ATOM 6689  H HG11 . VAL A 1 142 ? 17.556  -3.084  -19.226 1.00 0.00 ? 142 VAL A HG11 3  
ATOM 6690  H HG12 . VAL A 1 142 ? 18.131  -3.230  -17.568 1.00 0.00 ? 142 VAL A HG12 3  
ATOM 6691  H HG13 . VAL A 1 142 ? 19.175  -2.537  -18.804 1.00 0.00 ? 142 VAL A HG13 3  
ATOM 6692  H HG21 . VAL A 1 142 ? 17.748  -6.435  -18.997 1.00 0.00 ? 142 VAL A HG21 3  
ATOM 6693  H HG22 . VAL A 1 142 ? 18.645  -6.235  -17.495 1.00 0.00 ? 142 VAL A HG22 3  
ATOM 6694  H HG23 . VAL A 1 142 ? 17.224  -5.246  -17.809 1.00 0.00 ? 142 VAL A HG23 3  
ATOM 6695  N N    . GLN A 1 143 ? 20.994  -4.054  -21.443 1.00 0.00 ? 143 GLN A N    3  
ATOM 6696  C CA   . GLN A 1 143 ? 21.839  -3.009  -22.071 1.00 0.00 ? 143 GLN A CA   3  
ATOM 6697  C C    . GLN A 1 143 ? 21.683  -3.006  -23.587 1.00 0.00 ? 143 GLN A C    3  
ATOM 6698  O O    . GLN A 1 143 ? 21.595  -1.959  -24.201 1.00 0.00 ? 143 GLN A O    3  
ATOM 6699  C CB   . GLN A 1 143 ? 23.308  -3.305  -21.728 1.00 0.00 ? 143 GLN A CB   3  
ATOM 6700  C CG   . GLN A 1 143 ? 23.513  -3.151  -20.219 1.00 0.00 ? 143 GLN A CG   3  
ATOM 6701  C CD   . GLN A 1 143 ? 23.610  -1.665  -19.872 1.00 0.00 ? 143 GLN A CD   3  
ATOM 6702  O OE1  . GLN A 1 143 ? 24.057  -0.858  -20.663 1.00 0.00 ? 143 GLN A OE1  3  
ATOM 6703  N NE2  . GLN A 1 143 ? 23.202  -1.261  -18.699 1.00 0.00 ? 143 GLN A NE2  3  
ATOM 6704  H H    . GLN A 1 143 ? 21.347  -4.954  -21.299 1.00 0.00 ? 143 GLN A H    3  
ATOM 6705  H HA   . GLN A 1 143 ? 21.542  -2.041  -21.684 1.00 0.00 ? 143 GLN A HA   3  
ATOM 6706  H HB2  . GLN A 1 143 ? 23.555  -4.313  -22.027 1.00 0.00 ? 143 GLN A HB2  3  
ATOM 6707  H HB3  . GLN A 1 143 ? 23.949  -2.612  -22.253 1.00 0.00 ? 143 GLN A HB3  3  
ATOM 6708  H HG2  . GLN A 1 143 ? 22.681  -3.589  -19.690 1.00 0.00 ? 143 GLN A HG2  3  
ATOM 6709  H HG3  . GLN A 1 143 ? 24.426  -3.647  -19.922 1.00 0.00 ? 143 GLN A HG3  3  
ATOM 6710  H HE21 . GLN A 1 143 ? 22.841  -1.907  -18.057 1.00 0.00 ? 143 GLN A HE21 3  
ATOM 6711  H HE22 . GLN A 1 143 ? 23.257  -0.312  -18.462 1.00 0.00 ? 143 GLN A HE22 3  
ATOM 6712  N N    . MET A 1 144 ? 21.651  -4.172  -24.165 1.00 0.00 ? 144 MET A N    3  
ATOM 6713  C CA   . MET A 1 144 ? 21.502  -4.252  -25.639 1.00 0.00 ? 144 MET A CA   3  
ATOM 6714  C C    . MET A 1 144 ? 20.033  -4.263  -26.053 1.00 0.00 ? 144 MET A C    3  
ATOM 6715  O O    . MET A 1 144 ? 19.717  -4.152  -27.220 1.00 0.00 ? 144 MET A O    3  
ATOM 6716  C CB   . MET A 1 144 ? 22.163  -5.551  -26.122 1.00 0.00 ? 144 MET A CB   3  
ATOM 6717  C CG   . MET A 1 144 ? 22.042  -5.634  -27.646 1.00 0.00 ? 144 MET A CG   3  
ATOM 6718  S SD   . MET A 1 144 ? 20.604  -6.503  -28.318 1.00 0.00 ? 144 MET A SD   3  
ATOM 6719  C CE   . MET A 1 144 ? 21.172  -8.185  -27.971 1.00 0.00 ? 144 MET A CE   3  
ATOM 6720  H H    . MET A 1 144 ? 21.724  -4.987  -23.632 1.00 0.00 ? 144 MET A H    3  
ATOM 6721  H HA   . MET A 1 144 ? 21.986  -3.387  -26.086 1.00 0.00 ? 144 MET A HA   3  
ATOM 6722  H HB2  . MET A 1 144 ? 23.207  -5.554  -25.841 1.00 0.00 ? 144 MET A HB2  3  
ATOM 6723  H HB3  . MET A 1 144 ? 21.672  -6.400  -25.670 1.00 0.00 ? 144 MET A HB3  3  
ATOM 6724  H HG2  . MET A 1 144 ? 22.029  -4.629  -28.037 1.00 0.00 ? 144 MET A HG2  3  
ATOM 6725  H HG3  . MET A 1 144 ? 22.927  -6.122  -28.027 1.00 0.00 ? 144 MET A HG3  3  
ATOM 6726  H HE1  . MET A 1 144 ? 22.069  -8.145  -27.371 1.00 0.00 ? 144 MET A HE1  3  
ATOM 6727  H HE2  . MET A 1 144 ? 20.404  -8.721  -27.433 1.00 0.00 ? 144 MET A HE2  3  
ATOM 6728  H HE3  . MET A 1 144 ? 21.383  -8.693  -28.901 1.00 0.00 ? 144 MET A HE3  3  
ATOM 6729  N N    . MET A 1 145 ? 19.161  -4.400  -25.093 1.00 0.00 ? 145 MET A N    3  
ATOM 6730  C CA   . MET A 1 145 ? 17.717  -4.419  -25.426 1.00 0.00 ? 145 MET A CA   3  
ATOM 6731  C C    . MET A 1 145 ? 17.143  -3.009  -25.382 1.00 0.00 ? 145 MET A C    3  
ATOM 6732  O O    . MET A 1 145 ? 16.046  -2.765  -25.846 1.00 0.00 ? 145 MET A O    3  
ATOM 6733  C CB   . MET A 1 145 ? 16.989  -5.290  -24.386 1.00 0.00 ? 145 MET A CB   3  
ATOM 6734  C CG   . MET A 1 145 ? 15.549  -5.531  -24.844 1.00 0.00 ? 145 MET A CG   3  
ATOM 6735  S SD   . MET A 1 145 ? 15.305  -6.196  -26.512 1.00 0.00 ? 145 MET A SD   3  
ATOM 6736  C CE   . MET A 1 145 ? 14.418  -7.699  -26.027 1.00 0.00 ? 145 MET A CE   3  
ATOM 6737  H H    . MET A 1 145 ? 19.455  -4.483  -24.166 1.00 0.00 ? 145 MET A H    3  
ATOM 6738  H HA   . MET A 1 145 ? 17.591  -4.823  -26.428 1.00 0.00 ? 145 MET A HA   3  
ATOM 6739  H HB2  . MET A 1 145 ? 17.497  -6.236  -24.288 1.00 0.00 ? 145 MET A HB2  3  
ATOM 6740  H HB3  . MET A 1 145 ? 16.986  -4.787  -23.431 1.00 0.00 ? 145 MET A HB3  3  
ATOM 6741  H HG2  . MET A 1 145 ? 15.087  -6.216  -24.148 1.00 0.00 ? 145 MET A HG2  3  
ATOM 6742  H HG3  . MET A 1 145 ? 15.014  -4.597  -24.784 1.00 0.00 ? 145 MET A HG3  3  
ATOM 6743  H HE1  . MET A 1 145 ? 14.911  -8.149  -25.183 1.00 0.00 ? 145 MET A HE1  3  
ATOM 6744  H HE2  . MET A 1 145 ? 13.402  -7.450  -25.759 1.00 0.00 ? 145 MET A HE2  3  
ATOM 6745  H HE3  . MET A 1 145 ? 14.412  -8.397  -26.852 1.00 0.00 ? 145 MET A HE3  3  
ATOM 6746  N N    . THR A 1 146 ? 17.900  -2.104  -24.827 1.00 0.00 ? 146 THR A N    3  
ATOM 6747  C CA   . THR A 1 146 ? 17.422  -0.705  -24.741 1.00 0.00 ? 146 THR A CA   3  
ATOM 6748  C C    . THR A 1 146 ? 17.616  0.019   -26.068 1.00 0.00 ? 146 THR A C    3  
ATOM 6749  O O    . THR A 1 146 ? 16.668  0.276   -26.783 1.00 0.00 ? 146 THR A O    3  
ATOM 6750  C CB   . THR A 1 146 ? 18.241  0.013   -23.666 1.00 0.00 ? 146 THR A CB   3  
ATOM 6751  O OG1  . THR A 1 146 ? 18.126  -0.789  -22.508 1.00 0.00 ? 146 THR A OG1  3  
ATOM 6752  C CG2  . THR A 1 146 ? 17.587  1.343   -23.280 1.00 0.00 ? 146 THR A CG2  3  
ATOM 6753  H H    . THR A 1 146 ? 18.779  -2.347  -24.470 1.00 0.00 ? 146 THR A H    3  
ATOM 6754  H HA   . THR A 1 146 ? 16.363  -0.705  -24.486 1.00 0.00 ? 146 THR A HA   3  
ATOM 6755  H HB   . THR A 1 146 ? 19.284  0.123   -23.958 1.00 0.00 ? 146 THR A HB   3  
ATOM 6756  H HG1  . THR A 1 146 ? 19.011  -0.981  -22.190 1.00 0.00 ? 146 THR A HG1  3  
ATOM 6757  H HG21 . THR A 1 146 ? 17.402  1.928   -24.169 1.00 0.00 ? 146 THR A HG21 3  
ATOM 6758  H HG22 . THR A 1 146 ? 16.651  1.156   -22.776 1.00 0.00 ? 146 THR A HG22 3  
ATOM 6759  H HG23 . THR A 1 146 ? 18.242  1.894   -22.622 1.00 0.00 ? 146 THR A HG23 3  
ATOM 6760  N N    . ALA A 1 147 ? 18.846  0.336   -26.371 1.00 0.00 ? 147 ALA A N    3  
ATOM 6761  C CA   . ALA A 1 147 ? 19.127  1.042   -27.643 1.00 0.00 ? 147 ALA A CA   3  
ATOM 6762  C C    . ALA A 1 147 ? 18.357  0.414   -28.800 1.00 0.00 ? 147 ALA A C    3  
ATOM 6763  O O    . ALA A 1 147 ? 18.194  -0.788  -28.860 1.00 0.00 ? 147 ALA A O    3  
ATOM 6764  C CB   . ALA A 1 147 ? 20.631  0.933   -27.934 1.00 0.00 ? 147 ALA A CB   3  
ATOM 6765  H H    . ALA A 1 147 ? 19.578  0.107   -25.761 1.00 0.00 ? 147 ALA A H    3  
ATOM 6766  H HA   . ALA A 1 147 ? 18.827  2.084   -27.543 1.00 0.00 ? 147 ALA A HA   3  
ATOM 6767  H HB1  . ALA A 1 147 ? 21.193  1.268   -27.075 1.00 0.00 ? 147 ALA A HB1  3  
ATOM 6768  H HB2  . ALA A 1 147 ? 20.888  -0.094  -28.148 1.00 0.00 ? 147 ALA A HB2  3  
ATOM 6769  H HB3  . ALA A 1 147 ? 20.884  1.547   -28.785 1.00 0.00 ? 147 ALA A HB3  3  
ATOM 6770  N N    . LYS A 1 148 ? 17.899  1.242   -29.698 1.00 0.00 ? 148 LYS A N    3  
ATOM 6771  C CA   . LYS A 1 148 ? 17.138  0.715   -30.857 1.00 0.00 ? 148 LYS A CA   3  
ATOM 6772  C C    . LYS A 1 148 ? 18.066  0.445   -32.035 1.00 0.00 ? 148 LYS A C    3  
ATOM 6773  O O    . LYS A 1 148 ? 17.999  -0.666  -32.534 1.00 0.00 ? 148 LYS A O    3  
ATOM 6774  C CB   . LYS A 1 148 ? 16.101  1.770   -31.274 1.00 0.00 ? 148 LYS A CB   3  
ATOM 6775  C CG   . LYS A 1 148 ? 15.550  1.420   -32.658 1.00 0.00 ? 148 LYS A CG   3  
ATOM 6776  C CD   . LYS A 1 148 ? 14.162  2.046   -32.819 1.00 0.00 ? 148 LYS A CD   3  
ATOM 6777  C CE   . LYS A 1 148 ? 13.479  1.446   -34.051 1.00 0.00 ? 148 LYS A CE   3  
ATOM 6778  N NZ   . LYS A 1 148 ? 13.064  0.040   -33.786 1.00 0.00 ? 148 LYS A NZ   3  
ATOM 6779  O OXT  . LYS A 1 148 ? 18.794  1.365   -32.373 1.00 0.00 ? 148 LYS A OXT  3  
ATOM 6780  H H    . LYS A 1 148 ? 18.055  2.205   -29.607 1.00 0.00 ? 148 LYS A H    3  
ATOM 6781  H HA   . LYS A 1 148 ? 16.650  -0.215  -30.568 1.00 0.00 ? 148 LYS A HA   3  
ATOM 6782  H HB2  . LYS A 1 148 ? 15.293  1.787   -30.557 1.00 0.00 ? 148 LYS A HB2  3  
ATOM 6783  H HB3  . LYS A 1 148 ? 16.567  2.744   -31.305 1.00 0.00 ? 148 LYS A HB3  3  
ATOM 6784  H HG2  . LYS A 1 148 ? 16.213  1.805   -33.420 1.00 0.00 ? 148 LYS A HG2  3  
ATOM 6785  H HG3  . LYS A 1 148 ? 15.479  0.348   -32.760 1.00 0.00 ? 148 LYS A HG3  3  
ATOM 6786  H HD2  . LYS A 1 148 ? 13.569  1.842   -31.940 1.00 0.00 ? 148 LYS A HD2  3  
ATOM 6787  H HD3  . LYS A 1 148 ? 14.259  3.114   -32.941 1.00 0.00 ? 148 LYS A HD3  3  
ATOM 6788  H HE2  . LYS A 1 148 ? 12.605  2.031   -34.299 1.00 0.00 ? 148 LYS A HE2  3  
ATOM 6789  H HE3  . LYS A 1 148 ? 14.163  1.462   -34.887 1.00 0.00 ? 148 LYS A HE3  3  
ATOM 6790  H HZ1  . LYS A 1 148 ? 13.131  -0.155  -32.766 1.00 0.00 ? 148 LYS A HZ1  3  
ATOM 6791  H HZ2  . LYS A 1 148 ? 12.083  -0.098  -34.100 1.00 0.00 ? 148 LYS A HZ2  3  
ATOM 6792  H HZ3  . LYS A 1 148 ? 13.689  -0.610  -34.306 1.00 0.00 ? 148 LYS A HZ3  3  
ATOM 6793  N N    . ALA A 1 1   ? 13.621  15.361  -16.382 1.00 0.00 ? 1   ALA A N    4  
ATOM 6794  C CA   . ALA A 1 1   ? 12.257  15.925  -16.526 1.00 0.00 ? 1   ALA A CA   4  
ATOM 6795  C C    . ALA A 1 1   ? 11.437  15.638  -15.275 1.00 0.00 ? 1   ALA A C    4  
ATOM 6796  O O    . ALA A 1 1   ? 11.979  15.347  -14.228 1.00 0.00 ? 1   ALA A O    4  
ATOM 6797  C CB   . ALA A 1 1   ? 11.551  15.283  -17.731 1.00 0.00 ? 1   ALA A CB   4  
ATOM 6798  H H1   . ALA A 1 1   ? 13.556  14.343  -16.180 1.00 0.00 ? 1   ALA A H1   4  
ATOM 6799  H H2   . ALA A 1 1   ? 14.151  15.504  -17.266 1.00 0.00 ? 1   ALA A H2   4  
ATOM 6800  H H3   . ALA A 1 1   ? 14.114  15.839  -15.601 1.00 0.00 ? 1   ALA A H3   4  
ATOM 6801  H HA   . ALA A 1 1   ? 12.336  17.006  -16.654 1.00 0.00 ? 1   ALA A HA   4  
ATOM 6802  H HB1  . ALA A 1 1   ? 12.176  15.365  -18.607 1.00 0.00 ? 1   ALA A HB1  4  
ATOM 6803  H HB2  . ALA A 1 1   ? 11.359  14.240  -17.527 1.00 0.00 ? 1   ALA A HB2  4  
ATOM 6804  H HB3  . ALA A 1 1   ? 10.613  15.787  -17.914 1.00 0.00 ? 1   ALA A HB3  4  
ATOM 6805  N N    . ASP A 1 2   ? 10.140  15.725  -15.406 1.00 0.00 ? 2   ASP A N    4  
ATOM 6806  C CA   . ASP A 1 2   ? 9.270   15.461  -14.233 1.00 0.00 ? 2   ASP A CA   4  
ATOM 6807  C C    . ASP A 1 2   ? 9.709   14.196  -13.509 1.00 0.00 ? 2   ASP A C    4  
ATOM 6808  O O    . ASP A 1 2   ? 9.924   14.205  -12.314 1.00 0.00 ? 2   ASP A O    4  
ATOM 6809  C CB   . ASP A 1 2   ? 7.829   15.270  -14.732 1.00 0.00 ? 2   ASP A CB   4  
ATOM 6810  C CG   . ASP A 1 2   ? 6.879   15.228  -13.533 1.00 0.00 ? 2   ASP A CG   4  
ATOM 6811  O OD1  . ASP A 1 2   ? 7.231   15.844  -12.541 1.00 0.00 ? 2   ASP A OD1  4  
ATOM 6812  O OD2  . ASP A 1 2   ? 5.853   14.581  -13.678 1.00 0.00 ? 2   ASP A OD2  4  
ATOM 6813  H H    . ASP A 1 2   ? 9.745   15.962  -16.271 1.00 0.00 ? 2   ASP A H    4  
ATOM 6814  H HA   . ASP A 1 2   ? 9.334   16.300  -13.548 1.00 0.00 ? 2   ASP A HA   4  
ATOM 6815  H HB2  . ASP A 1 2   ? 7.553   16.091  -15.376 1.00 0.00 ? 2   ASP A HB2  4  
ATOM 6816  H HB3  . ASP A 1 2   ? 7.752   14.344  -15.281 1.00 0.00 ? 2   ASP A HB3  4  
ATOM 6817  N N    . GLN A 1 3   ? 9.833   13.131  -14.249 1.00 0.00 ? 3   GLN A N    4  
ATOM 6818  C CA   . GLN A 1 3   ? 10.258  11.850  -13.628 1.00 0.00 ? 3   GLN A CA   4  
ATOM 6819  C C    . GLN A 1 3   ? 9.152   11.264  -12.755 1.00 0.00 ? 3   GLN A C    4  
ATOM 6820  O O    . GLN A 1 3   ? 8.803   11.819  -11.732 1.00 0.00 ? 3   GLN A O    4  
ATOM 6821  C CB   . GLN A 1 3   ? 11.490  12.126  -12.750 1.00 0.00 ? 3   GLN A CB   4  
ATOM 6822  C CG   . GLN A 1 3   ? 12.425  10.917  -12.798 1.00 0.00 ? 3   GLN A CG   4  
ATOM 6823  C CD   . GLN A 1 3   ? 11.862  9.809   -11.904 1.00 0.00 ? 3   GLN A CD   4  
ATOM 6824  O OE1  . GLN A 1 3   ? 11.001  9.051   -12.305 1.00 0.00 ? 3   GLN A OE1  4  
ATOM 6825  N NE2  . GLN A 1 3   ? 12.319  9.682   -10.689 1.00 0.00 ? 3   GLN A NE2  4  
ATOM 6826  H H    . GLN A 1 3   ? 9.649   13.175  -15.208 1.00 0.00 ? 3   GLN A H    4  
ATOM 6827  H HA   . GLN A 1 3   ? 10.497  11.140  -14.418 1.00 0.00 ? 3   GLN A HA   4  
ATOM 6828  H HB2  . GLN A 1 3   ? 12.008  13.000  -13.115 1.00 0.00 ? 3   GLN A HB2  4  
ATOM 6829  H HB3  . GLN A 1 3   ? 11.179  12.300  -11.730 1.00 0.00 ? 3   GLN A HB3  4  
ATOM 6830  H HG2  . GLN A 1 3   ? 12.506  10.554  -13.811 1.00 0.00 ? 3   GLN A HG2  4  
ATOM 6831  H HG3  . GLN A 1 3   ? 13.405  11.199  -12.442 1.00 0.00 ? 3   GLN A HG3  4  
ATOM 6832  H HE21 . GLN A 1 3   ? 13.013  10.291  -10.361 1.00 0.00 ? 3   GLN A HE21 4  
ATOM 6833  H HE22 . GLN A 1 3   ? 11.967  8.979   -10.104 1.00 0.00 ? 3   GLN A HE22 4  
ATOM 6834  N N    . LEU A 1 4   ? 8.620   10.146  -13.179 1.00 0.00 ? 4   LEU A N    4  
ATOM 6835  C CA   . LEU A 1 4   ? 7.538   9.505   -12.390 1.00 0.00 ? 4   LEU A CA   4  
ATOM 6836  C C    . LEU A 1 4   ? 8.020   9.182   -10.978 1.00 0.00 ? 4   LEU A C    4  
ATOM 6837  O O    . LEU A 1 4   ? 8.731   8.218   -10.770 1.00 0.00 ? 4   LEU A O    4  
ATOM 6838  C CB   . LEU A 1 4   ? 7.139   8.195   -13.086 1.00 0.00 ? 4   LEU A CB   4  
ATOM 6839  C CG   . LEU A 1 4   ? 5.910   8.444   -13.968 1.00 0.00 ? 4   LEU A CG   4  
ATOM 6840  C CD1  . LEU A 1 4   ? 5.786   7.312   -14.990 1.00 0.00 ? 4   LEU A CD1  4  
ATOM 6841  C CD2  . LEU A 1 4   ? 4.653   8.468   -13.092 1.00 0.00 ? 4   LEU A CD2  4  
ATOM 6842  H H    . LEU A 1 4   ? 8.931   9.734   -14.014 1.00 0.00 ? 4   LEU A H    4  
ATOM 6843  H HA   . LEU A 1 4   ? 6.691   10.185  -12.331 1.00 0.00 ? 4   LEU A HA   4  
ATOM 6844  H HB2  . LEU A 1 4   ? 7.959   7.845   -13.697 1.00 0.00 ? 4   LEU A HB2  4  
ATOM 6845  H HB3  . LEU A 1 4   ? 6.908   7.445   -12.344 1.00 0.00 ? 4   LEU A HB3  4  
ATOM 6846  H HG   . LEU A 1 4   ? 6.015   9.389   -14.481 1.00 0.00 ? 4   LEU A HG   4  
ATOM 6847  H HD11 . LEU A 1 4   ? 5.906   6.359   -14.495 1.00 0.00 ? 4   LEU A HD11 4  
ATOM 6848  H HD12 . LEU A 1 4   ? 4.812   7.349   -15.458 1.00 0.00 ? 4   LEU A HD12 4  
ATOM 6849  H HD13 . LEU A 1 4   ? 6.549   7.418   -15.746 1.00 0.00 ? 4   LEU A HD13 4  
ATOM 6850  H HD21 . LEU A 1 4   ? 4.662   7.625   -12.417 1.00 0.00 ? 4   LEU A HD21 4  
ATOM 6851  H HD22 . LEU A 1 4   ? 4.625   9.382   -12.519 1.00 0.00 ? 4   LEU A HD22 4  
ATOM 6852  H HD23 . LEU A 1 4   ? 3.773   8.414   -13.717 1.00 0.00 ? 4   LEU A HD23 4  
ATOM 6853  N N    . THR A 1 5   ? 7.627   9.993   -10.031 1.00 0.00 ? 5   THR A N    4  
ATOM 6854  C CA   . THR A 1 5   ? 8.059   9.741   -8.631  1.00 0.00 ? 5   THR A CA   4  
ATOM 6855  C C    . THR A 1 5   ? 7.078   8.818   -7.915  1.00 0.00 ? 5   THR A C    4  
ATOM 6856  O O    . THR A 1 5   ? 5.996   8.554   -8.403  1.00 0.00 ? 5   THR A O    4  
ATOM 6857  C CB   . THR A 1 5   ? 8.103   11.079  -7.885  1.00 0.00 ? 5   THR A CB   4  
ATOM 6858  O OG1  . THR A 1 5   ? 6.933   11.760  -8.276  1.00 0.00 ? 5   THR A OG1  4  
ATOM 6859  C CG2  . THR A 1 5   ? 9.251   11.960  -8.401  1.00 0.00 ? 5   THR A CG2  4  
ATOM 6860  H H    . THR A 1 5   ? 7.054   10.759  -10.241 1.00 0.00 ? 5   THR A H    4  
ATOM 6861  H HA   . THR A 1 5   ? 9.042   9.271   -8.643  1.00 0.00 ? 5   THR A HA   4  
ATOM 6862  H HB   . THR A 1 5   ? 8.129   10.941  -6.807  1.00 0.00 ? 5   THR A HB   4  
ATOM 6863  H HG1  . THR A 1 5   ? 6.633   11.382  -9.106  1.00 0.00 ? 5   THR A HG1  4  
ATOM 6864  H HG21 . THR A 1 5   ? 10.174  11.402  -8.384  1.00 0.00 ? 5   THR A HG21 4  
ATOM 6865  H HG22 . THR A 1 5   ? 9.043   12.273  -9.412  1.00 0.00 ? 5   THR A HG22 4  
ATOM 6866  H HG23 . THR A 1 5   ? 9.350   12.834  -7.772  1.00 0.00 ? 5   THR A HG23 4  
ATOM 6867  N N    . GLU A 1 6   ? 7.475   8.344   -6.764  1.00 0.00 ? 6   GLU A N    4  
ATOM 6868  C CA   . GLU A 1 6   ? 6.583   7.440   -6.001  1.00 0.00 ? 6   GLU A CA   4  
ATOM 6869  C C    . GLU A 1 6   ? 5.258   8.124   -5.684  1.00 0.00 ? 6   GLU A C    4  
ATOM 6870  O O    . GLU A 1 6   ? 4.210   7.520   -5.780  1.00 0.00 ? 6   GLU A O    4  
ATOM 6871  C CB   . GLU A 1 6   ? 7.284   7.070   -4.683  1.00 0.00 ? 6   GLU A CB   4  
ATOM 6872  C CG   . GLU A 1 6   ? 7.588   5.568   -4.686  1.00 0.00 ? 6   GLU A CG   4  
ATOM 6873  C CD   . GLU A 1 6   ? 8.002   5.134   -3.275  1.00 0.00 ? 6   GLU A CD   4  
ATOM 6874  O OE1  . GLU A 1 6   ? 8.961   5.714   -2.791  1.00 0.00 ? 6   GLU A OE1  4  
ATOM 6875  O OE2  . GLU A 1 6   ? 7.335   4.251   -2.762  1.00 0.00 ? 6   GLU A OE2  4  
ATOM 6876  H H    . GLU A 1 6   ? 8.357   8.584   -6.409  1.00 0.00 ? 6   GLU A H    4  
ATOM 6877  H HA   . GLU A 1 6   ? 6.387   6.547   -6.598  1.00 0.00 ? 6   GLU A HA   4  
ATOM 6878  H HB2  . GLU A 1 6   ? 8.204   7.628   -4.593  1.00 0.00 ? 6   GLU A HB2  4  
ATOM 6879  H HB3  . GLU A 1 6   ? 6.640   7.310   -3.846  1.00 0.00 ? 6   GLU A HB3  4  
ATOM 6880  H HG2  . GLU A 1 6   ? 6.706   5.016   -4.986  1.00 0.00 ? 6   GLU A HG2  4  
ATOM 6881  H HG3  . GLU A 1 6   ? 8.394   5.358   -5.377  1.00 0.00 ? 6   GLU A HG3  4  
ATOM 6882  N N    . GLU A 1 7   ? 5.324   9.371   -5.306  1.00 0.00 ? 7   GLU A N    4  
ATOM 6883  C CA   . GLU A 1 7   ? 4.068   10.088  -4.987  1.00 0.00 ? 7   GLU A CA   4  
ATOM 6884  C C    . GLU A 1 7   ? 3.123   10.049  -6.173  1.00 0.00 ? 7   GLU A C    4  
ATOM 6885  O O    . GLU A 1 7   ? 1.947   9.792   -6.022  1.00 0.00 ? 7   GLU A O    4  
ATOM 6886  C CB   . GLU A 1 7   ? 4.399   11.556  -4.645  1.00 0.00 ? 7   GLU A CB   4  
ATOM 6887  C CG   . GLU A 1 7   ? 5.435   12.091  -5.639  1.00 0.00 ? 7   GLU A CG   4  
ATOM 6888  C CD   . GLU A 1 7   ? 5.912   13.472  -5.178  1.00 0.00 ? 7   GLU A CD   4  
ATOM 6889  O OE1  . GLU A 1 7   ? 5.042   14.278  -4.890  1.00 0.00 ? 7   GLU A OE1  4  
ATOM 6890  O OE2  . GLU A 1 7   ? 7.120   13.643  -5.137  1.00 0.00 ? 7   GLU A OE2  4  
ATOM 6891  H H    . GLU A 1 7   ? 6.189   9.822   -5.232  1.00 0.00 ? 7   GLU A H    4  
ATOM 6892  H HA   . GLU A 1 7   ? 3.586   9.592   -4.147  1.00 0.00 ? 7   GLU A HA   4  
ATOM 6893  H HB2  . GLU A 1 7   ? 3.500   12.152  -4.703  1.00 0.00 ? 7   GLU A HB2  4  
ATOM 6894  H HB3  . GLU A 1 7   ? 4.795   11.614  -3.642  1.00 0.00 ? 7   GLU A HB3  4  
ATOM 6895  H HG2  . GLU A 1 7   ? 6.278   11.421  -5.686  1.00 0.00 ? 7   GLU A HG2  4  
ATOM 6896  H HG3  . GLU A 1 7   ? 4.991   12.177  -6.620  1.00 0.00 ? 7   GLU A HG3  4  
ATOM 6897  N N    . GLN A 1 8   ? 3.648   10.303  -7.338  1.00 0.00 ? 8   GLN A N    4  
ATOM 6898  C CA   . GLN A 1 8   ? 2.780   10.277  -8.531  1.00 0.00 ? 8   GLN A CA   4  
ATOM 6899  C C    . GLN A 1 8   ? 2.087   8.932   -8.622  1.00 0.00 ? 8   GLN A C    4  
ATOM 6900  O O    . GLN A 1 8   ? 0.929   8.846   -8.979  1.00 0.00 ? 8   GLN A O    4  
ATOM 6901  C CB   . GLN A 1 8   ? 3.649   10.498  -9.775  1.00 0.00 ? 8   GLN A CB   4  
ATOM 6902  C CG   . GLN A 1 8   ? 4.142   11.948  -9.757  1.00 0.00 ? 8   GLN A CG   4  
ATOM 6903  C CD   . GLN A 1 8   ? 4.898   12.259  -11.048 1.00 0.00 ? 8   GLN A CD   4  
ATOM 6904  O OE1  . GLN A 1 8   ? 6.095   12.088  -11.134 1.00 0.00 ? 8   GLN A OE1  4  
ATOM 6905  N NE2  . GLN A 1 8   ? 4.240   12.735  -12.069 1.00 0.00 ? 8   GLN A NE2  4  
ATOM 6906  H H    . GLN A 1 8   ? 4.603   10.507  -7.419  1.00 0.00 ? 8   GLN A H    4  
ATOM 6907  H HA   . GLN A 1 8   ? 2.025   11.060  -8.438  1.00 0.00 ? 8   GLN A HA   4  
ATOM 6908  H HB2  . GLN A 1 8   ? 4.493   9.823   -9.758  1.00 0.00 ? 8   GLN A HB2  4  
ATOM 6909  H HB3  . GLN A 1 8   ? 3.066   10.320  -10.668 1.00 0.00 ? 8   GLN A HB3  4  
ATOM 6910  H HG2  . GLN A 1 8   ? 3.299   12.616  -9.670  1.00 0.00 ? 8   GLN A HG2  4  
ATOM 6911  H HG3  . GLN A 1 8   ? 4.799   12.096  -8.916  1.00 0.00 ? 8   GLN A HG3  4  
ATOM 6912  H HE21 . GLN A 1 8   ? 3.274   12.889  -12.002 1.00 0.00 ? 8   GLN A HE21 4  
ATOM 6913  H HE22 . GLN A 1 8   ? 4.711   12.940  -12.903 1.00 0.00 ? 8   GLN A HE22 4  
ATOM 6914  N N    . ILE A 1 9   ? 2.812   7.896   -8.292  1.00 0.00 ? 9   ILE A N    4  
ATOM 6915  C CA   . ILE A 1 9   ? 2.211   6.548   -8.349  1.00 0.00 ? 9   ILE A CA   4  
ATOM 6916  C C    . ILE A 1 9   ? 1.193   6.396   -7.228  1.00 0.00 ? 9   ILE A C    4  
ATOM 6917  O O    . ILE A 1 9   ? 0.203   5.707   -7.375  1.00 0.00 ? 9   ILE A O    4  
ATOM 6918  C CB   . ILE A 1 9   ? 3.314   5.508   -8.172  1.00 0.00 ? 9   ILE A CB   4  
ATOM 6919  C CG1  . ILE A 1 9   ? 4.054   5.315   -9.488  1.00 0.00 ? 9   ILE A CG1  4  
ATOM 6920  C CG2  . ILE A 1 9   ? 2.667   4.172   -7.778  1.00 0.00 ? 9   ILE A CG2  4  
ATOM 6921  C CD1  . ILE A 1 9   ? 5.526   5.014   -9.197  1.00 0.00 ? 9   ILE A CD1  4  
ATOM 6922  H H    . ILE A 1 9   ? 3.748   8.013   -8.014  1.00 0.00 ? 9   ILE A H    4  
ATOM 6923  H HA   . ILE A 1 9   ? 1.705   6.421   -9.306  1.00 0.00 ? 9   ILE A HA   4  
ATOM 6924  H HB   . ILE A 1 9   ? 4.012   5.843   -7.410  1.00 0.00 ? 9   ILE A HB   4  
ATOM 6925  H HG12 . ILE A 1 9   ? 3.618   4.492   -10.033 1.00 0.00 ? 9   ILE A HG12 4  
ATOM 6926  H HG13 . ILE A 1 9   ? 3.978   6.213   -10.082 1.00 0.00 ? 9   ILE A HG13 4  
ATOM 6927  H HG21 . ILE A 1 9   ? 1.727   4.058   -8.296  1.00 0.00 ? 9   ILE A HG21 4  
ATOM 6928  H HG22 . ILE A 1 9   ? 3.321   3.357   -8.048  1.00 0.00 ? 9   ILE A HG22 4  
ATOM 6929  H HG23 . ILE A 1 9   ? 2.491   4.150   -6.714  1.00 0.00 ? 9   ILE A HG23 4  
ATOM 6930  H HD11 . ILE A 1 9   ? 5.604   4.389   -8.321  1.00 0.00 ? 9   ILE A HD11 4  
ATOM 6931  H HD12 . ILE A 1 9   ? 5.966   4.501   -10.040 1.00 0.00 ? 9   ILE A HD12 4  
ATOM 6932  H HD13 . ILE A 1 9   ? 6.059   5.938   -9.026  1.00 0.00 ? 9   ILE A HD13 4  
ATOM 6933  N N    . ALA A 1 10  ? 1.452   7.050   -6.115  1.00 0.00 ? 10  ALA A N    4  
ATOM 6934  C CA   . ALA A 1 10  ? 0.502   6.948   -4.986  1.00 0.00 ? 10  ALA A CA   4  
ATOM 6935  C C    . ALA A 1 10  ? -0.804  7.621   -5.370  1.00 0.00 ? 10  ALA A C    4  
ATOM 6936  O O    . ALA A 1 10  ? -1.876  7.138   -5.058  1.00 0.00 ? 10  ALA A O    4  
ATOM 6937  C CB   . ALA A 1 10  ? 1.104   7.668   -3.768  1.00 0.00 ? 10  ALA A CB   4  
ATOM 6938  H H    . ALA A 1 10  ? 2.266   7.602   -6.034  1.00 0.00 ? 10  ALA A H    4  
ATOM 6939  H HA   . ALA A 1 10  ? 0.313   5.896   -4.770  1.00 0.00 ? 10  ALA A HA   4  
ATOM 6940  H HB1  . ALA A 1 10  ? 2.137   7.376   -3.648  1.00 0.00 ? 10  ALA A HB1  4  
ATOM 6941  H HB2  . ALA A 1 10  ? 1.051   8.737   -3.911  1.00 0.00 ? 10  ALA A HB2  4  
ATOM 6942  H HB3  . ALA A 1 10  ? 0.554   7.400   -2.877  1.00 0.00 ? 10  ALA A HB3  4  
ATOM 6943  N N    . GLU A 1 11  ? -0.688  8.735   -6.046  1.00 0.00 ? 11  GLU A N    4  
ATOM 6944  C CA   . GLU A 1 11  ? -1.903  9.462   -6.469  1.00 0.00 ? 11  GLU A CA   4  
ATOM 6945  C C    . GLU A 1 11  ? -2.587  8.689   -7.576  1.00 0.00 ? 11  GLU A C    4  
ATOM 6946  O O    . GLU A 1 11  ? -3.799  8.657   -7.667  1.00 0.00 ? 11  GLU A O    4  
ATOM 6947  C CB   . GLU A 1 11  ? -1.483  10.840  -7.012  1.00 0.00 ? 11  GLU A CB   4  
ATOM 6948  C CG   . GLU A 1 11  ? -1.232  11.792  -5.841  1.00 0.00 ? 11  GLU A CG   4  
ATOM 6949  C CD   . GLU A 1 11  ? -0.916  13.188  -6.386  1.00 0.00 ? 11  GLU A CD   4  
ATOM 6950  O OE1  . GLU A 1 11  ? -0.878  13.300  -7.600  1.00 0.00 ? 11  GLU A OE1  4  
ATOM 6951  O OE2  . GLU A 1 11  ? -0.729  14.062  -5.556  1.00 0.00 ? 11  GLU A OE2  4  
ATOM 6952  H H    . GLU A 1 11  ? 0.200   9.085   -6.270  1.00 0.00 ? 11  GLU A H    4  
ATOM 6953  H HA   . GLU A 1 11  ? -2.585  9.560   -5.626  1.00 0.00 ? 11  GLU A HA   4  
ATOM 6954  H HB2  . GLU A 1 11  ? -0.578  10.737  -7.595  1.00 0.00 ? 11  GLU A HB2  4  
ATOM 6955  H HB3  . GLU A 1 11  ? -2.266  11.236  -7.642  1.00 0.00 ? 11  GLU A HB3  4  
ATOM 6956  H HG2  . GLU A 1 11  ? -2.111  11.843  -5.216  1.00 0.00 ? 11  GLU A HG2  4  
ATOM 6957  H HG3  . GLU A 1 11  ? -0.396  11.439  -5.256  1.00 0.00 ? 11  GLU A HG3  4  
ATOM 6958  N N    . PHE A 1 12  ? -1.788  8.072   -8.401  1.00 0.00 ? 12  PHE A N    4  
ATOM 6959  C CA   . PHE A 1 12  ? -2.355  7.290   -9.515  1.00 0.00 ? 12  PHE A CA   4  
ATOM 6960  C C    . PHE A 1 12  ? -3.171  6.136   -8.965  1.00 0.00 ? 12  PHE A C    4  
ATOM 6961  O O    . PHE A 1 12  ? -4.257  5.860   -9.434  1.00 0.00 ? 12  PHE A O    4  
ATOM 6962  C CB   . PHE A 1 12  ? -1.197  6.718   -10.351 1.00 0.00 ? 12  PHE A CB   4  
ATOM 6963  C CG   . PHE A 1 12  ? -0.568  7.824   -11.214 1.00 0.00 ? 12  PHE A CG   4  
ATOM 6964  C CD1  . PHE A 1 12  ? -0.779  9.168   -10.925 1.00 0.00 ? 12  PHE A CD1  4  
ATOM 6965  C CD2  . PHE A 1 12  ? 0.216   7.490   -12.305 1.00 0.00 ? 12  PHE A CD2  4  
ATOM 6966  C CE1  . PHE A 1 12  ? -0.217  10.146  -11.716 1.00 0.00 ? 12  PHE A CE1  4  
ATOM 6967  C CE2  . PHE A 1 12  ? 0.776   8.476   -13.092 1.00 0.00 ? 12  PHE A CE2  4  
ATOM 6968  C CZ   . PHE A 1 12  ? 0.559   9.801   -12.797 1.00 0.00 ? 12  PHE A CZ   4  
ATOM 6969  H H    . PHE A 1 12  ? -0.816  8.131   -8.284  1.00 0.00 ? 12  PHE A H    4  
ATOM 6970  H HA   . PHE A 1 12  ? -3.001  7.933   -10.116 1.00 0.00 ? 12  PHE A HA   4  
ATOM 6971  H HB2  . PHE A 1 12  ? -0.443  6.308   -9.697  1.00 0.00 ? 12  PHE A HB2  4  
ATOM 6972  H HB3  . PHE A 1 12  ? -1.568  5.935   -10.997 1.00 0.00 ? 12  PHE A HB3  4  
ATOM 6973  H HD1  . PHE A 1 12  ? -1.386  9.449   -10.084 1.00 0.00 ? 12  PHE A HD1  4  
ATOM 6974  H HD2  . PHE A 1 12  ? 0.395   6.451   -12.540 1.00 0.00 ? 12  PHE A HD2  4  
ATOM 6975  H HE1  . PHE A 1 12  ? -0.389  11.187  -11.488 1.00 0.00 ? 12  PHE A HE1  4  
ATOM 6976  H HE2  . PHE A 1 12  ? 1.387   8.205   -13.941 1.00 0.00 ? 12  PHE A HE2  4  
ATOM 6977  H HZ   . PHE A 1 12  ? 0.995   10.570  -13.415 1.00 0.00 ? 12  PHE A HZ   4  
ATOM 6978  N N    . LYS A 1 13  ? -2.630  5.477   -7.971  1.00 0.00 ? 13  LYS A N    4  
ATOM 6979  C CA   . LYS A 1 13  ? -3.363  4.341   -7.379  1.00 0.00 ? 13  LYS A CA   4  
ATOM 6980  C C    . LYS A 1 13  ? -4.675  4.826   -6.811  1.00 0.00 ? 13  LYS A C    4  
ATOM 6981  O O    . LYS A 1 13  ? -5.695  4.191   -6.976  1.00 0.00 ? 13  LYS A O    4  
ATOM 6982  C CB   . LYS A 1 13  ? -2.521  3.743   -6.247  1.00 0.00 ? 13  LYS A CB   4  
ATOM 6983  C CG   . LYS A 1 13  ? -3.152  2.423   -5.800  1.00 0.00 ? 13  LYS A CG   4  
ATOM 6984  C CD   . LYS A 1 13  ? -2.234  1.747   -4.780  1.00 0.00 ? 13  LYS A CD   4  
ATOM 6985  C CE   . LYS A 1 13  ? -2.571  0.257   -4.713  1.00 0.00 ? 13  LYS A CE   4  
ATOM 6986  N NZ   . LYS A 1 13  ? -1.838  -0.490  -5.772  1.00 0.00 ? 13  LYS A NZ   4  
ATOM 6987  H H    . LYS A 1 13  ? -1.751  5.737   -7.622  1.00 0.00 ? 13  LYS A H    4  
ATOM 6988  H HA   . LYS A 1 13  ? -3.561  3.602   -8.153  1.00 0.00 ? 13  LYS A HA   4  
ATOM 6989  H HB2  . LYS A 1 13  ? -1.516  3.565   -6.598  1.00 0.00 ? 13  LYS A HB2  4  
ATOM 6990  H HB3  . LYS A 1 13  ? -2.491  4.431   -5.417  1.00 0.00 ? 13  LYS A HB3  4  
ATOM 6991  H HG2  . LYS A 1 13  ? -4.115  2.616   -5.349  1.00 0.00 ? 13  LYS A HG2  4  
ATOM 6992  H HG3  . LYS A 1 13  ? -3.284  1.776   -6.654  1.00 0.00 ? 13  LYS A HG3  4  
ATOM 6993  H HD2  . LYS A 1 13  ? -1.204  1.873   -5.081  1.00 0.00 ? 13  LYS A HD2  4  
ATOM 6994  H HD3  . LYS A 1 13  ? -2.377  2.197   -3.809  1.00 0.00 ? 13  LYS A HD3  4  
ATOM 6995  H HE2  . LYS A 1 13  ? -2.289  -0.133  -3.746  1.00 0.00 ? 13  LYS A HE2  4  
ATOM 6996  H HE3  . LYS A 1 13  ? -3.633  0.119   -4.853  1.00 0.00 ? 13  LYS A HE3  4  
ATOM 6997  H HZ1  . LYS A 1 13  ? -1.030  0.077   -6.101  1.00 0.00 ? 13  LYS A HZ1  4  
ATOM 6998  H HZ2  . LYS A 1 13  ? -1.493  -1.392  -5.386  1.00 0.00 ? 13  LYS A HZ2  4  
ATOM 6999  H HZ3  . LYS A 1 13  ? -2.477  -0.678  -6.571  1.00 0.00 ? 13  LYS A HZ3  4  
ATOM 7000  N N    . GLU A 1 14  ? -4.632  5.951   -6.138  1.00 0.00 ? 14  GLU A N    4  
ATOM 7001  C CA   . GLU A 1 14  ? -5.879  6.482   -5.561  1.00 0.00 ? 14  GLU A CA   4  
ATOM 7002  C C    . GLU A 1 14  ? -6.953  6.442   -6.618  1.00 0.00 ? 14  GLU A C    4  
ATOM 7003  O O    . GLU A 1 14  ? -8.023  5.905   -6.408  1.00 0.00 ? 14  GLU A O    4  
ATOM 7004  C CB   . GLU A 1 14  ? -5.646  7.938   -5.132  1.00 0.00 ? 14  GLU A CB   4  
ATOM 7005  C CG   . GLU A 1 14  ? -6.875  8.438   -4.371  1.00 0.00 ? 14  GLU A CG   4  
ATOM 7006  C CD   . GLU A 1 14  ? -7.045  7.619   -3.089  1.00 0.00 ? 14  GLU A CD   4  
ATOM 7007  O OE1  . GLU A 1 14  ? -7.719  6.605   -3.180  1.00 0.00 ? 14  GLU A OE1  4  
ATOM 7008  O OE2  . GLU A 1 14  ? -6.492  8.052   -2.091  1.00 0.00 ? 14  GLU A OE2  4  
ATOM 7009  H H    . GLU A 1 14  ? -3.785  6.431   -6.023  1.00 0.00 ? 14  GLU A H    4  
ATOM 7010  H HA   . GLU A 1 14  ? -6.178  5.864   -4.717  1.00 0.00 ? 14  GLU A HA   4  
ATOM 7011  H HB2  . GLU A 1 14  ? -4.776  7.994   -4.494  1.00 0.00 ? 14  GLU A HB2  4  
ATOM 7012  H HB3  . GLU A 1 14  ? -5.484  8.553   -6.004  1.00 0.00 ? 14  GLU A HB3  4  
ATOM 7013  H HG2  . GLU A 1 14  ? -6.749  9.479   -4.114  1.00 0.00 ? 14  GLU A HG2  4  
ATOM 7014  H HG3  . GLU A 1 14  ? -7.757  8.326   -4.985  1.00 0.00 ? 14  GLU A HG3  4  
ATOM 7015  N N    . ALA A 1 15  ? -6.646  7.010   -7.752  1.00 0.00 ? 15  ALA A N    4  
ATOM 7016  C CA   . ALA A 1 15  ? -7.634  7.014   -8.843  1.00 0.00 ? 15  ALA A CA   4  
ATOM 7017  C C    . ALA A 1 15  ? -8.030  5.584   -9.139  1.00 0.00 ? 15  ALA A C    4  
ATOM 7018  O O    . ALA A 1 15  ? -9.191  5.233   -9.132  1.00 0.00 ? 15  ALA A O    4  
ATOM 7019  C CB   . ALA A 1 15  ? -6.967  7.617   -10.098 1.00 0.00 ? 15  ALA A CB   4  
ATOM 7020  H H    . ALA A 1 15  ? -5.763  7.427   -7.876  1.00 0.00 ? 15  ALA A H    4  
ATOM 7021  H HA   . ALA A 1 15  ? -8.510  7.583   -8.541  1.00 0.00 ? 15  ALA A HA   4  
ATOM 7022  H HB1  . ALA A 1 15  ? -5.898  7.445   -10.063 1.00 0.00 ? 15  ALA A HB1  4  
ATOM 7023  H HB2  . ALA A 1 15  ? -7.370  7.152   -10.985 1.00 0.00 ? 15  ALA A HB2  4  
ATOM 7024  H HB3  . ALA A 1 15  ? -7.154  8.680   -10.137 1.00 0.00 ? 15  ALA A HB3  4  
ATOM 7025  N N    . PHE A 1 16  ? -7.037  4.781   -9.375  1.00 0.00 ? 16  PHE A N    4  
ATOM 7026  C CA   . PHE A 1 16  ? -7.286  3.358   -9.677  1.00 0.00 ? 16  PHE A CA   4  
ATOM 7027  C C    . PHE A 1 16  ? -8.169  2.733   -8.602  1.00 0.00 ? 16  PHE A C    4  
ATOM 7028  O O    . PHE A 1 16  ? -8.881  1.781   -8.855  1.00 0.00 ? 16  PHE A O    4  
ATOM 7029  C CB   . PHE A 1 16  ? -5.922  2.651   -9.677  1.00 0.00 ? 16  PHE A CB   4  
ATOM 7030  C CG   . PHE A 1 16  ? -6.023  1.316   -10.405 1.00 0.00 ? 16  PHE A CG   4  
ATOM 7031  C CD1  . PHE A 1 16  ? -6.185  1.275   -11.777 1.00 0.00 ? 16  PHE A CD1  4  
ATOM 7032  C CD2  . PHE A 1 16  ? -5.924  0.129   -9.704  1.00 0.00 ? 16  PHE A CD2  4  
ATOM 7033  C CE1  . PHE A 1 16  ? -6.244  0.067   -12.434 1.00 0.00 ? 16  PHE A CE1  4  
ATOM 7034  C CE2  . PHE A 1 16  ? -5.982  -1.076  -10.363 1.00 0.00 ? 16  PHE A CE2  4  
ATOM 7035  C CZ   . PHE A 1 16  ? -6.144  -1.108  -11.728 1.00 0.00 ? 16  PHE A CZ   4  
ATOM 7036  H H    . PHE A 1 16  ? -6.120  5.121   -9.352  1.00 0.00 ? 16  PHE A H    4  
ATOM 7037  H HA   . PHE A 1 16  ? -7.777  3.274   -10.645 1.00 0.00 ? 16  PHE A HA   4  
ATOM 7038  H HB2  . PHE A 1 16  ? -5.191  3.271   -10.175 1.00 0.00 ? 16  PHE A HB2  4  
ATOM 7039  H HB3  . PHE A 1 16  ? -5.604  2.475   -8.659  1.00 0.00 ? 16  PHE A HB3  4  
ATOM 7040  H HD1  . PHE A 1 16  ? -6.265  2.195   -12.338 1.00 0.00 ? 16  PHE A HD1  4  
ATOM 7041  H HD2  . PHE A 1 16  ? -5.799  0.150   -8.630  1.00 0.00 ? 16  PHE A HD2  4  
ATOM 7042  H HE1  . PHE A 1 16  ? -6.362  0.041   -13.504 1.00 0.00 ? 16  PHE A HE1  4  
ATOM 7043  H HE2  . PHE A 1 16  ? -5.895  -1.996  -9.807  1.00 0.00 ? 16  PHE A HE2  4  
ATOM 7044  H HZ   . PHE A 1 16  ? -6.192  -2.051  -12.244 1.00 0.00 ? 16  PHE A HZ   4  
ATOM 7045  N N    . SER A 1 17  ? -8.099  3.280   -7.418  1.00 0.00 ? 17  SER A N    4  
ATOM 7046  C CA   . SER A 1 17  ? -8.920  2.739   -6.312  1.00 0.00 ? 17  SER A CA   4  
ATOM 7047  C C    . SER A 1 17  ? -10.268 3.443   -6.253  1.00 0.00 ? 17  SER A C    4  
ATOM 7048  O O    . SER A 1 17  ? -11.232 2.903   -5.745  1.00 0.00 ? 17  SER A O    4  
ATOM 7049  C CB   . SER A 1 17  ? -8.172  2.976   -4.988  1.00 0.00 ? 17  SER A CB   4  
ATOM 7050  O OG   . SER A 1 17  ? -8.600  4.263   -4.570  1.00 0.00 ? 17  SER A OG   4  
ATOM 7051  H H    . SER A 1 17  ? -7.511  4.044   -7.264  1.00 0.00 ? 17  SER A H    4  
ATOM 7052  H HA   . SER A 1 17  ? -9.082  1.677   -6.482  1.00 0.00 ? 17  SER A HA   4  
ATOM 7053  H HB2  . SER A 1 17  ? -8.449  2.232   -4.255  1.00 0.00 ? 17  SER A HB2  4  
ATOM 7054  H HB3  . SER A 1 17  ? -7.104  2.970   -5.147  1.00 0.00 ? 17  SER A HB3  4  
ATOM 7055  H HG   . SER A 1 17  ? -9.368  4.151   -4.004  1.00 0.00 ? 17  SER A HG   4  
ATOM 7056  N N    . LEU A 1 18  ? -10.312 4.641   -6.771  1.00 0.00 ? 18  LEU A N    4  
ATOM 7057  C CA   . LEU A 1 18  ? -11.590 5.393   -6.754  1.00 0.00 ? 18  LEU A CA   4  
ATOM 7058  C C    . LEU A 1 18  ? -12.572 4.786   -7.745  1.00 0.00 ? 18  LEU A C    4  
ATOM 7059  O O    . LEU A 1 18  ? -13.766 4.776   -7.513  1.00 0.00 ? 18  LEU A O    4  
ATOM 7060  C CB   . LEU A 1 18  ? -11.311 6.849   -7.163  1.00 0.00 ? 18  LEU A CB   4  
ATOM 7061  C CG   . LEU A 1 18  ? -10.736 7.608   -5.963  1.00 0.00 ? 18  LEU A CG   4  
ATOM 7062  C CD1  . LEU A 1 18  ? -10.289 9.002   -6.415  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 7063  C CD2  . LEU A 1 18  ? -11.817 7.751   -4.889  1.00 0.00 ? 18  LEU A CD2  4  
ATOM 7064  H H    . LEU A 1 18  ? -9.510  5.039   -7.170  1.00 0.00 ? 18  LEU A H    4  
ATOM 7065  H HA   . LEU A 1 18  ? -12.016 5.344   -5.754  1.00 0.00 ? 18  LEU A HA   4  
ATOM 7066  H HB2  . LEU A 1 18  ? -10.603 6.870   -7.978  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 7067  H HB3  . LEU A 1 18  ? -12.230 7.318   -7.481  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 7068  H HG   . LEU A 1 18  ? -9.894  7.068   -5.563  1.00 0.00 ? 18  LEU A HG   4  
ATOM 7069  H HD11 . LEU A 1 18  ? -9.792  8.934   -7.371  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 7070  H HD12 . LEU A 1 18  ? -11.150 9.649   -6.507  1.00 0.00 ? 18  LEU A HD12 4  
ATOM 7071  H HD13 . LEU A 1 18  ? -9.608  9.419   -5.689  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 7072  H HD21 . LEU A 1 18  ? -12.794 7.699   -5.346  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 7073  H HD22 . LEU A 1 18  ? -11.718 6.956   -4.166  1.00 0.00 ? 18  LEU A HD22 4  
ATOM 7074  H HD23 . LEU A 1 18  ? -11.709 8.702   -4.389  1.00 0.00 ? 18  LEU A HD23 4  
ATOM 7075  N N    . PHE A 1 19  ? -12.044 4.288   -8.838  1.00 0.00 ? 19  PHE A N    4  
ATOM 7076  C CA   . PHE A 1 19  ? -12.920 3.674   -9.864  1.00 0.00 ? 19  PHE A CA   4  
ATOM 7077  C C    . PHE A 1 19  ? -12.917 2.160   -9.739  1.00 0.00 ? 19  PHE A C    4  
ATOM 7078  O O    . PHE A 1 19  ? -13.186 1.453   -10.687 1.00 0.00 ? 19  PHE A O    4  
ATOM 7079  C CB   . PHE A 1 19  ? -12.387 4.069   -11.250 1.00 0.00 ? 19  PHE A CB   4  
ATOM 7080  C CG   . PHE A 1 19  ? -12.466 5.587   -11.393 1.00 0.00 ? 19  PHE A CG   4  
ATOM 7081  C CD1  . PHE A 1 19  ? -13.673 6.204   -11.665 1.00 0.00 ? 19  PHE A CD1  4  
ATOM 7082  C CD2  . PHE A 1 19  ? -11.337 6.367   -11.224 1.00 0.00 ? 19  PHE A CD2  4  
ATOM 7083  C CE1  . PHE A 1 19  ? -13.749 7.577   -11.765 1.00 0.00 ? 19  PHE A CE1  4  
ATOM 7084  C CE2  . PHE A 1 19  ? -11.416 7.739   -11.324 1.00 0.00 ? 19  PHE A CE2  4  
ATOM 7085  C CZ   . PHE A 1 19  ? -12.620 8.344   -11.594 1.00 0.00 ? 19  PHE A CZ   4  
ATOM 7086  H H    . PHE A 1 19  ? -11.079 4.321   -8.975  1.00 0.00 ? 19  PHE A H    4  
ATOM 7087  H HA   . PHE A 1 19  ? -13.932 4.035   -9.724  1.00 0.00 ? 19  PHE A HA   4  
ATOM 7088  H HB2  . PHE A 1 19  ? -11.359 3.752   -11.353 1.00 0.00 ? 19  PHE A HB2  4  
ATOM 7089  H HB3  . PHE A 1 19  ? -12.984 3.604   -12.020 1.00 0.00 ? 19  PHE A HB3  4  
ATOM 7090  H HD1  . PHE A 1 19  ? -14.561 5.604   -11.802 1.00 0.00 ? 19  PHE A HD1  4  
ATOM 7091  H HD2  . PHE A 1 19  ? -10.387 5.898   -11.024 1.00 0.00 ? 19  PHE A HD2  4  
ATOM 7092  H HE1  . PHE A 1 19  ? -14.696 8.051   -11.976 1.00 0.00 ? 19  PHE A HE1  4  
ATOM 7093  H HE2  . PHE A 1 19  ? -10.530 8.339   -11.189 1.00 0.00 ? 19  PHE A HE2  4  
ATOM 7094  H HZ   . PHE A 1 19  ? -12.679 9.420   -11.674 1.00 0.00 ? 19  PHE A HZ   4  
ATOM 7095  N N    . ASP A 1 20  ? -12.605 1.691   -8.572  1.00 0.00 ? 20  ASP A N    4  
ATOM 7096  C CA   . ASP A 1 20  ? -12.579 0.227   -8.356  1.00 0.00 ? 20  ASP A CA   4  
ATOM 7097  C C    . ASP A 1 20  ? -13.995 -0.308  -8.179  1.00 0.00 ? 20  ASP A C    4  
ATOM 7098  O O    . ASP A 1 20  ? -14.952 0.438   -8.238  1.00 0.00 ? 20  ASP A O    4  
ATOM 7099  C CB   . ASP A 1 20  ? -11.779 -0.059  -7.075  1.00 0.00 ? 20  ASP A CB   4  
ATOM 7100  C CG   . ASP A 1 20  ? -11.500 -1.560  -6.974  1.00 0.00 ? 20  ASP A CG   4  
ATOM 7101  O OD1  . ASP A 1 20  ? -12.352 -2.231  -6.414  1.00 0.00 ? 20  ASP A OD1  4  
ATOM 7102  O OD2  . ASP A 1 20  ? -10.452 -1.950  -7.461  1.00 0.00 ? 20  ASP A OD2  4  
ATOM 7103  H H    . ASP A 1 20  ? -12.383 2.302   -7.843  1.00 0.00 ? 20  ASP A H    4  
ATOM 7104  H HA   . ASP A 1 20  ? -12.120 -0.254  -9.220  1.00 0.00 ? 20  ASP A HA   4  
ATOM 7105  H HB2  . ASP A 1 20  ? -10.841 0.477   -7.102  1.00 0.00 ? 20  ASP A HB2  4  
ATOM 7106  H HB3  . ASP A 1 20  ? -12.345 0.258   -6.212  1.00 0.00 ? 20  ASP A HB3  4  
ATOM 7107  N N    . LYS A 1 21  ? -14.107 -1.590  -7.967  1.00 0.00 ? 21  LYS A N    4  
ATOM 7108  C CA   . LYS A 1 21  ? -15.456 -2.180  -7.784  1.00 0.00 ? 21  LYS A CA   4  
ATOM 7109  C C    . LYS A 1 21  ? -15.840 -2.202  -6.311  1.00 0.00 ? 21  LYS A C    4  
ATOM 7110  O O    . LYS A 1 21  ? -16.767 -1.534  -5.898  1.00 0.00 ? 21  LYS A O    4  
ATOM 7111  C CB   . LYS A 1 21  ? -15.430 -3.620  -8.319  1.00 0.00 ? 21  LYS A CB   4  
ATOM 7112  C CG   . LYS A 1 21  ? -15.416 -3.585  -9.850  1.00 0.00 ? 21  LYS A CG   4  
ATOM 7113  C CD   . LYS A 1 21  ? -16.098 -4.842  -10.390 1.00 0.00 ? 21  LYS A CD   4  
ATOM 7114  C CE   . LYS A 1 21  ? -15.182 -6.045  -10.163 1.00 0.00 ? 21  LYS A CE   4  
ATOM 7115  N NZ   . LYS A 1 21  ? -15.899 -7.311  -10.483 1.00 0.00 ? 21  LYS A NZ   4  
ATOM 7116  H H    . LYS A 1 21  ? -13.308 -2.157  -7.927  1.00 0.00 ? 21  LYS A H    4  
ATOM 7117  H HA   . LYS A 1 21  ? -16.180 -1.579  -8.328  1.00 0.00 ? 21  LYS A HA   4  
ATOM 7118  H HB2  . LYS A 1 21  ? -14.546 -4.127  -7.959  1.00 0.00 ? 21  LYS A HB2  4  
ATOM 7119  H HB3  . LYS A 1 21  ? -16.307 -4.152  -7.976  1.00 0.00 ? 21  LYS A HB3  4  
ATOM 7120  H HG2  . LYS A 1 21  ? -15.943 -2.709  -10.197 1.00 0.00 ? 21  LYS A HG2  4  
ATOM 7121  H HG3  . LYS A 1 21  ? -14.395 -3.547  -10.203 1.00 0.00 ? 21  LYS A HG3  4  
ATOM 7122  H HD2  . LYS A 1 21  ? -17.035 -4.996  -9.875  1.00 0.00 ? 21  LYS A HD2  4  
ATOM 7123  H HD3  . LYS A 1 21  ? -16.290 -4.726  -11.447 1.00 0.00 ? 21  LYS A HD3  4  
ATOM 7124  H HE2  . LYS A 1 21  ? -14.313 -5.962  -10.797 1.00 0.00 ? 21  LYS A HE2  4  
ATOM 7125  H HE3  . LYS A 1 21  ? -14.867 -6.070  -9.131  1.00 0.00 ? 21  LYS A HE3  4  
ATOM 7126  H HZ1  . LYS A 1 21  ? -16.460 -7.183  -11.350 1.00 0.00 ? 21  LYS A HZ1  4  
ATOM 7127  H HZ2  . LYS A 1 21  ? -15.207 -8.074  -10.627 1.00 0.00 ? 21  LYS A HZ2  4  
ATOM 7128  H HZ3  . LYS A 1 21  ? -16.530 -7.560  -9.696  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM 7129  N N    . ASP A 1 22  ? -15.122 -2.971  -5.546  1.00 0.00 ? 22  ASP A N    4  
ATOM 7130  C CA   . ASP A 1 22  ? -15.430 -3.052  -4.096  1.00 0.00 ? 22  ASP A CA   4  
ATOM 7131  C C    . ASP A 1 22  ? -14.230 -3.576  -3.317  1.00 0.00 ? 22  ASP A C    4  
ATOM 7132  O O    . ASP A 1 22  ? -14.094 -3.324  -2.137  1.00 0.00 ? 22  ASP A O    4  
ATOM 7133  C CB   . ASP A 1 22  ? -16.608 -4.018  -3.899  1.00 0.00 ? 22  ASP A CB   4  
ATOM 7134  C CG   . ASP A 1 22  ? -16.329 -5.318  -4.653  1.00 0.00 ? 22  ASP A CG   4  
ATOM 7135  O OD1  . ASP A 1 22  ? -16.319 -5.245  -5.871  1.00 0.00 ? 22  ASP A OD1  4  
ATOM 7136  O OD2  . ASP A 1 22  ? -16.140 -6.311  -3.969  1.00 0.00 ? 22  ASP A OD2  4  
ATOM 7137  H H    . ASP A 1 22  ? -14.386 -3.494  -5.924  1.00 0.00 ? 22  ASP A H    4  
ATOM 7138  H HA   . ASP A 1 22  ? -15.680 -2.054  -3.732  1.00 0.00 ? 22  ASP A HA   4  
ATOM 7139  H HB2  . ASP A 1 22  ? -16.732 -4.234  -2.847  1.00 0.00 ? 22  ASP A HB2  4  
ATOM 7140  H HB3  . ASP A 1 22  ? -17.516 -3.571  -4.280  1.00 0.00 ? 22  ASP A HB3  4  
ATOM 7141  N N    . GLY A 1 23  ? -13.380 -4.300  -3.993  1.00 0.00 ? 23  GLY A N    4  
ATOM 7142  C CA   . GLY A 1 23  ? -12.180 -4.852  -3.305  1.00 0.00 ? 23  GLY A CA   4  
ATOM 7143  C C    . GLY A 1 23  ? -11.391 -5.757  -4.254  1.00 0.00 ? 23  GLY A C    4  
ATOM 7144  O O    . GLY A 1 23  ? -10.449 -6.410  -3.853  1.00 0.00 ? 23  GLY A O    4  
ATOM 7145  H H    . GLY A 1 23  ? -13.531 -4.480  -4.945  1.00 0.00 ? 23  GLY A H    4  
ATOM 7146  H HA2  . GLY A 1 23  ? -11.548 -4.037  -2.982  1.00 0.00 ? 23  GLY A HA2  4  
ATOM 7147  H HA3  . GLY A 1 23  ? -12.492 -5.423  -2.445  1.00 0.00 ? 23  GLY A HA3  4  
ATOM 7148  N N    . ASP A 1 24  ? -11.793 -5.775  -5.495  1.00 0.00 ? 24  ASP A N    4  
ATOM 7149  C CA   . ASP A 1 24  ? -11.084 -6.626  -6.480  1.00 0.00 ? 24  ASP A CA   4  
ATOM 7150  C C    . ASP A 1 24  ? -9.617  -6.220  -6.589  1.00 0.00 ? 24  ASP A C    4  
ATOM 7151  O O    . ASP A 1 24  ? -8.737  -7.057  -6.556  1.00 0.00 ? 24  ASP A O    4  
ATOM 7152  C CB   . ASP A 1 24  ? -11.753 -6.437  -7.849  1.00 0.00 ? 24  ASP A CB   4  
ATOM 7153  C CG   . ASP A 1 24  ? -13.091 -7.181  -7.861  1.00 0.00 ? 24  ASP A CG   4  
ATOM 7154  O OD1  . ASP A 1 24  ? -13.928 -6.802  -7.060  1.00 0.00 ? 24  ASP A OD1  4  
ATOM 7155  O OD2  . ASP A 1 24  ? -13.199 -8.086  -8.673  1.00 0.00 ? 24  ASP A OD2  4  
ATOM 7156  H H    . ASP A 1 24  ? -12.559 -5.231  -5.774  1.00 0.00 ? 24  ASP A H    4  
ATOM 7157  H HA   . ASP A 1 24  ? -11.142 -7.664  -6.159  1.00 0.00 ? 24  ASP A HA   4  
ATOM 7158  H HB2  . ASP A 1 24  ? -11.927 -5.386  -8.028  1.00 0.00 ? 24  ASP A HB2  4  
ATOM 7159  H HB3  . ASP A 1 24  ? -11.115 -6.833  -8.626  1.00 0.00 ? 24  ASP A HB3  4  
ATOM 7160  N N    . GLY A 1 25  ? -9.386  -4.940  -6.720  1.00 0.00 ? 25  GLY A N    4  
ATOM 7161  C CA   . GLY A 1 25  ? -7.979  -4.448  -6.835  1.00 0.00 ? 25  GLY A CA   4  
ATOM 7162  C C    . GLY A 1 25  ? -7.635  -4.145  -8.295  1.00 0.00 ? 25  GLY A C    4  
ATOM 7163  O O    . GLY A 1 25  ? -6.486  -3.950  -8.636  1.00 0.00 ? 25  GLY A O    4  
ATOM 7164  H H    . GLY A 1 25  ? -10.131 -4.305  -6.744  1.00 0.00 ? 25  GLY A H    4  
ATOM 7165  H HA2  . GLY A 1 25  ? -7.868  -3.549  -6.249  1.00 0.00 ? 25  GLY A HA2  4  
ATOM 7166  H HA3  . GLY A 1 25  ? -7.303  -5.202  -6.459  1.00 0.00 ? 25  GLY A HA3  4  
ATOM 7167  N N    . THR A 1 26  ? -8.642  -4.112  -9.125  1.00 0.00 ? 26  THR A N    4  
ATOM 7168  C CA   . THR A 1 26  ? -8.401  -3.824  -10.562 1.00 0.00 ? 26  THR A CA   4  
ATOM 7169  C C    . THR A 1 26  ? -9.627  -3.170  -11.188 1.00 0.00 ? 26  THR A C    4  
ATOM 7170  O O    . THR A 1 26  ? -10.716 -3.258  -10.656 1.00 0.00 ? 26  THR A O    4  
ATOM 7171  C CB   . THR A 1 26  ? -8.135  -5.149  -11.289 1.00 0.00 ? 26  THR A CB   4  
ATOM 7172  O OG1  . THR A 1 26  ? -9.394  -5.786  -11.370 1.00 0.00 ? 26  THR A OG1  4  
ATOM 7173  C CG2  . THR A 1 26  ? -7.283  -6.095  -10.428 1.00 0.00 ? 26  THR A CG2  4  
ATOM 7174  H H    . THR A 1 26  ? -9.551  -4.270  -8.801  1.00 0.00 ? 26  THR A H    4  
ATOM 7175  H HA   . THR A 1 26  ? -7.549  -3.151  -10.655 1.00 0.00 ? 26  THR A HA   4  
ATOM 7176  H HB   . THR A 1 26  ? -7.719  -4.988  -12.280 1.00 0.00 ? 26  THR A HB   4  
ATOM 7177  H HG1  . THR A 1 26  ? -9.862  -5.623  -10.548 1.00 0.00 ? 26  THR A HG1  4  
ATOM 7178  H HG21 . THR A 1 26  ? -7.772  -6.268  -9.482  1.00 0.00 ? 26  THR A HG21 4  
ATOM 7179  H HG22 . THR A 1 26  ? -7.155  -7.037  -10.939 1.00 0.00 ? 26  THR A HG22 4  
ATOM 7180  H HG23 . THR A 1 26  ? -6.313  -5.654  -10.254 1.00 0.00 ? 26  THR A HG23 4  
ATOM 7181  N N    . ILE A 1 27  ? -9.419  -2.527  -12.311 1.00 0.00 ? 27  ILE A N    4  
ATOM 7182  C CA   . ILE A 1 27  ? -10.552 -1.856  -13.006 1.00 0.00 ? 27  ILE A CA   4  
ATOM 7183  C C    . ILE A 1 27  ? -10.754 -2.481  -14.364 1.00 0.00 ? 27  ILE A C    4  
ATOM 7184  O O    . ILE A 1 27  ? -9.937  -3.254  -14.804 1.00 0.00 ? 27  ILE A O    4  
ATOM 7185  C CB   . ILE A 1 27  ? -10.197 -0.384  -13.208 1.00 0.00 ? 27  ILE A CB   4  
ATOM 7186  C CG1  . ILE A 1 27  ? -9.094  -0.270  -14.255 1.00 0.00 ? 27  ILE A CG1  4  
ATOM 7187  C CG2  . ILE A 1 27  ? -9.682  0.187   -11.873 1.00 0.00 ? 27  ILE A CG2  4  
ATOM 7188  C CD1  . ILE A 1 27  ? -8.621  1.182   -14.343 1.00 0.00 ? 27  ILE A CD1  4  
ATOM 7189  H H    . ILE A 1 27  ? -8.521  -2.497  -12.701 1.00 0.00 ? 27  ILE A H    4  
ATOM 7190  H HA   . ILE A 1 27  ? -11.462 -1.964  -12.420 1.00 0.00 ? 27  ILE A HA   4  
ATOM 7191  H HB   . ILE A 1 27  ? -11.081 0.158   -13.552 1.00 0.00 ? 27  ILE A HB   4  
ATOM 7192  H HG12 . ILE A 1 27  ? -8.267  -0.906  -13.981 1.00 0.00 ? 27  ILE A HG12 4  
ATOM 7193  H HG13 . ILE A 1 27  ? -9.474  -0.583  -15.217 1.00 0.00 ? 27  ILE A HG13 4  
ATOM 7194  H HG21 . ILE A 1 27  ? -10.260 -0.224  -11.057 1.00 0.00 ? 27  ILE A HG21 4  
ATOM 7195  H HG22 . ILE A 1 27  ? -8.643  -0.074  -11.741 1.00 0.00 ? 27  ILE A HG22 4  
ATOM 7196  H HG23 . ILE A 1 27  ? -9.784  1.261   -11.872 1.00 0.00 ? 27  ILE A HG23 4  
ATOM 7197  H HD11 . ILE A 1 27  ? -9.451  1.820   -14.610 1.00 0.00 ? 27  ILE A HD11 4  
ATOM 7198  H HD12 . ILE A 1 27  ? -8.222  1.494   -13.391 1.00 0.00 ? 27  ILE A HD12 4  
ATOM 7199  H HD13 . ILE A 1 27  ? -7.851  1.269   -15.097 1.00 0.00 ? 27  ILE A HD13 4  
ATOM 7200  N N    . THR A 1 28  ? -11.838 -2.138  -15.007 1.00 0.00 ? 28  THR A N    4  
ATOM 7201  C CA   . THR A 1 28  ? -12.102 -2.715  -16.349 1.00 0.00 ? 28  THR A CA   4  
ATOM 7202  C C    . THR A 1 28  ? -11.882 -1.671  -17.435 1.00 0.00 ? 28  THR A C    4  
ATOM 7203  O O    . THR A 1 28  ? -12.163 -0.504  -17.247 1.00 0.00 ? 28  THR A O    4  
ATOM 7204  C CB   . THR A 1 28  ? -13.549 -3.194  -16.403 1.00 0.00 ? 28  THR A CB   4  
ATOM 7205  O OG1  . THR A 1 28  ? -14.326 -2.110  -15.932 1.00 0.00 ? 28  THR A OG1  4  
ATOM 7206  C CG2  . THR A 1 28  ? -13.787 -4.313  -15.384 1.00 0.00 ? 28  THR A CG2  4  
ATOM 7207  H H    . THR A 1 28  ? -12.471 -1.507  -14.606 1.00 0.00 ? 28  THR A H    4  
ATOM 7208  H HA   . THR A 1 28  ? -11.420 -3.544  -16.523 1.00 0.00 ? 28  THR A HA   4  
ATOM 7209  H HB   . THR A 1 28  ? -13.838 -3.477  -17.411 1.00 0.00 ? 28  THR A HB   4  
ATOM 7210  H HG1  . THR A 1 28  ? -14.580 -2.299  -15.025 1.00 0.00 ? 28  THR A HG1  4  
ATOM 7211  H HG21 . THR A 1 28  ? -13.035 -5.079  -15.504 1.00 0.00 ? 28  THR A HG21 4  
ATOM 7212  H HG22 . THR A 1 28  ? -13.731 -3.913  -14.384 1.00 0.00 ? 28  THR A HG22 4  
ATOM 7213  H HG23 . THR A 1 28  ? -14.764 -4.745  -15.540 1.00 0.00 ? 28  THR A HG23 4  
ATOM 7214  N N    . THR A 1 29  ? -11.376 -2.119  -18.548 1.00 0.00 ? 29  THR A N    4  
ATOM 7215  C CA   . THR A 1 29  ? -11.116 -1.189  -19.680 1.00 0.00 ? 29  THR A CA   4  
ATOM 7216  C C    . THR A 1 29  ? -12.212 -0.132  -19.816 1.00 0.00 ? 29  THR A C    4  
ATOM 7217  O O    . THR A 1 29  ? -11.957 0.969   -20.261 1.00 0.00 ? 29  THR A O    4  
ATOM 7218  C CB   . THR A 1 29  ? -11.081 -2.013  -20.969 1.00 0.00 ? 29  THR A CB   4  
ATOM 7219  O OG1  . THR A 1 29  ? -12.294 -2.740  -20.981 1.00 0.00 ? 29  THR A OG1  4  
ATOM 7220  C CG2  . THR A 1 29  ? -9.989  -3.088  -20.903 1.00 0.00 ? 29  THR A CG2  4  
ATOM 7221  H H    . THR A 1 29  ? -11.160 -3.069  -18.637 1.00 0.00 ? 29  THR A H    4  
ATOM 7222  H HA   . THR A 1 29  ? -10.159 -0.691  -19.515 1.00 0.00 ? 29  THR A HA   4  
ATOM 7223  H HB   . THR A 1 29  ? -11.000 -1.381  -21.849 1.00 0.00 ? 29  THR A HB   4  
ATOM 7224  H HG1  . THR A 1 29  ? -13.008 -2.128  -20.785 1.00 0.00 ? 29  THR A HG1  4  
ATOM 7225  H HG21 . THR A 1 29  ? -10.056 -3.619  -19.965 1.00 0.00 ? 29  THR A HG21 4  
ATOM 7226  H HG22 . THR A 1 29  ? -10.115 -3.786  -21.718 1.00 0.00 ? 29  THR A HG22 4  
ATOM 7227  H HG23 . THR A 1 29  ? -9.016  -2.625  -20.980 1.00 0.00 ? 29  THR A HG23 4  
ATOM 7228  N N    . LYS A 1 30  ? -13.411 -0.479  -19.433 1.00 0.00 ? 30  LYS A N    4  
ATOM 7229  C CA   . LYS A 1 30  ? -14.519 0.510   -19.544 1.00 0.00 ? 30  LYS A CA   4  
ATOM 7230  C C    . LYS A 1 30  ? -14.326 1.657   -18.563 1.00 0.00 ? 30  LYS A C    4  
ATOM 7231  O O    . LYS A 1 30  ? -14.518 2.807   -18.904 1.00 0.00 ? 30  LYS A O    4  
ATOM 7232  C CB   . LYS A 1 30  ? -15.847 -0.196  -19.229 1.00 0.00 ? 30  LYS A CB   4  
ATOM 7233  C CG   . LYS A 1 30  ? -15.691 -1.010  -17.949 1.00 0.00 ? 30  LYS A CG   4  
ATOM 7234  C CD   . LYS A 1 30  ? -17.001 -1.750  -17.658 1.00 0.00 ? 30  LYS A CD   4  
ATOM 7235  C CE   . LYS A 1 30  ? -18.073 -0.734  -17.255 1.00 0.00 ? 30  LYS A CE   4  
ATOM 7236  N NZ   . LYS A 1 30  ? -19.108 -0.623  -18.320 1.00 0.00 ? 30  LYS A NZ   4  
ATOM 7237  H H    . LYS A 1 30  ? -13.579 -1.377  -19.073 1.00 0.00 ? 30  LYS A H    4  
ATOM 7238  H HA   . LYS A 1 30  ? -14.528 0.914   -20.555 1.00 0.00 ? 30  LYS A HA   4  
ATOM 7239  H HB2  . LYS A 1 30  ? -16.626 0.539   -19.099 1.00 0.00 ? 30  LYS A HB2  4  
ATOM 7240  H HB3  . LYS A 1 30  ? -16.110 -0.852  -20.047 1.00 0.00 ? 30  LYS A HB3  4  
ATOM 7241  H HG2  . LYS A 1 30  ? -14.897 -1.721  -18.075 1.00 0.00 ? 30  LYS A HG2  4  
ATOM 7242  H HG3  . LYS A 1 30  ? -15.453 -0.354  -17.125 1.00 0.00 ? 30  LYS A HG3  4  
ATOM 7243  H HD2  . LYS A 1 30  ? -17.321 -2.283  -18.541 1.00 0.00 ? 30  LYS A HD2  4  
ATOM 7244  H HD3  . LYS A 1 30  ? -16.849 -2.455  -16.854 1.00 0.00 ? 30  LYS A HD3  4  
ATOM 7245  H HE2  . LYS A 1 30  ? -18.545 -1.053  -16.337 1.00 0.00 ? 30  LYS A HE2  4  
ATOM 7246  H HE3  . LYS A 1 30  ? -17.619 0.233   -17.101 1.00 0.00 ? 30  LYS A HE3  4  
ATOM 7247  H HZ1  . LYS A 1 30  ? -18.645 -0.585  -19.250 1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 7248  H HZ2  . LYS A 1 30  ? -19.738 -1.449  -18.280 1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 7249  H HZ3  . LYS A 1 30  ? -19.664 0.244   -18.175 1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 7250  N N    . GLU A 1 31  ? -13.948 1.326   -17.364 1.00 0.00 ? 31  GLU A N    4  
ATOM 7251  C CA   . GLU A 1 31  ? -13.738 2.387   -16.349 1.00 0.00 ? 31  GLU A CA   4  
ATOM 7252  C C    . GLU A 1 31  ? -12.381 3.049   -16.536 1.00 0.00 ? 31  GLU A C    4  
ATOM 7253  O O    . GLU A 1 31  ? -12.090 4.053   -15.926 1.00 0.00 ? 31  GLU A O    4  
ATOM 7254  C CB   . GLU A 1 31  ? -13.790 1.741   -14.956 1.00 0.00 ? 31  GLU A CB   4  
ATOM 7255  C CG   . GLU A 1 31  ? -15.251 1.617   -14.516 1.00 0.00 ? 31  GLU A CG   4  
ATOM 7256  C CD   . GLU A 1 31  ? -15.316 0.902   -13.166 1.00 0.00 ? 31  GLU A CD   4  
ATOM 7257  O OE1  . GLU A 1 31  ? -15.077 1.582   -12.183 1.00 0.00 ? 31  GLU A OE1  4  
ATOM 7258  O OE2  . GLU A 1 31  ? -15.599 -0.284  -13.194 1.00 0.00 ? 31  GLU A OE2  4  
ATOM 7259  H H    . GLU A 1 31  ? -13.802 0.384   -17.135 1.00 0.00 ? 31  GLU A H    4  
ATOM 7260  H HA   . GLU A 1 31  ? -14.518 3.143   -16.456 1.00 0.00 ? 31  GLU A HA   4  
ATOM 7261  H HB2  . GLU A 1 31  ? -13.337 0.761   -14.993 1.00 0.00 ? 31  GLU A HB2  4  
ATOM 7262  H HB3  . GLU A 1 31  ? -13.249 2.355   -14.251 1.00 0.00 ? 31  GLU A HB3  4  
ATOM 7263  H HG2  . GLU A 1 31  ? -15.688 2.601   -14.419 1.00 0.00 ? 31  GLU A HG2  4  
ATOM 7264  H HG3  . GLU A 1 31  ? -15.807 1.050   -15.247 1.00 0.00 ? 31  GLU A HG3  4  
ATOM 7265  N N    . LEU A 1 32  ? -11.575 2.477   -17.380 1.00 0.00 ? 32  LEU A N    4  
ATOM 7266  C CA   . LEU A 1 32  ? -10.241 3.059   -17.616 1.00 0.00 ? 32  LEU A CA   4  
ATOM 7267  C C    . LEU A 1 32  ? -10.340 4.536   -17.967 1.00 0.00 ? 32  LEU A C    4  
ATOM 7268  O O    . LEU A 1 32  ? -9.901  5.387   -17.220 1.00 0.00 ? 32  LEU A O    4  
ATOM 7269  C CB   . LEU A 1 32  ? -9.615  2.319   -18.795 1.00 0.00 ? 32  LEU A CB   4  
ATOM 7270  C CG   . LEU A 1 32  ? -8.134  2.665   -18.876 1.00 0.00 ? 32  LEU A CG   4  
ATOM 7271  C CD1  . LEU A 1 32  ? -7.378  1.928   -17.765 1.00 0.00 ? 32  LEU A CD1  4  
ATOM 7272  C CD2  . LEU A 1 32  ? -7.601  2.220   -20.235 1.00 0.00 ? 32  LEU A CD2  4  
ATOM 7273  H H    . LEU A 1 32  ? -11.847 1.667   -17.858 1.00 0.00 ? 32  LEU A H    4  
ATOM 7274  H HA   . LEU A 1 32  ? -9.635  2.941   -16.718 1.00 0.00 ? 32  LEU A HA   4  
ATOM 7275  H HB2  . LEU A 1 32  ? -9.735  1.259   -18.659 1.00 0.00 ? 32  LEU A HB2  4  
ATOM 7276  H HB3  . LEU A 1 32  ? -10.107 2.616   -19.709 1.00 0.00 ? 32  LEU A HB3  4  
ATOM 7277  H HG   . LEU A 1 32  ? -8.001  3.731   -18.763 1.00 0.00 ? 32  LEU A HG   4  
ATOM 7278  H HD11 . LEU A 1 32  ? -7.959  1.082   -17.425 1.00 0.00 ? 32  LEU A HD11 4  
ATOM 7279  H HD12 . LEU A 1 32  ? -6.428  1.580   -18.140 1.00 0.00 ? 32  LEU A HD12 4  
ATOM 7280  H HD13 . LEU A 1 32  ? -7.209  2.595   -16.936 1.00 0.00 ? 32  LEU A HD13 4  
ATOM 7281  H HD21 . LEU A 1 32  ? -8.165  2.701   -21.022 1.00 0.00 ? 32  LEU A HD21 4  
ATOM 7282  H HD22 . LEU A 1 32  ? -6.561  2.493   -20.326 1.00 0.00 ? 32  LEU A HD22 4  
ATOM 7283  H HD23 . LEU A 1 32  ? -7.698  1.150   -20.333 1.00 0.00 ? 32  LEU A HD23 4  
ATOM 7284  N N    . GLY A 1 33  ? -10.919 4.815   -19.102 1.00 0.00 ? 33  GLY A N    4  
ATOM 7285  C CA   . GLY A 1 33  ? -11.059 6.235   -19.526 1.00 0.00 ? 33  GLY A CA   4  
ATOM 7286  C C    . GLY A 1 33  ? -11.517 7.107   -18.359 1.00 0.00 ? 33  GLY A C    4  
ATOM 7287  O O    . GLY A 1 33  ? -11.025 8.201   -18.170 1.00 0.00 ? 33  GLY A O    4  
ATOM 7288  H H    . GLY A 1 33  ? -11.263 4.095   -19.670 1.00 0.00 ? 33  GLY A H    4  
ATOM 7289  H HA2  . GLY A 1 33  ? -10.104 6.595   -19.883 1.00 0.00 ? 33  GLY A HA2  4  
ATOM 7290  H HA3  . GLY A 1 33  ? -11.783 6.298   -20.324 1.00 0.00 ? 33  GLY A HA3  4  
ATOM 7291  N N    . THR A 1 34  ? -12.450 6.607   -17.596 1.00 0.00 ? 34  THR A N    4  
ATOM 7292  C CA   . THR A 1 34  ? -12.939 7.404   -16.447 1.00 0.00 ? 34  THR A CA   4  
ATOM 7293  C C    . THR A 1 34  ? -11.812 7.675   -15.463 1.00 0.00 ? 34  THR A C    4  
ATOM 7294  O O    . THR A 1 34  ? -11.739 8.741   -14.882 1.00 0.00 ? 34  THR A O    4  
ATOM 7295  C CB   . THR A 1 34  ? -14.059 6.621   -15.746 1.00 0.00 ? 34  THR A CB   4  
ATOM 7296  O OG1  . THR A 1 34  ? -15.118 6.573   -16.679 1.00 0.00 ? 34  THR A OG1  4  
ATOM 7297  C CG2  . THR A 1 34  ? -14.632 7.418   -14.562 1.00 0.00 ? 34  THR A CG2  4  
ATOM 7298  H H    . THR A 1 34  ? -12.820 5.719   -17.782 1.00 0.00 ? 34  THR A H    4  
ATOM 7299  H HA   . THR A 1 34  ? -13.307 8.354   -16.817 1.00 0.00 ? 34  THR A HA   4  
ATOM 7300  H HB   . THR A 1 34  ? -13.746 5.624   -15.470 1.00 0.00 ? 34  THR A HB   4  
ATOM 7301  H HG1  . THR A 1 34  ? -15.114 5.705   -17.087 1.00 0.00 ? 34  THR A HG1  4  
ATOM 7302  H HG21 . THR A 1 34  ? -13.877 8.075   -14.162 1.00 0.00 ? 34  THR A HG21 4  
ATOM 7303  H HG22 . THR A 1 34  ? -15.475 8.008   -14.893 1.00 0.00 ? 34  THR A HG22 4  
ATOM 7304  H HG23 . THR A 1 34  ? -14.956 6.738   -13.788 1.00 0.00 ? 34  THR A HG23 4  
ATOM 7305  N N    . VAL A 1 35  ? -10.945 6.718   -15.288 1.00 0.00 ? 35  VAL A N    4  
ATOM 7306  C CA   . VAL A 1 35  ? -9.831  6.938   -14.343 1.00 0.00 ? 35  VAL A CA   4  
ATOM 7307  C C    . VAL A 1 35  ? -8.925  8.039   -14.862 1.00 0.00 ? 35  VAL A C    4  
ATOM 7308  O O    . VAL A 1 35  ? -8.840  9.102   -14.281 1.00 0.00 ? 35  VAL A O    4  
ATOM 7309  C CB   . VAL A 1 35  ? -9.007  5.643   -14.212 1.00 0.00 ? 35  VAL A CB   4  
ATOM 7310  C CG1  . VAL A 1 35  ? -7.883  5.869   -13.195 1.00 0.00 ? 35  VAL A CG1  4  
ATOM 7311  C CG2  . VAL A 1 35  ? -9.908  4.510   -13.719 1.00 0.00 ? 35  VAL A CG2  4  
ATOM 7312  H H    . VAL A 1 35  ? -11.030 5.871   -15.774 1.00 0.00 ? 35  VAL A H    4  
ATOM 7313  H HA   . VAL A 1 35  ? -10.236 7.237   -13.385 1.00 0.00 ? 35  VAL A HA   4  
ATOM 7314  H HB   . VAL A 1 35  ? -8.586  5.382   -15.169 1.00 0.00 ? 35  VAL A HB   4  
ATOM 7315  H HG11 . VAL A 1 35  ? -7.648  6.918   -13.145 1.00 0.00 ? 35  VAL A HG11 4  
ATOM 7316  H HG12 . VAL A 1 35  ? -8.197  5.533   -12.220 1.00 0.00 ? 35  VAL A HG12 4  
ATOM 7317  H HG13 . VAL A 1 35  ? -7.002  5.321   -13.496 1.00 0.00 ? 35  VAL A HG13 4  
ATOM 7318  H HG21 . VAL A 1 35  ? -10.787 4.924   -13.248 1.00 0.00 ? 35  VAL A HG21 4  
ATOM 7319  H HG22 . VAL A 1 35  ? -10.204 3.896   -14.551 1.00 0.00 ? 35  VAL A HG22 4  
ATOM 7320  H HG23 . VAL A 1 35  ? -9.373  3.902   -13.003 1.00 0.00 ? 35  VAL A HG23 4  
ATOM 7321  N N    . MET A 1 36  ? -8.269  7.770   -15.954 1.00 0.00 ? 36  MET A N    4  
ATOM 7322  C CA   . MET A 1 36  ? -7.363  8.789   -16.527 1.00 0.00 ? 36  MET A CA   4  
ATOM 7323  C C    . MET A 1 36  ? -8.036  10.155  -16.563 1.00 0.00 ? 36  MET A C    4  
ATOM 7324  O O    . MET A 1 36  ? -7.386  11.170  -16.417 1.00 0.00 ? 36  MET A O    4  
ATOM 7325  C CB   . MET A 1 36  ? -7.011  8.372   -17.963 1.00 0.00 ? 36  MET A CB   4  
ATOM 7326  C CG   . MET A 1 36  ? -7.031  6.844   -18.057 1.00 0.00 ? 36  MET A CG   4  
ATOM 7327  S SD   . MET A 1 36  ? -6.009  6.075   -19.339 1.00 0.00 ? 36  MET A SD   4  
ATOM 7328  C CE   . MET A 1 36  ? -4.411  6.698   -18.759 1.00 0.00 ? 36  MET A CE   4  
ATOM 7329  H H    . MET A 1 36  ? -8.380  6.900   -16.396 1.00 0.00 ? 36  MET A H    4  
ATOM 7330  H HA   . MET A 1 36  ? -6.465  8.853   -15.912 1.00 0.00 ? 36  MET A HA   4  
ATOM 7331  H HB2  . MET A 1 36  ? -7.733  8.788   -18.650 1.00 0.00 ? 36  MET A HB2  4  
ATOM 7332  H HB3  . MET A 1 36  ? -6.027  8.738   -18.217 1.00 0.00 ? 36  MET A HB3  4  
ATOM 7333  H HG2  . MET A 1 36  ? -6.717  6.445   -17.103 1.00 0.00 ? 36  MET A HG2  4  
ATOM 7334  H HG3  . MET A 1 36  ? -8.053  6.532   -18.222 1.00 0.00 ? 36  MET A HG3  4  
ATOM 7335  H HE1  . MET A 1 36  ? -4.392  6.688   -17.680 1.00 0.00 ? 36  MET A HE1  4  
ATOM 7336  H HE2  . MET A 1 36  ? -3.619  6.069   -19.140 1.00 0.00 ? 36  MET A HE2  4  
ATOM 7337  H HE3  . MET A 1 36  ? -4.268  7.710   -19.112 1.00 0.00 ? 36  MET A HE3  4  
ATOM 7338  N N    . ARG A 1 37  ? -9.332  10.159  -16.748 1.00 0.00 ? 37  ARG A N    4  
ATOM 7339  C CA   . ARG A 1 37  ? -10.052 11.456  -16.793 1.00 0.00 ? 37  ARG A CA   4  
ATOM 7340  C C    . ARG A 1 37  ? -9.947  12.189  -15.459 1.00 0.00 ? 37  ARG A C    4  
ATOM 7341  O O    . ARG A 1 37  ? -9.714  13.381  -15.422 1.00 0.00 ? 37  ARG A O    4  
ATOM 7342  C CB   . ARG A 1 37  ? -11.535 11.175  -17.094 1.00 0.00 ? 37  ARG A CB   4  
ATOM 7343  C CG   . ARG A 1 37  ? -11.763 11.248  -18.608 1.00 0.00 ? 37  ARG A CG   4  
ATOM 7344  C CD   . ARG A 1 37  ? -13.267 11.213  -18.888 1.00 0.00 ? 37  ARG A CD   4  
ATOM 7345  N NE   . ARG A 1 37  ? -13.579 12.175  -19.983 1.00 0.00 ? 37  ARG A NE   4  
ATOM 7346  C CZ   . ARG A 1 37  ? -14.822 12.376  -20.321 1.00 0.00 ? 37  ARG A CZ   4  
ATOM 7347  N NH1  . ARG A 1 37  ? -15.537 11.363  -20.727 1.00 0.00 ? 37  ARG A NH1  4  
ATOM 7348  N NH2  . ARG A 1 37  ? -15.309 13.584  -20.242 1.00 0.00 ? 37  ARG A NH2  4  
ATOM 7349  H H    . ARG A 1 37  ? -9.826  9.314   -16.853 1.00 0.00 ? 37  ARG A H    4  
ATOM 7350  H HA   . ARG A 1 37  ? -9.611  12.076  -17.573 1.00 0.00 ? 37  ARG A HA   4  
ATOM 7351  H HB2  . ARG A 1 37  ? -11.796 10.192  -16.737 1.00 0.00 ? 37  ARG A HB2  4  
ATOM 7352  H HB3  . ARG A 1 37  ? -12.153 11.909  -16.598 1.00 0.00 ? 37  ARG A HB3  4  
ATOM 7353  H HG2  . ARG A 1 37  ? -11.342 12.161  -18.996 1.00 0.00 ? 37  ARG A HG2  4  
ATOM 7354  H HG3  . ARG A 1 37  ? -11.286 10.405  -19.087 1.00 0.00 ? 37  ARG A HG3  4  
ATOM 7355  H HD2  . ARG A 1 37  ? -13.561 10.219  -19.190 1.00 0.00 ? 37  ARG A HD2  4  
ATOM 7356  H HD3  . ARG A 1 37  ? -13.812 11.495  -18.000 1.00 0.00 ? 37  ARG A HD3  4  
ATOM 7357  H HE   . ARG A 1 37  ? -12.857 12.651  -20.445 1.00 0.00 ? 37  ARG A HE   4  
ATOM 7358  H HH11 . ARG A 1 37  ? -15.129 10.451  -20.775 1.00 0.00 ? 37  ARG A HH11 4  
ATOM 7359  H HH12 . ARG A 1 37  ? -16.492 11.498  -20.992 1.00 0.00 ? 37  ARG A HH12 4  
ATOM 7360  H HH21 . ARG A 1 37  ? -14.731 14.336  -19.925 1.00 0.00 ? 37  ARG A HH21 4  
ATOM 7361  H HH22 . ARG A 1 37  ? -16.259 13.758  -20.498 1.00 0.00 ? 37  ARG A HH22 4  
ATOM 7362  N N    . SER A 1 38  ? -10.117 11.464  -14.384 1.00 0.00 ? 38  SER A N    4  
ATOM 7363  C CA   . SER A 1 38  ? -10.030 12.106  -13.048 1.00 0.00 ? 38  SER A CA   4  
ATOM 7364  C C    . SER A 1 38  ? -8.629  11.974  -12.459 1.00 0.00 ? 38  SER A C    4  
ATOM 7365  O O    . SER A 1 38  ? -8.329  12.550  -11.432 1.00 0.00 ? 38  SER A O    4  
ATOM 7366  C CB   . SER A 1 38  ? -11.022 11.405  -12.112 1.00 0.00 ? 38  SER A CB   4  
ATOM 7367  O OG   . SER A 1 38  ? -11.058 12.233  -10.959 1.00 0.00 ? 38  SER A OG   4  
ATOM 7368  H H    . SER A 1 38  ? -10.303 10.508  -14.459 1.00 0.00 ? 38  SER A H    4  
ATOM 7369  H HA   . SER A 1 38  ? -10.273 13.159  -13.147 1.00 0.00 ? 38  SER A HA   4  
ATOM 7370  H HB2  . SER A 1 38  ? -12.002 11.349  -12.563 1.00 0.00 ? 38  SER A HB2  4  
ATOM 7371  H HB3  . SER A 1 38  ? -10.671 10.419  -11.852 1.00 0.00 ? 38  SER A HB3  4  
ATOM 7372  H HG   . SER A 1 38  ? -11.607 11.801  -10.302 1.00 0.00 ? 38  SER A HG   4  
ATOM 7373  N N    . LEU A 1 39  ? -7.795  11.216  -13.115 1.00 0.00 ? 39  LEU A N    4  
ATOM 7374  C CA   . LEU A 1 39  ? -6.427  11.040  -12.608 1.00 0.00 ? 39  LEU A CA   4  
ATOM 7375  C C    . LEU A 1 39  ? -5.521  12.177  -13.069 1.00 0.00 ? 39  LEU A C    4  
ATOM 7376  O O    . LEU A 1 39  ? -4.532  12.481  -12.432 1.00 0.00 ? 39  LEU A O    4  
ATOM 7377  C CB   . LEU A 1 39  ? -5.895  9.716   -13.159 1.00 0.00 ? 39  LEU A CB   4  
ATOM 7378  C CG   . LEU A 1 39  ? -4.867  9.141   -12.185 1.00 0.00 ? 39  LEU A CG   4  
ATOM 7379  C CD1  . LEU A 1 39  ? -4.631  7.669   -12.516 1.00 0.00 ? 39  LEU A CD1  4  
ATOM 7380  C CD2  . LEU A 1 39  ? -3.556  9.914   -12.325 1.00 0.00 ? 39  LEU A CD2  4  
ATOM 7381  H H    . LEU A 1 39  ? -8.074  10.763  -13.932 1.00 0.00 ? 39  LEU A H    4  
ATOM 7382  H HA   . LEU A 1 39  ? -6.451  11.024  -11.520 1.00 0.00 ? 39  LEU A HA   4  
ATOM 7383  H HB2  . LEU A 1 39  ? -6.714  9.022   -13.272 1.00 0.00 ? 39  LEU A HB2  4  
ATOM 7384  H HB3  . LEU A 1 39  ? -5.437  9.879   -14.123 1.00 0.00 ? 39  LEU A HB3  4  
ATOM 7385  H HG   . LEU A 1 39  ? -5.231  9.229   -11.174 1.00 0.00 ? 39  LEU A HG   4  
ATOM 7386  H HD11 . LEU A 1 39  ? -5.525  7.242   -12.934 1.00 0.00 ? 39  LEU A HD11 4  
ATOM 7387  H HD12 . LEU A 1 39  ? -3.830  7.583   -13.230 1.00 0.00 ? 39  LEU A HD12 4  
ATOM 7388  H HD13 . LEU A 1 39  ? -4.371  7.132   -11.621 1.00 0.00 ? 39  LEU A HD13 4  
ATOM 7389  H HD21 . LEU A 1 39  ? -3.561  10.485  -13.241 1.00 0.00 ? 39  LEU A HD21 4  
ATOM 7390  H HD22 . LEU A 1 39  ? -3.440  10.585  -11.487 1.00 0.00 ? 39  LEU A HD22 4  
ATOM 7391  H HD23 . LEU A 1 39  ? -2.732  9.226   -12.345 1.00 0.00 ? 39  LEU A HD23 4  
ATOM 7392  N N    . GLY A 1 40  ? -5.876  12.794  -14.169 1.00 0.00 ? 40  GLY A N    4  
ATOM 7393  C CA   . GLY A 1 40  ? -5.034  13.916  -14.674 1.00 0.00 ? 40  GLY A CA   4  
ATOM 7394  C C    . GLY A 1 40  ? -5.293  14.175  -16.165 1.00 0.00 ? 40  GLY A C    4  
ATOM 7395  O O    . GLY A 1 40  ? -5.772  15.227  -16.539 1.00 0.00 ? 40  GLY A O    4  
ATOM 7396  H H    . GLY A 1 40  ? -6.685  12.523  -14.652 1.00 0.00 ? 40  GLY A H    4  
ATOM 7397  H HA2  . GLY A 1 40  ? -5.263  14.810  -14.114 1.00 0.00 ? 40  GLY A HA2  4  
ATOM 7398  H HA3  . GLY A 1 40  ? -3.993  13.668  -14.532 1.00 0.00 ? 40  GLY A HA3  4  
ATOM 7399  N N    . GLN A 1 41  ? -4.968  13.210  -16.983 1.00 0.00 ? 41  GLN A N    4  
ATOM 7400  C CA   . GLN A 1 41  ? -5.185  13.385  -18.444 1.00 0.00 ? 41  GLN A CA   4  
ATOM 7401  C C    . GLN A 1 41  ? -6.660  13.236  -18.814 1.00 0.00 ? 41  GLN A C    4  
ATOM 7402  O O    . GLN A 1 41  ? -7.517  13.152  -17.957 1.00 0.00 ? 41  GLN A O    4  
ATOM 7403  C CB   . GLN A 1 41  ? -4.384  12.303  -19.180 1.00 0.00 ? 41  GLN A CB   4  
ATOM 7404  C CG   . GLN A 1 41  ? -3.055  12.895  -19.651 1.00 0.00 ? 41  GLN A CG   4  
ATOM 7405  C CD   . GLN A 1 41  ? -2.268  13.395  -18.440 1.00 0.00 ? 41  GLN A CD   4  
ATOM 7406  O OE1  . GLN A 1 41  ? -2.628  14.367  -17.809 1.00 0.00 ? 41  GLN A OE1  4  
ATOM 7407  N NE2  . GLN A 1 41  ? -1.187  12.758  -18.082 1.00 0.00 ? 41  GLN A NE2  4  
ATOM 7408  H H    . GLN A 1 41  ? -4.583  12.378  -16.638 1.00 0.00 ? 41  GLN A H    4  
ATOM 7409  H HA   . GLN A 1 41  ? -4.847  14.379  -18.735 1.00 0.00 ? 41  GLN A HA   4  
ATOM 7410  H HB2  . GLN A 1 41  ? -4.196  11.475  -18.512 1.00 0.00 ? 41  GLN A HB2  4  
ATOM 7411  H HB3  . GLN A 1 41  ? -4.947  11.949  -20.031 1.00 0.00 ? 41  GLN A HB3  4  
ATOM 7412  H HG2  . GLN A 1 41  ? -2.479  12.139  -20.165 1.00 0.00 ? 41  GLN A HG2  4  
ATOM 7413  H HG3  . GLN A 1 41  ? -3.239  13.721  -20.323 1.00 0.00 ? 41  GLN A HG3  4  
ATOM 7414  H HE21 . GLN A 1 41  ? -0.892  11.973  -18.587 1.00 0.00 ? 41  GLN A HE21 4  
ATOM 7415  H HE22 . GLN A 1 41  ? -0.672  13.066  -17.308 1.00 0.00 ? 41  GLN A HE22 4  
ATOM 7416  N N    . ASN A 1 42  ? -6.922  13.213  -20.095 1.00 0.00 ? 42  ASN A N    4  
ATOM 7417  C CA   . ASN A 1 42  ? -8.322  13.072  -20.560 1.00 0.00 ? 42  ASN A CA   4  
ATOM 7418  C C    . ASN A 1 42  ? -8.359  12.464  -21.962 1.00 0.00 ? 42  ASN A C    4  
ATOM 7419  O O    . ASN A 1 42  ? -8.588  13.145  -22.941 1.00 0.00 ? 42  ASN A O    4  
ATOM 7420  C CB   . ASN A 1 42  ? -8.947  14.470  -20.613 1.00 0.00 ? 42  ASN A CB   4  
ATOM 7421  C CG   . ASN A 1 42  ? -7.922  15.456  -21.176 1.00 0.00 ? 42  ASN A CG   4  
ATOM 7422  O OD1  . ASN A 1 42  ? -7.739  15.564  -22.373 1.00 0.00 ? 42  ASN A OD1  4  
ATOM 7423  N ND2  . ASN A 1 42  ? -7.230  16.192  -20.349 1.00 0.00 ? 42  ASN A ND2  4  
ATOM 7424  H H    . ASN A 1 42  ? -6.200  13.301  -20.744 1.00 0.00 ? 42  ASN A H    4  
ATOM 7425  H HA   . ASN A 1 42  ? -8.866  12.427  -19.871 1.00 0.00 ? 42  ASN A HA   4  
ATOM 7426  H HB2  . ASN A 1 42  ? -9.817  14.458  -21.249 1.00 0.00 ? 42  ASN A HB2  4  
ATOM 7427  H HB3  . ASN A 1 42  ? -9.232  14.781  -19.620 1.00 0.00 ? 42  ASN A HB3  4  
ATOM 7428  H HD21 . ASN A 1 42  ? -7.372  16.107  -19.383 1.00 0.00 ? 42  ASN A HD21 4  
ATOM 7429  H HD22 . ASN A 1 42  ? -6.567  16.826  -20.693 1.00 0.00 ? 42  ASN A HD22 4  
ATOM 7430  N N    . PRO A 1 43  ? -8.126  11.176  -22.017 1.00 0.00 ? 43  PRO A N    4  
ATOM 7431  C CA   . PRO A 1 43  ? -8.121  10.438  -23.280 1.00 0.00 ? 43  PRO A CA   4  
ATOM 7432  C C    . PRO A 1 43  ? -9.513  10.359  -23.905 1.00 0.00 ? 43  PRO A C    4  
ATOM 7433  O O    . PRO A 1 43  ? -10.511 10.541  -23.233 1.00 0.00 ? 43  PRO A O    4  
ATOM 7434  C CB   . PRO A 1 43  ? -7.649  9.018   -22.900 1.00 0.00 ? 43  PRO A CB   4  
ATOM 7435  C CG   . PRO A 1 43  ? -7.458  8.992   -21.349 1.00 0.00 ? 43  PRO A CG   4  
ATOM 7436  C CD   . PRO A 1 43  ? -7.845  10.379  -20.820 1.00 0.00 ? 43  PRO A CD   4  
ATOM 7437  H HA   . PRO A 1 43  ? -7.429  10.905  -23.974 1.00 0.00 ? 43  PRO A HA   4  
ATOM 7438  H HB2  . PRO A 1 43  ? -8.392  8.292   -23.192 1.00 0.00 ? 43  PRO A HB2  4  
ATOM 7439  H HB3  . PRO A 1 43  ? -6.714  8.797   -23.390 1.00 0.00 ? 43  PRO A HB3  4  
ATOM 7440  H HG2  . PRO A 1 43  ? -8.097  8.240   -20.911 1.00 0.00 ? 43  PRO A HG2  4  
ATOM 7441  H HG3  . PRO A 1 43  ? -6.429  8.780   -21.107 1.00 0.00 ? 43  PRO A HG3  4  
ATOM 7442  H HD2  . PRO A 1 43  ? -8.728  10.310  -20.202 1.00 0.00 ? 43  PRO A HD2  4  
ATOM 7443  H HD3  . PRO A 1 43  ? -7.029  10.817  -20.263 1.00 0.00 ? 43  PRO A HD3  4  
ATOM 7444  N N    . THR A 1 44  ? -9.546  10.086  -25.189 1.00 0.00 ? 44  THR A N    4  
ATOM 7445  C CA   . THR A 1 44  ? -10.846 9.986   -25.893 1.00 0.00 ? 44  THR A CA   4  
ATOM 7446  C C    . THR A 1 44  ? -11.235 8.526   -26.101 1.00 0.00 ? 44  THR A C    4  
ATOM 7447  O O    . THR A 1 44  ? -10.389 7.662   -26.157 1.00 0.00 ? 44  THR A O    4  
ATOM 7448  C CB   . THR A 1 44  ? -10.695 10.650  -27.260 1.00 0.00 ? 44  THR A CB   4  
ATOM 7449  O OG1  . THR A 1 44  ? -10.219 11.951  -26.992 1.00 0.00 ? 44  THR A OG1  4  
ATOM 7450  C CG2  . THR A 1 44  ? -12.062 10.866  -27.913 1.00 0.00 ? 44  THR A CG2  4  
ATOM 7451  H H    . THR A 1 44  ? -8.713  9.951   -25.683 1.00 0.00 ? 44  THR A H    4  
ATOM 7452  H HA   . THR A 1 44  ? -11.613 10.480  -25.305 1.00 0.00 ? 44  THR A HA   4  
ATOM 7453  H HB   . THR A 1 44  ? -10.005 10.108  -27.895 1.00 0.00 ? 44  THR A HB   4  
ATOM 7454  H HG1  . THR A 1 44  ? -9.372  11.871  -26.547 1.00 0.00 ? 44  THR A HG1  4  
ATOM 7455  H HG21 . THR A 1 44  ? -12.795 11.098  -27.154 1.00 0.00 ? 44  THR A HG21 4  
ATOM 7456  H HG22 . THR A 1 44  ? -12.005 11.684  -28.614 1.00 0.00 ? 44  THR A HG22 4  
ATOM 7457  H HG23 . THR A 1 44  ? -12.362 9.970   -28.435 1.00 0.00 ? 44  THR A HG23 4  
ATOM 7458  N N    . GLU A 1 45  ? -12.508 8.278   -26.213 1.00 0.00 ? 45  GLU A N    4  
ATOM 7459  C CA   . GLU A 1 45  ? -12.959 6.879   -26.416 1.00 0.00 ? 45  GLU A CA   4  
ATOM 7460  C C    . GLU A 1 45  ? -12.146 6.193   -27.512 1.00 0.00 ? 45  GLU A C    4  
ATOM 7461  O O    . GLU A 1 45  ? -12.022 4.984   -27.532 1.00 0.00 ? 45  GLU A O    4  
ATOM 7462  C CB   . GLU A 1 45  ? -14.433 6.905   -26.843 1.00 0.00 ? 45  GLU A CB   4  
ATOM 7463  C CG   . GLU A 1 45  ? -14.598 7.884   -28.006 1.00 0.00 ? 45  GLU A CG   4  
ATOM 7464  C CD   . GLU A 1 45  ? -15.772 7.437   -28.881 1.00 0.00 ? 45  GLU A CD   4  
ATOM 7465  O OE1  . GLU A 1 45  ? -15.537 6.556   -29.692 1.00 0.00 ? 45  GLU A OE1  4  
ATOM 7466  O OE2  . GLU A 1 45  ? -16.835 8.002   -28.688 1.00 0.00 ? 45  GLU A OE2  4  
ATOM 7467  H H    . GLU A 1 45  ? -13.162 9.007   -26.164 1.00 0.00 ? 45  GLU A H    4  
ATOM 7468  H HA   . GLU A 1 45  ? -12.836 6.327   -25.485 1.00 0.00 ? 45  GLU A HA   4  
ATOM 7469  H HB2  . GLU A 1 45  ? -14.738 5.916   -27.155 1.00 0.00 ? 45  GLU A HB2  4  
ATOM 7470  H HB3  . GLU A 1 45  ? -15.046 7.220   -26.012 1.00 0.00 ? 45  GLU A HB3  4  
ATOM 7471  H HG2  . GLU A 1 45  ? -14.795 8.875   -27.624 1.00 0.00 ? 45  GLU A HG2  4  
ATOM 7472  H HG3  . GLU A 1 45  ? -13.696 7.902   -28.600 1.00 0.00 ? 45  GLU A HG3  4  
ATOM 7473  N N    . ALA A 1 46  ? -11.599 6.979   -28.402 1.00 0.00 ? 46  ALA A N    4  
ATOM 7474  C CA   . ALA A 1 46  ? -10.793 6.384   -29.498 1.00 0.00 ? 46  ALA A CA   4  
ATOM 7475  C C    . ALA A 1 46  ? -9.409  5.997   -29.004 1.00 0.00 ? 46  ALA A C    4  
ATOM 7476  O O    . ALA A 1 46  ? -9.099  4.832   -28.883 1.00 0.00 ? 46  ALA A O    4  
ATOM 7477  C CB   . ALA A 1 46  ? -10.647 7.424   -30.615 1.00 0.00 ? 46  ALA A CB   4  
ATOM 7478  H H    . ALA A 1 46  ? -11.714 7.946   -28.341 1.00 0.00 ? 46  ALA A H    4  
ATOM 7479  H HA   . ALA A 1 46  ? -11.299 5.492   -29.864 1.00 0.00 ? 46  ALA A HA   4  
ATOM 7480  H HB1  . ALA A 1 46  ? -10.592 8.413   -30.186 1.00 0.00 ? 46  ALA A HB1  4  
ATOM 7481  H HB2  . ALA A 1 46  ? -9.747  7.229   -31.178 1.00 0.00 ? 46  ALA A HB2  4  
ATOM 7482  H HB3  . ALA A 1 46  ? -11.500 7.370   -31.275 1.00 0.00 ? 46  ALA A HB3  4  
ATOM 7483  N N    . GLU A 1 47  ? -8.589  6.975   -28.727 1.00 0.00 ? 47  GLU A N    4  
ATOM 7484  C CA   . GLU A 1 47  ? -7.233  6.641   -28.241 1.00 0.00 ? 47  GLU A CA   4  
ATOM 7485  C C    . GLU A 1 47  ? -7.340  5.634   -27.124 1.00 0.00 ? 47  GLU A C    4  
ATOM 7486  O O    . GLU A 1 47  ? -6.570  4.697   -27.049 1.00 0.00 ? 47  GLU A O    4  
ATOM 7487  C CB   . GLU A 1 47  ? -6.565  7.921   -27.710 1.00 0.00 ? 47  GLU A CB   4  
ATOM 7488  C CG   . GLU A 1 47  ? -6.735  9.039   -28.739 1.00 0.00 ? 47  GLU A CG   4  
ATOM 7489  C CD   . GLU A 1 47  ? -5.571  10.023  -28.616 1.00 0.00 ? 47  GLU A CD   4  
ATOM 7490  O OE1  . GLU A 1 47  ? -5.255  10.350  -27.483 1.00 0.00 ? 47  GLU A OE1  4  
ATOM 7491  O OE2  . GLU A 1 47  ? -5.061  10.393  -29.661 1.00 0.00 ? 47  GLU A OE2  4  
ATOM 7492  H H    . GLU A 1 47  ? -8.867  7.908   -28.838 1.00 0.00 ? 47  GLU A H    4  
ATOM 7493  H HA   . GLU A 1 47  ? -6.659  6.202   -29.057 1.00 0.00 ? 47  GLU A HA   4  
ATOM 7494  H HB2  . GLU A 1 47  ? -7.027  8.211   -26.778 1.00 0.00 ? 47  GLU A HB2  4  
ATOM 7495  H HB3  . GLU A 1 47  ? -5.513  7.738   -27.541 1.00 0.00 ? 47  GLU A HB3  4  
ATOM 7496  H HG2  . GLU A 1 47  ? -6.745  8.621   -29.735 1.00 0.00 ? 47  GLU A HG2  4  
ATOM 7497  H HG3  . GLU A 1 47  ? -7.665  9.561   -28.562 1.00 0.00 ? 47  GLU A HG3  4  
ATOM 7498  N N    . LEU A 1 48  ? -8.296  5.842   -26.268 1.00 0.00 ? 48  LEU A N    4  
ATOM 7499  C CA   . LEU A 1 48  ? -8.472  4.905   -25.153 1.00 0.00 ? 48  LEU A CA   4  
ATOM 7500  C C    . LEU A 1 48  ? -8.545  3.494   -25.703 1.00 0.00 ? 48  LEU A C    4  
ATOM 7501  O O    . LEU A 1 48  ? -7.834  2.616   -25.265 1.00 0.00 ? 48  LEU A O    4  
ATOM 7502  C CB   . LEU A 1 48  ? -9.795  5.234   -24.446 1.00 0.00 ? 48  LEU A CB   4  
ATOM 7503  C CG   . LEU A 1 48  ? -9.827  4.531   -23.088 1.00 0.00 ? 48  LEU A CG   4  
ATOM 7504  C CD1  . LEU A 1 48  ? -8.753  5.137   -22.183 1.00 0.00 ? 48  LEU A CD1  4  
ATOM 7505  C CD2  . LEU A 1 48  ? -11.201 4.734   -22.448 1.00 0.00 ? 48  LEU A CD2  4  
ATOM 7506  H H    . LEU A 1 48  ? -8.890  6.611   -26.366 1.00 0.00 ? 48  LEU A H    4  
ATOM 7507  H HA   . LEU A 1 48  ? -7.625  4.985   -24.470 1.00 0.00 ? 48  LEU A HA   4  
ATOM 7508  H HB2  . LEU A 1 48  ? -9.873  6.302   -24.302 1.00 0.00 ? 48  LEU A HB2  4  
ATOM 7509  H HB3  . LEU A 1 48  ? -10.625 4.897   -25.052 1.00 0.00 ? 48  LEU A HB3  4  
ATOM 7510  H HG   . LEU A 1 48  ? -9.639  3.475   -23.221 1.00 0.00 ? 48  LEU A HG   4  
ATOM 7511  H HD11 . LEU A 1 48  ? -8.572  6.162   -22.469 1.00 0.00 ? 48  LEU A HD11 4  
ATOM 7512  H HD12 . LEU A 1 48  ? -9.084  5.107   -21.155 1.00 0.00 ? 48  LEU A HD12 4  
ATOM 7513  H HD13 . LEU A 1 48  ? -7.836  4.573   -22.278 1.00 0.00 ? 48  LEU A HD13 4  
ATOM 7514  H HD21 . LEU A 1 48  ? -11.460 5.783   -22.469 1.00 0.00 ? 48  LEU A HD21 4  
ATOM 7515  H HD22 . LEU A 1 48  ? -11.944 4.173   -22.995 1.00 0.00 ? 48  LEU A HD22 4  
ATOM 7516  H HD23 . LEU A 1 48  ? -11.179 4.393   -21.423 1.00 0.00 ? 48  LEU A HD23 4  
ATOM 7517  N N    . GLN A 1 49  ? -9.403  3.309   -26.673 1.00 0.00 ? 49  GLN A N    4  
ATOM 7518  C CA   . GLN A 1 49  ? -9.542  1.968   -27.273 1.00 0.00 ? 49  GLN A CA   4  
ATOM 7519  C C    . GLN A 1 49  ? -8.211  1.504   -27.849 1.00 0.00 ? 49  GLN A C    4  
ATOM 7520  O O    . GLN A 1 49  ? -7.908  0.326   -27.840 1.00 0.00 ? 49  GLN A O    4  
ATOM 7521  C CB   . GLN A 1 49  ? -10.583 2.044   -28.404 1.00 0.00 ? 49  GLN A CB   4  
ATOM 7522  C CG   . GLN A 1 49  ? -10.584 0.726   -29.175 1.00 0.00 ? 49  GLN A CG   4  
ATOM 7523  C CD   . GLN A 1 49  ? -11.906 0.586   -29.937 1.00 0.00 ? 49  GLN A CD   4  
ATOM 7524  O OE1  . GLN A 1 49  ? -12.757 1.453   -29.888 1.00 0.00 ? 49  GLN A OE1  4  
ATOM 7525  N NE2  . GLN A 1 49  ? -12.118 -0.487  -30.649 1.00 0.00 ? 49  GLN A NE2  4  
ATOM 7526  H H    . GLN A 1 49  ? -9.952  4.055   -26.996 1.00 0.00 ? 49  GLN A H    4  
ATOM 7527  H HA   . GLN A 1 49  ? -9.857  1.268   -26.502 1.00 0.00 ? 49  GLN A HA   4  
ATOM 7528  H HB2  . GLN A 1 49  ? -11.562 2.219   -27.983 1.00 0.00 ? 49  GLN A HB2  4  
ATOM 7529  H HB3  . GLN A 1 49  ? -10.336 2.852   -29.071 1.00 0.00 ? 49  GLN A HB3  4  
ATOM 7530  H HG2  . GLN A 1 49  ? -9.765  0.715   -29.878 1.00 0.00 ? 49  GLN A HG2  4  
ATOM 7531  H HG3  . GLN A 1 49  ? -10.478 -0.099  -28.488 1.00 0.00 ? 49  GLN A HG3  4  
ATOM 7532  H HE21 . GLN A 1 49  ? -11.436 -1.190  -30.691 1.00 0.00 ? 49  GLN A HE21 4  
ATOM 7533  H HE22 . GLN A 1 49  ? -12.959 -0.590  -31.141 1.00 0.00 ? 49  GLN A HE22 4  
ATOM 7534  N N    . ASP A 1 50  ? -7.431  2.436   -28.346 1.00 0.00 ? 50  ASP A N    4  
ATOM 7535  C CA   . ASP A 1 50  ? -6.125  2.043   -28.919 1.00 0.00 ? 50  ASP A CA   4  
ATOM 7536  C C    . ASP A 1 50  ? -5.253  1.427   -27.837 1.00 0.00 ? 50  ASP A C    4  
ATOM 7537  O O    . ASP A 1 50  ? -4.448  0.557   -28.102 1.00 0.00 ? 50  ASP A O    4  
ATOM 7538  C CB   . ASP A 1 50  ? -5.429  3.299   -29.468 1.00 0.00 ? 50  ASP A CB   4  
ATOM 7539  C CG   . ASP A 1 50  ? -4.301  2.878   -30.412 1.00 0.00 ? 50  ASP A CG   4  
ATOM 7540  O OD1  . ASP A 1 50  ? -4.588  2.055   -31.267 1.00 0.00 ? 50  ASP A OD1  4  
ATOM 7541  O OD2  . ASP A 1 50  ? -3.215  3.402   -30.227 1.00 0.00 ? 50  ASP A OD2  4  
ATOM 7542  H H    . ASP A 1 50  ? -7.708  3.386   -28.336 1.00 0.00 ? 50  ASP A H    4  
ATOM 7543  H HA   . ASP A 1 50  ? -6.287  1.308   -29.708 1.00 0.00 ? 50  ASP A HA   4  
ATOM 7544  H HB2  . ASP A 1 50  ? -6.140  3.905   -30.008 1.00 0.00 ? 50  ASP A HB2  4  
ATOM 7545  H HB3  . ASP A 1 50  ? -5.015  3.875   -28.653 1.00 0.00 ? 50  ASP A HB3  4  
ATOM 7546  N N    . MET A 1 51  ? -5.434  1.892   -26.631 1.00 0.00 ? 51  MET A N    4  
ATOM 7547  C CA   . MET A 1 51  ? -4.633  1.352   -25.512 1.00 0.00 ? 51  MET A CA   4  
ATOM 7548  C C    . MET A 1 51  ? -5.208  0.022   -25.049 1.00 0.00 ? 51  MET A C    4  
ATOM 7549  O O    . MET A 1 51  ? -4.483  -0.864  -24.641 1.00 0.00 ? 51  MET A O    4  
ATOM 7550  C CB   . MET A 1 51  ? -4.688  2.357   -24.350 1.00 0.00 ? 51  MET A CB   4  
ATOM 7551  C CG   . MET A 1 51  ? -3.826  3.576   -24.700 1.00 0.00 ? 51  MET A CG   4  
ATOM 7552  S SD   . MET A 1 51  ? -3.158  4.545   -23.327 1.00 0.00 ? 51  MET A SD   4  
ATOM 7553  C CE   . MET A 1 51  ? -4.368  5.891   -23.379 1.00 0.00 ? 51  MET A CE   4  
ATOM 7554  H H    . MET A 1 51  ? -6.097  2.595   -26.469 1.00 0.00 ? 51  MET A H    4  
ATOM 7555  H HA   . MET A 1 51  ? -3.609  1.201   -25.848 1.00 0.00 ? 51  MET A HA   4  
ATOM 7556  H HB2  . MET A 1 51  ? -5.709  2.670   -24.188 1.00 0.00 ? 51  MET A HB2  4  
ATOM 7557  H HB3  . MET A 1 51  ? -4.312  1.893   -23.450 1.00 0.00 ? 51  MET A HB3  4  
ATOM 7558  H HG2  . MET A 1 51  ? -2.991  3.237   -25.295 1.00 0.00 ? 51  MET A HG2  4  
ATOM 7559  H HG3  . MET A 1 51  ? -4.416  4.240   -25.313 1.00 0.00 ? 51  MET A HG3  4  
ATOM 7560  H HE1  . MET A 1 51  ? -4.378  6.327   -24.367 1.00 0.00 ? 51  MET A HE1  4  
ATOM 7561  H HE2  . MET A 1 51  ? -5.349  5.503   -23.147 1.00 0.00 ? 51  MET A HE2  4  
ATOM 7562  H HE3  . MET A 1 51  ? -4.099  6.647   -22.655 1.00 0.00 ? 51  MET A HE3  4  
ATOM 7563  N N    . ILE A 1 52  ? -6.507  -0.096  -25.122 1.00 0.00 ? 52  ILE A N    4  
ATOM 7564  C CA   . ILE A 1 52  ? -7.146  -1.361  -24.693 1.00 0.00 ? 52  ILE A CA   4  
ATOM 7565  C C    . ILE A 1 52  ? -6.558  -2.533  -25.468 1.00 0.00 ? 52  ILE A C    4  
ATOM 7566  O O    . ILE A 1 52  ? -6.269  -3.573  -24.908 1.00 0.00 ? 52  ILE A O    4  
ATOM 7567  C CB   . ILE A 1 52  ? -8.653  -1.261  -24.986 1.00 0.00 ? 52  ILE A CB   4  
ATOM 7568  C CG1  . ILE A 1 52  ? -9.377  -0.734  -23.761 1.00 0.00 ? 52  ILE A CG1  4  
ATOM 7569  C CG2  . ILE A 1 52  ? -9.205  -2.664  -25.303 1.00 0.00 ? 52  ILE A CG2  4  
ATOM 7570  C CD1  . ILE A 1 52  ? -9.027  0.737   -23.565 1.00 0.00 ? 52  ILE A CD1  4  
ATOM 7571  H H    . ILE A 1 52  ? -7.053  0.644   -25.457 1.00 0.00 ? 52  ILE A H    4  
ATOM 7572  H HA   . ILE A 1 52  ? -6.966  -1.507  -23.631 1.00 0.00 ? 52  ILE A HA   4  
ATOM 7573  H HB   . ILE A 1 52  ? -8.815  -0.578  -25.823 1.00 0.00 ? 52  ILE A HB   4  
ATOM 7574  H HG12 . ILE A 1 52  ? -10.444 -0.837  -23.899 1.00 0.00 ? 52  ILE A HG12 4  
ATOM 7575  H HG13 . ILE A 1 52  ? -9.076  -1.298  -22.891 1.00 0.00 ? 52  ILE A HG13 4  
ATOM 7576  H HG21 . ILE A 1 52  ? -8.817  -3.377  -24.592 1.00 0.00 ? 52  ILE A HG21 4  
ATOM 7577  H HG22 . ILE A 1 52  ? -10.283 -2.654  -25.243 1.00 0.00 ? 52  ILE A HG22 4  
ATOM 7578  H HG23 . ILE A 1 52  ? -8.906  -2.957  -26.299 1.00 0.00 ? 52  ILE A HG23 4  
ATOM 7579  H HD11 . ILE A 1 52  ? -7.964  0.876   -23.689 1.00 0.00 ? 52  ILE A HD11 4  
ATOM 7580  H HD12 . ILE A 1 52  ? -9.554  1.337   -24.292 1.00 0.00 ? 52  ILE A HD12 4  
ATOM 7581  H HD13 . ILE A 1 52  ? -9.311  1.050   -22.572 1.00 0.00 ? 52  ILE A HD13 4  
ATOM 7582  N N    . ASN A 1 53  ? -6.392  -2.338  -26.745 1.00 0.00 ? 53  ASN A N    4  
ATOM 7583  C CA   . ASN A 1 53  ? -5.825  -3.419  -27.586 1.00 0.00 ? 53  ASN A CA   4  
ATOM 7584  C C    . ASN A 1 53  ? -4.363  -3.676  -27.234 1.00 0.00 ? 53  ASN A C    4  
ATOM 7585  O O    . ASN A 1 53  ? -3.785  -4.662  -27.647 1.00 0.00 ? 53  ASN A O    4  
ATOM 7586  C CB   . ASN A 1 53  ? -5.906  -2.975  -29.054 1.00 0.00 ? 53  ASN A CB   4  
ATOM 7587  C CG   . ASN A 1 53  ? -5.544  -4.154  -29.960 1.00 0.00 ? 53  ASN A CG   4  
ATOM 7588  O OD1  . ASN A 1 53  ? -6.353  -5.022  -30.221 1.00 0.00 ? 53  ASN A OD1  4  
ATOM 7589  N ND2  . ASN A 1 53  ? -4.341  -4.222  -30.458 1.00 0.00 ? 53  ASN A ND2  4  
ATOM 7590  H H    . ASN A 1 53  ? -6.642  -1.480  -27.147 1.00 0.00 ? 53  ASN A H    4  
ATOM 7591  H HA   . ASN A 1 53  ? -6.396  -4.331  -27.425 1.00 0.00 ? 53  ASN A HA   4  
ATOM 7592  H HB2  . ASN A 1 53  ? -6.908  -2.642  -29.282 1.00 0.00 ? 53  ASN A HB2  4  
ATOM 7593  H HB3  . ASN A 1 53  ? -5.212  -2.164  -29.230 1.00 0.00 ? 53  ASN A HB3  4  
ATOM 7594  H HD21 . ASN A 1 53  ? -3.684  -3.524  -30.250 1.00 0.00 ? 53  ASN A HD21 4  
ATOM 7595  H HD22 . ASN A 1 53  ? -4.092  -4.970  -31.039 1.00 0.00 ? 53  ASN A HD22 4  
ATOM 7596  N N    . GLU A 1 54  ? -3.789  -2.782  -26.475 1.00 0.00 ? 54  GLU A N    4  
ATOM 7597  C CA   . GLU A 1 54  ? -2.369  -2.957  -26.087 1.00 0.00 ? 54  GLU A CA   4  
ATOM 7598  C C    . GLU A 1 54  ? -2.250  -3.743  -24.787 1.00 0.00 ? 54  GLU A C    4  
ATOM 7599  O O    . GLU A 1 54  ? -1.375  -4.574  -24.637 1.00 0.00 ? 54  GLU A O    4  
ATOM 7600  C CB   . GLU A 1 54  ? -1.753  -1.566  -25.881 1.00 0.00 ? 54  GLU A CB   4  
ATOM 7601  C CG   . GLU A 1 54  ? -0.236  -1.703  -25.748 1.00 0.00 ? 54  GLU A CG   4  
ATOM 7602  C CD   . GLU A 1 54  ? 0.406   -1.577  -27.131 1.00 0.00 ? 54  GLU A CD   4  
ATOM 7603  O OE1  . GLU A 1 54  ? 0.105   -0.587  -27.779 1.00 0.00 ? 54  GLU A OE1  4  
ATOM 7604  O OE2  . GLU A 1 54  ? 1.160   -2.476  -27.462 1.00 0.00 ? 54  GLU A OE2  4  
ATOM 7605  H H    . GLU A 1 54  ? -4.291  -2.003  -26.164 1.00 0.00 ? 54  GLU A H    4  
ATOM 7606  H HA   . GLU A 1 54  ? -1.852  -3.496  -26.877 1.00 0.00 ? 54  GLU A HA   4  
ATOM 7607  H HB2  . GLU A 1 54  ? -1.988  -0.937  -26.725 1.00 0.00 ? 54  GLU A HB2  4  
ATOM 7608  H HB3  . GLU A 1 54  ? -2.156  -1.121  -24.984 1.00 0.00 ? 54  GLU A HB3  4  
ATOM 7609  H HG2  . GLU A 1 54  ? 0.147   -0.924  -25.105 1.00 0.00 ? 54  GLU A HG2  4  
ATOM 7610  H HG3  . GLU A 1 54  ? 0.010   -2.667  -25.327 1.00 0.00 ? 54  GLU A HG3  4  
ATOM 7611  N N    . VAL A 1 55  ? -3.132  -3.465  -23.867 1.00 0.00 ? 55  VAL A N    4  
ATOM 7612  C CA   . VAL A 1 55  ? -3.086  -4.181  -22.573 1.00 0.00 ? 55  VAL A CA   4  
ATOM 7613  C C    . VAL A 1 55  ? -3.793  -5.527  -22.668 1.00 0.00 ? 55  VAL A C    4  
ATOM 7614  O O    . VAL A 1 55  ? -3.538  -6.421  -21.885 1.00 0.00 ? 55  VAL A O    4  
ATOM 7615  C CB   . VAL A 1 55  ? -3.805  -3.320  -21.526 1.00 0.00 ? 55  VAL A CB   4  
ATOM 7616  C CG1  . VAL A 1 55  ? -3.010  -2.032  -21.297 1.00 0.00 ? 55  VAL A CG1  4  
ATOM 7617  C CG2  . VAL A 1 55  ? -5.201  -2.964  -22.037 1.00 0.00 ? 55  VAL A CG2  4  
ATOM 7618  H H    . VAL A 1 55  ? -3.815  -2.788  -24.028 1.00 0.00 ? 55  VAL A H    4  
ATOM 7619  H HA   . VAL A 1 55  ? -2.046  -4.344  -22.293 1.00 0.00 ? 55  VAL A HA   4  
ATOM 7620  H HB   . VAL A 1 55  ? -3.885  -3.866  -20.603 1.00 0.00 ? 55  VAL A HB   4  
ATOM 7621  H HG11 . VAL A 1 55  ? -1.979  -2.274  -21.081 1.00 0.00 ? 55  VAL A HG11 4  
ATOM 7622  H HG12 . VAL A 1 55  ? -3.053  -1.416  -22.182 1.00 0.00 ? 55  VAL A HG12 4  
ATOM 7623  H HG13 . VAL A 1 55  ? -3.430  -1.488  -20.464 1.00 0.00 ? 55  VAL A HG13 4  
ATOM 7624  H HG21 . VAL A 1 55  ? -5.126  -2.514  -23.014 1.00 0.00 ? 55  VAL A HG21 4  
ATOM 7625  H HG22 . VAL A 1 55  ? -5.804  -3.857  -22.103 1.00 0.00 ? 55  VAL A HG22 4  
ATOM 7626  H HG23 . VAL A 1 55  ? -5.672  -2.266  -21.360 1.00 0.00 ? 55  VAL A HG23 4  
ATOM 7627  N N    . ASP A 1 56  ? -4.669  -5.653  -23.627 1.00 0.00 ? 56  ASP A N    4  
ATOM 7628  C CA   . ASP A 1 56  ? -5.395  -6.934  -23.780 1.00 0.00 ? 56  ASP A CA   4  
ATOM 7629  C C    . ASP A 1 56  ? -4.550  -7.945  -24.538 1.00 0.00 ? 56  ASP A C    4  
ATOM 7630  O O    . ASP A 1 56  ? -5.070  -8.837  -25.180 1.00 0.00 ? 56  ASP A O    4  
ATOM 7631  C CB   . ASP A 1 56  ? -6.686  -6.672  -24.571 1.00 0.00 ? 56  ASP A CB   4  
ATOM 7632  C CG   . ASP A 1 56  ? -7.660  -7.830  -24.344 1.00 0.00 ? 56  ASP A CG   4  
ATOM 7633  O OD1  . ASP A 1 56  ? -8.056  -7.987  -23.200 1.00 0.00 ? 56  ASP A OD1  4  
ATOM 7634  O OD2  . ASP A 1 56  ? -7.952  -8.492  -25.325 1.00 0.00 ? 56  ASP A OD2  4  
ATOM 7635  H H    . ASP A 1 56  ? -4.841  -4.910  -24.239 1.00 0.00 ? 56  ASP A H    4  
ATOM 7636  H HA   . ASP A 1 56  ? -5.618  -7.331  -22.795 1.00 0.00 ? 56  ASP A HA   4  
ATOM 7637  H HB2  . ASP A 1 56  ? -7.140  -5.752  -24.236 1.00 0.00 ? 56  ASP A HB2  4  
ATOM 7638  H HB3  . ASP A 1 56  ? -6.461  -6.598  -25.624 1.00 0.00 ? 56  ASP A HB3  4  
ATOM 7639  N N    . ALA A 1 57  ? -3.262  -7.790  -24.448 1.00 0.00 ? 57  ALA A N    4  
ATOM 7640  C CA   . ALA A 1 57  ? -2.363  -8.733  -25.157 1.00 0.00 ? 57  ALA A CA   4  
ATOM 7641  C C    . ALA A 1 57  ? -2.579  -10.156 -24.663 1.00 0.00 ? 57  ALA A C    4  
ATOM 7642  O O    . ALA A 1 57  ? -2.615  -11.089 -25.441 1.00 0.00 ? 57  ALA A O    4  
ATOM 7643  C CB   . ALA A 1 57  ? -0.909  -8.326  -24.869 1.00 0.00 ? 57  ALA A CB   4  
ATOM 7644  H H    . ALA A 1 57  ? -2.891  -7.057  -23.915 1.00 0.00 ? 57  ALA A H    4  
ATOM 7645  H HA   . ALA A 1 57  ? -2.574  -8.692  -26.223 1.00 0.00 ? 57  ALA A HA   4  
ATOM 7646  H HB1  . ALA A 1 57  ? -0.856  -7.260  -24.701 1.00 0.00 ? 57  ALA A HB1  4  
ATOM 7647  H HB2  . ALA A 1 57  ? -0.552  -8.844  -23.992 1.00 0.00 ? 57  ALA A HB2  4  
ATOM 7648  H HB3  . ALA A 1 57  ? -0.285  -8.583  -25.712 1.00 0.00 ? 57  ALA A HB3  4  
ATOM 7649  N N    . ASP A 1 58  ? -2.715  -10.296 -23.376 1.00 0.00 ? 58  ASP A N    4  
ATOM 7650  C CA   . ASP A 1 58  ? -2.930  -11.648 -22.807 1.00 0.00 ? 58  ASP A CA   4  
ATOM 7651  C C    . ASP A 1 58  ? -4.315  -12.178 -23.161 1.00 0.00 ? 58  ASP A C    4  
ATOM 7652  O O    . ASP A 1 58  ? -4.447  -13.275 -23.669 1.00 0.00 ? 58  ASP A O    4  
ATOM 7653  C CB   . ASP A 1 58  ? -2.816  -11.552 -21.279 1.00 0.00 ? 58  ASP A CB   4  
ATOM 7654  C CG   . ASP A 1 58  ? -3.313  -12.856 -20.654 1.00 0.00 ? 58  ASP A CG   4  
ATOM 7655  O OD1  . ASP A 1 58  ? -2.757  -13.878 -21.020 1.00 0.00 ? 58  ASP A OD1  4  
ATOM 7656  O OD2  . ASP A 1 58  ? -4.222  -12.756 -19.847 1.00 0.00 ? 58  ASP A OD2  4  
ATOM 7657  H H    . ASP A 1 58  ? -2.677  -9.514  -22.788 1.00 0.00 ? 58  ASP A H    4  
ATOM 7658  H HA   . ASP A 1 58  ? -2.176  -12.326 -23.209 1.00 0.00 ? 58  ASP A HA   4  
ATOM 7659  H HB2  . ASP A 1 58  ? -1.786  -11.390 -20.998 1.00 0.00 ? 58  ASP A HB2  4  
ATOM 7660  H HB3  . ASP A 1 58  ? -3.419  -10.731 -20.918 1.00 0.00 ? 58  ASP A HB3  4  
ATOM 7661  N N    . GLY A 1 59  ? -5.321  -11.383 -22.882 1.00 0.00 ? 59  GLY A N    4  
ATOM 7662  C CA   . GLY A 1 59  ? -6.721  -11.813 -23.191 1.00 0.00 ? 59  GLY A CA   4  
ATOM 7663  C C    . GLY A 1 59  ? -7.516  -11.974 -21.896 1.00 0.00 ? 59  GLY A C    4  
ATOM 7664  O O    . GLY A 1 59  ? -7.894  -13.071 -21.533 1.00 0.00 ? 59  GLY A O    4  
ATOM 7665  H H    . GLY A 1 59  ? -5.155  -10.509 -22.471 1.00 0.00 ? 59  GLY A H    4  
ATOM 7666  H HA2  . GLY A 1 59  ? -7.196  -11.066 -23.810 1.00 0.00 ? 59  GLY A HA2  4  
ATOM 7667  H HA3  . GLY A 1 59  ? -6.705  -12.754 -23.718 1.00 0.00 ? 59  GLY A HA3  4  
ATOM 7668  N N    . ASN A 1 60  ? -7.750  -10.867 -21.226 1.00 0.00 ? 60  ASN A N    4  
ATOM 7669  C CA   . ASN A 1 60  ? -8.517  -10.916 -19.949 1.00 0.00 ? 60  ASN A CA   4  
ATOM 7670  C C    . ASN A 1 60  ? -9.788  -10.080 -20.042 1.00 0.00 ? 60  ASN A C    4  
ATOM 7671  O O    . ASN A 1 60  ? -10.878 -10.589 -19.865 1.00 0.00 ? 60  ASN A O    4  
ATOM 7672  C CB   . ASN A 1 60  ? -7.631  -10.333 -18.837 1.00 0.00 ? 60  ASN A CB   4  
ATOM 7673  C CG   . ASN A 1 60  ? -7.909  -11.073 -17.528 1.00 0.00 ? 60  ASN A CG   4  
ATOM 7674  O OD1  . ASN A 1 60  ? -7.013  -11.601 -16.898 1.00 0.00 ? 60  ASN A OD1  4  
ATOM 7675  N ND2  . ASN A 1 60  ? -9.135  -11.136 -17.083 1.00 0.00 ? 60  ASN A ND2  4  
ATOM 7676  H H    . ASN A 1 60  ? -7.418  -10.009 -21.566 1.00 0.00 ? 60  ASN A H    4  
ATOM 7677  H HA   . ASN A 1 60  ? -8.787  -11.946 -19.726 1.00 0.00 ? 60  ASN A HA   4  
ATOM 7678  H HB2  . ASN A 1 60  ? -6.591  -10.449 -19.098 1.00 0.00 ? 60  ASN A HB2  4  
ATOM 7679  H HB3  . ASN A 1 60  ? -7.853  -9.282  -18.707 1.00 0.00 ? 60  ASN A HB3  4  
ATOM 7680  H HD21 . ASN A 1 60  ? -9.861  -10.712 -17.588 1.00 0.00 ? 60  ASN A HD21 4  
ATOM 7681  H HD22 . ASN A 1 60  ? -9.328  -11.604 -16.245 1.00 0.00 ? 60  ASN A HD22 4  
ATOM 7682  N N    . GLY A 1 61  ? -9.619  -8.810  -20.321 1.00 0.00 ? 61  GLY A N    4  
ATOM 7683  C CA   . GLY A 1 61  ? -10.806 -7.905  -20.434 1.00 0.00 ? 61  GLY A CA   4  
ATOM 7684  C C    . GLY A 1 61  ? -10.778 -6.872  -19.308 1.00 0.00 ? 61  GLY A C    4  
ATOM 7685  O O    . GLY A 1 61  ? -11.610 -5.985  -19.254 1.00 0.00 ? 61  GLY A O    4  
ATOM 7686  H H    . GLY A 1 61  ? -8.717  -8.453  -20.456 1.00 0.00 ? 61  GLY A H    4  
ATOM 7687  H HA2  . GLY A 1 61  ? -10.777 -7.395  -21.385 1.00 0.00 ? 61  GLY A HA2  4  
ATOM 7688  H HA3  . GLY A 1 61  ? -11.714 -8.483  -20.366 1.00 0.00 ? 61  GLY A HA3  4  
ATOM 7689  N N    . THR A 1 62  ? -9.815  -7.017  -18.429 1.00 0.00 ? 62  THR A N    4  
ATOM 7690  C CA   . THR A 1 62  ? -9.691  -6.068  -17.290 1.00 0.00 ? 62  THR A CA   4  
ATOM 7691  C C    . THR A 1 62  ? -8.265  -5.549  -17.185 1.00 0.00 ? 62  THR A C    4  
ATOM 7692  O O    . THR A 1 62  ? -7.377  -6.039  -17.857 1.00 0.00 ? 62  THR A O    4  
ATOM 7693  C CB   . THR A 1 62  ? -10.041 -6.810  -15.998 1.00 0.00 ? 62  THR A CB   4  
ATOM 7694  O OG1  . THR A 1 62  ? -9.129  -7.887  -15.927 1.00 0.00 ? 62  THR A OG1  4  
ATOM 7695  C CG2  . THR A 1 62  ? -11.420 -7.475  -16.109 1.00 0.00 ? 62  THR A CG2  4  
ATOM 7696  H H    . THR A 1 62  ? -9.173  -7.753  -18.524 1.00 0.00 ? 62  THR A H    4  
ATOM 7697  H HA   . THR A 1 62  ? -10.363 -5.225  -17.447 1.00 0.00 ? 62  THR A HA   4  
ATOM 7698  H HB   . THR A 1 62  ? -9.951  -6.167  -15.126 1.00 0.00 ? 62  THR A HB   4  
ATOM 7699  H HG1  . THR A 1 62  ? -8.307  -7.555  -15.555 1.00 0.00 ? 62  THR A HG1  4  
ATOM 7700  H HG21 . THR A 1 62  ? -12.070 -6.866  -16.718 1.00 0.00 ? 62  THR A HG21 4  
ATOM 7701  H HG22 . THR A 1 62  ? -11.318 -8.450  -16.561 1.00 0.00 ? 62  THR A HG22 4  
ATOM 7702  H HG23 . THR A 1 62  ? -11.852 -7.582  -15.125 1.00 0.00 ? 62  THR A HG23 4  
ATOM 7703  N N    . ILE A 1 63  ? -8.071  -4.564  -16.344 1.00 0.00 ? 63  ILE A N    4  
ATOM 7704  C CA   . ILE A 1 63  ? -6.712  -3.994  -16.173 1.00 0.00 ? 63  ILE A CA   4  
ATOM 7705  C C    . ILE A 1 63  ? -6.359  -3.860  -14.705 1.00 0.00 ? 63  ILE A C    4  
ATOM 7706  O O    . ILE A 1 63  ? -7.149  -3.390  -13.914 1.00 0.00 ? 63  ILE A O    4  
ATOM 7707  C CB   . ILE A 1 63  ? -6.694  -2.604  -16.793 1.00 0.00 ? 63  ILE A CB   4  
ATOM 7708  C CG1  . ILE A 1 63  ? -7.138  -2.674  -18.241 1.00 0.00 ? 63  ILE A CG1  4  
ATOM 7709  C CG2  . ILE A 1 63  ? -5.255  -2.074  -16.749 1.00 0.00 ? 63  ILE A CG2  4  
ATOM 7710  C CD1  . ILE A 1 63  ? -6.708  -1.389  -18.951 1.00 0.00 ? 63  ILE A CD1  4  
ATOM 7711  H H    . ILE A 1 63  ? -8.818  -4.209  -15.824 1.00 0.00 ? 63  ILE A H    4  
ATOM 7712  H HA   . ILE A 1 63  ? -5.986  -4.639  -16.654 1.00 0.00 ? 63  ILE A HA   4  
ATOM 7713  H HB   . ILE A 1 63  ? -7.367  -1.952  -16.237 1.00 0.00 ? 63  ILE A HB   4  
ATOM 7714  H HG12 . ILE A 1 63  ? -6.679  -3.525  -18.722 1.00 0.00 ? 63  ILE A HG12 4  
ATOM 7715  H HG13 . ILE A 1 63  ? -8.212  -2.774  -18.289 1.00 0.00 ? 63  ILE A HG13 4  
ATOM 7716  H HG21 . ILE A 1 63  ? -4.782  -2.377  -15.829 1.00 0.00 ? 63  ILE A HG21 4  
ATOM 7717  H HG22 . ILE A 1 63  ? -4.697  -2.472  -17.583 1.00 0.00 ? 63  ILE A HG22 4  
ATOM 7718  H HG23 . ILE A 1 63  ? -5.262  -0.996  -16.807 1.00 0.00 ? 63  ILE A HG23 4  
ATOM 7719  H HD11 . ILE A 1 63  ? -6.812  -0.556  -18.280 1.00 0.00 ? 63  ILE A HD11 4  
ATOM 7720  H HD12 . ILE A 1 63  ? -5.678  -1.469  -19.260 1.00 0.00 ? 63  ILE A HD12 4  
ATOM 7721  H HD13 . ILE A 1 63  ? -7.327  -1.227  -19.817 1.00 0.00 ? 63  ILE A HD13 4  
ATOM 7722  N N    . ASP A 1 64  ? -5.171  -4.278  -14.369 1.00 0.00 ? 64  ASP A N    4  
ATOM 7723  C CA   . ASP A 1 64  ? -4.733  -4.188  -12.956 1.00 0.00 ? 64  ASP A CA   4  
ATOM 7724  C C    . ASP A 1 64  ? -3.950  -2.884  -12.736 1.00 0.00 ? 64  ASP A C    4  
ATOM 7725  O O    . ASP A 1 64  ? -3.620  -2.200  -13.685 1.00 0.00 ? 64  ASP A O    4  
ATOM 7726  C CB   . ASP A 1 64  ? -3.831  -5.399  -12.665 1.00 0.00 ? 64  ASP A CB   4  
ATOM 7727  C CG   . ASP A 1 64  ? -4.537  -6.674  -13.130 1.00 0.00 ? 64  ASP A CG   4  
ATOM 7728  O OD1  . ASP A 1 64  ? -5.534  -6.520  -13.814 1.00 0.00 ? 64  ASP A OD1  4  
ATOM 7729  O OD2  . ASP A 1 64  ? -4.040  -7.729  -12.773 1.00 0.00 ? 64  ASP A OD2  4  
ATOM 7730  H H    . ASP A 1 64  ? -4.570  -4.652  -15.048 1.00 0.00 ? 64  ASP A H    4  
ATOM 7731  H HA   . ASP A 1 64  ? -5.613  -4.189  -12.309 1.00 0.00 ? 64  ASP A HA   4  
ATOM 7732  H HB2  . ASP A 1 64  ? -2.897  -5.300  -13.198 1.00 0.00 ? 64  ASP A HB2  4  
ATOM 7733  H HB3  . ASP A 1 64  ? -3.637  -5.468  -11.604 1.00 0.00 ? 64  ASP A HB3  4  
ATOM 7734  N N    . PHE A 1 65  ? -3.663  -2.556  -11.493 1.00 0.00 ? 65  PHE A N    4  
ATOM 7735  C CA   . PHE A 1 65  ? -2.908  -1.296  -11.240 1.00 0.00 ? 65  PHE A CA   4  
ATOM 7736  C C    . PHE A 1 65  ? -1.538  -1.262  -11.953 1.00 0.00 ? 65  PHE A C    4  
ATOM 7737  O O    . PHE A 1 65  ? -1.170  -0.250  -12.490 1.00 0.00 ? 65  PHE A O    4  
ATOM 7738  C CB   . PHE A 1 65  ? -2.706  -1.085  -9.720  1.00 0.00 ? 65  PHE A CB   4  
ATOM 7739  C CG   . PHE A 1 65  ? -2.035  0.280   -9.499  1.00 0.00 ? 65  PHE A CG   4  
ATOM 7740  C CD1  . PHE A 1 65  ? -2.628  1.439   -9.974  1.00 0.00 ? 65  PHE A CD1  4  
ATOM 7741  C CD2  . PHE A 1 65  ? -0.819  0.371   -8.838  1.00 0.00 ? 65  PHE A CD2  4  
ATOM 7742  C CE1  . PHE A 1 65  ? -2.014  2.663   -9.796  1.00 0.00 ? 65  PHE A CE1  4  
ATOM 7743  C CE2  . PHE A 1 65  ? -0.210  1.600   -8.662  1.00 0.00 ? 65  PHE A CE2  4  
ATOM 7744  C CZ   . PHE A 1 65  ? -0.807  2.744   -9.141  1.00 0.00 ? 65  PHE A CZ   4  
ATOM 7745  H H    . PHE A 1 65  ? -3.947  -3.123  -10.750 1.00 0.00 ? 65  PHE A H    4  
ATOM 7746  H HA   . PHE A 1 65  ? -3.503  -0.475  -11.646 1.00 0.00 ? 65  PHE A HA   4  
ATOM 7747  H HB2  . PHE A 1 65  ? -3.662  -1.098  -9.218  1.00 0.00 ? 65  PHE A HB2  4  
ATOM 7748  H HB3  . PHE A 1 65  ? -2.085  -1.851  -9.312  1.00 0.00 ? 65  PHE A HB3  4  
ATOM 7749  H HD1  . PHE A 1 65  ? -3.576  1.385   -10.486 1.00 0.00 ? 65  PHE A HD1  4  
ATOM 7750  H HD2  . PHE A 1 65  ? -0.346  -0.521  -8.458  1.00 0.00 ? 65  PHE A HD2  4  
ATOM 7751  H HE1  . PHE A 1 65  ? -2.485  3.561   -10.171 1.00 0.00 ? 65  PHE A HE1  4  
ATOM 7752  H HE2  . PHE A 1 65  ? 0.739   1.663   -8.149  1.00 0.00 ? 65  PHE A HE2  4  
ATOM 7753  H HZ   . PHE A 1 65  ? -0.325  3.707   -9.007  1.00 0.00 ? 65  PHE A HZ   4  
ATOM 7754  N N    . PRO A 1 66  ? -0.788  -2.360  -11.947 1.00 0.00 ? 66  PRO A N    4  
ATOM 7755  C CA   . PRO A 1 66  ? 0.509   -2.361  -12.612 1.00 0.00 ? 66  PRO A CA   4  
ATOM 7756  C C    . PRO A 1 66  ? 0.356   -2.054  -14.099 1.00 0.00 ? 66  PRO A C    4  
ATOM 7757  O O    . PRO A 1 66  ? 0.986   -1.155  -14.617 1.00 0.00 ? 66  PRO A O    4  
ATOM 7758  C CB   . PRO A 1 66  ? 1.059   -3.790  -12.425 1.00 0.00 ? 66  PRO A CB   4  
ATOM 7759  C CG   . PRO A 1 66  ? -0.009  -4.594  -11.626 1.00 0.00 ? 66  PRO A CG   4  
ATOM 7760  C CD   . PRO A 1 66  ? -1.162  -3.629  -11.304 1.00 0.00 ? 66  PRO A CD   4  
ATOM 7761  H HA   . PRO A 1 66  ? 1.157   -1.623  -12.150 1.00 0.00 ? 66  PRO A HA   4  
ATOM 7762  H HB2  . PRO A 1 66  ? 1.227   -4.251  -13.387 1.00 0.00 ? 66  PRO A HB2  4  
ATOM 7763  H HB3  . PRO A 1 66  ? 1.985   -3.758  -11.870 1.00 0.00 ? 66  PRO A HB3  4  
ATOM 7764  H HG2  . PRO A 1 66  ? -0.374  -5.417  -12.224 1.00 0.00 ? 66  PRO A HG2  4  
ATOM 7765  H HG3  . PRO A 1 66  ? 0.420   -4.974  -10.711 1.00 0.00 ? 66  PRO A HG3  4  
ATOM 7766  H HD2  . PRO A 1 66  ? -2.066  -3.996  -11.712 1.00 0.00 ? 66  PRO A HD2  4  
ATOM 7767  H HD3  . PRO A 1 66  ? -1.254  -3.505  -10.247 1.00 0.00 ? 66  PRO A HD3  4  
ATOM 7768  N N    . GLU A 1 67  ? -0.479  -2.807  -14.758 1.00 0.00 ? 67  GLU A N    4  
ATOM 7769  C CA   . GLU A 1 67  ? -0.684  -2.567  -16.211 1.00 0.00 ? 67  GLU A CA   4  
ATOM 7770  C C    . GLU A 1 67  ? -1.122  -1.130  -16.446 1.00 0.00 ? 67  GLU A C    4  
ATOM 7771  O O    . GLU A 1 67  ? -0.773  -0.529  -17.440 1.00 0.00 ? 67  GLU A O    4  
ATOM 7772  C CB   . GLU A 1 67  ? -1.787  -3.512  -16.715 1.00 0.00 ? 67  GLU A CB   4  
ATOM 7773  C CG   . GLU A 1 67  ? -1.218  -4.928  -16.842 1.00 0.00 ? 67  GLU A CG   4  
ATOM 7774  C CD   . GLU A 1 67  ? -2.061  -5.724  -17.840 1.00 0.00 ? 67  GLU A CD   4  
ATOM 7775  O OE1  . GLU A 1 67  ? -3.166  -5.274  -18.095 1.00 0.00 ? 67  GLU A OE1  4  
ATOM 7776  O OE2  . GLU A 1 67  ? -1.553  -6.739  -18.291 1.00 0.00 ? 67  GLU A OE2  4  
ATOM 7777  H H    . GLU A 1 67  ? -0.968  -3.520  -14.299 1.00 0.00 ? 67  GLU A H    4  
ATOM 7778  H HA   . GLU A 1 67  ? 0.259   -2.741  -16.744 1.00 0.00 ? 67  GLU A HA   4  
ATOM 7779  H HB2  . GLU A 1 67  ? -2.611  -3.514  -16.016 1.00 0.00 ? 67  GLU A HB2  4  
ATOM 7780  H HB3  . GLU A 1 67  ? -2.141  -3.176  -17.678 1.00 0.00 ? 67  GLU A HB3  4  
ATOM 7781  H HG2  . GLU A 1 67  ? -0.198  -4.882  -17.194 1.00 0.00 ? 67  GLU A HG2  4  
ATOM 7782  H HG3  . GLU A 1 67  ? -1.242  -5.421  -15.881 1.00 0.00 ? 67  GLU A HG3  4  
ATOM 7783  N N    . PHE A 1 68  ? -1.886  -0.601  -15.529 1.00 0.00 ? 68  PHE A N    4  
ATOM 7784  C CA   . PHE A 1 68  ? -2.343  0.793   -15.700 1.00 0.00 ? 68  PHE A CA   4  
ATOM 7785  C C    . PHE A 1 68  ? -1.133  1.721   -15.730 1.00 0.00 ? 68  PHE A C    4  
ATOM 7786  O O    . PHE A 1 68  ? -1.108  2.683   -16.471 1.00 0.00 ? 68  PHE A O    4  
ATOM 7787  C CB   . PHE A 1 68  ? -3.258  1.158   -14.519 1.00 0.00 ? 68  PHE A CB   4  
ATOM 7788  C CG   . PHE A 1 68  ? -3.649  2.630   -14.598 1.00 0.00 ? 68  PHE A CG   4  
ATOM 7789  C CD1  . PHE A 1 68  ? -4.364  3.117   -15.679 1.00 0.00 ? 68  PHE A CD1  4  
ATOM 7790  C CD2  . PHE A 1 68  ? -3.318  3.489   -13.568 1.00 0.00 ? 68  PHE A CD2  4  
ATOM 7791  C CE1  . PHE A 1 68  ? -4.741  4.445   -15.722 1.00 0.00 ? 68  PHE A CE1  4  
ATOM 7792  C CE2  . PHE A 1 68  ? -3.695  4.811   -13.613 1.00 0.00 ? 68  PHE A CE2  4  
ATOM 7793  C CZ   . PHE A 1 68  ? -4.407  5.289   -14.689 1.00 0.00 ? 68  PHE A CZ   4  
ATOM 7794  H H    . PHE A 1 68  ? -2.152  -1.120  -14.741 1.00 0.00 ? 68  PHE A H    4  
ATOM 7795  H HA   . PHE A 1 68  ? -2.880  0.874   -16.651 1.00 0.00 ? 68  PHE A HA   4  
ATOM 7796  H HB2  . PHE A 1 68  ? -4.151  0.552   -14.550 1.00 0.00 ? 68  PHE A HB2  4  
ATOM 7797  H HB3  . PHE A 1 68  ? -2.750  0.985   -13.597 1.00 0.00 ? 68  PHE A HB3  4  
ATOM 7798  H HD1  . PHE A 1 68  ? -4.625  2.456   -16.494 1.00 0.00 ? 68  PHE A HD1  4  
ATOM 7799  H HD2  . PHE A 1 68  ? -2.762  3.118   -12.719 1.00 0.00 ? 68  PHE A HD2  4  
ATOM 7800  H HE1  . PHE A 1 68  ? -5.300  4.820   -16.567 1.00 0.00 ? 68  PHE A HE1  4  
ATOM 7801  H HE2  . PHE A 1 68  ? -3.429  5.473   -12.805 1.00 0.00 ? 68  PHE A HE2  4  
ATOM 7802  H HZ   . PHE A 1 68  ? -4.710  6.324   -14.720 1.00 0.00 ? 68  PHE A HZ   4  
ATOM 7803  N N    . LEU A 1 69  ? -0.136  1.411   -14.917 1.00 0.00 ? 69  LEU A N    4  
ATOM 7804  C CA   . LEU A 1 69  ? 1.076   2.273   -14.901 1.00 0.00 ? 69  LEU A CA   4  
ATOM 7805  C C    . LEU A 1 69  ? 1.700   2.268   -16.278 1.00 0.00 ? 69  LEU A C    4  
ATOM 7806  O O    . LEU A 1 69  ? 1.938   3.300   -16.863 1.00 0.00 ? 69  LEU A O    4  
ATOM 7807  C CB   . LEU A 1 69  ? 2.115   1.694   -13.911 1.00 0.00 ? 69  LEU A CB   4  
ATOM 7808  C CG   . LEU A 1 69  ? 1.536   1.644   -12.499 1.00 0.00 ? 69  LEU A CG   4  
ATOM 7809  C CD1  . LEU A 1 69  ? 2.682   1.510   -11.493 1.00 0.00 ? 69  LEU A CD1  4  
ATOM 7810  C CD2  . LEU A 1 69  ? 0.769   2.930   -12.212 1.00 0.00 ? 69  LEU A CD2  4  
ATOM 7811  H H    . LEU A 1 69  ? -0.195  0.625   -14.335 1.00 0.00 ? 69  LEU A H    4  
ATOM 7812  H HA   . LEU A 1 69  ? 0.796   3.292   -14.635 1.00 0.00 ? 69  LEU A HA   4  
ATOM 7813  H HB2  . LEU A 1 69  ? 2.390   0.698   -14.223 1.00 0.00 ? 69  LEU A HB2  4  
ATOM 7814  H HB3  . LEU A 1 69  ? 2.999   2.316   -13.915 1.00 0.00 ? 69  LEU A HB3  4  
ATOM 7815  H HG   . LEU A 1 69  ? 0.881   0.802   -12.407 1.00 0.00 ? 69  LEU A HG   4  
ATOM 7816  H HD11 . LEU A 1 69  ? 3.361   2.344   -11.602 1.00 0.00 ? 69  LEU A HD11 4  
ATOM 7817  H HD12 . LEU A 1 69  ? 2.287   1.501   -10.488 1.00 0.00 ? 69  LEU A HD12 4  
ATOM 7818  H HD13 . LEU A 1 69  ? 3.218   0.590   -11.672 1.00 0.00 ? 69  LEU A HD13 4  
ATOM 7819  H HD21 . LEU A 1 69  ? 1.333   3.779   -12.569 1.00 0.00 ? 69  LEU A HD21 4  
ATOM 7820  H HD22 . LEU A 1 69  ? -0.188  2.902   -12.709 1.00 0.00 ? 69  LEU A HD22 4  
ATOM 7821  H HD23 . LEU A 1 69  ? 0.613   3.031   -11.147 1.00 0.00 ? 69  LEU A HD23 4  
ATOM 7822  N N    . THR A 1 70  ? 1.960   1.082   -16.768 1.00 0.00 ? 70  THR A N    4  
ATOM 7823  C CA   . THR A 1 70  ? 2.568   0.958   -18.107 1.00 0.00 ? 70  THR A CA   4  
ATOM 7824  C C    . THR A 1 70  ? 1.886   1.912   -19.069 1.00 0.00 ? 70  THR A C    4  
ATOM 7825  O O    . THR A 1 70  ? 2.533   2.610   -19.824 1.00 0.00 ? 70  THR A O    4  
ATOM 7826  C CB   . THR A 1 70  ? 2.363   -0.492  -18.582 1.00 0.00 ? 70  THR A CB   4  
ATOM 7827  O OG1  . THR A 1 70  ? 3.295   -1.257  -17.847 1.00 0.00 ? 70  THR A OG1  4  
ATOM 7828  C CG2  . THR A 1 70  ? 2.788   -0.680  -20.046 1.00 0.00 ? 70  THR A CG2  4  
ATOM 7829  H H    . THR A 1 70  ? 1.750   0.279   -16.246 1.00 0.00 ? 70  THR A H    4  
ATOM 7830  H HA   . THR A 1 70  ? 3.620   1.205   -18.046 1.00 0.00 ? 70  THR A HA   4  
ATOM 7831  H HB   . THR A 1 70  ? 1.353   -0.836  -18.390 1.00 0.00 ? 70  THR A HB   4  
ATOM 7832  H HG1  . THR A 1 70  ? 3.855   -0.651  -17.359 1.00 0.00 ? 70  THR A HG1  4  
ATOM 7833  H HG21 . THR A 1 70  ? 2.452   0.154   -20.638 1.00 0.00 ? 70  THR A HG21 4  
ATOM 7834  H HG22 . THR A 1 70  ? 3.862   -0.750  -20.106 1.00 0.00 ? 70  THR A HG22 4  
ATOM 7835  H HG23 . THR A 1 70  ? 2.352   -1.590  -20.435 1.00 0.00 ? 70  THR A HG23 4  
ATOM 7836  N N    . MET A 1 71  ? 0.585   1.927   -19.022 1.00 0.00 ? 71  MET A N    4  
ATOM 7837  C CA   . MET A 1 71  ? -0.159  2.814   -19.908 1.00 0.00 ? 71  MET A CA   4  
ATOM 7838  C C    . MET A 1 71  ? -0.044  4.255   -19.436 1.00 0.00 ? 71  MET A C    4  
ATOM 7839  O O    . MET A 1 71  ? -0.119  5.177   -20.223 1.00 0.00 ? 71  MET A O    4  
ATOM 7840  C CB   . MET A 1 71  ? -1.628  2.399   -19.865 1.00 0.00 ? 71  MET A CB   4  
ATOM 7841  C CG   . MET A 1 71  ? -2.318  2.982   -21.073 1.00 0.00 ? 71  MET A CG   4  
ATOM 7842  S SD   . MET A 1 71  ? -4.126  2.932   -21.115 1.00 0.00 ? 71  MET A SD   4  
ATOM 7843  C CE   . MET A 1 71  ? -4.304  1.132   -21.103 1.00 0.00 ? 71  MET A CE   4  
ATOM 7844  H H    . MET A 1 71  ? 0.107   1.344   -18.411 1.00 0.00 ? 71  MET A H    4  
ATOM 7845  H HA   . MET A 1 71  ? 0.241   2.733   -20.917 1.00 0.00 ? 71  MET A HA   4  
ATOM 7846  H HB2  . MET A 1 71  ? -1.704  1.321   -19.885 1.00 0.00 ? 71  MET A HB2  4  
ATOM 7847  H HB3  . MET A 1 71  ? -2.089  2.773   -18.963 1.00 0.00 ? 71  MET A HB3  4  
ATOM 7848  H HG2  . MET A 1 71  ? -2.015  4.012   -21.155 1.00 0.00 ? 71  MET A HG2  4  
ATOM 7849  H HG3  . MET A 1 71  ? -1.953  2.462   -21.944 1.00 0.00 ? 71  MET A HG3  4  
ATOM 7850  H HE1  . MET A 1 71  ? -3.569  0.692   -21.760 1.00 0.00 ? 71  MET A HE1  4  
ATOM 7851  H HE2  . MET A 1 71  ? -4.156  0.762   -20.099 1.00 0.00 ? 71  MET A HE2  4  
ATOM 7852  H HE3  . MET A 1 71  ? -5.295  0.867   -21.441 1.00 0.00 ? 71  MET A HE3  4  
ATOM 7853  N N    . MET A 1 72  ? 0.136   4.425   -18.155 1.00 0.00 ? 72  MET A N    4  
ATOM 7854  C CA   . MET A 1 72  ? 0.259   5.798   -17.614 1.00 0.00 ? 72  MET A CA   4  
ATOM 7855  C C    . MET A 1 72  ? 1.649   6.353   -17.882 1.00 0.00 ? 72  MET A C    4  
ATOM 7856  O O    . MET A 1 72  ? 1.853   7.546   -17.857 1.00 0.00 ? 72  MET A O    4  
ATOM 7857  C CB   . MET A 1 72  ? 0.031   5.747   -16.095 1.00 0.00 ? 72  MET A CB   4  
ATOM 7858  C CG   . MET A 1 72  ? -0.688  7.022   -15.638 1.00 0.00 ? 72  MET A CG   4  
ATOM 7859  S SD   . MET A 1 72  ? -2.127  7.567   -16.592 1.00 0.00 ? 72  MET A SD   4  
ATOM 7860  C CE   . MET A 1 72  ? -1.797  9.345   -16.497 1.00 0.00 ? 72  MET A CE   4  
ATOM 7861  H H    . MET A 1 72  ? 0.190   3.651   -17.556 1.00 0.00 ? 72  MET A H    4  
ATOM 7862  H HA   . MET A 1 72  ? -0.478  6.436   -18.100 1.00 0.00 ? 72  MET A HA   4  
ATOM 7863  H HB2  . MET A 1 72  ? -0.570  4.887   -15.848 1.00 0.00 ? 72  MET A HB2  4  
ATOM 7864  H HB3  . MET A 1 72  ? 0.983   5.669   -15.591 1.00 0.00 ? 72  MET A HB3  4  
ATOM 7865  H HG2  . MET A 1 72  ? -1.012  6.874   -14.618 1.00 0.00 ? 72  MET A HG2  4  
ATOM 7866  H HG3  . MET A 1 72  ? 0.028   7.830   -15.637 1.00 0.00 ? 72  MET A HG3  4  
ATOM 7867  H HE1  . MET A 1 72  ? -1.607  9.621   -15.470 1.00 0.00 ? 72  MET A HE1  4  
ATOM 7868  H HE2  . MET A 1 72  ? -0.934  9.583   -17.100 1.00 0.00 ? 72  MET A HE2  4  
ATOM 7869  H HE3  . MET A 1 72  ? -2.654  9.891   -16.863 1.00 0.00 ? 72  MET A HE3  4  
ATOM 7870  N N    . ALA A 1 73  ? 2.583   5.472   -18.132 1.00 0.00 ? 73  ALA A N    4  
ATOM 7871  C CA   . ALA A 1 73  ? 3.964   5.932   -18.404 1.00 0.00 ? 73  ALA A CA   4  
ATOM 7872  C C    . ALA A 1 73  ? 4.131   6.234   -19.882 1.00 0.00 ? 73  ALA A C    4  
ATOM 7873  O O    . ALA A 1 73  ? 4.728   7.226   -20.254 1.00 0.00 ? 73  ALA A O    4  
ATOM 7874  C CB   . ALA A 1 73  ? 4.941   4.809   -18.014 1.00 0.00 ? 73  ALA A CB   4  
ATOM 7875  H H    . ALA A 1 73  ? 2.372   4.520   -18.144 1.00 0.00 ? 73  ALA A H    4  
ATOM 7876  H HA   . ALA A 1 73  ? 4.158   6.834   -17.830 1.00 0.00 ? 73  ALA A HA   4  
ATOM 7877  H HB1  . ALA A 1 73  ? 4.584   4.306   -17.128 1.00 0.00 ? 73  ALA A HB1  4  
ATOM 7878  H HB2  . ALA A 1 73  ? 5.017   4.095   -18.821 1.00 0.00 ? 73  ALA A HB2  4  
ATOM 7879  H HB3  . ALA A 1 73  ? 5.917   5.228   -17.816 1.00 0.00 ? 73  ALA A HB3  4  
ATOM 7880  N N    . ARG A 1 74  ? 3.601   5.369   -20.703 1.00 0.00 ? 74  ARG A N    4  
ATOM 7881  C CA   . ARG A 1 74  ? 3.717   5.589   -22.160 1.00 0.00 ? 74  ARG A CA   4  
ATOM 7882  C C    . ARG A 1 74  ? 3.176   6.958   -22.526 1.00 0.00 ? 74  ARG A C    4  
ATOM 7883  O O    . ARG A 1 74  ? 3.855   7.757   -23.141 1.00 0.00 ? 74  ARG A O    4  
ATOM 7884  C CB   . ARG A 1 74  ? 2.890   4.515   -22.877 1.00 0.00 ? 74  ARG A CB   4  
ATOM 7885  C CG   . ARG A 1 74  ? 3.839   3.482   -23.481 1.00 0.00 ? 74  ARG A CG   4  
ATOM 7886  C CD   . ARG A 1 74  ? 3.042   2.237   -23.862 1.00 0.00 ? 74  ARG A CD   4  
ATOM 7887  N NE   . ARG A 1 74  ? 2.142   2.570   -25.001 1.00 0.00 ? 74  ARG A NE   4  
ATOM 7888  C CZ   . ARG A 1 74  ? 0.947   2.047   -25.047 1.00 0.00 ? 74  ARG A CZ   4  
ATOM 7889  N NH1  . ARG A 1 74  ? 0.284   1.888   -23.935 1.00 0.00 ? 74  ARG A NH1  4  
ATOM 7890  N NH2  . ARG A 1 74  ? 0.457   1.700   -26.205 1.00 0.00 ? 74  ARG A NH2  4  
ATOM 7891  H H    . ARG A 1 74  ? 3.129   4.585   -20.357 1.00 0.00 ? 74  ARG A H    4  
ATOM 7892  H HA   . ARG A 1 74  ? 4.763   5.529   -22.447 1.00 0.00 ? 74  ARG A HA   4  
ATOM 7893  H HB2  . ARG A 1 74  ? 2.230   4.032   -22.169 1.00 0.00 ? 74  ARG A HB2  4  
ATOM 7894  H HB3  . ARG A 1 74  ? 2.300   4.970   -23.658 1.00 0.00 ? 74  ARG A HB3  4  
ATOM 7895  H HG2  . ARG A 1 74  ? 4.313   3.893   -24.359 1.00 0.00 ? 74  ARG A HG2  4  
ATOM 7896  H HG3  . ARG A 1 74  ? 4.599   3.220   -22.759 1.00 0.00 ? 74  ARG A HG3  4  
ATOM 7897  H HD2  . ARG A 1 74  ? 3.716   1.447   -24.156 1.00 0.00 ? 74  ARG A HD2  4  
ATOM 7898  H HD3  . ARG A 1 74  ? 2.449   1.910   -23.021 1.00 0.00 ? 74  ARG A HD3  4  
ATOM 7899  H HE   . ARG A 1 74  ? 2.443   3.178   -25.708 1.00 0.00 ? 74  ARG A HE   4  
ATOM 7900  H HH11 . ARG A 1 74  ? 0.691   2.167   -23.065 1.00 0.00 ? 74  ARG A HH11 4  
ATOM 7901  H HH12 . ARG A 1 74  ? -0.632  1.487   -23.952 1.00 0.00 ? 74  ARG A HH12 4  
ATOM 7902  H HH21 . ARG A 1 74  ? 0.994   1.836   -27.037 1.00 0.00 ? 74  ARG A HH21 4  
ATOM 7903  H HH22 . ARG A 1 74  ? -0.457  1.296   -26.260 1.00 0.00 ? 74  ARG A HH22 4  
ATOM 7904  N N    . LYS A 1 75  ? 1.957   7.206   -22.142 1.00 0.00 ? 75  LYS A N    4  
ATOM 7905  C CA   . LYS A 1 75  ? 1.352   8.519   -22.456 1.00 0.00 ? 75  LYS A CA   4  
ATOM 7906  C C    . LYS A 1 75  ? 2.193   9.629   -21.848 1.00 0.00 ? 75  LYS A C    4  
ATOM 7907  O O    . LYS A 1 75  ? 2.266   10.720  -22.379 1.00 0.00 ? 75  LYS A O    4  
ATOM 7908  C CB   . LYS A 1 75  ? -0.058  8.552   -21.839 1.00 0.00 ? 75  LYS A CB   4  
ATOM 7909  C CG   . LYS A 1 75  ? -0.713  9.919   -22.102 1.00 0.00 ? 75  LYS A CG   4  
ATOM 7910  C CD   . LYS A 1 75  ? -0.864  10.155  -23.615 1.00 0.00 ? 75  LYS A CD   4  
ATOM 7911  C CE   . LYS A 1 75  ? -1.443  8.901   -24.280 1.00 0.00 ? 75  LYS A CE   4  
ATOM 7912  N NZ   . LYS A 1 75  ? -2.498  8.289   -23.422 1.00 0.00 ? 75  LYS A NZ   4  
ATOM 7913  H H    . LYS A 1 75  ? 1.447   6.529   -21.653 1.00 0.00 ? 75  LYS A H    4  
ATOM 7914  H HA   . LYS A 1 75  ? 1.312   8.645   -23.536 1.00 0.00 ? 75  LYS A HA   4  
ATOM 7915  H HB2  . LYS A 1 75  ? -0.658  7.769   -22.271 1.00 0.00 ? 75  LYS A HB2  4  
ATOM 7916  H HB3  . LYS A 1 75  ? 0.014   8.389   -20.774 1.00 0.00 ? 75  LYS A HB3  4  
ATOM 7917  H HG2  . LYS A 1 75  ? -1.688  9.946   -21.636 1.00 0.00 ? 75  LYS A HG2  4  
ATOM 7918  H HG3  . LYS A 1 75  ? -0.101  10.700  -21.677 1.00 0.00 ? 75  LYS A HG3  4  
ATOM 7919  H HD2  . LYS A 1 75  ? -1.530  10.991  -23.783 1.00 0.00 ? 75  LYS A HD2  4  
ATOM 7920  H HD3  . LYS A 1 75  ? 0.098   10.383  -24.044 1.00 0.00 ? 75  LYS A HD3  4  
ATOM 7921  H HE2  . LYS A 1 75  ? -1.876  9.166   -25.233 1.00 0.00 ? 75  LYS A HE2  4  
ATOM 7922  H HE3  . LYS A 1 75  ? -0.656  8.181   -24.440 1.00 0.00 ? 75  LYS A HE3  4  
ATOM 7923  H HZ1  . LYS A 1 75  ? -2.318  8.533   -22.426 1.00 0.00 ? 75  LYS A HZ1  4  
ATOM 7924  H HZ2  . LYS A 1 75  ? -3.430  8.651   -23.706 1.00 0.00 ? 75  LYS A HZ2  4  
ATOM 7925  H HZ3  . LYS A 1 75  ? -2.477  7.254   -23.535 1.00 0.00 ? 75  LYS A HZ3  4  
ATOM 7926  N N    . MET A 1 76  ? 2.820   9.321   -20.733 1.00 0.00 ? 76  MET A N    4  
ATOM 7927  C CA   . MET A 1 76  ? 3.669   10.334  -20.059 1.00 0.00 ? 76  MET A CA   4  
ATOM 7928  C C    . MET A 1 76  ? 5.139   10.073  -20.350 1.00 0.00 ? 76  MET A C    4  
ATOM 7929  O O    . MET A 1 76  ? 6.007   10.530  -19.632 1.00 0.00 ? 76  MET A O    4  
ATOM 7930  C CB   . MET A 1 76  ? 3.448   10.235  -18.543 1.00 0.00 ? 76  MET A CB   4  
ATOM 7931  C CG   . MET A 1 76  ? 2.106   10.879  -18.190 1.00 0.00 ? 76  MET A CG   4  
ATOM 7932  S SD   . MET A 1 76  ? 1.632   10.935  -16.440 1.00 0.00 ? 76  MET A SD   4  
ATOM 7933  C CE   . MET A 1 76  ? 3.282   10.685  -15.733 1.00 0.00 ? 76  MET A CE   4  
ATOM 7934  H H    . MET A 1 76  ? 2.726   8.428   -20.348 1.00 0.00 ? 76  MET A H    4  
ATOM 7935  H HA   . MET A 1 76  ? 3.404   11.321  -20.426 1.00 0.00 ? 76  MET A HA   4  
ATOM 7936  H HB2  . MET A 1 76  ? 3.447   9.202   -18.244 1.00 0.00 ? 76  MET A HB2  4  
ATOM 7937  H HB3  . MET A 1 76  ? 4.243   10.750  -18.029 1.00 0.00 ? 76  MET A HB3  4  
ATOM 7938  H HG2  . MET A 1 76  ? 2.116   11.894  -18.558 1.00 0.00 ? 76  MET A HG2  4  
ATOM 7939  H HG3  . MET A 1 76  ? 1.330   10.348  -18.721 1.00 0.00 ? 76  MET A HG3  4  
ATOM 7940  H HE1  . MET A 1 76  ? 3.715   9.782   -16.138 1.00 0.00 ? 76  MET A HE1  4  
ATOM 7941  H HE2  . MET A 1 76  ? 3.911   11.529  -15.978 1.00 0.00 ? 76  MET A HE2  4  
ATOM 7942  H HE3  . MET A 1 76  ? 3.203   10.595  -14.659 1.00 0.00 ? 76  MET A HE3  4  
ATOM 7943  N N    . LYS A 1 77  ? 5.394   9.322   -21.391 1.00 0.00 ? 77  LYS A N    4  
ATOM 7944  C CA   . LYS A 1 77  ? 6.793   9.019   -21.746 1.00 0.00 ? 77  LYS A CA   4  
ATOM 7945  C C    . LYS A 1 77  ? 7.444   8.171   -20.670 1.00 0.00 ? 77  LYS A C    4  
ATOM 7946  O O    . LYS A 1 77  ? 7.742   8.648   -19.595 1.00 0.00 ? 77  LYS A O    4  
ATOM 7947  C CB   . LYS A 1 77  ? 7.561   10.343  -21.883 1.00 0.00 ? 77  LYS A CB   4  
ATOM 7948  C CG   . LYS A 1 77  ? 8.121   10.447  -23.301 1.00 0.00 ? 77  LYS A CG   4  
ATOM 7949  C CD   . LYS A 1 77  ? 9.163   11.564  -23.352 1.00 0.00 ? 77  LYS A CD   4  
ATOM 7950  C CE   . LYS A 1 77  ? 9.869   11.516  -24.707 1.00 0.00 ? 77  LYS A CE   4  
ATOM 7951  N NZ   . LYS A 1 77  ? 11.222  12.128  -24.616 1.00 0.00 ? 77  LYS A NZ   4  
ATOM 7952  H H    . LYS A 1 77  ? 4.663   8.949   -21.921 1.00 0.00 ? 77  LYS A H    4  
ATOM 7953  H HA   . LYS A 1 77  ? 6.805   8.466   -22.687 1.00 0.00 ? 77  LYS A HA   4  
ATOM 7954  H HB2  . LYS A 1 77  ? 6.895   11.172  -21.699 1.00 0.00 ? 77  LYS A HB2  4  
ATOM 7955  H HB3  . LYS A 1 77  ? 8.371   10.372  -21.168 1.00 0.00 ? 77  LYS A HB3  4  
ATOM 7956  H HG2  . LYS A 1 77  ? 8.581   9.510   -23.578 1.00 0.00 ? 77  LYS A HG2  4  
ATOM 7957  H HG3  . LYS A 1 77  ? 7.320   10.665  -23.992 1.00 0.00 ? 77  LYS A HG3  4  
ATOM 7958  H HD2  . LYS A 1 77  ? 8.677   12.520  -23.229 1.00 0.00 ? 77  LYS A HD2  4  
ATOM 7959  H HD3  . LYS A 1 77  ? 9.883   11.428  -22.559 1.00 0.00 ? 77  LYS A HD3  4  
ATOM 7960  H HE2  . LYS A 1 77  ? 9.968   10.489  -25.026 1.00 0.00 ? 77  LYS A HE2  4  
ATOM 7961  H HE3  . LYS A 1 77  ? 9.286   12.056  -25.437 1.00 0.00 ? 77  LYS A HE3  4  
ATOM 7962  H HZ1  . LYS A 1 77  ? 11.139  13.106  -24.272 1.00 0.00 ? 77  LYS A HZ1  4  
ATOM 7963  H HZ2  . LYS A 1 77  ? 11.809  11.578  -23.958 1.00 0.00 ? 77  LYS A HZ2  4  
ATOM 7964  H HZ3  . LYS A 1 77  ? 11.666  12.130  -25.557 1.00 0.00 ? 77  LYS A HZ3  4  
ATOM 7965  N N    . ASP A 1 78  ? 7.641   6.923   -20.980 1.00 0.00 ? 78  ASP A N    4  
ATOM 7966  C CA   . ASP A 1 78  ? 8.272   6.014   -19.992 1.00 0.00 ? 78  ASP A CA   4  
ATOM 7967  C C    . ASP A 1 78  ? 9.439   6.702   -19.286 1.00 0.00 ? 78  ASP A C    4  
ATOM 7968  O O    . ASP A 1 78  ? 10.559  6.669   -19.761 1.00 0.00 ? 78  ASP A O    4  
ATOM 7969  C CB   . ASP A 1 78  ? 8.803   4.780   -20.742 1.00 0.00 ? 78  ASP A CB   4  
ATOM 7970  C CG   . ASP A 1 78  ? 9.046   3.644   -19.747 1.00 0.00 ? 78  ASP A CG   4  
ATOM 7971  O OD1  . ASP A 1 78  ? 10.113  3.658   -19.160 1.00 0.00 ? 78  ASP A OD1  4  
ATOM 7972  O OD2  . ASP A 1 78  ? 8.149   2.826   -19.633 1.00 0.00 ? 78  ASP A OD2  4  
ATOM 7973  H H    . ASP A 1 78  ? 7.366   6.585   -21.859 1.00 0.00 ? 78  ASP A H    4  
ATOM 7974  H HA   . ASP A 1 78  ? 7.526   5.729   -19.251 1.00 0.00 ? 78  ASP A HA   4  
ATOM 7975  H HB2  . ASP A 1 78  ? 8.079   4.460   -21.477 1.00 0.00 ? 78  ASP A HB2  4  
ATOM 7976  H HB3  . ASP A 1 78  ? 9.730   5.023   -21.239 1.00 0.00 ? 78  ASP A HB3  4  
ATOM 7977  N N    . THR A 1 79  ? 9.151   7.307   -18.156 1.00 0.00 ? 79  THR A N    4  
ATOM 7978  C CA   . THR A 1 79  ? 10.215  8.005   -17.395 1.00 0.00 ? 79  THR A CA   4  
ATOM 7979  C C    . THR A 1 79  ? 11.177  8.728   -18.329 1.00 0.00 ? 79  THR A C    4  
ATOM 7980  O O    . THR A 1 79  ? 10.780  9.229   -19.362 1.00 0.00 ? 79  THR A O    4  
ATOM 7981  C CB   . THR A 1 79  ? 10.983  6.959   -16.596 1.00 0.00 ? 79  THR A CB   4  
ATOM 7982  O OG1  . THR A 1 79  ? 10.009  6.022   -16.181 1.00 0.00 ? 79  THR A OG1  4  
ATOM 7983  C CG2  . THR A 1 79  ? 11.527  7.554   -15.291 1.00 0.00 ? 79  THR A CG2  4  
ATOM 7984  H H    . THR A 1 79  ? 8.245   7.285   -17.810 1.00 0.00 ? 79  THR A H    4  
ATOM 7985  H HA   . THR A 1 79  ? 9.754   8.736   -16.731 1.00 0.00 ? 79  THR A HA   4  
ATOM 7986  H HB   . THR A 1 79  ? 11.745  6.479   -17.195 1.00 0.00 ? 79  THR A HB   4  
ATOM 7987  H HG1  . THR A 1 79  ? 9.595   6.359   -15.383 1.00 0.00 ? 79  THR A HG1  4  
ATOM 7988  H HG21 . THR A 1 79  ? 12.118  8.431   -15.509 1.00 0.00 ? 79  THR A HG21 4  
ATOM 7989  H HG22 . THR A 1 79  ? 10.704  7.831   -14.647 1.00 0.00 ? 79  THR A HG22 4  
ATOM 7990  H HG23 . THR A 1 79  ? 12.143  6.826   -14.787 1.00 0.00 ? 79  THR A HG23 4  
ATOM 7991  N N    . ASP A 1 80  ? 12.428  8.770   -17.940 1.00 0.00 ? 80  ASP A N    4  
ATOM 7992  C CA   . ASP A 1 80  ? 13.444  9.454   -18.786 1.00 0.00 ? 80  ASP A CA   4  
ATOM 7993  C C    . ASP A 1 80  ? 14.716  8.617   -18.903 1.00 0.00 ? 80  ASP A C    4  
ATOM 7994  O O    . ASP A 1 80  ? 15.798  9.152   -19.057 1.00 0.00 ? 80  ASP A O    4  
ATOM 7995  C CB   . ASP A 1 80  ? 13.792  10.798  -18.130 1.00 0.00 ? 80  ASP A CB   4  
ATOM 7996  C CG   . ASP A 1 80  ? 14.565  10.542  -16.836 1.00 0.00 ? 80  ASP A CG   4  
ATOM 7997  O OD1  . ASP A 1 80  ? 13.930  10.063  -15.911 1.00 0.00 ? 80  ASP A OD1  4  
ATOM 7998  O OD2  . ASP A 1 80  ? 15.748  10.840  -16.846 1.00 0.00 ? 80  ASP A OD2  4  
ATOM 7999  H H    . ASP A 1 80  ? 12.691  8.359   -17.097 1.00 0.00 ? 80  ASP A H    4  
ATOM 8000  H HA   . ASP A 1 80  ? 13.034  9.604   -19.778 1.00 0.00 ? 80  ASP A HA   4  
ATOM 8001  H HB2  . ASP A 1 80  ? 14.402  11.385  -18.802 1.00 0.00 ? 80  ASP A HB2  4  
ATOM 8002  H HB3  . ASP A 1 80  ? 12.885  11.340  -17.904 1.00 0.00 ? 80  ASP A HB3  4  
ATOM 8003  N N    . SER A 1 81  ? 14.554  7.319   -18.826 1.00 0.00 ? 81  SER A N    4  
ATOM 8004  C CA   . SER A 1 81  ? 15.728  6.407   -18.929 1.00 0.00 ? 81  SER A CA   4  
ATOM 8005  C C    . SER A 1 81  ? 15.502  5.399   -20.041 1.00 0.00 ? 81  SER A C    4  
ATOM 8006  O O    . SER A 1 81  ? 16.196  5.402   -21.050 1.00 0.00 ? 81  SER A O    4  
ATOM 8007  C CB   . SER A 1 81  ? 15.878  5.649   -17.599 1.00 0.00 ? 81  SER A CB   4  
ATOM 8008  O OG   . SER A 1 81  ? 15.653  6.640   -16.607 1.00 0.00 ? 81  SER A OG   4  
ATOM 8009  H H    . SER A 1 81  ? 13.661  6.947   -18.705 1.00 0.00 ? 81  SER A H    4  
ATOM 8010  H HA   . SER A 1 81  ? 16.615  6.984   -19.150 1.00 0.00 ? 81  SER A HA   4  
ATOM 8011  H HB2  . SER A 1 81  ? 15.139  4.866   -17.521 1.00 0.00 ? 81  SER A HB2  4  
ATOM 8012  H HB3  . SER A 1 81  ? 16.873  5.241   -17.501 1.00 0.00 ? 81  SER A HB3  4  
ATOM 8013  H HG   . SER A 1 81  ? 16.060  7.457   -16.906 1.00 0.00 ? 81  SER A HG   4  
ATOM 8014  N N    . GLU A 1 82  ? 14.539  4.547   -19.843 1.00 0.00 ? 82  GLU A N    4  
ATOM 8015  C CA   . GLU A 1 82  ? 14.256  3.541   -20.877 1.00 0.00 ? 82  GLU A CA   4  
ATOM 8016  C C    . GLU A 1 82  ? 14.172  4.226   -22.224 1.00 0.00 ? 82  GLU A C    4  
ATOM 8017  O O    . GLU A 1 82  ? 14.244  3.593   -23.252 1.00 0.00 ? 82  GLU A O    4  
ATOM 8018  C CB   . GLU A 1 82  ? 12.906  2.878   -20.559 1.00 0.00 ? 82  GLU A CB   4  
ATOM 8019  C CG   . GLU A 1 82  ? 13.085  1.930   -19.369 1.00 0.00 ? 82  GLU A CG   4  
ATOM 8020  C CD   . GLU A 1 82  ? 11.730  1.700   -18.697 1.00 0.00 ? 82  GLU A CD   4  
ATOM 8021  O OE1  . GLU A 1 82  ? 10.978  0.913   -19.249 1.00 0.00 ? 82  GLU A OE1  4  
ATOM 8022  O OE2  . GLU A 1 82  ? 11.522  2.324   -17.669 1.00 0.00 ? 82  GLU A OE2  4  
ATOM 8023  H H    . GLU A 1 82  ? 14.013  4.576   -19.018 1.00 0.00 ? 82  GLU A H    4  
ATOM 8024  H HA   . GLU A 1 82  ? 15.063  2.805   -20.899 1.00 0.00 ? 82  GLU A HA   4  
ATOM 8025  H HB2  . GLU A 1 82  ? 12.178  3.636   -20.312 1.00 0.00 ? 82  GLU A HB2  4  
ATOM 8026  H HB3  . GLU A 1 82  ? 12.562  2.321   -21.418 1.00 0.00 ? 82  GLU A HB3  4  
ATOM 8027  H HG2  . GLU A 1 82  ? 13.478  0.984   -19.710 1.00 0.00 ? 82  GLU A HG2  4  
ATOM 8028  H HG3  . GLU A 1 82  ? 13.768  2.365   -18.655 1.00 0.00 ? 82  GLU A HG3  4  
ATOM 8029  N N    . GLU A 1 83  ? 14.013  5.528   -22.186 1.00 0.00 ? 83  GLU A N    4  
ATOM 8030  C CA   . GLU A 1 83  ? 13.922  6.287   -23.449 1.00 0.00 ? 83  GLU A CA   4  
ATOM 8031  C C    . GLU A 1 83  ? 15.279  6.300   -24.129 1.00 0.00 ? 83  GLU A C    4  
ATOM 8032  O O    . GLU A 1 83  ? 15.396  5.973   -25.293 1.00 0.00 ? 83  GLU A O    4  
ATOM 8033  C CB   . GLU A 1 83  ? 13.507  7.732   -23.126 1.00 0.00 ? 83  GLU A CB   4  
ATOM 8034  C CG   . GLU A 1 83  ? 12.184  7.714   -22.356 1.00 0.00 ? 83  GLU A CG   4  
ATOM 8035  C CD   . GLU A 1 83  ? 11.636  9.140   -22.257 1.00 0.00 ? 83  GLU A CD   4  
ATOM 8036  O OE1  . GLU A 1 83  ? 12.426  10.040  -22.491 1.00 0.00 ? 83  GLU A OE1  4  
ATOM 8037  O OE2  . GLU A 1 83  ? 10.459  9.249   -21.952 1.00 0.00 ? 83  GLU A OE2  4  
ATOM 8038  H H    . GLU A 1 83  ? 13.956  5.993   -21.325 1.00 0.00 ? 83  GLU A H    4  
ATOM 8039  H HA   . GLU A 1 83  ? 13.197  5.806   -24.106 1.00 0.00 ? 83  GLU A HA   4  
ATOM 8040  H HB2  . GLU A 1 83  ? 14.270  8.204   -22.525 1.00 0.00 ? 83  GLU A HB2  4  
ATOM 8041  H HB3  . GLU A 1 83  ? 13.385  8.288   -24.044 1.00 0.00 ? 83  GLU A HB3  4  
ATOM 8042  H HG2  . GLU A 1 83  ? 11.468  7.093   -22.873 1.00 0.00 ? 83  GLU A HG2  4  
ATOM 8043  H HG3  . GLU A 1 83  ? 12.344  7.323   -21.362 1.00 0.00 ? 83  GLU A HG3  4  
ATOM 8044  N N    . GLU A 1 84  ? 16.288  6.683   -23.389 1.00 0.00 ? 84  GLU A N    4  
ATOM 8045  C CA   . GLU A 1 84  ? 17.639  6.717   -23.982 1.00 0.00 ? 84  GLU A CA   4  
ATOM 8046  C C    . GLU A 1 84  ? 17.927  5.381   -24.628 1.00 0.00 ? 84  GLU A C    4  
ATOM 8047  O O    . GLU A 1 84  ? 18.496  5.309   -25.699 1.00 0.00 ? 84  GLU A O    4  
ATOM 8048  C CB   . GLU A 1 84  ? 18.664  6.964   -22.864 1.00 0.00 ? 84  GLU A CB   4  
ATOM 8049  C CG   . GLU A 1 84  ? 19.943  7.539   -23.476 1.00 0.00 ? 84  GLU A CG   4  
ATOM 8050  C CD   . GLU A 1 84  ? 20.934  7.867   -22.358 1.00 0.00 ? 84  GLU A CD   4  
ATOM 8051  O OE1  . GLU A 1 84  ? 21.405  6.916   -21.755 1.00 0.00 ? 84  GLU A OE1  4  
ATOM 8052  O OE2  . GLU A 1 84  ? 21.164  9.051   -22.169 1.00 0.00 ? 84  GLU A OE2  4  
ATOM 8053  H H    . GLU A 1 84  ? 16.149  6.940   -22.453 1.00 0.00 ? 84  GLU A H    4  
ATOM 8054  H HA   . GLU A 1 84  ? 17.681  7.501   -24.739 1.00 0.00 ? 84  GLU A HA   4  
ATOM 8055  H HB2  . GLU A 1 84  ? 18.258  7.661   -22.147 1.00 0.00 ? 84  GLU A HB2  4  
ATOM 8056  H HB3  . GLU A 1 84  ? 18.888  6.031   -22.366 1.00 0.00 ? 84  GLU A HB3  4  
ATOM 8057  H HG2  . GLU A 1 84  ? 20.387  6.816   -24.144 1.00 0.00 ? 84  GLU A HG2  4  
ATOM 8058  H HG3  . GLU A 1 84  ? 19.714  8.440   -24.026 1.00 0.00 ? 84  GLU A HG3  4  
ATOM 8059  N N    . ILE A 1 85  ? 17.524  4.337   -23.956 1.00 0.00 ? 85  ILE A N    4  
ATOM 8060  C CA   . ILE A 1 85  ? 17.757  2.985   -24.506 1.00 0.00 ? 85  ILE A CA   4  
ATOM 8061  C C    . ILE A 1 85  ? 16.875  2.774   -25.730 1.00 0.00 ? 85  ILE A C    4  
ATOM 8062  O O    . ILE A 1 85  ? 17.326  2.308   -26.763 1.00 0.00 ? 85  ILE A O    4  
ATOM 8063  C CB   . ILE A 1 85  ? 17.379  1.961   -23.432 1.00 0.00 ? 85  ILE A CB   4  
ATOM 8064  C CG1  . ILE A 1 85  ? 18.294  2.125   -22.228 1.00 0.00 ? 85  ILE A CG1  4  
ATOM 8065  C CG2  . ILE A 1 85  ? 17.566  0.537   -23.999 1.00 0.00 ? 85  ILE A CG2  4  
ATOM 8066  C CD1  . ILE A 1 85  ? 17.911  1.099   -21.159 1.00 0.00 ? 85  ILE A CD1  4  
ATOM 8067  H H    . ILE A 1 85  ? 17.068  4.450   -23.089 1.00 0.00 ? 85  ILE A H    4  
ATOM 8068  H HA   . ILE A 1 85  ? 18.800  2.888   -24.792 1.00 0.00 ? 85  ILE A HA   4  
ATOM 8069  H HB   . ILE A 1 85  ? 16.347  2.127   -23.124 1.00 0.00 ? 85  ILE A HB   4  
ATOM 8070  H HG12 . ILE A 1 85  ? 19.321  1.971   -22.528 1.00 0.00 ? 85  ILE A HG12 4  
ATOM 8071  H HG13 . ILE A 1 85  ? 18.188  3.122   -21.826 1.00 0.00 ? 85  ILE A HG13 4  
ATOM 8072  H HG21 . ILE A 1 85  ? 17.610  0.573   -25.076 1.00 0.00 ? 85  ILE A HG21 4  
ATOM 8073  H HG22 . ILE A 1 85  ? 18.483  0.112   -23.623 1.00 0.00 ? 85  ILE A HG22 4  
ATOM 8074  H HG23 . ILE A 1 85  ? 16.736  -0.086  -23.698 1.00 0.00 ? 85  ILE A HG23 4  
ATOM 8075  H HD11 . ILE A 1 85  ? 16.837  1.065   -21.057 1.00 0.00 ? 85  ILE A HD11 4  
ATOM 8076  H HD12 . ILE A 1 85  ? 18.271  0.121   -21.446 1.00 0.00 ? 85  ILE A HD12 4  
ATOM 8077  H HD13 . ILE A 1 85  ? 18.351  1.375   -20.214 1.00 0.00 ? 85  ILE A HD13 4  
ATOM 8078  N N    . ARG A 1 86  ? 15.631  3.132   -25.589 1.00 0.00 ? 86  ARG A N    4  
ATOM 8079  C CA   . ARG A 1 86  ? 14.691  2.972   -26.716 1.00 0.00 ? 86  ARG A CA   4  
ATOM 8080  C C    . ARG A 1 86  ? 15.277  3.578   -27.980 1.00 0.00 ? 86  ARG A C    4  
ATOM 8081  O O    . ARG A 1 86  ? 15.108  3.055   -29.064 1.00 0.00 ? 86  ARG A O    4  
ATOM 8082  C CB   . ARG A 1 86  ? 13.392  3.719   -26.364 1.00 0.00 ? 86  ARG A CB   4  
ATOM 8083  C CG   . ARG A 1 86  ? 12.259  3.210   -27.247 1.00 0.00 ? 86  ARG A CG   4  
ATOM 8084  C CD   . ARG A 1 86  ? 10.998  4.029   -26.964 1.00 0.00 ? 86  ARG A CD   4  
ATOM 8085  N NE   . ARG A 1 86  ? 10.013  3.796   -28.057 1.00 0.00 ? 86  ARG A NE   4  
ATOM 8086  C CZ   . ARG A 1 86  ? 9.560   2.591   -28.267 1.00 0.00 ? 86  ARG A CZ   4  
ATOM 8087  N NH1  . ARG A 1 86  ? 8.585   2.144   -27.521 1.00 0.00 ? 86  ARG A NH1  4  
ATOM 8088  N NH2  . ARG A 1 86  ? 10.097  1.872   -29.215 1.00 0.00 ? 86  ARG A NH2  4  
ATOM 8089  H H    . ARG A 1 86  ? 15.321  3.508   -24.741 1.00 0.00 ? 86  ARG A H    4  
ATOM 8090  H HA   . ARG A 1 86  ? 14.502  1.910   -26.879 1.00 0.00 ? 86  ARG A HA   4  
ATOM 8091  H HB2  . ARG A 1 86  ? 13.147  3.547   -25.329 1.00 0.00 ? 86  ARG A HB2  4  
ATOM 8092  H HB3  . ARG A 1 86  ? 13.528  4.777   -26.524 1.00 0.00 ? 86  ARG A HB3  4  
ATOM 8093  H HG2  . ARG A 1 86  ? 12.534  3.313   -28.284 1.00 0.00 ? 86  ARG A HG2  4  
ATOM 8094  H HG3  . ARG A 1 86  ? 12.070  2.170   -27.028 1.00 0.00 ? 86  ARG A HG3  4  
ATOM 8095  H HD2  . ARG A 1 86  ? 10.567  3.726   -26.022 1.00 0.00 ? 86  ARG A HD2  4  
ATOM 8096  H HD3  . ARG A 1 86  ? 11.245  5.080   -26.923 1.00 0.00 ? 86  ARG A HD3  4  
ATOM 8097  H HE   . ARG A 1 86  ? 9.707   4.542   -28.614 1.00 0.00 ? 86  ARG A HE   4  
ATOM 8098  H HH11 . ARG A 1 86  ? 8.198   2.724   -26.805 1.00 0.00 ? 86  ARG A HH11 4  
ATOM 8099  H HH12 . ARG A 1 86  ? 8.227   1.223   -27.667 1.00 0.00 ? 86  ARG A HH12 4  
ATOM 8100  H HH21 . ARG A 1 86  ? 10.841  2.248   -29.767 1.00 0.00 ? 86  ARG A HH21 4  
ATOM 8101  H HH22 . ARG A 1 86  ? 9.763   0.945   -29.389 1.00 0.00 ? 86  ARG A HH22 4  
ATOM 8102  N N    . GLU A 1 87  ? 15.959  4.677   -27.816 1.00 0.00 ? 87  GLU A N    4  
ATOM 8103  C CA   . GLU A 1 87  ? 16.568  5.340   -28.988 1.00 0.00 ? 87  GLU A CA   4  
ATOM 8104  C C    . GLU A 1 87  ? 17.705  4.496   -29.544 1.00 0.00 ? 87  GLU A C    4  
ATOM 8105  O O    . GLU A 1 87  ? 17.748  4.215   -30.726 1.00 0.00 ? 87  GLU A O    4  
ATOM 8106  C CB   . GLU A 1 87  ? 17.117  6.708   -28.534 1.00 0.00 ? 87  GLU A CB   4  
ATOM 8107  C CG   . GLU A 1 87  ? 18.090  7.255   -29.587 1.00 0.00 ? 87  GLU A CG   4  
ATOM 8108  C CD   . GLU A 1 87  ? 17.359  7.416   -30.921 1.00 0.00 ? 87  GLU A CD   4  
ATOM 8109  O OE1  . GLU A 1 87  ? 16.982  6.390   -31.461 1.00 0.00 ? 87  GLU A OE1  4  
ATOM 8110  O OE2  . GLU A 1 87  ? 17.220  8.558   -31.326 1.00 0.00 ? 87  GLU A OE2  4  
ATOM 8111  H H    . GLU A 1 87  ? 16.067  5.062   -26.921 1.00 0.00 ? 87  GLU A H    4  
ATOM 8112  H HA   . GLU A 1 87  ? 15.810  5.462   -29.758 1.00 0.00 ? 87  GLU A HA   4  
ATOM 8113  H HB2  . GLU A 1 87  ? 16.298  7.401   -28.407 1.00 0.00 ? 87  GLU A HB2  4  
ATOM 8114  H HB3  . GLU A 1 87  ? 17.631  6.596   -27.592 1.00 0.00 ? 87  GLU A HB3  4  
ATOM 8115  H HG2  . GLU A 1 87  ? 18.463  8.217   -29.270 1.00 0.00 ? 87  GLU A HG2  4  
ATOM 8116  H HG3  . GLU A 1 87  ? 18.920  6.578   -29.711 1.00 0.00 ? 87  GLU A HG3  4  
ATOM 8117  N N    . ALA A 1 88  ? 18.607  4.104   -28.683 1.00 0.00 ? 88  ALA A N    4  
ATOM 8118  C CA   . ALA A 1 88  ? 19.746  3.275   -29.154 1.00 0.00 ? 88  ALA A CA   4  
ATOM 8119  C C    . ALA A 1 88  ? 19.244  2.197   -30.093 1.00 0.00 ? 88  ALA A C    4  
ATOM 8120  O O    . ALA A 1 88  ? 19.955  1.747   -30.967 1.00 0.00 ? 88  ALA A O    4  
ATOM 8121  C CB   . ALA A 1 88  ? 20.415  2.614   -27.937 1.00 0.00 ? 88  ALA A CB   4  
ATOM 8122  H H    . ALA A 1 88  ? 18.531  4.353   -27.740 1.00 0.00 ? 88  ALA A H    4  
ATOM 8123  H HA   . ALA A 1 88  ? 20.451  3.911   -29.691 1.00 0.00 ? 88  ALA A HA   4  
ATOM 8124  H HB1  . ALA A 1 88  ? 19.666  2.364   -27.199 1.00 0.00 ? 88  ALA A HB1  4  
ATOM 8125  H HB2  . ALA A 1 88  ? 20.925  1.712   -28.244 1.00 0.00 ? 88  ALA A HB2  4  
ATOM 8126  H HB3  . ALA A 1 88  ? 21.130  3.294   -27.499 1.00 0.00 ? 88  ALA A HB3  4  
ATOM 8127  N N    . PHE A 1 89  ? 18.019  1.800   -29.895 1.00 0.00 ? 89  PHE A N    4  
ATOM 8128  C CA   . PHE A 1 89  ? 17.450  0.756   -30.765 1.00 0.00 ? 89  PHE A CA   4  
ATOM 8129  C C    . PHE A 1 89  ? 16.860  1.381   -32.023 1.00 0.00 ? 89  PHE A C    4  
ATOM 8130  O O    . PHE A 1 89  ? 17.087  0.911   -33.120 1.00 0.00 ? 89  PHE A O    4  
ATOM 8131  C CB   . PHE A 1 89  ? 16.330  0.038   -30.000 1.00 0.00 ? 89  PHE A CB   4  
ATOM 8132  C CG   . PHE A 1 89  ? 16.925  -0.785  -28.850 1.00 0.00 ? 89  PHE A CG   4  
ATOM 8133  C CD1  . PHE A 1 89  ? 17.941  -1.703  -29.081 1.00 0.00 ? 89  PHE A CD1  4  
ATOM 8134  C CD2  . PHE A 1 89  ? 16.439  -0.637  -27.562 1.00 0.00 ? 89  PHE A CD2  4  
ATOM 8135  C CE1  . PHE A 1 89  ? 18.453  -2.452  -28.044 1.00 0.00 ? 89  PHE A CE1  4  
ATOM 8136  C CE2  . PHE A 1 89  ? 16.956  -1.393  -26.529 1.00 0.00 ? 89  PHE A CE2  4  
ATOM 8137  C CZ   . PHE A 1 89  ? 17.960  -2.297  -26.771 1.00 0.00 ? 89  PHE A CZ   4  
ATOM 8138  H H    . PHE A 1 89  ? 17.483  2.185   -29.165 1.00 0.00 ? 89  PHE A H    4  
ATOM 8139  H HA   . PHE A 1 89  ? 18.236  0.065   -31.052 1.00 0.00 ? 89  PHE A HA   4  
ATOM 8140  H HB2  . PHE A 1 89  ? 15.641  0.766   -29.595 1.00 0.00 ? 89  PHE A HB2  4  
ATOM 8141  H HB3  . PHE A 1 89  ? 15.796  -0.619  -30.669 1.00 0.00 ? 89  PHE A HB3  4  
ATOM 8142  H HD1  . PHE A 1 89  ? 18.327  -1.841  -30.077 1.00 0.00 ? 89  PHE A HD1  4  
ATOM 8143  H HD2  . PHE A 1 89  ? 15.648  0.072   -27.364 1.00 0.00 ? 89  PHE A HD2  4  
ATOM 8144  H HE1  . PHE A 1 89  ? 19.243  -3.161  -28.231 1.00 0.00 ? 89  PHE A HE1  4  
ATOM 8145  H HE2  . PHE A 1 89  ? 16.569  -1.277  -25.530 1.00 0.00 ? 89  PHE A HE2  4  
ATOM 8146  H HZ   . PHE A 1 89  ? 18.360  -2.888  -25.961 1.00 0.00 ? 89  PHE A HZ   4  
ATOM 8147  N N    . ARG A 1 90  ? 16.109  2.435   -31.846 1.00 0.00 ? 90  ARG A N    4  
ATOM 8148  C CA   . ARG A 1 90  ? 15.506  3.093   -33.019 1.00 0.00 ? 90  ARG A CA   4  
ATOM 8149  C C    . ARG A 1 90  ? 16.575  3.447   -34.042 1.00 0.00 ? 90  ARG A C    4  
ATOM 8150  O O    . ARG A 1 90  ? 16.273  3.786   -35.169 1.00 0.00 ? 90  ARG A O    4  
ATOM 8151  C CB   . ARG A 1 90  ? 14.814  4.378   -32.554 1.00 0.00 ? 90  ARG A CB   4  
ATOM 8152  C CG   . ARG A 1 90  ? 13.419  4.421   -33.166 1.00 0.00 ? 90  ARG A CG   4  
ATOM 8153  C CD   . ARG A 1 90  ? 12.649  5.602   -32.583 1.00 0.00 ? 90  ARG A CD   4  
ATOM 8154  N NE   . ARG A 1 90  ? 13.595  6.475   -31.836 1.00 0.00 ? 90  ARG A NE   4  
ATOM 8155  C CZ   . ARG A 1 90  ? 13.630  7.751   -32.100 1.00 0.00 ? 90  ARG A CZ   4  
ATOM 8156  N NH1  . ARG A 1 90  ? 12.552  8.331   -32.551 1.00 0.00 ? 90  ARG A NH1  4  
ATOM 8157  N NH2  . ARG A 1 90  ? 14.741  8.404   -31.905 1.00 0.00 ? 90  ARG A NH2  4  
ATOM 8158  H H    . ARG A 1 90  ? 15.942  2.781   -30.947 1.00 0.00 ? 90  ARG A H    4  
ATOM 8159  H HA   . ARG A 1 90  ? 14.787  2.414   -33.477 1.00 0.00 ? 90  ARG A HA   4  
ATOM 8160  H HB2  . ARG A 1 90  ? 14.741  4.384   -31.475 1.00 0.00 ? 90  ARG A HB2  4  
ATOM 8161  H HB3  . ARG A 1 90  ? 15.384  5.237   -32.877 1.00 0.00 ? 90  ARG A HB3  4  
ATOM 8162  H HG2  . ARG A 1 90  ? 13.498  4.531   -34.237 1.00 0.00 ? 90  ARG A HG2  4  
ATOM 8163  H HG3  . ARG A 1 90  ? 12.897  3.502   -32.941 1.00 0.00 ? 90  ARG A HG3  4  
ATOM 8164  H HD2  . ARG A 1 90  ? 12.191  6.169   -33.379 1.00 0.00 ? 90  ARG A HD2  4  
ATOM 8165  H HD3  . ARG A 1 90  ? 11.884  5.243   -31.912 1.00 0.00 ? 90  ARG A HD3  4  
ATOM 8166  H HE   . ARG A 1 90  ? 14.186  6.094   -31.152 1.00 0.00 ? 90  ARG A HE   4  
ATOM 8167  H HH11 . ARG A 1 90  ? 11.717  7.797   -32.689 1.00 0.00 ? 90  ARG A HH11 4  
ATOM 8168  H HH12 . ARG A 1 90  ? 12.560  9.309   -32.762 1.00 0.00 ? 90  ARG A HH12 4  
ATOM 8169  H HH21 . ARG A 1 90  ? 15.548  7.927   -31.558 1.00 0.00 ? 90  ARG A HH21 4  
ATOM 8170  H HH22 . ARG A 1 90  ? 14.785  9.383   -32.102 1.00 0.00 ? 90  ARG A HH22 4  
ATOM 8171  N N    . VAL A 1 91  ? 17.812  3.364   -33.630 1.00 0.00 ? 91  VAL A N    4  
ATOM 8172  C CA   . VAL A 1 91  ? 18.915  3.691   -34.564 1.00 0.00 ? 91  VAL A CA   4  
ATOM 8173  C C    . VAL A 1 91  ? 18.961  2.685   -35.706 1.00 0.00 ? 91  VAL A C    4  
ATOM 8174  O O    . VAL A 1 91  ? 19.733  2.830   -36.634 1.00 0.00 ? 91  VAL A O    4  
ATOM 8175  C CB   . VAL A 1 91  ? 20.242  3.629   -33.791 1.00 0.00 ? 91  VAL A CB   4  
ATOM 8176  C CG1  . VAL A 1 91  ? 21.408  3.693   -34.780 1.00 0.00 ? 91  VAL A CG1  4  
ATOM 8177  C CG2  . VAL A 1 91  ? 20.326  4.823   -32.837 1.00 0.00 ? 91  VAL A CG2  4  
ATOM 8178  H H    . VAL A 1 91  ? 18.009  3.089   -32.710 1.00 0.00 ? 91  VAL A H    4  
ATOM 8179  H HA   . VAL A 1 91  ? 18.751  4.686   -34.972 1.00 0.00 ? 91  VAL A HA   4  
ATOM 8180  H HB   . VAL A 1 91  ? 20.291  2.711   -33.230 1.00 0.00 ? 91  VAL A HB   4  
ATOM 8181  H HG11 . VAL A 1 91  ? 21.171  4.382   -35.579 1.00 0.00 ? 91  VAL A HG11 4  
ATOM 8182  H HG12 . VAL A 1 91  ? 22.300  4.032   -34.273 1.00 0.00 ? 91  VAL A HG12 4  
ATOM 8183  H HG13 . VAL A 1 91  ? 21.589  2.714   -35.197 1.00 0.00 ? 91  VAL A HG13 4  
ATOM 8184  H HG21 . VAL A 1 91  ? 19.332  5.120   -32.536 1.00 0.00 ? 91  VAL A HG21 4  
ATOM 8185  H HG22 . VAL A 1 91  ? 20.897  4.551   -31.962 1.00 0.00 ? 91  VAL A HG22 4  
ATOM 8186  H HG23 . VAL A 1 91  ? 20.809  5.652   -33.333 1.00 0.00 ? 91  VAL A HG23 4  
ATOM 8187  N N    . PHE A 1 92  ? 18.122  1.679   -35.611 1.00 0.00 ? 92  PHE A N    4  
ATOM 8188  C CA   . PHE A 1 92  ? 18.086  0.641   -36.675 1.00 0.00 ? 92  PHE A CA   4  
ATOM 8189  C C    . PHE A 1 92  ? 16.649  0.320   -37.066 1.00 0.00 ? 92  PHE A C    4  
ATOM 8190  O O    . PHE A 1 92  ? 16.309  -0.822  -37.303 1.00 0.00 ? 92  PHE A O    4  
ATOM 8191  C CB   . PHE A 1 92  ? 18.746  -0.637  -36.130 1.00 0.00 ? 92  PHE A CB   4  
ATOM 8192  C CG   . PHE A 1 92  ? 20.075  -0.277  -35.462 1.00 0.00 ? 92  PHE A CG   4  
ATOM 8193  C CD1  . PHE A 1 92  ? 21.246  -0.250  -36.200 1.00 0.00 ? 92  PHE A CD1  4  
ATOM 8194  C CD2  . PHE A 1 92  ? 20.127  0.025   -34.109 1.00 0.00 ? 92  PHE A CD2  4  
ATOM 8195  C CE1  . PHE A 1 92  ? 22.444  0.072   -35.598 1.00 0.00 ? 92  PHE A CE1  4  
ATOM 8196  C CE2  . PHE A 1 92  ? 21.329  0.346   -33.511 1.00 0.00 ? 92  PHE A CE2  4  
ATOM 8197  C CZ   . PHE A 1 92  ? 22.486  0.370   -34.256 1.00 0.00 ? 92  PHE A CZ   4  
ATOM 8198  H H    . PHE A 1 92  ? 17.521  1.612   -34.841 1.00 0.00 ? 92  PHE A H    4  
ATOM 8199  H HA   . PHE A 1 92  ? 18.616  1.007   -37.552 1.00 0.00 ? 92  PHE A HA   4  
ATOM 8200  H HB2  . PHE A 1 92  ? 18.097  -1.104  -35.405 1.00 0.00 ? 92  PHE A HB2  4  
ATOM 8201  H HB3  . PHE A 1 92  ? 18.930  -1.326  -36.942 1.00 0.00 ? 92  PHE A HB3  4  
ATOM 8202  H HD1  . PHE A 1 92  ? 21.220  -0.483  -37.253 1.00 0.00 ? 92  PHE A HD1  4  
ATOM 8203  H HD2  . PHE A 1 92  ? 19.224  0.007   -33.520 1.00 0.00 ? 92  PHE A HD2  4  
ATOM 8204  H HE1  . PHE A 1 92  ? 23.353  0.090   -36.182 1.00 0.00 ? 92  PHE A HE1  4  
ATOM 8205  H HE2  . PHE A 1 92  ? 21.363  0.578   -32.457 1.00 0.00 ? 92  PHE A HE2  4  
ATOM 8206  H HZ   . PHE A 1 92  ? 23.425  0.621   -33.789 1.00 0.00 ? 92  PHE A HZ   4  
ATOM 8207  N N    . ASP A 1 93  ? 15.834  1.339   -37.129 1.00 0.00 ? 93  ASP A N    4  
ATOM 8208  C CA   . ASP A 1 93  ? 14.416  1.129   -37.500 1.00 0.00 ? 93  ASP A CA   4  
ATOM 8209  C C    . ASP A 1 93  ? 14.215  1.437   -38.969 1.00 0.00 ? 93  ASP A C    4  
ATOM 8210  O O    . ASP A 1 93  ? 13.578  2.409   -39.324 1.00 0.00 ? 93  ASP A O    4  
ATOM 8211  C CB   . ASP A 1 93  ? 13.547  2.083   -36.669 1.00 0.00 ? 93  ASP A CB   4  
ATOM 8212  C CG   . ASP A 1 93  ? 12.070  1.774   -36.925 1.00 0.00 ? 93  ASP A CG   4  
ATOM 8213  O OD1  . ASP A 1 93  ? 11.791  1.350   -38.035 1.00 0.00 ? 93  ASP A OD1  4  
ATOM 8214  O OD2  . ASP A 1 93  ? 11.305  1.979   -35.997 1.00 0.00 ? 93  ASP A OD2  4  
ATOM 8215  H H    . ASP A 1 93  ? 16.160  2.235   -36.950 1.00 0.00 ? 93  ASP A H    4  
ATOM 8216  H HA   . ASP A 1 93  ? 14.144  0.091   -37.312 1.00 0.00 ? 93  ASP A HA   4  
ATOM 8217  H HB2  . ASP A 1 93  ? 13.763  1.952   -35.618 1.00 0.00 ? 93  ASP A HB2  4  
ATOM 8218  H HB3  . ASP A 1 93  ? 13.752  3.104   -36.951 1.00 0.00 ? 93  ASP A HB3  4  
ATOM 8219  N N    . LYS A 1 94  ? 14.779  0.603   -39.794 1.00 0.00 ? 94  LYS A N    4  
ATOM 8220  C CA   . LYS A 1 94  ? 14.654  0.799   -41.255 1.00 0.00 ? 94  LYS A CA   4  
ATOM 8221  C C    . LYS A 1 94  ? 13.268  1.305   -41.637 1.00 0.00 ? 94  LYS A C    4  
ATOM 8222  O O    . LYS A 1 94  ? 13.063  2.490   -41.810 1.00 0.00 ? 94  LYS A O    4  
ATOM 8223  C CB   . LYS A 1 94  ? 14.878  -0.557  -41.917 1.00 0.00 ? 94  LYS A CB   4  
ATOM 8224  C CG   . LYS A 1 94  ? 16.279  -0.602  -42.524 1.00 0.00 ? 94  LYS A CG   4  
ATOM 8225  C CD   . LYS A 1 94  ? 16.768  -2.051  -42.529 1.00 0.00 ? 94  LYS A CD   4  
ATOM 8226  C CE   . LYS A 1 94  ? 18.180  -2.103  -43.106 1.00 0.00 ? 94  LYS A CE   4  
ATOM 8227  N NZ   . LYS A 1 94  ? 18.132  -2.243  -44.589 1.00 0.00 ? 94  LYS A NZ   4  
ATOM 8228  H H    . LYS A 1 94  ? 15.288  -0.159  -39.445 1.00 0.00 ? 94  LYS A H    4  
ATOM 8229  H HA   . LYS A 1 94  ? 15.400  1.518   -41.583 1.00 0.00 ? 94  LYS A HA   4  
ATOM 8230  H HB2  . LYS A 1 94  ? 14.783  -1.337  -41.175 1.00 0.00 ? 94  LYS A HB2  4  
ATOM 8231  H HB3  . LYS A 1 94  ? 14.144  -0.710  -42.688 1.00 0.00 ? 94  LYS A HB3  4  
ATOM 8232  H HG2  . LYS A 1 94  ? 16.250  -0.225  -43.535 1.00 0.00 ? 94  LYS A HG2  4  
ATOM 8233  H HG3  . LYS A 1 94  ? 16.951  0.006   -41.937 1.00 0.00 ? 94  LYS A HG3  4  
ATOM 8234  H HD2  . LYS A 1 94  ? 16.774  -2.435  -41.519 1.00 0.00 ? 94  LYS A HD2  4  
ATOM 8235  H HD3  . LYS A 1 94  ? 16.107  -2.654  -43.134 1.00 0.00 ? 94  LYS A HD3  4  
ATOM 8236  H HE2  . LYS A 1 94  ? 18.707  -1.194  -42.855 1.00 0.00 ? 94  LYS A HE2  4  
ATOM 8237  H HE3  . LYS A 1 94  ? 18.711  -2.945  -42.690 1.00 0.00 ? 94  LYS A HE3  4  
ATOM 8238  H HZ1  . LYS A 1 94  ? 17.306  -2.815  -44.855 1.00 0.00 ? 94  LYS A HZ1  4  
ATOM 8239  H HZ2  . LYS A 1 94  ? 18.056  -1.301  -45.023 1.00 0.00 ? 94  LYS A HZ2  4  
ATOM 8240  H HZ3  . LYS A 1 94  ? 18.999  -2.710  -44.922 1.00 0.00 ? 94  LYS A HZ3  4  
ATOM 8241  N N    . ASP A 1 95  ? 12.341  0.397   -41.764 1.00 0.00 ? 95  ASP A N    4  
ATOM 8242  C CA   . ASP A 1 95  ? 10.966  0.811   -42.136 1.00 0.00 ? 95  ASP A CA   4  
ATOM 8243  C C    . ASP A 1 95  ? 9.924   -0.109  -41.510 1.00 0.00 ? 95  ASP A C    4  
ATOM 8244  O O    . ASP A 1 95  ? 9.071   -0.640  -42.196 1.00 0.00 ? 95  ASP A O    4  
ATOM 8245  C CB   . ASP A 1 95  ? 10.840  0.735   -43.666 1.00 0.00 ? 95  ASP A CB   4  
ATOM 8246  C CG   . ASP A 1 95  ? 9.448   1.211   -44.083 1.00 0.00 ? 95  ASP A CG   4  
ATOM 8247  O OD1  . ASP A 1 95  ? 9.263   2.417   -44.076 1.00 0.00 ? 95  ASP A OD1  4  
ATOM 8248  O OD2  . ASP A 1 95  ? 8.647   0.342   -44.388 1.00 0.00 ? 95  ASP A OD2  4  
ATOM 8249  H H    . ASP A 1 95  ? 12.550  -0.548  -41.614 1.00 0.00 ? 95  ASP A H    4  
ATOM 8250  H HA   . ASP A 1 95  ? 10.796  1.828   -41.785 1.00 0.00 ? 95  ASP A HA   4  
ATOM 8251  H HB2  . ASP A 1 95  ? 11.586  1.366   -44.126 1.00 0.00 ? 95  ASP A HB2  4  
ATOM 8252  H HB3  . ASP A 1 95  ? 10.982  -0.285  -43.995 1.00 0.00 ? 95  ASP A HB3  4  
ATOM 8253  N N    . GLY A 1 96  ? 10.017  -0.279  -40.213 1.00 0.00 ? 96  GLY A N    4  
ATOM 8254  C CA   . GLY A 1 96  ? 9.040   -1.163  -39.502 1.00 0.00 ? 96  GLY A CA   4  
ATOM 8255  C C    . GLY A 1 96  ? 8.150   -0.322  -38.584 1.00 0.00 ? 96  GLY A C    4  
ATOM 8256  O O    . GLY A 1 96  ? 7.201   0.291   -39.029 1.00 0.00 ? 96  GLY A O    4  
ATOM 8257  H H    . GLY A 1 96  ? 10.726  0.173   -39.708 1.00 0.00 ? 96  GLY A H    4  
ATOM 8258  H HA2  . GLY A 1 96  ? 8.424   -1.680  -40.222 1.00 0.00 ? 96  GLY A HA2  4  
ATOM 8259  H HA3  . GLY A 1 96  ? 9.579   -1.888  -38.910 1.00 0.00 ? 96  GLY A HA3  4  
ATOM 8260  N N    . ASN A 1 97  ? 8.477   -0.314  -37.322 1.00 0.00 ? 97  ASN A N    4  
ATOM 8261  C CA   . ASN A 1 97  ? 7.665   0.477   -36.364 1.00 0.00 ? 97  ASN A CA   4  
ATOM 8262  C C    . ASN A 1 97  ? 8.078   0.173   -34.932 1.00 0.00 ? 97  ASN A C    4  
ATOM 8263  O O    . ASN A 1 97  ? 7.503   0.690   -33.992 1.00 0.00 ? 97  ASN A O    4  
ATOM 8264  C CB   . ASN A 1 97  ? 6.186   0.101   -36.547 1.00 0.00 ? 97  ASN A CB   4  
ATOM 8265  C CG   . ASN A 1 97  ? 5.434   1.291   -37.149 1.00 0.00 ? 97  ASN A CG   4  
ATOM 8266  O OD1  . ASN A 1 97  ? 4.794   1.180   -38.176 1.00 0.00 ? 97  ASN A OD1  4  
ATOM 8267  N ND2  . ASN A 1 97  ? 5.484   2.444   -36.540 1.00 0.00 ? 97  ASN A ND2  4  
ATOM 8268  H H    . ASN A 1 97  ? 9.249   -0.828  -37.008 1.00 0.00 ? 97  ASN A H    4  
ATOM 8269  H HA   . ASN A 1 97  ? 7.824   1.536   -36.559 1.00 0.00 ? 97  ASN A HA   4  
ATOM 8270  H HB2  . ASN A 1 97  ? 6.102   -0.747  -37.211 1.00 0.00 ? 97  ASN A HB2  4  
ATOM 8271  H HB3  . ASN A 1 97  ? 5.749   -0.150  -35.591 1.00 0.00 ? 97  ASN A HB3  4  
ATOM 8272  H HD21 . ASN A 1 97  ? 5.999   2.538   -35.712 1.00 0.00 ? 97  ASN A HD21 4  
ATOM 8273  H HD22 . ASN A 1 97  ? 5.009   3.216   -36.913 1.00 0.00 ? 97  ASN A HD22 4  
ATOM 8274  N N    . GLY A 1 98  ? 9.071   -0.659  -34.788 1.00 0.00 ? 98  GLY A N    4  
ATOM 8275  C CA   . GLY A 1 98  ? 9.538   -1.010  -33.422 1.00 0.00 ? 98  GLY A CA   4  
ATOM 8276  C C    . GLY A 1 98  ? 10.278  -2.350  -33.443 1.00 0.00 ? 98  GLY A C    4  
ATOM 8277  O O    . GLY A 1 98  ? 10.040  -3.202  -32.611 1.00 0.00 ? 98  GLY A O    4  
ATOM 8278  H H    . GLY A 1 98  ? 9.504   -1.050  -35.577 1.00 0.00 ? 98  GLY A H    4  
ATOM 8279  H HA2  . GLY A 1 98  ? 10.201  -0.240  -33.062 1.00 0.00 ? 98  GLY A HA2  4  
ATOM 8280  H HA3  . GLY A 1 98  ? 8.687   -1.084  -32.762 1.00 0.00 ? 98  GLY A HA3  4  
ATOM 8281  N N    . TYR A 1 99  ? 11.162  -2.507  -34.394 1.00 0.00 ? 99  TYR A N    4  
ATOM 8282  C CA   . TYR A 1 99  ? 11.919  -3.786  -34.478 1.00 0.00 ? 99  TYR A CA   4  
ATOM 8283  C C    . TYR A 1 99  ? 13.342  -3.565  -34.995 1.00 0.00 ? 99  TYR A C    4  
ATOM 8284  O O    . TYR A 1 99  ? 13.620  -2.596  -35.672 1.00 0.00 ? 99  TYR A O    4  
ATOM 8285  C CB   . TYR A 1 99  ? 11.187  -4.712  -35.465 1.00 0.00 ? 99  TYR A CB   4  
ATOM 8286  C CG   . TYR A 1 99  ? 10.224  -5.627  -34.702 1.00 0.00 ? 99  TYR A CG   4  
ATOM 8287  C CD1  . TYR A 1 99  ? 10.683  -6.774  -34.079 1.00 0.00 ? 99  TYR A CD1  4  
ATOM 8288  C CD2  . TYR A 1 99  ? 8.877   -5.331  -34.643 1.00 0.00 ? 99  TYR A CD2  4  
ATOM 8289  C CE1  . TYR A 1 99  ? 9.806   -7.608  -33.412 1.00 0.00 ? 99  TYR A CE1  4  
ATOM 8290  C CE2  . TYR A 1 99  ? 8.003   -6.164  -33.976 1.00 0.00 ? 99  TYR A CE2  4  
ATOM 8291  C CZ   . TYR A 1 99  ? 8.460   -7.310  -33.356 1.00 0.00 ? 99  TYR A CZ   4  
ATOM 8292  O OH   . TYR A 1 99  ? 7.582   -8.144  -32.690 1.00 0.00 ? 99  TYR A OH   4  
ATOM 8293  H H    . TYR A 1 99  ? 11.320  -1.792  -35.047 1.00 0.00 ? 99  TYR A H    4  
ATOM 8294  H HA   . TYR A 1 99  ? 11.968  -4.237  -33.489 1.00 0.00 ? 99  TYR A HA   4  
ATOM 8295  H HB2  . TYR A 1 99  ? 10.626  -4.118  -36.172 1.00 0.00 ? 99  TYR A HB2  4  
ATOM 8296  H HB3  . TYR A 1 99  ? 11.904  -5.316  -35.998 1.00 0.00 ? 99  TYR A HB3  4  
ATOM 8297  H HD1  . TYR A 1 99  ? 11.734  -7.018  -34.112 1.00 0.00 ? 99  TYR A HD1  4  
ATOM 8298  H HD2  . TYR A 1 99  ? 8.505   -4.439  -35.123 1.00 0.00 ? 99  TYR A HD2  4  
ATOM 8299  H HE1  . TYR A 1 99  ? 10.178  -8.501  -32.932 1.00 0.00 ? 99  TYR A HE1  4  
ATOM 8300  H HE2  . TYR A 1 99  ? 6.952   -5.918  -33.936 1.00 0.00 ? 99  TYR A HE2  4  
ATOM 8301  H HH   . TYR A 1 99  ? 6.929   -8.452  -33.322 1.00 0.00 ? 99  TYR A HH   4  
ATOM 8302  N N    . ILE A 1 100 ? 14.213  -4.481  -34.657 1.00 0.00 ? 100 ILE A N    4  
ATOM 8303  C CA   . ILE A 1 100 ? 15.628  -4.369  -35.105 1.00 0.00 ? 100 ILE A CA   4  
ATOM 8304  C C    . ILE A 1 100 ? 16.246  -5.756  -35.199 1.00 0.00 ? 100 ILE A C    4  
ATOM 8305  O O    . ILE A 1 100 ? 15.789  -6.675  -34.565 1.00 0.00 ? 100 ILE A O    4  
ATOM 8306  C CB   . ILE A 1 100 ? 16.413  -3.559  -34.073 1.00 0.00 ? 100 ILE A CB   4  
ATOM 8307  C CG1  . ILE A 1 100 ? 16.143  -4.110  -32.682 1.00 0.00 ? 100 ILE A CG1  4  
ATOM 8308  C CG2  . ILE A 1 100 ? 15.942  -2.092  -34.124 1.00 0.00 ? 100 ILE A CG2  4  
ATOM 8309  C CD1  . ILE A 1 100 ? 17.068  -3.418  -31.681 1.00 0.00 ? 100 ILE A CD1  4  
ATOM 8310  H H    . ILE A 1 100 ? 13.934  -5.242  -34.105 1.00 0.00 ? 100 ILE A H    4  
ATOM 8311  H HA   . ILE A 1 100 ? 15.658  -3.893  -36.087 1.00 0.00 ? 100 ILE A HA   4  
ATOM 8312  H HB   . ILE A 1 100 ? 17.481  -3.636  -34.290 1.00 0.00 ? 100 ILE A HB   4  
ATOM 8313  H HG12 . ILE A 1 100 ? 15.114  -3.926  -32.415 1.00 0.00 ? 100 ILE A HG12 4  
ATOM 8314  H HG13 . ILE A 1 100 ? 16.326  -5.176  -32.672 1.00 0.00 ? 100 ILE A HG13 4  
ATOM 8315  H HG21 . ILE A 1 100 ? 15.975  -1.733  -35.142 1.00 0.00 ? 100 ILE A HG21 4  
ATOM 8316  H HG22 . ILE A 1 100 ? 14.932  -2.021  -33.756 1.00 0.00 ? 100 ILE A HG22 4  
ATOM 8317  H HG23 . ILE A 1 100 ? 16.587  -1.479  -33.511 1.00 0.00 ? 100 ILE A HG23 4  
ATOM 8318  H HD11 . ILE A 1 100 ? 18.079  -3.413  -32.062 1.00 0.00 ? 100 ILE A HD11 4  
ATOM 8319  H HD12 . ILE A 1 100 ? 16.743  -2.403  -31.525 1.00 0.00 ? 100 ILE A HD12 4  
ATOM 8320  H HD13 . ILE A 1 100 ? 17.048  -3.947  -30.738 1.00 0.00 ? 100 ILE A HD13 4  
ATOM 8321  N N    . SER A 1 101 ? 17.279  -5.889  -35.977 1.00 0.00 ? 101 SER A N    4  
ATOM 8322  C CA   . SER A 1 101 ? 17.912  -7.226  -36.098 1.00 0.00 ? 101 SER A CA   4  
ATOM 8323  C C    . SER A 1 101 ? 18.613  -7.611  -34.800 1.00 0.00 ? 101 SER A C    4  
ATOM 8324  O O    . SER A 1 101 ? 19.382  -6.843  -34.256 1.00 0.00 ? 101 SER A O    4  
ATOM 8325  C CB   . SER A 1 101 ? 18.954  -7.171  -37.224 1.00 0.00 ? 101 SER A CB   4  
ATOM 8326  O OG   . SER A 1 101 ? 18.250  -7.625  -38.371 1.00 0.00 ? 101 SER A OG   4  
ATOM 8327  H H    . SER A 1 101 ? 17.633  -5.122  -36.473 1.00 0.00 ? 101 SER A H    4  
ATOM 8328  H HA   . SER A 1 101 ? 17.138  -7.966  -36.317 1.00 0.00 ? 101 SER A HA   4  
ATOM 8329  H HB2  . SER A 1 101 ? 19.302  -6.160  -37.375 1.00 0.00 ? 101 SER A HB2  4  
ATOM 8330  H HB3  . SER A 1 101 ? 19.784  -7.829  -37.010 1.00 0.00 ? 101 SER A HB3  4  
ATOM 8331  H HG   . SER A 1 101 ? 18.433  -7.017  -39.090 1.00 0.00 ? 101 SER A HG   4  
ATOM 8332  N N    . ALA A 1 102 ? 18.334  -8.798  -34.326 1.00 0.00 ? 102 ALA A N    4  
ATOM 8333  C CA   . ALA A 1 102 ? 18.977  -9.243  -33.065 1.00 0.00 ? 102 ALA A CA   4  
ATOM 8334  C C    . ALA A 1 102 ? 20.491  -9.089  -33.149 1.00 0.00 ? 102 ALA A C    4  
ATOM 8335  O O    . ALA A 1 102 ? 21.168  -9.032  -32.142 1.00 0.00 ? 102 ALA A O    4  
ATOM 8336  C CB   . ALA A 1 102 ? 18.637  -10.720 -32.836 1.00 0.00 ? 102 ALA A CB   4  
ATOM 8337  H H    . ALA A 1 102 ? 17.707  -9.386  -34.797 1.00 0.00 ? 102 ALA A H    4  
ATOM 8338  H HA   . ALA A 1 102 ? 18.604  -8.629  -32.245 1.00 0.00 ? 102 ALA A HA   4  
ATOM 8339  H HB1  . ALA A 1 102 ? 17.586  -10.885 -33.023 1.00 0.00 ? 102 ALA A HB1  4  
ATOM 8340  H HB2  . ALA A 1 102 ? 19.218  -11.336 -33.504 1.00 0.00 ? 102 ALA A HB2  4  
ATOM 8341  H HB3  . ALA A 1 102 ? 18.864  -10.990 -31.815 1.00 0.00 ? 102 ALA A HB3  4  
ATOM 8342  N N    . ALA A 1 103 ? 21.002  -9.037  -34.350 1.00 0.00 ? 103 ALA A N    4  
ATOM 8343  C CA   . ALA A 1 103 ? 22.467  -8.885  -34.501 1.00 0.00 ? 103 ALA A CA   4  
ATOM 8344  C C    . ALA A 1 103 ? 22.885  -7.506  -34.028 1.00 0.00 ? 103 ALA A C    4  
ATOM 8345  O O    . ALA A 1 103 ? 23.610  -7.365  -33.057 1.00 0.00 ? 103 ALA A O    4  
ATOM 8346  C CB   . ALA A 1 103 ? 22.827  -9.036  -35.986 1.00 0.00 ? 103 ALA A CB   4  
ATOM 8347  H H    . ALA A 1 103 ? 20.424  -9.096  -35.139 1.00 0.00 ? 103 ALA A H    4  
ATOM 8348  H HA   . ALA A 1 103 ? 22.968  -9.637  -33.896 1.00 0.00 ? 103 ALA A HA   4  
ATOM 8349  H HB1  . ALA A 1 103 ? 22.391  -9.944  -36.376 1.00 0.00 ? 103 ALA A HB1  4  
ATOM 8350  H HB2  . ALA A 1 103 ? 22.445  -8.192  -36.542 1.00 0.00 ? 103 ALA A HB2  4  
ATOM 8351  H HB3  . ALA A 1 103 ? 23.900  -9.080  -36.098 1.00 0.00 ? 103 ALA A HB3  4  
ATOM 8352  N N    . GLU A 1 104 ? 22.420  -6.507  -34.720 1.00 0.00 ? 104 GLU A N    4  
ATOM 8353  C CA   . GLU A 1 104 ? 22.778  -5.136  -34.324 1.00 0.00 ? 104 GLU A CA   4  
ATOM 8354  C C    . GLU A 1 104 ? 22.455  -4.934  -32.855 1.00 0.00 ? 104 GLU A C    4  
ATOM 8355  O O    . GLU A 1 104 ? 23.149  -4.228  -32.153 1.00 0.00 ? 104 GLU A O    4  
ATOM 8356  C CB   . GLU A 1 104 ? 21.948  -4.152  -35.163 1.00 0.00 ? 104 GLU A CB   4  
ATOM 8357  C CG   . GLU A 1 104 ? 22.172  -4.450  -36.648 1.00 0.00 ? 104 GLU A CG   4  
ATOM 8358  C CD   . GLU A 1 104 ? 23.589  -4.030  -37.040 1.00 0.00 ? 104 GLU A CD   4  
ATOM 8359  O OE1  . GLU A 1 104 ? 23.804  -2.830  -37.091 1.00 0.00 ? 104 GLU A OE1  4  
ATOM 8360  O OE2  . GLU A 1 104 ? 24.378  -4.933  -37.267 1.00 0.00 ? 104 GLU A OE2  4  
ATOM 8361  H H    . GLU A 1 104 ? 21.842  -6.667  -35.493 1.00 0.00 ? 104 GLU A H    4  
ATOM 8362  H HA   . GLU A 1 104 ? 23.846  -4.983  -34.482 1.00 0.00 ? 104 GLU A HA   4  
ATOM 8363  H HB2  . GLU A 1 104 ? 20.902  -4.262  -34.923 1.00 0.00 ? 104 GLU A HB2  4  
ATOM 8364  H HB3  . GLU A 1 104 ? 22.257  -3.140  -34.945 1.00 0.00 ? 104 GLU A HB3  4  
ATOM 8365  H HG2  . GLU A 1 104 ? 22.049  -5.507  -36.832 1.00 0.00 ? 104 GLU A HG2  4  
ATOM 8366  H HG3  . GLU A 1 104 ? 21.458  -3.899  -37.243 1.00 0.00 ? 104 GLU A HG3  4  
ATOM 8367  N N    . LEU A 1 105 ? 21.399  -5.570  -32.412 1.00 0.00 ? 105 LEU A N    4  
ATOM 8368  C CA   . LEU A 1 105 ? 21.016  -5.432  -30.992 1.00 0.00 ? 105 LEU A CA   4  
ATOM 8369  C C    . LEU A 1 105 ? 22.162  -5.883  -30.104 1.00 0.00 ? 105 LEU A C    4  
ATOM 8370  O O    . LEU A 1 105 ? 22.556  -5.185  -29.196 1.00 0.00 ? 105 LEU A O    4  
ATOM 8371  C CB   . LEU A 1 105 ? 19.791  -6.318  -30.728 1.00 0.00 ? 105 LEU A CB   4  
ATOM 8372  C CG   . LEU A 1 105 ? 19.569  -6.438  -29.217 1.00 0.00 ? 105 LEU A CG   4  
ATOM 8373  C CD1  . LEU A 1 105 ? 18.098  -6.173  -28.907 1.00 0.00 ? 105 LEU A CD1  4  
ATOM 8374  C CD2  . LEU A 1 105 ? 19.932  -7.851  -28.766 1.00 0.00 ? 105 LEU A CD2  4  
ATOM 8375  H H    . LEU A 1 105 ? 20.870  -6.131  -33.016 1.00 0.00 ? 105 LEU A H    4  
ATOM 8376  H HA   . LEU A 1 105 ? 20.793  -4.385  -30.783 1.00 0.00 ? 105 LEU A HA   4  
ATOM 8377  H HB2  . LEU A 1 105 ? 18.919  -5.875  -31.188 1.00 0.00 ? 105 LEU A HB2  4  
ATOM 8378  H HB3  . LEU A 1 105 ? 19.954  -7.294  -31.147 1.00 0.00 ? 105 LEU A HB3  4  
ATOM 8379  H HG   . LEU A 1 105 ? 20.185  -5.722  -28.698 1.00 0.00 ? 105 LEU A HG   4  
ATOM 8380  H HD11 . LEU A 1 105 ? 17.480  -6.607  -29.678 1.00 0.00 ? 105 LEU A HD11 4  
ATOM 8381  H HD12 . LEU A 1 105 ? 17.842  -6.612  -27.955 1.00 0.00 ? 105 LEU A HD12 4  
ATOM 8382  H HD13 . LEU A 1 105 ? 17.921  -5.108  -28.868 1.00 0.00 ? 105 LEU A HD13 4  
ATOM 8383  H HD21 . LEU A 1 105 ? 20.940  -8.080  -29.074 1.00 0.00 ? 105 LEU A HD21 4  
ATOM 8384  H HD22 . LEU A 1 105 ? 19.863  -7.920  -27.690 1.00 0.00 ? 105 LEU A HD22 4  
ATOM 8385  H HD23 . LEU A 1 105 ? 19.252  -8.562  -29.212 1.00 0.00 ? 105 LEU A HD23 4  
ATOM 8386  N N    . ARG A 1 106 ? 22.682  -7.048  -30.367 1.00 0.00 ? 106 ARG A N    4  
ATOM 8387  C CA   . ARG A 1 106 ? 23.798  -7.515  -29.529 1.00 0.00 ? 106 ARG A CA   4  
ATOM 8388  C C    . ARG A 1 106 ? 24.839  -6.424  -29.464 1.00 0.00 ? 106 ARG A C    4  
ATOM 8389  O O    . ARG A 1 106 ? 25.506  -6.248  -28.465 1.00 0.00 ? 106 ARG A O    4  
ATOM 8390  C CB   . ARG A 1 106 ? 24.417  -8.768  -30.164 1.00 0.00 ? 106 ARG A CB   4  
ATOM 8391  C CG   . ARG A 1 106 ? 24.969  -9.669  -29.054 1.00 0.00 ? 106 ARG A CG   4  
ATOM 8392  C CD   . ARG A 1 106 ? 25.661  -10.879 -29.691 1.00 0.00 ? 106 ARG A CD   4  
ATOM 8393  N NE   . ARG A 1 106 ? 24.909  -11.280 -30.915 1.00 0.00 ? 106 ARG A NE   4  
ATOM 8394  C CZ   . ARG A 1 106 ? 25.552  -11.810 -31.920 1.00 0.00 ? 106 ARG A CZ   4  
ATOM 8395  N NH1  . ARG A 1 106 ? 26.763  -12.259 -31.730 1.00 0.00 ? 106 ARG A NH1  4  
ATOM 8396  N NH2  . ARG A 1 106 ? 24.961  -11.874 -33.083 1.00 0.00 ? 106 ARG A NH2  4  
ATOM 8397  H H    . ARG A 1 106 ? 22.340  -7.598  -31.104 1.00 0.00 ? 106 ARG A H    4  
ATOM 8398  H HA   . ARG A 1 106 ? 23.430  -7.717  -28.522 1.00 0.00 ? 106 ARG A HA   4  
ATOM 8399  H HB2  . ARG A 1 106 ? 23.664  -9.301  -30.725 1.00 0.00 ? 106 ARG A HB2  4  
ATOM 8400  H HB3  . ARG A 1 106 ? 25.217  -8.479  -30.829 1.00 0.00 ? 106 ARG A HB3  4  
ATOM 8401  H HG2  . ARG A 1 106 ? 25.681  -9.116  -28.456 1.00 0.00 ? 106 ARG A HG2  4  
ATOM 8402  H HG3  . ARG A 1 106 ? 24.160  -10.003 -28.420 1.00 0.00 ? 106 ARG A HG3  4  
ATOM 8403  H HD2  . ARG A 1 106 ? 26.675  -10.623 -29.962 1.00 0.00 ? 106 ARG A HD2  4  
ATOM 8404  H HD3  . ARG A 1 106 ? 25.676  -11.704 -28.993 1.00 0.00 ? 106 ARG A HD3  4  
ATOM 8405  H HE   . ARG A 1 106 ? 23.938  -11.146 -30.964 1.00 0.00 ? 106 ARG A HE   4  
ATOM 8406  H HH11 . ARG A 1 106 ? 27.183  -12.194 -30.824 1.00 0.00 ? 106 ARG A HH11 4  
ATOM 8407  H HH12 . ARG A 1 106 ? 27.270  -12.668 -32.488 1.00 0.00 ? 106 ARG A HH12 4  
ATOM 8408  H HH21 . ARG A 1 106 ? 24.034  -11.522 -33.193 1.00 0.00 ? 106 ARG A HH21 4  
ATOM 8409  H HH22 . ARG A 1 106 ? 25.439  -12.278 -33.864 1.00 0.00 ? 106 ARG A HH22 4  
ATOM 8410  N N    . HIS A 1 107 ? 24.960  -5.700  -30.549 1.00 0.00 ? 107 HIS A N    4  
ATOM 8411  C CA   . HIS A 1 107 ? 25.949  -4.608  -30.578 1.00 0.00 ? 107 HIS A CA   4  
ATOM 8412  C C    . HIS A 1 107 ? 25.421  -3.417  -29.791 1.00 0.00 ? 107 HIS A C    4  
ATOM 8413  O O    . HIS A 1 107 ? 26.176  -2.696  -29.168 1.00 0.00 ? 107 HIS A O    4  
ATOM 8414  C CB   . HIS A 1 107 ? 26.179  -4.181  -32.037 1.00 0.00 ? 107 HIS A CB   4  
ATOM 8415  C CG   . HIS A 1 107 ? 27.516  -3.440  -32.136 1.00 0.00 ? 107 HIS A CG   4  
ATOM 8416  N ND1  . HIS A 1 107 ? 28.591  -3.836  -31.636 1.00 0.00 ? 107 HIS A ND1  4  
ATOM 8417  C CD2  . HIS A 1 107 ? 27.819  -2.242  -32.756 1.00 0.00 ? 107 HIS A CD2  4  
ATOM 8418  C CE1  . HIS A 1 107 ? 29.538  -3.026  -31.866 1.00 0.00 ? 107 HIS A CE1  4  
ATOM 8419  N NE2  . HIS A 1 107 ? 29.141  -1.971  -32.581 1.00 0.00 ? 107 HIS A NE2  4  
ATOM 8420  H H    . HIS A 1 107 ? 24.402  -5.888  -31.337 1.00 0.00 ? 107 HIS A H    4  
ATOM 8421  H HA   . HIS A 1 107 ? 26.873  -4.955  -30.124 1.00 0.00 ? 107 HIS A HA   4  
ATOM 8422  H HB2  . HIS A 1 107 ? 26.205  -5.053  -32.676 1.00 0.00 ? 107 HIS A HB2  4  
ATOM 8423  H HB3  . HIS A 1 107 ? 25.385  -3.525  -32.357 1.00 0.00 ? 107 HIS A HB3  4  
ATOM 8424  H HD1  . HIS A 1 107 ? 28.688  -4.667  -31.127 1.00 0.00 ? 107 HIS A HD1  4  
ATOM 8425  H HD2  . HIS A 1 107 ? 27.118  -1.621  -33.296 1.00 0.00 ? 107 HIS A HD2  4  
ATOM 8426  H HE1  . HIS A 1 107 ? 30.552  -3.172  -31.523 1.00 0.00 ? 107 HIS A HE1  4  
ATOM 8427  N N    . VAL A 1 108 ? 24.118  -3.229  -29.831 1.00 0.00 ? 108 VAL A N    4  
ATOM 8428  C CA   . VAL A 1 108 ? 23.529  -2.089  -29.086 1.00 0.00 ? 108 VAL A CA   4  
ATOM 8429  C C    . VAL A 1 108 ? 23.836  -2.230  -27.605 1.00 0.00 ? 108 VAL A C    4  
ATOM 8430  O O    . VAL A 1 108 ? 23.965  -1.250  -26.898 1.00 0.00 ? 108 VAL A O    4  
ATOM 8431  C CB   . VAL A 1 108 ? 21.996  -2.097  -29.277 1.00 0.00 ? 108 VAL A CB   4  
ATOM 8432  C CG1  . VAL A 1 108 ? 21.357  -1.151  -28.258 1.00 0.00 ? 108 VAL A CG1  4  
ATOM 8433  C CG2  . VAL A 1 108 ? 21.654  -1.618  -30.686 1.00 0.00 ? 108 VAL A CG2  4  
ATOM 8434  H H    . VAL A 1 108 ? 23.546  -3.835  -30.345 1.00 0.00 ? 108 VAL A H    4  
ATOM 8435  H HA   . VAL A 1 108 ? 23.963  -1.161  -29.456 1.00 0.00 ? 108 VAL A HA   4  
ATOM 8436  H HB   . VAL A 1 108 ? 21.615  -3.085  -29.133 1.00 0.00 ? 108 VAL A HB   4  
ATOM 8437  H HG11 . VAL A 1 108 ? 21.992  -0.292  -28.109 1.00 0.00 ? 108 VAL A HG11 4  
ATOM 8438  H HG12 . VAL A 1 108 ? 20.393  -0.823  -28.620 1.00 0.00 ? 108 VAL A HG12 4  
ATOM 8439  H HG13 . VAL A 1 108 ? 21.226  -1.663  -27.317 1.00 0.00 ? 108 VAL A HG13 4  
ATOM 8440  H HG21 . VAL A 1 108 ? 22.241  -0.745  -30.928 1.00 0.00 ? 108 VAL A HG21 4  
ATOM 8441  H HG22 . VAL A 1 108 ? 21.868  -2.399  -31.398 1.00 0.00 ? 108 VAL A HG22 4  
ATOM 8442  H HG23 . VAL A 1 108 ? 20.604  -1.367  -30.740 1.00 0.00 ? 108 VAL A HG23 4  
ATOM 8443  N N    . MET A 1 109 ? 23.949  -3.457  -27.158 1.00 0.00 ? 109 MET A N    4  
ATOM 8444  C CA   . MET A 1 109 ? 24.248  -3.682  -25.726 1.00 0.00 ? 109 MET A CA   4  
ATOM 8445  C C    . MET A 1 109 ? 25.728  -3.463  -25.453 1.00 0.00 ? 109 MET A C    4  
ATOM 8446  O O    . MET A 1 109 ? 26.108  -3.039  -24.381 1.00 0.00 ? 109 MET A O    4  
ATOM 8447  C CB   . MET A 1 109 ? 23.886  -5.133  -25.377 1.00 0.00 ? 109 MET A CB   4  
ATOM 8448  C CG   . MET A 1 109 ? 22.461  -5.421  -25.849 1.00 0.00 ? 109 MET A CG   4  
ATOM 8449  S SD   . MET A 1 109 ? 21.507  -4.035  -26.519 1.00 0.00 ? 109 MET A SD   4  
ATOM 8450  C CE   . MET A 1 109 ? 21.234  -3.159  -24.956 1.00 0.00 ? 109 MET A CE   4  
ATOM 8451  H H    . MET A 1 109 ? 23.838  -4.222  -27.768 1.00 0.00 ? 109 MET A H    4  
ATOM 8452  H HA   . MET A 1 109 ? 23.669  -2.982  -25.126 1.00 0.00 ? 109 MET A HA   4  
ATOM 8453  H HB2  . MET A 1 109 ? 24.574  -5.808  -25.866 1.00 0.00 ? 109 MET A HB2  4  
ATOM 8454  H HB3  . MET A 1 109 ? 23.951  -5.276  -24.309 1.00 0.00 ? 109 MET A HB3  4  
ATOM 8455  H HG2  . MET A 1 109 ? 22.509  -6.185  -26.612 1.00 0.00 ? 109 MET A HG2  4  
ATOM 8456  H HG3  . MET A 1 109 ? 21.910  -5.828  -25.018 1.00 0.00 ? 109 MET A HG3  4  
ATOM 8457  H HE1  . MET A 1 109 ? 21.735  -3.684  -24.156 1.00 0.00 ? 109 MET A HE1  4  
ATOM 8458  H HE2  . MET A 1 109 ? 21.628  -2.157  -25.030 1.00 0.00 ? 109 MET A HE2  4  
ATOM 8459  H HE3  . MET A 1 109 ? 20.175  -3.114  -24.749 1.00 0.00 ? 109 MET A HE3  4  
ATOM 8460  N N    . THR A 1 110 ? 26.538  -3.759  -26.433 1.00 0.00 ? 110 THR A N    4  
ATOM 8461  C CA   . THR A 1 110 ? 27.995  -3.572  -26.250 1.00 0.00 ? 110 THR A CA   4  
ATOM 8462  C C    . THR A 1 110 ? 28.315  -2.108  -26.011 1.00 0.00 ? 110 THR A C    4  
ATOM 8463  O O    . THR A 1 110 ? 28.951  -1.756  -25.036 1.00 0.00 ? 110 THR A O    4  
ATOM 8464  C CB   . THR A 1 110 ? 28.707  -4.036  -27.523 1.00 0.00 ? 110 THR A CB   4  
ATOM 8465  O OG1  . THR A 1 110 ? 27.850  -4.998  -28.098 1.00 0.00 ? 110 THR A OG1  4  
ATOM 8466  C CG2  . THR A 1 110 ? 29.984  -4.816  -27.183 1.00 0.00 ? 110 THR A CG2  4  
ATOM 8467  H H    . THR A 1 110 ? 26.186  -4.099  -27.283 1.00 0.00 ? 110 THR A H    4  
ATOM 8468  H HA   . THR A 1 110 ? 28.321  -4.152  -25.391 1.00 0.00 ? 110 THR A HA   4  
ATOM 8469  H HB   . THR A 1 110 ? 28.885  -3.212  -28.211 1.00 0.00 ? 110 THR A HB   4  
ATOM 8470  H HG1  . THR A 1 110 ? 27.830  -5.763  -27.518 1.00 0.00 ? 110 THR A HG1  4  
ATOM 8471  H HG21 . THR A 1 110 ? 30.654  -4.188  -26.616 1.00 0.00 ? 110 THR A HG21 4  
ATOM 8472  H HG22 . THR A 1 110 ? 29.732  -5.688  -26.599 1.00 0.00 ? 110 THR A HG22 4  
ATOM 8473  H HG23 . THR A 1 110 ? 30.474  -5.129  -28.094 1.00 0.00 ? 110 THR A HG23 4  
ATOM 8474  N N    . ASN A 1 111 ? 27.866  -1.274  -26.905 1.00 0.00 ? 111 ASN A N    4  
ATOM 8475  C CA   . ASN A 1 111 ? 28.133  0.174   -26.746 1.00 0.00 ? 111 ASN A CA   4  
ATOM 8476  C C    . ASN A 1 111 ? 27.504  0.691   -25.461 1.00 0.00 ? 111 ASN A C    4  
ATOM 8477  O O    . ASN A 1 111 ? 28.109  1.451   -24.731 1.00 0.00 ? 111 ASN A O    4  
ATOM 8478  C CB   . ASN A 1 111 ? 27.509  0.915   -27.937 1.00 0.00 ? 111 ASN A CB   4  
ATOM 8479  C CG   . ASN A 1 111 ? 28.115  0.379   -29.235 1.00 0.00 ? 111 ASN A CG   4  
ATOM 8480  O OD1  . ASN A 1 111 ? 27.482  0.368   -30.271 1.00 0.00 ? 111 ASN A OD1  4  
ATOM 8481  N ND2  . ASN A 1 111 ? 29.338  -0.075  -29.222 1.00 0.00 ? 111 ASN A ND2  4  
ATOM 8482  H H    . ASN A 1 111 ? 27.357  -1.603  -27.674 1.00 0.00 ? 111 ASN A H    4  
ATOM 8483  H HA   . ASN A 1 111 ? 29.210  0.336   -26.707 1.00 0.00 ? 111 ASN A HA   4  
ATOM 8484  H HB2  . ASN A 1 111 ? 26.441  0.757   -27.950 1.00 0.00 ? 111 ASN A HB2  4  
ATOM 8485  H HB3  . ASN A 1 111 ? 27.714  1.973   -27.858 1.00 0.00 ? 111 ASN A HB3  4  
ATOM 8486  H HD21 . ASN A 1 111 ? 29.854  -0.069  -28.388 1.00 0.00 ? 111 ASN A HD21 4  
ATOM 8487  H HD22 . ASN A 1 111 ? 29.741  -0.423  -30.044 1.00 0.00 ? 111 ASN A HD22 4  
ATOM 8488  N N    . LEU A 1 112 ? 26.295  0.267   -25.203 1.00 0.00 ? 112 LEU A N    4  
ATOM 8489  C CA   . LEU A 1 112 ? 25.613  0.719   -23.976 1.00 0.00 ? 112 LEU A CA   4  
ATOM 8490  C C    . LEU A 1 112 ? 26.316  0.152   -22.758 1.00 0.00 ? 112 LEU A C    4  
ATOM 8491  O O    . LEU A 1 112 ? 27.004  0.854   -22.044 1.00 0.00 ? 112 LEU A O    4  
ATOM 8492  C CB   . LEU A 1 112 ? 24.170  0.191   -24.012 1.00 0.00 ? 112 LEU A CB   4  
ATOM 8493  C CG   . LEU A 1 112 ? 23.285  1.089   -23.158 1.00 0.00 ? 112 LEU A CG   4  
ATOM 8494  C CD1  . LEU A 1 112 ? 22.835  2.288   -23.997 1.00 0.00 ? 112 LEU A CD1  4  
ATOM 8495  C CD2  . LEU A 1 112 ? 22.053  0.300   -22.707 1.00 0.00 ? 112 LEU A CD2  4  
ATOM 8496  H H    . LEU A 1 112 ? 25.846  -0.350  -25.815 1.00 0.00 ? 112 LEU A H    4  
ATOM 8497  H HA   . LEU A 1 112 ? 25.633  1.807   -23.931 1.00 0.00 ? 112 LEU A HA   4  
ATOM 8498  H HB2  . LEU A 1 112 ? 23.809  0.190   -25.030 1.00 0.00 ? 112 LEU A HB2  4  
ATOM 8499  H HB3  . LEU A 1 112 ? 24.143  -0.817  -23.627 1.00 0.00 ? 112 LEU A HB3  4  
ATOM 8500  H HG   . LEU A 1 112 ? 23.838  1.427   -22.297 1.00 0.00 ? 112 LEU A HG   4  
ATOM 8501  H HD11 . LEU A 1 112 ? 22.484  1.948   -24.961 1.00 0.00 ? 112 LEU A HD11 4  
ATOM 8502  H HD12 . LEU A 1 112 ? 22.037  2.809   -23.491 1.00 0.00 ? 112 LEU A HD12 4  
ATOM 8503  H HD13 . LEU A 1 112 ? 23.665  2.964   -24.140 1.00 0.00 ? 112 LEU A HD13 4  
ATOM 8504  H HD21 . LEU A 1 112 ? 21.667  -0.277  -23.536 1.00 0.00 ? 112 LEU A HD21 4  
ATOM 8505  H HD22 . LEU A 1 112 ? 22.323  -0.369  -21.902 1.00 0.00 ? 112 LEU A HD22 4  
ATOM 8506  H HD23 . LEU A 1 112 ? 21.289  0.981   -22.364 1.00 0.00 ? 112 LEU A HD23 4  
ATOM 8507  N N    . GLY A 1 113 ? 26.127  -1.113  -22.546 1.00 0.00 ? 113 GLY A N    4  
ATOM 8508  C CA   . GLY A 1 113 ? 26.776  -1.768  -21.376 1.00 0.00 ? 113 GLY A CA   4  
ATOM 8509  C C    . GLY A 1 113 ? 26.172  -1.262  -20.068 1.00 0.00 ? 113 GLY A C    4  
ATOM 8510  O O    . GLY A 1 113 ? 26.849  -1.182  -19.063 1.00 0.00 ? 113 GLY A O    4  
ATOM 8511  H H    . GLY A 1 113 ? 25.554  -1.630  -23.149 1.00 0.00 ? 113 GLY A H    4  
ATOM 8512  H HA2  . GLY A 1 113 ? 26.634  -2.837  -21.443 1.00 0.00 ? 113 GLY A HA2  4  
ATOM 8513  H HA3  . GLY A 1 113 ? 27.834  -1.549  -21.387 1.00 0.00 ? 113 GLY A HA3  4  
ATOM 8514  N N    . GLU A 1 114 ? 24.912  -0.930  -20.106 1.00 0.00 ? 114 GLU A N    4  
ATOM 8515  C CA   . GLU A 1 114 ? 24.259  -0.430  -18.873 1.00 0.00 ? 114 GLU A CA   4  
ATOM 8516  C C    . GLU A 1 114 ? 24.635  -1.301  -17.686 1.00 0.00 ? 114 GLU A C    4  
ATOM 8517  O O    . GLU A 1 114 ? 25.191  -0.830  -16.714 1.00 0.00 ? 114 GLU A O    4  
ATOM 8518  C CB   . GLU A 1 114 ? 22.736  -0.489  -19.072 1.00 0.00 ? 114 GLU A CB   4  
ATOM 8519  C CG   . GLU A 1 114 ? 22.249  0.862   -19.597 1.00 0.00 ? 114 GLU A CG   4  
ATOM 8520  C CD   . GLU A 1 114 ? 21.971  1.794   -18.416 1.00 0.00 ? 114 GLU A CD   4  
ATOM 8521  O OE1  . GLU A 1 114 ? 20.938  1.593   -17.798 1.00 0.00 ? 114 GLU A OE1  4  
ATOM 8522  O OE2  . GLU A 1 114 ? 22.808  2.653   -18.196 1.00 0.00 ? 114 GLU A OE2  4  
ATOM 8523  H H    . GLU A 1 114 ? 24.403  -1.008  -20.941 1.00 0.00 ? 114 GLU A H    4  
ATOM 8524  H HA   . GLU A 1 114 ? 24.587  0.589   -18.685 1.00 0.00 ? 114 GLU A HA   4  
ATOM 8525  H HB2  . GLU A 1 114 ? 22.492  -1.265  -19.783 1.00 0.00 ? 114 GLU A HB2  4  
ATOM 8526  H HB3  . GLU A 1 114 ? 22.254  -0.707  -18.130 1.00 0.00 ? 114 GLU A HB3  4  
ATOM 8527  H HG2  . GLU A 1 114 ? 23.005  1.301   -20.229 1.00 0.00 ? 114 GLU A HG2  4  
ATOM 8528  H HG3  . GLU A 1 114 ? 21.341  0.726   -20.167 1.00 0.00 ? 114 GLU A HG3  4  
ATOM 8529  N N    . LYS A 1 115 ? 24.323  -2.558  -17.789 1.00 0.00 ? 115 LYS A N    4  
ATOM 8530  C CA   . LYS A 1 115 ? 24.648  -3.483  -16.688 1.00 0.00 ? 115 LYS A CA   4  
ATOM 8531  C C    . LYS A 1 115 ? 24.456  -4.932  -17.124 1.00 0.00 ? 115 LYS A C    4  
ATOM 8532  O O    . LYS A 1 115 ? 24.162  -5.794  -16.317 1.00 0.00 ? 115 LYS A O    4  
ATOM 8533  C CB   . LYS A 1 115 ? 23.718  -3.176  -15.524 1.00 0.00 ? 115 LYS A CB   4  
ATOM 8534  C CG   . LYS A 1 115 ? 22.280  -3.146  -16.022 1.00 0.00 ? 115 LYS A CG   4  
ATOM 8535  C CD   . LYS A 1 115 ? 21.397  -3.796  -14.972 1.00 0.00 ? 115 LYS A CD   4  
ATOM 8536  C CE   . LYS A 1 115 ? 19.958  -3.302  -15.143 1.00 0.00 ? 115 LYS A CE   4  
ATOM 8537  N NZ   . LYS A 1 115 ? 18.995  -4.420  -14.939 1.00 0.00 ? 115 LYS A NZ   4  
ATOM 8538  H H    . LYS A 1 115 ? 23.866  -2.885  -18.583 1.00 0.00 ? 115 LYS A H    4  
ATOM 8539  H HA   . LYS A 1 115 ? 25.677  -3.339  -16.398 1.00 0.00 ? 115 LYS A HA   4  
ATOM 8540  H HB2  . LYS A 1 115 ? 23.824  -3.936  -14.767 1.00 0.00 ? 115 LYS A HB2  4  
ATOM 8541  H HB3  . LYS A 1 115 ? 23.975  -2.217  -15.103 1.00 0.00 ? 115 LYS A HB3  4  
ATOM 8542  H HG2  . LYS A 1 115 ? 21.969  -2.124  -16.179 1.00 0.00 ? 115 LYS A HG2  4  
ATOM 8543  H HG3  . LYS A 1 115 ? 22.204  -3.690  -16.953 1.00 0.00 ? 115 LYS A HG3  4  
ATOM 8544  H HD2  . LYS A 1 115 ? 21.433  -4.869  -15.088 1.00 0.00 ? 115 LYS A HD2  4  
ATOM 8545  H HD3  . LYS A 1 115 ? 21.760  -3.534  -13.989 1.00 0.00 ? 115 LYS A HD3  4  
ATOM 8546  H HE2  . LYS A 1 115 ? 19.754  -2.524  -14.422 1.00 0.00 ? 115 LYS A HE2  4  
ATOM 8547  H HE3  . LYS A 1 115 ? 19.830  -2.902  -16.139 1.00 0.00 ? 115 LYS A HE3  4  
ATOM 8548  H HZ1  . LYS A 1 115 ? 19.492  -5.328  -15.041 1.00 0.00 ? 115 LYS A HZ1  4  
ATOM 8549  H HZ2  . LYS A 1 115 ? 18.583  -4.353  -13.987 1.00 0.00 ? 115 LYS A HZ2  4  
ATOM 8550  H HZ3  . LYS A 1 115 ? 18.237  -4.359  -15.651 1.00 0.00 ? 115 LYS A HZ3  4  
ATOM 8551  N N    . LEU A 1 116 ? 24.637  -5.166  -18.405 1.00 0.00 ? 116 LEU A N    4  
ATOM 8552  C CA   . LEU A 1 116 ? 24.475  -6.547  -18.945 1.00 0.00 ? 116 LEU A CA   4  
ATOM 8553  C C    . LEU A 1 116 ? 25.624  -6.897  -19.890 1.00 0.00 ? 116 LEU A C    4  
ATOM 8554  O O    . LEU A 1 116 ? 25.720  -6.363  -20.978 1.00 0.00 ? 116 LEU A O    4  
ATOM 8555  C CB   . LEU A 1 116 ? 23.155  -6.603  -19.731 1.00 0.00 ? 116 LEU A CB   4  
ATOM 8556  C CG   . LEU A 1 116 ? 22.002  -6.183  -18.809 1.00 0.00 ? 116 LEU A CG   4  
ATOM 8557  C CD1  . LEU A 1 116 ? 21.417  -4.858  -19.303 1.00 0.00 ? 116 LEU A CD1  4  
ATOM 8558  C CD2  . LEU A 1 116 ? 20.913  -7.258  -18.843 1.00 0.00 ? 116 LEU A CD2  4  
ATOM 8559  H H    . LEU A 1 116 ? 24.880  -4.432  -19.006 1.00 0.00 ? 116 LEU A H    4  
ATOM 8560  H HA   . LEU A 1 116 ? 24.467  -7.257  -18.123 1.00 0.00 ? 116 LEU A HA   4  
ATOM 8561  H HB2  . LEU A 1 116 ? 23.207  -5.932  -20.575 1.00 0.00 ? 116 LEU A HB2  4  
ATOM 8562  H HB3  . LEU A 1 116 ? 22.988  -7.608  -20.088 1.00 0.00 ? 116 LEU A HB3  4  
ATOM 8563  H HG   . LEU A 1 116 ? 22.366  -6.068  -17.801 1.00 0.00 ? 116 LEU A HG   4  
ATOM 8564  H HD11 . LEU A 1 116 ? 22.202  -4.120  -19.384 1.00 0.00 ? 116 LEU A HD11 4  
ATOM 8565  H HD12 . LEU A 1 116 ? 20.960  -4.999  -20.271 1.00 0.00 ? 116 LEU A HD12 4  
ATOM 8566  H HD13 . LEU A 1 116 ? 20.670  -4.506  -18.604 1.00 0.00 ? 116 LEU A HD13 4  
ATOM 8567  H HD21 . LEU A 1 116 ? 21.337  -8.218  -18.586 1.00 0.00 ? 116 LEU A HD21 4  
ATOM 8568  H HD22 . LEU A 1 116 ? 20.136  -7.012  -18.135 1.00 0.00 ? 116 LEU A HD22 4  
ATOM 8569  H HD23 . LEU A 1 116 ? 20.486  -7.313  -19.833 1.00 0.00 ? 116 LEU A HD23 4  
ATOM 8570  N N    . THR A 1 117 ? 26.472  -7.791  -19.454 1.00 0.00 ? 117 THR A N    4  
ATOM 8571  C CA   . THR A 1 117 ? 27.620  -8.191  -20.309 1.00 0.00 ? 117 THR A CA   4  
ATOM 8572  C C    . THR A 1 117 ? 27.158  -9.017  -21.502 1.00 0.00 ? 117 THR A C    4  
ATOM 8573  O O    . THR A 1 117 ? 25.976  -9.197  -21.717 1.00 0.00 ? 117 THR A O    4  
ATOM 8574  C CB   . THR A 1 117 ? 28.569  -9.043  -19.467 1.00 0.00 ? 117 THR A CB   4  
ATOM 8575  O OG1  . THR A 1 117 ? 27.738  -9.778  -18.590 1.00 0.00 ? 117 THR A OG1  4  
ATOM 8576  C CG2  . THR A 1 117 ? 29.420  -8.164  -18.547 1.00 0.00 ? 117 THR A CG2  4  
ATOM 8577  H H    . THR A 1 117 ? 26.352  -8.195  -18.567 1.00 0.00 ? 117 THR A H    4  
ATOM 8578  H HA   . THR A 1 117 ? 28.122  -7.294  -20.671 1.00 0.00 ? 117 THR A HA   4  
ATOM 8579  H HB   . THR A 1 117 ? 29.168  -9.710  -20.084 1.00 0.00 ? 117 THR A HB   4  
ATOM 8580  H HG1  . THR A 1 117 ? 28.049  -9.629  -17.693 1.00 0.00 ? 117 THR A HG1  4  
ATOM 8581  H HG21 . THR A 1 117 ? 28.817  -7.357  -18.156 1.00 0.00 ? 117 THR A HG21 4  
ATOM 8582  H HG22 . THR A 1 117 ? 29.796  -8.756  -17.726 1.00 0.00 ? 117 THR A HG22 4  
ATOM 8583  H HG23 . THR A 1 117 ? 30.249  -7.753  -19.101 1.00 0.00 ? 117 THR A HG23 4  
ATOM 8584  N N    . ASP A 1 118 ? 28.106  -9.508  -22.260 1.00 0.00 ? 118 ASP A N    4  
ATOM 8585  C CA   . ASP A 1 118 ? 27.741  -10.325 -23.440 1.00 0.00 ? 118 ASP A CA   4  
ATOM 8586  C C    . ASP A 1 118 ? 27.104  -11.632 -23.005 1.00 0.00 ? 118 ASP A C    4  
ATOM 8587  O O    . ASP A 1 118 ? 26.010  -11.959 -23.417 1.00 0.00 ? 118 ASP A O    4  
ATOM 8588  C CB   . ASP A 1 118 ? 29.019  -10.638 -24.237 1.00 0.00 ? 118 ASP A CB   4  
ATOM 8589  C CG   . ASP A 1 118 ? 29.944  -9.418  -24.219 1.00 0.00 ? 118 ASP A CG   4  
ATOM 8590  O OD1  . ASP A 1 118 ? 29.571  -8.446  -24.858 1.00 0.00 ? 118 ASP A OD1  4  
ATOM 8591  O OD2  . ASP A 1 118 ? 30.972  -9.527  -23.572 1.00 0.00 ? 118 ASP A OD2  4  
ATOM 8592  H H    . ASP A 1 118 ? 29.047  -9.337  -22.049 1.00 0.00 ? 118 ASP A H    4  
ATOM 8593  H HA   . ASP A 1 118 ? 27.030  -9.772  -24.048 1.00 0.00 ? 118 ASP A HA   4  
ATOM 8594  H HB2  . ASP A 1 118 ? 29.529  -11.480 -23.791 1.00 0.00 ? 118 ASP A HB2  4  
ATOM 8595  H HB3  . ASP A 1 118 ? 28.762  -10.877 -25.257 1.00 0.00 ? 118 ASP A HB3  4  
ATOM 8596  N N    . GLU A 1 119 ? 27.800  -12.362 -22.176 1.00 0.00 ? 119 GLU A N    4  
ATOM 8597  C CA   . GLU A 1 119 ? 27.239  -13.651 -21.707 1.00 0.00 ? 119 GLU A CA   4  
ATOM 8598  C C    . GLU A 1 119 ? 25.799  -13.463 -21.276 1.00 0.00 ? 119 GLU A C    4  
ATOM 8599  O O    . GLU A 1 119 ? 24.923  -14.204 -21.672 1.00 0.00 ? 119 GLU A O    4  
ATOM 8600  C CB   . GLU A 1 119 ? 28.063  -14.144 -20.503 1.00 0.00 ? 119 GLU A CB   4  
ATOM 8601  C CG   . GLU A 1 119 ? 29.240  -13.194 -20.271 1.00 0.00 ? 119 GLU A CG   4  
ATOM 8602  C CD   . GLU A 1 119 ? 30.017  -13.650 -19.033 1.00 0.00 ? 119 GLU A CD   4  
ATOM 8603  O OE1  . GLU A 1 119 ? 29.976  -14.842 -18.777 1.00 0.00 ? 119 GLU A OE1  4  
ATOM 8604  O OE2  . GLU A 1 119 ? 30.607  -12.781 -18.413 1.00 0.00 ? 119 GLU A OE2  4  
ATOM 8605  H H    . GLU A 1 119 ? 28.678  -12.060 -21.868 1.00 0.00 ? 119 GLU A H    4  
ATOM 8606  H HA   . GLU A 1 119 ? 27.271  -14.368 -22.522 1.00 0.00 ? 119 GLU A HA   4  
ATOM 8607  H HB2  . GLU A 1 119 ? 27.438  -14.169 -19.620 1.00 0.00 ? 119 GLU A HB2  4  
ATOM 8608  H HB3  . GLU A 1 119 ? 28.434  -15.138 -20.701 1.00 0.00 ? 119 GLU A HB3  4  
ATOM 8609  H HG2  . GLU A 1 119 ? 29.895  -13.206 -21.129 1.00 0.00 ? 119 GLU A HG2  4  
ATOM 8610  H HG3  . GLU A 1 119 ? 28.875  -12.189 -20.113 1.00 0.00 ? 119 GLU A HG3  4  
ATOM 8611  N N    . GLU A 1 120 ? 25.580  -12.470 -20.464 1.00 0.00 ? 120 GLU A N    4  
ATOM 8612  C CA   . GLU A 1 120 ? 24.204  -12.209 -19.993 1.00 0.00 ? 120 GLU A CA   4  
ATOM 8613  C C    . GLU A 1 120 ? 23.308  -11.909 -21.175 1.00 0.00 ? 120 GLU A C    4  
ATOM 8614  O O    . GLU A 1 120 ? 22.311  -12.570 -21.395 1.00 0.00 ? 120 GLU A O    4  
ATOM 8615  C CB   . GLU A 1 120 ? 24.236  -10.980 -19.069 1.00 0.00 ? 120 GLU A CB   4  
ATOM 8616  C CG   . GLU A 1 120 ? 23.546  -11.325 -17.754 1.00 0.00 ? 120 GLU A CG   4  
ATOM 8617  C CD   . GLU A 1 120 ? 22.031  -11.378 -17.974 1.00 0.00 ? 120 GLU A CD   4  
ATOM 8618  O OE1  . GLU A 1 120 ? 21.574  -10.587 -18.784 1.00 0.00 ? 120 GLU A OE1  4  
ATOM 8619  O OE2  . GLU A 1 120 ? 21.417  -12.204 -17.318 1.00 0.00 ? 120 GLU A OE2  4  
ATOM 8620  H H    . GLU A 1 120 ? 26.320  -11.901 -20.170 1.00 0.00 ? 120 GLU A H    4  
ATOM 8621  H HA   . GLU A 1 120 ? 23.830  -13.086 -19.469 1.00 0.00 ? 120 GLU A HA   4  
ATOM 8622  H HB2  . GLU A 1 120 ? 25.261  -10.699 -18.876 1.00 0.00 ? 120 GLU A HB2  4  
ATOM 8623  H HB3  . GLU A 1 120 ? 23.725  -10.153 -19.541 1.00 0.00 ? 120 GLU A HB3  4  
ATOM 8624  H HG2  . GLU A 1 120 ? 23.888  -12.285 -17.404 1.00 0.00 ? 120 GLU A HG2  4  
ATOM 8625  H HG3  . GLU A 1 120 ? 23.773  -10.572 -17.014 1.00 0.00 ? 120 GLU A HG3  4  
ATOM 8626  N N    . VAL A 1 121 ? 23.682  -10.909 -21.914 1.00 0.00 ? 121 VAL A N    4  
ATOM 8627  C CA   . VAL A 1 121 ? 22.872  -10.533 -23.097 1.00 0.00 ? 121 VAL A CA   4  
ATOM 8628  C C    . VAL A 1 121 ? 22.619  -11.744 -23.989 1.00 0.00 ? 121 VAL A C    4  
ATOM 8629  O O    . VAL A 1 121 ? 21.646  -11.790 -24.712 1.00 0.00 ? 121 VAL A O    4  
ATOM 8630  C CB   . VAL A 1 121 ? 23.652  -9.485  -23.903 1.00 0.00 ? 121 VAL A CB   4  
ATOM 8631  C CG1  . VAL A 1 121 ? 22.928  -9.226  -25.226 1.00 0.00 ? 121 VAL A CG1  4  
ATOM 8632  C CG2  . VAL A 1 121 ? 23.720  -8.184  -23.104 1.00 0.00 ? 121 VAL A CG2  4  
ATOM 8633  H H    . VAL A 1 121 ? 24.493  -10.402 -21.680 1.00 0.00 ? 121 VAL A H    4  
ATOM 8634  H HA   . VAL A 1 121 ? 21.918  -10.133 -22.763 1.00 0.00 ? 121 VAL A HA   4  
ATOM 8635  H HB   . VAL A 1 121 ? 24.648  -9.846  -24.097 1.00 0.00 ? 121 VAL A HB   4  
ATOM 8636  H HG11 . VAL A 1 121 ? 21.864  -9.159  -25.052 1.00 0.00 ? 121 VAL A HG11 4  
ATOM 8637  H HG12 . VAL A 1 121 ? 23.277  -8.300  -25.656 1.00 0.00 ? 121 VAL A HG12 4  
ATOM 8638  H HG13 . VAL A 1 121 ? 23.128  -10.034 -25.914 1.00 0.00 ? 121 VAL A HG13 4  
ATOM 8639  H HG21 . VAL A 1 121 ? 23.603  -8.397  -22.053 1.00 0.00 ? 121 VAL A HG21 4  
ATOM 8640  H HG22 . VAL A 1 121 ? 24.674  -7.706  -23.266 1.00 0.00 ? 121 VAL A HG22 4  
ATOM 8641  H HG23 . VAL A 1 121 ? 22.931  -7.520  -23.422 1.00 0.00 ? 121 VAL A HG23 4  
ATOM 8642  N N    . ASP A 1 122 ? 23.505  -12.705 -23.925 1.00 0.00 ? 122 ASP A N    4  
ATOM 8643  C CA   . ASP A 1 122 ? 23.322  -13.914 -24.765 1.00 0.00 ? 122 ASP A CA   4  
ATOM 8644  C C    . ASP A 1 122 ? 22.205  -14.789 -24.215 1.00 0.00 ? 122 ASP A C    4  
ATOM 8645  O O    . ASP A 1 122 ? 21.329  -15.211 -24.945 1.00 0.00 ? 122 ASP A O    4  
ATOM 8646  C CB   . ASP A 1 122 ? 24.632  -14.717 -24.753 1.00 0.00 ? 122 ASP A CB   4  
ATOM 8647  C CG   . ASP A 1 122 ? 24.601  -15.751 -25.883 1.00 0.00 ? 122 ASP A CG   4  
ATOM 8648  O OD1  . ASP A 1 122 ? 24.023  -16.798 -25.644 1.00 0.00 ? 122 ASP A OD1  4  
ATOM 8649  O OD2  . ASP A 1 122 ? 25.160  -15.435 -26.921 1.00 0.00 ? 122 ASP A OD2  4  
ATOM 8650  H H    . ASP A 1 122 ? 24.281  -12.628 -23.329 1.00 0.00 ? 122 ASP A H    4  
ATOM 8651  H HA   . ASP A 1 122 ? 23.065  -13.605 -25.778 1.00 0.00 ? 122 ASP A HA   4  
ATOM 8652  H HB2  . ASP A 1 122 ? 25.471  -14.053 -24.901 1.00 0.00 ? 122 ASP A HB2  4  
ATOM 8653  H HB3  . ASP A 1 122 ? 24.741  -15.227 -23.807 1.00 0.00 ? 122 ASP A HB3  4  
ATOM 8654  N N    . GLU A 1 123 ? 22.251  -15.046 -22.937 1.00 0.00 ? 123 GLU A N    4  
ATOM 8655  C CA   . GLU A 1 123 ? 21.198  -15.891 -22.330 1.00 0.00 ? 123 GLU A CA   4  
ATOM 8656  C C    . GLU A 1 123 ? 19.834  -15.233 -22.481 1.00 0.00 ? 123 GLU A C    4  
ATOM 8657  O O    . GLU A 1 123 ? 18.815  -15.894 -22.452 1.00 0.00 ? 123 GLU A O    4  
ATOM 8658  C CB   . GLU A 1 123 ? 21.506  -16.058 -20.834 1.00 0.00 ? 123 GLU A CB   4  
ATOM 8659  C CG   . GLU A 1 123 ? 21.063  -17.451 -20.384 1.00 0.00 ? 123 GLU A CG   4  
ATOM 8660  C CD   . GLU A 1 123 ? 19.546  -17.575 -20.540 1.00 0.00 ? 123 GLU A CD   4  
ATOM 8661  O OE1  . GLU A 1 123 ? 18.874  -16.706 -20.009 1.00 0.00 ? 123 GLU A OE1  4  
ATOM 8662  O OE2  . GLU A 1 123 ? 19.144  -18.532 -21.184 1.00 0.00 ? 123 GLU A OE2  4  
ATOM 8663  H H    . GLU A 1 123 ? 22.974  -14.681 -22.384 1.00 0.00 ? 123 GLU A H    4  
ATOM 8664  H HA   . GLU A 1 123 ? 21.183  -16.857 -22.834 1.00 0.00 ? 123 GLU A HA   4  
ATOM 8665  H HB2  . GLU A 1 123 ? 22.566  -15.941 -20.666 1.00 0.00 ? 123 GLU A HB2  4  
ATOM 8666  H HB3  . GLU A 1 123 ? 20.973  -15.307 -20.268 1.00 0.00 ? 123 GLU A HB3  4  
ATOM 8667  H HG2  . GLU A 1 123 ? 21.547  -18.203 -20.990 1.00 0.00 ? 123 GLU A HG2  4  
ATOM 8668  H HG3  . GLU A 1 123 ? 21.329  -17.603 -19.347 1.00 0.00 ? 123 GLU A HG3  4  
ATOM 8669  N N    . MET A 1 124 ? 19.838  -13.938 -22.639 1.00 0.00 ? 124 MET A N    4  
ATOM 8670  C CA   . MET A 1 124 ? 18.554  -13.222 -22.793 1.00 0.00 ? 124 MET A CA   4  
ATOM 8671  C C    . MET A 1 124 ? 18.145  -13.173 -24.254 1.00 0.00 ? 124 MET A C    4  
ATOM 8672  O O    . MET A 1 124 ? 17.046  -13.550 -24.608 1.00 0.00 ? 124 MET A O    4  
ATOM 8673  C CB   . MET A 1 124 ? 18.734  -11.787 -22.277 1.00 0.00 ? 124 MET A CB   4  
ATOM 8674  C CG   . MET A 1 124 ? 17.483  -11.376 -21.500 1.00 0.00 ? 124 MET A CG   4  
ATOM 8675  S SD   . MET A 1 124 ? 17.227  -9.609  -21.214 1.00 0.00 ? 124 MET A SD   4  
ATOM 8676  C CE   . MET A 1 124 ? 17.456  -9.075  -22.927 1.00 0.00 ? 124 MET A CE   4  
ATOM 8677  H H    . MET A 1 124 ? 20.683  -13.444 -22.657 1.00 0.00 ? 124 MET A H    4  
ATOM 8678  H HA   . MET A 1 124 ? 17.789  -13.745 -22.229 1.00 0.00 ? 124 MET A HA   4  
ATOM 8679  H HB2  . MET A 1 124 ? 19.596  -11.740 -21.629 1.00 0.00 ? 124 MET A HB2  4  
ATOM 8680  H HB3  . MET A 1 124 ? 18.880  -11.117 -23.112 1.00 0.00 ? 124 MET A HB3  4  
ATOM 8681  H HG2  . MET A 1 124 ? 16.619  -11.751 -22.032 1.00 0.00 ? 124 MET A HG2  4  
ATOM 8682  H HG3  . MET A 1 124 ? 17.511  -11.863 -20.537 1.00 0.00 ? 124 MET A HG3  4  
ATOM 8683  H HE1  . MET A 1 124 ? 17.068  -9.830  -23.596 1.00 0.00 ? 124 MET A HE1  4  
ATOM 8684  H HE2  . MET A 1 124 ? 16.928  -8.146  -23.090 1.00 0.00 ? 124 MET A HE2  4  
ATOM 8685  H HE3  . MET A 1 124 ? 18.509  -8.929  -23.123 1.00 0.00 ? 124 MET A HE3  4  
ATOM 8686  N N    . ILE A 1 125 ? 19.037  -12.709 -25.078 1.00 0.00 ? 125 ILE A N    4  
ATOM 8687  C CA   . ILE A 1 125 ? 18.716  -12.628 -26.518 1.00 0.00 ? 125 ILE A CA   4  
ATOM 8688  C C    . ILE A 1 125 ? 18.203  -13.972 -27.020 1.00 0.00 ? 125 ILE A C    4  
ATOM 8689  O O    . ILE A 1 125 ? 17.511  -14.046 -28.017 1.00 0.00 ? 125 ILE A O    4  
ATOM 8690  C CB   . ILE A 1 125 ? 19.991  -12.258 -27.281 1.00 0.00 ? 125 ILE A CB   4  
ATOM 8691  C CG1  . ILE A 1 125 ? 20.157  -10.744 -27.297 1.00 0.00 ? 125 ILE A CG1  4  
ATOM 8692  C CG2  . ILE A 1 125 ? 19.858  -12.752 -28.734 1.00 0.00 ? 125 ILE A CG2  4  
ATOM 8693  C CD1  . ILE A 1 125 ? 21.444  -10.385 -28.046 1.00 0.00 ? 125 ILE A CD1  4  
ATOM 8694  H H    . ILE A 1 125 ? 19.910  -12.416 -24.747 1.00 0.00 ? 125 ILE A H    4  
ATOM 8695  H HA   . ILE A 1 125 ? 17.944  -11.877 -26.666 1.00 0.00 ? 125 ILE A HA   4  
ATOM 8696  H HB   . ILE A 1 125 ? 20.852  -12.712 -26.789 1.00 0.00 ? 125 ILE A HB   4  
ATOM 8697  H HG12 . ILE A 1 125 ? 19.311  -10.291 -27.793 1.00 0.00 ? 125 ILE A HG12 4  
ATOM 8698  H HG13 . ILE A 1 125 ? 20.213  -10.375 -26.284 1.00 0.00 ? 125 ILE A HG13 4  
ATOM 8699  H HG21 . ILE A 1 125 ? 18.906  -12.440 -29.138 1.00 0.00 ? 125 ILE A HG21 4  
ATOM 8700  H HG22 . ILE A 1 125 ? 20.652  -12.339 -29.335 1.00 0.00 ? 125 ILE A HG22 4  
ATOM 8701  H HG23 . ILE A 1 125 ? 19.918  -13.830 -28.760 1.00 0.00 ? 125 ILE A HG23 4  
ATOM 8702  H HD11 . ILE A 1 125 ? 22.164  -11.180 -27.932 1.00 0.00 ? 125 ILE A HD11 4  
ATOM 8703  H HD12 . ILE A 1 125 ? 21.229  -10.247 -29.096 1.00 0.00 ? 125 ILE A HD12 4  
ATOM 8704  H HD13 . ILE A 1 125 ? 21.856  -9.471  -27.644 1.00 0.00 ? 125 ILE A HD13 4  
ATOM 8705  N N    . ARG A 1 126 ? 18.556  -15.015 -26.317 1.00 0.00 ? 126 ARG A N    4  
ATOM 8706  C CA   . ARG A 1 126 ? 18.103  -16.364 -26.731 1.00 0.00 ? 126 ARG A CA   4  
ATOM 8707  C C    . ARG A 1 126 ? 16.582  -16.443 -26.735 1.00 0.00 ? 126 ARG A C    4  
ATOM 8708  O O    . ARG A 1 126 ? 15.997  -17.104 -27.573 1.00 0.00 ? 126 ARG A O    4  
ATOM 8709  C CB   . ARG A 1 126 ? 18.648  -17.386 -25.722 1.00 0.00 ? 126 ARG A CB   4  
ATOM 8710  C CG   . ARG A 1 126 ? 18.934  -18.701 -26.447 1.00 0.00 ? 126 ARG A CG   4  
ATOM 8711  C CD   . ARG A 1 126 ? 17.608  -19.381 -26.798 1.00 0.00 ? 126 ARG A CD   4  
ATOM 8712  N NE   . ARG A 1 126 ? 17.768  -20.855 -26.664 1.00 0.00 ? 126 ARG A NE   4  
ATOM 8713  C CZ   . ARG A 1 126 ? 18.870  -21.420 -27.073 1.00 0.00 ? 126 ARG A CZ   4  
ATOM 8714  N NH1  . ARG A 1 126 ? 18.963  -21.792 -28.320 1.00 0.00 ? 126 ARG A NH1  4  
ATOM 8715  N NH2  . ARG A 1 126 ? 19.844  -21.592 -26.221 1.00 0.00 ? 126 ARG A NH2  4  
ATOM 8716  H H    . ARG A 1 126 ? 19.116  -14.907 -25.519 1.00 0.00 ? 126 ARG A H    4  
ATOM 8717  H HA   . ARG A 1 126 ? 18.473  -16.571 -27.734 1.00 0.00 ? 126 ARG A HA   4  
ATOM 8718  H HB2  . ARG A 1 126 ? 19.560  -17.010 -25.280 1.00 0.00 ? 126 ARG A HB2  4  
ATOM 8719  H HB3  . ARG A 1 126 ? 17.920  -17.553 -24.941 1.00 0.00 ? 126 ARG A HB3  4  
ATOM 8720  H HG2  . ARG A 1 126 ? 19.489  -18.502 -27.351 1.00 0.00 ? 126 ARG A HG2  4  
ATOM 8721  H HG3  . ARG A 1 126 ? 19.518  -19.349 -25.809 1.00 0.00 ? 126 ARG A HG3  4  
ATOM 8722  H HD2  . ARG A 1 126 ? 16.833  -19.043 -26.126 1.00 0.00 ? 126 ARG A HD2  4  
ATOM 8723  H HD3  . ARG A 1 126 ? 17.331  -19.142 -27.813 1.00 0.00 ? 126 ARG A HD3  4  
ATOM 8724  H HE   . ARG A 1 126 ? 17.052  -21.397 -26.272 1.00 0.00 ? 126 ARG A HE   4  
ATOM 8725  H HH11 . ARG A 1 126 ? 18.195  -21.644 -28.943 1.00 0.00 ? 126 ARG A HH11 4  
ATOM 8726  H HH12 . ARG A 1 126 ? 19.799  -22.226 -28.652 1.00 0.00 ? 126 ARG A HH12 4  
ATOM 8727  H HH21 . ARG A 1 126 ? 19.737  -21.293 -25.273 1.00 0.00 ? 126 ARG A HH21 4  
ATOM 8728  H HH22 . ARG A 1 126 ? 20.696  -22.022 -26.517 1.00 0.00 ? 126 ARG A HH22 4  
ATOM 8729  N N    . GLU A 1 127 ? 15.971  -15.761 -25.792 1.00 0.00 ? 127 GLU A N    4  
ATOM 8730  C CA   . GLU A 1 127 ? 14.487  -15.770 -25.708 1.00 0.00 ? 127 GLU A CA   4  
ATOM 8731  C C    . GLU A 1 127 ? 13.924  -14.363 -25.841 1.00 0.00 ? 127 GLU A C    4  
ATOM 8732  O O    . GLU A 1 127 ? 13.026  -13.982 -25.117 1.00 0.00 ? 127 GLU A O    4  
ATOM 8733  C CB   . GLU A 1 127 ? 14.092  -16.326 -24.334 1.00 0.00 ? 127 GLU A CB   4  
ATOM 8734  C CG   . GLU A 1 127 ? 12.588  -16.610 -24.324 1.00 0.00 ? 127 GLU A CG   4  
ATOM 8735  C CD   . GLU A 1 127 ? 11.931  -15.831 -23.180 1.00 0.00 ? 127 GLU A CD   4  
ATOM 8736  O OE1  . GLU A 1 127 ? 12.482  -15.899 -22.094 1.00 0.00 ? 127 GLU A OE1  4  
ATOM 8737  O OE2  . GLU A 1 127 ? 10.916  -15.214 -23.459 1.00 0.00 ? 127 GLU A OE2  4  
ATOM 8738  H H    . GLU A 1 127 ? 16.492  -15.251 -25.141 1.00 0.00 ? 127 GLU A H    4  
ATOM 8739  H HA   . GLU A 1 127 ? 14.082  -16.390 -26.507 1.00 0.00 ? 127 GLU A HA   4  
ATOM 8740  H HB2  . GLU A 1 127 ? 14.634  -17.240 -24.143 1.00 0.00 ? 127 GLU A HB2  4  
ATOM 8741  H HB3  . GLU A 1 127 ? 14.332  -15.604 -23.568 1.00 0.00 ? 127 GLU A HB3  4  
ATOM 8742  H HG2  . GLU A 1 127 ? 12.150  -16.302 -25.263 1.00 0.00 ? 127 GLU A HG2  4  
ATOM 8743  H HG3  . GLU A 1 127 ? 12.418  -17.666 -24.181 1.00 0.00 ? 127 GLU A HG3  4  
ATOM 8744  N N    . ALA A 1 128 ? 14.461  -13.608 -26.762 1.00 0.00 ? 128 ALA A N    4  
ATOM 8745  C CA   . ALA A 1 128 ? 13.959  -12.224 -26.945 1.00 0.00 ? 128 ALA A CA   4  
ATOM 8746  C C    . ALA A 1 128 ? 12.601  -12.237 -27.629 1.00 0.00 ? 128 ALA A C    4  
ATOM 8747  O O    . ALA A 1 128 ? 12.252  -11.318 -28.344 1.00 0.00 ? 128 ALA A O    4  
ATOM 8748  C CB   . ALA A 1 128 ? 14.956  -11.453 -27.826 1.00 0.00 ? 128 ALA A CB   4  
ATOM 8749  H H    . ALA A 1 128 ? 15.186  -13.952 -27.324 1.00 0.00 ? 128 ALA A H    4  
ATOM 8750  H HA   . ALA A 1 128 ? 13.857  -11.754 -25.970 1.00 0.00 ? 128 ALA A HA   4  
ATOM 8751  H HB1  . ALA A 1 128 ? 15.965  -11.727 -27.560 1.00 0.00 ? 128 ALA A HB1  4  
ATOM 8752  H HB2  . ALA A 1 128 ? 14.787  -11.689 -28.864 1.00 0.00 ? 128 ALA A HB2  4  
ATOM 8753  H HB3  . ALA A 1 128 ? 14.827  -10.391 -27.678 1.00 0.00 ? 128 ALA A HB3  4  
ATOM 8754  N N    . ASN A 1 129 ? 11.859  -13.283 -27.396 1.00 0.00 ? 129 ASN A N    4  
ATOM 8755  C CA   . ASN A 1 129 ? 10.518  -13.388 -28.018 1.00 0.00 ? 129 ASN A CA   4  
ATOM 8756  C C    . ASN A 1 129 ? 10.555  -12.941 -29.477 1.00 0.00 ? 129 ASN A C    4  
ATOM 8757  O O    . ASN A 1 129 ? 9.832   -12.049 -29.875 1.00 0.00 ? 129 ASN A O    4  
ATOM 8758  C CB   . ASN A 1 129 ? 9.558   -12.482 -27.235 1.00 0.00 ? 129 ASN A CB   4  
ATOM 8759  C CG   . ASN A 1 129 ? 9.132   -13.196 -25.948 1.00 0.00 ? 129 ASN A CG   4  
ATOM 8760  O OD1  . ASN A 1 129 ? 8.546   -14.260 -25.981 1.00 0.00 ? 129 ASN A OD1  4  
ATOM 8761  N ND2  . ASN A 1 129 ? 9.408   -12.648 -24.796 1.00 0.00 ? 129 ASN A ND2  4  
ATOM 8762  H H    . ASN A 1 129 ? 12.183  -13.994 -26.809 1.00 0.00 ? 129 ASN A H    4  
ATOM 8763  H HA   . ASN A 1 129 ? 10.191  -14.426 -27.974 1.00 0.00 ? 129 ASN A HA   4  
ATOM 8764  H HB2  . ASN A 1 129 ? 10.052  -11.555 -26.982 1.00 0.00 ? 129 ASN A HB2  4  
ATOM 8765  H HB3  . ASN A 1 129 ? 8.684   -12.270 -27.831 1.00 0.00 ? 129 ASN A HB3  4  
ATOM 8766  H HD21 . ASN A 1 129 ? 9.881   -11.791 -24.761 1.00 0.00 ? 129 ASN A HD21 4  
ATOM 8767  H HD22 . ASN A 1 129 ? 9.142   -13.094 -23.964 1.00 0.00 ? 129 ASN A HD22 4  
ATOM 8768  N N    . ILE A 1 130 ? 11.401  -13.570 -30.247 1.00 0.00 ? 130 ILE A N    4  
ATOM 8769  C CA   . ILE A 1 130 ? 11.498  -13.198 -31.680 1.00 0.00 ? 130 ILE A CA   4  
ATOM 8770  C C    . ILE A 1 130 ? 10.343  -13.803 -32.469 1.00 0.00 ? 130 ILE A C    4  
ATOM 8771  O O    . ILE A 1 130 ? 9.734   -14.764 -32.044 1.00 0.00 ? 130 ILE A O    4  
ATOM 8772  C CB   . ILE A 1 130 ? 12.814  -13.742 -32.233 1.00 0.00 ? 130 ILE A CB   4  
ATOM 8773  C CG1  . ILE A 1 130 ? 13.868  -13.754 -31.133 1.00 0.00 ? 130 ILE A CG1  4  
ATOM 8774  C CG2  . ILE A 1 130 ? 13.289  -12.812 -33.364 1.00 0.00 ? 130 ILE A CG2  4  
ATOM 8775  C CD1  . ILE A 1 130 ? 15.255  -13.943 -31.759 1.00 0.00 ? 130 ILE A CD1  4  
ATOM 8776  H H    . ILE A 1 130 ? 11.968  -14.280 -29.882 1.00 0.00 ? 130 ILE A H    4  
ATOM 8777  H HA   . ILE A 1 130 ? 11.459  -12.113 -31.768 1.00 0.00 ? 130 ILE A HA   4  
ATOM 8778  H HB   . ILE A 1 130 ? 12.659  -14.758 -32.600 1.00 0.00 ? 130 ILE A HB   4  
ATOM 8779  H HG12 . ILE A 1 130 ? 13.839  -12.819 -30.592 1.00 0.00 ? 130 ILE A HG12 4  
ATOM 8780  H HG13 . ILE A 1 130 ? 13.668  -14.565 -30.448 1.00 0.00 ? 130 ILE A HG13 4  
ATOM 8781  H HG21 . ILE A 1 130 ? 12.443  -12.501 -33.958 1.00 0.00 ? 130 ILE A HG21 4  
ATOM 8782  H HG22 . ILE A 1 130 ? 13.766  -11.940 -32.942 1.00 0.00 ? 130 ILE A HG22 4  
ATOM 8783  H HG23 . ILE A 1 130 ? 13.993  -13.334 -33.994 1.00 0.00 ? 130 ILE A HG23 4  
ATOM 8784  H HD11 . ILE A 1 130 ? 15.236  -14.779 -32.442 1.00 0.00 ? 130 ILE A HD11 4  
ATOM 8785  H HD12 . ILE A 1 130 ? 15.536  -13.052 -32.298 1.00 0.00 ? 130 ILE A HD12 4  
ATOM 8786  H HD13 . ILE A 1 130 ? 15.982  -14.134 -30.983 1.00 0.00 ? 130 ILE A HD13 4  
ATOM 8787  N N    . ASP A 1 131 ? 10.063  -13.233 -33.609 1.00 0.00 ? 131 ASP A N    4  
ATOM 8788  C CA   . ASP A 1 131 ? 8.951   -13.765 -34.434 1.00 0.00 ? 131 ASP A CA   4  
ATOM 8789  C C    . ASP A 1 131 ? 9.323   -15.113 -35.043 1.00 0.00 ? 131 ASP A C    4  
ATOM 8790  O O    . ASP A 1 131 ? 8.485   -15.977 -35.200 1.00 0.00 ? 131 ASP A O    4  
ATOM 8791  C CB   . ASP A 1 131 ? 8.668   -12.769 -35.570 1.00 0.00 ? 131 ASP A CB   4  
ATOM 8792  C CG   . ASP A 1 131 ? 8.113   -11.470 -34.979 1.00 0.00 ? 131 ASP A CG   4  
ATOM 8793  O OD1  . ASP A 1 131 ? 8.738   -10.986 -34.050 1.00 0.00 ? 131 ASP A OD1  4  
ATOM 8794  O OD2  . ASP A 1 131 ? 7.094   -11.034 -35.492 1.00 0.00 ? 131 ASP A OD2  4  
ATOM 8795  H H    . ASP A 1 131 ? 10.582  -12.460 -33.916 1.00 0.00 ? 131 ASP A H    4  
ATOM 8796  H HA   . ASP A 1 131 ? 8.074   -13.892 -33.803 1.00 0.00 ? 131 ASP A HA   4  
ATOM 8797  H HB2  . ASP A 1 131 ? 9.581   -12.555 -36.105 1.00 0.00 ? 131 ASP A HB2  4  
ATOM 8798  H HB3  . ASP A 1 131 ? 7.944   -13.188 -36.252 1.00 0.00 ? 131 ASP A HB3  4  
ATOM 8799  N N    . GLY A 1 132 ? 10.576  -15.267 -35.373 1.00 0.00 ? 132 GLY A N    4  
ATOM 8800  C CA   . GLY A 1 132 ? 11.020  -16.558 -35.974 1.00 0.00 ? 132 GLY A CA   4  
ATOM 8801  C C    . GLY A 1 132 ? 12.217  -16.329 -36.897 1.00 0.00 ? 132 GLY A C    4  
ATOM 8802  O O    . GLY A 1 132 ? 12.975  -17.236 -37.174 1.00 0.00 ? 132 GLY A O    4  
ATOM 8803  H H    . GLY A 1 132 ? 11.219  -14.543 -35.226 1.00 0.00 ? 132 GLY A H    4  
ATOM 8804  H HA2  . GLY A 1 132 ? 11.301  -17.242 -35.187 1.00 0.00 ? 132 GLY A HA2  4  
ATOM 8805  H HA3  . GLY A 1 132 ? 10.207  -16.985 -36.543 1.00 0.00 ? 132 GLY A HA3  4  
ATOM 8806  N N    . ASP A 1 133 ? 12.359  -15.116 -37.355 1.00 0.00 ? 133 ASP A N    4  
ATOM 8807  C CA   . ASP A 1 133 ? 13.493  -14.803 -38.256 1.00 0.00 ? 133 ASP A CA   4  
ATOM 8808  C C    . ASP A 1 133 ? 14.682  -14.281 -37.461 1.00 0.00 ? 133 ASP A C    4  
ATOM 8809  O O    . ASP A 1 133 ? 15.610  -15.010 -37.170 1.00 0.00 ? 133 ASP A O    4  
ATOM 8810  C CB   . ASP A 1 133 ? 13.040  -13.712 -39.239 1.00 0.00 ? 133 ASP A CB   4  
ATOM 8811  C CG   . ASP A 1 133 ? 12.151  -14.338 -40.316 1.00 0.00 ? 133 ASP A CG   4  
ATOM 8812  O OD1  . ASP A 1 133 ? 12.487  -15.438 -40.723 1.00 0.00 ? 133 ASP A OD1  4  
ATOM 8813  O OD2  . ASP A 1 133 ? 11.187  -13.680 -40.672 1.00 0.00 ? 133 ASP A OD2  4  
ATOM 8814  H H    . ASP A 1 133 ? 11.720  -14.415 -37.104 1.00 0.00 ? 133 ASP A H    4  
ATOM 8815  H HA   . ASP A 1 133 ? 13.787  -15.708 -38.788 1.00 0.00 ? 133 ASP A HA   4  
ATOM 8816  H HB2  . ASP A 1 133 ? 12.480  -12.954 -38.711 1.00 0.00 ? 133 ASP A HB2  4  
ATOM 8817  H HB3  . ASP A 1 133 ? 13.903  -13.259 -39.706 1.00 0.00 ? 133 ASP A HB3  4  
ATOM 8818  N N    . GLY A 1 134 ? 14.629  -13.023 -37.125 1.00 0.00 ? 134 GLY A N    4  
ATOM 8819  C CA   . GLY A 1 134 ? 15.746  -12.421 -36.347 1.00 0.00 ? 134 GLY A CA   4  
ATOM 8820  C C    . GLY A 1 134 ? 15.348  -11.027 -35.864 1.00 0.00 ? 134 GLY A C    4  
ATOM 8821  O O    . GLY A 1 134 ? 16.125  -10.333 -35.238 1.00 0.00 ? 134 GLY A O    4  
ATOM 8822  H H    . GLY A 1 134 ? 13.858  -12.477 -37.386 1.00 0.00 ? 134 GLY A H    4  
ATOM 8823  H HA2  . GLY A 1 134 ? 15.967  -13.045 -35.495 1.00 0.00 ? 134 GLY A HA2  4  
ATOM 8824  H HA3  . GLY A 1 134 ? 16.622  -12.347 -36.974 1.00 0.00 ? 134 GLY A HA3  4  
ATOM 8825  N N    . GLN A 1 135 ? 14.136  -10.646 -36.168 1.00 0.00 ? 135 GLN A N    4  
ATOM 8826  C CA   . GLN A 1 135 ? 13.660  -9.309  -35.743 1.00 0.00 ? 135 GLN A CA   4  
ATOM 8827  C C    . GLN A 1 135 ? 13.304  -9.304  -34.261 1.00 0.00 ? 135 GLN A C    4  
ATOM 8828  O O    . GLN A 1 135 ? 12.507  -10.104 -33.811 1.00 0.00 ? 135 GLN A O    4  
ATOM 8829  C CB   . GLN A 1 135 ? 12.401  -8.965  -36.554 1.00 0.00 ? 135 GLN A CB   4  
ATOM 8830  C CG   . GLN A 1 135 ? 12.816  -8.420  -37.922 1.00 0.00 ? 135 GLN A CG   4  
ATOM 8831  C CD   . GLN A 1 135 ? 11.580  -8.286  -38.812 1.00 0.00 ? 135 GLN A CD   4  
ATOM 8832  O OE1  . GLN A 1 135 ? 10.496  -8.704  -38.454 1.00 0.00 ? 135 GLN A OE1  4  
ATOM 8833  N NE2  . GLN A 1 135 ? 11.698  -7.711  -39.977 1.00 0.00 ? 135 GLN A NE2  4  
ATOM 8834  H H    . GLN A 1 135 ? 13.545  -11.241 -36.675 1.00 0.00 ? 135 GLN A H    4  
ATOM 8835  H HA   . GLN A 1 135 ? 14.452  -8.577  -35.923 1.00 0.00 ? 135 GLN A HA   4  
ATOM 8836  H HB2  . GLN A 1 135 ? 11.800  -9.853  -36.686 1.00 0.00 ? 135 GLN A HB2  4  
ATOM 8837  H HB3  . GLN A 1 135 ? 11.822  -8.221  -36.028 1.00 0.00 ? 135 GLN A HB3  4  
ATOM 8838  H HG2  . GLN A 1 135 ? 13.277  -7.451  -37.805 1.00 0.00 ? 135 GLN A HG2  4  
ATOM 8839  H HG3  . GLN A 1 135 ? 13.519  -9.096  -38.387 1.00 0.00 ? 135 GLN A HG3  4  
ATOM 8840  H HE21 . GLN A 1 135 ? 12.570  -7.373  -40.270 1.00 0.00 ? 135 GLN A HE21 4  
ATOM 8841  H HE22 . GLN A 1 135 ? 10.914  -7.618  -40.558 1.00 0.00 ? 135 GLN A HE22 4  
ATOM 8842  N N    . VAL A 1 136 ? 13.904  -8.395  -33.537 1.00 0.00 ? 136 VAL A N    4  
ATOM 8843  C CA   . VAL A 1 136 ? 13.631  -8.299  -32.079 1.00 0.00 ? 136 VAL A CA   4  
ATOM 8844  C C    . VAL A 1 136 ? 12.938  -6.994  -31.742 1.00 0.00 ? 136 VAL A C    4  
ATOM 8845  O O    . VAL A 1 136 ? 13.476  -5.927  -31.965 1.00 0.00 ? 136 VAL A O    4  
ATOM 8846  C CB   . VAL A 1 136 ? 14.971  -8.331  -31.332 1.00 0.00 ? 136 VAL A CB   4  
ATOM 8847  C CG1  . VAL A 1 136 ? 14.712  -8.530  -29.838 1.00 0.00 ? 136 VAL A CG1  4  
ATOM 8848  C CG2  . VAL A 1 136 ? 15.812  -9.490  -31.853 1.00 0.00 ? 136 VAL A CG2  4  
ATOM 8849  H H    . VAL A 1 136 ? 14.529  -7.780  -33.953 1.00 0.00 ? 136 VAL A H    4  
ATOM 8850  H HA   . VAL A 1 136 ? 13.000  -9.127  -31.769 1.00 0.00 ? 136 VAL A HA   4  
ATOM 8851  H HB   . VAL A 1 136 ? 15.495  -7.402  -31.490 1.00 0.00 ? 136 VAL A HB   4  
ATOM 8852  H HG11 . VAL A 1 136 ? 14.157  -9.443  -29.684 1.00 0.00 ? 136 VAL A HG11 4  
ATOM 8853  H HG12 . VAL A 1 136 ? 15.652  -8.591  -29.310 1.00 0.00 ? 136 VAL A HG12 4  
ATOM 8854  H HG13 . VAL A 1 136 ? 14.142  -7.698  -29.453 1.00 0.00 ? 136 VAL A HG13 4  
ATOM 8855  H HG21 . VAL A 1 136 ? 15.947  -9.391  -32.920 1.00 0.00 ? 136 VAL A HG21 4  
ATOM 8856  H HG22 . VAL A 1 136 ? 16.778  -9.484  -31.370 1.00 0.00 ? 136 VAL A HG22 4  
ATOM 8857  H HG23 . VAL A 1 136 ? 15.314  -10.423 -31.641 1.00 0.00 ? 136 VAL A HG23 4  
ATOM 8858  N N    . ASN A 1 137 ? 11.755  -7.092  -31.211 1.00 0.00 ? 137 ASN A N    4  
ATOM 8859  C CA   . ASN A 1 137 ? 11.024  -5.862  -30.857 1.00 0.00 ? 137 ASN A CA   4  
ATOM 8860  C C    . ASN A 1 137 ? 11.725  -5.193  -29.685 1.00 0.00 ? 137 ASN A C    4  
ATOM 8861  O O    . ASN A 1 137 ? 11.310  -5.314  -28.549 1.00 0.00 ? 137 ASN A O    4  
ATOM 8862  C CB   . ASN A 1 137 ? 9.593   -6.255  -30.450 1.00 0.00 ? 137 ASN A CB   4  
ATOM 8863  C CG   . ASN A 1 137 ? 9.578   -7.721  -30.020 1.00 0.00 ? 137 ASN A CG   4  
ATOM 8864  O OD1  . ASN A 1 137 ? 9.196   -8.596  -30.772 1.00 0.00 ? 137 ASN A OD1  4  
ATOM 8865  N ND2  . ASN A 1 137 ? 9.981   -8.033  -28.818 1.00 0.00 ? 137 ASN A ND2  4  
ATOM 8866  H H    . ASN A 1 137 ? 11.357  -7.972  -31.048 1.00 0.00 ? 137 ASN A H    4  
ATOM 8867  H HA   . ASN A 1 137 ? 11.021  -5.183  -31.712 1.00 0.00 ? 137 ASN A HA   4  
ATOM 8868  H HB2  . ASN A 1 137 ? 9.263   -5.647  -29.633 1.00 0.00 ? 137 ASN A HB2  4  
ATOM 8869  H HB3  . ASN A 1 137 ? 8.927   -6.121  -31.284 1.00 0.00 ? 137 ASN A HB3  4  
ATOM 8870  H HD21 . ASN A 1 137 ? 10.287  -7.331  -28.206 1.00 0.00 ? 137 ASN A HD21 4  
ATOM 8871  H HD22 . ASN A 1 137 ? 9.979   -8.969  -28.528 1.00 0.00 ? 137 ASN A HD22 4  
ATOM 8872  N N    . TYR A 1 138 ? 12.790  -4.503  -29.986 1.00 0.00 ? 138 TYR A N    4  
ATOM 8873  C CA   . TYR A 1 138 ? 13.540  -3.823  -28.916 1.00 0.00 ? 138 TYR A CA   4  
ATOM 8874  C C    . TYR A 1 138 ? 12.618  -3.142  -27.905 1.00 0.00 ? 138 TYR A C    4  
ATOM 8875  O O    . TYR A 1 138 ? 12.955  -3.034  -26.749 1.00 0.00 ? 138 TYR A O    4  
ATOM 8876  C CB   . TYR A 1 138 ? 14.465  -2.781  -29.538 1.00 0.00 ? 138 TYR A CB   4  
ATOM 8877  C CG   . TYR A 1 138 ? 13.651  -1.604  -30.051 1.00 0.00 ? 138 TYR A CG   4  
ATOM 8878  C CD1  . TYR A 1 138 ? 13.266  -0.596  -29.197 1.00 0.00 ? 138 TYR A CD1  4  
ATOM 8879  C CD2  . TYR A 1 138 ? 13.316  -1.517  -31.381 1.00 0.00 ? 138 TYR A CD2  4  
ATOM 8880  C CE1  . TYR A 1 138 ? 12.560  0.488   -29.669 1.00 0.00 ? 138 TYR A CE1  4  
ATOM 8881  C CE2  . TYR A 1 138 ? 12.613  -0.434  -31.856 1.00 0.00 ? 138 TYR A CE2  4  
ATOM 8882  C CZ   . TYR A 1 138 ? 12.225  0.577   -31.003 1.00 0.00 ? 138 TYR A CZ   4  
ATOM 8883  O OH   . TYR A 1 138 ? 11.517  1.663   -31.477 1.00 0.00 ? 138 TYR A OH   4  
ATOM 8884  H H    . TYR A 1 138 ? 13.089  -4.437  -30.918 1.00 0.00 ? 138 TYR A H    4  
ATOM 8885  H HA   . TYR A 1 138 ? 14.126  -4.571  -28.395 1.00 0.00 ? 138 TYR A HA   4  
ATOM 8886  H HB2  . TYR A 1 138 ? 15.161  -2.432  -28.797 1.00 0.00 ? 138 TYR A HB2  4  
ATOM 8887  H HB3  . TYR A 1 138 ? 15.009  -3.219  -30.355 1.00 0.00 ? 138 TYR A HB3  4  
ATOM 8888  H HD1  . TYR A 1 138 ? 13.520  -0.654  -28.149 1.00 0.00 ? 138 TYR A HD1  4  
ATOM 8889  H HD2  . TYR A 1 138 ? 13.603  -2.307  -32.056 1.00 0.00 ? 138 TYR A HD2  4  
ATOM 8890  H HE1  . TYR A 1 138 ? 12.267  1.268   -28.991 1.00 0.00 ? 138 TYR A HE1  4  
ATOM 8891  H HE2  . TYR A 1 138 ? 12.372  -0.373  -32.900 1.00 0.00 ? 138 TYR A HE2  4  
ATOM 8892  H HH   . TYR A 1 138 ? 12.124  2.222   -31.965 1.00 0.00 ? 138 TYR A HH   4  
ATOM 8893  N N    . GLU A 1 139 ? 11.474  -2.687  -28.350 1.00 0.00 ? 139 GLU A N    4  
ATOM 8894  C CA   . GLU A 1 139 ? 10.552  -2.019  -27.389 1.00 0.00 ? 139 GLU A CA   4  
ATOM 8895  C C    . GLU A 1 139 ? 10.274  -2.940  -26.208 1.00 0.00 ? 139 GLU A C    4  
ATOM 8896  O O    . GLU A 1 139 ? 10.276  -2.512  -25.073 1.00 0.00 ? 139 GLU A O    4  
ATOM 8897  C CB   . GLU A 1 139 ? 9.230   -1.698  -28.104 1.00 0.00 ? 139 GLU A CB   4  
ATOM 8898  C CG   . GLU A 1 139 ? 8.440   -2.983  -28.284 1.00 0.00 ? 139 GLU A CG   4  
ATOM 8899  C CD   . GLU A 1 139 ? 7.267   -2.732  -29.236 1.00 0.00 ? 139 GLU A CD   4  
ATOM 8900  O OE1  . GLU A 1 139 ? 7.004   -1.564  -29.474 1.00 0.00 ? 139 GLU A OE1  4  
ATOM 8901  O OE2  . GLU A 1 139 ? 6.701   -3.720  -29.669 1.00 0.00 ? 139 GLU A OE2  4  
ATOM 8902  H H    . GLU A 1 139 ? 11.231  -2.781  -29.293 1.00 0.00 ? 139 GLU A H    4  
ATOM 8903  H HA   . GLU A 1 139 ? 11.027  -1.107  -27.018 1.00 0.00 ? 139 GLU A HA   4  
ATOM 8904  H HB2  . GLU A 1 139 ? 8.657   -1.000  -27.513 1.00 0.00 ? 139 GLU A HB2  4  
ATOM 8905  H HB3  . GLU A 1 139 ? 9.436   -1.260  -29.070 1.00 0.00 ? 139 GLU A HB3  4  
ATOM 8906  H HG2  . GLU A 1 139 ? 9.078   -3.739  -28.698 1.00 0.00 ? 139 GLU A HG2  4  
ATOM 8907  H HG3  . GLU A 1 139 ? 8.062   -3.318  -27.331 1.00 0.00 ? 139 GLU A HG3  4  
ATOM 8908  N N    . GLU A 1 140 ? 10.028  -4.193  -26.494 1.00 0.00 ? 140 GLU A N    4  
ATOM 8909  C CA   . GLU A 1 140 ? 9.755   -5.143  -25.389 1.00 0.00 ? 140 GLU A CA   4  
ATOM 8910  C C    . GLU A 1 140 ? 11.066  -5.462  -24.693 1.00 0.00 ? 140 GLU A C    4  
ATOM 8911  O O    . GLU A 1 140 ? 11.116  -5.687  -23.501 1.00 0.00 ? 140 GLU A O    4  
ATOM 8912  C CB   . GLU A 1 140 ? 9.174   -6.443  -25.976 1.00 0.00 ? 140 GLU A CB   4  
ATOM 8913  C CG   . GLU A 1 140 ? 7.956   -6.114  -26.840 1.00 0.00 ? 140 GLU A CG   4  
ATOM 8914  C CD   . GLU A 1 140 ? 6.915   -5.383  -25.990 1.00 0.00 ? 140 GLU A CD   4  
ATOM 8915  O OE1  . GLU A 1 140 ? 6.839   -5.721  -24.821 1.00 0.00 ? 140 GLU A OE1  4  
ATOM 8916  O OE2  . GLU A 1 140 ? 6.253   -4.529  -26.559 1.00 0.00 ? 140 GLU A OE2  4  
ATOM 8917  H H    . GLU A 1 140 ? 10.023  -4.498  -27.425 1.00 0.00 ? 140 GLU A H    4  
ATOM 8918  H HA   . GLU A 1 140 ? 9.067   -4.684  -24.677 1.00 0.00 ? 140 GLU A HA   4  
ATOM 8919  H HB2  . GLU A 1 140 ? 9.923   -6.935  -26.579 1.00 0.00 ? 140 GLU A HB2  4  
ATOM 8920  H HB3  . GLU A 1 140 ? 8.880   -7.101  -25.173 1.00 0.00 ? 140 GLU A HB3  4  
ATOM 8921  H HG2  . GLU A 1 140 ? 8.250   -5.484  -27.664 1.00 0.00 ? 140 GLU A HG2  4  
ATOM 8922  H HG3  . GLU A 1 140 ? 7.525   -7.027  -27.224 1.00 0.00 ? 140 GLU A HG3  4  
ATOM 8923  N N    . PHE A 1 141 ? 12.109  -5.467  -25.477 1.00 0.00 ? 141 PHE A N    4  
ATOM 8924  C CA   . PHE A 1 141 ? 13.457  -5.759  -24.939 1.00 0.00 ? 141 PHE A CA   4  
ATOM 8925  C C    . PHE A 1 141 ? 13.907  -4.633  -24.021 1.00 0.00 ? 141 PHE A C    4  
ATOM 8926  O O    . PHE A 1 141 ? 14.708  -4.829  -23.129 1.00 0.00 ? 141 PHE A O    4  
ATOM 8927  C CB   . PHE A 1 141 ? 14.408  -5.814  -26.142 1.00 0.00 ? 141 PHE A CB   4  
ATOM 8928  C CG   . PHE A 1 141 ? 15.587  -6.735  -25.868 1.00 0.00 ? 141 PHE A CG   4  
ATOM 8929  C CD1  . PHE A 1 141 ? 16.749  -6.243  -25.301 1.00 0.00 ? 141 PHE A CD1  4  
ATOM 8930  C CD2  . PHE A 1 141 ? 15.531  -8.063  -26.241 1.00 0.00 ? 141 PHE A CD2  4  
ATOM 8931  C CE1  . PHE A 1 141 ? 17.837  -7.068  -25.118 1.00 0.00 ? 141 PHE A CE1  4  
ATOM 8932  C CE2  . PHE A 1 141 ? 16.620  -8.885  -26.058 1.00 0.00 ? 141 PHE A CE2  4  
ATOM 8933  C CZ   . PHE A 1 141 ? 17.770  -8.390  -25.498 1.00 0.00 ? 141 PHE A CZ   4  
ATOM 8934  H H    . PHE A 1 141 ? 11.998  -5.276  -26.432 1.00 0.00 ? 141 PHE A H    4  
ATOM 8935  H HA   . PHE A 1 141 ? 13.444  -6.701  -24.396 1.00 0.00 ? 141 PHE A HA   4  
ATOM 8936  H HB2  . PHE A 1 141 ? 13.874  -6.181  -27.003 1.00 0.00 ? 141 PHE A HB2  4  
ATOM 8937  H HB3  . PHE A 1 141 ? 14.781  -4.823  -26.350 1.00 0.00 ? 141 PHE A HB3  4  
ATOM 8938  H HD1  . PHE A 1 141 ? 16.803  -5.206  -25.000 1.00 0.00 ? 141 PHE A HD1  4  
ATOM 8939  H HD2  . PHE A 1 141 ? 14.629  -8.458  -26.681 1.00 0.00 ? 141 PHE A HD2  4  
ATOM 8940  H HE1  . PHE A 1 141 ? 18.743  -6.676  -24.683 1.00 0.00 ? 141 PHE A HE1  4  
ATOM 8941  H HE2  . PHE A 1 141 ? 16.570  -9.917  -26.358 1.00 0.00 ? 141 PHE A HE2  4  
ATOM 8942  H HZ   . PHE A 1 141 ? 18.621  -9.038  -25.357 1.00 0.00 ? 141 PHE A HZ   4  
ATOM 8943  N N    . VAL A 1 142 ? 13.370  -3.467  -24.264 1.00 0.00 ? 142 VAL A N    4  
ATOM 8944  C CA   . VAL A 1 142 ? 13.736  -2.299  -23.433 1.00 0.00 ? 142 VAL A CA   4  
ATOM 8945  C C    . VAL A 1 142 ? 13.175  -2.438  -22.026 1.00 0.00 ? 142 VAL A C    4  
ATOM 8946  O O    . VAL A 1 142 ? 13.826  -2.100  -21.058 1.00 0.00 ? 142 VAL A O    4  
ATOM 8947  C CB   . VAL A 1 142 ? 13.140  -1.038  -24.089 1.00 0.00 ? 142 VAL A CB   4  
ATOM 8948  C CG1  . VAL A 1 142 ? 13.079  0.088   -23.058 1.00 0.00 ? 142 VAL A CG1  4  
ATOM 8949  C CG2  . VAL A 1 142 ? 14.029  -0.606  -25.253 1.00 0.00 ? 142 VAL A CG2  4  
ATOM 8950  H H    . VAL A 1 142 ? 12.719  -3.369  -24.985 1.00 0.00 ? 142 VAL A H    4  
ATOM 8951  H HA   . VAL A 1 142 ? 14.820  -2.229  -23.378 1.00 0.00 ? 142 VAL A HA   4  
ATOM 8952  H HB   . VAL A 1 142 ? 12.148  -1.252  -24.453 1.00 0.00 ? 142 VAL A HB   4  
ATOM 8953  H HG11 . VAL A 1 142 ? 13.995  0.109   -22.487 1.00 0.00 ? 142 VAL A HG11 4  
ATOM 8954  H HG12 . VAL A 1 142 ? 12.952  1.036   -23.560 1.00 0.00 ? 142 VAL A HG12 4  
ATOM 8955  H HG13 . VAL A 1 142 ? 12.246  -0.075  -22.390 1.00 0.00 ? 142 VAL A HG13 4  
ATOM 8956  H HG21 . VAL A 1 142 ? 14.423  -1.477  -25.751 1.00 0.00 ? 142 VAL A HG21 4  
ATOM 8957  H HG22 . VAL A 1 142 ? 13.451  -0.027  -25.956 1.00 0.00 ? 142 VAL A HG22 4  
ATOM 8958  H HG23 . VAL A 1 142 ? 14.846  -0.005  -24.885 1.00 0.00 ? 142 VAL A HG23 4  
ATOM 8959  N N    . GLN A 1 143 ? 11.974  -2.935  -21.937 1.00 0.00 ? 143 GLN A N    4  
ATOM 8960  C CA   . GLN A 1 143 ? 11.359  -3.103  -20.624 1.00 0.00 ? 143 GLN A CA   4  
ATOM 8961  C C    . GLN A 1 143 ? 11.735  -4.455  -20.023 1.00 0.00 ? 143 GLN A C    4  
ATOM 8962  O O    . GLN A 1 143 ? 11.797  -4.606  -18.820 1.00 0.00 ? 143 GLN A O    4  
ATOM 8963  C CB   . GLN A 1 143 ? 9.842   -3.044  -20.822 1.00 0.00 ? 143 GLN A CB   4  
ATOM 8964  C CG   . GLN A 1 143 ? 9.163   -3.459  -19.537 1.00 0.00 ? 143 GLN A CG   4  
ATOM 8965  C CD   . GLN A 1 143 ? 7.647   -3.350  -19.708 1.00 0.00 ? 143 GLN A CD   4  
ATOM 8966  O OE1  . GLN A 1 143 ? 7.087   -2.271  -19.721 1.00 0.00 ? 143 GLN A OE1  4  
ATOM 8967  N NE2  . GLN A 1 143 ? 6.948   -4.444  -19.844 1.00 0.00 ? 143 GLN A NE2  4  
ATOM 8968  H H    . GLN A 1 143 ? 11.484  -3.192  -22.733 1.00 0.00 ? 143 GLN A H    4  
ATOM 8969  H HA   . GLN A 1 143 ? 11.698  -2.307  -19.965 1.00 0.00 ? 143 GLN A HA   4  
ATOM 8970  H HB2  . GLN A 1 143 ? 9.547   -2.037  -21.081 1.00 0.00 ? 143 GLN A HB2  4  
ATOM 8971  H HB3  . GLN A 1 143 ? 9.552   -3.714  -21.619 1.00 0.00 ? 143 GLN A HB3  4  
ATOM 8972  H HG2  . GLN A 1 143 ? 9.423   -4.478  -19.302 1.00 0.00 ? 143 GLN A HG2  4  
ATOM 8973  H HG3  . GLN A 1 143 ? 9.482   -2.813  -18.739 1.00 0.00 ? 143 GLN A HG3  4  
ATOM 8974  H HE21 . GLN A 1 143 ? 7.396   -5.315  -19.836 1.00 0.00 ? 143 GLN A HE21 4  
ATOM 8975  H HE22 . GLN A 1 143 ? 5.976   -4.393  -19.955 1.00 0.00 ? 143 GLN A HE22 4  
ATOM 8976  N N    . MET A 1 144 ? 11.980  -5.415  -20.877 1.00 0.00 ? 144 MET A N    4  
ATOM 8977  C CA   . MET A 1 144 ? 12.353  -6.762  -20.375 1.00 0.00 ? 144 MET A CA   4  
ATOM 8978  C C    . MET A 1 144 ? 13.790  -6.783  -19.868 1.00 0.00 ? 144 MET A C    4  
ATOM 8979  O O    . MET A 1 144 ? 14.179  -7.673  -19.137 1.00 0.00 ? 144 MET A O    4  
ATOM 8980  C CB   . MET A 1 144 ? 12.226  -7.766  -21.534 1.00 0.00 ? 144 MET A CB   4  
ATOM 8981  C CG   . MET A 1 144 ? 12.187  -9.186  -20.964 1.00 0.00 ? 144 MET A CG   4  
ATOM 8982  S SD   . MET A 1 144 ? 11.965  -10.548 -22.136 1.00 0.00 ? 144 MET A SD   4  
ATOM 8983  C CE   . MET A 1 144 ? 13.719  -10.928 -22.383 1.00 0.00 ? 144 MET A CE   4  
ATOM 8984  H H    . MET A 1 144 ? 11.915  -5.247  -21.840 1.00 0.00 ? 144 MET A H    4  
ATOM 8985  H HA   . MET A 1 144 ? 11.685  -7.031  -19.559 1.00 0.00 ? 144 MET A HA   4  
ATOM 8986  H HB2  . MET A 1 144 ? 11.319  -7.570  -22.087 1.00 0.00 ? 144 MET A HB2  4  
ATOM 8987  H HB3  . MET A 1 144 ? 13.073  -7.665  -22.197 1.00 0.00 ? 144 MET A HB3  4  
ATOM 8988  H HG2  . MET A 1 144 ? 13.110  -9.360  -20.431 1.00 0.00 ? 144 MET A HG2  4  
ATOM 8989  H HG3  . MET A 1 144 ? 11.381  -9.238  -20.246 1.00 0.00 ? 144 MET A HG3  4  
ATOM 8990  H HE1  . MET A 1 144 ? 14.233  -10.042 -22.726 1.00 0.00 ? 144 MET A HE1  4  
ATOM 8991  H HE2  . MET A 1 144 ? 14.152  -11.256 -21.448 1.00 0.00 ? 144 MET A HE2  4  
ATOM 8992  H HE3  . MET A 1 144 ? 13.817  -11.711 -23.119 1.00 0.00 ? 144 MET A HE3  4  
ATOM 8993  N N    . MET A 1 145 ? 14.559  -5.806  -20.262 1.00 0.00 ? 145 MET A N    4  
ATOM 8994  C CA   . MET A 1 145 ? 15.969  -5.763  -19.806 1.00 0.00 ? 145 MET A CA   4  
ATOM 8995  C C    . MET A 1 145 ? 16.042  -5.467  -18.313 1.00 0.00 ? 145 MET A C    4  
ATOM 8996  O O    . MET A 1 145 ? 17.074  -5.631  -17.693 1.00 0.00 ? 145 MET A O    4  
ATOM 8997  C CB   . MET A 1 145 ? 16.696  -4.645  -20.574 1.00 0.00 ? 145 MET A CB   4  
ATOM 8998  C CG   . MET A 1 145 ? 17.869  -5.249  -21.347 1.00 0.00 ? 145 MET A CG   4  
ATOM 8999  S SD   . MET A 1 145 ? 19.053  -4.101  -22.091 1.00 0.00 ? 145 MET A SD   4  
ATOM 9000  C CE   . MET A 1 145 ? 20.092  -5.343  -22.900 1.00 0.00 ? 145 MET A CE   4  
ATOM 9001  H H    . MET A 1 145 ? 14.207  -5.104  -20.848 1.00 0.00 ? 145 MET A H    4  
ATOM 9002  H HA   . MET A 1 145 ? 16.432  -6.731  -19.998 1.00 0.00 ? 145 MET A HA   4  
ATOM 9003  H HB2  . MET A 1 145 ? 16.012  -4.174  -21.263 1.00 0.00 ? 145 MET A HB2  4  
ATOM 9004  H HB3  . MET A 1 145 ? 17.064  -3.904  -19.877 1.00 0.00 ? 145 MET A HB3  4  
ATOM 9005  H HG2  . MET A 1 145 ? 18.417  -5.896  -20.678 1.00 0.00 ? 145 MET A HG2  4  
ATOM 9006  H HG3  . MET A 1 145 ? 17.467  -5.863  -22.140 1.00 0.00 ? 145 MET A HG3  4  
ATOM 9007  H HE1  . MET A 1 145 ? 19.683  -6.327  -22.721 1.00 0.00 ? 145 MET A HE1  4  
ATOM 9008  H HE2  . MET A 1 145 ? 20.117  -5.152  -23.961 1.00 0.00 ? 145 MET A HE2  4  
ATOM 9009  H HE3  . MET A 1 145 ? 21.093  -5.289  -22.500 1.00 0.00 ? 145 MET A HE3  4  
ATOM 9010  N N    . THR A 1 146 ? 14.938  -5.040  -17.763 1.00 0.00 ? 146 THR A N    4  
ATOM 9011  C CA   . THR A 1 146 ? 14.914  -4.726  -16.314 1.00 0.00 ? 146 THR A CA   4  
ATOM 9012  C C    . THR A 1 146 ? 14.377  -5.904  -15.510 1.00 0.00 ? 146 THR A C    4  
ATOM 9013  O O    . THR A 1 146 ? 14.443  -5.912  -14.296 1.00 0.00 ? 146 THR A O    4  
ATOM 9014  C CB   . THR A 1 146 ? 13.992  -3.522  -16.103 1.00 0.00 ? 146 THR A CB   4  
ATOM 9015  O OG1  . THR A 1 146 ? 13.862  -2.924  -17.377 1.00 0.00 ? 146 THR A OG1  4  
ATOM 9016  C CG2  . THR A 1 146 ? 14.678  -2.451  -15.243 1.00 0.00 ? 146 THR A CG2  4  
ATOM 9017  H H    . THR A 1 146 ? 14.129  -4.928  -18.305 1.00 0.00 ? 146 THR A H    4  
ATOM 9018  H HA   . THR A 1 146 ? 15.926  -4.499  -15.981 1.00 0.00 ? 146 THR A HA   4  
ATOM 9019  H HB   . THR A 1 146 ? 13.020  -3.819  -15.713 1.00 0.00 ? 146 THR A HB   4  
ATOM 9020  H HG1  . THR A 1 146 ? 13.049  -3.245  -17.775 1.00 0.00 ? 146 THR A HG1  4  
ATOM 9021  H HG21 . THR A 1 146 ? 15.664  -2.248  -15.635 1.00 0.00 ? 146 THR A HG21 4  
ATOM 9022  H HG22 . THR A 1 146 ? 14.094  -1.542  -15.259 1.00 0.00 ? 146 THR A HG22 4  
ATOM 9023  H HG23 . THR A 1 146 ? 14.764  -2.801  -14.227 1.00 0.00 ? 146 THR A HG23 4  
ATOM 9024  N N    . ALA A 1 147 ? 13.851  -6.877  -16.200 1.00 0.00 ? 147 ALA A N    4  
ATOM 9025  C CA   . ALA A 1 147 ? 13.306  -8.060  -15.491 1.00 0.00 ? 147 ALA A CA   4  
ATOM 9026  C C    . ALA A 1 147 ? 14.432  -8.940  -14.959 1.00 0.00 ? 147 ALA A C    4  
ATOM 9027  O O    . ALA A 1 147 ? 15.398  -8.449  -14.407 1.00 0.00 ? 147 ALA A O    4  
ATOM 9028  C CB   . ALA A 1 147 ? 12.467  -8.879  -16.484 1.00 0.00 ? 147 ALA A CB   4  
ATOM 9029  H H    . ALA A 1 147 ? 13.816  -6.828  -17.178 1.00 0.00 ? 147 ALA A H    4  
ATOM 9030  H HA   . ALA A 1 147 ? 12.696  -7.722  -14.654 1.00 0.00 ? 147 ALA A HA   4  
ATOM 9031  H HB1  . ALA A 1 147 ? 11.735  -8.240  -16.955 1.00 0.00 ? 147 ALA A HB1  4  
ATOM 9032  H HB2  . ALA A 1 147 ? 13.109  -9.303  -17.241 1.00 0.00 ? 147 ALA A HB2  4  
ATOM 9033  H HB3  . ALA A 1 147 ? 11.958  -9.676  -15.961 1.00 0.00 ? 147 ALA A HB3  4  
ATOM 9034  N N    . LYS A 1 148 ? 14.290  -10.226 -15.135 1.00 0.00 ? 148 LYS A N    4  
ATOM 9035  C CA   . LYS A 1 148 ? 15.345  -11.148 -14.646 1.00 0.00 ? 148 LYS A CA   4  
ATOM 9036  C C    . LYS A 1 148 ? 16.726  -10.667 -15.075 1.00 0.00 ? 148 LYS A C    4  
ATOM 9037  O O    . LYS A 1 148 ? 17.423  -10.177 -14.202 1.00 0.00 ? 148 LYS A O    4  
ATOM 9038  C CB   . LYS A 1 148 ? 15.095  -12.538 -15.251 1.00 0.00 ? 148 LYS A CB   4  
ATOM 9039  C CG   . LYS A 1 148 ? 15.511  -13.608 -14.240 1.00 0.00 ? 148 LYS A CG   4  
ATOM 9040  C CD   . LYS A 1 148 ? 17.015  -13.500 -13.982 1.00 0.00 ? 148 LYS A CD   4  
ATOM 9041  C CE   . LYS A 1 148 ? 17.478  -14.729 -13.199 1.00 0.00 ? 148 LYS A CE   4  
ATOM 9042  N NZ   . LYS A 1 148 ? 17.580  -15.911 -14.099 1.00 0.00 ? 148 LYS A NZ   4  
ATOM 9043  O OXT  . LYS A 1 148 ? 17.008  -10.817 -16.252 1.00 0.00 ? 148 LYS A OXT  4  
ATOM 9044  H H    . LYS A 1 148 ? 13.495  -10.579 -15.587 1.00 0.00 ? 148 LYS A H    4  
ATOM 9045  H HA   . LYS A 1 148 ? 15.305  -11.186 -13.558 1.00 0.00 ? 148 LYS A HA   4  
ATOM 9046  H HB2  . LYS A 1 148 ? 14.047  -12.648 -15.486 1.00 0.00 ? 148 LYS A HB2  4  
ATOM 9047  H HB3  . LYS A 1 148 ? 15.674  -12.649 -16.156 1.00 0.00 ? 148 LYS A HB3  4  
ATOM 9048  H HG2  . LYS A 1 148 ? 14.973  -13.461 -13.316 1.00 0.00 ? 148 LYS A HG2  4  
ATOM 9049  H HG3  . LYS A 1 148 ? 15.279  -14.587 -14.633 1.00 0.00 ? 148 LYS A HG3  4  
ATOM 9050  H HD2  . LYS A 1 148 ? 17.543  -13.449 -14.925 1.00 0.00 ? 148 LYS A HD2  4  
ATOM 9051  H HD3  . LYS A 1 148 ? 17.223  -12.606 -13.411 1.00 0.00 ? 148 LYS A HD3  4  
ATOM 9052  H HE2  . LYS A 1 148 ? 18.446  -14.537 -12.759 1.00 0.00 ? 148 LYS A HE2  4  
ATOM 9053  H HE3  . LYS A 1 148 ? 16.770  -14.945 -12.413 1.00 0.00 ? 148 LYS A HE3  4  
ATOM 9054  H HZ1  . LYS A 1 148 ? 18.089  -15.644 -14.966 1.00 0.00 ? 148 LYS A HZ1  4  
ATOM 9055  H HZ2  . LYS A 1 148 ? 18.096  -16.673 -13.614 1.00 0.00 ? 148 LYS A HZ2  4  
ATOM 9056  H HZ3  . LYS A 1 148 ? 16.625  -16.242 -14.347 1.00 0.00 ? 148 LYS A HZ3  4  
ATOM 9057  N N    . ALA A 1 1   ? 10.816  11.711  -17.833 1.00 0.00 ? 1   ALA A N    5  
ATOM 9058  C CA   . ALA A 1 1   ? 11.737  10.574  -18.065 1.00 0.00 ? 1   ALA A CA   5  
ATOM 9059  C C    . ALA A 1 1   ? 12.302  10.074  -16.741 1.00 0.00 ? 1   ALA A C    5  
ATOM 9060  O O    . ALA A 1 1   ? 13.398  10.433  -16.354 1.00 0.00 ? 1   ALA A O    5  
ATOM 9061  C CB   . ALA A 1 1   ? 12.906  11.022  -18.954 1.00 0.00 ? 1   ALA A CB   5  
ATOM 9062  H H1   . ALA A 1 1   ? 10.224  11.515  -17.002 1.00 0.00 ? 1   ALA A H1   5  
ATOM 9063  H H2   . ALA A 1 1   ? 11.369  12.576  -17.669 1.00 0.00 ? 1   ALA A H2   5  
ATOM 9064  H H3   . ALA A 1 1   ? 10.210  11.841  -18.669 1.00 0.00 ? 1   ALA A H3   5  
ATOM 9065  H HA   . ALA A 1 1   ? 11.182  9.762   -18.536 1.00 0.00 ? 1   ALA A HA   5  
ATOM 9066  H HB1  . ALA A 1 1   ? 13.261  11.988  -18.629 1.00 0.00 ? 1   ALA A HB1  5  
ATOM 9067  H HB2  . ALA A 1 1   ? 13.711  10.306  -18.886 1.00 0.00 ? 1   ALA A HB2  5  
ATOM 9068  H HB3  . ALA A 1 1   ? 12.577  11.090  -19.979 1.00 0.00 ? 1   ALA A HB3  5  
ATOM 9069  N N    . ASP A 1 2   ? 11.542  9.253   -16.070 1.00 0.00 ? 2   ASP A N    5  
ATOM 9070  C CA   . ASP A 1 2   ? 12.013  8.717   -14.770 1.00 0.00 ? 2   ASP A CA   5  
ATOM 9071  C C    . ASP A 1 2   ? 11.283  7.426   -14.429 1.00 0.00 ? 2   ASP A C    5  
ATOM 9072  O O    . ASP A 1 2   ? 11.296  6.981   -13.298 1.00 0.00 ? 2   ASP A O    5  
ATOM 9073  C CB   . ASP A 1 2   ? 11.715  9.754   -13.676 1.00 0.00 ? 2   ASP A CB   5  
ATOM 9074  C CG   . ASP A 1 2   ? 12.793  9.669   -12.594 1.00 0.00 ? 2   ASP A CG   5  
ATOM 9075  O OD1  . ASP A 1 2   ? 13.186  8.549   -12.308 1.00 0.00 ? 2   ASP A OD1  5  
ATOM 9076  O OD2  . ASP A 1 2   ? 13.163  10.727  -12.113 1.00 0.00 ? 2   ASP A OD2  5  
ATOM 9077  H H    . ASP A 1 2   ? 10.666  8.992   -16.423 1.00 0.00 ? 2   ASP A H    5  
ATOM 9078  H HA   . ASP A 1 2   ? 13.082  8.516   -14.833 1.00 0.00 ? 2   ASP A HA   5  
ATOM 9079  H HB2  . ASP A 1 2   ? 11.713  10.746  -14.102 1.00 0.00 ? 2   ASP A HB2  5  
ATOM 9080  H HB3  . ASP A 1 2   ? 10.749  9.552   -13.234 1.00 0.00 ? 2   ASP A HB3  5  
ATOM 9081  N N    . GLN A 1 3   ? 10.658  6.847   -15.416 1.00 0.00 ? 3   GLN A N    5  
ATOM 9082  C CA   . GLN A 1 3   ? 9.922   5.587   -15.173 1.00 0.00 ? 3   GLN A CA   5  
ATOM 9083  C C    . GLN A 1 3   ? 8.829   5.795   -14.132 1.00 0.00 ? 3   GLN A C    5  
ATOM 9084  O O    . GLN A 1 3   ? 8.561   4.923   -13.329 1.00 0.00 ? 3   GLN A O    5  
ATOM 9085  C CB   . GLN A 1 3   ? 10.920  4.534   -14.653 1.00 0.00 ? 3   GLN A CB   5  
ATOM 9086  C CG   . GLN A 1 3   ? 10.438  3.130   -15.043 1.00 0.00 ? 3   GLN A CG   5  
ATOM 9087  C CD   . GLN A 1 3   ? 11.642  2.191   -15.133 1.00 0.00 ? 3   GLN A CD   5  
ATOM 9088  O OE1  . GLN A 1 3   ? 11.722  1.198   -14.438 1.00 0.00 ? 3   GLN A OE1  5  
ATOM 9089  N NE2  . GLN A 1 3   ? 12.598  2.468   -15.976 1.00 0.00 ? 3   GLN A NE2  5  
ATOM 9090  H H    . GLN A 1 3   ? 10.676  7.243   -16.312 1.00 0.00 ? 3   GLN A H    5  
ATOM 9091  H HA   . GLN A 1 3   ? 9.464   5.263   -16.105 1.00 0.00 ? 3   GLN A HA   5  
ATOM 9092  H HB2  . GLN A 1 3   ? 11.893  4.715   -15.085 1.00 0.00 ? 3   GLN A HB2  5  
ATOM 9093  H HB3  . GLN A 1 3   ? 10.993  4.605   -13.578 1.00 0.00 ? 3   GLN A HB3  5  
ATOM 9094  H HG2  . GLN A 1 3   ? 9.751   2.759   -14.298 1.00 0.00 ? 3   GLN A HG2  5  
ATOM 9095  H HG3  . GLN A 1 3   ? 9.941   3.162   -16.001 1.00 0.00 ? 3   GLN A HG3  5  
ATOM 9096  H HE21 . GLN A 1 3   ? 12.538  3.267   -16.540 1.00 0.00 ? 3   GLN A HE21 5  
ATOM 9097  H HE22 . GLN A 1 3   ? 13.376  1.876   -16.047 1.00 0.00 ? 3   GLN A HE22 5  
ATOM 9098  N N    . LEU A 1 4   ? 8.223   6.961   -14.169 1.00 0.00 ? 4   LEU A N    5  
ATOM 9099  C CA   . LEU A 1 4   ? 7.134   7.277   -13.197 1.00 0.00 ? 4   LEU A CA   5  
ATOM 9100  C C    . LEU A 1 4   ? 7.648   7.272   -11.752 1.00 0.00 ? 4   LEU A C    5  
ATOM 9101  O O    . LEU A 1 4   ? 8.217   6.306   -11.291 1.00 0.00 ? 4   LEU A O    5  
ATOM 9102  C CB   . LEU A 1 4   ? 6.025   6.221   -13.351 1.00 0.00 ? 4   LEU A CB   5  
ATOM 9103  C CG   . LEU A 1 4   ? 4.813   6.870   -14.025 1.00 0.00 ? 4   LEU A CG   5  
ATOM 9104  C CD1  . LEU A 1 4   ? 3.901   5.778   -14.587 1.00 0.00 ? 4   LEU A CD1  5  
ATOM 9105  C CD2  . LEU A 1 4   ? 4.043   7.686   -12.991 1.00 0.00 ? 4   LEU A CD2  5  
ATOM 9106  H H    . LEU A 1 4   ? 8.485   7.626   -14.839 1.00 0.00 ? 4   LEU A H    5  
ATOM 9107  H HA   . LEU A 1 4   ? 6.748   8.271   -13.424 1.00 0.00 ? 4   LEU A HA   5  
ATOM 9108  H HB2  . LEU A 1 4   ? 6.378   5.405   -13.960 1.00 0.00 ? 4   LEU A HB2  5  
ATOM 9109  H HB3  . LEU A 1 4   ? 5.742   5.844   -12.379 1.00 0.00 ? 4   LEU A HB3  5  
ATOM 9110  H HG   . LEU A 1 4   ? 5.143   7.517   -14.828 1.00 0.00 ? 4   LEU A HG   5  
ATOM 9111  H HD11 . LEU A 1 4   ? 4.492   5.049   -15.121 1.00 0.00 ? 4   LEU A HD11 5  
ATOM 9112  H HD12 . LEU A 1 4   ? 3.377   5.290   -13.779 1.00 0.00 ? 4   LEU A HD12 5  
ATOM 9113  H HD13 . LEU A 1 4   ? 3.181   6.216   -15.262 1.00 0.00 ? 4   LEU A HD13 5  
ATOM 9114  H HD21 . LEU A 1 4   ? 4.737   8.202   -12.349 1.00 0.00 ? 4   LEU A HD21 5  
ATOM 9115  H HD22 . LEU A 1 4   ? 3.414   8.408   -13.490 1.00 0.00 ? 4   LEU A HD22 5  
ATOM 9116  H HD23 . LEU A 1 4   ? 3.427   7.029   -12.394 1.00 0.00 ? 4   LEU A HD23 5  
ATOM 9117  N N    . THR A 1 5   ? 7.425   8.361   -11.060 1.00 0.00 ? 5   THR A N    5  
ATOM 9118  C CA   . THR A 1 5   ? 7.889   8.442   -9.651  1.00 0.00 ? 5   THR A CA   5  
ATOM 9119  C C    . THR A 1 5   ? 6.904   7.771   -8.700  1.00 0.00 ? 5   THR A C    5  
ATOM 9120  O O    . THR A 1 5   ? 5.820   7.386   -9.093  1.00 0.00 ? 5   THR A O    5  
ATOM 9121  C CB   . THR A 1 5   ? 8.004   9.915   -9.270  1.00 0.00 ? 5   THR A CB   5  
ATOM 9122  O OG1  . THR A 1 5   ? 9.092   10.415  -10.020 1.00 0.00 ? 5   THR A OG1  5  
ATOM 9123  C CG2  . THR A 1 5   ? 8.441   10.065  -7.807  1.00 0.00 ? 5   THR A CG2  5  
ATOM 9124  H H    . THR A 1 5   ? 6.955   9.118   -11.469 1.00 0.00 ? 5   THR A H    5  
ATOM 9125  H HA   . THR A 1 5   ? 8.854   7.949   -9.568  1.00 0.00 ? 5   THR A HA   5  
ATOM 9126  H HB   . THR A 1 5   ? 7.095   10.461  -9.496  1.00 0.00 ? 5   THR A HB   5  
ATOM 9127  H HG1  . THR A 1 5   ? 9.265   11.313  -9.730  1.00 0.00 ? 5   THR A HG1  5  
ATOM 9128  H HG21 . THR A 1 5   ? 9.207   9.339   -7.581  1.00 0.00 ? 5   THR A HG21 5  
ATOM 9129  H HG22 . THR A 1 5   ? 8.833   11.058  -7.645  1.00 0.00 ? 5   THR A HG22 5  
ATOM 9130  H HG23 . THR A 1 5   ? 7.595   9.904   -7.156  1.00 0.00 ? 5   THR A HG23 5  
ATOM 9131  N N    . GLU A 1 6   ? 7.301   7.648   -7.457  1.00 0.00 ? 6   GLU A N    5  
ATOM 9132  C CA   . GLU A 1 6   ? 6.406   7.006   -6.460  1.00 0.00 ? 6   GLU A CA   5  
ATOM 9133  C C    . GLU A 1 6   ? 5.165   7.857   -6.215  1.00 0.00 ? 6   GLU A C    5  
ATOM 9134  O O    . GLU A 1 6   ? 4.061   7.356   -6.189  1.00 0.00 ? 6   GLU A O    5  
ATOM 9135  C CB   . GLU A 1 6   ? 7.180   6.862   -5.136  1.00 0.00 ? 6   GLU A CB   5  
ATOM 9136  C CG   . GLU A 1 6   ? 7.252   5.383   -4.754  1.00 0.00 ? 6   GLU A CG   5  
ATOM 9137  C CD   . GLU A 1 6   ? 7.653   5.259   -3.281  1.00 0.00 ? 6   GLU A CD   5  
ATOM 9138  O OE1  . GLU A 1 6   ? 7.690   6.299   -2.642  1.00 0.00 ? 6   GLU A OE1  5  
ATOM 9139  O OE2  . GLU A 1 6   ? 7.900   4.134   -2.880  1.00 0.00 ? 6   GLU A OE2  5  
ATOM 9140  H H    . GLU A 1 6   ? 8.182   7.981   -7.188  1.00 0.00 ? 6   GLU A H    5  
ATOM 9141  H HA   . GLU A 1 6   ? 6.099   6.030   -6.837  1.00 0.00 ? 6   GLU A HA   5  
ATOM 9142  H HB2  . GLU A 1 6   ? 8.179   7.255   -5.256  1.00 0.00 ? 6   GLU A HB2  5  
ATOM 9143  H HB3  . GLU A 1 6   ? 6.675   7.413   -4.356  1.00 0.00 ? 6   GLU A HB3  5  
ATOM 9144  H HG2  . GLU A 1 6   ? 6.288   4.919   -4.901  1.00 0.00 ? 6   GLU A HG2  5  
ATOM 9145  H HG3  . GLU A 1 6   ? 7.986   4.882   -5.368  1.00 0.00 ? 6   GLU A HG3  5  
ATOM 9146  N N    . GLU A 1 7   ? 5.365   9.132   -6.031  1.00 0.00 ? 7   GLU A N    5  
ATOM 9147  C CA   . GLU A 1 7   ? 4.201   10.015  -5.790  1.00 0.00 ? 7   GLU A CA   5  
ATOM 9148  C C    . GLU A 1 7   ? 3.216   9.911   -6.934  1.00 0.00 ? 7   GLU A C    5  
ATOM 9149  O O    . GLU A 1 7   ? 2.045   9.665   -6.729  1.00 0.00 ? 7   GLU A O    5  
ATOM 9150  C CB   . GLU A 1 7   ? 4.697   11.465  -5.688  1.00 0.00 ? 7   GLU A CB   5  
ATOM 9151  C CG   . GLU A 1 7   ? 3.498   12.393  -5.496  1.00 0.00 ? 7   GLU A CG   5  
ATOM 9152  C CD   . GLU A 1 7   ? 2.672   11.912  -4.301  1.00 0.00 ? 7   GLU A CD   5  
ATOM 9153  O OE1  . GLU A 1 7   ? 3.300   11.557  -3.317  1.00 0.00 ? 7   GLU A OE1  5  
ATOM 9154  O OE2  . GLU A 1 7   ? 1.460   11.925  -4.441  1.00 0.00 ? 7   GLU A OE2  5  
ATOM 9155  H H    . GLU A 1 7   ? 6.272   9.501   -6.051  1.00 0.00 ? 7   GLU A H    5  
ATOM 9156  H HA   . GLU A 1 7   ? 3.705   9.704   -4.875  1.00 0.00 ? 7   GLU A HA   5  
ATOM 9157  H HB2  . GLU A 1 7   ? 5.369   11.560  -4.849  1.00 0.00 ? 7   GLU A HB2  5  
ATOM 9158  H HB3  . GLU A 1 7   ? 5.222   11.732  -6.594  1.00 0.00 ? 7   GLU A HB3  5  
ATOM 9159  H HG2  . GLU A 1 7   ? 3.842   13.401  -5.310  1.00 0.00 ? 7   GLU A HG2  5  
ATOM 9160  H HG3  . GLU A 1 7   ? 2.882   12.383  -6.383  1.00 0.00 ? 7   GLU A HG3  5  
ATOM 9161  N N    . GLN A 1 8   ? 3.703   10.104  -8.122  1.00 0.00 ? 8   GLN A N    5  
ATOM 9162  C CA   . GLN A 1 8   ? 2.801   10.015  -9.286  1.00 0.00 ? 8   GLN A CA   5  
ATOM 9163  C C    . GLN A 1 8   ? 1.998   8.732   -9.210  1.00 0.00 ? 8   GLN A C    5  
ATOM 9164  O O    . GLN A 1 8   ? 0.821   8.711   -9.508  1.00 0.00 ? 8   GLN A O    5  
ATOM 9165  C CB   . GLN A 1 8   ? 3.655   10.001  -10.560 1.00 0.00 ? 8   GLN A CB   5  
ATOM 9166  C CG   . GLN A 1 8   ? 4.309   11.373  -10.744 1.00 0.00 ? 8   GLN A CG   5  
ATOM 9167  C CD   . GLN A 1 8   ? 3.221   12.428  -10.945 1.00 0.00 ? 8   GLN A CD   5  
ATOM 9168  O OE1  . GLN A 1 8   ? 3.462   13.614  -10.825 1.00 0.00 ? 8   GLN A OE1  5  
ATOM 9169  N NE2  . GLN A 1 8   ? 2.014   12.044  -11.255 1.00 0.00 ? 8   GLN A NE2  5  
ATOM 9170  H H    . GLN A 1 8   ? 4.654   10.305  -8.242  1.00 0.00 ? 8   GLN A H    5  
ATOM 9171  H HA   . GLN A 1 8   ? 2.117   10.866  -9.276  1.00 0.00 ? 8   GLN A HA   5  
ATOM 9172  H HB2  . GLN A 1 8   ? 4.420   9.247   -10.471 1.00 0.00 ? 8   GLN A HB2  5  
ATOM 9173  H HB3  . GLN A 1 8   ? 3.033   9.777   -11.413 1.00 0.00 ? 8   GLN A HB3  5  
ATOM 9174  H HG2  . GLN A 1 8   ? 4.891   11.620  -9.869  1.00 0.00 ? 8   GLN A HG2  5  
ATOM 9175  H HG3  . GLN A 1 8   ? 4.954   11.357  -11.610 1.00 0.00 ? 8   GLN A HG3  5  
ATOM 9176  H HE21 . GLN A 1 8   ? 1.815   11.089  -11.357 1.00 0.00 ? 8   GLN A HE21 5  
ATOM 9177  H HE22 . GLN A 1 8   ? 1.306   12.709  -11.387 1.00 0.00 ? 8   GLN A HE22 5  
ATOM 9178  N N    . ILE A 1 9   ? 2.651   7.673   -8.810  1.00 0.00 ? 9   ILE A N    5  
ATOM 9179  C CA   . ILE A 1 9   ? 1.940   6.386   -8.706  1.00 0.00 ? 9   ILE A CA   5  
ATOM 9180  C C    . ILE A 1 9   ? 0.953   6.439   -7.553  1.00 0.00 ? 9   ILE A C    5  
ATOM 9181  O O    . ILE A 1 9   ? -0.042  5.743   -7.551  1.00 0.00 ? 9   ILE A O    5  
ATOM 9182  C CB   . ILE A 1 9   ? 2.959   5.277   -8.449  1.00 0.00 ? 9   ILE A CB   5  
ATOM 9183  C CG1  . ILE A 1 9   ? 3.705   4.965   -9.737  1.00 0.00 ? 9   ILE A CG1  5  
ATOM 9184  C CG2  . ILE A 1 9   ? 2.210   4.011   -7.998  1.00 0.00 ? 9   ILE A CG2  5  
ATOM 9185  C CD1  . ILE A 1 9   ? 5.076   4.379   -9.394  1.00 0.00 ? 9   ILE A CD1  5  
ATOM 9186  H H    . ILE A 1 9   ? 3.603   7.735   -8.583  1.00 0.00 ? 9   ILE A H    5  
ATOM 9187  H HA   . ILE A 1 9   ? 1.395   6.205   -9.632  1.00 0.00 ? 9   ILE A HA   5  
ATOM 9188  H HB   . ILE A 1 9   ? 3.667   5.605   -7.693  1.00 0.00 ? 9   ILE A HB   5  
ATOM 9189  H HG12 . ILE A 1 9   ? 3.141   4.253   -10.318 1.00 0.00 ? 9   ILE A HG12 5  
ATOM 9190  H HG13 . ILE A 1 9   ? 3.831   5.870   -10.312 1.00 0.00 ? 9   ILE A HG13 5  
ATOM 9191  H HG21 . ILE A 1 9   ? 1.456   3.754   -8.727  1.00 0.00 ? 9   ILE A HG21 5  
ATOM 9192  H HG22 . ILE A 1 9   ? 2.905   3.190   -7.903  1.00 0.00 ? 9   ILE A HG22 5  
ATOM 9193  H HG23 . ILE A 1 9   ? 1.737   4.185   -7.043  1.00 0.00 ? 9   ILE A HG23 5  
ATOM 9194  H HD11 . ILE A 1 9   ? 5.613   5.060   -8.752  1.00 0.00 ? 9   ILE A HD11 5  
ATOM 9195  H HD12 . ILE A 1 9   ? 4.952   3.436   -8.885  1.00 0.00 ? 9   ILE A HD12 5  
ATOM 9196  H HD13 . ILE A 1 9   ? 5.642   4.224   -10.302 1.00 0.00 ? 9   ILE A HD13 5  
ATOM 9197  N N    . ALA A 1 10  ? 1.249   7.271   -6.578  1.00 0.00 ? 10  ALA A N    5  
ATOM 9198  C CA   . ALA A 1 10  ? 0.336   7.383   -5.419  1.00 0.00 ? 10  ALA A CA   5  
ATOM 9199  C C    . ALA A 1 10  ? -0.966  8.038   -5.848  1.00 0.00 ? 10  ALA A C    5  
ATOM 9200  O O    . ALA A 1 10  ? -2.038  7.534   -5.576  1.00 0.00 ? 10  ALA A O    5  
ATOM 9201  C CB   . ALA A 1 10  ? 1.008   8.255   -4.348  1.00 0.00 ? 10  ALA A CB   5  
ATOM 9202  H H    . ALA A 1 10  ? 2.071   7.815   -6.616  1.00 0.00 ? 10  ALA A H    5  
ATOM 9203  H HA   . ALA A 1 10  ? 0.124   6.385   -5.036  1.00 0.00 ? 10  ALA A HA   5  
ATOM 9204  H HB1  . ALA A 1 10  ? 2.066   8.040   -4.314  1.00 0.00 ? 10  ALA A HB1  5  
ATOM 9205  H HB2  . ALA A 1 10  ? 0.864   9.299   -4.584  1.00 0.00 ? 10  ALA A HB2  5  
ATOM 9206  H HB3  . ALA A 1 10  ? 0.574   8.046   -3.382  1.00 0.00 ? 10  ALA A HB3  5  
ATOM 9207  N N    . GLU A 1 11  ? -0.853  9.158   -6.515  1.00 0.00 ? 11  GLU A N    5  
ATOM 9208  C CA   . GLU A 1 11  ? -2.077  9.853   -6.969  1.00 0.00 ? 11  GLU A CA   5  
ATOM 9209  C C    . GLU A 1 11  ? -2.829  8.956   -7.928  1.00 0.00 ? 11  GLU A C    5  
ATOM 9210  O O    . GLU A 1 11  ? -4.043  8.982   -7.999  1.00 0.00 ? 11  GLU A O    5  
ATOM 9211  C CB   . GLU A 1 11  ? -1.662  11.142  -7.698  1.00 0.00 ? 11  GLU A CB   5  
ATOM 9212  C CG   . GLU A 1 11  ? -1.750  12.320  -6.724  1.00 0.00 ? 11  GLU A CG   5  
ATOM 9213  C CD   . GLU A 1 11  ? -1.496  13.626  -7.482  1.00 0.00 ? 11  GLU A CD   5  
ATOM 9214  O OE1  . GLU A 1 11  ? -0.352  13.820  -7.858  1.00 0.00 ? 11  GLU A OE1  5  
ATOM 9215  O OE2  . GLU A 1 11  ? -2.461  14.356  -7.640  1.00 0.00 ? 11  GLU A OE2  5  
ATOM 9216  H H    . GLU A 1 11  ? 0.034   9.531   -6.716  1.00 0.00 ? 11  GLU A H    5  
ATOM 9217  H HA   . GLU A 1 11  ? -2.713  10.068  -6.109  1.00 0.00 ? 11  GLU A HA   5  
ATOM 9218  H HB2  . GLU A 1 11  ? -0.649  11.044  -8.058  1.00 0.00 ? 11  GLU A HB2  5  
ATOM 9219  H HB3  . GLU A 1 11  ? -2.321  11.314  -8.537  1.00 0.00 ? 11  GLU A HB3  5  
ATOM 9220  H HG2  . GLU A 1 11  ? -2.732  12.353  -6.275  1.00 0.00 ? 11  GLU A HG2  5  
ATOM 9221  H HG3  . GLU A 1 11  ? -1.008  12.208  -5.948  1.00 0.00 ? 11  GLU A HG3  5  
ATOM 9222  N N    . PHE A 1 12  ? -2.083  8.172   -8.651  1.00 0.00 ? 12  PHE A N    5  
ATOM 9223  C CA   . PHE A 1 12  ? -2.709  7.254   -9.617  1.00 0.00 ? 12  PHE A CA   5  
ATOM 9224  C C    . PHE A 1 12  ? -3.506  6.196   -8.882  1.00 0.00 ? 12  PHE A C    5  
ATOM 9225  O O    . PHE A 1 12  ? -4.681  6.030   -9.120  1.00 0.00 ? 12  PHE A O    5  
ATOM 9226  C CB   . PHE A 1 12  ? -1.596  6.568   -10.410 1.00 0.00 ? 12  PHE A CB   5  
ATOM 9227  C CG   . PHE A 1 12  ? -1.091  7.506   -11.510 1.00 0.00 ? 12  PHE A CG   5  
ATOM 9228  C CD1  . PHE A 1 12  ? -1.311  8.877   -11.443 1.00 0.00 ? 12  PHE A CD1  5  
ATOM 9229  C CD2  . PHE A 1 12  ? -0.414  6.991   -12.595 1.00 0.00 ? 12  PHE A CD2  5  
ATOM 9230  C CE1  . PHE A 1 12  ? -0.861  9.703   -12.450 1.00 0.00 ? 12  PHE A CE1  5  
ATOM 9231  C CE2  . PHE A 1 12  ? 0.034   7.820   -13.594 1.00 0.00 ? 12  PHE A CE2  5  
ATOM 9232  C CZ   . PHE A 1 12  ? -0.189  9.173   -13.524 1.00 0.00 ? 12  PHE A CZ   5  
ATOM 9233  H H    . PHE A 1 12  ? -1.108  8.194   -8.552  1.00 0.00 ? 12  PHE A H    5  
ATOM 9234  H HA   . PHE A 1 12  ? -3.376  7.817   -10.276 1.00 0.00 ? 12  PHE A HA   5  
ATOM 9235  H HB2  . PHE A 1 12  ? -0.780  6.321   -9.752  1.00 0.00 ? 12  PHE A HB2  5  
ATOM 9236  H HB3  . PHE A 1 12  ? -1.974  5.663   -10.861 1.00 0.00 ? 12  PHE A HB3  5  
ATOM 9237  H HD1  . PHE A 1 12  ? -1.829  9.302   -10.597 1.00 0.00 ? 12  PHE A HD1  5  
ATOM 9238  H HD2  . PHE A 1 12  ? -0.230  5.929   -12.657 1.00 0.00 ? 12  PHE A HD2  5  
ATOM 9239  H HE1  . PHE A 1 12  ? -1.034  10.767  -12.394 1.00 0.00 ? 12  PHE A HE1  5  
ATOM 9240  H HE2  . PHE A 1 12  ? 0.566   7.410   -14.427 1.00 0.00 ? 12  PHE A HE2  5  
ATOM 9241  H HZ   . PHE A 1 12  ? 0.156   9.816   -14.317 1.00 0.00 ? 12  PHE A HZ   5  
ATOM 9242  N N    . LYS A 1 13  ? -2.852  5.493   -7.991  1.00 0.00 ? 13  LYS A N    5  
ATOM 9243  C CA   . LYS A 1 13  ? -3.573  4.446   -7.237  1.00 0.00 ? 13  LYS A CA   5  
ATOM 9244  C C    . LYS A 1 13  ? -4.852  5.019   -6.657  1.00 0.00 ? 13  LYS A C    5  
ATOM 9245  O O    . LYS A 1 13  ? -5.867  4.354   -6.609  1.00 0.00 ? 13  LYS A O    5  
ATOM 9246  C CB   . LYS A 1 13  ? -2.680  3.954   -6.090  1.00 0.00 ? 13  LYS A CB   5  
ATOM 9247  C CG   . LYS A 1 13  ? -3.519  3.103   -5.132  1.00 0.00 ? 13  LYS A CG   5  
ATOM 9248  C CD   . LYS A 1 13  ? -2.587  2.347   -4.183  1.00 0.00 ? 13  LYS A CD   5  
ATOM 9249  C CE   . LYS A 1 13  ? -2.168  1.029   -4.835  1.00 0.00 ? 13  LYS A CE   5  
ATOM 9250  N NZ   . LYS A 1 13  ? -0.889  0.542   -4.248  1.00 0.00 ? 13  LYS A NZ   5  
ATOM 9251  H H    . LYS A 1 13  ? -1.900  5.660   -7.825  1.00 0.00 ? 13  LYS A H    5  
ATOM 9252  H HA   . LYS A 1 13  ? -3.824  3.628   -7.914  1.00 0.00 ? 13  LYS A HA   5  
ATOM 9253  H HB2  . LYS A 1 13  ? -1.872  3.360   -6.490  1.00 0.00 ? 13  LYS A HB2  5  
ATOM 9254  H HB3  . LYS A 1 13  ? -2.271  4.800   -5.561  1.00 0.00 ? 13  LYS A HB3  5  
ATOM 9255  H HG2  . LYS A 1 13  ? -4.178  3.742   -4.560  1.00 0.00 ? 13  LYS A HG2  5  
ATOM 9256  H HG3  . LYS A 1 13  ? -4.111  2.399   -5.695  1.00 0.00 ? 13  LYS A HG3  5  
ATOM 9257  H HD2  . LYS A 1 13  ? -1.711  2.946   -3.982  1.00 0.00 ? 13  LYS A HD2  5  
ATOM 9258  H HD3  . LYS A 1 13  ? -3.099  2.146   -3.254  1.00 0.00 ? 13  LYS A HD3  5  
ATOM 9259  H HE2  . LYS A 1 13  ? -2.936  0.286   -4.674  1.00 0.00 ? 13  LYS A HE2  5  
ATOM 9260  H HE3  . LYS A 1 13  ? -2.037  1.175   -5.897  1.00 0.00 ? 13  LYS A HE3  5  
ATOM 9261  H HZ1  . LYS A 1 13  ? -0.997  0.439   -3.219  1.00 0.00 ? 13  LYS A HZ1  5  
ATOM 9262  H HZ2  . LYS A 1 13  ? -0.644  -0.379  -4.665  1.00 0.00 ? 13  LYS A HZ2  5  
ATOM 9263  H HZ3  . LYS A 1 13  ? -0.132  1.226   -4.450  1.00 0.00 ? 13  LYS A HZ3  5  
ATOM 9264  N N    . GLU A 1 14  ? -4.784  6.254   -6.221  1.00 0.00 ? 14  GLU A N    5  
ATOM 9265  C CA   . GLU A 1 14  ? -5.993  6.879   -5.646  1.00 0.00 ? 14  GLU A CA   5  
ATOM 9266  C C    . GLU A 1 14  ? -7.120  6.803   -6.654  1.00 0.00 ? 14  GLU A C    5  
ATOM 9267  O O    . GLU A 1 14  ? -8.200  6.331   -6.355  1.00 0.00 ? 14  GLU A O    5  
ATOM 9268  C CB   . GLU A 1 14  ? -5.689  8.353   -5.341  1.00 0.00 ? 14  GLU A CB   5  
ATOM 9269  C CG   . GLU A 1 14  ? -6.281  8.714   -3.976  1.00 0.00 ? 14  GLU A CG   5  
ATOM 9270  C CD   . GLU A 1 14  ? -5.492  8.000   -2.878  1.00 0.00 ? 14  GLU A CD   5  
ATOM 9271  O OE1  . GLU A 1 14  ? -4.386  8.449   -2.627  1.00 0.00 ? 14  GLU A OE1  5  
ATOM 9272  O OE2  . GLU A 1 14  ? -6.040  7.044   -2.351  1.00 0.00 ? 14  GLU A OE2  5  
ATOM 9273  H H    . GLU A 1 14  ? -3.942  6.757   -6.278  1.00 0.00 ? 14  GLU A H    5  
ATOM 9274  H HA   . GLU A 1 14  ? -6.281  6.341   -4.746  1.00 0.00 ? 14  GLU A HA   5  
ATOM 9275  H HB2  . GLU A 1 14  ? -4.620  8.509   -5.325  1.00 0.00 ? 14  GLU A HB2  5  
ATOM 9276  H HB3  . GLU A 1 14  ? -6.127  8.980   -6.105  1.00 0.00 ? 14  GLU A HB3  5  
ATOM 9277  H HG2  . GLU A 1 14  ? -6.222  9.781   -3.823  1.00 0.00 ? 14  GLU A HG2  5  
ATOM 9278  H HG3  . GLU A 1 14  ? -7.315  8.403   -3.933  1.00 0.00 ? 14  GLU A HG3  5  
ATOM 9279  N N    . ALA A 1 15  ? -6.848  7.274   -7.839  1.00 0.00 ? 15  ALA A N    5  
ATOM 9280  C CA   . ALA A 1 15  ? -7.884  7.238   -8.890  1.00 0.00 ? 15  ALA A CA   5  
ATOM 9281  C C    . ALA A 1 15  ? -8.266  5.796   -9.164  1.00 0.00 ? 15  ALA A C    5  
ATOM 9282  O O    . ALA A 1 15  ? -9.428  5.439   -9.181  1.00 0.00 ? 15  ALA A O    5  
ATOM 9283  C CB   . ALA A 1 15  ? -7.292  7.847   -10.174 1.00 0.00 ? 15  ALA A CB   5  
ATOM 9284  H H    . ALA A 1 15  ? -5.962  7.650   -8.028  1.00 0.00 ? 15  ALA A H    5  
ATOM 9285  H HA   . ALA A 1 15  ? -8.762  7.790   -8.556  1.00 0.00 ? 15  ALA A HA   5  
ATOM 9286  H HB1  . ALA A 1 15  ? -6.791  8.776   -9.941  1.00 0.00 ? 15  ALA A HB1  5  
ATOM 9287  H HB2  . ALA A 1 15  ? -6.579  7.160   -10.607 1.00 0.00 ? 15  ALA A HB2  5  
ATOM 9288  H HB3  . ALA A 1 15  ? -8.080  8.037   -10.887 1.00 0.00 ? 15  ALA A HB3  5  
ATOM 9289  N N    . PHE A 1 16  ? -7.263  4.993   -9.370  1.00 0.00 ? 16  PHE A N    5  
ATOM 9290  C CA   . PHE A 1 16  ? -7.503  3.563   -9.644  1.00 0.00 ? 16  PHE A CA   5  
ATOM 9291  C C    . PHE A 1 16  ? -8.338  2.940   -8.534  1.00 0.00 ? 16  PHE A C    5  
ATOM 9292  O O    . PHE A 1 16  ? -9.059  1.989   -8.756  1.00 0.00 ? 16  PHE A O    5  
ATOM 9293  C CB   . PHE A 1 16  ? -6.133  2.863   -9.690  1.00 0.00 ? 16  PHE A CB   5  
ATOM 9294  C CG   . PHE A 1 16  ? -6.268  1.500   -10.364 1.00 0.00 ? 16  PHE A CG   5  
ATOM 9295  C CD1  . PHE A 1 16  ? -6.587  0.379   -9.619  1.00 0.00 ? 16  PHE A CD1  5  
ATOM 9296  C CD2  . PHE A 1 16  ? -6.058  1.367   -11.723 1.00 0.00 ? 16  PHE A CD2  5  
ATOM 9297  C CE1  . PHE A 1 16  ? -6.692  -0.853  -10.225 1.00 0.00 ? 16  PHE A CE1  5  
ATOM 9298  C CE2  . PHE A 1 16  ? -6.165  0.134   -12.329 1.00 0.00 ? 16  PHE A CE2  5  
ATOM 9299  C CZ   . PHE A 1 16  ? -6.482  -0.976  -11.583 1.00 0.00 ? 16  PHE A CZ   5  
ATOM 9300  H H    . PHE A 1 16  ? -6.351  5.340   -9.350  1.00 0.00 ? 16  PHE A H    5  
ATOM 9301  H HA   . PHE A 1 16  ? -8.027  3.461   -10.594 1.00 0.00 ? 16  PHE A HA   5  
ATOM 9302  H HB2  . PHE A 1 16  ? -5.433  3.467   -10.249 1.00 0.00 ? 16  PHE A HB2  5  
ATOM 9303  H HB3  . PHE A 1 16  ? -5.759  2.728   -8.686  1.00 0.00 ? 16  PHE A HB3  5  
ATOM 9304  H HD1  . PHE A 1 16  ? -6.757  0.470   -8.557  1.00 0.00 ? 16  PHE A HD1  5  
ATOM 9305  H HD2  . PHE A 1 16  ? -5.806  2.235   -12.315 1.00 0.00 ? 16  PHE A HD2  5  
ATOM 9306  H HE1  . PHE A 1 16  ? -6.933  -1.723  -9.633  1.00 0.00 ? 16  PHE A HE1  5  
ATOM 9307  H HE2  . PHE A 1 16  ? -5.999  0.040   -13.388 1.00 0.00 ? 16  PHE A HE2  5  
ATOM 9308  H HZ   . PHE A 1 16  ? -6.570  -1.942  -12.063 1.00 0.00 ? 16  PHE A HZ   5  
ATOM 9309  N N    . SER A 1 17  ? -8.224  3.489   -7.352  1.00 0.00 ? 17  SER A N    5  
ATOM 9310  C CA   . SER A 1 17  ? -9.004  2.943   -6.216  1.00 0.00 ? 17  SER A CA   5  
ATOM 9311  C C    . SER A 1 17  ? -10.417 3.507   -6.215  1.00 0.00 ? 17  SER A C    5  
ATOM 9312  O O    . SER A 1 17  ? -11.362 2.823   -5.880  1.00 0.00 ? 17  SER A O    5  
ATOM 9313  C CB   . SER A 1 17  ? -8.309  3.351   -4.907  1.00 0.00 ? 17  SER A CB   5  
ATOM 9314  O OG   . SER A 1 17  ? -9.325  3.233   -3.922  1.00 0.00 ? 17  SER A OG   5  
ATOM 9315  H H    . SER A 1 17  ? -7.627  4.254   -7.218  1.00 0.00 ? 17  SER A H    5  
ATOM 9316  H HA   . SER A 1 17  ? -9.053  1.861   -6.309  1.00 0.00 ? 17  SER A HA   5  
ATOM 9317  H HB2  . SER A 1 17  ? -7.492  2.684   -4.682  1.00 0.00 ? 17  SER A HB2  5  
ATOM 9318  H HB3  . SER A 1 17  ? -7.958  4.371   -4.961  1.00 0.00 ? 17  SER A HB3  5  
ATOM 9319  H HG   . SER A 1 17  ? -9.901  3.999   -3.996  1.00 0.00 ? 17  SER A HG   5  
ATOM 9320  N N    . LEU A 1 18  ? -10.533 4.747   -6.595  1.00 0.00 ? 18  LEU A N    5  
ATOM 9321  C CA   . LEU A 1 18  ? -11.873 5.374   -6.623  1.00 0.00 ? 18  LEU A CA   5  
ATOM 9322  C C    . LEU A 1 18  ? -12.830 4.569   -7.487  1.00 0.00 ? 18  LEU A C    5  
ATOM 9323  O O    . LEU A 1 18  ? -13.983 4.398   -7.144  1.00 0.00 ? 18  LEU A O    5  
ATOM 9324  C CB   . LEU A 1 18  ? -11.737 6.780   -7.225  1.00 0.00 ? 18  LEU A CB   5  
ATOM 9325  C CG   . LEU A 1 18  ? -11.302 7.753   -6.130  1.00 0.00 ? 18  LEU A CG   5  
ATOM 9326  C CD1  . LEU A 1 18  ? -11.094 9.140   -6.742  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 9327  C CD2  . LEU A 1 18  ? -12.396 7.831   -5.062  1.00 0.00 ? 18  LEU A CD2  5  
ATOM 9328  H H    . LEU A 1 18  ? -9.741  5.259   -6.859  1.00 0.00 ? 18  LEU A H    5  
ATOM 9329  H HA   . LEU A 1 18  ? -12.263 5.424   -5.611  1.00 0.00 ? 18  LEU A HA   5  
ATOM 9330  H HB2  . LEU A 1 18  ? -10.999 6.768   -8.013  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 9331  H HB3  . LEU A 1 18  ? -12.686 7.095   -7.635  1.00 0.00 ? 18  LEU A HB3  5  
ATOM 9332  H HG   . LEU A 1 18  ? -10.383 7.408   -5.684  1.00 0.00 ? 18  LEU A HG   5  
ATOM 9333  H HD11 . LEU A 1 18  ? -10.364 9.083   -7.536  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 9334  H HD12 . LEU A 1 18  ? -12.027 9.505   -7.142  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 9335  H HD13 . LEU A 1 18  ? -10.740 9.824   -5.983  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 9336  H HD21 . LEU A 1 18  ? -13.334 7.493   -5.476  1.00 0.00 ? 18  LEU A HD21 5  
ATOM 9337  H HD22 . LEU A 1 18  ? -12.131 7.204   -4.224  1.00 0.00 ? 18  LEU A HD22 5  
ATOM 9338  H HD23 . LEU A 1 18  ? -12.503 8.851   -4.724  1.00 0.00 ? 18  LEU A HD23 5  
ATOM 9339  N N    . PHE A 1 19  ? -12.330 4.084   -8.592  1.00 0.00 ? 19  PHE A N    5  
ATOM 9340  C CA   . PHE A 1 19  ? -13.189 3.285   -9.500  1.00 0.00 ? 19  PHE A CA   5  
ATOM 9341  C C    . PHE A 1 19  ? -12.980 1.793   -9.296  1.00 0.00 ? 19  PHE A C    5  
ATOM 9342  O O    . PHE A 1 19  ? -13.169 1.007   -10.205 1.00 0.00 ? 19  PHE A O    5  
ATOM 9343  C CB   . PHE A 1 19  ? -12.827 3.660   -10.939 1.00 0.00 ? 19  PHE A CB   5  
ATOM 9344  C CG   . PHE A 1 19  ? -12.986 5.172   -11.098 1.00 0.00 ? 19  PHE A CG   5  
ATOM 9345  C CD1  . PHE A 1 19  ? -14.246 5.742   -11.142 1.00 0.00 ? 19  PHE A CD1  5  
ATOM 9346  C CD2  . PHE A 1 19  ? -11.873 5.994   -11.169 1.00 0.00 ? 19  PHE A CD2  5  
ATOM 9347  C CE1  . PHE A 1 19  ? -14.392 7.108   -11.254 1.00 0.00 ? 19  PHE A CE1  5  
ATOM 9348  C CE2  . PHE A 1 19  ? -12.023 7.361   -11.281 1.00 0.00 ? 19  PHE A CE2  5  
ATOM 9349  C CZ   . PHE A 1 19  ? -13.282 7.917   -11.323 1.00 0.00 ? 19  PHE A CZ   5  
ATOM 9350  H H    . PHE A 1 19  ? -11.393 4.248   -8.821  1.00 0.00 ? 19  PHE A H    5  
ATOM 9351  H HA   . PHE A 1 19  ? -14.227 3.521   -9.295  1.00 0.00 ? 19  PHE A HA   5  
ATOM 9352  H HB2  . PHE A 1 19  ? -11.805 3.382   -11.147 1.00 0.00 ? 19  PHE A HB2  5  
ATOM 9353  H HB3  . PHE A 1 19  ? -13.486 3.154   -11.630 1.00 0.00 ? 19  PHE A HB3  5  
ATOM 9354  H HD1  . PHE A 1 19  ? -15.120 5.111   -11.090 1.00 0.00 ? 19  PHE A HD1  5  
ATOM 9355  H HD2  . PHE A 1 19  ? -10.883 5.562   -11.134 1.00 0.00 ? 19  PHE A HD2  5  
ATOM 9356  H HE1  . PHE A 1 19  ? -15.379 7.544   -11.285 1.00 0.00 ? 19  PHE A HE1  5  
ATOM 9357  H HE2  . PHE A 1 19  ? -11.151 7.996   -11.336 1.00 0.00 ? 19  PHE A HE2  5  
ATOM 9358  H HZ   . PHE A 1 19  ? -13.397 8.987   -11.409 1.00 0.00 ? 19  PHE A HZ   5  
ATOM 9359  N N    . ASP A 1 20  ? -12.592 1.434   -8.105  1.00 0.00 ? 20  ASP A N    5  
ATOM 9360  C CA   . ASP A 1 20  ? -12.361 -0.001  -7.799  1.00 0.00 ? 20  ASP A CA   5  
ATOM 9361  C C    . ASP A 1 20  ? -12.935 -0.350  -6.433  1.00 0.00 ? 20  ASP A C    5  
ATOM 9362  O O    . ASP A 1 20  ? -12.636 0.295   -5.447  1.00 0.00 ? 20  ASP A O    5  
ATOM 9363  C CB   . ASP A 1 20  ? -10.850 -0.264  -7.779  1.00 0.00 ? 20  ASP A CB   5  
ATOM 9364  C CG   . ASP A 1 20  ? -10.605 -1.762  -7.599  1.00 0.00 ? 20  ASP A CG   5  
ATOM 9365  O OD1  . ASP A 1 20  ? -11.430 -2.370  -6.935  1.00 0.00 ? 20  ASP A OD1  5  
ATOM 9366  O OD2  . ASP A 1 20  ? -9.608  -2.216  -8.134  1.00 0.00 ? 20  ASP A OD2  5  
ATOM 9367  H H    . ASP A 1 20  ? -12.446 2.110   -7.416  1.00 0.00 ? 20  ASP A H    5  
ATOM 9368  H HA   . ASP A 1 20  ? -12.850 -0.610  -8.553  1.00 0.00 ? 20  ASP A HA   5  
ATOM 9369  H HB2  . ASP A 1 20  ? -10.410 0.060   -8.709  1.00 0.00 ? 20  ASP A HB2  5  
ATOM 9370  H HB3  . ASP A 1 20  ? -10.397 0.272   -6.961  1.00 0.00 ? 20  ASP A HB3  5  
ATOM 9371  N N    . LYS A 1 21  ? -13.749 -1.367  -6.399  1.00 0.00 ? 21  LYS A N    5  
ATOM 9372  C CA   . LYS A 1 21  ? -14.353 -1.773  -5.106  1.00 0.00 ? 21  LYS A CA   5  
ATOM 9373  C C    . LYS A 1 21  ? -13.273 -2.144  -4.090  1.00 0.00 ? 21  LYS A C    5  
ATOM 9374  O O    . LYS A 1 21  ? -13.566 -2.660  -3.031  1.00 0.00 ? 21  LYS A O    5  
ATOM 9375  C CB   . LYS A 1 21  ? -15.243 -2.999  -5.356  1.00 0.00 ? 21  LYS A CB   5  
ATOM 9376  C CG   . LYS A 1 21  ? -16.311 -2.643  -6.397  1.00 0.00 ? 21  LYS A CG   5  
ATOM 9377  C CD   . LYS A 1 21  ? -17.286 -1.628  -5.794  1.00 0.00 ? 21  LYS A CD   5  
ATOM 9378  C CE   . LYS A 1 21  ? -18.716 -1.994  -6.204  1.00 0.00 ? 21  LYS A CE   5  
ATOM 9379  N NZ   . LYS A 1 21  ? -18.750 -2.464  -7.618  1.00 0.00 ? 21  LYS A NZ   5  
ATOM 9380  H H    . LYS A 1 21  ? -13.961 -1.859  -7.219  1.00 0.00 ? 21  LYS A H    5  
ATOM 9381  H HA   . LYS A 1 21  ? -14.939 -0.943  -4.712  1.00 0.00 ? 21  LYS A HA   5  
ATOM 9382  H HB2  . LYS A 1 21  ? -14.639 -3.817  -5.721  1.00 0.00 ? 21  LYS A HB2  5  
ATOM 9383  H HB3  . LYS A 1 21  ? -15.719 -3.295  -4.433  1.00 0.00 ? 21  LYS A HB3  5  
ATOM 9384  H HG2  . LYS A 1 21  ? -15.838 -2.218  -7.271  1.00 0.00 ? 21  LYS A HG2  5  
ATOM 9385  H HG3  . LYS A 1 21  ? -16.849 -3.535  -6.685  1.00 0.00 ? 21  LYS A HG3  5  
ATOM 9386  H HD2  . LYS A 1 21  ? -17.203 -1.642  -4.717  1.00 0.00 ? 21  LYS A HD2  5  
ATOM 9387  H HD3  . LYS A 1 21  ? -17.047 -0.639  -6.154  1.00 0.00 ? 21  LYS A HD3  5  
ATOM 9388  H HE2  . LYS A 1 21  ? -19.086 -2.779  -5.562  1.00 0.00 ? 21  LYS A HE2  5  
ATOM 9389  H HE3  . LYS A 1 21  ? -19.353 -1.128  -6.105  1.00 0.00 ? 21  LYS A HE3  5  
ATOM 9390  H HZ1  . LYS A 1 21  ? -17.903 -2.125  -8.118  1.00 0.00 ? 21  LYS A HZ1  5  
ATOM 9391  H HZ2  . LYS A 1 21  ? -18.770 -3.503  -7.638  1.00 0.00 ? 21  LYS A HZ2  5  
ATOM 9392  H HZ3  . LYS A 1 21  ? -19.601 -2.092  -8.086  1.00 0.00 ? 21  LYS A HZ3  5  
ATOM 9393  N N    . ASP A 1 22  ? -12.041 -1.875  -4.436  1.00 0.00 ? 22  ASP A N    5  
ATOM 9394  C CA   . ASP A 1 22  ? -10.930 -2.204  -3.506  1.00 0.00 ? 22  ASP A CA   5  
ATOM 9395  C C    . ASP A 1 22  ? -10.818 -3.711  -3.303  1.00 0.00 ? 22  ASP A C    5  
ATOM 9396  O O    . ASP A 1 22  ? -9.809  -4.203  -2.836  1.00 0.00 ? 22  ASP A O    5  
ATOM 9397  C CB   . ASP A 1 22  ? -11.217 -1.534  -2.150  1.00 0.00 ? 22  ASP A CB   5  
ATOM 9398  C CG   . ASP A 1 22  ? -10.066 -0.586  -1.801  1.00 0.00 ? 22  ASP A CG   5  
ATOM 9399  O OD1  . ASP A 1 22  ? -8.944  -1.066  -1.822  1.00 0.00 ? 22  ASP A OD1  5  
ATOM 9400  O OD2  . ASP A 1 22  ? -10.374 0.564   -1.534  1.00 0.00 ? 22  ASP A OD2  5  
ATOM 9401  H H    . ASP A 1 22  ? -11.851 -1.464  -5.301  1.00 0.00 ? 22  ASP A H    5  
ATOM 9402  H HA   . ASP A 1 22  ? -9.996  -1.834  -3.930  1.00 0.00 ? 22  ASP A HA   5  
ATOM 9403  H HB2  . ASP A 1 22  ? -12.137 -0.972  -2.207  1.00 0.00 ? 22  ASP A HB2  5  
ATOM 9404  H HB3  . ASP A 1 22  ? -11.306 -2.287  -1.380  1.00 0.00 ? 22  ASP A HB3  5  
ATOM 9405  N N    . GLY A 1 23  ? -11.856 -4.418  -3.657  1.00 0.00 ? 23  GLY A N    5  
ATOM 9406  C CA   . GLY A 1 23  ? -11.827 -5.898  -3.492  1.00 0.00 ? 23  GLY A CA   5  
ATOM 9407  C C    . GLY A 1 23  ? -11.334 -6.563  -4.778  1.00 0.00 ? 23  GLY A C    5  
ATOM 9408  O O    . GLY A 1 23  ? -10.575 -7.512  -4.739  1.00 0.00 ? 23  GLY A O    5  
ATOM 9409  H H    . GLY A 1 23  ? -12.648 -3.979  -4.027  1.00 0.00 ? 23  GLY A H    5  
ATOM 9410  H HA2  . GLY A 1 23  ? -11.162 -6.154  -2.680  1.00 0.00 ? 23  GLY A HA2  5  
ATOM 9411  H HA3  . GLY A 1 23  ? -12.821 -6.252  -3.264  1.00 0.00 ? 23  GLY A HA3  5  
ATOM 9412  N N    . ASP A 1 24  ? -11.779 -6.053  -5.895  1.00 0.00 ? 24  ASP A N    5  
ATOM 9413  C CA   . ASP A 1 24  ? -11.349 -6.639  -7.188  1.00 0.00 ? 24  ASP A CA   5  
ATOM 9414  C C    . ASP A 1 24  ? -9.854  -6.437  -7.400  1.00 0.00 ? 24  ASP A C    5  
ATOM 9415  O O    . ASP A 1 24  ? -9.181  -7.288  -7.948  1.00 0.00 ? 24  ASP A O    5  
ATOM 9416  C CB   . ASP A 1 24  ? -12.108 -5.930  -8.318  1.00 0.00 ? 24  ASP A CB   5  
ATOM 9417  C CG   . ASP A 1 24  ? -13.606 -5.948  -8.011  1.00 0.00 ? 24  ASP A CG   5  
ATOM 9418  O OD1  . ASP A 1 24  ? -13.920 -6.197  -6.859  1.00 0.00 ? 24  ASP A OD1  5  
ATOM 9419  O OD2  . ASP A 1 24  ? -14.353 -5.713  -8.947  1.00 0.00 ? 24  ASP A OD2  5  
ATOM 9420  H H    . ASP A 1 24  ? -12.392 -5.289  -5.878  1.00 0.00 ? 24  ASP A H    5  
ATOM 9421  H HA   . ASP A 1 24  ? -11.567 -7.707  -7.185  1.00 0.00 ? 24  ASP A HA   5  
ATOM 9422  H HB2  . ASP A 1 24  ? -11.773 -4.907  -8.398  1.00 0.00 ? 24  ASP A HB2  5  
ATOM 9423  H HB3  . ASP A 1 24  ? -11.930 -6.437  -9.253  1.00 0.00 ? 24  ASP A HB3  5  
ATOM 9424  N N    . GLY A 1 25  ? -9.363  -5.309  -6.963  1.00 0.00 ? 25  GLY A N    5  
ATOM 9425  C CA   . GLY A 1 25  ? -7.909  -5.025  -7.128  1.00 0.00 ? 25  GLY A CA   5  
ATOM 9426  C C    . GLY A 1 25  ? -7.601  -4.574  -8.558  1.00 0.00 ? 25  GLY A C    5  
ATOM 9427  O O    . GLY A 1 25  ? -6.477  -4.237  -8.873  1.00 0.00 ? 25  GLY A O    5  
ATOM 9428  H H    . GLY A 1 25  ? -9.947  -4.652  -6.531  1.00 0.00 ? 25  GLY A H    5  
ATOM 9429  H HA2  . GLY A 1 25  ? -7.619  -4.245  -6.440  1.00 0.00 ? 25  GLY A HA2  5  
ATOM 9430  H HA3  . GLY A 1 25  ? -7.346  -5.921  -6.909  1.00 0.00 ? 25  GLY A HA3  5  
ATOM 9431  N N    . THR A 1 26  ? -8.603  -4.572  -9.393  1.00 0.00 ? 26  THR A N    5  
ATOM 9432  C CA   . THR A 1 26  ? -8.373  -4.146  -10.793 1.00 0.00 ? 26  THR A CA   5  
ATOM 9433  C C    . THR A 1 26  ? -9.622  -3.506  -11.388 1.00 0.00 ? 26  THR A C    5  
ATOM 9434  O O    . THR A 1 26  ? -10.717 -3.712  -10.903 1.00 0.00 ? 26  THR A O    5  
ATOM 9435  C CB   . THR A 1 26  ? -8.017  -5.381  -11.620 1.00 0.00 ? 26  THR A CB   5  
ATOM 9436  O OG1  . THR A 1 26  ? -9.221  -6.112  -11.737 1.00 0.00 ? 26  THR A OG1  5  
ATOM 9437  C CG2  . THR A 1 26  ? -7.074  -6.312  -10.841 1.00 0.00 ? 26  THR A CG2  5  
ATOM 9438  H H    . THR A 1 26  ? -9.493  -4.846  -9.100  1.00 0.00 ? 26  THR A H    5  
ATOM 9439  H HA   . THR A 1 26  ? -7.563  -3.426  -10.814 1.00 0.00 ? 26  THR A HA   5  
ATOM 9440  H HB   . THR A 1 26  ? -7.631  -5.112  -12.599 1.00 0.00 ? 26  THR A HB   5  
ATOM 9441  H HG1  . THR A 1 26  ? -9.880  -5.536  -12.132 1.00 0.00 ? 26  THR A HG1  5  
ATOM 9442  H HG21 . THR A 1 26  ? -7.542  -6.616  -9.917  1.00 0.00 ? 26  THR A HG21 5  
ATOM 9443  H HG22 . THR A 1 26  ? -6.854  -7.188  -11.433 1.00 0.00 ? 26  THR A HG22 5  
ATOM 9444  H HG23 . THR A 1 26  ? -6.153  -5.794  -10.619 1.00 0.00 ? 26  THR A HG23 5  
ATOM 9445  N N    . ILE A 1 27  ? -9.426  -2.740  -12.439 1.00 0.00 ? 27  ILE A N    5  
ATOM 9446  C CA   . ILE A 1 27  ? -10.579 -2.066  -13.100 1.00 0.00 ? 27  ILE A CA   5  
ATOM 9447  C C    . ILE A 1 27  ? -10.738 -2.604  -14.505 1.00 0.00 ? 27  ILE A C    5  
ATOM 9448  O O    . ILE A 1 27  ? -9.796  -3.088  -15.081 1.00 0.00 ? 27  ILE A O    5  
ATOM 9449  C CB   . ILE A 1 27  ? -10.296 -0.559  -13.184 1.00 0.00 ? 27  ILE A CB   5  
ATOM 9450  C CG1  . ILE A 1 27  ? -9.036  -0.312  -14.009 1.00 0.00 ? 27  ILE A CG1  5  
ATOM 9451  C CG2  . ILE A 1 27  ? -10.071 -0.017  -11.757 1.00 0.00 ? 27  ILE A CG2  5  
ATOM 9452  C CD1  . ILE A 1 27  ? -8.912  1.176   -14.307 1.00 0.00 ? 27  ILE A CD1  5  
ATOM 9453  H H    . ILE A 1 27  ? -8.521  -2.623  -12.799 1.00 0.00 ? 27  ILE A H    5  
ATOM 9454  H HA   . ILE A 1 27  ? -11.490 -2.263  -12.538 1.00 0.00 ? 27  ILE A HA   5  
ATOM 9455  H HB   . ILE A 1 27  ? -11.143 -0.060  -13.662 1.00 0.00 ? 27  ILE A HB   5  
ATOM 9456  H HG12 . ILE A 1 27  ? -8.172  -0.644  -13.461 1.00 0.00 ? 27  ILE A HG12 5  
ATOM 9457  H HG13 . ILE A 1 27  ? -9.097  -0.855  -14.938 1.00 0.00 ? 27  ILE A HG13 5  
ATOM 9458  H HG21 . ILE A 1 27  ? -10.622 -0.618  -11.047 1.00 0.00 ? 27  ILE A HG21 5  
ATOM 9459  H HG22 . ILE A 1 27  ? -9.019  -0.053  -11.514 1.00 0.00 ? 27  ILE A HG22 5  
ATOM 9460  H HG23 . ILE A 1 27  ? -10.415 1.006   -11.697 1.00 0.00 ? 27  ILE A HG23 5  
ATOM 9461  H HD11 . ILE A 1 27  ? -8.854  1.729   -13.385 1.00 0.00 ? 27  ILE A HD11 5  
ATOM 9462  H HD12 . ILE A 1 27  ? -8.019  1.358   -14.889 1.00 0.00 ? 27  ILE A HD12 5  
ATOM 9463  H HD13 . ILE A 1 27  ? -9.772  1.505   -14.866 1.00 0.00 ? 27  ILE A HD13 5  
ATOM 9464  N N    . THR A 1 28  ? -11.918 -2.517  -15.035 1.00 0.00 ? 28  THR A N    5  
ATOM 9465  C CA   . THR A 1 28  ? -12.121 -3.031  -16.408 1.00 0.00 ? 28  THR A CA   5  
ATOM 9466  C C    . THR A 1 28  ? -11.860 -1.952  -17.442 1.00 0.00 ? 28  THR A C    5  
ATOM 9467  O O    . THR A 1 28  ? -12.161 -0.794  -17.232 1.00 0.00 ? 28  THR A O    5  
ATOM 9468  C CB   . THR A 1 28  ? -13.560 -3.506  -16.546 1.00 0.00 ? 28  THR A CB   5  
ATOM 9469  O OG1  . THR A 1 28  ? -14.343 -2.526  -15.898 1.00 0.00 ? 28  THR A OG1  5  
ATOM 9470  C CG2  . THR A 1 28  ? -13.787 -4.787  -15.735 1.00 0.00 ? 28  THR A CG2  5  
ATOM 9471  H H    . THR A 1 28  ? -12.662 -2.120  -14.536 1.00 0.00 ? 28  THR A H    5  
ATOM 9472  H HA   . THR A 1 28  ? -11.428 -3.855  -16.583 1.00 0.00 ? 28  THR A HA   5  
ATOM 9473  H HB   . THR A 1 28  ? -13.847 -3.610  -17.590 1.00 0.00 ? 28  THR A HB   5  
ATOM 9474  H HG1  . THR A 1 28  ? -13.954 -1.667  -16.082 1.00 0.00 ? 28  THR A HG1  5  
ATOM 9475  H HG21 . THR A 1 28  ? -13.357 -4.674  -14.750 1.00 0.00 ? 28  THR A HG21 5  
ATOM 9476  H HG22 . THR A 1 28  ? -14.844 -4.977  -15.644 1.00 0.00 ? 28  THR A HG22 5  
ATOM 9477  H HG23 . THR A 1 28  ? -13.316 -5.622  -16.234 1.00 0.00 ? 28  THR A HG23 5  
ATOM 9478  N N    . THR A 1 29  ? -11.290 -2.361  -18.535 1.00 0.00 ? 29  THR A N    5  
ATOM 9479  C CA   . THR A 1 29  ? -10.983 -1.403  -19.625 1.00 0.00 ? 29  THR A CA   5  
ATOM 9480  C C    . THR A 1 29  ? -12.073 -0.347  -19.778 1.00 0.00 ? 29  THR A C    5  
ATOM 9481  O O    . THR A 1 29  ? -11.799 0.774   -20.159 1.00 0.00 ? 29  THR A O    5  
ATOM 9482  C CB   . THR A 1 29  ? -10.890 -2.194  -20.925 1.00 0.00 ? 29  THR A CB   5  
ATOM 9483  O OG1  . THR A 1 29  ? -11.979 -3.094  -20.892 1.00 0.00 ? 29  THR A OG1  5  
ATOM 9484  C CG2  . THR A 1 29  ? -9.645  -3.090  -20.930 1.00 0.00 ? 29  THR A CG2  5  
ATOM 9485  H H    . THR A 1 29  ? -11.050 -3.304  -18.633 1.00 0.00 ? 29  THR A H    5  
ATOM 9486  H HA   . THR A 1 29  ? -10.038 -0.908  -19.406 1.00 0.00 ? 29  THR A HA   5  
ATOM 9487  H HB   . THR A 1 29  ? -10.951 -1.548  -21.791 1.00 0.00 ? 29  THR A HB   5  
ATOM 9488  H HG1  . THR A 1 29  ? -12.687 -2.688  -20.386 1.00 0.00 ? 29  THR A HG1  5  
ATOM 9489  H HG21 . THR A 1 29  ? -9.582  -3.630  -19.996 1.00 0.00 ? 29  THR A HG21 5  
ATOM 9490  H HG22 . THR A 1 29  ? -9.707  -3.795  -21.745 1.00 0.00 ? 29  THR A HG22 5  
ATOM 9491  H HG23 . THR A 1 29  ? -8.760  -2.484  -21.050 1.00 0.00 ? 29  THR A HG23 5  
ATOM 9492  N N    . LYS A 1 30  ? -13.291 -0.717  -19.487 1.00 0.00 ? 30  LYS A N    5  
ATOM 9493  C CA   . LYS A 1 30  ? -14.390 0.270   -19.619 1.00 0.00 ? 30  LYS A CA   5  
ATOM 9494  C C    . LYS A 1 30  ? -14.249 1.368   -18.572 1.00 0.00 ? 30  LYS A C    5  
ATOM 9495  O O    . LYS A 1 30  ? -14.414 2.536   -18.865 1.00 0.00 ? 30  LYS A O    5  
ATOM 9496  C CB   . LYS A 1 30  ? -15.740 -0.459  -19.432 1.00 0.00 ? 30  LYS A CB   5  
ATOM 9497  C CG   . LYS A 1 30  ? -16.052 -0.621  -17.943 1.00 0.00 ? 30  LYS A CG   5  
ATOM 9498  C CD   . LYS A 1 30  ? -17.374 -1.381  -17.792 1.00 0.00 ? 30  LYS A CD   5  
ATOM 9499  C CE   . LYS A 1 30  ? -17.224 -2.458  -16.714 1.00 0.00 ? 30  LYS A CE   5  
ATOM 9500  N NZ   . LYS A 1 30  ? -16.568 -3.672  -17.277 1.00 0.00 ? 30  LYS A NZ   5  
ATOM 9501  H H    . LYS A 1 30  ? -13.474 -1.632  -19.183 1.00 0.00 ? 30  LYS A H    5  
ATOM 9502  H HA   . LYS A 1 30  ? -14.333 0.724   -20.607 1.00 0.00 ? 30  LYS A HA   5  
ATOM 9503  H HB2  . LYS A 1 30  ? -16.524 0.111   -19.904 1.00 0.00 ? 30  LYS A HB2  5  
ATOM 9504  H HB3  . LYS A 1 30  ? -15.688 -1.433  -19.896 1.00 0.00 ? 30  LYS A HB3  5  
ATOM 9505  H HG2  . LYS A 1 30  ? -15.259 -1.171  -17.463 1.00 0.00 ? 30  LYS A HG2  5  
ATOM 9506  H HG3  . LYS A 1 30  ? -16.142 0.350   -17.481 1.00 0.00 ? 30  LYS A HG3  5  
ATOM 9507  H HD2  . LYS A 1 30  ? -18.157 -0.694  -17.509 1.00 0.00 ? 30  LYS A HD2  5  
ATOM 9508  H HD3  . LYS A 1 30  ? -17.634 -1.844  -18.732 1.00 0.00 ? 30  LYS A HD3  5  
ATOM 9509  H HE2  . LYS A 1 30  ? -16.622 -2.077  -15.903 1.00 0.00 ? 30  LYS A HE2  5  
ATOM 9510  H HE3  . LYS A 1 30  ? -18.199 -2.729  -16.335 1.00 0.00 ? 30  LYS A HE3  5  
ATOM 9511  H HZ1  . LYS A 1 30  ? -16.187 -3.455  -18.220 1.00 0.00 ? 30  LYS A HZ1  5  
ATOM 9512  H HZ2  . LYS A 1 30  ? -15.794 -3.970  -16.651 1.00 0.00 ? 30  LYS A HZ2  5  
ATOM 9513  H HZ3  . LYS A 1 30  ? -17.267 -4.439  -17.353 1.00 0.00 ? 30  LYS A HZ3  5  
ATOM 9514  N N    . GLU A 1 31  ? -13.944 0.973   -17.369 1.00 0.00 ? 31  GLU A N    5  
ATOM 9515  C CA   . GLU A 1 31  ? -13.786 1.978   -16.290 1.00 0.00 ? 31  GLU A CA   5  
ATOM 9516  C C    . GLU A 1 31  ? -12.468 2.723   -16.444 1.00 0.00 ? 31  GLU A C    5  
ATOM 9517  O O    . GLU A 1 31  ? -12.229 3.716   -15.789 1.00 0.00 ? 31  GLU A O    5  
ATOM 9518  C CB   . GLU A 1 31  ? -13.781 1.242   -14.941 1.00 0.00 ? 31  GLU A CB   5  
ATOM 9519  C CG   . GLU A 1 31  ? -15.115 0.515   -14.759 1.00 0.00 ? 31  GLU A CG   5  
ATOM 9520  C CD   . GLU A 1 31  ? -16.262 1.496   -15.003 1.00 0.00 ? 31  GLU A CD   5  
ATOM 9521  O OE1  . GLU A 1 31  ? -16.120 2.617   -14.545 1.00 0.00 ? 31  GLU A OE1  5  
ATOM 9522  O OE2  . GLU A 1 31  ? -17.216 1.070   -15.634 1.00 0.00 ? 31  GLU A OE2  5  
ATOM 9523  H H    . GLU A 1 31  ? -13.823 0.020   -17.179 1.00 0.00 ? 31  GLU A H    5  
ATOM 9524  H HA   . GLU A 1 31  ? -14.606 2.691   -16.343 1.00 0.00 ? 31  GLU A HA   5  
ATOM 9525  H HB2  . GLU A 1 31  ? -12.972 0.527   -14.922 1.00 0.00 ? 31  GLU A HB2  5  
ATOM 9526  H HB3  . GLU A 1 31  ? -13.643 1.954   -14.140 1.00 0.00 ? 31  GLU A HB3  5  
ATOM 9527  H HG2  . GLU A 1 31  ? -15.186 -0.300  -15.460 1.00 0.00 ? 31  GLU A HG2  5  
ATOM 9528  H HG3  . GLU A 1 31  ? -15.185 0.129   -13.754 1.00 0.00 ? 31  GLU A HG3  5  
ATOM 9529  N N    . LEU A 1 32  ? -11.639 2.229   -17.312 1.00 0.00 ? 32  LEU A N    5  
ATOM 9530  C CA   . LEU A 1 32  ? -10.335 2.881   -17.535 1.00 0.00 ? 32  LEU A CA   5  
ATOM 9531  C C    . LEU A 1 32  ? -10.494 4.371   -17.808 1.00 0.00 ? 32  LEU A C    5  
ATOM 9532  O O    . LEU A 1 32  ? -10.095 5.199   -17.014 1.00 0.00 ? 32  LEU A O    5  
ATOM 9533  C CB   . LEU A 1 32  ? -9.704  2.235   -18.763 1.00 0.00 ? 32  LEU A CB   5  
ATOM 9534  C CG   . LEU A 1 32  ? -8.238  2.626   -18.835 1.00 0.00 ? 32  LEU A CG   5  
ATOM 9535  C CD1  . LEU A 1 32  ? -7.463  1.878   -17.748 1.00 0.00 ? 32  LEU A CD1  5  
ATOM 9536  C CD2  . LEU A 1 32  ? -7.696  2.240   -20.207 1.00 0.00 ? 32  LEU A CD2  5  
ATOM 9537  H H    . LEU A 1 32  ? -11.876 1.426   -17.821 1.00 0.00 ? 32  LEU A H    5  
ATOM 9538  H HA   . LEU A 1 32  ? -9.707  2.738   -16.656 1.00 0.00 ? 32  LEU A HA   5  
ATOM 9539  H HB2  . LEU A 1 32  ? -9.793  1.162   -18.696 1.00 0.00 ? 32  LEU A HB2  5  
ATOM 9540  H HB3  . LEU A 1 32  ? -10.214 2.576   -19.652 1.00 0.00 ? 32  LEU A HB3  5  
ATOM 9541  H HG   . LEU A 1 32  ? -8.135  3.691   -18.689 1.00 0.00 ? 32  LEU A HG   5  
ATOM 9542  H HD11 . LEU A 1 32  ? -7.965  0.949   -17.516 1.00 0.00 ? 32  LEU A HD11 5  
ATOM 9543  H HD12 . LEU A 1 32  ? -6.463  1.666   -18.093 1.00 0.00 ? 32  LEU A HD12 5  
ATOM 9544  H HD13 . LEU A 1 32  ? -7.410  2.483   -16.856 1.00 0.00 ? 32  LEU A HD13 5  
ATOM 9545  H HD21 . LEU A 1 32  ? -8.397  2.543   -20.971 1.00 0.00 ? 32  LEU A HD21 5  
ATOM 9546  H HD22 . LEU A 1 32  ? -6.751  2.729   -20.376 1.00 0.00 ? 32  LEU A HD22 5  
ATOM 9547  H HD23 . LEU A 1 32  ? -7.559  1.171   -20.255 1.00 0.00 ? 32  LEU A HD23 5  
ATOM 9548  N N    . GLY A 1 33  ? -11.081 4.679   -18.934 1.00 0.00 ? 33  GLY A N    5  
ATOM 9549  C CA   . GLY A 1 33  ? -11.285 6.110   -19.300 1.00 0.00 ? 33  GLY A CA   5  
ATOM 9550  C C    . GLY A 1 33  ? -11.709 6.931   -18.085 1.00 0.00 ? 33  GLY A C    5  
ATOM 9551  O O    . GLY A 1 33  ? -11.231 8.030   -17.879 1.00 0.00 ? 33  GLY A O    5  
ATOM 9552  H H    . GLY A 1 33  ? -11.396 3.971   -19.529 1.00 0.00 ? 33  GLY A H    5  
ATOM 9553  H HA2  . GLY A 1 33  ? -10.362 6.509   -19.695 1.00 0.00 ? 33  GLY A HA2  5  
ATOM 9554  H HA3  . GLY A 1 33  ? -12.051 6.175   -20.059 1.00 0.00 ? 33  GLY A HA3  5  
ATOM 9555  N N    . THR A 1 34  ? -12.594 6.387   -17.305 1.00 0.00 ? 34  THR A N    5  
ATOM 9556  C CA   . THR A 1 34  ? -13.052 7.127   -16.107 1.00 0.00 ? 34  THR A CA   5  
ATOM 9557  C C    . THR A 1 34  ? -11.886 7.391   -15.161 1.00 0.00 ? 34  THR A C    5  
ATOM 9558  O O    . THR A 1 34  ? -11.748 8.475   -14.627 1.00 0.00 ? 34  THR A O    5  
ATOM 9559  C CB   . THR A 1 34  ? -14.111 6.281   -15.390 1.00 0.00 ? 34  THR A CB   5  
ATOM 9560  O OG1  . THR A 1 34  ? -15.355 6.791   -15.830 1.00 0.00 ? 34  THR A OG1  5  
ATOM 9561  C CG2  . THR A 1 34  ? -14.099 6.544   -13.875 1.00 0.00 ? 34  THR A CG2  5  
ATOM 9562  H H    . THR A 1 34  ? -12.949 5.494   -17.507 1.00 0.00 ? 34  THR A H    5  
ATOM 9563  H HA   . THR A 1 34  ? -13.468 8.082   -16.424 1.00 0.00 ? 34  THR A HA   5  
ATOM 9564  H HB   . THR A 1 34  ? -14.020 5.228   -15.636 1.00 0.00 ? 34  THR A HB   5  
ATOM 9565  H HG1  . THR A 1 34  ? -15.674 7.409   -15.169 1.00 0.00 ? 34  THR A HG1  5  
ATOM 9566  H HG21 . THR A 1 34  ? -14.040 7.607   -13.690 1.00 0.00 ? 34  THR A HG21 5  
ATOM 9567  H HG22 . THR A 1 34  ? -15.003 6.155   -13.431 1.00 0.00 ? 34  THR A HG22 5  
ATOM 9568  H HG23 . THR A 1 34  ? -13.245 6.057   -13.427 1.00 0.00 ? 34  THR A HG23 5  
ATOM 9569  N N    . VAL A 1 35  ? -11.063 6.396   -14.970 1.00 0.00 ? 35  VAL A N    5  
ATOM 9570  C CA   . VAL A 1 35  ? -9.903  6.579   -14.064 1.00 0.00 ? 35  VAL A CA   5  
ATOM 9571  C C    . VAL A 1 35  ? -8.926  7.587   -14.651 1.00 0.00 ? 35  VAL A C    5  
ATOM 9572  O O    . VAL A 1 35  ? -8.401  8.430   -13.950 1.00 0.00 ? 35  VAL A O    5  
ATOM 9573  C CB   . VAL A 1 35  ? -9.182  5.234   -13.908 1.00 0.00 ? 35  VAL A CB   5  
ATOM 9574  C CG1  . VAL A 1 35  ? -8.091  5.370   -12.844 1.00 0.00 ? 35  VAL A CG1  5  
ATOM 9575  C CG2  . VAL A 1 35  ? -10.186 4.169   -13.463 1.00 0.00 ? 35  VAL A CG2  5  
ATOM 9576  H H    . VAL A 1 35  ? -11.211 5.539   -15.420 1.00 0.00 ? 35  VAL A H    5  
ATOM 9577  H HA   . VAL A 1 35  ? -10.257 6.944   -13.103 1.00 0.00 ? 35  VAL A HA   5  
ATOM 9578  H HB   . VAL A 1 35  ? -8.741  4.948   -14.848 1.00 0.00 ? 35  VAL A HB   5  
ATOM 9579  H HG11 . VAL A 1 35  ? -8.531  5.673   -11.907 1.00 0.00 ? 35  VAL A HG11 5  
ATOM 9580  H HG12 . VAL A 1 35  ? -7.591  4.421   -12.712 1.00 0.00 ? 35  VAL A HG12 5  
ATOM 9581  H HG13 . VAL A 1 35  ? -7.370  6.111   -13.155 1.00 0.00 ? 35  VAL A HG13 5  
ATOM 9582  H HG21 . VAL A 1 35  ? -11.092 4.643   -13.121 1.00 0.00 ? 35  VAL A HG21 5  
ATOM 9583  H HG22 . VAL A 1 35  ? -10.416 3.517   -14.291 1.00 0.00 ? 35  VAL A HG22 5  
ATOM 9584  H HG23 . VAL A 1 35  ? -9.764  3.586   -12.658 1.00 0.00 ? 35  VAL A HG23 5  
ATOM 9585  N N    . MET A 1 36  ? -8.702  7.484   -15.934 1.00 0.00 ? 36  MET A N    5  
ATOM 9586  C CA   . MET A 1 36  ? -7.764  8.423   -16.591 1.00 0.00 ? 36  MET A CA   5  
ATOM 9587  C C    . MET A 1 36  ? -8.244  9.862   -16.440 1.00 0.00 ? 36  MET A C    5  
ATOM 9588  O O    . MET A 1 36  ? -7.453  10.767  -16.261 1.00 0.00 ? 36  MET A O    5  
ATOM 9589  C CB   . MET A 1 36  ? -7.703  8.079   -18.089 1.00 0.00 ? 36  MET A CB   5  
ATOM 9590  C CG   . MET A 1 36  ? -7.555  6.563   -18.254 1.00 0.00 ? 36  MET A CG   5  
ATOM 9591  S SD   . MET A 1 36  ? -6.388  5.975   -19.508 1.00 0.00 ? 36  MET A SD   5  
ATOM 9592  C CE   . MET A 1 36  ? -4.868  6.461   -18.652 1.00 0.00 ? 36  MET A CE   5  
ATOM 9593  H H    . MET A 1 36  ? -9.151  6.788   -16.458 1.00 0.00 ? 36  MET A H    5  
ATOM 9594  H HA   . MET A 1 36  ? -6.782  8.325   -16.131 1.00 0.00 ? 36  MET A HA   5  
ATOM 9595  H HB2  . MET A 1 36  ? -8.608  8.409   -18.573 1.00 0.00 ? 36  MET A HB2  5  
ATOM 9596  H HB3  . MET A 1 36  ? -6.858  8.577   -18.540 1.00 0.00 ? 36  MET A HB3  5  
ATOM 9597  H HG2  . MET A 1 36  ? -7.251  6.147   -17.305 1.00 0.00 ? 36  MET A HG2  5  
ATOM 9598  H HG3  . MET A 1 36  ? -8.525  6.155   -18.495 1.00 0.00 ? 36  MET A HG3  5  
ATOM 9599  H HE1  . MET A 1 36  ? -4.969  6.254   -17.596 1.00 0.00 ? 36  MET A HE1  5  
ATOM 9600  H HE2  . MET A 1 36  ? -4.036  5.901   -19.051 1.00 0.00 ? 36  MET A HE2  5  
ATOM 9601  H HE3  . MET A 1 36  ? -4.696  7.517   -18.797 1.00 0.00 ? 36  MET A HE3  5  
ATOM 9602  N N    . ARG A 1 37  ? -9.537  10.050  -16.514 1.00 0.00 ? 37  ARG A N    5  
ATOM 9603  C CA   . ARG A 1 37  ? -10.081 11.424  -16.376 1.00 0.00 ? 37  ARG A CA   5  
ATOM 9604  C C    . ARG A 1 37  ? -9.861  11.954  -14.964 1.00 0.00 ? 37  ARG A C    5  
ATOM 9605  O O    . ARG A 1 37  ? -9.599  13.125  -14.771 1.00 0.00 ? 37  ARG A O    5  
ATOM 9606  C CB   . ARG A 1 37  ? -11.593 11.378  -16.657 1.00 0.00 ? 37  ARG A CB   5  
ATOM 9607  C CG   . ARG A 1 37  ? -11.957 12.514  -17.613 1.00 0.00 ? 37  ARG A CG   5  
ATOM 9608  C CD   . ARG A 1 37  ? -13.429 12.882  -17.418 1.00 0.00 ? 37  ARG A CD   5  
ATOM 9609  N NE   . ARG A 1 37  ? -13.744 14.064  -18.269 1.00 0.00 ? 37  ARG A NE   5  
ATOM 9610  C CZ   . ARG A 1 37  ? -14.989 14.403  -18.462 1.00 0.00 ? 37  ARG A CZ   5  
ATOM 9611  N NH1  . ARG A 1 37  ? -15.731 13.664  -19.239 1.00 0.00 ? 37  ARG A NH1  5  
ATOM 9612  N NH2  . ARG A 1 37  ? -15.452 15.471  -17.869 1.00 0.00 ? 37  ARG A NH2  5  
ATOM 9613  H H    . ARG A 1 37  ? -10.141 9.290   -16.661 1.00 0.00 ? 37  ARG A H    5  
ATOM 9614  H HA   . ARG A 1 37  ? -9.574  12.077  -17.084 1.00 0.00 ? 37  ARG A HA   5  
ATOM 9615  H HB2  . ARG A 1 37  ? -11.851 10.430  -17.106 1.00 0.00 ? 37  ARG A HB2  5  
ATOM 9616  H HB3  . ARG A 1 37  ? -12.138 11.493  -15.733 1.00 0.00 ? 37  ARG A HB3  5  
ATOM 9617  H HG2  . ARG A 1 37  ? -11.340 13.375  -17.406 1.00 0.00 ? 37  ARG A HG2  5  
ATOM 9618  H HG3  . ARG A 1 37  ? -11.796 12.198  -18.633 1.00 0.00 ? 37  ARG A HG3  5  
ATOM 9619  H HD2  . ARG A 1 37  ? -14.058 12.053  -17.710 1.00 0.00 ? 37  ARG A HD2  5  
ATOM 9620  H HD3  . ARG A 1 37  ? -13.613 13.127  -16.383 1.00 0.00 ? 37  ARG A HD3  5  
ATOM 9621  H HE   . ARG A 1 37  ? -13.023 14.582  -18.682 1.00 0.00 ? 37  ARG A HE   5  
ATOM 9622  H HH11 . ARG A 1 37  ? -15.343 12.853  -19.677 1.00 0.00 ? 37  ARG A HH11 5  
ATOM 9623  H HH12 . ARG A 1 37  ? -16.687 13.908  -19.398 1.00 0.00 ? 37  ARG A HH12 5  
ATOM 9624  H HH21 . ARG A 1 37  ? -14.854 16.014  -17.279 1.00 0.00 ? 37  ARG A HH21 5  
ATOM 9625  H HH22 . ARG A 1 37  ? -16.404 15.745  -18.005 1.00 0.00 ? 37  ARG A HH22 5  
ATOM 9626  N N    . SER A 1 38  ? -9.972  11.080  -14.000 1.00 0.00 ? 38  SER A N    5  
ATOM 9627  C CA   . SER A 1 38  ? -9.775  11.511  -12.594 1.00 0.00 ? 38  SER A CA   5  
ATOM 9628  C C    . SER A 1 38  ? -8.332  11.934  -12.349 1.00 0.00 ? 38  SER A C    5  
ATOM 9629  O O    . SER A 1 38  ? -8.071  12.852  -11.595 1.00 0.00 ? 38  SER A O    5  
ATOM 9630  C CB   . SER A 1 38  ? -10.100 10.322  -11.677 1.00 0.00 ? 38  SER A CB   5  
ATOM 9631  O OG   . SER A 1 38  ? -11.511 10.197  -11.758 1.00 0.00 ? 38  SER A OG   5  
ATOM 9632  H H    . SER A 1 38  ? -10.184 10.144  -14.206 1.00 0.00 ? 38  SER A H    5  
ATOM 9633  H HA   . SER A 1 38  ? -10.433 12.353  -12.383 1.00 0.00 ? 38  SER A HA   5  
ATOM 9634  H HB2  . SER A 1 38  ? -9.624  9.421   -12.036 1.00 0.00 ? 38  SER A HB2  5  
ATOM 9635  H HB3  . SER A 1 38  ? -9.800  10.528  -10.661 1.00 0.00 ? 38  SER A HB3  5  
ATOM 9636  H HG   . SER A 1 38  ? -11.719 9.695   -12.550 1.00 0.00 ? 38  SER A HG   5  
ATOM 9637  N N    . LEU A 1 39  ? -7.420  11.258  -12.988 1.00 0.00 ? 39  LEU A N    5  
ATOM 9638  C CA   . LEU A 1 39  ? -5.992  11.607  -12.803 1.00 0.00 ? 39  LEU A CA   5  
ATOM 9639  C C    . LEU A 1 39  ? -5.746  13.073  -13.134 1.00 0.00 ? 39  LEU A C    5  
ATOM 9640  O O    . LEU A 1 39  ? -5.154  13.796  -12.358 1.00 0.00 ? 39  LEU A O    5  
ATOM 9641  C CB   . LEU A 1 39  ? -5.156  10.732  -13.750 1.00 0.00 ? 39  LEU A CB   5  
ATOM 9642  C CG   . LEU A 1 39  ? -4.645  9.498   -12.989 1.00 0.00 ? 39  LEU A CG   5  
ATOM 9643  C CD1  . LEU A 1 39  ? -5.753  8.450   -12.925 1.00 0.00 ? 39  LEU A CD1  5  
ATOM 9644  C CD2  . LEU A 1 39  ? -3.457  8.913   -13.735 1.00 0.00 ? 39  LEU A CD2  5  
ATOM 9645  H H    . LEU A 1 39  ? -7.677  10.526  -13.587 1.00 0.00 ? 39  LEU A H    5  
ATOM 9646  H HA   . LEU A 1 39  ? -5.718  11.431  -11.770 1.00 0.00 ? 39  LEU A HA   5  
ATOM 9647  H HB2  . LEU A 1 39  ? -5.767  10.414  -14.583 1.00 0.00 ? 39  LEU A HB2  5  
ATOM 9648  H HB3  . LEU A 1 39  ? -4.317  11.301  -14.124 1.00 0.00 ? 39  LEU A HB3  5  
ATOM 9649  H HG   . LEU A 1 39  ? -4.344  9.774   -11.986 1.00 0.00 ? 39  LEU A HG   5  
ATOM 9650  H HD11 . LEU A 1 39  ? -6.052  8.174   -13.926 1.00 0.00 ? 39  LEU A HD11 5  
ATOM 9651  H HD12 . LEU A 1 39  ? -5.394  7.573   -12.408 1.00 0.00 ? 39  LEU A HD12 5  
ATOM 9652  H HD13 . LEU A 1 39  ? -6.605  8.851   -12.397 1.00 0.00 ? 39  LEU A HD13 5  
ATOM 9653  H HD21 . LEU A 1 39  ? -2.763  9.701   -13.985 1.00 0.00 ? 39  LEU A HD21 5  
ATOM 9654  H HD22 . LEU A 1 39  ? -2.959  8.183   -13.113 1.00 0.00 ? 39  LEU A HD22 5  
ATOM 9655  H HD23 . LEU A 1 39  ? -3.797  8.435   -14.639 1.00 0.00 ? 39  LEU A HD23 5  
ATOM 9656  N N    . GLY A 1 40  ? -6.205  13.486  -14.281 1.00 0.00 ? 40  GLY A N    5  
ATOM 9657  C CA   . GLY A 1 40  ? -6.003  14.909  -14.676 1.00 0.00 ? 40  GLY A CA   5  
ATOM 9658  C C    . GLY A 1 40  ? -6.029  15.055  -16.199 1.00 0.00 ? 40  GLY A C    5  
ATOM 9659  O O    . GLY A 1 40  ? -6.208  16.140  -16.716 1.00 0.00 ? 40  GLY A O    5  
ATOM 9660  H H    . GLY A 1 40  ? -6.676  12.869  -14.876 1.00 0.00 ? 40  GLY A H    5  
ATOM 9661  H HA2  . GLY A 1 40  ? -6.790  15.511  -14.247 1.00 0.00 ? 40  GLY A HA2  5  
ATOM 9662  H HA3  . GLY A 1 40  ? -5.049  15.250  -14.301 1.00 0.00 ? 40  GLY A HA3  5  
ATOM 9663  N N    . GLN A 1 41  ? -5.850  13.961  -16.886 1.00 0.00 ? 41  GLN A N    5  
ATOM 9664  C CA   . GLN A 1 41  ? -5.863  14.024  -18.369 1.00 0.00 ? 41  GLN A CA   5  
ATOM 9665  C C    . GLN A 1 41  ? -7.273  13.836  -18.912 1.00 0.00 ? 41  GLN A C    5  
ATOM 9666  O O    . GLN A 1 41  ? -8.213  13.677  -18.162 1.00 0.00 ? 41  GLN A O    5  
ATOM 9667  C CB   . GLN A 1 41  ? -4.973  12.898  -18.909 1.00 0.00 ? 41  GLN A CB   5  
ATOM 9668  C CG   . GLN A 1 41  ? -3.511  13.223  -18.598 1.00 0.00 ? 41  GLN A CG   5  
ATOM 9669  C CD   . GLN A 1 41  ? -2.686  11.935  -18.642 1.00 0.00 ? 41  GLN A CD   5  
ATOM 9670  O OE1  . GLN A 1 41  ? -2.844  11.112  -19.521 1.00 0.00 ? 41  GLN A OE1  5  
ATOM 9671  N NE2  . GLN A 1 41  ? -1.793  11.724  -17.713 1.00 0.00 ? 41  GLN A NE2  5  
ATOM 9672  H H    . GLN A 1 41  ? -5.707  13.106  -16.429 1.00 0.00 ? 41  GLN A H    5  
ATOM 9673  H HA   . GLN A 1 41  ? -5.488  14.997  -18.685 1.00 0.00 ? 41  GLN A HA   5  
ATOM 9674  H HB2  . GLN A 1 41  ? -5.245  11.963  -18.440 1.00 0.00 ? 41  GLN A HB2  5  
ATOM 9675  H HB3  . GLN A 1 41  ? -5.106  12.810  -19.977 1.00 0.00 ? 41  GLN A HB3  5  
ATOM 9676  H HG2  . GLN A 1 41  ? -3.129  13.918  -19.331 1.00 0.00 ? 41  GLN A HG2  5  
ATOM 9677  H HG3  . GLN A 1 41  ? -3.436  13.663  -17.615 1.00 0.00 ? 41  GLN A HG3  5  
ATOM 9678  H HE21 . GLN A 1 41  ? -1.662  12.384  -17.001 1.00 0.00 ? 41  GLN A HE21 5  
ATOM 9679  H HE22 . GLN A 1 41  ? -1.254  10.906  -17.729 1.00 0.00 ? 41  GLN A HE22 5  
ATOM 9680  N N    . ASN A 1 42  ? -7.394  13.859  -20.214 1.00 0.00 ? 42  ASN A N    5  
ATOM 9681  C CA   . ASN A 1 42  ? -8.734  13.682  -20.825 1.00 0.00 ? 42  ASN A CA   5  
ATOM 9682  C C    . ASN A 1 42  ? -8.631  12.945  -22.160 1.00 0.00 ? 42  ASN A C    5  
ATOM 9683  O O    . ASN A 1 42  ? -8.792  13.524  -23.215 1.00 0.00 ? 42  ASN A O    5  
ATOM 9684  C CB   . ASN A 1 42  ? -9.334  15.075  -21.077 1.00 0.00 ? 42  ASN A CB   5  
ATOM 9685  C CG   . ASN A 1 42  ? -8.388  15.881  -21.968 1.00 0.00 ? 42  ASN A CG   5  
ATOM 9686  O OD1  . ASN A 1 42  ? -8.689  16.985  -22.375 1.00 0.00 ? 42  ASN A OD1  5  
ATOM 9687  N ND2  . ASN A 1 42  ? -7.233  15.366  -22.294 1.00 0.00 ? 42  ASN A ND2  5  
ATOM 9688  H H    . ASN A 1 42  ? -6.607  13.995  -20.781 1.00 0.00 ? 42  ASN A H    5  
ATOM 9689  H HA   . ASN A 1 42  ? -9.361  13.108  -20.148 1.00 0.00 ? 42  ASN A HA   5  
ATOM 9690  H HB2  . ASN A 1 42  ? -10.292 14.979  -21.567 1.00 0.00 ? 42  ASN A HB2  5  
ATOM 9691  H HB3  . ASN A 1 42  ? -9.464  15.592  -20.137 1.00 0.00 ? 42  ASN A HB3  5  
ATOM 9692  H HD21 . ASN A 1 42  ? -6.983  14.476  -21.968 1.00 0.00 ? 42  ASN A HD21 5  
ATOM 9693  H HD22 . ASN A 1 42  ? -6.616  15.870  -22.864 1.00 0.00 ? 42  ASN A HD22 5  
ATOM 9694  N N    . PRO A 1 43  ? -8.361  11.665  -22.071 1.00 0.00 ? 43  PRO A N    5  
ATOM 9695  C CA   . PRO A 1 43  ? -8.228  10.819  -23.255 1.00 0.00 ? 43  PRO A CA   5  
ATOM 9696  C C    . PRO A 1 43  ? -9.558  10.681  -23.990 1.00 0.00 ? 43  PRO A C    5  
ATOM 9697  O O    . PRO A 1 43  ? -10.611 10.702  -23.382 1.00 0.00 ? 43  PRO A O    5  
ATOM 9698  C CB   . PRO A 1 43  ? -7.794  9.443   -22.707 1.00 0.00 ? 43  PRO A CB   5  
ATOM 9699  C CG   . PRO A 1 43  ? -7.775  9.550   -21.150 1.00 0.00 ? 43  PRO A CG   5  
ATOM 9700  C CD   . PRO A 1 43  ? -8.163  10.989  -20.786 1.00 0.00 ? 43  PRO A CD   5  
ATOM 9701  H HA   . PRO A 1 43  ? -7.476  11.231  -23.921 1.00 0.00 ? 43  PRO A HA   5  
ATOM 9702  H HB2  . PRO A 1 43  ? -8.495  8.683   -23.018 1.00 0.00 ? 43  PRO A HB2  5  
ATOM 9703  H HB3  . PRO A 1 43  ? -6.808  9.196   -23.072 1.00 0.00 ? 43  PRO A HB3  5  
ATOM 9704  H HG2  . PRO A 1 43  ? -8.486  8.860   -20.724 1.00 0.00 ? 43  PRO A HG2  5  
ATOM 9705  H HG3  . PRO A 1 43  ? -6.787  9.330   -20.776 1.00 0.00 ? 43  PRO A HG3  5  
ATOM 9706  H HD2  . PRO A 1 43  ? -9.079  10.993  -20.216 1.00 0.00 ? 43  PRO A HD2  5  
ATOM 9707  H HD3  . PRO A 1 43  ? -7.371  11.468  -20.231 1.00 0.00 ? 43  PRO A HD3  5  
ATOM 9708  N N    . THR A 1 44  ? -9.485  10.540  -25.290 1.00 0.00 ? 44  THR A N    5  
ATOM 9709  C CA   . THR A 1 44  ? -10.729 10.397  -26.082 1.00 0.00 ? 44  THR A CA   5  
ATOM 9710  C C    . THR A 1 44  ? -11.036 8.929   -26.357 1.00 0.00 ? 44  THR A C    5  
ATOM 9711  O O    . THR A 1 44  ? -10.145 8.109   -26.428 1.00 0.00 ? 44  THR A O    5  
ATOM 9712  C CB   . THR A 1 44  ? -10.528 11.113  -27.415 1.00 0.00 ? 44  THR A CB   5  
ATOM 9713  O OG1  . THR A 1 44  ? -10.229 12.453  -27.080 1.00 0.00 ? 44  THR A OG1  5  
ATOM 9714  C CG2  . THR A 1 44  ? -11.845 11.192  -28.193 1.00 0.00 ? 44  THR A CG2  5  
ATOM 9715  H H    . THR A 1 44  ? -8.615  10.532  -25.737 1.00 0.00 ? 44  THR A H    5  
ATOM 9716  H HA   . THR A 1 44  ? -11.555 10.836  -25.530 1.00 0.00 ? 44  THR A HA   5  
ATOM 9717  H HB   . THR A 1 44  ? -9.724  10.669  -27.992 1.00 0.00 ? 44  THR A HB   5  
ATOM 9718  H HG1  . THR A 1 44  ? -10.912 13.013  -27.459 1.00 0.00 ? 44  THR A HG1  5  
ATOM 9719  H HG21 . THR A 1 44  ? -12.662 11.370  -27.509 1.00 0.00 ? 44  THR A HG21 5  
ATOM 9720  H HG22 . THR A 1 44  ? -11.798 11.999  -28.909 1.00 0.00 ? 44  THR A HG22 5  
ATOM 9721  H HG23 . THR A 1 44  ? -12.015 10.262  -28.715 1.00 0.00 ? 44  THR A HG23 5  
ATOM 9722  N N    . GLU A 1 45  ? -12.299 8.628   -26.502 1.00 0.00 ? 45  GLU A N    5  
ATOM 9723  C CA   . GLU A 1 45  ? -12.700 7.232   -26.771 1.00 0.00 ? 45  GLU A CA   5  
ATOM 9724  C C    . GLU A 1 45  ? -11.755 6.557   -27.757 1.00 0.00 ? 45  GLU A C    5  
ATOM 9725  O O    . GLU A 1 45  ? -11.587 5.353   -27.739 1.00 0.00 ? 45  GLU A O    5  
ATOM 9726  C CB   . GLU A 1 45  ? -14.099 7.266   -27.385 1.00 0.00 ? 45  GLU A CB   5  
ATOM 9727  C CG   . GLU A 1 45  ? -14.845 6.032   -26.941 1.00 0.00 ? 45  GLU A CG   5  
ATOM 9728  C CD   . GLU A 1 45  ? -16.250 6.035   -27.552 1.00 0.00 ? 45  GLU A CD   5  
ATOM 9729  O OE1  . GLU A 1 45  ? -16.512 6.959   -28.304 1.00 0.00 ? 45  GLU A OE1  5  
ATOM 9730  O OE2  . GLU A 1 45  ? -16.982 5.112   -27.230 1.00 0.00 ? 45  GLU A OE2  5  
ATOM 9731  H H    . GLU A 1 45  ? -12.982 9.323   -26.429 1.00 0.00 ? 45  GLU A H    5  
ATOM 9732  H HA   . GLU A 1 45  ? -12.702 6.673   -25.836 1.00 0.00 ? 45  GLU A HA   5  
ATOM 9733  H HB2  . GLU A 1 45  ? -14.623 8.150   -27.051 1.00 0.00 ? 45  GLU A HB2  5  
ATOM 9734  H HB3  . GLU A 1 45  ? -14.025 7.282   -28.462 1.00 0.00 ? 45  GLU A HB3  5  
ATOM 9735  H HG2  . GLU A 1 45  ? -14.312 5.157   -27.268 1.00 0.00 ? 45  GLU A HG2  5  
ATOM 9736  H HG3  . GLU A 1 45  ? -14.920 6.028   -25.867 1.00 0.00 ? 45  GLU A HG3  5  
ATOM 9737  N N    . ALA A 1 46  ? -11.159 7.343   -28.594 1.00 0.00 ? 46  ALA A N    5  
ATOM 9738  C CA   . ALA A 1 46  ? -10.219 6.774   -29.595 1.00 0.00 ? 46  ALA A CA   5  
ATOM 9739  C C    . ALA A 1 46  ? -8.919  6.350   -28.932 1.00 0.00 ? 46  ALA A C    5  
ATOM 9740  O O    . ALA A 1 46  ? -8.641  5.178   -28.805 1.00 0.00 ? 46  ALA A O    5  
ATOM 9741  C CB   . ALA A 1 46  ? -9.912  7.852   -30.640 1.00 0.00 ? 46  ALA A CB   5  
ATOM 9742  H H    . ALA A 1 46  ? -11.324 8.298   -28.560 1.00 0.00 ? 46  ALA A H    5  
ATOM 9743  H HA   . ALA A 1 46  ? -10.681 5.903   -30.060 1.00 0.00 ? 46  ALA A HA   5  
ATOM 9744  H HB1  . ALA A 1 46  ? -10.832 8.202   -31.084 1.00 0.00 ? 46  ALA A HB1  5  
ATOM 9745  H HB2  . ALA A 1 46  ? -9.405  8.682   -30.170 1.00 0.00 ? 46  ALA A HB2  5  
ATOM 9746  H HB3  . ALA A 1 46  ? -9.279  7.441   -31.411 1.00 0.00 ? 46  ALA A HB3  5  
ATOM 9747  N N    . GLU A 1 47  ? -8.139  7.303   -28.519 1.00 0.00 ? 47  GLU A N    5  
ATOM 9748  C CA   . GLU A 1 47  ? -6.866  6.935   -27.868 1.00 0.00 ? 47  GLU A CA   5  
ATOM 9749  C C    . GLU A 1 47  ? -7.142  5.922   -26.791 1.00 0.00 ? 47  GLU A C    5  
ATOM 9750  O O    . GLU A 1 47  ? -6.434  4.946   -26.647 1.00 0.00 ? 47  GLU A O    5  
ATOM 9751  C CB   . GLU A 1 47  ? -6.249  8.189   -27.234 1.00 0.00 ? 47  GLU A CB   5  
ATOM 9752  C CG   . GLU A 1 47  ? -6.088  9.266   -28.306 1.00 0.00 ? 47  GLU A CG   5  
ATOM 9753  C CD   . GLU A 1 47  ? -5.702  10.587  -27.639 1.00 0.00 ? 47  GLU A CD   5  
ATOM 9754  O OE1  . GLU A 1 47  ? -4.976  10.506  -26.661 1.00 0.00 ? 47  GLU A OE1  5  
ATOM 9755  O OE2  . GLU A 1 47  ? -6.153  11.601  -28.144 1.00 0.00 ? 47  GLU A OE2  5  
ATOM 9756  H H    . GLU A 1 47  ? -8.391  8.243   -28.634 1.00 0.00 ? 47  GLU A H    5  
ATOM 9757  H HA   . GLU A 1 47  ? -6.199  6.491   -28.608 1.00 0.00 ? 47  GLU A HA   5  
ATOM 9758  H HB2  . GLU A 1 47  ? -6.894  8.551   -26.448 1.00 0.00 ? 47  GLU A HB2  5  
ATOM 9759  H HB3  . GLU A 1 47  ? -5.283  7.945   -26.817 1.00 0.00 ? 47  GLU A HB3  5  
ATOM 9760  H HG2  . GLU A 1 47  ? -5.313  8.978   -29.001 1.00 0.00 ? 47  GLU A HG2  5  
ATOM 9761  H HG3  . GLU A 1 47  ? -7.017  9.394   -28.841 1.00 0.00 ? 47  GLU A HG3  5  
ATOM 9762  N N    . LEU A 1 48  ? -8.176  6.171   -26.043 1.00 0.00 ? 48  LEU A N    5  
ATOM 9763  C CA   . LEU A 1 48  ? -8.522  5.237   -24.971 1.00 0.00 ? 48  LEU A CA   5  
ATOM 9764  C C    . LEU A 1 48  ? -8.631  3.841   -25.546 1.00 0.00 ? 48  LEU A C    5  
ATOM 9765  O O    . LEU A 1 48  ? -8.102  2.898   -25.002 1.00 0.00 ? 48  LEU A O    5  
ATOM 9766  C CB   . LEU A 1 48  ? -9.884  5.647   -24.394 1.00 0.00 ? 48  LEU A CB   5  
ATOM 9767  C CG   . LEU A 1 48  ? -10.158 4.830   -23.129 1.00 0.00 ? 48  LEU A CG   5  
ATOM 9768  C CD1  . LEU A 1 48  ? -9.030  5.071   -22.124 1.00 0.00 ? 48  LEU A CD1  5  
ATOM 9769  C CD2  . LEU A 1 48  ? -11.483 5.279   -22.513 1.00 0.00 ? 48  LEU A CD2  5  
ATOM 9770  H H    . LEU A 1 48  ? -8.713  6.972   -26.194 1.00 0.00 ? 48  LEU A H    5  
ATOM 9771  H HA   . LEU A 1 48  ? -7.745  5.256   -24.206 1.00 0.00 ? 48  LEU A HA   5  
ATOM 9772  H HB2  . LEU A 1 48  ? -9.874  6.701   -24.153 1.00 0.00 ? 48  LEU A HB2  5  
ATOM 9773  H HB3  . LEU A 1 48  ? -10.660 5.459   -25.125 1.00 0.00 ? 48  LEU A HB3  5  
ATOM 9774  H HG   . LEU A 1 48  ? -10.207 3.780   -23.377 1.00 0.00 ? 48  LEU A HG   5  
ATOM 9775  H HD11 . LEU A 1 48  ? -8.615  6.056   -22.270 1.00 0.00 ? 48  LEU A HD11 5  
ATOM 9776  H HD12 . LEU A 1 48  ? -9.416  4.993   -21.119 1.00 0.00 ? 48  LEU A HD12 5  
ATOM 9777  H HD13 . LEU A 1 48  ? -8.254  4.334   -22.265 1.00 0.00 ? 48  LEU A HD13 5  
ATOM 9778  H HD21 . LEU A 1 48  ? -12.282 5.149   -23.229 1.00 0.00 ? 48  LEU A HD21 5  
ATOM 9779  H HD22 . LEU A 1 48  ? -11.695 4.686   -21.634 1.00 0.00 ? 48  LEU A HD22 5  
ATOM 9780  H HD23 . LEU A 1 48  ? -11.422 6.319   -22.234 1.00 0.00 ? 48  LEU A HD23 5  
ATOM 9781  N N    . GLN A 1 49  ? -9.311  3.742   -26.659 1.00 0.00 ? 49  GLN A N    5  
ATOM 9782  C CA   . GLN A 1 49  ? -9.474  2.421   -27.299 1.00 0.00 ? 49  GLN A CA   5  
ATOM 9783  C C    . GLN A 1 49  ? -8.125  1.879   -27.762 1.00 0.00 ? 49  GLN A C    5  
ATOM 9784  O O    . GLN A 1 49  ? -7.920  0.680   -27.803 1.00 0.00 ? 49  GLN A O    5  
ATOM 9785  C CB   . GLN A 1 49  ? -10.400 2.582   -28.520 1.00 0.00 ? 49  GLN A CB   5  
ATOM 9786  C CG   . GLN A 1 49  ? -10.487 1.251   -29.263 1.00 0.00 ? 49  GLN A CG   5  
ATOM 9787  C CD   . GLN A 1 49  ? -11.637 1.309   -30.268 1.00 0.00 ? 49  GLN A CD   5  
ATOM 9788  O OE1  . GLN A 1 49  ? -12.147 2.366   -30.585 1.00 0.00 ? 49  GLN A OE1  5  
ATOM 9789  N NE2  . GLN A 1 49  ? -12.078 0.199   -30.793 1.00 0.00 ? 49  GLN A NE2  5  
ATOM 9790  H H    . GLN A 1 49  ? -9.708  4.540   -27.066 1.00 0.00 ? 49  GLN A H    5  
ATOM 9791  H HA   . GLN A 1 49  ? -9.903  1.728   -26.576 1.00 0.00 ? 49  GLN A HA   5  
ATOM 9792  H HB2  . GLN A 1 49  ? -11.385 2.878   -28.191 1.00 0.00 ? 49  GLN A HB2  5  
ATOM 9793  H HB3  . GLN A 1 49  ? -10.007 3.335   -29.180 1.00 0.00 ? 49  GLN A HB3  5  
ATOM 9794  H HG2  . GLN A 1 49  ? -9.563  1.064   -29.789 1.00 0.00 ? 49  GLN A HG2  5  
ATOM 9795  H HG3  . GLN A 1 49  ? -10.667 0.454   -28.560 1.00 0.00 ? 49  GLN A HG3  5  
ATOM 9796  H HE21 . GLN A 1 49  ? -11.671 -0.656  -30.540 1.00 0.00 ? 49  GLN A HE21 5  
ATOM 9797  H HE22 . GLN A 1 49  ? -12.813 0.220   -31.439 1.00 0.00 ? 49  GLN A HE22 5  
ATOM 9798  N N    . ASP A 1 50  ? -7.222  2.769   -28.103 1.00 0.00 ? 50  ASP A N    5  
ATOM 9799  C CA   . ASP A 1 50  ? -5.888  2.305   -28.562 1.00 0.00 ? 50  ASP A CA   5  
ATOM 9800  C C    . ASP A 1 50  ? -5.159  1.591   -27.432 1.00 0.00 ? 50  ASP A C    5  
ATOM 9801  O O    . ASP A 1 50  ? -4.490  0.600   -27.649 1.00 0.00 ? 50  ASP A O    5  
ATOM 9802  C CB   . ASP A 1 50  ? -5.067  3.531   -28.989 1.00 0.00 ? 50  ASP A CB   5  
ATOM 9803  C CG   . ASP A 1 50  ? -3.825  3.067   -29.756 1.00 0.00 ? 50  ASP A CG   5  
ATOM 9804  O OD1  . ASP A 1 50  ? -2.882  2.689   -29.081 1.00 0.00 ? 50  ASP A OD1  5  
ATOM 9805  O OD2  . ASP A 1 50  ? -3.890  3.118   -30.973 1.00 0.00 ? 50  ASP A OD2  5  
ATOM 9806  H H    . ASP A 1 50  ? -7.426  3.734   -28.057 1.00 0.00 ? 50  ASP A H    5  
ATOM 9807  H HA   . ASP A 1 50  ? -6.018  1.611   -29.393 1.00 0.00 ? 50  ASP A HA   5  
ATOM 9808  H HB2  . ASP A 1 50  ? -5.663  4.166   -29.626 1.00 0.00 ? 50  ASP A HB2  5  
ATOM 9809  H HB3  . ASP A 1 50  ? -4.758  4.087   -28.117 1.00 0.00 ? 50  ASP A HB3  5  
ATOM 9810  N N    . MET A 1 51  ? -5.300  2.109   -26.243 1.00 0.00 ? 51  MET A N    5  
ATOM 9811  C CA   . MET A 1 51  ? -4.624  1.472   -25.089 1.00 0.00 ? 51  MET A CA   5  
ATOM 9812  C C    . MET A 1 51  ? -5.235  0.110   -24.814 1.00 0.00 ? 51  MET A C    5  
ATOM 9813  O O    . MET A 1 51  ? -4.536  -0.850  -24.546 1.00 0.00 ? 51  MET A O    5  
ATOM 9814  C CB   . MET A 1 51  ? -4.819  2.366   -23.854 1.00 0.00 ? 51  MET A CB   5  
ATOM 9815  C CG   . MET A 1 51  ? -4.069  3.684   -24.063 1.00 0.00 ? 51  MET A CG   5  
ATOM 9816  S SD   . MET A 1 51  ? -3.351  4.479   -22.601 1.00 0.00 ? 51  MET A SD   5  
ATOM 9817  C CE   . MET A 1 51  ? -4.904  4.816   -21.733 1.00 0.00 ? 51  MET A CE   5  
ATOM 9818  H H    . MET A 1 51  ? -5.849  2.910   -26.115 1.00 0.00 ? 51  MET A H    5  
ATOM 9819  H HA   . MET A 1 51  ? -3.568  1.346   -25.319 1.00 0.00 ? 51  MET A HA   5  
ATOM 9820  H HB2  . MET A 1 51  ? -5.871  2.565   -23.715 1.00 0.00 ? 51  MET A HB2  5  
ATOM 9821  H HB3  . MET A 1 51  ? -4.435  1.864   -22.979 1.00 0.00 ? 51  MET A HB3  5  
ATOM 9822  H HG2  . MET A 1 51  ? -3.267  3.506   -24.765 1.00 0.00 ? 51  MET A HG2  5  
ATOM 9823  H HG3  . MET A 1 51  ? -4.750  4.389   -24.517 1.00 0.00 ? 51  MET A HG3  5  
ATOM 9824  H HE1  . MET A 1 51  ? -5.727  4.383   -22.282 1.00 0.00 ? 51  MET A HE1  5  
ATOM 9825  H HE2  . MET A 1 51  ? -4.864  4.383   -20.744 1.00 0.00 ? 51  MET A HE2  5  
ATOM 9826  H HE3  . MET A 1 51  ? -5.047  5.883   -21.652 1.00 0.00 ? 51  MET A HE3  5  
ATOM 9827  N N    . ILE A 1 52  ? -6.536  0.048   -24.881 1.00 0.00 ? 52  ILE A N    5  
ATOM 9828  C CA   . ILE A 1 52  ? -7.213  -1.242  -24.629 1.00 0.00 ? 52  ILE A CA   5  
ATOM 9829  C C    . ILE A 1 52  ? -6.634  -2.312  -25.541 1.00 0.00 ? 52  ILE A C    5  
ATOM 9830  O O    . ILE A 1 52  ? -6.251  -3.375  -25.097 1.00 0.00 ? 52  ILE A O    5  
ATOM 9831  C CB   . ILE A 1 52  ? -8.712  -1.074  -24.941 1.00 0.00 ? 52  ILE A CB   5  
ATOM 9832  C CG1  . ILE A 1 52  ? -9.463  -0.634  -23.691 1.00 0.00 ? 52  ILE A CG1  5  
ATOM 9833  C CG2  . ILE A 1 52  ? -9.286  -2.431  -25.394 1.00 0.00 ? 52  ILE A CG2  5  
ATOM 9834  C CD1  . ILE A 1 52  ? -9.295  0.873   -23.502 1.00 0.00 ? 52  ILE A CD1  5  
ATOM 9835  H H    . ILE A 1 52  ? -7.059  0.848   -25.096 1.00 0.00 ? 52  ILE A H    5  
ATOM 9836  H HA   . ILE A 1 52  ? -7.058  -1.531  -23.593 1.00 0.00 ? 52  ILE A HA   5  
ATOM 9837  H HB   . ILE A 1 52  ? -8.834  -0.319  -25.718 1.00 0.00 ? 52  ILE A HB   5  
ATOM 9838  H HG12 . ILE A 1 52  ? -10.511 -0.868  -23.802 1.00 0.00 ? 52  ILE A HG12 5  
ATOM 9839  H HG13 . ILE A 1 52  ? -9.073  -1.154  -22.830 1.00 0.00 ? 52  ILE A HG13 5  
ATOM 9840  H HG21 . ILE A 1 52  ? -8.946  -3.211  -24.730 1.00 0.00 ? 52  ILE A HG21 5  
ATOM 9841  H HG22 . ILE A 1 52  ? -10.365 -2.395  -25.378 1.00 0.00 ? 52  ILE A HG22 5  
ATOM 9842  H HG23 . ILE A 1 52  ? -8.955  -2.651  -26.398 1.00 0.00 ? 52  ILE A HG23 5  
ATOM 9843  H HD11 . ILE A 1 52  ? -8.245  1.122   -23.476 1.00 0.00 ? 52  ILE A HD11 5  
ATOM 9844  H HD12 . ILE A 1 52  ? -9.768  1.396   -24.320 1.00 0.00 ? 52  ILE A HD12 5  
ATOM 9845  H HD13 . ILE A 1 52  ? -9.754  1.179   -22.573 1.00 0.00 ? 52  ILE A HD13 5  
ATOM 9846  N N    . ASN A 1 53  ? -6.578  -2.001  -26.804 1.00 0.00 ? 53  ASN A N    5  
ATOM 9847  C CA   . ASN A 1 53  ? -6.032  -2.974  -27.778 1.00 0.00 ? 53  ASN A CA   5  
ATOM 9848  C C    . ASN A 1 53  ? -4.662  -3.479  -27.336 1.00 0.00 ? 53  ASN A C    5  
ATOM 9849  O O    . ASN A 1 53  ? -4.166  -4.459  -27.853 1.00 0.00 ? 53  ASN A O    5  
ATOM 9850  C CB   . ASN A 1 53  ? -5.882  -2.263  -29.133 1.00 0.00 ? 53  ASN A CB   5  
ATOM 9851  C CG   . ASN A 1 53  ? -7.268  -1.999  -29.724 1.00 0.00 ? 53  ASN A CG   5  
ATOM 9852  O OD1  . ASN A 1 53  ? -7.402  -1.569  -30.852 1.00 0.00 ? 53  ASN A OD1  5  
ATOM 9853  N ND2  . ASN A 1 53  ? -8.324  -2.241  -28.998 1.00 0.00 ? 53  ASN A ND2  5  
ATOM 9854  H H    . ASN A 1 53  ? -6.899  -1.128  -27.108 1.00 0.00 ? 53  ASN A H    5  
ATOM 9855  H HA   . ASN A 1 53  ? -6.715  -3.818  -27.857 1.00 0.00 ? 53  ASN A HA   5  
ATOM 9856  H HB2  . ASN A 1 53  ? -5.367  -1.321  -28.997 1.00 0.00 ? 53  ASN A HB2  5  
ATOM 9857  H HB3  . ASN A 1 53  ? -5.317  -2.883  -29.811 1.00 0.00 ? 53  ASN A HB3  5  
ATOM 9858  H HD21 . ASN A 1 53  ? -8.222  -2.587  -28.086 1.00 0.00 ? 53  ASN A HD21 5  
ATOM 9859  H HD22 . ASN A 1 53  ? -9.218  -2.077  -29.363 1.00 0.00 ? 53  ASN A HD22 5  
ATOM 9860  N N    . GLU A 1 54  ? -4.071  -2.801  -26.389 1.00 0.00 ? 54  GLU A N    5  
ATOM 9861  C CA   . GLU A 1 54  ? -2.739  -3.237  -25.912 1.00 0.00 ? 54  GLU A CA   5  
ATOM 9862  C C    . GLU A 1 54  ? -2.857  -4.224  -24.750 1.00 0.00 ? 54  GLU A C    5  
ATOM 9863  O O    . GLU A 1 54  ? -2.209  -5.252  -24.741 1.00 0.00 ? 54  GLU A O    5  
ATOM 9864  C CB   . GLU A 1 54  ? -1.969  -1.996  -25.433 1.00 0.00 ? 54  GLU A CB   5  
ATOM 9865  C CG   . GLU A 1 54  ? -0.475  -2.317  -25.406 1.00 0.00 ? 54  GLU A CG   5  
ATOM 9866  C CD   . GLU A 1 54  ? 0.302   -1.085  -24.934 1.00 0.00 ? 54  GLU A CD   5  
ATOM 9867  O OE1  . GLU A 1 54  ? -0.166  -0.483  -23.981 1.00 0.00 ? 54  GLU A OE1  5  
ATOM 9868  O OE2  . GLU A 1 54  ? 1.316   -0.815  -25.553 1.00 0.00 ? 54  GLU A OE2  5  
ATOM 9869  H H    . GLU A 1 54  ? -4.501  -2.010  -26.003 1.00 0.00 ? 54  GLU A H    5  
ATOM 9870  H HA   . GLU A 1 54  ? -2.215  -3.719  -26.733 1.00 0.00 ? 54  GLU A HA   5  
ATOM 9871  H HB2  . GLU A 1 54  ? -2.152  -1.173  -26.108 1.00 0.00 ? 54  GLU A HB2  5  
ATOM 9872  H HB3  . GLU A 1 54  ? -2.301  -1.722  -24.442 1.00 0.00 ? 54  GLU A HB3  5  
ATOM 9873  H HG2  . GLU A 1 54  ? -0.288  -3.136  -24.728 1.00 0.00 ? 54  GLU A HG2  5  
ATOM 9874  H HG3  . GLU A 1 54  ? -0.141  -2.590  -26.396 1.00 0.00 ? 54  GLU A HG3  5  
ATOM 9875  N N    . VAL A 1 55  ? -3.681  -3.894  -23.790 1.00 0.00 ? 55  VAL A N    5  
ATOM 9876  C CA   . VAL A 1 55  ? -3.849  -4.802  -22.626 1.00 0.00 ? 55  VAL A CA   5  
ATOM 9877  C C    . VAL A 1 55  ? -4.874  -5.897  -22.910 1.00 0.00 ? 55  VAL A C    5  
ATOM 9878  O O    . VAL A 1 55  ? -5.116  -6.749  -22.078 1.00 0.00 ? 55  VAL A O    5  
ATOM 9879  C CB   . VAL A 1 55  ? -4.358  -3.972  -21.448 1.00 0.00 ? 55  VAL A CB   5  
ATOM 9880  C CG1  . VAL A 1 55  ? -3.479  -2.730  -21.283 1.00 0.00 ? 55  VAL A CG1  5  
ATOM 9881  C CG2  . VAL A 1 55  ? -5.797  -3.545  -21.735 1.00 0.00 ? 55  VAL A CG2  5  
ATOM 9882  H H    . VAL A 1 55  ? -4.180  -3.053  -23.832 1.00 0.00 ? 55  VAL A H    5  
ATOM 9883  H HA   . VAL A 1 55  ? -2.890  -5.262  -22.390 1.00 0.00 ? 55  VAL A HA   5  
ATOM 9884  H HB   . VAL A 1 55  ? -4.326  -4.562  -20.550 1.00 0.00 ? 55  VAL A HB   5  
ATOM 9885  H HG11 . VAL A 1 55  ? -3.293  -2.284  -22.248 1.00 0.00 ? 55  VAL A HG11 5  
ATOM 9886  H HG12 . VAL A 1 55  ? -3.979  -2.012  -20.652 1.00 0.00 ? 55  VAL A HG12 5  
ATOM 9887  H HG13 . VAL A 1 55  ? -2.539  -3.006  -20.831 1.00 0.00 ? 55  VAL A HG13 5  
ATOM 9888  H HG21 . VAL A 1 55  ? -5.869  -3.176  -22.747 1.00 0.00 ? 55  VAL A HG21 5  
ATOM 9889  H HG22 . VAL A 1 55  ? -6.458  -4.390  -21.618 1.00 0.00 ? 55  VAL A HG22 5  
ATOM 9890  H HG23 . VAL A 1 55  ? -6.090  -2.766  -21.052 1.00 0.00 ? 55  VAL A HG23 5  
ATOM 9891  N N    . ASP A 1 56  ? -5.462  -5.858  -24.072 1.00 0.00 ? 56  ASP A N    5  
ATOM 9892  C CA   . ASP A 1 56  ? -6.469  -6.896  -24.405 1.00 0.00 ? 56  ASP A CA   5  
ATOM 9893  C C    . ASP A 1 56  ? -5.794  -8.230  -24.658 1.00 0.00 ? 56  ASP A C    5  
ATOM 9894  O O    . ASP A 1 56  ? -6.297  -9.060  -25.387 1.00 0.00 ? 56  ASP A O    5  
ATOM 9895  C CB   . ASP A 1 56  ? -7.224  -6.463  -25.674 1.00 0.00 ? 56  ASP A CB   5  
ATOM 9896  C CG   . ASP A 1 56  ? -6.445  -6.912  -26.912 1.00 0.00 ? 56  ASP A CG   5  
ATOM 9897  O OD1  . ASP A 1 56  ? -5.334  -6.433  -27.055 1.00 0.00 ? 56  ASP A OD1  5  
ATOM 9898  O OD2  . ASP A 1 56  ? -7.007  -7.709  -27.645 1.00 0.00 ? 56  ASP A OD2  5  
ATOM 9899  H H    . ASP A 1 56  ? -5.236  -5.162  -24.718 1.00 0.00 ? 56  ASP A H    5  
ATOM 9900  H HA   . ASP A 1 56  ? -7.153  -7.002  -23.564 1.00 0.00 ? 56  ASP A HA   5  
ATOM 9901  H HB2  . ASP A 1 56  ? -8.206  -6.915  -25.686 1.00 0.00 ? 56  ASP A HB2  5  
ATOM 9902  H HB3  . ASP A 1 56  ? -7.328  -5.389  -25.688 1.00 0.00 ? 56  ASP A HB3  5  
ATOM 9903  N N    . ALA A 1 57  ? -4.661  -8.411  -24.044 1.00 0.00 ? 57  ALA A N    5  
ATOM 9904  C CA   . ALA A 1 57  ? -3.926  -9.684  -24.228 1.00 0.00 ? 57  ALA A CA   5  
ATOM 9905  C C    . ALA A 1 57  ? -2.891  -9.876  -23.131 1.00 0.00 ? 57  ALA A C    5  
ATOM 9906  O O    . ALA A 1 57  ? -2.165  -10.852 -23.123 1.00 0.00 ? 57  ALA A O    5  
ATOM 9907  C CB   . ALA A 1 57  ? -3.200  -9.629  -25.576 1.00 0.00 ? 57  ALA A CB   5  
ATOM 9908  H H    . ALA A 1 57  ? -4.297  -7.708  -23.467 1.00 0.00 ? 57  ALA A H    5  
ATOM 9909  H HA   . ALA A 1 57  ? -4.634  -10.511 -24.201 1.00 0.00 ? 57  ALA A HA   5  
ATOM 9910  H HB1  . ALA A 1 57  ? -3.919  -9.499  -26.371 1.00 0.00 ? 57  ALA A HB1  5  
ATOM 9911  H HB2  . ALA A 1 57  ? -2.508  -8.799  -25.582 1.00 0.00 ? 57  ALA A HB2  5  
ATOM 9912  H HB3  . ALA A 1 57  ? -2.655  -10.547 -25.733 1.00 0.00 ? 57  ALA A HB3  5  
ATOM 9913  N N    . ASP A 1 58  ? -2.839  -8.945  -22.221 1.00 0.00 ? 58  ASP A N    5  
ATOM 9914  C CA   . ASP A 1 58  ? -1.856  -9.062  -21.121 1.00 0.00 ? 58  ASP A CA   5  
ATOM 9915  C C    . ASP A 1 58  ? -2.445  -9.829  -19.942 1.00 0.00 ? 58  ASP A C    5  
ATOM 9916  O O    . ASP A 1 58  ? -1.766  -10.622 -19.317 1.00 0.00 ? 58  ASP A O    5  
ATOM 9917  C CB   . ASP A 1 58  ? -1.483  -7.647  -20.654 1.00 0.00 ? 58  ASP A CB   5  
ATOM 9918  C CG   . ASP A 1 58  ? -0.343  -7.733  -19.637 1.00 0.00 ? 58  ASP A CG   5  
ATOM 9919  O OD1  . ASP A 1 58  ? 0.715   -8.182  -20.047 1.00 0.00 ? 58  ASP A OD1  5  
ATOM 9920  O OD2  . ASP A 1 58  ? -0.594  -7.345  -18.509 1.00 0.00 ? 58  ASP A OD2  5  
ATOM 9921  H H    . ASP A 1 58  ? -3.445  -8.176  -22.264 1.00 0.00 ? 58  ASP A H    5  
ATOM 9922  H HA   . ASP A 1 58  ? -0.980  -9.593  -21.489 1.00 0.00 ? 58  ASP A HA   5  
ATOM 9923  H HB2  . ASP A 1 58  ? -1.164  -7.056  -21.499 1.00 0.00 ? 58  ASP A HB2  5  
ATOM 9924  H HB3  . ASP A 1 58  ? -2.339  -7.178  -20.191 1.00 0.00 ? 58  ASP A HB3  5  
ATOM 9925  N N    . GLY A 1 59  ? -3.703  -9.576  -19.663 1.00 0.00 ? 59  GLY A N    5  
ATOM 9926  C CA   . GLY A 1 59  ? -4.372  -10.280 -18.520 1.00 0.00 ? 59  GLY A CA   5  
ATOM 9927  C C    . GLY A 1 59  ? -5.491  -11.196 -19.030 1.00 0.00 ? 59  GLY A C    5  
ATOM 9928  O O    . GLY A 1 59  ? -5.289  -12.379 -19.221 1.00 0.00 ? 59  GLY A O    5  
ATOM 9929  H H    . GLY A 1 59  ? -4.205  -8.928  -20.202 1.00 0.00 ? 59  GLY A H    5  
ATOM 9930  H HA2  . GLY A 1 59  ? -3.648  -10.870 -17.984 1.00 0.00 ? 59  GLY A HA2  5  
ATOM 9931  H HA3  . GLY A 1 59  ? -4.794  -9.543  -17.852 1.00 0.00 ? 59  GLY A HA3  5  
ATOM 9932  N N    . ASN A 1 60  ? -6.649  -10.628 -19.239 1.00 0.00 ? 60  ASN A N    5  
ATOM 9933  C CA   . ASN A 1 60  ? -7.788  -11.446 -19.733 1.00 0.00 ? 60  ASN A CA   5  
ATOM 9934  C C    . ASN A 1 60  ? -8.881  -10.551 -20.305 1.00 0.00 ? 60  ASN A C    5  
ATOM 9935  O O    . ASN A 1 60  ? -9.612  -10.943 -21.192 1.00 0.00 ? 60  ASN A O    5  
ATOM 9936  C CB   . ASN A 1 60  ? -8.370  -12.231 -18.544 1.00 0.00 ? 60  ASN A CB   5  
ATOM 9937  C CG   . ASN A 1 60  ? -8.805  -13.620 -19.015 1.00 0.00 ? 60  ASN A CG   5  
ATOM 9938  O OD1  . ASN A 1 60  ? -8.929  -14.542 -18.232 1.00 0.00 ? 60  ASN A OD1  5  
ATOM 9939  N ND2  . ASN A 1 60  ? -9.052  -13.813 -20.281 1.00 0.00 ? 60  ASN A ND2  5  
ATOM 9940  H H    . ASN A 1 60  ? -6.766  -9.669  -19.073 1.00 0.00 ? 60  ASN A H    5  
ATOM 9941  H HA   . ASN A 1 60  ? -7.434  -12.121 -20.511 1.00 0.00 ? 60  ASN A HA   5  
ATOM 9942  H HB2  . ASN A 1 60  ? -7.621  -12.333 -17.772 1.00 0.00 ? 60  ASN A HB2  5  
ATOM 9943  H HB3  . ASN A 1 60  ? -9.225  -11.706 -18.144 1.00 0.00 ? 60  ASN A HB3  5  
ATOM 9944  H HD21 . ASN A 1 60  ? -8.956  -13.073 -20.918 1.00 0.00 ? 60  ASN A HD21 5  
ATOM 9945  H HD22 . ASN A 1 60  ? -9.332  -14.697 -20.597 1.00 0.00 ? 60  ASN A HD22 5  
ATOM 9946  N N    . GLY A 1 61  ? -8.969  -9.364  -19.779 1.00 0.00 ? 61  GLY A N    5  
ATOM 9947  C CA   . GLY A 1 61  ? -10.005 -8.411  -20.267 1.00 0.00 ? 61  GLY A CA   5  
ATOM 9948  C C    . GLY A 1 61  ? -9.991  -7.155  -19.403 1.00 0.00 ? 61  GLY A C    5  
ATOM 9949  O O    . GLY A 1 61  ? -10.330 -6.079  -19.856 1.00 0.00 ? 61  GLY A O    5  
ATOM 9950  H H    . GLY A 1 61  ? -8.354  -9.097  -19.063 1.00 0.00 ? 61  GLY A H    5  
ATOM 9951  H HA2  . GLY A 1 61  ? -9.795  -8.146  -21.292 1.00 0.00 ? 61  GLY A HA2  5  
ATOM 9952  H HA3  . GLY A 1 61  ? -10.978 -8.877  -20.208 1.00 0.00 ? 61  GLY A HA3  5  
ATOM 9953  N N    . THR A 1 62  ? -9.596  -7.326  -18.169 1.00 0.00 ? 62  THR A N    5  
ATOM 9954  C CA   . THR A 1 62  ? -9.542  -6.172  -17.239 1.00 0.00 ? 62  THR A CA   5  
ATOM 9955  C C    . THR A 1 62  ? -8.111  -5.668  -17.099 1.00 0.00 ? 62  THR A C    5  
ATOM 9956  O O    . THR A 1 62  ? -7.185  -6.296  -17.574 1.00 0.00 ? 62  THR A O    5  
ATOM 9957  C CB   . THR A 1 62  ? -10.037 -6.635  -15.868 1.00 0.00 ? 62  THR A CB   5  
ATOM 9958  O OG1  . THR A 1 62  ? -9.092  -7.594  -15.436 1.00 0.00 ? 62  THR A OG1  5  
ATOM 9959  C CG2  . THR A 1 62  ? -11.350 -7.419  -15.999 1.00 0.00 ? 62  THR A CG2  5  
ATOM 9960  H H    . THR A 1 62  ? -9.335  -8.217  -17.858 1.00 0.00 ? 62  THR A H    5  
ATOM 9961  H HA   . THR A 1 62  ? -10.168 -5.368  -17.627 1.00 0.00 ? 62  THR A HA   5  
ATOM 9962  H HB   . THR A 1 62  ? -10.104 -5.811  -15.163 1.00 0.00 ? 62  THR A HB   5  
ATOM 9963  H HG1  . THR A 1 62  ? -8.388  -7.130  -14.975 1.00 0.00 ? 62  THR A HG1  5  
ATOM 9964  H HG21 . THR A 1 62  ? -11.823 -7.183  -16.941 1.00 0.00 ? 62  THR A HG21 5  
ATOM 9965  H HG22 . THR A 1 62  ? -11.148 -8.478  -15.958 1.00 0.00 ? 62  THR A HG22 5  
ATOM 9966  H HG23 . THR A 1 62  ? -12.015 -7.151  -15.190 1.00 0.00 ? 62  THR A HG23 5  
ATOM 9967  N N    . ILE A 1 63  ? -7.962  -4.540  -16.451 1.00 0.00 ? 63  ILE A N    5  
ATOM 9968  C CA   . ILE A 1 63  ? -6.607  -3.962  -16.259 1.00 0.00 ? 63  ILE A CA   5  
ATOM 9969  C C    . ILE A 1 63  ? -6.266  -3.851  -14.782 1.00 0.00 ? 63  ILE A C    5  
ATOM 9970  O O    . ILE A 1 63  ? -7.034  -3.321  -14.005 1.00 0.00 ? 63  ILE A O    5  
ATOM 9971  C CB   . ILE A 1 63  ? -6.599  -2.555  -16.842 1.00 0.00 ? 63  ILE A CB   5  
ATOM 9972  C CG1  . ILE A 1 63  ? -6.932  -2.591  -18.322 1.00 0.00 ? 63  ILE A CG1  5  
ATOM 9973  C CG2  . ILE A 1 63  ? -5.190  -1.960  -16.676 1.00 0.00 ? 63  ILE A CG2  5  
ATOM 9974  C CD1  . ILE A 1 63  ? -6.602  -1.225  -18.928 1.00 0.00 ? 63  ILE A CD1  5  
ATOM 9975  H H    . ILE A 1 63  ? -8.740  -4.083  -16.087 1.00 0.00 ? 63  ILE A H    5  
ATOM 9976  H HA   . ILE A 1 63  ? -5.866  -4.588  -16.750 1.00 0.00 ? 63  ILE A HA   5  
ATOM 9977  H HB   . ILE A 1 63  ? -7.339  -1.949  -16.322 1.00 0.00 ? 63  ILE A HB   5  
ATOM 9978  H HG12 . ILE A 1 63  ? -6.347  -3.359  -18.809 1.00 0.00 ? 63  ILE A HG12 5  
ATOM 9979  H HG13 . ILE A 1 63  ? -7.982  -2.805  -18.455 1.00 0.00 ? 63  ILE A HG13 5  
ATOM 9980  H HG21 . ILE A 1 63  ? -4.621  -2.554  -15.982 1.00 0.00 ? 63  ILE A HG21 5  
ATOM 9981  H HG22 . ILE A 1 63  ? -4.683  -1.949  -17.629 1.00 0.00 ? 63  ILE A HG22 5  
ATOM 9982  H HG23 . ILE A 1 63  ? -5.266  -0.951  -16.302 1.00 0.00 ? 63  ILE A HG23 5  
ATOM 9983  H HD11 . ILE A 1 63  ? -6.481  -0.500  -18.141 1.00 0.00 ? 63  ILE A HD11 5  
ATOM 9984  H HD12 . ILE A 1 63  ? -5.683  -1.286  -19.488 1.00 0.00 ? 63  ILE A HD12 5  
ATOM 9985  H HD13 . ILE A 1 63  ? -7.398  -0.911  -19.581 1.00 0.00 ? 63  ILE A HD13 5  
ATOM 9986  N N    . ASP A 1 64  ? -5.117  -4.342  -14.420 1.00 0.00 ? 64  ASP A N    5  
ATOM 9987  C CA   . ASP A 1 64  ? -4.714  -4.269  -13.002 1.00 0.00 ? 64  ASP A CA   5  
ATOM 9988  C C    . ASP A 1 64  ? -3.984  -2.948  -12.749 1.00 0.00 ? 64  ASP A C    5  
ATOM 9989  O O    . ASP A 1 64  ? -3.628  -2.255  -13.681 1.00 0.00 ? 64  ASP A O    5  
ATOM 9990  C CB   . ASP A 1 64  ? -3.776  -5.450  -12.700 1.00 0.00 ? 64  ASP A CB   5  
ATOM 9991  C CG   . ASP A 1 64  ? -4.407  -6.747  -13.221 1.00 0.00 ? 64  ASP A CG   5  
ATOM 9992  O OD1  . ASP A 1 64  ? -5.239  -6.629  -14.104 1.00 0.00 ? 64  ASP A OD1  5  
ATOM 9993  O OD2  . ASP A 1 64  ? -4.022  -7.782  -12.703 1.00 0.00 ? 64  ASP A OD2  5  
ATOM 9994  H H    . ASP A 1 64  ? -4.524  -4.756  -15.083 1.00 0.00 ? 64  ASP A H    5  
ATOM 9995  H HA   . ASP A 1 64  ? -5.607  -4.308  -12.376 1.00 0.00 ? 64  ASP A HA   5  
ATOM 9996  H HB2  . ASP A 1 64  ? -2.824  -5.298  -13.187 1.00 0.00 ? 64  ASP A HB2  5  
ATOM 9997  H HB3  . ASP A 1 64  ? -3.626  -5.536  -11.635 1.00 0.00 ? 64  ASP A HB3  5  
ATOM 9998  N N    . PHE A 1 65  ? -3.769  -2.614  -11.501 1.00 0.00 ? 65  PHE A N    5  
ATOM 9999  C CA   . PHE A 1 65  ? -3.068  -1.339  -11.216 1.00 0.00 ? 65  PHE A CA   5  
ATOM 10000 C C    . PHE A 1 65  ? -1.656  -1.266  -11.838 1.00 0.00 ? 65  PHE A C    5  
ATOM 10001 O O    . PHE A 1 65  ? -1.306  -0.262  -12.390 1.00 0.00 ? 65  PHE A O    5  
ATOM 10002 C CB   . PHE A 1 65  ? -2.969  -1.118  -9.691  1.00 0.00 ? 65  PHE A CB   5  
ATOM 10003 C CG   . PHE A 1 65  ? -2.339  0.260   -9.435  1.00 0.00 ? 65  PHE A CG   5  
ATOM 10004 C CD1  . PHE A 1 65  ? -2.917  1.406   -9.961  1.00 0.00 ? 65  PHE A CD1  5  
ATOM 10005 C CD2  . PHE A 1 65  ? -1.175  0.378   -8.692  1.00 0.00 ? 65  PHE A CD2  5  
ATOM 10006 C CE1  . PHE A 1 65  ? -2.340  2.642   -9.748  1.00 0.00 ? 65  PHE A CE1  5  
ATOM 10007 C CE2  . PHE A 1 65  ? -0.602  1.617   -8.482  1.00 0.00 ? 65  PHE A CE2  5  
ATOM 10008 C CZ   . PHE A 1 65  ? -1.184  2.748   -9.009  1.00 0.00 ? 65  PHE A CZ   5  
ATOM 10009 H H    . PHE A 1 65  ? -4.071  -3.187  -10.773 1.00 0.00 ? 65  PHE A H    5  
ATOM 10010 H HA   . PHE A 1 65  ? -3.659  -0.538  -11.663 1.00 0.00 ? 65  PHE A HA   5  
ATOM 10011 H HB2  . PHE A 1 65  ? -3.957  -1.145  -9.254  1.00 0.00 ? 65  PHE A HB2  5  
ATOM 10012 H HB3  . PHE A 1 65  ? -2.363  -1.873  -9.240  1.00 0.00 ? 65  PHE A HB3  5  
ATOM 10013 H HD1  . PHE A 1 65  ? -3.827  1.333   -10.537 1.00 0.00 ? 65  PHE A HD1  5  
ATOM 10014 H HD2  . PHE A 1 65  ? -0.712  -0.504  -8.276  1.00 0.00 ? 65  PHE A HD2  5  
ATOM 10015 H HE1  . PHE A 1 65  ? -2.793  3.528   -10.167 1.00 0.00 ? 65  PHE A HE1  5  
ATOM 10016 H HE2  . PHE A 1 65  ? 0.306   1.701   -7.901  1.00 0.00 ? 65  PHE A HE2  5  
ATOM 10017 H HZ   . PHE A 1 65  ? -0.734  3.718   -8.844  1.00 0.00 ? 65  PHE A HZ   5  
ATOM 10018 N N    . PRO A 1 66  ? -0.860  -2.331  -11.756 1.00 0.00 ? 66  PRO A N    5  
ATOM 10019 C CA   . PRO A 1 66  ? 0.482   -2.288  -12.334 1.00 0.00 ? 66  PRO A CA   5  
ATOM 10020 C C    . PRO A 1 66  ? 0.436   -1.908  -13.809 1.00 0.00 ? 66  PRO A C    5  
ATOM 10021 O O    . PRO A 1 66  ? 1.060   -0.952  -14.224 1.00 0.00 ? 66  PRO A O    5  
ATOM 10022 C CB   . PRO A 1 66  ? 1.035   -3.718  -12.174 1.00 0.00 ? 66  PRO A CB   5  
ATOM 10023 C CG   . PRO A 1 66  ? -0.055  -4.558  -11.444 1.00 0.00 ? 66  PRO A CG   5  
ATOM 10024 C CD   . PRO A 1 66  ? -1.235  -3.617  -11.145 1.00 0.00 ? 66  PRO A CD   5  
ATOM 10025 H HA   . PRO A 1 66  ? 1.088   -1.568  -11.790 1.00 0.00 ? 66  PRO A HA   5  
ATOM 10026 H HB2  . PRO A 1 66  ? 1.243   -4.143  -13.145 1.00 0.00 ? 66  PRO A HB2  5  
ATOM 10027 H HB3  . PRO A 1 66  ? 1.941   -3.699  -11.586 1.00 0.00 ? 66  PRO A HB3  5  
ATOM 10028 H HG2  . PRO A 1 66  ? -0.382  -5.368  -12.080 1.00 0.00 ? 66  PRO A HG2  5  
ATOM 10029 H HG3  . PRO A 1 66  ? 0.341   -4.960  -10.524 1.00 0.00 ? 66  PRO A HG3  5  
ATOM 10030 H HD2  . PRO A 1 66  ? -2.122  -3.994  -11.590 1.00 0.00 ? 66  PRO A HD2  5  
ATOM 10031 H HD3  . PRO A 1 66  ? -1.362  -3.509  -10.086 1.00 0.00 ? 66  PRO A HD3  5  
ATOM 10032 N N    . GLU A 1 67  ? -0.297  -2.660  -14.574 1.00 0.00 ? 67  GLU A N    5  
ATOM 10033 C CA   . GLU A 1 67  ? -0.388  -2.348  -16.019 1.00 0.00 ? 67  GLU A CA   5  
ATOM 10034 C C    . GLU A 1 67  ? -0.809  -0.898  -16.221 1.00 0.00 ? 67  GLU A C    5  
ATOM 10035 O O    . GLU A 1 67  ? -0.253  -0.198  -17.043 1.00 0.00 ? 67  GLU A O    5  
ATOM 10036 C CB   . GLU A 1 67  ? -1.446  -3.267  -16.651 1.00 0.00 ? 67  GLU A CB   5  
ATOM 10037 C CG   . GLU A 1 67  ? -0.771  -4.555  -17.125 1.00 0.00 ? 67  GLU A CG   5  
ATOM 10038 C CD   . GLU A 1 67  ? -0.235  -5.320  -15.914 1.00 0.00 ? 67  GLU A CD   5  
ATOM 10039 O OE1  . GLU A 1 67  ? -1.065  -5.700  -15.105 1.00 0.00 ? 67  GLU A OE1  5  
ATOM 10040 O OE2  . GLU A 1 67  ? 0.973   -5.479  -15.866 1.00 0.00 ? 67  GLU A OE2  5  
ATOM 10041 H H    . GLU A 1 67  ? -0.783  -3.422  -14.198 1.00 0.00 ? 67  GLU A H    5  
ATOM 10042 H HA   . GLU A 1 67  ? 0.591   -2.502  -16.481 1.00 0.00 ? 67  GLU A HA   5  
ATOM 10043 H HB2  . GLU A 1 67  ? -2.205  -3.503  -15.921 1.00 0.00 ? 67  GLU A HB2  5  
ATOM 10044 H HB3  . GLU A 1 67  ? -1.905  -2.767  -17.491 1.00 0.00 ? 67  GLU A HB3  5  
ATOM 10045 H HG2  . GLU A 1 67  ? -1.485  -5.172  -17.650 1.00 0.00 ? 67  GLU A HG2  5  
ATOM 10046 H HG3  . GLU A 1 67  ? 0.048   -4.317  -17.788 1.00 0.00 ? 67  GLU A HG3  5  
ATOM 10047 N N    . PHE A 1 68  ? -1.787  -0.472  -15.463 1.00 0.00 ? 68  PHE A N    5  
ATOM 10048 C CA   . PHE A 1 68  ? -2.251  0.928   -15.602 1.00 0.00 ? 68  PHE A CA   5  
ATOM 10049 C C    . PHE A 1 68  ? -1.060  1.885   -15.496 1.00 0.00 ? 68  PHE A C    5  
ATOM 10050 O O    . PHE A 1 68  ? -1.031  2.912   -16.146 1.00 0.00 ? 68  PHE A O    5  
ATOM 10051 C CB   . PHE A 1 68  ? -3.267  1.218   -14.473 1.00 0.00 ? 68  PHE A CB   5  
ATOM 10052 C CG   . PHE A 1 68  ? -3.741  2.671   -14.536 1.00 0.00 ? 68  PHE A CG   5  
ATOM 10053 C CD1  . PHE A 1 68  ? -2.994  3.677   -13.950 1.00 0.00 ? 68  PHE A CD1  5  
ATOM 10054 C CD2  . PHE A 1 68  ? -4.943  2.994   -15.141 1.00 0.00 ? 68  PHE A CD2  5  
ATOM 10055 C CE1  . PHE A 1 68  ? -3.442  4.982   -13.964 1.00 0.00 ? 68  PHE A CE1  5  
ATOM 10056 C CE2  . PHE A 1 68  ? -5.390  4.302   -15.156 1.00 0.00 ? 68  PHE A CE2  5  
ATOM 10057 C CZ   . PHE A 1 68  ? -4.638  5.294   -14.566 1.00 0.00 ? 68  PHE A CZ   5  
ATOM 10058 H H    . PHE A 1 68  ? -2.207  -1.071  -14.811 1.00 0.00 ? 68  PHE A H    5  
ATOM 10059 H HA   . PHE A 1 68  ? -2.715  1.048   -16.588 1.00 0.00 ? 68  PHE A HA   5  
ATOM 10060 H HB2  . PHE A 1 68  ? -4.120  0.564   -14.578 1.00 0.00 ? 68  PHE A HB2  5  
ATOM 10061 H HB3  . PHE A 1 68  ? -2.810  1.046   -13.522 1.00 0.00 ? 68  PHE A HB3  5  
ATOM 10062 H HD1  . PHE A 1 68  ? -2.059  3.437   -13.473 1.00 0.00 ? 68  PHE A HD1  5  
ATOM 10063 H HD2  . PHE A 1 68  ? -5.539  2.216   -15.601 1.00 0.00 ? 68  PHE A HD2  5  
ATOM 10064 H HE1  . PHE A 1 68  ? -2.851  5.759   -13.502 1.00 0.00 ? 68  PHE A HE1  5  
ATOM 10065 H HE2  . PHE A 1 68  ? -6.328  4.546   -15.630 1.00 0.00 ? 68  PHE A HE2  5  
ATOM 10066 H HZ   . PHE A 1 68  ? -4.995  6.317   -14.563 1.00 0.00 ? 68  PHE A HZ   5  
ATOM 10067 N N    . LEU A 1 69  ? -0.090  1.533   -14.671 1.00 0.00 ? 69  LEU A N    5  
ATOM 10068 C CA   . LEU A 1 69  ? 1.098   2.426   -14.530 1.00 0.00 ? 69  LEU A CA   5  
ATOM 10069 C C    . LEU A 1 69  ? 1.868   2.443   -15.836 1.00 0.00 ? 69  LEU A C    5  
ATOM 10070 O O    . LEU A 1 69  ? 2.135   3.485   -16.401 1.00 0.00 ? 69  LEU A O    5  
ATOM 10071 C CB   . LEU A 1 69  ? 2.055   1.866   -13.442 1.00 0.00 ? 69  LEU A CB   5  
ATOM 10072 C CG   . LEU A 1 69  ? 1.322   1.702   -12.116 1.00 0.00 ? 69  LEU A CG   5  
ATOM 10073 C CD1  . LEU A 1 69  ? 2.336   1.361   -11.023 1.00 0.00 ? 69  LEU A CD1  5  
ATOM 10074 C CD2  . LEU A 1 69  ? 0.620   3.002   -11.757 1.00 0.00 ? 69  LEU A CD2  5  
ATOM 10075 H H    . LEU A 1 69  ? -0.151  0.698   -14.157 1.00 0.00 ? 69  LEU A H    5  
ATOM 10076 H HA   . LEU A 1 69  ? 0.769   3.435   -14.290 1.00 0.00 ? 69  LEU A HA   5  
ATOM 10077 H HB2  . LEU A 1 69  ? 2.439   0.908   -13.760 1.00 0.00 ? 69  LEU A HB2  5  
ATOM 10078 H HB3  . LEU A 1 69  ? 2.883   2.547   -13.310 1.00 0.00 ? 69  LEU A HB3  5  
ATOM 10079 H HG   . LEU A 1 69  ? 0.611   0.918   -12.197 1.00 0.00 ? 69  LEU A HG   5  
ATOM 10080 H HD11 . LEU A 1 69  ? 2.844   0.441   -11.271 1.00 0.00 ? 69  LEU A HD11 5  
ATOM 10081 H HD12 . LEU A 1 69  ? 3.062   2.154   -10.936 1.00 0.00 ? 69  LEU A HD12 5  
ATOM 10082 H HD13 . LEU A 1 69  ? 1.826   1.241   -10.077 1.00 0.00 ? 69  LEU A HD13 5  
ATOM 10083 H HD21 . LEU A 1 69  ? 1.163   3.836   -12.172 1.00 0.00 ? 69  LEU A HD21 5  
ATOM 10084 H HD22 . LEU A 1 69  ? -0.381  2.993   -12.155 1.00 0.00 ? 69  LEU A HD22 5  
ATOM 10085 H HD23 . LEU A 1 69  ? 0.574   3.104   -10.684 1.00 0.00 ? 69  LEU A HD23 5  
ATOM 10086 N N    . THR A 1 70  ? 2.208   1.269   -16.288 1.00 0.00 ? 70  THR A N    5  
ATOM 10087 C CA   . THR A 1 70  ? 2.962   1.148   -17.552 1.00 0.00 ? 70  THR A CA   5  
ATOM 10088 C C    . THR A 1 70  ? 2.315   1.948   -18.668 1.00 0.00 ? 70  THR A C    5  
ATOM 10089 O O    . THR A 1 70  ? 2.983   2.677   -19.376 1.00 0.00 ? 70  THR A O    5  
ATOM 10090 C CB   . THR A 1 70  ? 2.978   -0.331  -17.946 1.00 0.00 ? 70  THR A CB   5  
ATOM 10091 O OG1  . THR A 1 70  ? 3.907   -0.939  -17.075 1.00 0.00 ? 70  THR A OG1  5  
ATOM 10092 C CG2  . THR A 1 70  ? 3.577   -0.524  -19.344 1.00 0.00 ? 70  THR A CG2  5  
ATOM 10093 H H    . THR A 1 70  ? 1.960   0.463   -15.788 1.00 0.00 ? 70  THR A H    5  
ATOM 10094 H HA   . THR A 1 70  ? 3.969   1.512   -17.395 1.00 0.00 ? 70  THR A HA   5  
ATOM 10095 H HB   . THR A 1 70  ? 1.997   -0.784  -17.841 1.00 0.00 ? 70  THR A HB   5  
ATOM 10096 H HG1  . THR A 1 70  ? 3.984   -1.864  -17.322 1.00 0.00 ? 70  THR A HG1  5  
ATOM 10097 H HG21 . THR A 1 70  ? 3.019   0.055   -20.063 1.00 0.00 ? 70  THR A HG21 5  
ATOM 10098 H HG22 . THR A 1 70  ? 4.606   -0.199  -19.346 1.00 0.00 ? 70  THR A HG22 5  
ATOM 10099 H HG23 . THR A 1 70  ? 3.533   -1.569  -19.617 1.00 0.00 ? 70  THR A HG23 5  
ATOM 10100 N N    . MET A 1 71  ? 1.029   1.811   -18.810 1.00 0.00 ? 71  MET A N    5  
ATOM 10101 C CA   . MET A 1 71  ? 0.343   2.566   -19.882 1.00 0.00 ? 71  MET A CA   5  
ATOM 10102 C C    . MET A 1 71  ? 0.548   4.055   -19.708 1.00 0.00 ? 71  MET A C    5  
ATOM 10103 O O    . MET A 1 71  ? 0.786   4.765   -20.664 1.00 0.00 ? 71  MET A O    5  
ATOM 10104 C CB   . MET A 1 71  ? -1.161  2.258   -19.814 1.00 0.00 ? 71  MET A CB   5  
ATOM 10105 C CG   . MET A 1 71  ? -1.375  0.754   -19.991 1.00 0.00 ? 71  MET A CG   5  
ATOM 10106 S SD   . MET A 1 71  ? -2.911  0.052   -19.340 1.00 0.00 ? 71  MET A SD   5  
ATOM 10107 C CE   . MET A 1 71  ? -4.019  0.700   -20.619 1.00 0.00 ? 71  MET A CE   5  
ATOM 10108 H H    . MET A 1 71  ? 0.520   1.222   -18.209 1.00 0.00 ? 71  MET A H    5  
ATOM 10109 H HA   . MET A 1 71  ? 0.759   2.269   -20.843 1.00 0.00 ? 71  MET A HA   5  
ATOM 10110 H HB2  . MET A 1 71  ? -1.551  2.569   -18.857 1.00 0.00 ? 71  MET A HB2  5  
ATOM 10111 H HB3  . MET A 1 71  ? -1.677  2.793   -20.598 1.00 0.00 ? 71  MET A HB3  5  
ATOM 10112 H HG2  . MET A 1 71  ? -1.334  0.531   -21.047 1.00 0.00 ? 71  MET A HG2  5  
ATOM 10113 H HG3  . MET A 1 71  ? -0.552  0.240   -19.517 1.00 0.00 ? 71  MET A HG3  5  
ATOM 10114 H HE1  . MET A 1 71  ? -3.683  1.680   -20.922 1.00 0.00 ? 71  MET A HE1  5  
ATOM 10115 H HE2  . MET A 1 71  ? -4.012  0.036   -21.471 1.00 0.00 ? 71  MET A HE2  5  
ATOM 10116 H HE3  . MET A 1 71  ? -5.022  0.767   -20.224 1.00 0.00 ? 71  MET A HE3  5  
ATOM 10117 N N    . MET A 1 72  ? 0.455   4.510   -18.495 1.00 0.00 ? 72  MET A N    5  
ATOM 10118 C CA   . MET A 1 72  ? 0.645   5.951   -18.262 1.00 0.00 ? 72  MET A CA   5  
ATOM 10119 C C    . MET A 1 72  ? 2.063   6.358   -18.602 1.00 0.00 ? 72  MET A C    5  
ATOM 10120 O O    . MET A 1 72  ? 2.280   7.309   -19.325 1.00 0.00 ? 72  MET A O    5  
ATOM 10121 C CB   . MET A 1 72  ? 0.402   6.251   -16.782 1.00 0.00 ? 72  MET A CB   5  
ATOM 10122 C CG   . MET A 1 72  ? -1.104  6.379   -16.521 1.00 0.00 ? 72  MET A CG   5  
ATOM 10123 S SD   . MET A 1 72  ? -2.091  7.326   -17.712 1.00 0.00 ? 72  MET A SD   5  
ATOM 10124 C CE   . MET A 1 72  ? -1.917  8.947   -16.925 1.00 0.00 ? 72  MET A CE   5  
ATOM 10125 H H    . MET A 1 72  ? 0.265   3.905   -17.748 1.00 0.00 ? 72  MET A H    5  
ATOM 10126 H HA   . MET A 1 72  ? -0.044  6.505   -18.889 1.00 0.00 ? 72  MET A HA   5  
ATOM 10127 H HB2  . MET A 1 72  ? 0.809   5.454   -16.179 1.00 0.00 ? 72  MET A HB2  5  
ATOM 10128 H HB3  . MET A 1 72  ? 0.894   7.176   -16.525 1.00 0.00 ? 72  MET A HB3  5  
ATOM 10129 H HG2  . MET A 1 72  ? -1.520  5.385   -16.471 1.00 0.00 ? 72  MET A HG2  5  
ATOM 10130 H HG3  . MET A 1 72  ? -1.238  6.835   -15.551 1.00 0.00 ? 72  MET A HG3  5  
ATOM 10131 H HE1  . MET A 1 72  ? -2.033  8.843   -15.860 1.00 0.00 ? 72  MET A HE1  5  
ATOM 10132 H HE2  . MET A 1 72  ? -0.942  9.349   -17.143 1.00 0.00 ? 72  MET A HE2  5  
ATOM 10133 H HE3  . MET A 1 72  ? -2.676  9.614   -17.305 1.00 0.00 ? 72  MET A HE3  5  
ATOM 10134 N N    . ALA A 1 73  ? 3.009   5.621   -18.082 1.00 0.00 ? 73  ALA A N    5  
ATOM 10135 C CA   . ALA A 1 73  ? 4.421   5.950   -18.364 1.00 0.00 ? 73  ALA A CA   5  
ATOM 10136 C C    . ALA A 1 73  ? 4.611   6.266   -19.834 1.00 0.00 ? 73  ALA A C    5  
ATOM 10137 O O    . ALA A 1 73  ? 5.285   7.211   -20.179 1.00 0.00 ? 73  ALA A O    5  
ATOM 10138 C CB   . ALA A 1 73  ? 5.290   4.738   -17.998 1.00 0.00 ? 73  ALA A CB   5  
ATOM 10139 H H    . ALA A 1 73  ? 2.784   4.853   -17.515 1.00 0.00 ? 73  ALA A H    5  
ATOM 10140 H HA   . ALA A 1 73  ? 4.703   6.828   -17.775 1.00 0.00 ? 73  ALA A HA   5  
ATOM 10141 H HB1  . ALA A 1 73  ? 4.698   4.017   -17.456 1.00 0.00 ? 73  ALA A HB1  5  
ATOM 10142 H HB2  . ALA A 1 73  ? 5.675   4.278   -18.896 1.00 0.00 ? 73  ALA A HB2  5  
ATOM 10143 H HB3  . ALA A 1 73  ? 6.116   5.056   -17.380 1.00 0.00 ? 73  ALA A HB3  5  
ATOM 10144 N N    . ARG A 1 74  ? 4.017   5.470   -20.683 1.00 0.00 ? 74  ARG A N    5  
ATOM 10145 C CA   . ARG A 1 74  ? 4.171   5.739   -22.128 1.00 0.00 ? 74  ARG A CA   5  
ATOM 10146 C C    . ARG A 1 74  ? 3.344   6.941   -22.510 1.00 0.00 ? 74  ARG A C    5  
ATOM 10147 O O    . ARG A 1 74  ? 3.782   7.783   -23.267 1.00 0.00 ? 74  ARG A O    5  
ATOM 10148 C CB   . ARG A 1 74  ? 3.695   4.514   -22.914 1.00 0.00 ? 74  ARG A CB   5  
ATOM 10149 C CG   . ARG A 1 74  ? 4.873   3.556   -23.092 1.00 0.00 ? 74  ARG A CG   5  
ATOM 10150 C CD   . ARG A 1 74  ? 4.339   2.157   -23.377 1.00 0.00 ? 74  ARG A CD   5  
ATOM 10151 N NE   . ARG A 1 74  ? 3.710   2.141   -24.729 1.00 0.00 ? 74  ARG A NE   5  
ATOM 10152 C CZ   . ARG A 1 74  ? 4.293   2.765   -25.716 1.00 0.00 ? 74  ARG A CZ   5  
ATOM 10153 N NH1  . ARG A 1 74  ? 5.579   2.617   -25.884 1.00 0.00 ? 74  ARG A NH1  5  
ATOM 10154 N NH2  . ARG A 1 74  ? 3.570   3.517   -26.500 1.00 0.00 ? 74  ARG A NH2  5  
ATOM 10155 H H    . ARG A 1 74  ? 3.470   4.708   -20.368 1.00 0.00 ? 74  ARG A H    5  
ATOM 10156 H HA   . ARG A 1 74  ? 5.217   5.956   -22.337 1.00 0.00 ? 74  ARG A HA   5  
ATOM 10157 H HB2  . ARG A 1 74  ? 2.901   4.019   -22.374 1.00 0.00 ? 74  ARG A HB2  5  
ATOM 10158 H HB3  . ARG A 1 74  ? 3.327   4.823   -23.882 1.00 0.00 ? 74  ARG A HB3  5  
ATOM 10159 H HG2  . ARG A 1 74  ? 5.490   3.886   -23.913 1.00 0.00 ? 74  ARG A HG2  5  
ATOM 10160 H HG3  . ARG A 1 74  ? 5.465   3.539   -22.189 1.00 0.00 ? 74  ARG A HG3  5  
ATOM 10161 H HD2  . ARG A 1 74  ? 5.149   1.445   -23.350 1.00 0.00 ? 74  ARG A HD2  5  
ATOM 10162 H HD3  . ARG A 1 74  ? 3.602   1.890   -22.636 1.00 0.00 ? 74  ARG A HD3  5  
ATOM 10163 H HE   . ARG A 1 74  ? 2.865   1.665   -24.875 1.00 0.00 ? 74  ARG A HE   5  
ATOM 10164 H HH11 . ARG A 1 74  ? 6.101   2.033   -25.263 1.00 0.00 ? 74  ARG A HH11 5  
ATOM 10165 H HH12 . ARG A 1 74  ? 6.041   3.089   -26.635 1.00 0.00 ? 74  ARG A HH12 5  
ATOM 10166 H HH21 . ARG A 1 74  ? 2.587   3.608   -26.339 1.00 0.00 ? 74  ARG A HH21 5  
ATOM 10167 H HH22 . ARG A 1 74  ? 3.999   4.004   -27.261 1.00 0.00 ? 74  ARG A HH22 5  
ATOM 10168 N N    . LYS A 1 75  ? 2.157   7.007   -21.985 1.00 0.00 ? 75  LYS A N    5  
ATOM 10169 C CA   . LYS A 1 75  ? 1.301   8.155   -22.312 1.00 0.00 ? 75  LYS A CA   5  
ATOM 10170 C C    . LYS A 1 75  ? 1.861   9.388   -21.628 1.00 0.00 ? 75  LYS A C    5  
ATOM 10171 O O    . LYS A 1 75  ? 1.394   10.490  -21.836 1.00 0.00 ? 75  LYS A O    5  
ATOM 10172 C CB   . LYS A 1 75  ? -0.117  7.887   -21.786 1.00 0.00 ? 75  LYS A CB   5  
ATOM 10173 C CG   . LYS A 1 75  ? -0.723  6.706   -22.551 1.00 0.00 ? 75  LYS A CG   5  
ATOM 10174 C CD   . LYS A 1 75  ? -1.866  7.212   -23.433 1.00 0.00 ? 75  LYS A CD   5  
ATOM 10175 C CE   . LYS A 1 75  ? -2.971  7.785   -22.544 1.00 0.00 ? 75  LYS A CE   5  
ATOM 10176 N NZ   . LYS A 1 75  ? -3.002  9.271   -22.644 1.00 0.00 ? 75  LYS A NZ   5  
ATOM 10177 H H    . LYS A 1 75  ? 1.840   6.303   -21.382 1.00 0.00 ? 75  LYS A H    5  
ATOM 10178 H HA   . LYS A 1 75  ? 1.301   8.310   -23.392 1.00 0.00 ? 75  LYS A HA   5  
ATOM 10179 H HB2  . LYS A 1 75  ? -0.075  7.654   -20.736 1.00 0.00 ? 75  LYS A HB2  5  
ATOM 10180 H HB3  . LYS A 1 75  ? -0.729  8.766   -21.928 1.00 0.00 ? 75  LYS A HB3  5  
ATOM 10181 H HG2  . LYS A 1 75  ? 0.034   6.246   -23.167 1.00 0.00 ? 75  LYS A HG2  5  
ATOM 10182 H HG3  . LYS A 1 75  ? -1.102  5.977   -21.851 1.00 0.00 ? 75  LYS A HG3  5  
ATOM 10183 H HD2  . LYS A 1 75  ? -1.500  7.983   -24.096 1.00 0.00 ? 75  LYS A HD2  5  
ATOM 10184 H HD3  . LYS A 1 75  ? -2.259  6.397   -24.021 1.00 0.00 ? 75  LYS A HD3  5  
ATOM 10185 H HE2  . LYS A 1 75  ? -3.927  7.390   -22.854 1.00 0.00 ? 75  LYS A HE2  5  
ATOM 10186 H HE3  . LYS A 1 75  ? -2.791  7.505   -21.516 1.00 0.00 ? 75  LYS A HE3  5  
ATOM 10187 H HZ1  . LYS A 1 75  ? -2.035  9.629   -22.779 1.00 0.00 ? 75  LYS A HZ1  5  
ATOM 10188 H HZ2  . LYS A 1 75  ? -3.591  9.551   -23.454 1.00 0.00 ? 75  LYS A HZ2  5  
ATOM 10189 H HZ3  . LYS A 1 75  ? -3.401  9.669   -21.771 1.00 0.00 ? 75  LYS A HZ3  5  
ATOM 10190 N N    . MET A 1 76  ? 2.872   9.160   -20.810 1.00 0.00 ? 76  MET A N    5  
ATOM 10191 C CA   . MET A 1 76  ? 3.510   10.278  -20.081 1.00 0.00 ? 76  MET A CA   5  
ATOM 10192 C C    . MET A 1 76  ? 5.011   10.298  -20.336 1.00 0.00 ? 76  MET A C    5  
ATOM 10193 O O    . MET A 1 76  ? 5.724   11.110  -19.783 1.00 0.00 ? 76  MET A O    5  
ATOM 10194 C CB   . MET A 1 76  ? 3.282   10.076  -18.579 1.00 0.00 ? 76  MET A CB   5  
ATOM 10195 C CG   . MET A 1 76  ? 1.835   10.429  -18.233 1.00 0.00 ? 76  MET A CG   5  
ATOM 10196 S SD   . MET A 1 76  ? 1.360   10.385  -16.486 1.00 0.00 ? 76  MET A SD   5  
ATOM 10197 C CE   . MET A 1 76  ? 2.951   10.914  -15.802 1.00 0.00 ? 76  MET A CE   5  
ATOM 10198 H H    . MET A 1 76  ? 3.200   8.247   -20.682 1.00 0.00 ? 76  MET A H    5  
ATOM 10199 H HA   . MET A 1 76  ? 3.081   11.215  -20.413 1.00 0.00 ? 76  MET A HA   5  
ATOM 10200 H HB2  . MET A 1 76  ? 3.480   9.048   -18.314 1.00 0.00 ? 76  MET A HB2  5  
ATOM 10201 H HB3  . MET A 1 76  ? 3.954   10.713  -18.031 1.00 0.00 ? 76  MET A HB3  5  
ATOM 10202 H HG2  . MET A 1 76  ? 1.635   11.424  -18.601 1.00 0.00 ? 76  MET A HG2  5  
ATOM 10203 H HG3  . MET A 1 76  ? 1.187   9.748   -18.765 1.00 0.00 ? 76  MET A HG3  5  
ATOM 10204 H HE1  . MET A 1 76  ? 3.277   11.817  -16.301 1.00 0.00 ? 76  MET A HE1  5  
ATOM 10205 H HE2  . MET A 1 76  ? 2.842   11.107  -14.749 1.00 0.00 ? 76  MET A HE2  5  
ATOM 10206 H HE3  . MET A 1 76  ? 3.685   10.133  -15.951 1.00 0.00 ? 76  MET A HE3  5  
ATOM 10207 N N    . LYS A 1 77  ? 5.469   9.399   -21.171 1.00 0.00 ? 77  LYS A N    5  
ATOM 10208 C CA   . LYS A 1 77  ? 6.917   9.364   -21.464 1.00 0.00 ? 77  LYS A CA   5  
ATOM 10209 C C    . LYS A 1 77  ? 7.300   10.624  -22.175 1.00 0.00 ? 77  LYS A C    5  
ATOM 10210 O O    . LYS A 1 77  ? 8.434   10.820  -22.563 1.00 0.00 ? 77  LYS A O    5  
ATOM 10211 C CB   . LYS A 1 77  ? 7.215   8.158   -22.369 1.00 0.00 ? 77  LYS A CB   5  
ATOM 10212 C CG   . LYS A 1 77  ? 8.711   8.127   -22.686 1.00 0.00 ? 77  LYS A CG   5  
ATOM 10213 C CD   . LYS A 1 77  ? 9.200   6.676   -22.676 1.00 0.00 ? 77  LYS A CD   5  
ATOM 10214 C CE   . LYS A 1 77  ? 10.666  6.639   -23.118 1.00 0.00 ? 77  LYS A CE   5  
ATOM 10215 N NZ   . LYS A 1 77  ? 11.300  5.350   -22.718 1.00 0.00 ? 77  LYS A NZ   5  
ATOM 10216 H H    . LYS A 1 77  ? 4.863   8.778   -21.611 1.00 0.00 ? 77  LYS A H    5  
ATOM 10217 H HA   . LYS A 1 77  ? 7.461   9.306   -20.534 1.00 0.00 ? 77  LYS A HA   5  
ATOM 10218 H HB2  . LYS A 1 77  ? 6.932   7.247   -21.866 1.00 0.00 ? 77  LYS A HB2  5  
ATOM 10219 H HB3  . LYS A 1 77  ? 6.652   8.245   -23.287 1.00 0.00 ? 77  LYS A HB3  5  
ATOM 10220 H HG2  . LYS A 1 77  ? 8.885   8.562   -23.658 1.00 0.00 ? 77  LYS A HG2  5  
ATOM 10221 H HG3  . LYS A 1 77  ? 9.250   8.695   -21.942 1.00 0.00 ? 77  LYS A HG3  5  
ATOM 10222 H HD2  . LYS A 1 77  ? 9.112   6.270   -21.677 1.00 0.00 ? 77  LYS A HD2  5  
ATOM 10223 H HD3  . LYS A 1 77  ? 8.601   6.086   -23.352 1.00 0.00 ? 77  LYS A HD3  5  
ATOM 10224 H HE2  . LYS A 1 77  ? 10.722  6.742   -24.192 1.00 0.00 ? 77  LYS A HE2  5  
ATOM 10225 H HE3  . LYS A 1 77  ? 11.204  7.454   -22.657 1.00 0.00 ? 77  LYS A HE3  5  
ATOM 10226 H HZ1  . LYS A 1 77  ? 10.839  4.987   -21.861 1.00 0.00 ? 77  LYS A HZ1  5  
ATOM 10227 H HZ2  . LYS A 1 77  ? 11.195  4.659   -23.489 1.00 0.00 ? 77  LYS A HZ2  5  
ATOM 10228 H HZ3  . LYS A 1 77  ? 12.311  5.506   -22.529 1.00 0.00 ? 77  LYS A HZ3  5  
ATOM 10229 N N    . ASP A 1 78  ? 6.322   11.452  -22.329 1.00 0.00 ? 78  ASP A N    5  
ATOM 10230 C CA   . ASP A 1 78  ? 6.536   12.750  -23.013 1.00 0.00 ? 78  ASP A CA   5  
ATOM 10231 C C    . ASP A 1 78  ? 6.037   13.909  -22.149 1.00 0.00 ? 78  ASP A C    5  
ATOM 10232 O O    . ASP A 1 78  ? 5.150   14.640  -22.540 1.00 0.00 ? 78  ASP A O    5  
ATOM 10233 C CB   . ASP A 1 78  ? 5.738   12.739  -24.325 1.00 0.00 ? 78  ASP A CB   5  
ATOM 10234 C CG   . ASP A 1 78  ? 6.292   11.647  -25.242 1.00 0.00 ? 78  ASP A CG   5  
ATOM 10235 O OD1  . ASP A 1 78  ? 7.311   11.090  -24.868 1.00 0.00 ? 78  ASP A OD1  5  
ATOM 10236 O OD2  . ASP A 1 78  ? 5.665   11.433  -26.267 1.00 0.00 ? 78  ASP A OD2  5  
ATOM 10237 H H    . ASP A 1 78  ? 5.434   11.206  -21.997 1.00 0.00 ? 78  ASP A H    5  
ATOM 10238 H HA   . ASP A 1 78  ? 7.592   12.881  -23.204 1.00 0.00 ? 78  ASP A HA   5  
ATOM 10239 H HB2  . ASP A 1 78  ? 4.698   12.536  -24.118 1.00 0.00 ? 78  ASP A HB2  5  
ATOM 10240 H HB3  . ASP A 1 78  ? 5.826   13.697  -24.815 1.00 0.00 ? 78  ASP A HB3  5  
ATOM 10241 N N    . THR A 1 79  ? 6.618   14.054  -20.989 1.00 0.00 ? 79  THR A N    5  
ATOM 10242 C CA   . THR A 1 79  ? 6.191   15.154  -20.091 1.00 0.00 ? 79  THR A CA   5  
ATOM 10243 C C    . THR A 1 79  ? 7.017   16.397  -20.328 1.00 0.00 ? 79  THR A C    5  
ATOM 10244 O O    . THR A 1 79  ? 6.946   17.352  -19.580 1.00 0.00 ? 79  THR A O    5  
ATOM 10245 C CB   . THR A 1 79  ? 6.408   14.703  -18.658 1.00 0.00 ? 79  THR A CB   5  
ATOM 10246 O OG1  . THR A 1 79  ? 5.507   13.633  -18.464 1.00 0.00 ? 79  THR A OG1  5  
ATOM 10247 C CG2  . THR A 1 79  ? 5.953   15.787  -17.671 1.00 0.00 ? 79  THR A CG2  5  
ATOM 10248 H H    . THR A 1 79  ? 7.327   13.442  -20.711 1.00 0.00 ? 79  THR A H    5  
ATOM 10249 H HA   . THR A 1 79  ? 5.154   15.379  -20.277 1.00 0.00 ? 79  THR A HA   5  
ATOM 10250 H HB   . THR A 1 79  ? 7.434   14.384  -18.495 1.00 0.00 ? 79  THR A HB   5  
ATOM 10251 H HG1  . THR A 1 79  ? 5.548   13.069  -19.240 1.00 0.00 ? 79  THR A HG1  5  
ATOM 10252 H HG21 . THR A 1 79  ? 5.250   16.450  -18.155 1.00 0.00 ? 79  THR A HG21 5  
ATOM 10253 H HG22 . THR A 1 79  ? 5.478   15.327  -16.816 1.00 0.00 ? 79  THR A HG22 5  
ATOM 10254 H HG23 . THR A 1 79  ? 6.809   16.358  -17.337 1.00 0.00 ? 79  THR A HG23 5  
ATOM 10255 N N    . ASP A 1 80  ? 7.779   16.362  -21.360 1.00 0.00 ? 80  ASP A N    5  
ATOM 10256 C CA   . ASP A 1 80  ? 8.633   17.532  -21.682 1.00 0.00 ? 80  ASP A CA   5  
ATOM 10257 C C    . ASP A 1 80  ? 7.932   18.487  -22.644 1.00 0.00 ? 80  ASP A C    5  
ATOM 10258 O O    . ASP A 1 80  ? 7.828   18.215  -23.823 1.00 0.00 ? 80  ASP A O    5  
ATOM 10259 C CB   . ASP A 1 80  ? 9.915   17.023  -22.350 1.00 0.00 ? 80  ASP A CB   5  
ATOM 10260 C CG   . ASP A 1 80  ? 10.943  18.152  -22.373 1.00 0.00 ? 80  ASP A CG   5  
ATOM 10261 O OD1  . ASP A 1 80  ? 10.616  19.169  -22.962 1.00 0.00 ? 80  ASP A OD1  5  
ATOM 10262 O OD2  . ASP A 1 80  ? 11.996  17.936  -21.798 1.00 0.00 ? 80  ASP A OD2  5  
ATOM 10263 H H    . ASP A 1 80  ? 7.794   15.569  -21.921 1.00 0.00 ? 80  ASP A H    5  
ATOM 10264 H HA   . ASP A 1 80  ? 8.864   18.062  -20.762 1.00 0.00 ? 80  ASP A HA   5  
ATOM 10265 H HB2  . ASP A 1 80  ? 10.312  16.186  -21.796 1.00 0.00 ? 80  ASP A HB2  5  
ATOM 10266 H HB3  . ASP A 1 80  ? 9.702   16.714  -23.362 1.00 0.00 ? 80  ASP A HB3  5  
ATOM 10267 N N    . SER A 1 81  ? 7.462   19.593  -22.124 1.00 0.00 ? 81  SER A N    5  
ATOM 10268 C CA   . SER A 1 81  ? 6.769   20.571  -23.004 1.00 0.00 ? 81  SER A CA   5  
ATOM 10269 C C    . SER A 1 81  ? 6.950   22.006  -22.500 1.00 0.00 ? 81  SER A C    5  
ATOM 10270 O O    . SER A 1 81  ? 6.681   22.958  -23.212 1.00 0.00 ? 81  SER A O    5  
ATOM 10271 C CB   . SER A 1 81  ? 5.271   20.238  -23.008 1.00 0.00 ? 81  SER A CB   5  
ATOM 10272 O OG   . SER A 1 81  ? 5.098   19.423  -24.158 1.00 0.00 ? 81  SER A OG   5  
ATOM 10273 H H    . SER A 1 81  ? 7.554   19.767  -21.167 1.00 0.00 ? 81  SER A H    5  
ATOM 10274 H HA   . SER A 1 81  ? 7.183   20.494  -24.006 1.00 0.00 ? 81  SER A HA   5  
ATOM 10275 H HB2  . SER A 1 81  ? 4.998   19.692  -22.117 1.00 0.00 ? 81  SER A HB2  5  
ATOM 10276 H HB3  . SER A 1 81  ? 4.680   21.138  -23.095 1.00 0.00 ? 81  SER A HB3  5  
ATOM 10277 H HG   . SER A 1 81  ? 5.331   19.946  -24.930 1.00 0.00 ? 81  SER A HG   5  
ATOM 10278 N N    . GLU A 1 82  ? 7.406   22.136  -21.288 1.00 0.00 ? 82  GLU A N    5  
ATOM 10279 C CA   . GLU A 1 82  ? 7.608   23.497  -20.725 1.00 0.00 ? 82  GLU A CA   5  
ATOM 10280 C C    . GLU A 1 82  ? 8.501   24.352  -21.631 1.00 0.00 ? 82  GLU A C    5  
ATOM 10281 O O    . GLU A 1 82  ? 8.312   25.547  -21.738 1.00 0.00 ? 82  GLU A O    5  
ATOM 10282 C CB   . GLU A 1 82  ? 8.282   23.353  -19.344 1.00 0.00 ? 82  GLU A CB   5  
ATOM 10283 C CG   . GLU A 1 82  ? 9.805   23.407  -19.510 1.00 0.00 ? 82  GLU A CG   5  
ATOM 10284 C CD   . GLU A 1 82  ? 10.475  22.981  -18.202 1.00 0.00 ? 82  GLU A CD   5  
ATOM 10285 O OE1  . GLU A 1 82  ? 10.553  23.833  -17.332 1.00 0.00 ? 82  GLU A OE1  5  
ATOM 10286 O OE2  . GLU A 1 82  ? 10.871  21.829  -18.148 1.00 0.00 ? 82  GLU A OE2  5  
ATOM 10287 H H    . GLU A 1 82  ? 7.613   21.344  -20.750 1.00 0.00 ? 82  GLU A H    5  
ATOM 10288 H HA   . GLU A 1 82  ? 6.637   23.984  -20.629 1.00 0.00 ? 82  GLU A HA   5  
ATOM 10289 H HB2  . GLU A 1 82  ? 7.958   24.156  -18.698 1.00 0.00 ? 82  GLU A HB2  5  
ATOM 10290 H HB3  . GLU A 1 82  ? 7.999   22.408  -18.902 1.00 0.00 ? 82  GLU A HB3  5  
ATOM 10291 H HG2  . GLU A 1 82  ? 10.110  22.740  -20.302 1.00 0.00 ? 82  GLU A HG2  5  
ATOM 10292 H HG3  . GLU A 1 82  ? 10.111  24.414  -19.754 1.00 0.00 ? 82  GLU A HG3  5  
ATOM 10293 N N    . GLU A 1 83  ? 9.453   23.724  -22.265 1.00 0.00 ? 83  GLU A N    5  
ATOM 10294 C CA   . GLU A 1 83  ? 10.363  24.488  -23.163 1.00 0.00 ? 83  GLU A CA   5  
ATOM 10295 C C    . GLU A 1 83  ? 9.590   25.156  -24.296 1.00 0.00 ? 83  GLU A C    5  
ATOM 10296 O O    . GLU A 1 83  ? 9.781   26.327  -24.577 1.00 0.00 ? 83  GLU A O    5  
ATOM 10297 C CB   . GLU A 1 83  ? 11.384  23.509  -23.769 1.00 0.00 ? 83  GLU A CB   5  
ATOM 10298 C CG   . GLU A 1 83  ? 12.302  22.989  -22.657 1.00 0.00 ? 83  GLU A CG   5  
ATOM 10299 C CD   . GLU A 1 83  ? 13.528  22.319  -23.283 1.00 0.00 ? 83  GLU A CD   5  
ATOM 10300 O OE1  . GLU A 1 83  ? 13.434  22.007  -24.459 1.00 0.00 ? 83  GLU A OE1  5  
ATOM 10301 O OE2  . GLU A 1 83  ? 14.490  22.158  -22.549 1.00 0.00 ? 83  GLU A OE2  5  
ATOM 10302 H H    . GLU A 1 83  ? 9.567   22.758  -22.155 1.00 0.00 ? 83  GLU A H    5  
ATOM 10303 H HA   . GLU A 1 83  ? 10.869  25.258  -22.580 1.00 0.00 ? 83  GLU A HA   5  
ATOM 10304 H HB2  . GLU A 1 83  ? 10.865  22.681  -24.227 1.00 0.00 ? 83  GLU A HB2  5  
ATOM 10305 H HB3  . GLU A 1 83  ? 11.974  24.015  -24.519 1.00 0.00 ? 83  GLU A HB3  5  
ATOM 10306 H HG2  . GLU A 1 83  ? 12.623  23.810  -22.034 1.00 0.00 ? 83  GLU A HG2  5  
ATOM 10307 H HG3  . GLU A 1 83  ? 11.771  22.268  -22.053 1.00 0.00 ? 83  GLU A HG3  5  
ATOM 10308 N N    . GLU A 1 84  ? 8.726   24.407  -24.926 1.00 0.00 ? 84  GLU A N    5  
ATOM 10309 C CA   . GLU A 1 84  ? 7.941   24.993  -26.037 1.00 0.00 ? 84  GLU A CA   5  
ATOM 10310 C C    . GLU A 1 84  ? 7.122   26.168  -25.538 1.00 0.00 ? 84  GLU A C    5  
ATOM 10311 O O    . GLU A 1 84  ? 6.909   27.132  -26.249 1.00 0.00 ? 84  GLU A O    5  
ATOM 10312 C CB   . GLU A 1 84  ? 6.986   23.918  -26.581 1.00 0.00 ? 84  GLU A CB   5  
ATOM 10313 C CG   . GLU A 1 84  ? 6.696   24.209  -28.056 1.00 0.00 ? 84  GLU A CG   5  
ATOM 10314 C CD   . GLU A 1 84  ? 5.986   25.561  -28.176 1.00 0.00 ? 84  GLU A CD   5  
ATOM 10315 O OE1  . GLU A 1 84  ? 5.146   25.809  -27.327 1.00 0.00 ? 84  GLU A OE1  5  
ATOM 10316 O OE2  . GLU A 1 84  ? 6.326   26.270  -29.109 1.00 0.00 ? 84  GLU A OE2  5  
ATOM 10317 H H    . GLU A 1 84  ? 8.590   23.474  -24.659 1.00 0.00 ? 84  GLU A H    5  
ATOM 10318 H HA   . GLU A 1 84  ? 8.625   25.336  -26.813 1.00 0.00 ? 84  GLU A HA   5  
ATOM 10319 H HB2  . GLU A 1 84  ? 7.442   22.944  -26.485 1.00 0.00 ? 84  GLU A HB2  5  
ATOM 10320 H HB3  . GLU A 1 84  ? 6.064   23.935  -26.018 1.00 0.00 ? 84  GLU A HB3  5  
ATOM 10321 H HG2  . GLU A 1 84  ? 7.621   24.242  -28.612 1.00 0.00 ? 84  GLU A HG2  5  
ATOM 10322 H HG3  . GLU A 1 84  ? 6.061   23.437  -28.463 1.00 0.00 ? 84  GLU A HG3  5  
ATOM 10323 N N    . ILE A 1 85  ? 6.677   26.069  -24.319 1.00 0.00 ? 85  ILE A N    5  
ATOM 10324 C CA   . ILE A 1 85  ? 5.870   27.169  -23.752 1.00 0.00 ? 85  ILE A CA   5  
ATOM 10325 C C    . ILE A 1 85  ? 6.738   28.381  -23.438 1.00 0.00 ? 85  ILE A C    5  
ATOM 10326 O O    . ILE A 1 85  ? 6.438   29.483  -23.855 1.00 0.00 ? 85  ILE A O    5  
ATOM 10327 C CB   . ILE A 1 85  ? 5.231   26.675  -22.464 1.00 0.00 ? 85  ILE A CB   5  
ATOM 10328 C CG1  . ILE A 1 85  ? 4.141   25.667  -22.793 1.00 0.00 ? 85  ILE A CG1  5  
ATOM 10329 C CG2  . ILE A 1 85  ? 4.595   27.877  -21.743 1.00 0.00 ? 85  ILE A CG2  5  
ATOM 10330 C CD1  . ILE A 1 85  ? 3.423   25.263  -21.507 1.00 0.00 ? 85  ILE A CD1  5  
ATOM 10331 H H    . ILE A 1 85  ? 6.872   25.267  -23.782 1.00 0.00 ? 85  ILE A H    5  
ATOM 10332 H HA   . ILE A 1 85  ? 5.109   27.457  -24.474 1.00 0.00 ? 85  ILE A HA   5  
ATOM 10333 H HB   . ILE A 1 85  ? 5.989   26.200  -21.842 1.00 0.00 ? 85  ILE A HB   5  
ATOM 10334 H HG12 . ILE A 1 85  ? 3.435   26.108  -23.479 1.00 0.00 ? 85  ILE A HG12 5  
ATOM 10335 H HG13 . ILE A 1 85  ? 4.581   24.794  -23.252 1.00 0.00 ? 85  ILE A HG13 5  
ATOM 10336 H HG21 . ILE A 1 85  ? 3.909   28.380  -22.408 1.00 0.00 ? 85  ILE A HG21 5  
ATOM 10337 H HG22 . ILE A 1 85  ? 4.061   27.539  -20.870 1.00 0.00 ? 85  ILE A HG22 5  
ATOM 10338 H HG23 . ILE A 1 85  ? 5.364   28.565  -21.443 1.00 0.00 ? 85  ILE A HG23 5  
ATOM 10339 H HD11 . ILE A 1 85  ? 4.117   25.290  -20.680 1.00 0.00 ? 85  ILE A HD11 5  
ATOM 10340 H HD12 . ILE A 1 85  ? 2.611   25.948  -21.313 1.00 0.00 ? 85  ILE A HD12 5  
ATOM 10341 H HD13 . ILE A 1 85  ? 3.029   24.263  -21.609 1.00 0.00 ? 85  ILE A HD13 5  
ATOM 10342 N N    . ARG A 1 86  ? 7.799   28.160  -22.700 1.00 0.00 ? 86  ARG A N    5  
ATOM 10343 C CA   . ARG A 1 86  ? 8.692   29.295  -22.354 1.00 0.00 ? 86  ARG A CA   5  
ATOM 10344 C C    . ARG A 1 86  ? 8.918   30.179  -23.566 1.00 0.00 ? 86  ARG A C    5  
ATOM 10345 O O    . ARG A 1 86  ? 8.959   31.390  -23.460 1.00 0.00 ? 86  ARG A O    5  
ATOM 10346 C CB   . ARG A 1 86  ? 10.048  28.733  -21.892 1.00 0.00 ? 86  ARG A CB   5  
ATOM 10347 C CG   . ARG A 1 86  ? 10.982  29.898  -21.546 1.00 0.00 ? 86  ARG A CG   5  
ATOM 10348 C CD   . ARG A 1 86  ? 12.195  29.871  -22.480 1.00 0.00 ? 86  ARG A CD   5  
ATOM 10349 N NE   . ARG A 1 86  ? 13.033  28.684  -22.151 1.00 0.00 ? 86  ARG A NE   5  
ATOM 10350 C CZ   . ARG A 1 86  ? 14.211  28.862  -21.616 1.00 0.00 ? 86  ARG A CZ   5  
ATOM 10351 N NH1  . ARG A 1 86  ? 14.444  29.964  -20.955 1.00 0.00 ? 86  ARG A NH1  5  
ATOM 10352 N NH2  . ARG A 1 86  ? 15.115  27.934  -21.762 1.00 0.00 ? 86  ARG A NH2  5  
ATOM 10353 H H    . ARG A 1 86  ? 8.000   27.257  -22.380 1.00 0.00 ? 86  ARG A H    5  
ATOM 10354 H HA   . ARG A 1 86  ? 8.226   29.886  -21.563 1.00 0.00 ? 86  ARG A HA   5  
ATOM 10355 H HB2  . ARG A 1 86  ? 9.906   28.111  -21.019 1.00 0.00 ? 86  ARG A HB2  5  
ATOM 10356 H HB3  . ARG A 1 86  ? 10.485  28.138  -22.681 1.00 0.00 ? 86  ARG A HB3  5  
ATOM 10357 H HG2  . ARG A 1 86  ? 10.455  30.833  -21.664 1.00 0.00 ? 86  ARG A HG2  5  
ATOM 10358 H HG3  . ARG A 1 86  ? 11.312  29.806  -20.521 1.00 0.00 ? 86  ARG A HG3  5  
ATOM 10359 H HD2  . ARG A 1 86  ? 11.866  29.803  -23.507 1.00 0.00 ? 86  ARG A HD2  5  
ATOM 10360 H HD3  . ARG A 1 86  ? 12.779  30.769  -22.349 1.00 0.00 ? 86  ARG A HD3  5  
ATOM 10361 H HE   . ARG A 1 86  ? 12.705  27.780  -22.335 1.00 0.00 ? 86  ARG A HE   5  
ATOM 10362 H HH11 . ARG A 1 86  ? 13.726  30.655  -20.865 1.00 0.00 ? 86  ARG A HH11 5  
ATOM 10363 H HH12 . ARG A 1 86  ? 15.340  30.116  -20.538 1.00 0.00 ? 86  ARG A HH12 5  
ATOM 10364 H HH21 . ARG A 1 86  ? 14.900  27.104  -22.277 1.00 0.00 ? 86  ARG A HH21 5  
ATOM 10365 H HH22 . ARG A 1 86  ? 16.022  28.051  -21.360 1.00 0.00 ? 86  ARG A HH22 5  
ATOM 10366 N N    . GLU A 1 87  ? 9.062   29.558  -24.703 1.00 0.00 ? 87  GLU A N    5  
ATOM 10367 C CA   . GLU A 1 87  ? 9.286   30.348  -25.932 1.00 0.00 ? 87  GLU A CA   5  
ATOM 10368 C C    . GLU A 1 87  ? 8.021   31.096  -26.315 1.00 0.00 ? 87  GLU A C    5  
ATOM 10369 O O    . GLU A 1 87  ? 8.061   32.272  -26.626 1.00 0.00 ? 87  GLU A O    5  
ATOM 10370 C CB   . GLU A 1 87  ? 9.660   29.384  -27.066 1.00 0.00 ? 87  GLU A CB   5  
ATOM 10371 C CG   . GLU A 1 87  ? 10.043  30.191  -28.308 1.00 0.00 ? 87  GLU A CG   5  
ATOM 10372 C CD   . GLU A 1 87  ? 10.718  29.265  -29.321 1.00 0.00 ? 87  GLU A CD   5  
ATOM 10373 O OE1  . GLU A 1 87  ? 10.340  28.104  -29.329 1.00 0.00 ? 87  GLU A OE1  5  
ATOM 10374 O OE2  . GLU A 1 87  ? 11.575  29.768  -30.029 1.00 0.00 ? 87  GLU A OE2  5  
ATOM 10375 H H    . GLU A 1 87  ? 9.028   28.574  -24.742 1.00 0.00 ? 87  GLU A H    5  
ATOM 10376 H HA   . GLU A 1 87  ? 10.079  31.066  -25.751 1.00 0.00 ? 87  GLU A HA   5  
ATOM 10377 H HB2  . GLU A 1 87  ? 10.494  28.771  -26.761 1.00 0.00 ? 87  GLU A HB2  5  
ATOM 10378 H HB3  . GLU A 1 87  ? 8.818   28.747  -27.294 1.00 0.00 ? 87  GLU A HB3  5  
ATOM 10379 H HG2  . GLU A 1 87  ? 9.158   30.623  -28.751 1.00 0.00 ? 87  GLU A HG2  5  
ATOM 10380 H HG3  . GLU A 1 87  ? 10.728  30.980  -28.034 1.00 0.00 ? 87  GLU A HG3  5  
ATOM 10381 N N    . ALA A 1 88  ? 6.920   30.404  -26.289 1.00 0.00 ? 88  ALA A N    5  
ATOM 10382 C CA   . ALA A 1 88  ? 5.642   31.059  -26.649 1.00 0.00 ? 88  ALA A CA   5  
ATOM 10383 C C    . ALA A 1 88  ? 5.530   32.420  -25.973 1.00 0.00 ? 88  ALA A C    5  
ATOM 10384 O O    . ALA A 1 88  ? 4.991   33.352  -26.536 1.00 0.00 ? 88  ALA A O    5  
ATOM 10385 C CB   . ALA A 1 88  ? 4.488   30.169  -26.164 1.00 0.00 ? 88  ALA A CB   5  
ATOM 10386 H H    . ALA A 1 88  ? 6.939   29.456  -26.037 1.00 0.00 ? 88  ALA A H    5  
ATOM 10387 H HA   . ALA A 1 88  ? 5.603   31.193  -27.729 1.00 0.00 ? 88  ALA A HA   5  
ATOM 10388 H HB1  . ALA A 1 88  ? 4.722   29.134  -26.358 1.00 0.00 ? 88  ALA A HB1  5  
ATOM 10389 H HB2  . ALA A 1 88  ? 4.340   30.310  -25.105 1.00 0.00 ? 88  ALA A HB2  5  
ATOM 10390 H HB3  . ALA A 1 88  ? 3.580   30.433  -26.688 1.00 0.00 ? 88  ALA A HB3  5  
ATOM 10391 N N    . PHE A 1 89  ? 6.041   32.512  -24.772 1.00 0.00 ? 89  PHE A N    5  
ATOM 10392 C CA   . PHE A 1 89  ? 5.970   33.807  -24.053 1.00 0.00 ? 89  PHE A CA   5  
ATOM 10393 C C    . PHE A 1 89  ? 7.015   34.771  -24.591 1.00 0.00 ? 89  PHE A C    5  
ATOM 10394 O O    . PHE A 1 89  ? 6.744   35.940  -24.777 1.00 0.00 ? 89  PHE A O    5  
ATOM 10395 C CB   . PHE A 1 89  ? 6.259   33.567  -22.558 1.00 0.00 ? 89  PHE A CB   5  
ATOM 10396 C CG   . PHE A 1 89  ? 5.118   32.768  -21.915 1.00 0.00 ? 89  PHE A CG   5  
ATOM 10397 C CD1  . PHE A 1 89  ? 3.802   33.197  -22.016 1.00 0.00 ? 89  PHE A CD1  5  
ATOM 10398 C CD2  . PHE A 1 89  ? 5.392   31.615  -21.196 1.00 0.00 ? 89  PHE A CD2  5  
ATOM 10399 C CE1  . PHE A 1 89  ? 2.787   32.485  -21.408 1.00 0.00 ? 89  PHE A CE1  5  
ATOM 10400 C CE2  . PHE A 1 89  ? 4.370   30.910  -20.590 1.00 0.00 ? 89  PHE A CE2  5  
ATOM 10401 C CZ   . PHE A 1 89  ? 3.072   31.346  -20.696 1.00 0.00 ? 89  PHE A CZ   5  
ATOM 10402 H H    . PHE A 1 89  ? 6.466   31.735  -24.353 1.00 0.00 ? 89  PHE A H    5  
ATOM 10403 H HA   . PHE A 1 89  ? 4.981   34.239  -24.196 1.00 0.00 ? 89  PHE A HA   5  
ATOM 10404 H HB2  . PHE A 1 89  ? 7.181   33.017  -22.450 1.00 0.00 ? 89  PHE A HB2  5  
ATOM 10405 H HB3  . PHE A 1 89  ? 6.354   34.517  -22.052 1.00 0.00 ? 89  PHE A HB3  5  
ATOM 10406 H HD1  . PHE A 1 89  ? 3.569   34.094  -22.567 1.00 0.00 ? 89  PHE A HD1  5  
ATOM 10407 H HD2  . PHE A 1 89  ? 6.410   31.264  -21.111 1.00 0.00 ? 89  PHE A HD2  5  
ATOM 10408 H HE1  . PHE A 1 89  ? 1.769   32.824  -21.491 1.00 0.00 ? 89  PHE A HE1  5  
ATOM 10409 H HE2  . PHE A 1 89  ? 4.594   30.020  -20.020 1.00 0.00 ? 89  PHE A HE2  5  
ATOM 10410 H HZ   . PHE A 1 89  ? 2.276   30.793  -20.219 1.00 0.00 ? 89  PHE A HZ   5  
ATOM 10411 N N    . ARG A 1 90  ? 8.201   34.268  -24.822 1.00 0.00 ? 90  ARG A N    5  
ATOM 10412 C CA   . ARG A 1 90  ? 9.270   35.149  -25.349 1.00 0.00 ? 90  ARG A CA   5  
ATOM 10413 C C    . ARG A 1 90  ? 8.753   35.981  -26.515 1.00 0.00 ? 90  ARG A C    5  
ATOM 10414 O O    . ARG A 1 90  ? 9.163   37.109  -26.706 1.00 0.00 ? 90  ARG A O    5  
ATOM 10415 C CB   . ARG A 1 90  ? 10.432  34.274  -25.835 1.00 0.00 ? 90  ARG A CB   5  
ATOM 10416 C CG   . ARG A 1 90  ? 11.673  34.591  -24.998 1.00 0.00 ? 90  ARG A CG   5  
ATOM 10417 C CD   . ARG A 1 90  ? 12.817  33.673  -25.426 1.00 0.00 ? 90  ARG A CD   5  
ATOM 10418 N NE   . ARG A 1 90  ? 13.437  34.215  -26.668 1.00 0.00 ? 90  ARG A NE   5  
ATOM 10419 C CZ   . ARG A 1 90  ? 13.094  33.721  -27.827 1.00 0.00 ? 90  ARG A CZ   5  
ATOM 10420 N NH1  . ARG A 1 90  ? 12.012  32.996  -27.908 1.00 0.00 ? 90  ARG A NH1  5  
ATOM 10421 N NH2  . ARG A 1 90  ? 13.846  33.968  -28.866 1.00 0.00 ? 90  ARG A NH2  5  
ATOM 10422 H H    . ARG A 1 90  ? 8.382   33.319  -24.643 1.00 0.00 ? 90  ARG A H    5  
ATOM 10423 H HA   . ARG A 1 90  ? 9.597   35.815  -24.556 1.00 0.00 ? 90  ARG A HA   5  
ATOM 10424 H HB2  . ARG A 1 90  ? 10.174  33.237  -25.722 1.00 0.00 ? 90  ARG A HB2  5  
ATOM 10425 H HB3  . ARG A 1 90  ? 10.634  34.478  -26.876 1.00 0.00 ? 90  ARG A HB3  5  
ATOM 10426 H HG2  . ARG A 1 90  ? 11.960  35.622  -25.149 1.00 0.00 ? 90  ARG A HG2  5  
ATOM 10427 H HG3  . ARG A 1 90  ? 11.454  34.435  -23.952 1.00 0.00 ? 90  ARG A HG3  5  
ATOM 10428 H HD2  . ARG A 1 90  ? 13.560  33.627  -24.645 1.00 0.00 ? 90  ARG A HD2  5  
ATOM 10429 H HD3  . ARG A 1 90  ? 12.437  32.681  -25.618 1.00 0.00 ? 90  ARG A HD3  5  
ATOM 10430 H HE   . ARG A 1 90  ? 14.098  34.937  -26.614 1.00 0.00 ? 90  ARG A HE   5  
ATOM 10431 H HH11 . ARG A 1 90  ? 11.460  32.826  -27.092 1.00 0.00 ? 90  ARG A HH11 5  
ATOM 10432 H HH12 . ARG A 1 90  ? 11.734  32.611  -28.788 1.00 0.00 ? 90  ARG A HH12 5  
ATOM 10433 H HH21 . ARG A 1 90  ? 14.669  34.527  -28.765 1.00 0.00 ? 90  ARG A HH21 5  
ATOM 10434 H HH22 . ARG A 1 90  ? 13.598  33.600  -29.762 1.00 0.00 ? 90  ARG A HH22 5  
ATOM 10435 N N    . VAL A 1 91  ? 7.865   35.408  -27.278 1.00 0.00 ? 91  VAL A N    5  
ATOM 10436 C CA   . VAL A 1 91  ? 7.314   36.153  -28.434 1.00 0.00 ? 91  VAL A CA   5  
ATOM 10437 C C    . VAL A 1 91  ? 6.750   37.494  -27.982 1.00 0.00 ? 91  VAL A C    5  
ATOM 10438 O O    . VAL A 1 91  ? 6.876   38.488  -28.669 1.00 0.00 ? 91  VAL A O    5  
ATOM 10439 C CB   . VAL A 1 91  ? 6.182   35.319  -29.052 1.00 0.00 ? 91  VAL A CB   5  
ATOM 10440 C CG1  . VAL A 1 91  ? 5.649   36.034  -30.294 1.00 0.00 ? 91  VAL A CG1  5  
ATOM 10441 C CG2  . VAL A 1 91  ? 6.731   33.948  -29.456 1.00 0.00 ? 91  VAL A CG2  5  
ATOM 10442 H H    . VAL A 1 91  ? 7.566   34.493  -27.091 1.00 0.00 ? 91  VAL A H    5  
ATOM 10443 H HA   . VAL A 1 91  ? 8.105   36.326  -29.156 1.00 0.00 ? 91  VAL A HA   5  
ATOM 10444 H HB   . VAL A 1 91  ? 5.389   35.196  -28.334 1.00 0.00 ? 91  VAL A HB   5  
ATOM 10445 H HG11 . VAL A 1 91  ? 5.313   37.025  -30.029 1.00 0.00 ? 91  VAL A HG11 5  
ATOM 10446 H HG12 . VAL A 1 91  ? 6.430   36.110  -31.035 1.00 0.00 ? 91  VAL A HG12 5  
ATOM 10447 H HG13 . VAL A 1 91  ? 4.821   35.477  -30.708 1.00 0.00 ? 91  VAL A HG13 5  
ATOM 10448 H HG21 . VAL A 1 91  ? 7.234   33.494  -28.614 1.00 0.00 ? 91  VAL A HG21 5  
ATOM 10449 H HG22 . VAL A 1 91  ? 5.920   33.310  -29.774 1.00 0.00 ? 91  VAL A HG22 5  
ATOM 10450 H HG23 . VAL A 1 91  ? 7.434   34.062  -30.269 1.00 0.00 ? 91  VAL A HG23 5  
ATOM 10451 N N    . PHE A 1 92  ? 6.137   37.493  -26.830 1.00 0.00 ? 92  PHE A N    5  
ATOM 10452 C CA   . PHE A 1 92  ? 5.556   38.753  -26.308 1.00 0.00 ? 92  PHE A CA   5  
ATOM 10453 C C    . PHE A 1 92  ? 6.533   39.452  -25.366 1.00 0.00 ? 92  PHE A C    5  
ATOM 10454 O O    . PHE A 1 92  ? 6.135   40.235  -24.525 1.00 0.00 ? 92  PHE A O    5  
ATOM 10455 C CB   . PHE A 1 92  ? 4.283   38.406  -25.525 1.00 0.00 ? 92  PHE A CB   5  
ATOM 10456 C CG   . PHE A 1 92  ? 3.294   37.703  -26.454 1.00 0.00 ? 92  PHE A CG   5  
ATOM 10457 C CD1  . PHE A 1 92  ? 3.404   36.344  -26.701 1.00 0.00 ? 92  PHE A CD1  5  
ATOM 10458 C CD2  . PHE A 1 92  ? 2.269   38.413  -27.055 1.00 0.00 ? 92  PHE A CD2  5  
ATOM 10459 C CE1  . PHE A 1 92  ? 2.504   35.710  -27.533 1.00 0.00 ? 92  PHE A CE1  5  
ATOM 10460 C CE2  . PHE A 1 92  ? 1.372   37.776  -27.887 1.00 0.00 ? 92  PHE A CE2  5  
ATOM 10461 C CZ   . PHE A 1 92  ? 1.490   36.427  -28.125 1.00 0.00 ? 92  PHE A CZ   5  
ATOM 10462 H H    . PHE A 1 92  ? 6.056   36.666  -26.318 1.00 0.00 ? 92  PHE A H    5  
ATOM 10463 H HA   . PHE A 1 92  ? 5.330   39.416  -27.143 1.00 0.00 ? 92  PHE A HA   5  
ATOM 10464 H HB2  . PHE A 1 92  ? 4.528   37.751  -24.702 1.00 0.00 ? 92  PHE A HB2  5  
ATOM 10465 H HB3  . PHE A 1 92  ? 3.832   39.309  -25.140 1.00 0.00 ? 92  PHE A HB3  5  
ATOM 10466 H HD1  . PHE A 1 92  ? 4.200   35.778  -26.241 1.00 0.00 ? 92  PHE A HD1  5  
ATOM 10467 H HD2  . PHE A 1 92  ? 2.171   39.473  -26.871 1.00 0.00 ? 92  PHE A HD2  5  
ATOM 10468 H HE1  . PHE A 1 92  ? 2.597   34.651  -27.722 1.00 0.00 ? 92  PHE A HE1  5  
ATOM 10469 H HE2  . PHE A 1 92  ? 0.574   38.337  -28.351 1.00 0.00 ? 92  PHE A HE2  5  
ATOM 10470 H HZ   . PHE A 1 92  ? 0.786   35.930  -28.777 1.00 0.00 ? 92  PHE A HZ   5  
ATOM 10471 N N    . ASP A 1 93  ? 7.797   39.156  -25.530 1.00 0.00 ? 93  ASP A N    5  
ATOM 10472 C CA   . ASP A 1 93  ? 8.823   39.788  -24.658 1.00 0.00 ? 93  ASP A CA   5  
ATOM 10473 C C    . ASP A 1 93  ? 9.493   40.944  -25.383 1.00 0.00 ? 93  ASP A C    5  
ATOM 10474 O O    . ASP A 1 93  ? 10.702  41.074  -25.366 1.00 0.00 ? 93  ASP A O    5  
ATOM 10475 C CB   . ASP A 1 93  ? 9.887   38.736  -24.320 1.00 0.00 ? 93  ASP A CB   5  
ATOM 10476 C CG   . ASP A 1 93  ? 10.877  39.322  -23.314 1.00 0.00 ? 93  ASP A CG   5  
ATOM 10477 O OD1  . ASP A 1 93  ? 10.424  40.119  -22.510 1.00 0.00 ? 93  ASP A OD1  5  
ATOM 10478 O OD2  . ASP A 1 93  ? 12.032  38.939  -23.405 1.00 0.00 ? 93  ASP A OD2  5  
ATOM 10479 H H    . ASP A 1 93  ? 8.067   38.530  -26.228 1.00 0.00 ? 93  ASP A H    5  
ATOM 10480 H HA   . ASP A 1 93  ? 8.346   40.161  -23.752 1.00 0.00 ? 93  ASP A HA   5  
ATOM 10481 H HB2  . ASP A 1 93  ? 9.416   37.868  -23.889 1.00 0.00 ? 93  ASP A HB2  5  
ATOM 10482 H HB3  . ASP A 1 93  ? 10.416  38.448  -25.218 1.00 0.00 ? 93  ASP A HB3  5  
ATOM 10483 N N    . LYS A 1 94  ? 8.690   41.761  -26.009 1.00 0.00 ? 94  LYS A N    5  
ATOM 10484 C CA   . LYS A 1 94  ? 9.242   42.925  -26.753 1.00 0.00 ? 94  LYS A CA   5  
ATOM 10485 C C    . LYS A 1 94  ? 10.406  43.566  -26.007 1.00 0.00 ? 94  LYS A C    5  
ATOM 10486 O O    . LYS A 1 94  ? 11.530  43.542  -26.473 1.00 0.00 ? 94  LYS A O    5  
ATOM 10487 C CB   . LYS A 1 94  ? 8.130   43.971  -26.903 1.00 0.00 ? 94  LYS A CB   5  
ATOM 10488 C CG   . LYS A 1 94  ? 6.906   43.328  -27.556 1.00 0.00 ? 94  LYS A CG   5  
ATOM 10489 C CD   . LYS A 1 94  ? 5.657   44.109  -27.143 1.00 0.00 ? 94  LYS A CD   5  
ATOM 10490 C CE   . LYS A 1 94  ? 4.508   43.766  -28.091 1.00 0.00 ? 94  LYS A CE   5  
ATOM 10491 N NZ   . LYS A 1 94  ? 3.402   44.754  -27.944 1.00 0.00 ? 94  LYS A NZ   5  
ATOM 10492 H H    . LYS A 1 94  ? 7.723   41.606  -25.991 1.00 0.00 ? 94  LYS A H    5  
ATOM 10493 H HA   . LYS A 1 94  ? 9.588   42.591  -27.726 1.00 0.00 ? 94  LYS A HA   5  
ATOM 10494 H HB2  . LYS A 1 94  ? 7.860   44.353  -25.929 1.00 0.00 ? 94  LYS A HB2  5  
ATOM 10495 H HB3  . LYS A 1 94  ? 8.482   44.785  -27.517 1.00 0.00 ? 94  LYS A HB3  5  
ATOM 10496 H HG2  . LYS A 1 94  ? 7.012   43.354  -28.631 1.00 0.00 ? 94  LYS A HG2  5  
ATOM 10497 H HG3  . LYS A 1 94  ? 6.817   42.303  -27.234 1.00 0.00 ? 94  LYS A HG3  5  
ATOM 10498 H HD2  . LYS A 1 94  ? 5.384   43.847  -26.131 1.00 0.00 ? 94  LYS A HD2  5  
ATOM 10499 H HD3  . LYS A 1 94  ? 5.860   45.169  -27.190 1.00 0.00 ? 94  LYS A HD3  5  
ATOM 10500 H HE2  . LYS A 1 94  ? 4.862   43.781  -29.110 1.00 0.00 ? 94  LYS A HE2  5  
ATOM 10501 H HE3  . LYS A 1 94  ? 4.132   42.779  -27.861 1.00 0.00 ? 94  LYS A HE3  5  
ATOM 10502 H HZ1  . LYS A 1 94  ? 3.777   45.715  -28.073 1.00 0.00 ? 94  LYS A HZ1  5  
ATOM 10503 H HZ2  . LYS A 1 94  ? 2.672   44.567  -28.661 1.00 0.00 ? 94  LYS A HZ2  5  
ATOM 10504 H HZ3  . LYS A 1 94  ? 2.985   44.669  -26.995 1.00 0.00 ? 94  LYS A HZ3  5  
ATOM 10505 N N    . ASP A 1 95  ? 10.111  44.130  -24.862 1.00 0.00 ? 95  ASP A N    5  
ATOM 10506 C CA   . ASP A 1 95  ? 11.184  44.784  -24.060 1.00 0.00 ? 95  ASP A CA   5  
ATOM 10507 C C    . ASP A 1 95  ? 11.089  44.397  -22.589 1.00 0.00 ? 95  ASP A C    5  
ATOM 10508 O O    . ASP A 1 95  ? 11.977  44.687  -21.812 1.00 0.00 ? 95  ASP A O    5  
ATOM 10509 C CB   . ASP A 1 95  ? 11.008  46.305  -24.181 1.00 0.00 ? 95  ASP A CB   5  
ATOM 10510 C CG   . ASP A 1 95  ? 10.863  46.682  -25.656 1.00 0.00 ? 95  ASP A CG   5  
ATOM 10511 O OD1  . ASP A 1 95  ? 11.718  46.252  -26.412 1.00 0.00 ? 95  ASP A OD1  5  
ATOM 10512 O OD2  . ASP A 1 95  ? 9.904   47.379  -25.945 1.00 0.00 ? 95  ASP A OD2  5  
ATOM 10513 H H    . ASP A 1 95  ? 9.189   44.121  -24.535 1.00 0.00 ? 95  ASP A H    5  
ATOM 10514 H HA   . ASP A 1 95  ? 12.154  44.477  -24.442 1.00 0.00 ? 95  ASP A HA   5  
ATOM 10515 H HB2  . ASP A 1 95  ? 10.123  46.615  -23.645 1.00 0.00 ? 95  ASP A HB2  5  
ATOM 10516 H HB3  . ASP A 1 95  ? 11.870  46.807  -23.767 1.00 0.00 ? 95  ASP A HB3  5  
ATOM 10517 N N    . GLY A 1 96  ? 10.015  43.750  -22.226 1.00 0.00 ? 96  GLY A N    5  
ATOM 10518 C CA   . GLY A 1 96  ? 9.860   43.340  -20.802 1.00 0.00 ? 96  GLY A CA   5  
ATOM 10519 C C    . GLY A 1 96  ? 11.154  42.705  -20.291 1.00 0.00 ? 96  GLY A C    5  
ATOM 10520 O O    . GLY A 1 96  ? 11.640  43.043  -19.230 1.00 0.00 ? 96  GLY A O    5  
ATOM 10521 H H    . GLY A 1 96  ? 9.319   43.536  -22.882 1.00 0.00 ? 96  GLY A H    5  
ATOM 10522 H HA2  . GLY A 1 96  ? 9.629   44.209  -20.204 1.00 0.00 ? 96  GLY A HA2  5  
ATOM 10523 H HA3  . GLY A 1 96  ? 9.055   42.626  -20.721 1.00 0.00 ? 96  GLY A HA3  5  
ATOM 10524 N N    . ASN A 1 97  ? 11.686  41.796  -21.060 1.00 0.00 ? 97  ASN A N    5  
ATOM 10525 C CA   . ASN A 1 97  ? 12.941  41.130  -20.641 1.00 0.00 ? 97  ASN A CA   5  
ATOM 10526 C C    . ASN A 1 97  ? 12.698  40.194  -19.464 1.00 0.00 ? 97  ASN A C    5  
ATOM 10527 O O    . ASN A 1 97  ? 13.612  39.869  -18.731 1.00 0.00 ? 97  ASN A O    5  
ATOM 10528 C CB   . ASN A 1 97  ? 13.944  42.213  -20.214 1.00 0.00 ? 97  ASN A CB   5  
ATOM 10529 C CG   . ASN A 1 97  ? 15.347  41.814  -20.678 1.00 0.00 ? 97  ASN A CG   5  
ATOM 10530 O OD1  . ASN A 1 97  ? 15.854  42.318  -21.660 1.00 0.00 ? 97  ASN A OD1  5  
ATOM 10531 N ND2  . ASN A 1 97  ? 16.007  40.913  -20.002 1.00 0.00 ? 97  ASN A ND2  5  
ATOM 10532 H H    . ASN A 1 97  ? 11.258  41.555  -21.907 1.00 0.00 ? 97  ASN A H    5  
ATOM 10533 H HA   . ASN A 1 97  ? 13.332  40.552  -21.478 1.00 0.00 ? 97  ASN A HA   5  
ATOM 10534 H HB2  . ASN A 1 97  ? 13.675  43.157  -20.662 1.00 0.00 ? 97  ASN A HB2  5  
ATOM 10535 H HB3  . ASN A 1 97  ? 13.940  42.314  -19.139 1.00 0.00 ? 97  ASN A HB3  5  
ATOM 10536 H HD21 . ASN A 1 97  ? 15.602  40.502  -19.208 1.00 0.00 ? 97  ASN A HD21 5  
ATOM 10537 H HD22 . ASN A 1 97  ? 16.905  40.647  -20.287 1.00 0.00 ? 97  ASN A HD22 5  
ATOM 10538 N N    . GLY A 1 98  ? 11.470  39.778  -19.296 1.00 0.00 ? 98  GLY A N    5  
ATOM 10539 C CA   . GLY A 1 98  ? 11.168  38.860  -18.163 1.00 0.00 ? 98  GLY A CA   5  
ATOM 10540 C C    . GLY A 1 98  ? 9.695   38.955  -17.751 1.00 0.00 ? 98  GLY A C    5  
ATOM 10541 O O    . GLY A 1 98  ? 9.290   38.365  -16.769 1.00 0.00 ? 98  GLY A O    5  
ATOM 10542 H H    . GLY A 1 98  ? 10.759  40.066  -19.907 1.00 0.00 ? 98  GLY A H    5  
ATOM 10543 H HA2  . GLY A 1 98  ? 11.386  37.845  -18.461 1.00 0.00 ? 98  GLY A HA2  5  
ATOM 10544 H HA3  . GLY A 1 98  ? 11.789  39.122  -17.320 1.00 0.00 ? 98  GLY A HA3  5  
ATOM 10545 N N    . TYR A 1 99  ? 8.919   39.690  -18.504 1.00 0.00 ? 99  TYR A N    5  
ATOM 10546 C CA   . TYR A 1 99  ? 7.485   39.815  -18.146 1.00 0.00 ? 99  TYR A CA   5  
ATOM 10547 C C    . TYR A 1 99  ? 6.621   40.088  -19.369 1.00 0.00 ? 99  TYR A C    5  
ATOM 10548 O O    . TYR A 1 99  ? 6.988   40.858  -20.235 1.00 0.00 ? 99  TYR A O    5  
ATOM 10549 C CB   . TYR A 1 99  ? 7.321   40.989  -17.171 1.00 0.00 ? 99  TYR A CB   5  
ATOM 10550 C CG   . TYR A 1 99  ? 7.966   40.640  -15.835 1.00 0.00 ? 99  TYR A CG   5  
ATOM 10551 C CD1  . TYR A 1 99  ? 9.328   40.742  -15.671 1.00 0.00 ? 99  TYR A CD1  5  
ATOM 10552 C CD2  . TYR A 1 99  ? 7.191   40.229  -14.769 1.00 0.00 ? 99  TYR A CD2  5  
ATOM 10553 C CE1  . TYR A 1 99  ? 9.913   40.442  -14.459 1.00 0.00 ? 99  TYR A CE1  5  
ATOM 10554 C CE2  . TYR A 1 99  ? 7.775   39.929  -13.557 1.00 0.00 ? 99  TYR A CE2  5  
ATOM 10555 C CZ   . TYR A 1 99  ? 9.140   40.033  -13.391 1.00 0.00 ? 99  TYR A CZ   5  
ATOM 10556 O OH   . TYR A 1 99  ? 9.723   39.734  -12.178 1.00 0.00 ? 99  TYR A OH   5  
ATOM 10557 H H    . TYR A 1 99  ? 9.278   40.148  -19.293 1.00 0.00 ? 99  TYR A H    5  
ATOM 10558 H HA   . TYR A 1 99  ? 7.157   38.886  -17.685 1.00 0.00 ? 99  TYR A HA   5  
ATOM 10559 H HB2  . TYR A 1 99  ? 7.796   41.870  -17.576 1.00 0.00 ? 99  TYR A HB2  5  
ATOM 10560 H HB3  . TYR A 1 99  ? 6.274   41.190  -17.017 1.00 0.00 ? 99  TYR A HB3  5  
ATOM 10561 H HD1  . TYR A 1 99  ? 9.942   41.062  -16.497 1.00 0.00 ? 99  TYR A HD1  5  
ATOM 10562 H HD2  . TYR A 1 99  ? 6.118   40.138  -14.886 1.00 0.00 ? 99  TYR A HD2  5  
ATOM 10563 H HE1  . TYR A 1 99  ? 10.984  40.526  -14.343 1.00 0.00 ? 99  TYR A HE1  5  
ATOM 10564 H HE2  . TYR A 1 99  ? 7.158   39.608  -12.731 1.00 0.00 ? 99  TYR A HE2  5  
ATOM 10565 H HH   . TYR A 1 99  ? 10.516  40.268  -12.090 1.00 0.00 ? 99  TYR A HH   5  
ATOM 10566 N N    . ILE A 1 100 ? 5.482   39.445  -19.403 1.00 0.00 ? 100 ILE A N    5  
ATOM 10567 C CA   . ILE A 1 100 ? 4.549   39.627  -20.543 1.00 0.00 ? 100 ILE A CA   5  
ATOM 10568 C C    . ILE A 1 100 ? 3.217   40.166  -20.028 1.00 0.00 ? 100 ILE A C    5  
ATOM 10569 O O    . ILE A 1 100 ? 2.898   40.013  -18.866 1.00 0.00 ? 100 ILE A O    5  
ATOM 10570 C CB   . ILE A 1 100 ? 4.312   38.262  -21.193 1.00 0.00 ? 100 ILE A CB   5  
ATOM 10571 C CG1  . ILE A 1 100 ? 3.727   37.306  -20.165 1.00 0.00 ? 100 ILE A CG1  5  
ATOM 10572 C CG2  . ILE A 1 100 ? 5.667   37.697  -21.677 1.00 0.00 ? 100 ILE A CG2  5  
ATOM 10573 C CD1  . ILE A 1 100 ? 3.332   36.003  -20.860 1.00 0.00 ? 100 ILE A CD1  5  
ATOM 10574 H H    . ILE A 1 100 ? 5.244   38.839  -18.673 1.00 0.00 ? 100 ILE A H    5  
ATOM 10575 H HA   . ILE A 1 100 ? 4.972   40.336  -21.255 1.00 0.00 ? 100 ILE A HA   5  
ATOM 10576 H HB   . ILE A 1 100 ? 3.614   38.372  -22.024 1.00 0.00 ? 100 ILE A HB   5  
ATOM 10577 H HG12 . ILE A 1 100 ? 4.460   37.102  -19.399 1.00 0.00 ? 100 ILE A HG12 5  
ATOM 10578 H HG13 . ILE A 1 100 ? 2.855   37.752  -19.710 1.00 0.00 ? 100 ILE A HG13 5  
ATOM 10579 H HG21 . ILE A 1 100 ? 6.379   37.702  -20.864 1.00 0.00 ? 100 ILE A HG21 5  
ATOM 10580 H HG22 . ILE A 1 100 ? 5.535   36.682  -22.027 1.00 0.00 ? 100 ILE A HG22 5  
ATOM 10581 H HG23 . ILE A 1 100 ? 6.047   38.303  -22.487 1.00 0.00 ? 100 ILE A HG23 5  
ATOM 10582 H HD11 . ILE A 1 100 ? 3.093   36.198  -21.894 1.00 0.00 ? 100 ILE A HD11 5  
ATOM 10583 H HD12 . ILE A 1 100 ? 4.153   35.300  -20.811 1.00 0.00 ? 100 ILE A HD12 5  
ATOM 10584 H HD13 . ILE A 1 100 ? 2.472   35.578  -20.371 1.00 0.00 ? 100 ILE A HD13 5  
ATOM 10585 N N    . SER A 1 101 ? 2.463   40.787  -20.888 1.00 0.00 ? 101 SER A N    5  
ATOM 10586 C CA   . SER A 1 101 ? 1.157   41.331  -20.437 1.00 0.00 ? 101 SER A CA   5  
ATOM 10587 C C    . SER A 1 101 ? 0.178   40.204  -20.130 1.00 0.00 ? 101 SER A C    5  
ATOM 10588 O O    . SER A 1 101 ? 0.026   39.285  -20.911 1.00 0.00 ? 101 SER A O    5  
ATOM 10589 C CB   . SER A 1 101 ? 0.573   42.190  -21.567 1.00 0.00 ? 101 SER A CB   5  
ATOM 10590 O OG   . SER A 1 101 ? 1.147   43.472  -21.359 1.00 0.00 ? 101 SER A OG   5  
ATOM 10591 H H    . SER A 1 101 ? 2.753   40.895  -21.819 1.00 0.00 ? 101 SER A H    5  
ATOM 10592 H HA   . SER A 1 101 ? 1.310   41.925  -19.537 1.00 0.00 ? 101 SER A HA   5  
ATOM 10593 H HB2  . SER A 1 101 ? 0.863   41.802  -22.532 1.00 0.00 ? 101 SER A HB2  5  
ATOM 10594 H HB3  . SER A 1 101 ? -0.502  42.244  -21.489 1.00 0.00 ? 101 SER A HB3  5  
ATOM 10595 H HG   . SER A 1 101 ? 0.479   44.131  -21.560 1.00 0.00 ? 101 SER A HG   5  
ATOM 10596 N N    . ALA A 1 102 ? -0.473  40.292  -18.998 1.00 0.00 ? 102 ALA A N    5  
ATOM 10597 C CA   . ALA A 1 102 ? -1.442  39.225  -18.639 1.00 0.00 ? 102 ALA A CA   5  
ATOM 10598 C C    . ALA A 1 102 ? -2.494  39.076  -19.728 1.00 0.00 ? 102 ALA A C    5  
ATOM 10599 O O    . ALA A 1 102 ? -3.176  38.074  -19.805 1.00 0.00 ? 102 ALA A O    5  
ATOM 10600 C CB   . ALA A 1 102 ? -2.130  39.601  -17.326 1.00 0.00 ? 102 ALA A CB   5  
ATOM 10601 H H    . ALA A 1 102 ? -0.322  41.050  -18.394 1.00 0.00 ? 102 ALA A H    5  
ATOM 10602 H HA   . ALA A 1 102 ? -0.903  38.282  -18.538 1.00 0.00 ? 102 ALA A HA   5  
ATOM 10603 H HB1  . ALA A 1 102 ? -1.401  39.996  -16.633 1.00 0.00 ? 102 ALA A HB1  5  
ATOM 10604 H HB2  . ALA A 1 102 ? -2.885  40.347  -17.511 1.00 0.00 ? 102 ALA A HB2  5  
ATOM 10605 H HB3  . ALA A 1 102 ? -2.592  38.725  -16.893 1.00 0.00 ? 102 ALA A HB3  5  
ATOM 10606 N N    . ALA A 1 103 ? -2.624  40.089  -20.543 1.00 0.00 ? 103 ALA A N    5  
ATOM 10607 C CA   . ALA A 1 103 ? -3.624  40.016  -21.631 1.00 0.00 ? 103 ALA A CA   5  
ATOM 10608 C C    . ALA A 1 103 ? -3.080  39.144  -22.739 1.00 0.00 ? 103 ALA A C    5  
ATOM 10609 O O    . ALA A 1 103 ? -3.650  38.117  -23.078 1.00 0.00 ? 103 ALA A O    5  
ATOM 10610 C CB   . ALA A 1 103 ? -3.862  41.432  -22.178 1.00 0.00 ? 103 ALA A CB   5  
ATOM 10611 H H    . ALA A 1 103 ? -2.070  40.887  -20.434 1.00 0.00 ? 103 ALA A H    5  
ATOM 10612 H HA   . ALA A 1 103 ? -4.543  39.579  -21.247 1.00 0.00 ? 103 ALA A HA   5  
ATOM 10613 H HB1  . ALA A 1 103 ? -2.928  41.852  -22.523 1.00 0.00 ? 103 ALA A HB1  5  
ATOM 10614 H HB2  . ALA A 1 103 ? -4.559  41.393  -23.002 1.00 0.00 ? 103 ALA A HB2  5  
ATOM 10615 H HB3  . ALA A 1 103 ? -4.267  42.061  -21.400 1.00 0.00 ? 103 ALA A HB3  5  
ATOM 10616 N N    . GLU A 1 104 ? -1.977  39.558  -23.287 1.00 0.00 ? 104 GLU A N    5  
ATOM 10617 C CA   . GLU A 1 104 ? -1.382  38.766  -24.368 1.00 0.00 ? 104 GLU A CA   5  
ATOM 10618 C C    . GLU A 1 104 ? -1.195  37.343  -23.885 1.00 0.00 ? 104 GLU A C    5  
ATOM 10619 O O    . GLU A 1 104 ? -1.277  36.403  -24.651 1.00 0.00 ? 104 GLU A O    5  
ATOM 10620 C CB   . GLU A 1 104 ? -0.016  39.365  -24.719 1.00 0.00 ? 104 GLU A CB   5  
ATOM 10621 C CG   . GLU A 1 104 ? -0.212  40.801  -25.208 1.00 0.00 ? 104 GLU A CG   5  
ATOM 10622 C CD   . GLU A 1 104 ? 1.128   41.357  -25.694 1.00 0.00 ? 104 GLU A CD   5  
ATOM 10623 O OE1  . GLU A 1 104 ? 2.092   41.151  -24.975 1.00 0.00 ? 104 GLU A OE1  5  
ATOM 10624 O OE2  . GLU A 1 104 ? 1.111   41.956  -26.757 1.00 0.00 ? 104 GLU A OE2  5  
ATOM 10625 H H    . GLU A 1 104 ? -1.551  40.385  -22.983 1.00 0.00 ? 104 GLU A H    5  
ATOM 10626 H HA   . GLU A 1 104 ? -2.051  38.771  -25.229 1.00 0.00 ? 104 GLU A HA   5  
ATOM 10627 H HB2  . GLU A 1 104 ? 0.618   39.361  -23.846 1.00 0.00 ? 104 GLU A HB2  5  
ATOM 10628 H HB3  . GLU A 1 104 ? 0.445   38.777  -25.495 1.00 0.00 ? 104 GLU A HB3  5  
ATOM 10629 H HG2  . GLU A 1 104 ? -0.921  40.817  -26.022 1.00 0.00 ? 104 GLU A HG2  5  
ATOM 10630 H HG3  . GLU A 1 104 ? -0.582  41.415  -24.400 1.00 0.00 ? 104 GLU A HG3  5  
ATOM 10631 N N    . LEU A 1 105 ? -0.942  37.210  -22.604 1.00 0.00 ? 105 LEU A N    5  
ATOM 10632 C CA   . LEU A 1 105 ? -0.749  35.860  -22.044 1.00 0.00 ? 105 LEU A CA   5  
ATOM 10633 C C    . LEU A 1 105 ? -1.956  35.007  -22.381 1.00 0.00 ? 105 LEU A C    5  
ATOM 10634 O O    . LEU A 1 105 ? -1.825  33.945  -22.945 1.00 0.00 ? 105 LEU A O    5  
ATOM 10635 C CB   . LEU A 1 105 ? -0.608  35.981  -20.512 1.00 0.00 ? 105 LEU A CB   5  
ATOM 10636 C CG   . LEU A 1 105 ? -0.773  34.599  -19.857 1.00 0.00 ? 105 LEU A CG   5  
ATOM 10637 C CD1  . LEU A 1 105 ? 0.423   34.324  -18.955 1.00 0.00 ? 105 LEU A CD1  5  
ATOM 10638 C CD2  . LEU A 1 105 ? -2.042  34.590  -19.008 1.00 0.00 ? 105 LEU A CD2  5  
ATOM 10639 H H    . LEU A 1 105 ? -0.881  38.000  -22.027 1.00 0.00 ? 105 LEU A H    5  
ATOM 10640 H HA   . LEU A 1 105 ? 0.142   35.412  -22.487 1.00 0.00 ? 105 LEU A HA   5  
ATOM 10641 H HB2  . LEU A 1 105 ? 0.366   36.381  -20.273 1.00 0.00 ? 105 LEU A HB2  5  
ATOM 10642 H HB3  . LEU A 1 105 ? -1.361  36.649  -20.135 1.00 0.00 ? 105 LEU A HB3  5  
ATOM 10643 H HG   . LEU A 1 105 ? -0.837  33.835  -20.612 1.00 0.00 ? 105 LEU A HG   5  
ATOM 10644 H HD11 . LEU A 1 105 ? 0.705   35.230  -18.437 1.00 0.00 ? 105 LEU A HD11 5  
ATOM 10645 H HD12 . LEU A 1 105 ? 0.165   33.568  -18.233 1.00 0.00 ? 105 LEU A HD12 5  
ATOM 10646 H HD13 . LEU A 1 105 ? 1.253   33.979  -19.547 1.00 0.00 ? 105 LEU A HD13 5  
ATOM 10647 H HD21 . LEU A 1 105 ? -2.018  35.414  -18.309 1.00 0.00 ? 105 LEU A HD21 5  
ATOM 10648 H HD22 . LEU A 1 105 ? -2.907  34.690  -19.646 1.00 0.00 ? 105 LEU A HD22 5  
ATOM 10649 H HD23 . LEU A 1 105 ? -2.107  33.662  -18.462 1.00 0.00 ? 105 LEU A HD23 5  
ATOM 10650 N N    . ARG A 1 106 ? -3.122  35.481  -22.033 1.00 0.00 ? 106 ARG A N    5  
ATOM 10651 C CA   . ARG A 1 106 ? -4.320  34.684  -22.348 1.00 0.00 ? 106 ARG A CA   5  
ATOM 10652 C C    . ARG A 1 106 ? -4.263  34.285  -23.805 1.00 0.00 ? 106 ARG A C    5  
ATOM 10653 O O    . ARG A 1 106 ? -4.718  33.226  -24.188 1.00 0.00 ? 106 ARG A O    5  
ATOM 10654 C CB   . ARG A 1 106 ? -5.569  35.538  -22.109 1.00 0.00 ? 106 ARG A CB   5  
ATOM 10655 C CG   . ARG A 1 106 ? -6.719  34.624  -21.679 1.00 0.00 ? 106 ARG A CG   5  
ATOM 10656 C CD   . ARG A 1 106 ? -8.041  35.365  -21.872 1.00 0.00 ? 106 ARG A CD   5  
ATOM 10657 N NE   . ARG A 1 106 ? -7.930  36.713  -21.251 1.00 0.00 ? 106 ARG A NE   5  
ATOM 10658 C CZ   . ARG A 1 106 ? -8.977  37.487  -21.212 1.00 0.00 ? 106 ARG A CZ   5  
ATOM 10659 N NH1  . ARG A 1 106 ? -9.858  37.304  -20.270 1.00 0.00 ? 106 ARG A NH1  5  
ATOM 10660 N NH2  . ARG A 1 106 ? -9.109  38.416  -22.119 1.00 0.00 ? 106 ARG A NH2  5  
ATOM 10661 H H    . ARG A 1 106 ? -3.199  36.345  -21.577 1.00 0.00 ? 106 ARG A H    5  
ATOM 10662 H HA   . ARG A 1 106 ? -4.327  33.787  -21.728 1.00 0.00 ? 106 ARG A HA   5  
ATOM 10663 H HB2  . ARG A 1 106 ? -5.373  36.264  -21.334 1.00 0.00 ? 106 ARG A HB2  5  
ATOM 10664 H HB3  . ARG A 1 106 ? -5.837  36.053  -23.019 1.00 0.00 ? 106 ARG A HB3  5  
ATOM 10665 H HG2  . ARG A 1 106 ? -6.714  33.726  -22.279 1.00 0.00 ? 106 ARG A HG2  5  
ATOM 10666 H HG3  . ARG A 1 106 ? -6.602  34.357  -20.638 1.00 0.00 ? 106 ARG A HG3  5  
ATOM 10667 H HD2  . ARG A 1 106 ? -8.249  35.472  -22.927 1.00 0.00 ? 106 ARG A HD2  5  
ATOM 10668 H HD3  . ARG A 1 106 ? -8.843  34.816  -21.402 1.00 0.00 ? 106 ARG A HD3  5  
ATOM 10669 H HE   . ARG A 1 106 ? -7.077  37.016  -20.876 1.00 0.00 ? 106 ARG A HE   5  
ATOM 10670 H HH11 . ARG A 1 106 ? -9.724  36.579  -19.594 1.00 0.00 ? 106 ARG A HH11 5  
ATOM 10671 H HH12 . ARG A 1 106 ? -10.669 37.888  -20.222 1.00 0.00 ? 106 ARG A HH12 5  
ATOM 10672 H HH21 . ARG A 1 106 ? -8.414  38.526  -22.829 1.00 0.00 ? 106 ARG A HH21 5  
ATOM 10673 H HH22 . ARG A 1 106 ? -9.907  39.020  -22.102 1.00 0.00 ? 106 ARG A HH22 5  
ATOM 10674 N N    . HIS A 1 107 ? -3.697  35.159  -24.604 1.00 0.00 ? 107 HIS A N    5  
ATOM 10675 C CA   . HIS A 1 107 ? -3.590  34.858  -26.047 1.00 0.00 ? 107 HIS A CA   5  
ATOM 10676 C C    . HIS A 1 107 ? -2.629  33.699  -26.249 1.00 0.00 ? 107 HIS A C    5  
ATOM 10677 O O    . HIS A 1 107 ? -2.837  32.852  -27.097 1.00 0.00 ? 107 HIS A O    5  
ATOM 10678 C CB   . HIS A 1 107 ? -3.031  36.098  -26.769 1.00 0.00 ? 107 HIS A CB   5  
ATOM 10679 C CG   . HIS A 1 107 ? -3.672  36.211  -28.156 1.00 0.00 ? 107 HIS A CG   5  
ATOM 10680 N ND1  . HIS A 1 107 ? -4.897  36.320  -28.369 1.00 0.00 ? 107 HIS A ND1  5  
ATOM 10681 C CD2  . HIS A 1 107 ? -3.080  36.212  -29.406 1.00 0.00 ? 107 HIS A CD2  5  
ATOM 10682 C CE1  . HIS A 1 107 ? -5.150  36.390  -29.610 1.00 0.00 ? 107 HIS A CE1  5  
ATOM 10683 N NE2  . HIS A 1 107 ? -4.047  36.331  -30.357 1.00 0.00 ? 107 HIS A NE2  5  
ATOM 10684 H H    . HIS A 1 107 ? -3.357  36.012  -24.246 1.00 0.00 ? 107 HIS A H    5  
ATOM 10685 H HA   . HIS A 1 107 ? -4.572  34.585  -26.434 1.00 0.00 ? 107 HIS A HA   5  
ATOM 10686 H HB2  . HIS A 1 107 ? -3.256  36.987  -26.199 1.00 0.00 ? 107 HIS A HB2  5  
ATOM 10687 H HB3  . HIS A 1 107 ? -1.962  36.008  -26.879 1.00 0.00 ? 107 HIS A HB3  5  
ATOM 10688 H HD1  . HIS A 1 107 ? -5.579  36.347  -27.666 1.00 0.00 ? 107 HIS A HD1  5  
ATOM 10689 H HD2  . HIS A 1 107 ? -2.020  36.136  -29.598 1.00 0.00 ? 107 HIS A HD2  5  
ATOM 10690 H HE1  . HIS A 1 107 ? -6.146  36.488  -30.015 1.00 0.00 ? 107 HIS A HE1  5  
ATOM 10691 N N    . VAL A 1 108 ? -1.585  33.685  -25.456 1.00 0.00 ? 108 VAL A N    5  
ATOM 10692 C CA   . VAL A 1 108 ? -0.593  32.595  -25.575 1.00 0.00 ? 108 VAL A CA   5  
ATOM 10693 C C    . VAL A 1 108 ? -1.240  31.272  -25.219 1.00 0.00 ? 108 VAL A C    5  
ATOM 10694 O O    . VAL A 1 108 ? -0.864  30.237  -25.722 1.00 0.00 ? 108 VAL A O    5  
ATOM 10695 C CB   . VAL A 1 108 ? 0.554   32.862  -24.583 1.00 0.00 ? 108 VAL A CB   5  
ATOM 10696 C CG1  . VAL A 1 108 ? 1.559   31.712  -24.645 1.00 0.00 ? 108 VAL A CG1  5  
ATOM 10697 C CG2  . VAL A 1 108 ? 1.251   34.172  -24.957 1.00 0.00 ? 108 VAL A CG2  5  
ATOM 10698 H H    . VAL A 1 108 ? -1.463  34.393  -24.790 1.00 0.00 ? 108 VAL A H    5  
ATOM 10699 H HA   . VAL A 1 108 ? -0.224  32.553  -26.597 1.00 0.00 ? 108 VAL A HA   5  
ATOM 10700 H HB   . VAL A 1 108 ? 0.162   32.937  -23.588 1.00 0.00 ? 108 VAL A HB   5  
ATOM 10701 H HG11 . VAL A 1 108 ? 1.656   31.365  -25.663 1.00 0.00 ? 108 VAL A HG11 5  
ATOM 10702 H HG12 . VAL A 1 108 ? 2.521   32.048  -24.289 1.00 0.00 ? 108 VAL A HG12 5  
ATOM 10703 H HG13 . VAL A 1 108 ? 1.217   30.896  -24.024 1.00 0.00 ? 108 VAL A HG13 5  
ATOM 10704 H HG21 . VAL A 1 108 ? 0.530   34.864  -25.368 1.00 0.00 ? 108 VAL A HG21 5  
ATOM 10705 H HG22 . VAL A 1 108 ? 1.699   34.611  -24.076 1.00 0.00 ? 108 VAL A HG22 5  
ATOM 10706 H HG23 . VAL A 1 108 ? 2.019   33.981  -25.690 1.00 0.00 ? 108 VAL A HG23 5  
ATOM 10707 N N    . MET A 1 109 ? -2.215  31.336  -24.353 1.00 0.00 ? 109 MET A N    5  
ATOM 10708 C CA   . MET A 1 109 ? -2.912  30.098  -23.941 1.00 0.00 ? 109 MET A CA   5  
ATOM 10709 C C    . MET A 1 109 ? -3.765  29.568  -25.083 1.00 0.00 ? 109 MET A C    5  
ATOM 10710 O O    . MET A 1 109 ? -3.839  28.377  -25.309 1.00 0.00 ? 109 MET A O    5  
ATOM 10711 C CB   . MET A 1 109 ? -3.829  30.436  -22.756 1.00 0.00 ? 109 MET A CB   5  
ATOM 10712 C CG   . MET A 1 109 ? -2.986  31.021  -21.624 1.00 0.00 ? 109 MET A CG   5  
ATOM 10713 S SD   . MET A 1 109 ? -1.776  29.932  -20.850 1.00 0.00 ? 109 MET A SD   5  
ATOM 10714 C CE   . MET A 1 109 ? -0.343  30.416  -21.845 1.00 0.00 ? 109 MET A CE   5  
ATOM 10715 H H    . MET A 1 109 ? -2.487  32.202  -23.982 1.00 0.00 ? 109 MET A H    5  
ATOM 10716 H HA   . MET A 1 109 ? -2.173  29.345  -23.660 1.00 0.00 ? 109 MET A HA   5  
ATOM 10717 H HB2  . MET A 1 109 ? -4.570  31.156  -23.064 1.00 0.00 ? 109 MET A HB2  5  
ATOM 10718 H HB3  . MET A 1 109 ? -4.326  29.540  -22.414 1.00 0.00 ? 109 MET A HB3  5  
ATOM 10719 H HG2  . MET A 1 109 ? -2.455  31.879  -22.007 1.00 0.00 ? 109 MET A HG2  5  
ATOM 10720 H HG3  . MET A 1 109 ? -3.655  31.367  -20.850 1.00 0.00 ? 109 MET A HG3  5  
ATOM 10721 H HE1  . MET A 1 109 ? -0.679  30.823  -22.785 1.00 0.00 ? 109 MET A HE1  5  
ATOM 10722 H HE2  . MET A 1 109 ? 0.228   31.161  -21.313 1.00 0.00 ? 109 MET A HE2  5  
ATOM 10723 H HE3  . MET A 1 109 ? 0.276   29.550  -22.028 1.00 0.00 ? 109 MET A HE3  5  
ATOM 10724 N N    . THR A 1 110 ? -4.397  30.469  -25.788 1.00 0.00 ? 110 THR A N    5  
ATOM 10725 C CA   . THR A 1 110 ? -5.251  30.045  -26.920 1.00 0.00 ? 110 THR A CA   5  
ATOM 10726 C C    . THR A 1 110 ? -4.406  29.405  -28.016 1.00 0.00 ? 110 THR A C    5  
ATOM 10727 O O    . THR A 1 110 ? -4.696  28.318  -28.474 1.00 0.00 ? 110 THR A O    5  
ATOM 10728 C CB   . THR A 1 110 ? -5.959  31.292  -27.482 1.00 0.00 ? 110 THR A CB   5  
ATOM 10729 O OG1  . THR A 1 110 ? -7.307  31.167  -27.076 1.00 0.00 ? 110 THR A OG1  5  
ATOM 10730 C CG2  . THR A 1 110 ? -6.019  31.261  -29.020 1.00 0.00 ? 110 THR A CG2  5  
ATOM 10731 H H    . THR A 1 110 ? -4.306  31.420  -25.567 1.00 0.00 ? 110 THR A H    5  
ATOM 10732 H HA   . THR A 1 110 ? -5.975  29.316  -26.563 1.00 0.00 ? 110 THR A HA   5  
ATOM 10733 H HB   . THR A 1 110 ? -5.525  32.211  -27.095 1.00 0.00 ? 110 THR A HB   5  
ATOM 10734 H HG1  . THR A 1 110 ? -7.471  31.815  -26.388 1.00 0.00 ? 110 THR A HG1  5  
ATOM 10735 H HG21 . THR A 1 110 ? -6.340  30.285  -29.351 1.00 0.00 ? 110 THR A HG21 5  
ATOM 10736 H HG22 . THR A 1 110 ? -6.718  32.004  -29.372 1.00 0.00 ? 110 THR A HG22 5  
ATOM 10737 H HG23 . THR A 1 110 ? -5.041  31.470  -29.426 1.00 0.00 ? 110 THR A HG23 5  
ATOM 10738 N N    . ASN A 1 111 ? -3.374  30.093  -28.415 1.00 0.00 ? 111 ASN A N    5  
ATOM 10739 C CA   . ASN A 1 111 ? -2.499  29.542  -29.476 1.00 0.00 ? 111 ASN A CA   5  
ATOM 10740 C C    . ASN A 1 111 ? -1.908  28.210  -29.041 1.00 0.00 ? 111 ASN A C    5  
ATOM 10741 O O    . ASN A 1 111 ? -1.611  27.363  -29.859 1.00 0.00 ? 111 ASN A O    5  
ATOM 10742 C CB   . ASN A 1 111 ? -1.353  30.538  -29.726 1.00 0.00 ? 111 ASN A CB   5  
ATOM 10743 C CG   . ASN A 1 111 ? -0.159  29.798  -30.337 1.00 0.00 ? 111 ASN A CG   5  
ATOM 10744 O OD1  . ASN A 1 111 ? 0.583   29.122  -29.653 1.00 0.00 ? 111 ASN A OD1  5  
ATOM 10745 N ND2  . ASN A 1 111 ? 0.061   29.900  -31.620 1.00 0.00 ? 111 ASN A ND2  5  
ATOM 10746 H H    . ASN A 1 111 ? -3.180  30.965  -28.016 1.00 0.00 ? 111 ASN A H    5  
ATOM 10747 H HA   . ASN A 1 111 ? -3.088  29.393  -30.381 1.00 0.00 ? 111 ASN A HA   5  
ATOM 10748 H HB2  . ASN A 1 111 ? -1.681  31.308  -30.407 1.00 0.00 ? 111 ASN A HB2  5  
ATOM 10749 H HB3  . ASN A 1 111 ? -1.051  30.989  -28.793 1.00 0.00 ? 111 ASN A HB3  5  
ATOM 10750 H HD21 . ASN A 1 111 ? -0.534  30.444  -32.178 1.00 0.00 ? 111 ASN A HD21 5  
ATOM 10751 H HD22 . ASN A 1 111 ? 0.821   29.434  -32.026 1.00 0.00 ? 111 ASN A HD22 5  
ATOM 10752 N N    . LEU A 1 112 ? -1.750  28.048  -27.756 1.00 0.00 ? 112 LEU A N    5  
ATOM 10753 C CA   . LEU A 1 112 ? -1.182  26.786  -27.248 1.00 0.00 ? 112 LEU A CA   5  
ATOM 10754 C C    . LEU A 1 112 ? -2.239  25.689  -27.193 1.00 0.00 ? 112 LEU A C    5  
ATOM 10755 O O    . LEU A 1 112 ? -2.184  24.735  -27.940 1.00 0.00 ? 112 LEU A O    5  
ATOM 10756 C CB   . LEU A 1 112 ? -0.657  27.039  -25.830 1.00 0.00 ? 112 LEU A CB   5  
ATOM 10757 C CG   . LEU A 1 112 ? 0.351   25.958  -25.466 1.00 0.00 ? 112 LEU A CG   5  
ATOM 10758 C CD1  . LEU A 1 112 ? 1.571   26.087  -26.379 1.00 0.00 ? 112 LEU A CD1  5  
ATOM 10759 C CD2  . LEU A 1 112 ? 0.785   26.153  -24.014 1.00 0.00 ? 112 LEU A CD2  5  
ATOM 10760 H H    . LEU A 1 112 ? -1.996  28.761  -27.132 1.00 0.00 ? 112 LEU A H    5  
ATOM 10761 H HA   . LEU A 1 112 ? -0.380  26.470  -27.905 1.00 0.00 ? 112 LEU A HA   5  
ATOM 10762 H HB2  . LEU A 1 112 ? -0.176  28.003  -25.789 1.00 0.00 ? 112 LEU A HB2  5  
ATOM 10763 H HB3  . LEU A 1 112 ? -1.477  27.023  -25.128 1.00 0.00 ? 112 LEU A HB3  5  
ATOM 10764 H HG   . LEU A 1 112 ? -0.097  24.983  -25.588 1.00 0.00 ? 112 LEU A HG   5  
ATOM 10765 H HD11 . LEU A 1 112 ? 1.653   27.104  -26.737 1.00 0.00 ? 112 LEU A HD11 5  
ATOM 10766 H HD12 . LEU A 1 112 ? 2.466   25.831  -25.832 1.00 0.00 ? 112 LEU A HD12 5  
ATOM 10767 H HD13 . LEU A 1 112 ? 1.467   25.422  -27.223 1.00 0.00 ? 112 LEU A HD13 5  
ATOM 10768 H HD21 . LEU A 1 112 ? -0.077  26.377  -23.403 1.00 0.00 ? 112 LEU A HD21 5  
ATOM 10769 H HD22 . LEU A 1 112 ? 1.255   25.253  -23.649 1.00 0.00 ? 112 LEU A HD22 5  
ATOM 10770 H HD23 . LEU A 1 112 ? 1.486   26.972  -23.951 1.00 0.00 ? 112 LEU A HD23 5  
ATOM 10771 N N    . GLY A 1 113 ? -3.190  25.848  -26.313 1.00 0.00 ? 113 GLY A N    5  
ATOM 10772 C CA   . GLY A 1 113 ? -4.259  24.813  -26.198 1.00 0.00 ? 113 GLY A CA   5  
ATOM 10773 C C    . GLY A 1 113 ? -3.700  23.591  -25.469 1.00 0.00 ? 113 GLY A C    5  
ATOM 10774 O O    . GLY A 1 113 ? -3.475  22.556  -26.065 1.00 0.00 ? 113 GLY A O    5  
ATOM 10775 H H    . GLY A 1 113 ? -3.197  26.636  -25.732 1.00 0.00 ? 113 GLY A H    5  
ATOM 10776 H HA2  . GLY A 1 113 ? -5.094  25.216  -25.643 1.00 0.00 ? 113 GLY A HA2  5  
ATOM 10777 H HA3  . GLY A 1 113 ? -4.588  24.524  -27.186 1.00 0.00 ? 113 GLY A HA3  5  
ATOM 10778 N N    . GLU A 1 114 ? -3.506  23.735  -24.182 1.00 0.00 ? 114 GLU A N    5  
ATOM 10779 C CA   . GLU A 1 114 ? -2.972  22.635  -23.394 1.00 0.00 ? 114 GLU A CA   5  
ATOM 10780 C C    . GLU A 1 114 ? -2.692  23.137  -21.997 1.00 0.00 ? 114 GLU A C    5  
ATOM 10781 O O    . GLU A 1 114 ? -2.144  24.204  -21.821 1.00 0.00 ? 114 GLU A O    5  
ATOM 10782 C CB   . GLU A 1 114 ? -1.654  22.153  -24.034 1.00 0.00 ? 114 GLU A CB   5  
ATOM 10783 C CG   . GLU A 1 114 ? -1.795  20.676  -24.417 1.00 0.00 ? 114 GLU A CG   5  
ATOM 10784 C CD   . GLU A 1 114 ? -0.444  20.148  -24.903 1.00 0.00 ? 114 GLU A CD   5  
ATOM 10785 O OE1  . GLU A 1 114 ? 0.477   20.200  -24.103 1.00 0.00 ? 114 GLU A OE1  5  
ATOM 10786 O OE2  . GLU A 1 114 ? -0.409  19.722  -26.045 1.00 0.00 ? 114 GLU A OE2  5  
ATOM 10787 H H    . GLU A 1 114 ? -3.745  24.565  -23.733 1.00 0.00 ? 114 GLU A H    5  
ATOM 10788 H HA   . GLU A 1 114 ? -3.708  21.833  -23.349 1.00 0.00 ? 114 GLU A HA   5  
ATOM 10789 H HB2  . GLU A 1 114 ? -1.441  22.738  -24.915 1.00 0.00 ? 114 GLU A HB2  5  
ATOM 10790 H HB3  . GLU A 1 114 ? -0.844  22.268  -23.330 1.00 0.00 ? 114 GLU A HB3  5  
ATOM 10791 H HG2  . GLU A 1 114 ? -2.115  20.105  -23.559 1.00 0.00 ? 114 GLU A HG2  5  
ATOM 10792 H HG3  . GLU A 1 114 ? -2.524  20.571  -25.207 1.00 0.00 ? 114 GLU A HG3  5  
ATOM 10793 N N    . LYS A 1 115 ? -3.107  22.377  -21.046 1.00 0.00 ? 115 LYS A N    5  
ATOM 10794 C CA   . LYS A 1 115 ? -2.902  22.742  -19.639 1.00 0.00 ? 115 LYS A CA   5  
ATOM 10795 C C    . LYS A 1 115 ? -3.724  23.954  -19.271 1.00 0.00 ? 115 LYS A C    5  
ATOM 10796 O O    . LYS A 1 115 ? -3.585  25.015  -19.846 1.00 0.00 ? 115 LYS A O    5  
ATOM 10797 C CB   . LYS A 1 115 ? -1.417  23.030  -19.377 1.00 0.00 ? 115 LYS A CB   5  
ATOM 10798 C CG   . LYS A 1 115 ? -0.566  21.912  -19.987 1.00 0.00 ? 115 LYS A CG   5  
ATOM 10799 C CD   . LYS A 1 115 ? 0.030   21.064  -18.857 1.00 0.00 ? 115 LYS A CD   5  
ATOM 10800 C CE   . LYS A 1 115 ? -1.100  20.325  -18.132 1.00 0.00 ? 115 LYS A CE   5  
ATOM 10801 N NZ   . LYS A 1 115 ? -0.540  19.343  -17.157 1.00 0.00 ? 115 LYS A NZ   5  
ATOM 10802 H H    . LYS A 1 115 ? -3.576  21.578  -21.258 1.00 0.00 ? 115 LYS A H    5  
ATOM 10803 H HA   . LYS A 1 115 ? -3.236  21.907  -19.021 1.00 0.00 ? 115 LYS A HA   5  
ATOM 10804 H HB2  . LYS A 1 115 ? -1.143  23.973  -19.807 1.00 0.00 ? 115 LYS A HB2  5  
ATOM 10805 H HB3  . LYS A 1 115 ? -1.248  23.067  -18.317 1.00 0.00 ? 115 LYS A HB3  5  
ATOM 10806 H HG2  . LYS A 1 115 ? -1.180  21.291  -20.622 1.00 0.00 ? 115 LYS A HG2  5  
ATOM 10807 H HG3  . LYS A 1 115 ? 0.231   22.343  -20.577 1.00 0.00 ? 115 LYS A HG3  5  
ATOM 10808 H HD2  . LYS A 1 115 ? 0.727   20.349  -19.268 1.00 0.00 ? 115 LYS A HD2  5  
ATOM 10809 H HD3  . LYS A 1 115 ? 0.548   21.705  -18.159 1.00 0.00 ? 115 LYS A HD3  5  
ATOM 10810 H HE2  . LYS A 1 115 ? -1.716  21.035  -17.601 1.00 0.00 ? 115 LYS A HE2  5  
ATOM 10811 H HE3  . LYS A 1 115 ? -1.710  19.798  -18.853 1.00 0.00 ? 115 LYS A HE3  5  
ATOM 10812 H HZ1  . LYS A 1 115 ? 0.266   19.770  -16.659 1.00 0.00 ? 115 LYS A HZ1  5  
ATOM 10813 H HZ2  . LYS A 1 115 ? -1.275  19.081  -16.468 1.00 0.00 ? 115 LYS A HZ2  5  
ATOM 10814 H HZ3  . LYS A 1 115 ? -0.223  18.492  -17.665 1.00 0.00 ? 115 LYS A HZ3  5  
ATOM 10815 N N    . LEU A 1 116 ? -4.587  23.740  -18.331 1.00 0.00 ? 116 LEU A N    5  
ATOM 10816 C CA   . LEU A 1 116 ? -5.476  24.817  -17.841 1.00 0.00 ? 116 LEU A CA   5  
ATOM 10817 C C    . LEU A 1 116 ? -6.345  25.376  -18.954 1.00 0.00 ? 116 LEU A C    5  
ATOM 10818 O O    . LEU A 1 116 ? -5.877  26.078  -19.828 1.00 0.00 ? 116 LEU A O    5  
ATOM 10819 C CB   . LEU A 1 116 ? -4.617  25.933  -17.237 1.00 0.00 ? 116 LEU A CB   5  
ATOM 10820 C CG   . LEU A 1 116 ? -3.876  25.382  -16.016 1.00 0.00 ? 116 LEU A CG   5  
ATOM 10821 C CD1  . LEU A 1 116 ? -2.741  24.466  -16.485 1.00 0.00 ? 116 LEU A CD1  5  
ATOM 10822 C CD2  . LEU A 1 116 ? -3.290  26.545  -15.215 1.00 0.00 ? 116 LEU A CD2  5  
ATOM 10823 H H    . LEU A 1 116 ? -4.657  22.856  -17.957 1.00 0.00 ? 116 LEU A H    5  
ATOM 10824 H HA   . LEU A 1 116 ? -6.131  24.397  -17.081 1.00 0.00 ? 116 LEU A HA   5  
ATOM 10825 H HB2  . LEU A 1 116 ? -3.908  26.286  -17.962 1.00 0.00 ? 116 LEU A HB2  5  
ATOM 10826 H HB3  . LEU A 1 116 ? -5.248  26.748  -16.934 1.00 0.00 ? 116 LEU A HB3  5  
ATOM 10827 H HG   . LEU A 1 116 ? -4.564  24.822  -15.398 1.00 0.00 ? 116 LEU A HG   5  
ATOM 10828 H HD11 . LEU A 1 116 ? -2.362  24.811  -17.433 1.00 0.00 ? 116 LEU A HD11 5  
ATOM 10829 H HD12 . LEU A 1 116 ? -1.943  24.477  -15.758 1.00 0.00 ? 116 LEU A HD12 5  
ATOM 10830 H HD13 . LEU A 1 116 ? -3.109  23.456  -16.594 1.00 0.00 ? 116 LEU A HD13 5  
ATOM 10831 H HD21 . LEU A 1 116 ? -4.084  27.204  -14.897 1.00 0.00 ? 116 LEU A HD21 5  
ATOM 10832 H HD22 . LEU A 1 116 ? -2.773  26.164  -14.345 1.00 0.00 ? 116 LEU A HD22 5  
ATOM 10833 H HD23 . LEU A 1 116 ? -2.594  27.095  -15.829 1.00 0.00 ? 116 LEU A HD23 5  
ATOM 10834 N N    . THR A 1 117 ? -7.611  25.044  -18.896 1.00 0.00 ? 117 THR A N    5  
ATOM 10835 C CA   . THR A 1 117 ? -8.551  25.532  -19.929 1.00 0.00 ? 117 THR A CA   5  
ATOM 10836 C C    . THR A 1 117 ? -8.901  26.989  -19.687 1.00 0.00 ? 117 THR A C    5  
ATOM 10837 O O    . THR A 1 117 ? -8.061  27.777  -19.305 1.00 0.00 ? 117 THR A O    5  
ATOM 10838 C CB   . THR A 1 117 ? -9.833  24.695  -19.844 1.00 0.00 ? 117 THR A CB   5  
ATOM 10839 O OG1  . THR A 1 117 ? -9.425  23.437  -19.344 1.00 0.00 ? 117 THR A OG1  5  
ATOM 10840 C CG2  . THR A 1 117 ? -10.383 24.392  -21.246 1.00 0.00 ? 117 THR A CG2  5  
ATOM 10841 H H    . THR A 1 117 ? -7.934  24.473  -18.167 1.00 0.00 ? 117 THR A H    5  
ATOM 10842 H HA   . THR A 1 117 ? -8.092  25.438  -20.906 1.00 0.00 ? 117 THR A HA   5  
ATOM 10843 H HB   . THR A 1 117 ? -10.571 25.150  -19.190 1.00 0.00 ? 117 THR A HB   5  
ATOM 10844 H HG1  . THR A 1 117 ? -10.160 23.060  -18.853 1.00 0.00 ? 117 THR A HG1  5  
ATOM 10845 H HG21 . THR A 1 117 ? -9.580  24.067  -21.891 1.00 0.00 ? 117 THR A HG21 5  
ATOM 10846 H HG22 . THR A 1 117 ? -11.127 23.612  -21.185 1.00 0.00 ? 117 THR A HG22 5  
ATOM 10847 H HG23 . THR A 1 117 ? -10.833 25.281  -21.662 1.00 0.00 ? 117 THR A HG23 5  
ATOM 10848 N N    . ASP A 1 118 ? -10.135 27.321  -19.911 1.00 0.00 ? 118 ASP A N    5  
ATOM 10849 C CA   . ASP A 1 118 ? -10.560 28.726  -19.699 1.00 0.00 ? 118 ASP A CA   5  
ATOM 10850 C C    . ASP A 1 118 ? -10.719 29.033  -18.217 1.00 0.00 ? 118 ASP A C    5  
ATOM 10851 O O    . ASP A 1 118 ? -9.940  29.772  -17.649 1.00 0.00 ? 118 ASP A O    5  
ATOM 10852 C CB   . ASP A 1 118 ? -11.912 28.932  -20.398 1.00 0.00 ? 118 ASP A CB   5  
ATOM 10853 C CG   . ASP A 1 118 ? -12.307 30.406  -20.310 1.00 0.00 ? 118 ASP A CG   5  
ATOM 10854 O OD1  . ASP A 1 118 ? -11.397 31.201  -20.144 1.00 0.00 ? 118 ASP A OD1  5  
ATOM 10855 O OD2  . ASP A 1 118 ? -13.497 30.655  -20.416 1.00 0.00 ? 118 ASP A OD2  5  
ATOM 10856 H H    . ASP A 1 118 ? -10.776 26.649  -20.220 1.00 0.00 ? 118 ASP A H    5  
ATOM 10857 H HA   . ASP A 1 118 ? -9.806  29.386  -20.112 1.00 0.00 ? 118 ASP A HA   5  
ATOM 10858 H HB2  . ASP A 1 118 ? -11.836 28.644  -21.436 1.00 0.00 ? 118 ASP A HB2  5  
ATOM 10859 H HB3  . ASP A 1 118 ? -12.670 28.331  -19.916 1.00 0.00 ? 118 ASP A HB3  5  
ATOM 10860 N N    . GLU A 1 119 ? -11.723 28.465  -17.616 1.00 0.00 ? 119 GLU A N    5  
ATOM 10861 C CA   . GLU A 1 119 ? -11.939 28.719  -16.172 1.00 0.00 ? 119 GLU A CA   5  
ATOM 10862 C C    . GLU A 1 119 ? -10.638 28.548  -15.406 1.00 0.00 ? 119 GLU A C    5  
ATOM 10863 O O    . GLU A 1 119 ? -10.347 29.296  -14.492 1.00 0.00 ? 119 GLU A O    5  
ATOM 10864 C CB   . GLU A 1 119 ? -12.973 27.709  -15.648 1.00 0.00 ? 119 GLU A CB   5  
ATOM 10865 C CG   . GLU A 1 119 ? -14.167 28.471  -15.068 1.00 0.00 ? 119 GLU A CG   5  
ATOM 10866 C CD   . GLU A 1 119 ? -15.326 27.499  -14.839 1.00 0.00 ? 119 GLU A CD   5  
ATOM 10867 O OE1  . GLU A 1 119 ? -15.103 26.557  -14.096 1.00 0.00 ? 119 GLU A OE1  5  
ATOM 10868 O OE2  . GLU A 1 119 ? -16.369 27.754  -15.418 1.00 0.00 ? 119 GLU A OE2  5  
ATOM 10869 H H    . GLU A 1 119 ? -12.328 27.876  -18.112 1.00 0.00 ? 119 GLU A H    5  
ATOM 10870 H HA   . GLU A 1 119 ? -12.292 29.741  -16.043 1.00 0.00 ? 119 GLU A HA   5  
ATOM 10871 H HB2  . GLU A 1 119 ? -13.306 27.077  -16.458 1.00 0.00 ? 119 GLU A HB2  5  
ATOM 10872 H HB3  . GLU A 1 119 ? -12.527 27.095  -14.880 1.00 0.00 ? 119 GLU A HB3  5  
ATOM 10873 H HG2  . GLU A 1 119 ? -13.890 28.925  -14.128 1.00 0.00 ? 119 GLU A HG2  5  
ATOM 10874 H HG3  . GLU A 1 119 ? -14.480 29.241  -15.758 1.00 0.00 ? 119 GLU A HG3  5  
ATOM 10875 N N    . GLU A 1 120 ? -9.877  27.565  -15.789 1.00 0.00 ? 120 GLU A N    5  
ATOM 10876 C CA   . GLU A 1 120 ? -8.592  27.331  -15.096 1.00 0.00 ? 120 GLU A CA   5  
ATOM 10877 C C    . GLU A 1 120 ? -7.644  28.484  -15.349 1.00 0.00 ? 120 GLU A C    5  
ATOM 10878 O O    . GLU A 1 120 ? -7.125  29.085  -14.430 1.00 0.00 ? 120 GLU A O    5  
ATOM 10879 C CB   . GLU A 1 120 ? -7.964  26.050  -15.660 1.00 0.00 ? 120 GLU A CB   5  
ATOM 10880 C CG   . GLU A 1 120 ? -8.730  24.840  -15.133 1.00 0.00 ? 120 GLU A CG   5  
ATOM 10881 C CD   . GLU A 1 120 ? -10.213 25.193  -14.993 1.00 0.00 ? 120 GLU A CD   5  
ATOM 10882 O OE1  . GLU A 1 120 ? -10.890 25.100  -16.005 1.00 0.00 ? 120 GLU A OE1  5  
ATOM 10883 O OE2  . GLU A 1 120 ? -10.586 25.535  -13.883 1.00 0.00 ? 120 GLU A OE2  5  
ATOM 10884 H H    . GLU A 1 120 ? -10.153 26.986  -16.528 1.00 0.00 ? 120 GLU A H    5  
ATOM 10885 H HA   . GLU A 1 120 ? -8.770  27.242  -14.028 1.00 0.00 ? 120 GLU A HA   5  
ATOM 10886 H HB2  . GLU A 1 120 ? -8.013  26.069  -16.739 1.00 0.00 ? 120 GLU A HB2  5  
ATOM 10887 H HB3  . GLU A 1 120 ? -6.931  25.988  -15.354 1.00 0.00 ? 120 GLU A HB3  5  
ATOM 10888 H HG2  . GLU A 1 120 ? -8.624  24.016  -15.820 1.00 0.00 ? 120 GLU A HG2  5  
ATOM 10889 H HG3  . GLU A 1 120 ? -8.339  24.554  -14.170 1.00 0.00 ? 120 GLU A HG3  5  
ATOM 10890 N N    . VAL A 1 121 ? -7.435  28.773  -16.599 1.00 0.00 ? 121 VAL A N    5  
ATOM 10891 C CA   . VAL A 1 121 ? -6.523  29.887  -16.947 1.00 0.00 ? 121 VAL A CA   5  
ATOM 10892 C C    . VAL A 1 121 ? -6.962  31.175  -16.269 1.00 0.00 ? 121 VAL A C    5  
ATOM 10893 O O    . VAL A 1 121 ? -6.149  32.012  -15.935 1.00 0.00 ? 121 VAL A O    5  
ATOM 10894 C CB   . VAL A 1 121 ? -6.564  30.089  -18.466 1.00 0.00 ? 121 VAL A CB   5  
ATOM 10895 C CG1  . VAL A 1 121 ? -5.959  31.452  -18.812 1.00 0.00 ? 121 VAL A CG1  5  
ATOM 10896 C CG2  . VAL A 1 121 ? -5.742  28.988  -19.136 1.00 0.00 ? 121 VAL A CG2  5  
ATOM 10897 H H    . VAL A 1 121 ? -7.881  28.253  -17.306 1.00 0.00 ? 121 VAL A H    5  
ATOM 10898 H HA   . VAL A 1 121 ? -5.515  29.637  -16.617 1.00 0.00 ? 121 VAL A HA   5  
ATOM 10899 H HB   . VAL A 1 121 ? -7.584  30.043  -18.811 1.00 0.00 ? 121 VAL A HB   5  
ATOM 10900 H HG11 . VAL A 1 121 ? -5.010  31.568  -18.309 1.00 0.00 ? 121 VAL A HG11 5  
ATOM 10901 H HG12 . VAL A 1 121 ? -5.808  31.523  -19.879 1.00 0.00 ? 121 VAL A HG12 5  
ATOM 10902 H HG13 . VAL A 1 121 ? -6.627  32.239  -18.495 1.00 0.00 ? 121 VAL A HG13 5  
ATOM 10903 H HG21 . VAL A 1 121 ? -5.839  28.073  -18.573 1.00 0.00 ? 121 VAL A HG21 5  
ATOM 10904 H HG22 . VAL A 1 121 ? -6.098  28.826  -20.141 1.00 0.00 ? 121 VAL A HG22 5  
ATOM 10905 H HG23 . VAL A 1 121 ? -4.703  29.277  -19.167 1.00 0.00 ? 121 VAL A HG23 5  
ATOM 10906 N N    . ASP A 1 122 ? -8.245  31.314  -16.074 1.00 0.00 ? 122 ASP A N    5  
ATOM 10907 C CA   . ASP A 1 122 ? -8.748  32.543  -15.418 1.00 0.00 ? 122 ASP A CA   5  
ATOM 10908 C C    . ASP A 1 122 ? -8.458  32.511  -13.925 1.00 0.00 ? 122 ASP A C    5  
ATOM 10909 O O    . ASP A 1 122 ? -8.016  33.488  -13.354 1.00 0.00 ? 122 ASP A O    5  
ATOM 10910 C CB   . ASP A 1 122 ? -10.269 32.616  -15.624 1.00 0.00 ? 122 ASP A CB   5  
ATOM 10911 C CG   . ASP A 1 122 ? -10.567 33.139  -17.031 1.00 0.00 ? 122 ASP A CG   5  
ATOM 10912 O OD1  . ASP A 1 122 ? -10.083 34.221  -17.320 1.00 0.00 ? 122 ASP A OD1  5  
ATOM 10913 O OD2  . ASP A 1 122 ? -11.262 32.427  -17.737 1.00 0.00 ? 122 ASP A OD2  5  
ATOM 10914 H H    . ASP A 1 122 ? -8.869  30.613  -16.358 1.00 0.00 ? 122 ASP A H    5  
ATOM 10915 H HA   . ASP A 1 122 ? -8.253  33.408  -15.857 1.00 0.00 ? 122 ASP A HA   5  
ATOM 10916 H HB2  . ASP A 1 122 ? -10.702 31.633  -15.510 1.00 0.00 ? 122 ASP A HB2  5  
ATOM 10917 H HB3  . ASP A 1 122 ? -10.705 33.284  -14.896 1.00 0.00 ? 122 ASP A HB3  5  
ATOM 10918 N N    . GLU A 1 123 ? -8.710  31.386  -13.317 1.00 0.00 ? 123 GLU A N    5  
ATOM 10919 C CA   . GLU A 1 123 ? -8.455  31.271  -11.863 1.00 0.00 ? 123 GLU A CA   5  
ATOM 10920 C C    . GLU A 1 123 ? -6.961  31.290  -11.575 1.00 0.00 ? 123 GLU A C    5  
ATOM 10921 O O    . GLU A 1 123 ? -6.539  31.622  -10.486 1.00 0.00 ? 123 GLU A O    5  
ATOM 10922 C CB   . GLU A 1 123 ? -9.034  29.935  -11.374 1.00 0.00 ? 123 GLU A CB   5  
ATOM 10923 C CG   . GLU A 1 123 ? -9.291  30.022  -9.869  1.00 0.00 ? 123 GLU A CG   5  
ATOM 10924 C CD   . GLU A 1 123 ? -10.530 30.882  -9.617  1.00 0.00 ? 123 GLU A CD   5  
ATOM 10925 O OE1  . GLU A 1 123 ? -11.606 30.367  -9.869  1.00 0.00 ? 123 GLU A OE1  5  
ATOM 10926 O OE2  . GLU A 1 123 ? -10.330 32.007  -9.188  1.00 0.00 ? 123 GLU A OE2  5  
ATOM 10927 H H    . GLU A 1 123 ? -9.065  30.622  -13.817 1.00 0.00 ? 123 GLU A H    5  
ATOM 10928 H HA   . GLU A 1 123 ? -8.927  32.109  -11.351 1.00 0.00 ? 123 GLU A HA   5  
ATOM 10929 H HB2  . GLU A 1 123 ? -9.960  29.732  -11.890 1.00 0.00 ? 123 GLU A HB2  5  
ATOM 10930 H HB3  . GLU A 1 123 ? -8.332  29.140  -11.577 1.00 0.00 ? 123 GLU A HB3  5  
ATOM 10931 H HG2  . GLU A 1 123 ? -9.455  29.033  -9.469  1.00 0.00 ? 123 GLU A HG2  5  
ATOM 10932 H HG3  . GLU A 1 123 ? -8.440  30.470  -9.378  1.00 0.00 ? 123 GLU A HG3  5  
ATOM 10933 N N    . MET A 1 124 ? -6.183  30.932  -12.562 1.00 0.00 ? 124 MET A N    5  
ATOM 10934 C CA   . MET A 1 124 ? -4.717  30.924  -12.362 1.00 0.00 ? 124 MET A CA   5  
ATOM 10935 C C    . MET A 1 124 ? -4.123  32.286  -12.677 1.00 0.00 ? 124 MET A C    5  
ATOM 10936 O O    . MET A 1 124 ? -3.289  32.787  -11.948 1.00 0.00 ? 124 MET A O    5  
ATOM 10937 C CB   . MET A 1 124 ? -4.102  29.886  -13.313 1.00 0.00 ? 124 MET A CB   5  
ATOM 10938 C CG   . MET A 1 124 ? -2.804  29.356  -12.701 1.00 0.00 ? 124 MET A CG   5  
ATOM 10939 S SD   . MET A 1 124 ? -1.715  28.382  -13.771 1.00 0.00 ? 124 MET A SD   5  
ATOM 10940 C CE   . MET A 1 124 ? -1.182  29.733  -14.854 1.00 0.00 ? 124 MET A CE   5  
ATOM 10941 H H    . MET A 1 124 ? -6.565  30.675  -13.424 1.00 0.00 ? 124 MET A H    5  
ATOM 10942 H HA   . MET A 1 124 ? -4.503  30.677  -11.328 1.00 0.00 ? 124 MET A HA   5  
ATOM 10943 H HB2  . MET A 1 124 ? -4.795  29.071  -13.458 1.00 0.00 ? 124 MET A HB2  5  
ATOM 10944 H HB3  . MET A 1 124 ? -3.892  30.347  -14.267 1.00 0.00 ? 124 MET A HB3  5  
ATOM 10945 H HG2  . MET A 1 124 ? -2.238  30.199  -12.335 1.00 0.00 ? 124 MET A HG2  5  
ATOM 10946 H HG3  . MET A 1 124 ? -3.062  28.742  -11.851 1.00 0.00 ? 124 MET A HG3  5  
ATOM 10947 H HE1  . MET A 1 124 ? -1.259  30.670  -14.325 1.00 0.00 ? 124 MET A HE1  5  
ATOM 10948 H HE2  . MET A 1 124 ? -0.156  29.570  -15.153 1.00 0.00 ? 124 MET A HE2  5  
ATOM 10949 H HE3  . MET A 1 124 ? -1.812  29.761  -15.730 1.00 0.00 ? 124 MET A HE3  5  
ATOM 10950 N N    . ILE A 1 125 ? -4.562  32.863  -13.759 1.00 0.00 ? 125 ILE A N    5  
ATOM 10951 C CA   . ILE A 1 125 ? -4.031  34.192  -14.131 1.00 0.00 ? 125 ILE A CA   5  
ATOM 10952 C C    . ILE A 1 125 ? -4.249  35.179  -13.000 1.00 0.00 ? 125 ILE A C    5  
ATOM 10953 O O    . ILE A 1 125 ? -3.346  35.894  -12.612 1.00 0.00 ? 125 ILE A O    5  
ATOM 10954 C CB   . ILE A 1 125 ? -4.772  34.677  -15.380 1.00 0.00 ? 125 ILE A CB   5  
ATOM 10955 C CG1  . ILE A 1 125 ? -4.087  34.119  -16.623 1.00 0.00 ? 125 ILE A CG1  5  
ATOM 10956 C CG2  . ILE A 1 125 ? -4.705  36.215  -15.428 1.00 0.00 ? 125 ILE A CG2  5  
ATOM 10957 C CD1  . ILE A 1 125 ? -4.787  34.650  -17.878 1.00 0.00 ? 125 ILE A CD1  5  
ATOM 10958 H H    . ILE A 1 125 ? -5.237  32.423  -14.316 1.00 0.00 ? 125 ILE A H    5  
ATOM 10959 H HA   . ILE A 1 125 ? -2.964  34.104  -14.323 1.00 0.00 ? 125 ILE A HA   5  
ATOM 10960 H HB   . ILE A 1 125 ? -5.806  34.328  -15.346 1.00 0.00 ? 125 ILE A HB   5  
ATOM 10961 H HG12 . ILE A 1 125 ? -3.051  34.424  -16.632 1.00 0.00 ? 125 ILE A HG12 5  
ATOM 10962 H HG13 . ILE A 1 125 ? -4.136  33.041  -16.612 1.00 0.00 ? 125 ILE A HG13 5  
ATOM 10963 H HG21 . ILE A 1 125 ? -3.687  36.540  -15.277 1.00 0.00 ? 125 ILE A HG21 5  
ATOM 10964 H HG22 . ILE A 1 125 ? -5.051  36.567  -16.388 1.00 0.00 ? 125 ILE A HG22 5  
ATOM 10965 H HG23 . ILE A 1 125 ? -5.330  36.633  -14.651 1.00 0.00 ? 125 ILE A HG23 5  
ATOM 10966 H HD11 . ILE A 1 125 ? -5.827  34.841  -17.663 1.00 0.00 ? 125 ILE A HD11 5  
ATOM 10967 H HD12 . ILE A 1 125 ? -4.315  35.568  -18.198 1.00 0.00 ? 125 ILE A HD12 5  
ATOM 10968 H HD13 . ILE A 1 125 ? -4.716  33.919  -18.672 1.00 0.00 ? 125 ILE A HD13 5  
ATOM 10969 N N    . ARG A 1 126 ? -5.445  35.202  -12.488 1.00 0.00 ? 126 ARG A N    5  
ATOM 10970 C CA   . ARG A 1 126 ? -5.739  36.135  -11.381 1.00 0.00 ? 126 ARG A CA   5  
ATOM 10971 C C    . ARG A 1 126 ? -4.762  35.905  -10.239 1.00 0.00 ? 126 ARG A C    5  
ATOM 10972 O O    . ARG A 1 126 ? -4.659  36.710  -9.337  1.00 0.00 ? 126 ARG A O    5  
ATOM 10973 C CB   . ARG A 1 126 ? -7.169  35.862  -10.877 1.00 0.00 ? 126 ARG A CB   5  
ATOM 10974 C CG   . ARG A 1 126 ? -8.054  37.071  -11.189 1.00 0.00 ? 126 ARG A CG   5  
ATOM 10975 C CD   . ARG A 1 126 ? -7.683  38.222  -10.251 1.00 0.00 ? 126 ARG A CD   5  
ATOM 10976 N NE   . ARG A 1 126 ? -8.513  38.129  -9.017  1.00 0.00 ? 126 ARG A NE   5  
ATOM 10977 C CZ   . ARG A 1 126 ? -9.359  39.083  -8.741  1.00 0.00 ? 126 ARG A CZ   5  
ATOM 10978 N NH1  . ARG A 1 126 ? -10.482 39.139  -9.400  1.00 0.00 ? 126 ARG A NH1  5  
ATOM 10979 N NH2  . ARG A 1 126 ? -9.052  39.947  -7.813  1.00 0.00 ? 126 ARG A NH2  5  
ATOM 10980 H H    . ARG A 1 126 ? -6.140  34.605  -12.832 1.00 0.00 ? 126 ARG A H    5  
ATOM 10981 H HA   . ARG A 1 126 ? -5.638  37.159  -11.740 1.00 0.00 ? 126 ARG A HA   5  
ATOM 10982 H HB2  . ARG A 1 126 ? -7.564  34.986  -11.371 1.00 0.00 ? 126 ARG A HB2  5  
ATOM 10983 H HB3  . ARG A 1 126 ? -7.152  35.689  -9.811  1.00 0.00 ? 126 ARG A HB3  5  
ATOM 10984 H HG2  . ARG A 1 126 ? -7.905  37.375  -12.213 1.00 0.00 ? 126 ARG A HG2  5  
ATOM 10985 H HG3  . ARG A 1 126 ? -9.091  36.807  -11.045 1.00 0.00 ? 126 ARG A HG3  5  
ATOM 10986 H HD2  . ARG A 1 126 ? -6.639  38.158  -9.987  1.00 0.00 ? 126 ARG A HD2  5  
ATOM 10987 H HD3  . ARG A 1 126 ? -7.872  39.168  -10.739 1.00 0.00 ? 126 ARG A HD3  5  
ATOM 10988 H HE   . ARG A 1 126 ? -8.424  37.357  -8.419  1.00 0.00 ? 126 ARG A HE   5  
ATOM 10989 H HH11 . ARG A 1 126 ? -10.684 38.458  -10.103 1.00 0.00 ? 126 ARG A HH11 5  
ATOM 10990 H HH12 . ARG A 1 126 ? -11.142 39.865  -9.202  1.00 0.00 ? 126 ARG A HH12 5  
ATOM 10991 H HH21 . ARG A 1 126 ? -8.182  39.872  -7.327  1.00 0.00 ? 126 ARG A HH21 5  
ATOM 10992 H HH22 . ARG A 1 126 ? -9.687  40.684  -7.590  1.00 0.00 ? 126 ARG A HH22 5  
ATOM 10993 N N    . GLU A 1 127 ? -4.061  34.795  -10.310 1.00 0.00 ? 127 GLU A N    5  
ATOM 10994 C CA   . GLU A 1 127 ? -3.074  34.466  -9.247  1.00 0.00 ? 127 GLU A CA   5  
ATOM 10995 C C    . GLU A 1 127 ? -1.707  34.162  -9.849  1.00 0.00 ? 127 GLU A C    5  
ATOM 10996 O O    . GLU A 1 127 ? -0.984  33.318  -9.358  1.00 0.00 ? 127 GLU A O    5  
ATOM 10997 C CB   . GLU A 1 127 ? -3.569  33.216  -8.504  1.00 0.00 ? 127 GLU A CB   5  
ATOM 10998 C CG   . GLU A 1 127 ? -4.757  33.589  -7.615  1.00 0.00 ? 127 GLU A CG   5  
ATOM 10999 C CD   . GLU A 1 127 ? -5.298  32.326  -6.942  1.00 0.00 ? 127 GLU A CD   5  
ATOM 11000 O OE1  . GLU A 1 127 ? -4.656  31.900  -5.997  1.00 0.00 ? 127 GLU A OE1  5  
ATOM 11001 O OE2  . GLU A 1 127 ? -6.322  31.858  -7.412  1.00 0.00 ? 127 GLU A OE2  5  
ATOM 11002 H H    . GLU A 1 127 ? -4.191  34.180  -11.065 1.00 0.00 ? 127 GLU A H    5  
ATOM 11003 H HA   . GLU A 1 127 ? -2.981  35.309  -8.565  1.00 0.00 ? 127 GLU A HA   5  
ATOM 11004 H HB2  . GLU A 1 127 ? -3.875  32.467  -9.221  1.00 0.00 ? 127 GLU A HB2  5  
ATOM 11005 H HB3  . GLU A 1 127 ? -2.772  32.816  -7.897  1.00 0.00 ? 127 GLU A HB3  5  
ATOM 11006 H HG2  . GLU A 1 127 ? -4.440  34.291  -6.857  1.00 0.00 ? 127 GLU A HG2  5  
ATOM 11007 H HG3  . GLU A 1 127 ? -5.537  34.038  -8.214  1.00 0.00 ? 127 GLU A HG3  5  
ATOM 11008 N N    . ALA A 1 128 ? -1.374  34.853  -10.906 1.00 0.00 ? 128 ALA A N    5  
ATOM 11009 C CA   . ALA A 1 128 ? -0.057  34.609  -11.544 1.00 0.00 ? 128 ALA A CA   5  
ATOM 11010 C C    . ALA A 1 128 ? 1.050   35.331  -10.791 1.00 0.00 ? 128 ALA A C    5  
ATOM 11011 O O    . ALA A 1 128 ? 1.783   36.113  -11.362 1.00 0.00 ? 128 ALA A O    5  
ATOM 11012 C CB   . ALA A 1 128 ? -0.101  35.145  -12.984 1.00 0.00 ? 128 ALA A CB   5  
ATOM 11013 H H    . ALA A 1 128 ? -1.985  35.523  -11.272 1.00 0.00 ? 128 ALA A H    5  
ATOM 11014 H HA   . ALA A 1 128 ? 0.146   33.540  -11.535 1.00 0.00 ? 128 ALA A HA   5  
ATOM 11015 H HB1  . ALA A 1 128 ? -1.063  34.931  -13.424 1.00 0.00 ? 128 ALA A HB1  5  
ATOM 11016 H HB2  . ALA A 1 128 ? 0.061   36.210  -12.983 1.00 0.00 ? 128 ALA A HB2  5  
ATOM 11017 H HB3  . ALA A 1 128 ? 0.670   34.672  -13.569 1.00 0.00 ? 128 ALA A HB3  5  
ATOM 11018 N N    . ASN A 1 129 ? 1.153   35.056  -9.519  1.00 0.00 ? 129 ASN A N    5  
ATOM 11019 C CA   . ASN A 1 129 ? 2.207   35.717  -8.714  1.00 0.00 ? 129 ASN A CA   5  
ATOM 11020 C C    . ASN A 1 129 ? 2.284   37.202  -9.049  1.00 0.00 ? 129 ASN A C    5  
ATOM 11021 O O    . ASN A 1 129 ? 3.343   37.796  -9.011  1.00 0.00 ? 129 ASN A O    5  
ATOM 11022 C CB   . ASN A 1 129 ? 3.556   35.056  -9.053  1.00 0.00 ? 129 ASN A CB   5  
ATOM 11023 C CG   . ASN A 1 129 ? 4.654   35.647  -8.167  1.00 0.00 ? 129 ASN A CG   5  
ATOM 11024 O OD1  . ASN A 1 129 ? 4.433   35.971  -7.016  1.00 0.00 ? 129 ASN A OD1  5  
ATOM 11025 N ND2  . ASN A 1 129 ? 5.852   35.801  -8.662  1.00 0.00 ? 129 ASN A ND2  5  
ATOM 11026 H H    . ASN A 1 129 ? 0.536   34.419  -9.099  1.00 0.00 ? 129 ASN A H    5  
ATOM 11027 H HA   . ASN A 1 129 ? 1.973   35.602  -7.656  1.00 0.00 ? 129 ASN A HA   5  
ATOM 11028 H HB2  . ASN A 1 129 ? 3.495   33.991  -8.880  1.00 0.00 ? 129 ASN A HB2  5  
ATOM 11029 H HB3  . ASN A 1 129 ? 3.801   35.236  -10.090 1.00 0.00 ? 129 ASN A HB3  5  
ATOM 11030 H HD21 . ASN A 1 129 ? 6.036   35.538  -9.589  1.00 0.00 ? 129 ASN A HD21 5  
ATOM 11031 H HD22 . ASN A 1 129 ? 6.566   36.179  -8.108  1.00 0.00 ? 129 ASN A HD22 5  
ATOM 11032 N N    . ILE A 1 130 ? 1.155   37.776  -9.369  1.00 0.00 ? 130 ILE A N    5  
ATOM 11033 C CA   . ILE A 1 130 ? 1.142   39.222  -9.709  1.00 0.00 ? 130 ILE A CA   5  
ATOM 11034 C C    . ILE A 1 130 ? 1.284   40.072  -8.458  1.00 0.00 ? 130 ILE A C    5  
ATOM 11035 O O    . ILE A 1 130 ? 0.856   39.685  -7.391  1.00 0.00 ? 130 ILE A O    5  
ATOM 11036 C CB   . ILE A 1 130 ? -0.194  39.560  -10.373 1.00 0.00 ? 130 ILE A CB   5  
ATOM 11037 C CG1  . ILE A 1 130 ? -0.686  38.372  -11.190 1.00 0.00 ? 130 ILE A CG1  5  
ATOM 11038 C CG2  . ILE A 1 130 ? 0.023   40.753  -11.321 1.00 0.00 ? 130 ILE A CG2  5  
ATOM 11039 C CD1  . ILE A 1 130 ? -2.029  38.719  -11.842 1.00 0.00 ? 130 ILE A CD1  5  
ATOM 11040 H H    . ILE A 1 130 ? 0.325   37.259  -9.379  1.00 0.00 ? 130 ILE A H    5  
ATOM 11041 H HA   . ILE A 1 130 ? 1.972   39.436  -10.379 1.00 0.00 ? 130 ILE A HA   5  
ATOM 11042 H HB   . ILE A 1 130 ? -0.928  39.802  -9.604  1.00 0.00 ? 130 ILE A HB   5  
ATOM 11043 H HG12 . ILE A 1 130 ? 0.038   38.135  -11.954 1.00 0.00 ? 130 ILE A HG12 5  
ATOM 11044 H HG13 . ILE A 1 130 ? -0.810  37.516  -10.545 1.00 0.00 ? 130 ILE A HG13 5  
ATOM 11045 H HG21 . ILE A 1 130 ? 0.949   41.251  -11.077 1.00 0.00 ? 130 ILE A HG21 5  
ATOM 11046 H HG22 . ILE A 1 130 ? 0.066   40.403  -12.341 1.00 0.00 ? 130 ILE A HG22 5  
ATOM 11047 H HG23 . ILE A 1 130 ? -0.794  41.451  -11.220 1.00 0.00 ? 130 ILE A HG23 5  
ATOM 11048 H HD11 . ILE A 1 130 ? -2.107  39.787  -11.976 1.00 0.00 ? 130 ILE A HD11 5  
ATOM 11049 H HD12 . ILE A 1 130 ? -2.103  38.235  -12.805 1.00 0.00 ? 130 ILE A HD12 5  
ATOM 11050 H HD13 . ILE A 1 130 ? -2.838  38.380  -11.213 1.00 0.00 ? 130 ILE A HD13 5  
ATOM 11051 N N    . ASP A 1 131 ? 1.878   41.224  -8.617  1.00 0.00 ? 131 ASP A N    5  
ATOM 11052 C CA   . ASP A 1 131 ? 2.063   42.124  -7.451  1.00 0.00 ? 131 ASP A CA   5  
ATOM 11053 C C    . ASP A 1 131 ? 2.841   43.376  -7.849  1.00 0.00 ? 131 ASP A C    5  
ATOM 11054 O O    . ASP A 1 131 ? 2.775   44.388  -7.182  1.00 0.00 ? 131 ASP A O    5  
ATOM 11055 C CB   . ASP A 1 131 ? 2.868   41.371  -6.377  1.00 0.00 ? 131 ASP A CB   5  
ATOM 11056 C CG   . ASP A 1 131 ? 3.540   42.383  -5.447  1.00 0.00 ? 131 ASP A CG   5  
ATOM 11057 O OD1  . ASP A 1 131 ? 2.826   43.263  -4.999  1.00 0.00 ? 131 ASP A OD1  5  
ATOM 11058 O OD2  . ASP A 1 131 ? 4.731   42.220  -5.241  1.00 0.00 ? 131 ASP A OD2  5  
ATOM 11059 H H    . ASP A 1 131 ? 2.196   41.494  -9.504  1.00 0.00 ? 131 ASP A H    5  
ATOM 11060 H HA   . ASP A 1 131 ? 1.086   42.419  -7.070  1.00 0.00 ? 131 ASP A HA   5  
ATOM 11061 H HB2  . ASP A 1 131 ? 2.210   40.742  -5.798  1.00 0.00 ? 131 ASP A HB2  5  
ATOM 11062 H HB3  . ASP A 1 131 ? 3.625   40.760  -6.848  1.00 0.00 ? 131 ASP A HB3  5  
ATOM 11063 N N    . GLY A 1 132 ? 3.565   43.280  -8.931  1.00 0.00 ? 132 GLY A N    5  
ATOM 11064 C CA   . GLY A 1 132 ? 4.357   44.457  -9.390  1.00 0.00 ? 132 GLY A CA   5  
ATOM 11065 C C    . GLY A 1 132 ? 3.437   45.544  -9.949  1.00 0.00 ? 132 GLY A C    5  
ATOM 11066 O O    . GLY A 1 132 ? 2.597   46.071  -9.248  1.00 0.00 ? 132 GLY A O    5  
ATOM 11067 H H    . GLY A 1 132 ? 3.586   42.442  -9.440  1.00 0.00 ? 132 GLY A H    5  
ATOM 11068 H HA2  . GLY A 1 132 ? 4.914   44.857  -8.556  1.00 0.00 ? 132 GLY A HA2  5  
ATOM 11069 H HA3  . GLY A 1 132 ? 5.047   44.144  -10.161 1.00 0.00 ? 132 GLY A HA3  5  
ATOM 11070 N N    . ASP A 1 133 ? 3.617   45.855  -11.203 1.00 0.00 ? 133 ASP A N    5  
ATOM 11071 C CA   . ASP A 1 133 ? 2.768   46.899  -11.825 1.00 0.00 ? 133 ASP A CA   5  
ATOM 11072 C C    . ASP A 1 133 ? 1.476   46.296  -12.364 1.00 0.00 ? 133 ASP A C    5  
ATOM 11073 O O    . ASP A 1 133 ? 0.394   46.681  -11.966 1.00 0.00 ? 133 ASP A O    5  
ATOM 11074 C CB   . ASP A 1 133 ? 3.551   47.523  -12.990 1.00 0.00 ? 133 ASP A CB   5  
ATOM 11075 C CG   . ASP A 1 133 ? 4.876   48.082  -12.466 1.00 0.00 ? 133 ASP A CG   5  
ATOM 11076 O OD1  . ASP A 1 133 ? 4.865   48.518  -11.325 1.00 0.00 ? 133 ASP A OD1  5  
ATOM 11077 O OD2  . ASP A 1 133 ? 5.822   48.044  -13.234 1.00 0.00 ? 133 ASP A OD2  5  
ATOM 11078 H H    . ASP A 1 133 ? 4.308   45.402  -11.730 1.00 0.00 ? 133 ASP A H    5  
ATOM 11079 H HA   . ASP A 1 133 ? 2.523   47.651  -11.075 1.00 0.00 ? 133 ASP A HA   5  
ATOM 11080 H HB2  . ASP A 1 133 ? 3.753   46.772  -13.739 1.00 0.00 ? 133 ASP A HB2  5  
ATOM 11081 H HB3  . ASP A 1 133 ? 2.974   48.322  -13.432 1.00 0.00 ? 133 ASP A HB3  5  
ATOM 11082 N N    . GLY A 1 134 ? 1.612   45.360  -13.263 1.00 0.00 ? 134 GLY A N    5  
ATOM 11083 C CA   . GLY A 1 134 ? 0.398   44.719  -13.842 1.00 0.00 ? 134 GLY A CA   5  
ATOM 11084 C C    . GLY A 1 134 ? 0.798   43.665  -14.875 1.00 0.00 ? 134 GLY A C    5  
ATOM 11085 O O    . GLY A 1 134 ? -0.042  42.982  -15.427 1.00 0.00 ? 134 GLY A O    5  
ATOM 11086 H H    . GLY A 1 134 ? 2.505   45.080  -13.553 1.00 0.00 ? 134 GLY A H    5  
ATOM 11087 H HA2  . GLY A 1 134 ? -0.168  44.247  -13.052 1.00 0.00 ? 134 GLY A HA2  5  
ATOM 11088 H HA3  . GLY A 1 134 ? -0.211  45.473  -14.318 1.00 0.00 ? 134 GLY A HA3  5  
ATOM 11089 N N    . GLN A 1 135 ? 2.077   43.556  -15.118 1.00 0.00 ? 135 GLN A N    5  
ATOM 11090 C CA   . GLN A 1 135 ? 2.549   42.556  -16.108 1.00 0.00 ? 135 GLN A CA   5  
ATOM 11091 C C    . GLN A 1 135 ? 2.505   41.149  -15.519 1.00 0.00 ? 135 GLN A C    5  
ATOM 11092 O O    . GLN A 1 135 ? 1.827   40.905  -14.539 1.00 0.00 ? 135 GLN A O    5  
ATOM 11093 C CB   . GLN A 1 135 ? 4.002   42.889  -16.485 1.00 0.00 ? 135 GLN A CB   5  
ATOM 11094 C CG   . GLN A 1 135 ? 4.070   44.316  -17.035 1.00 0.00 ? 135 GLN A CG   5  
ATOM 11095 C CD   . GLN A 1 135 ? 5.297   44.448  -17.943 1.00 0.00 ? 135 GLN A CD   5  
ATOM 11096 O OE1  . GLN A 1 135 ? 6.349   43.909  -17.664 1.00 0.00 ? 135 GLN A OE1  5  
ATOM 11097 N NE2  . GLN A 1 135 ? 5.206   45.157  -19.034 1.00 0.00 ? 135 GLN A NE2  5  
ATOM 11098 H H    . GLN A 1 135 ? 2.720   44.131  -14.650 1.00 0.00 ? 135 GLN A H    5  
ATOM 11099 H HA   . GLN A 1 135 ? 1.901   42.594  -16.985 1.00 0.00 ? 135 GLN A HA   5  
ATOM 11100 H HB2  . GLN A 1 135 ? 4.632   42.804  -15.612 1.00 0.00 ? 135 GLN A HB2  5  
ATOM 11101 H HB3  . GLN A 1 135 ? 4.345   42.196  -17.238 1.00 0.00 ? 135 GLN A HB3  5  
ATOM 11102 H HG2  . GLN A 1 135 ? 3.179   44.533  -17.605 1.00 0.00 ? 135 GLN A HG2  5  
ATOM 11103 H HG3  . GLN A 1 135 ? 4.153   45.020  -16.219 1.00 0.00 ? 135 GLN A HG3  5  
ATOM 11104 H HE21 . GLN A 1 135 ? 4.361   45.596  -19.265 1.00 0.00 ? 135 GLN A HE21 5  
ATOM 11105 H HE22 . GLN A 1 135 ? 5.983   45.250  -19.625 1.00 0.00 ? 135 GLN A HE22 5  
ATOM 11106 N N    . VAL A 1 136 ? 3.229   40.244  -16.127 1.00 0.00 ? 136 VAL A N    5  
ATOM 11107 C CA   . VAL A 1 136 ? 3.237   38.850  -15.611 1.00 0.00 ? 136 VAL A CA   5  
ATOM 11108 C C    . VAL A 1 136 ? 4.584   38.187  -15.838 1.00 0.00 ? 136 VAL A C    5  
ATOM 11109 O O    . VAL A 1 136 ? 5.059   38.117  -16.952 1.00 0.00 ? 136 VAL A O    5  
ATOM 11110 C CB   . VAL A 1 136 ? 2.179   38.044  -16.374 1.00 0.00 ? 136 VAL A CB   5  
ATOM 11111 C CG1  . VAL A 1 136 ? 2.138   36.617  -15.822 1.00 0.00 ? 136 VAL A CG1  5  
ATOM 11112 C CG2  . VAL A 1 136 ? 0.811   38.691  -16.187 1.00 0.00 ? 136 VAL A CG2  5  
ATOM 11113 H H    . VAL A 1 136 ? 3.758   40.484  -16.916 1.00 0.00 ? 136 VAL A H    5  
ATOM 11114 H HA   . VAL A 1 136 ? 3.023   38.858  -14.546 1.00 0.00 ? 136 VAL A HA   5  
ATOM 11115 H HB   . VAL A 1 136 ? 2.429   38.020  -17.421 1.00 0.00 ? 136 VAL A HB   5  
ATOM 11116 H HG11 . VAL A 1 136 ? 2.495   36.609  -14.803 1.00 0.00 ? 136 VAL A HG11 5  
ATOM 11117 H HG12 . VAL A 1 136 ? 1.124   36.245  -15.847 1.00 0.00 ? 136 VAL A HG12 5  
ATOM 11118 H HG13 . VAL A 1 136 ? 2.766   35.974  -16.424 1.00 0.00 ? 136 VAL A HG13 5  
ATOM 11119 H HG21 . VAL A 1 136 ? 0.647   38.898  -15.141 1.00 0.00 ? 136 VAL A HG21 5  
ATOM 11120 H HG22 . VAL A 1 136 ? 0.768   39.614  -16.744 1.00 0.00 ? 136 VAL A HG22 5  
ATOM 11121 H HG23 . VAL A 1 136 ? 0.041   38.024  -16.544 1.00 0.00 ? 136 VAL A HG23 5  
ATOM 11122 N N    . ASN A 1 137 ? 5.177   37.705  -14.780 1.00 0.00 ? 137 ASN A N    5  
ATOM 11123 C CA   . ASN A 1 137 ? 6.490   37.044  -14.937 1.00 0.00 ? 137 ASN A CA   5  
ATOM 11124 C C    . ASN A 1 137 ? 6.301   35.727  -15.675 1.00 0.00 ? 137 ASN A C    5  
ATOM 11125 O O    . ASN A 1 137 ? 6.194   34.679  -15.068 1.00 0.00 ? 137 ASN A O    5  
ATOM 11126 C CB   . ASN A 1 137 ? 7.078   36.763  -13.537 1.00 0.00 ? 137 ASN A CB   5  
ATOM 11127 C CG   . ASN A 1 137 ? 5.957   36.795  -12.494 1.00 0.00 ? 137 ASN A CG   5  
ATOM 11128 O OD1  . ASN A 1 137 ? 4.985   36.071  -12.588 1.00 0.00 ? 137 ASN A OD1  5  
ATOM 11129 N ND2  . ASN A 1 137 ? 6.055   37.617  -11.487 1.00 0.00 ? 137 ASN A ND2  5  
ATOM 11130 H H    . ASN A 1 137 ? 4.760   37.780  -13.897 1.00 0.00 ? 137 ASN A H    5  
ATOM 11131 H HA   . ASN A 1 137 ? 7.149   37.689  -15.519 1.00 0.00 ? 137 ASN A HA   5  
ATOM 11132 H HB2  . ASN A 1 137 ? 7.550   35.793  -13.523 1.00 0.00 ? 137 ASN A HB2  5  
ATOM 11133 H HB3  . ASN A 1 137 ? 7.811   37.514  -13.293 1.00 0.00 ? 137 ASN A HB3  5  
ATOM 11134 H HD21 . ASN A 1 137 ? 6.836   38.203  -11.405 1.00 0.00 ? 137 ASN A HD21 5  
ATOM 11135 H HD22 . ASN A 1 137 ? 5.347   37.649  -10.809 1.00 0.00 ? 137 ASN A HD22 5  
ATOM 11136 N N    . TYR A 1 138 ? 6.247   35.809  -16.981 1.00 0.00 ? 138 TYR A N    5  
ATOM 11137 C CA   . TYR A 1 138 ? 6.063   34.575  -17.784 1.00 0.00 ? 138 TYR A CA   5  
ATOM 11138 C C    . TYR A 1 138 ? 6.897   33.427  -17.223 1.00 0.00 ? 138 TYR A C    5  
ATOM 11139 O O    . TYR A 1 138 ? 6.443   32.303  -17.164 1.00 0.00 ? 138 TYR A O    5  
ATOM 11140 C CB   . TYR A 1 138 ? 6.480   34.866  -19.239 1.00 0.00 ? 138 TYR A CB   5  
ATOM 11141 C CG   . TYR A 1 138 ? 7.965   34.562  -19.439 1.00 0.00 ? 138 TYR A CG   5  
ATOM 11142 C CD1  . TYR A 1 138 ? 8.409   33.259  -19.524 1.00 0.00 ? 138 TYR A CD1  5  
ATOM 11143 C CD2  . TYR A 1 138 ? 8.878   35.588  -19.574 1.00 0.00 ? 138 TYR A CD2  5  
ATOM 11144 C CE1  . TYR A 1 138 ? 9.743   32.986  -19.747 1.00 0.00 ? 138 TYR A CE1  5  
ATOM 11145 C CE2  . TYR A 1 138 ? 10.210  35.317  -19.797 1.00 0.00 ? 138 TYR A CE2  5  
ATOM 11146 C CZ   . TYR A 1 138 ? 10.655  34.015  -19.885 1.00 0.00 ? 138 TYR A CZ   5  
ATOM 11147 O OH   . TYR A 1 138 ? 11.990  33.744  -20.114 1.00 0.00 ? 138 TYR A OH   5  
ATOM 11148 H H    . TYR A 1 138 ? 6.327   36.679  -17.423 1.00 0.00 ? 138 TYR A H    5  
ATOM 11149 H HA   . TYR A 1 138 ? 5.007   34.295  -17.738 1.00 0.00 ? 138 TYR A HA   5  
ATOM 11150 H HB2  . TYR A 1 138 ? 5.901   34.251  -19.913 1.00 0.00 ? 138 TYR A HB2  5  
ATOM 11151 H HB3  . TYR A 1 138 ? 6.298   35.905  -19.468 1.00 0.00 ? 138 TYR A HB3  5  
ATOM 11152 H HD1  . TYR A 1 138 ? 7.706   32.447  -19.417 1.00 0.00 ? 138 TYR A HD1  5  
ATOM 11153 H HD2  . TYR A 1 138 ? 8.544   36.613  -19.506 1.00 0.00 ? 138 TYR A HD2  5  
ATOM 11154 H HE1  . TYR A 1 138 ? 10.075  31.962  -19.815 1.00 0.00 ? 138 TYR A HE1  5  
ATOM 11155 H HE2  . TYR A 1 138 ? 10.910  36.130  -19.909 1.00 0.00 ? 138 TYR A HE2  5  
ATOM 11156 H HH   . TYR A 1 138 ? 12.261  34.227  -20.900 1.00 0.00 ? 138 TYR A HH   5  
ATOM 11157 N N    . GLU A 1 139 ? 8.102   33.726  -16.818 1.00 0.00 ? 139 GLU A N    5  
ATOM 11158 C CA   . GLU A 1 139 ? 8.960   32.648  -16.261 1.00 0.00 ? 139 GLU A CA   5  
ATOM 11159 C C    . GLU A 1 139 ? 8.224   31.934  -15.141 1.00 0.00 ? 139 GLU A C    5  
ATOM 11160 O O    . GLU A 1 139 ? 8.168   30.721  -15.102 1.00 0.00 ? 139 GLU A O    5  
ATOM 11161 C CB   . GLU A 1 139 ? 10.241  33.280  -15.689 1.00 0.00 ? 139 GLU A CB   5  
ATOM 11162 C CG   . GLU A 1 139 ? 9.872   34.532  -14.887 1.00 0.00 ? 139 GLU A CG   5  
ATOM 11163 C CD   . GLU A 1 139 ? 11.144  35.314  -14.558 1.00 0.00 ? 139 GLU A CD   5  
ATOM 11164 O OE1  . GLU A 1 139 ? 11.649  35.935  -15.478 1.00 0.00 ? 139 GLU A OE1  5  
ATOM 11165 O OE2  . GLU A 1 139 ? 11.537  35.247  -13.405 1.00 0.00 ? 139 GLU A OE2  5  
ATOM 11166 H H    . GLU A 1 139 ? 8.437   34.643  -16.884 1.00 0.00 ? 139 GLU A H    5  
ATOM 11167 H HA   . GLU A 1 139 ? 9.191   31.927  -17.049 1.00 0.00 ? 139 GLU A HA   5  
ATOM 11168 H HB2  . GLU A 1 139 ? 10.739  32.571  -15.044 1.00 0.00 ? 139 GLU A HB2  5  
ATOM 11169 H HB3  . GLU A 1 139 ? 10.904  33.549  -16.498 1.00 0.00 ? 139 GLU A HB3  5  
ATOM 11170 H HG2  . GLU A 1 139 ? 9.209   35.157  -15.467 1.00 0.00 ? 139 GLU A HG2  5  
ATOM 11171 H HG3  . GLU A 1 139 ? 9.380   34.247  -13.969 1.00 0.00 ? 139 GLU A HG3  5  
ATOM 11172 N N    . GLU A 1 140 ? 7.671   32.701  -14.241 1.00 0.00 ? 140 GLU A N    5  
ATOM 11173 C CA   . GLU A 1 140 ? 6.935   32.082  -13.122 1.00 0.00 ? 140 GLU A CA   5  
ATOM 11174 C C    . GLU A 1 140 ? 5.708   31.362  -13.657 1.00 0.00 ? 140 GLU A C    5  
ATOM 11175 O O    . GLU A 1 140 ? 5.318   30.329  -13.150 1.00 0.00 ? 140 GLU A O    5  
ATOM 11176 C CB   . GLU A 1 140 ? 6.494   33.188  -12.157 1.00 0.00 ? 140 GLU A CB   5  
ATOM 11177 C CG   . GLU A 1 140 ? 7.578   33.385  -11.096 1.00 0.00 ? 140 GLU A CG   5  
ATOM 11178 C CD   . GLU A 1 140 ? 7.629   32.155  -10.188 1.00 0.00 ? 140 GLU A CD   5  
ATOM 11179 O OE1  . GLU A 1 140 ? 6.571   31.578  -10.000 1.00 0.00 ? 140 GLU A OE1  5  
ATOM 11180 O OE2  . GLU A 1 140 ? 8.723   31.862  -9.733  1.00 0.00 ? 140 GLU A OE2  5  
ATOM 11181 H H    . GLU A 1 140 ? 7.744   33.676  -14.308 1.00 0.00 ? 140 GLU A H    5  
ATOM 11182 H HA   . GLU A 1 140 ? 7.584   31.360  -12.624 1.00 0.00 ? 140 GLU A HA   5  
ATOM 11183 H HB2  . GLU A 1 140 ? 6.346   34.109  -12.701 1.00 0.00 ? 140 GLU A HB2  5  
ATOM 11184 H HB3  . GLU A 1 140 ? 5.568   32.904  -11.679 1.00 0.00 ? 140 GLU A HB3  5  
ATOM 11185 H HG2  . GLU A 1 140 ? 8.539   33.517  -11.573 1.00 0.00 ? 140 GLU A HG2  5  
ATOM 11186 H HG3  . GLU A 1 140 ? 7.354   34.258  -10.501 1.00 0.00 ? 140 GLU A HG3  5  
ATOM 11187 N N    . PHE A 1 141 ? 5.117   31.928  -14.680 1.00 0.00 ? 141 PHE A N    5  
ATOM 11188 C CA   . PHE A 1 141 ? 3.913   31.295  -15.270 1.00 0.00 ? 141 PHE A CA   5  
ATOM 11189 C C    . PHE A 1 141 ? 4.286   29.942  -15.837 1.00 0.00 ? 141 PHE A C    5  
ATOM 11190 O O    . PHE A 1 141 ? 3.514   29.004  -15.795 1.00 0.00 ? 141 PHE A O    5  
ATOM 11191 C CB   . PHE A 1 141 ? 3.411   32.186  -16.418 1.00 0.00 ? 141 PHE A CB   5  
ATOM 11192 C CG   . PHE A 1 141 ? 1.880   32.182  -16.439 1.00 0.00 ? 141 PHE A CG   5  
ATOM 11193 C CD1  . PHE A 1 141 ? 1.185   31.158  -17.062 1.00 0.00 ? 141 PHE A CD1  5  
ATOM 11194 C CD2  . PHE A 1 141 ? 1.172   33.204  -15.839 1.00 0.00 ? 141 PHE A CD2  5  
ATOM 11195 C CE1  . PHE A 1 141 ? -0.196  31.162  -17.082 1.00 0.00 ? 141 PHE A CE1  5  
ATOM 11196 C CE2  . PHE A 1 141 ? -0.208  33.206  -15.859 1.00 0.00 ? 141 PHE A CE2  5  
ATOM 11197 C CZ   . PHE A 1 141 ? -0.891  32.185  -16.480 1.00 0.00 ? 141 PHE A CZ   5  
ATOM 11198 H H    . PHE A 1 141 ? 5.468   32.764  -15.052 1.00 0.00 ? 141 PHE A H    5  
ATOM 11199 H HA   . PHE A 1 141 ? 3.151   31.172  -14.500 1.00 0.00 ? 141 PHE A HA   5  
ATOM 11200 H HB2  . PHE A 1 141 ? 3.763   33.198  -16.275 1.00 0.00 ? 141 PHE A HB2  5  
ATOM 11201 H HB3  . PHE A 1 141 ? 3.782   31.810  -17.361 1.00 0.00 ? 141 PHE A HB3  5  
ATOM 11202 H HD1  . PHE A 1 141 ? 1.725   30.351  -17.535 1.00 0.00 ? 141 PHE A HD1  5  
ATOM 11203 H HD2  . PHE A 1 141 ? 1.703   34.011  -15.361 1.00 0.00 ? 141 PHE A HD2  5  
ATOM 11204 H HE1  . PHE A 1 141 ? -0.730  30.368  -17.581 1.00 0.00 ? 141 PHE A HE1  5  
ATOM 11205 H HE2  . PHE A 1 141 ? -0.752  34.012  -15.395 1.00 0.00 ? 141 PHE A HE2  5  
ATOM 11206 H HZ   . PHE A 1 141 ? -1.972  32.185  -16.489 1.00 0.00 ? 141 PHE A HZ   5  
ATOM 11207 N N    . VAL A 1 142 ? 5.480   29.870  -16.361 1.00 0.00 ? 142 VAL A N    5  
ATOM 11208 C CA   . VAL A 1 142 ? 5.951   28.600  -16.943 1.00 0.00 ? 142 VAL A CA   5  
ATOM 11209 C C    . VAL A 1 142 ? 6.208   27.582  -15.842 1.00 0.00 ? 142 VAL A C    5  
ATOM 11210 O O    . VAL A 1 142 ? 6.012   26.397  -16.025 1.00 0.00 ? 142 VAL A O    5  
ATOM 11211 C CB   . VAL A 1 142 ? 7.267   28.876  -17.689 1.00 0.00 ? 142 VAL A CB   5  
ATOM 11212 C CG1  . VAL A 1 142 ? 7.885   27.552  -18.125 1.00 0.00 ? 142 VAL A CG1  5  
ATOM 11213 C CG2  . VAL A 1 142 ? 6.977   29.717  -18.929 1.00 0.00 ? 142 VAL A CG2  5  
ATOM 11214 H H    . VAL A 1 142 ? 6.061   30.658  -16.368 1.00 0.00 ? 142 VAL A H    5  
ATOM 11215 H HA   . VAL A 1 142 ? 5.194   28.212  -17.620 1.00 0.00 ? 142 VAL A HA   5  
ATOM 11216 H HB   . VAL A 1 142 ? 7.951   29.406  -17.043 1.00 0.00 ? 142 VAL A HB   5  
ATOM 11217 H HG11 . VAL A 1 142 ? 7.176   27.001  -18.725 1.00 0.00 ? 142 VAL A HG11 5  
ATOM 11218 H HG12 . VAL A 1 142 ? 8.774   27.740  -18.707 1.00 0.00 ? 142 VAL A HG12 5  
ATOM 11219 H HG13 . VAL A 1 142 ? 8.146   26.968  -17.255 1.00 0.00 ? 142 VAL A HG13 5  
ATOM 11220 H HG21 . VAL A 1 142 ? 6.284   30.506  -18.682 1.00 0.00 ? 142 VAL A HG21 5  
ATOM 11221 H HG22 . VAL A 1 142 ? 7.894   30.150  -19.299 1.00 0.00 ? 142 VAL A HG22 5  
ATOM 11222 H HG23 . VAL A 1 142 ? 6.547   29.095  -19.694 1.00 0.00 ? 142 VAL A HG23 5  
ATOM 11223 N N    . GLN A 1 143 ? 6.643   28.069  -14.711 1.00 0.00 ? 143 GLN A N    5  
ATOM 11224 C CA   . GLN A 1 143 ? 6.920   27.157  -13.581 1.00 0.00 ? 143 GLN A CA   5  
ATOM 11225 C C    . GLN A 1 143 ? 5.614   26.683  -12.946 1.00 0.00 ? 143 GLN A C    5  
ATOM 11226 O O    . GLN A 1 143 ? 5.535   25.588  -12.426 1.00 0.00 ? 143 GLN A O    5  
ATOM 11227 C CB   . GLN A 1 143 ? 7.734   27.933  -12.528 1.00 0.00 ? 143 GLN A CB   5  
ATOM 11228 C CG   . GLN A 1 143 ? 9.023   27.173  -12.211 1.00 0.00 ? 143 GLN A CG   5  
ATOM 11229 C CD   . GLN A 1 143 ? 9.467   27.516  -10.789 1.00 0.00 ? 143 GLN A CD   5  
ATOM 11230 O OE1  . GLN A 1 143 ? 9.035   26.910  -9.830  1.00 0.00 ? 143 GLN A OE1  5  
ATOM 11231 N NE2  . GLN A 1 143 ? 10.327  28.482  -10.608 1.00 0.00 ? 143 GLN A NE2  5  
ATOM 11232 H H    . GLN A 1 143 ? 6.787   29.033  -14.612 1.00 0.00 ? 143 GLN A H    5  
ATOM 11233 H HA   . GLN A 1 143 ? 7.474   26.295  -13.948 1.00 0.00 ? 143 GLN A HA   5  
ATOM 11234 H HB2  . GLN A 1 143 ? 7.979   28.913  -12.912 1.00 0.00 ? 143 GLN A HB2  5  
ATOM 11235 H HB3  . GLN A 1 143 ? 7.150   28.045  -11.627 1.00 0.00 ? 143 GLN A HB3  5  
ATOM 11236 H HG2  . GLN A 1 143 ? 8.851   26.111  -12.283 1.00 0.00 ? 143 GLN A HG2  5  
ATOM 11237 H HG3  . GLN A 1 143 ? 9.797   27.459  -12.907 1.00 0.00 ? 143 GLN A HG3  5  
ATOM 11238 H HE21 . GLN A 1 143 ? 10.678  28.975  -11.378 1.00 0.00 ? 143 GLN A HE21 5  
ATOM 11239 H HE22 . GLN A 1 143 ? 10.619  28.714  -9.703  1.00 0.00 ? 143 GLN A HE22 5  
ATOM 11240 N N    . MET A 1 144 ? 4.615   27.525  -13.001 1.00 0.00 ? 144 MET A N    5  
ATOM 11241 C CA   . MET A 1 144 ? 3.305   27.151  -12.410 1.00 0.00 ? 144 MET A CA   5  
ATOM 11242 C C    . MET A 1 144 ? 2.521   26.256  -13.360 1.00 0.00 ? 144 MET A C    5  
ATOM 11243 O O    . MET A 1 144 ? 1.829   25.350  -12.939 1.00 0.00 ? 144 MET A O    5  
ATOM 11244 C CB   . MET A 1 144 ? 2.496   28.438  -12.168 1.00 0.00 ? 144 MET A CB   5  
ATOM 11245 C CG   . MET A 1 144 ? 2.524   28.778  -10.676 1.00 0.00 ? 144 MET A CG   5  
ATOM 11246 S SD   . MET A 1 144 ? 1.659   30.278  -10.148 1.00 0.00 ? 144 MET A SD   5  
ATOM 11247 C CE   . MET A 1 144 ? 0.133   30.003  -11.081 1.00 0.00 ? 144 MET A CE   5  
ATOM 11248 H H    . MET A 1 144 ? 4.730   28.397  -13.427 1.00 0.00 ? 144 MET A H    5  
ATOM 11249 H HA   . MET A 1 144 ? 3.475   26.618  -11.476 1.00 0.00 ? 144 MET A HA   5  
ATOM 11250 H HB2  . MET A 1 144 ? 2.929   29.251  -12.734 1.00 0.00 ? 144 MET A HB2  5  
ATOM 11251 H HB3  . MET A 1 144 ? 1.475   28.290  -12.487 1.00 0.00 ? 144 MET A HB3  5  
ATOM 11252 H HG2  . MET A 1 144 ? 2.097   27.947  -10.134 1.00 0.00 ? 144 MET A HG2  5  
ATOM 11253 H HG3  . MET A 1 144 ? 3.556   28.872  -10.372 1.00 0.00 ? 144 MET A HG3  5  
ATOM 11254 H HE1  . MET A 1 144 ? -0.097  28.948  -11.089 1.00 0.00 ? 144 MET A HE1  5  
ATOM 11255 H HE2  . MET A 1 144 ? -0.677  30.545  -10.615 1.00 0.00 ? 144 MET A HE2  5  
ATOM 11256 H HE3  . MET A 1 144 ? 0.264   30.351  -12.095 1.00 0.00 ? 144 MET A HE3  5  
ATOM 11257 N N    . MET A 1 145 ? 2.646   26.526  -14.631 1.00 0.00 ? 145 MET A N    5  
ATOM 11258 C CA   . MET A 1 145 ? 1.918   25.707  -15.629 1.00 0.00 ? 145 MET A CA   5  
ATOM 11259 C C    . MET A 1 145 ? 2.532   24.318  -15.731 1.00 0.00 ? 145 MET A C    5  
ATOM 11260 O O    . MET A 1 145 ? 2.165   23.532  -16.581 1.00 0.00 ? 145 MET A O    5  
ATOM 11261 C CB   . MET A 1 145 ? 2.032   26.399  -16.995 1.00 0.00 ? 145 MET A CB   5  
ATOM 11262 C CG   . MET A 1 145 ? 0.790   27.263  -17.226 1.00 0.00 ? 145 MET A CG   5  
ATOM 11263 S SD   . MET A 1 145 ? -0.604  26.491  -18.093 1.00 0.00 ? 145 MET A SD   5  
ATOM 11264 C CE   . MET A 1 145 ? -1.337  28.002  -18.781 1.00 0.00 ? 145 MET A CE   5  
ATOM 11265 H H    . MET A 1 145 ? 3.222   27.263  -14.923 1.00 0.00 ? 145 MET A H    5  
ATOM 11266 H HA   . MET A 1 145 ? 0.876   25.615  -15.324 1.00 0.00 ? 145 MET A HA   5  
ATOM 11267 H HB2  . MET A 1 145 ? 2.914   27.022  -17.013 1.00 0.00 ? 145 MET A HB2  5  
ATOM 11268 H HB3  . MET A 1 145 ? 2.107   25.656  -17.774 1.00 0.00 ? 145 MET A HB3  5  
ATOM 11269 H HG2  . MET A 1 145 ? 0.431   27.601  -16.267 1.00 0.00 ? 145 MET A HG2  5  
ATOM 11270 H HG3  . MET A 1 145 ? 1.089   28.132  -17.788 1.00 0.00 ? 145 MET A HG3  5  
ATOM 11271 H HE1  . MET A 1 145 ? -0.555  28.685  -19.070 1.00 0.00 ? 145 MET A HE1  5  
ATOM 11272 H HE2  . MET A 1 145 ? -1.929  27.746  -19.648 1.00 0.00 ? 145 MET A HE2  5  
ATOM 11273 H HE3  . MET A 1 145 ? -1.969  28.468  -18.040 1.00 0.00 ? 145 MET A HE3  5  
ATOM 11274 N N    . THR A 1 146 ? 3.459   24.042  -14.858 1.00 0.00 ? 146 THR A N    5  
ATOM 11275 C CA   . THR A 1 146 ? 4.115   22.714  -14.881 1.00 0.00 ? 146 THR A CA   5  
ATOM 11276 C C    . THR A 1 146 ? 4.518   22.295  -13.464 1.00 0.00 ? 146 THR A C    5  
ATOM 11277 O O    . THR A 1 146 ? 4.742   21.132  -13.195 1.00 0.00 ? 146 THR A O    5  
ATOM 11278 C CB   . THR A 1 146 ? 5.366   22.823  -15.773 1.00 0.00 ? 146 THR A CB   5  
ATOM 11279 O OG1  . THR A 1 146 ? 5.018   22.176  -16.979 1.00 0.00 ? 146 THR A OG1  5  
ATOM 11280 C CG2  . THR A 1 146 ? 6.532   21.994  -15.220 1.00 0.00 ? 146 THR A CG2  5  
ATOM 11281 H H    . THR A 1 146 ? 3.720   24.709  -14.189 1.00 0.00 ? 146 THR A H    5  
ATOM 11282 H HA   . THR A 1 146 ? 3.415   21.981  -15.281 1.00 0.00 ? 146 THR A HA   5  
ATOM 11283 H HB   . THR A 1 146 ? 5.638   23.860  -15.958 1.00 0.00 ? 146 THR A HB   5  
ATOM 11284 H HG1  . THR A 1 146 ? 4.224   21.662  -16.822 1.00 0.00 ? 146 THR A HG1  5  
ATOM 11285 H HG21 . THR A 1 146 ? 6.203   20.986  -15.024 1.00 0.00 ? 146 THR A HG21 5  
ATOM 11286 H HG22 . THR A 1 146 ? 7.335   21.971  -15.942 1.00 0.00 ? 146 THR A HG22 5  
ATOM 11287 H HG23 . THR A 1 146 ? 6.891   22.436  -14.309 1.00 0.00 ? 146 THR A HG23 5  
ATOM 11288 N N    . ALA A 1 147 ? 4.588   23.259  -12.583 1.00 0.00 ? 147 ALA A N    5  
ATOM 11289 C CA   . ALA A 1 147 ? 4.969   22.951  -11.177 1.00 0.00 ? 147 ALA A CA   5  
ATOM 11290 C C    . ALA A 1 147 ? 6.225   22.088  -11.115 1.00 0.00 ? 147 ALA A C    5  
ATOM 11291 O O    . ALA A 1 147 ? 7.050   22.123  -12.002 1.00 0.00 ? 147 ALA A O    5  
ATOM 11292 C CB   . ALA A 1 147 ? 3.809   22.185  -10.522 1.00 0.00 ? 147 ALA A CB   5  
ATOM 11293 H H    . ALA A 1 147 ? 4.392   24.182  -12.848 1.00 0.00 ? 147 ALA A H    5  
ATOM 11294 H HA   . ALA A 1 147 ? 5.158   23.886  -10.649 1.00 0.00 ? 147 ALA A HA   5  
ATOM 11295 H HB1  . ALA A 1 147 ? 2.878   22.698  -10.713 1.00 0.00 ? 147 ALA A HB1  5  
ATOM 11296 H HB2  . ALA A 1 147 ? 3.754   21.186  -10.929 1.00 0.00 ? 147 ALA A HB2  5  
ATOM 11297 H HB3  . ALA A 1 147 ? 3.968   22.125  -9.455  1.00 0.00 ? 147 ALA A HB3  5  
ATOM 11298 N N    . LYS A 1 148 ? 6.346   21.328  -10.058 1.00 0.00 ? 148 LYS A N    5  
ATOM 11299 C CA   . LYS A 1 148 ? 7.538   20.455  -9.917  1.00 0.00 ? 148 LYS A CA   5  
ATOM 11300 C C    . LYS A 1 148 ? 7.242   19.050  -10.422 1.00 0.00 ? 148 LYS A C    5  
ATOM 11301 O O    . LYS A 1 148 ? 6.066   18.772  -10.588 1.00 0.00 ? 148 LYS A O    5  
ATOM 11302 C CB   . LYS A 1 148 ? 7.905   20.380  -8.427  1.00 0.00 ? 148 LYS A CB   5  
ATOM 11303 C CG   . LYS A 1 148 ? 8.216   21.789  -7.917  1.00 0.00 ? 148 LYS A CG   5  
ATOM 11304 C CD   . LYS A 1 148 ? 9.730   21.935  -7.741  1.00 0.00 ? 148 LYS A CD   5  
ATOM 11305 C CE   . LYS A 1 148 ? 10.170  21.157  -6.498  1.00 0.00 ? 148 LYS A CE   5  
ATOM 11306 N NZ   . LYS A 1 148 ? 11.454  21.698  -5.969  1.00 0.00 ? 148 LYS A NZ   5  
ATOM 11307 O OXT  . LYS A 1 148 ? 8.207   18.329  -10.614 1.00 0.00 ? 148 LYS A OXT  5  
ATOM 11308 H H    . LYS A 1 148 ? 5.656   21.337  -9.364  1.00 0.00 ? 148 LYS A H    5  
ATOM 11309 H HA   . LYS A 1 148 ? 8.359   20.874  -10.496 1.00 0.00 ? 148 LYS A HA   5  
ATOM 11310 H HB2  . LYS A 1 148 ? 7.078   19.967  -7.868  1.00 0.00 ? 148 LYS A HB2  5  
ATOM 11311 H HB3  . LYS A 1 148 ? 8.771   19.748  -8.297  1.00 0.00 ? 148 LYS A HB3  5  
ATOM 11312 H HG2  . LYS A 1 148 ? 7.862   22.518  -8.631  1.00 0.00 ? 148 LYS A HG2  5  
ATOM 11313 H HG3  . LYS A 1 148 ? 7.723   21.950  -6.970  1.00 0.00 ? 148 LYS A HG3  5  
ATOM 11314 H HD2  . LYS A 1 148 ? 10.237  21.545  -8.612  1.00 0.00 ? 148 LYS A HD2  5  
ATOM 11315 H HD3  . LYS A 1 148 ? 9.982   22.979  -7.623  1.00 0.00 ? 148 LYS A HD3  5  
ATOM 11316 H HE2  . LYS A 1 148 ? 9.411   21.237  -5.733  1.00 0.00 ? 148 LYS A HE2  5  
ATOM 11317 H HE3  . LYS A 1 148 ? 10.305  20.116  -6.752  1.00 0.00 ? 148 LYS A HE3  5  
ATOM 11318 H HZ1  . LYS A 1 148 ? 11.981  22.157  -6.740  1.00 0.00 ? 148 LYS A HZ1  5  
ATOM 11319 H HZ2  . LYS A 1 148 ? 11.256  22.396  -5.222  1.00 0.00 ? 148 LYS A HZ2  5  
ATOM 11320 H HZ3  . LYS A 1 148 ? 12.023  20.922  -5.574  1.00 0.00 ? 148 LYS A HZ3  5  
ATOM 11321 N N    . ALA A 1 1   ? 13.889  2.480   -19.674 1.00 0.00 ? 1   ALA A N    6  
ATOM 11322 C CA   . ALA A 1 1   ? 14.103  3.935   -19.495 1.00 0.00 ? 1   ALA A CA   6  
ATOM 11323 C C    . ALA A 1 1   ? 12.867  4.573   -18.879 1.00 0.00 ? 1   ALA A C    6  
ATOM 11324 O O    . ALA A 1 1   ? 12.560  5.719   -19.142 1.00 0.00 ? 1   ALA A O    6  
ATOM 11325 C CB   . ALA A 1 1   ? 14.367  4.598   -20.856 1.00 0.00 ? 1   ALA A CB   6  
ATOM 11326 H H1   . ALA A 1 1   ? 13.297  2.118   -18.898 1.00 0.00 ? 1   ALA A H1   6  
ATOM 11327 H H2   . ALA A 1 1   ? 13.414  2.307   -20.582 1.00 0.00 ? 1   ALA A H2   6  
ATOM 11328 H H3   . ALA A 1 1   ? 14.807  1.991   -19.664 1.00 0.00 ? 1   ALA A H3   6  
ATOM 11329 H HA   . ALA A 1 1   ? 14.947  4.087   -18.821 1.00 0.00 ? 1   ALA A HA   6  
ATOM 11330 H HB1  . ALA A 1 1   ? 13.614  4.285   -21.566 1.00 0.00 ? 1   ALA A HB1  6  
ATOM 11331 H HB2  . ALA A 1 1   ? 14.332  5.672   -20.751 1.00 0.00 ? 1   ALA A HB2  6  
ATOM 11332 H HB3  . ALA A 1 1   ? 15.341  4.306   -21.220 1.00 0.00 ? 1   ALA A HB3  6  
ATOM 11333 N N    . ASP A 1 2   ? 12.178  3.819   -18.067 1.00 0.00 ? 2   ASP A N    6  
ATOM 11334 C CA   . ASP A 1 2   ? 10.959  4.367   -17.425 1.00 0.00 ? 2   ASP A CA   6  
ATOM 11335 C C    . ASP A 1 2   ? 11.307  5.062   -16.116 1.00 0.00 ? 2   ASP A C    6  
ATOM 11336 O O    . ASP A 1 2   ? 12.028  4.522   -15.300 1.00 0.00 ? 2   ASP A O    6  
ATOM 11337 C CB   . ASP A 1 2   ? 10.003  3.202   -17.126 1.00 0.00 ? 2   ASP A CB   6  
ATOM 11338 C CG   . ASP A 1 2   ? 10.185  2.111   -18.184 1.00 0.00 ? 2   ASP A CG   6  
ATOM 11339 O OD1  . ASP A 1 2   ? 9.693   2.331   -19.278 1.00 0.00 ? 2   ASP A OD1  6  
ATOM 11340 O OD2  . ASP A 1 2   ? 10.806  1.120   -17.837 1.00 0.00 ? 2   ASP A OD2  6  
ATOM 11341 H H    . ASP A 1 2   ? 12.466  2.901   -17.879 1.00 0.00 ? 2   ASP A H    6  
ATOM 11342 H HA   . ASP A 1 2   ? 10.495  5.087   -18.098 1.00 0.00 ? 2   ASP A HA   6  
ATOM 11343 H HB2  . ASP A 1 2   ? 10.220  2.792   -16.151 1.00 0.00 ? 2   ASP A HB2  6  
ATOM 11344 H HB3  . ASP A 1 2   ? 8.982   3.552   -17.147 1.00 0.00 ? 2   ASP A HB3  6  
ATOM 11345 N N    . GLN A 1 3   ? 10.785  6.252   -15.942 1.00 0.00 ? 3   GLN A N    6  
ATOM 11346 C CA   . GLN A 1 3   ? 11.068  7.007   -14.694 1.00 0.00 ? 3   GLN A CA   6  
ATOM 11347 C C    . GLN A 1 3   ? 9.798   7.655   -14.154 1.00 0.00 ? 3   GLN A C    6  
ATOM 11348 O O    . GLN A 1 3   ? 9.623   8.853   -14.240 1.00 0.00 ? 3   GLN A O    6  
ATOM 11349 C CB   . GLN A 1 3   ? 12.087  8.112   -15.019 1.00 0.00 ? 3   GLN A CB   6  
ATOM 11350 C CG   . GLN A 1 3   ? 12.545  8.772   -13.718 1.00 0.00 ? 3   GLN A CG   6  
ATOM 11351 C CD   . GLN A 1 3   ? 13.715  9.716   -14.014 1.00 0.00 ? 3   GLN A CD   6  
ATOM 11352 O OE1  . GLN A 1 3   ? 14.775  9.298   -14.435 1.00 0.00 ? 3   GLN A OE1  6  
ATOM 11353 N NE2  . GLN A 1 3   ? 13.563  10.996  -13.806 1.00 0.00 ? 3   GLN A NE2  6  
ATOM 11354 H H    . GLN A 1 3   ? 10.211  6.642   -16.631 1.00 0.00 ? 3   GLN A H    6  
ATOM 11355 H HA   . GLN A 1 3   ? 11.462  6.327   -13.941 1.00 0.00 ? 3   GLN A HA   6  
ATOM 11356 H HB2  . GLN A 1 3   ? 12.937  7.682   -15.527 1.00 0.00 ? 3   GLN A HB2  6  
ATOM 11357 H HB3  . GLN A 1 3   ? 11.629  8.851   -15.659 1.00 0.00 ? 3   GLN A HB3  6  
ATOM 11358 H HG2  . GLN A 1 3   ? 11.731  9.336   -13.287 1.00 0.00 ? 3   GLN A HG2  6  
ATOM 11359 H HG3  . GLN A 1 3   ? 12.866  8.015   -13.018 1.00 0.00 ? 3   GLN A HG3  6  
ATOM 11360 H HE21 . GLN A 1 3   ? 12.710  11.340  -13.466 1.00 0.00 ? 3   GLN A HE21 6  
ATOM 11361 H HE22 . GLN A 1 3   ? 14.301  11.614  -13.991 1.00 0.00 ? 3   GLN A HE22 6  
ATOM 11362 N N    . LEU A 1 4   ? 8.930   6.844   -13.612 1.00 0.00 ? 4   LEU A N    6  
ATOM 11363 C CA   . LEU A 1 4   ? 7.665   7.389   -13.060 1.00 0.00 ? 4   LEU A CA   6  
ATOM 11364 C C    . LEU A 1 4   ? 7.837   7.742   -11.588 1.00 0.00 ? 4   LEU A C    6  
ATOM 11365 O O    . LEU A 1 4   ? 8.039   6.877   -10.758 1.00 0.00 ? 4   LEU A O    6  
ATOM 11366 C CB   . LEU A 1 4   ? 6.575   6.305   -13.186 1.00 0.00 ? 4   LEU A CB   6  
ATOM 11367 C CG   . LEU A 1 4   ? 5.593   6.669   -14.313 1.00 0.00 ? 4   LEU A CG   6  
ATOM 11368 C CD1  . LEU A 1 4   ? 5.185   5.393   -15.049 1.00 0.00 ? 4   LEU A CD1  6  
ATOM 11369 C CD2  . LEU A 1 4   ? 4.347   7.315   -13.701 1.00 0.00 ? 4   LEU A CD2  6  
ATOM 11370 H H    . LEU A 1 4   ? 9.111   5.882   -13.569 1.00 0.00 ? 4   LEU A H    6  
ATOM 11371 H HA   . LEU A 1 4   ? 7.394   8.289   -13.609 1.00 0.00 ? 4   LEU A HA   6  
ATOM 11372 H HB2  . LEU A 1 4   ? 7.037   5.354   -13.405 1.00 0.00 ? 4   LEU A HB2  6  
ATOM 11373 H HB3  . LEU A 1 4   ? 6.037   6.226   -12.253 1.00 0.00 ? 4   LEU A HB3  6  
ATOM 11374 H HG   . LEU A 1 4   ? 6.057   7.355   -15.007 1.00 0.00 ? 4   LEU A HG   6  
ATOM 11375 H HD11 . LEU A 1 4   ? 6.065   4.899   -15.436 1.00 0.00 ? 4   LEU A HD11 6  
ATOM 11376 H HD12 . LEU A 1 4   ? 4.672   4.728   -14.370 1.00 0.00 ? 4   LEU A HD12 6  
ATOM 11377 H HD13 . LEU A 1 4   ? 4.527   5.640   -15.869 1.00 0.00 ? 4   LEU A HD13 6  
ATOM 11378 H HD21 . LEU A 1 4   ? 4.639   8.120   -13.044 1.00 0.00 ? 4   LEU A HD21 6  
ATOM 11379 H HD22 . LEU A 1 4   ? 3.716   7.707   -14.484 1.00 0.00 ? 4   LEU A HD22 6  
ATOM 11380 H HD23 . LEU A 1 4   ? 3.796   6.577   -13.137 1.00 0.00 ? 4   LEU A HD23 6  
ATOM 11381 N N    . THR A 1 5   ? 7.755   9.008   -11.290 1.00 0.00 ? 5   THR A N    6  
ATOM 11382 C CA   . THR A 1 5   ? 7.912   9.437   -9.879  1.00 0.00 ? 5   THR A CA   6  
ATOM 11383 C C    . THR A 1 5   ? 7.002   8.632   -8.953  1.00 0.00 ? 5   THR A C    6  
ATOM 11384 O O    . THR A 1 5   ? 5.971   8.133   -9.366  1.00 0.00 ? 5   THR A O    6  
ATOM 11385 C CB   . THR A 1 5   ? 7.529   10.915  -9.787  1.00 0.00 ? 5   THR A CB   6  
ATOM 11386 O OG1  . THR A 1 5   ? 6.348   11.040  -10.548 1.00 0.00 ? 5   THR A OG1  6  
ATOM 11387 C CG2  . THR A 1 5   ? 8.557   11.788  -10.522 1.00 0.00 ? 5   THR A CG2  6  
ATOM 11388 H H    . THR A 1 5   ? 7.591   9.670   -11.992 1.00 0.00 ? 5   THR A H    6  
ATOM 11389 H HA   . THR A 1 5   ? 8.948   9.287   -9.577  1.00 0.00 ? 5   THR A HA   6  
ATOM 11390 H HB   . THR A 1 5   ? 7.366   11.228  -8.760  1.00 0.00 ? 5   THR A HB   6  
ATOM 11391 H HG1  . THR A 1 5   ? 5.608   10.799  -9.985  1.00 0.00 ? 5   THR A HG1  6  
ATOM 11392 H HG21 . THR A 1 5   ? 9.541   11.353  -10.425 1.00 0.00 ? 5   THR A HG21 6  
ATOM 11393 H HG22 . THR A 1 5   ? 8.299   11.852  -11.569 1.00 0.00 ? 5   THR A HG22 6  
ATOM 11394 H HG23 . THR A 1 5   ? 8.564   12.780  -10.097 1.00 0.00 ? 5   THR A HG23 6  
ATOM 11395 N N    . GLU A 1 6   ? 7.402   8.524   -7.715  1.00 0.00 ? 6   GLU A N    6  
ATOM 11396 C CA   . GLU A 1 6   ? 6.584   7.759   -6.743  1.00 0.00 ? 6   GLU A CA   6  
ATOM 11397 C C    . GLU A 1 6   ? 5.250   8.454   -6.477  1.00 0.00 ? 6   GLU A C    6  
ATOM 11398 O O    . GLU A 1 6   ? 4.202   7.862   -6.621  1.00 0.00 ? 6   GLU A O    6  
ATOM 11399 C CB   . GLU A 1 6   ? 7.370   7.661   -5.426  1.00 0.00 ? 6   GLU A CB   6  
ATOM 11400 C CG   . GLU A 1 6   ? 7.803   6.209   -5.206  1.00 0.00 ? 6   GLU A CG   6  
ATOM 11401 C CD   . GLU A 1 6   ? 8.356   6.057   -3.789  1.00 0.00 ? 6   GLU A CD   6  
ATOM 11402 O OE1  . GLU A 1 6   ? 7.639   6.452   -2.884  1.00 0.00 ? 6   GLU A OE1  6  
ATOM 11403 O OE2  . GLU A 1 6   ? 9.461   5.552   -3.690  1.00 0.00 ? 6   GLU A OE2  6  
ATOM 11404 H H    . GLU A 1 6   ? 8.240   8.946   -7.429  1.00 0.00 ? 6   GLU A H    6  
ATOM 11405 H HA   . GLU A 1 6   ? 6.389   6.767   -7.150  1.00 0.00 ? 6   GLU A HA   6  
ATOM 11406 H HB2  . GLU A 1 6   ? 8.243   8.295   -5.478  1.00 0.00 ? 6   GLU A HB2  6  
ATOM 11407 H HB3  . GLU A 1 6   ? 6.747   7.983   -4.604  1.00 0.00 ? 6   GLU A HB3  6  
ATOM 11408 H HG2  . GLU A 1 6   ? 6.955   5.551   -5.334  1.00 0.00 ? 6   GLU A HG2  6  
ATOM 11409 H HG3  . GLU A 1 6   ? 8.570   5.945   -5.919  1.00 0.00 ? 6   GLU A HG3  6  
ATOM 11410 N N    . GLU A 1 7   ? 5.306   9.697   -6.089  1.00 0.00 ? 7   GLU A N    6  
ATOM 11411 C CA   . GLU A 1 7   ? 4.039   10.417  -5.818  1.00 0.00 ? 7   GLU A CA   6  
ATOM 11412 C C    . GLU A 1 7   ? 3.059   10.195  -6.947  1.00 0.00 ? 7   GLU A C    6  
ATOM 11413 O O    . GLU A 1 7   ? 1.889   9.968   -6.717  1.00 0.00 ? 7   GLU A O    6  
ATOM 11414 C CB   . GLU A 1 7   ? 4.339   11.920  -5.696  1.00 0.00 ? 7   GLU A CB   6  
ATOM 11415 C CG   . GLU A 1 7   ? 5.389   12.133  -4.606  1.00 0.00 ? 7   GLU A CG   6  
ATOM 11416 C CD   . GLU A 1 7   ? 4.711   12.080  -3.236  1.00 0.00 ? 7   GLU A CD   6  
ATOM 11417 O OE1  . GLU A 1 7   ? 3.529   11.779  -3.229  1.00 0.00 ? 7   GLU A OE1  6  
ATOM 11418 O OE2  . GLU A 1 7   ? 5.413   12.342  -2.274  1.00 0.00 ? 7   GLU A OE2  6  
ATOM 11419 H H    . GLU A 1 7   ? 6.170   10.147  -5.979  1.00 0.00 ? 7   GLU A H    6  
ATOM 11420 H HA   . GLU A 1 7   ? 3.603   10.029  -4.903  1.00 0.00 ? 7   GLU A HA   6  
ATOM 11421 H HB2  . GLU A 1 7   ? 4.712   12.294  -6.638  1.00 0.00 ? 7   GLU A HB2  6  
ATOM 11422 H HB3  . GLU A 1 7   ? 3.434   12.451  -5.438  1.00 0.00 ? 7   GLU A HB3  6  
ATOM 11423 H HG2  . GLU A 1 7   ? 6.140   11.360  -4.664  1.00 0.00 ? 7   GLU A HG2  6  
ATOM 11424 H HG3  . GLU A 1 7   ? 5.860   13.097  -4.734  1.00 0.00 ? 7   GLU A HG3  6  
ATOM 11425 N N    . GLN A 1 8   ? 3.544   10.266  -8.150  1.00 0.00 ? 8   GLN A N    6  
ATOM 11426 C CA   . GLN A 1 8   ? 2.640   10.056  -9.293  1.00 0.00 ? 8   GLN A CA   6  
ATOM 11427 C C    . GLN A 1 8   ? 1.993   8.690   -9.172  1.00 0.00 ? 8   GLN A C    6  
ATOM 11428 O O    . GLN A 1 8   ? 0.805   8.539   -9.377  1.00 0.00 ? 8   GLN A O    6  
ATOM 11429 C CB   . GLN A 1 8   ? 3.461   10.121  -10.586 1.00 0.00 ? 8   GLN A CB   6  
ATOM 11430 C CG   . GLN A 1 8   ? 3.850   11.576  -10.851 1.00 0.00 ? 8   GLN A CG   6  
ATOM 11431 C CD   . GLN A 1 8   ? 2.584   12.400  -11.099 1.00 0.00 ? 8   GLN A CD   6  
ATOM 11432 O OE1  . GLN A 1 8   ? 1.658   11.955  -11.747 1.00 0.00 ? 8   GLN A OE1  6  
ATOM 11433 N NE2  . GLN A 1 8   ? 2.504   13.602  -10.597 1.00 0.00 ? 8   GLN A NE2  6  
ATOM 11434 H H    . GLN A 1 8   ? 4.493   10.456  -8.293  1.00 0.00 ? 8   GLN A H    6  
ATOM 11435 H HA   . GLN A 1 8   ? 1.861   10.823  -9.279  1.00 0.00 ? 8   GLN A HA   6  
ATOM 11436 H HB2  . GLN A 1 8   ? 4.352   9.520   -10.481 1.00 0.00 ? 8   GLN A HB2  6  
ATOM 11437 H HB3  . GLN A 1 8   ? 2.874   9.746   -11.410 1.00 0.00 ? 8   GLN A HB3  6  
ATOM 11438 H HG2  . GLN A 1 8   ? 4.372   11.978  -9.993  1.00 0.00 ? 8   GLN A HG2  6  
ATOM 11439 H HG3  . GLN A 1 8   ? 4.489   11.634  -11.718 1.00 0.00 ? 8   GLN A HG3  6  
ATOM 11440 H HE21 . GLN A 1 8   ? 3.247   13.965  -10.072 1.00 0.00 ? 8   GLN A HE21 6  
ATOM 11441 H HE22 . GLN A 1 8   ? 1.700   14.143  -10.748 1.00 0.00 ? 8   GLN A HE22 6  
ATOM 11442 N N    . ILE A 1 9   ? 2.791   7.709   -8.838  1.00 0.00 ? 9   ILE A N    6  
ATOM 11443 C CA   . ILE A 1 9   ? 2.235   6.347   -8.696  1.00 0.00 ? 9   ILE A CA   6  
ATOM 11444 C C    . ILE A 1 9   ? 1.262   6.321   -7.529  1.00 0.00 ? 9   ILE A C    6  
ATOM 11445 O O    . ILE A 1 9   ? 0.388   5.480   -7.465  1.00 0.00 ? 9   ILE A O    6  
ATOM 11446 C CB   . ILE A 1 9   ? 3.379   5.369   -8.430  1.00 0.00 ? 9   ILE A CB   6  
ATOM 11447 C CG1  . ILE A 1 9   ? 4.037   4.981   -9.747  1.00 0.00 ? 9   ILE A CG1  6  
ATOM 11448 C CG2  . ILE A 1 9   ? 2.800   4.101   -7.782  1.00 0.00 ? 9   ILE A CG2  6  
ATOM 11449 C CD1  . ILE A 1 9   ? 5.537   4.797   -9.523  1.00 0.00 ? 9   ILE A CD1  6  
ATOM 11450 H H    . ILE A 1 9   ? 3.748   7.876   -8.687  1.00 0.00 ? 9   ILE A H    6  
ATOM 11451 H HA   . ILE A 1 9   ? 1.699   6.081   -9.607  1.00 0.00 ? 9   ILE A HA   6  
ATOM 11452 H HB   . ILE A 1 9   ? 4.116   5.837   -7.783  1.00 0.00 ? 9   ILE A HB   6  
ATOM 11453 H HG12 . ILE A 1 9   ? 3.609   4.057   -10.109 1.00 0.00 ? 9   ILE A HG12 6  
ATOM 11454 H HG13 . ILE A 1 9   ? 3.872   5.759   -10.478 1.00 0.00 ? 9   ILE A HG13 6  
ATOM 11455 H HG21 . ILE A 1 9   ? 1.917   3.788   -8.318  1.00 0.00 ? 9   ILE A HG21 6  
ATOM 11456 H HG22 . ILE A 1 9   ? 3.533   3.309   -7.812  1.00 0.00 ? 9   ILE A HG22 6  
ATOM 11457 H HG23 . ILE A 1 9   ? 2.539   4.304   -6.753  1.00 0.00 ? 9   ILE A HG23 6  
ATOM 11458 H HD11 . ILE A 1 9   ? 5.702   4.068   -8.745  1.00 0.00 ? 9   ILE A HD11 6  
ATOM 11459 H HD12 . ILE A 1 9   ? 6.002   4.455   -10.436 1.00 0.00 ? 9   ILE A HD12 6  
ATOM 11460 H HD13 . ILE A 1 9   ? 5.979   5.737   -9.229  1.00 0.00 ? 9   ILE A HD13 6  
ATOM 11461 N N    . ALA A 1 10  ? 1.432   7.255   -6.614  1.00 0.00 ? 10  ALA A N    6  
ATOM 11462 C CA   . ALA A 1 10  ? 0.522   7.295   -5.452  1.00 0.00 ? 10  ALA A CA   6  
ATOM 11463 C C    . ALA A 1 10  ? -0.810  7.891   -5.877  1.00 0.00 ? 10  ALA A C    6  
ATOM 11464 O O    . ALA A 1 10  ? -1.846  7.272   -5.729  1.00 0.00 ? 10  ALA A O    6  
ATOM 11465 C CB   . ALA A 1 10  ? 1.149   8.185   -4.370  1.00 0.00 ? 10  ALA A CB   6  
ATOM 11466 H H    . ALA A 1 10  ? 2.162   7.917   -6.697  1.00 0.00 ? 10  ALA A H    6  
ATOM 11467 H HA   . ALA A 1 10  ? 0.361   6.281   -5.088  1.00 0.00 ? 10  ALA A HA   6  
ATOM 11468 H HB1  . ALA A 1 10  ? 2.225   8.114   -4.418  1.00 0.00 ? 10  ALA A HB1  6  
ATOM 11469 H HB2  . ALA A 1 10  ? 0.853   9.212   -4.524  1.00 0.00 ? 10  ALA A HB2  6  
ATOM 11470 H HB3  . ALA A 1 10  ? 0.815   7.861   -3.395  1.00 0.00 ? 10  ALA A HB3  6  
ATOM 11471 N N    . GLU A 1 11  ? -0.762  9.089   -6.402  1.00 0.00 ? 11  GLU A N    6  
ATOM 11472 C CA   . GLU A 1 11  ? -2.019  9.730   -6.843  1.00 0.00 ? 11  GLU A CA   6  
ATOM 11473 C C    . GLU A 1 11  ? -2.691  8.841   -7.865  1.00 0.00 ? 11  GLU A C    6  
ATOM 11474 O O    . GLU A 1 11  ? -3.891  8.888   -8.054  1.00 0.00 ? 11  GLU A O    6  
ATOM 11475 C CB   . GLU A 1 11  ? -1.677  11.081  -7.495  1.00 0.00 ? 11  GLU A CB   6  
ATOM 11476 C CG   . GLU A 1 11  ? -1.370  12.105  -6.400  1.00 0.00 ? 11  GLU A CG   6  
ATOM 11477 C CD   . GLU A 1 11  ? -0.948  13.426  -7.046  1.00 0.00 ? 11  GLU A CD   6  
ATOM 11478 O OE1  . GLU A 1 11  ? -1.836  14.089  -7.555  1.00 0.00 ? 11  GLU A OE1  6  
ATOM 11479 O OE2  . GLU A 1 11  ? 0.241   13.698  -6.994  1.00 0.00 ? 11  GLU A OE2  6  
ATOM 11480 H H    . GLU A 1 11  ? 0.093   9.554   -6.503  1.00 0.00 ? 11  GLU A H    6  
ATOM 11481 H HA   . GLU A 1 11  ? -2.681  9.858   -5.987  1.00 0.00 ? 11  GLU A HA   6  
ATOM 11482 H HB2  . GLU A 1 11  ? -0.815  10.967  -8.137  1.00 0.00 ? 11  GLU A HB2  6  
ATOM 11483 H HB3  . GLU A 1 11  ? -2.515  11.421  -8.086  1.00 0.00 ? 11  GLU A HB3  6  
ATOM 11484 H HG2  . GLU A 1 11  ? -2.250  12.269  -5.795  1.00 0.00 ? 11  GLU A HG2  6  
ATOM 11485 H HG3  . GLU A 1 11  ? -0.569  11.742  -5.774  1.00 0.00 ? 11  GLU A HG3  6  
ATOM 11486 N N    . PHE A 1 12  ? -1.892  8.035   -8.509  1.00 0.00 ? 12  PHE A N    6  
ATOM 11487 C CA   . PHE A 1 12  ? -2.442  7.124   -9.524  1.00 0.00 ? 12  PHE A CA   6  
ATOM 11488 C C    . PHE A 1 12  ? -3.293  6.063   -8.854  1.00 0.00 ? 12  PHE A C    6  
ATOM 11489 O O    . PHE A 1 12  ? -4.475  5.953   -9.114  1.00 0.00 ? 12  PHE A O    6  
ATOM 11490 C CB   . PHE A 1 12  ? -1.273  6.426   -10.232 1.00 0.00 ? 12  PHE A CB   6  
ATOM 11491 C CG   . PHE A 1 12  ? -0.739  7.302   -11.368 1.00 0.00 ? 12  PHE A CG   6  
ATOM 11492 C CD1  . PHE A 1 12  ? -0.938  8.675   -11.369 1.00 0.00 ? 12  PHE A CD1  6  
ATOM 11493 C CD2  . PHE A 1 12  ? -0.042  6.726   -12.415 1.00 0.00 ? 12  PHE A CD2  6  
ATOM 11494 C CE1  . PHE A 1 12  ? -0.449  9.447   -12.402 1.00 0.00 ? 12  PHE A CE1  6  
ATOM 11495 C CE2  . PHE A 1 12  ? 0.443   7.502   -13.441 1.00 0.00 ? 12  PHE A CE2  6  
ATOM 11496 C CZ   . PHE A 1 12  ? 0.240   8.858   -13.437 1.00 0.00 ? 12  PHE A CZ   6  
ATOM 11497 H H    . PHE A 1 12  ? -0.931  8.035   -8.316  1.00 0.00 ? 12  PHE A H    6  
ATOM 11498 H HA   . PHE A 1 12  ? -3.054  7.691   -10.226 1.00 0.00 ? 12  PHE A HA   6  
ATOM 11499 H HB2  . PHE A 1 12  ? -0.480  6.244   -9.525  1.00 0.00 ? 12  PHE A HB2  6  
ATOM 11500 H HB3  . PHE A 1 12  ? -1.606  5.484   -10.640 1.00 0.00 ? 12  PHE A HB3  6  
ATOM 11501 H HD1  . PHE A 1 12  ? -1.471  9.143   -10.556 1.00 0.00 ? 12  PHE A HD1  6  
ATOM 11502 H HD2  . PHE A 1 12  ? 0.127   5.659   -12.424 1.00 0.00 ? 12  PHE A HD2  6  
ATOM 11503 H HE1  . PHE A 1 12  ? -0.607  10.516  -12.399 1.00 0.00 ? 12  PHE A HE1  6  
ATOM 11504 H HE2  . PHE A 1 12  ? 0.993   7.044   -14.247 1.00 0.00 ? 12  PHE A HE2  6  
ATOM 11505 H HZ   . PHE A 1 12  ? 0.610   9.459   -14.249 1.00 0.00 ? 12  PHE A HZ   6  
ATOM 11506 N N    . LYS A 1 13  ? -2.674  5.291   -7.994  1.00 0.00 ? 13  LYS A N    6  
ATOM 11507 C CA   . LYS A 1 13  ? -3.435  4.234   -7.300  1.00 0.00 ? 13  LYS A CA   6  
ATOM 11508 C C    . LYS A 1 13  ? -4.707  4.815   -6.729  1.00 0.00 ? 13  LYS A C    6  
ATOM 11509 O O    . LYS A 1 13  ? -5.717  4.150   -6.656  1.00 0.00 ? 13  LYS A O    6  
ATOM 11510 C CB   . LYS A 1 13  ? -2.583  3.677   -6.157  1.00 0.00 ? 13  LYS A CB   6  
ATOM 11511 C CG   . LYS A 1 13  ? -3.389  2.618   -5.405  1.00 0.00 ? 13  LYS A CG   6  
ATOM 11512 C CD   . LYS A 1 13  ? -2.492  1.410   -5.133  1.00 0.00 ? 13  LYS A CD   6  
ATOM 11513 C CE   . LYS A 1 13  ? -1.365  1.828   -4.190  1.00 0.00 ? 13  LYS A CE   6  
ATOM 11514 N NZ   . LYS A 1 13  ? -1.883  2.000   -2.805  1.00 0.00 ? 13  LYS A NZ   6  
ATOM 11515 H H    . LYS A 1 13  ? -1.717  5.417   -7.812  1.00 0.00 ? 13  LYS A H    6  
ATOM 11516 H HA   . LYS A 1 13  ? -3.692  3.452   -8.013  1.00 0.00 ? 13  LYS A HA   6  
ATOM 11517 H HB2  . LYS A 1 13  ? -1.684  3.232   -6.557  1.00 0.00 ? 13  LYS A HB2  6  
ATOM 11518 H HB3  . LYS A 1 13  ? -2.315  4.475   -5.483  1.00 0.00 ? 13  LYS A HB3  6  
ATOM 11519 H HG2  . LYS A 1 13  ? -3.742  3.027   -4.469  1.00 0.00 ? 13  LYS A HG2  6  
ATOM 11520 H HG3  . LYS A 1 13  ? -4.236  2.315   -6.002  1.00 0.00 ? 13  LYS A HG3  6  
ATOM 11521 H HD2  . LYS A 1 13  ? -3.074  0.621   -4.678  1.00 0.00 ? 13  LYS A HD2  6  
ATOM 11522 H HD3  . LYS A 1 13  ? -2.075  1.051   -6.062  1.00 0.00 ? 13  LYS A HD3  6  
ATOM 11523 H HE2  . LYS A 1 13  ? -0.595  1.071   -4.189  1.00 0.00 ? 13  LYS A HE2  6  
ATOM 11524 H HE3  . LYS A 1 13  ? -0.939  2.762   -4.527  1.00 0.00 ? 13  LYS A HE3  6  
ATOM 11525 H HZ1  . LYS A 1 13  ? -2.427  1.157   -2.532  1.00 0.00 ? 13  LYS A HZ1  6  
ATOM 11526 H HZ2  . LYS A 1 13  ? -1.086  2.126   -2.149  1.00 0.00 ? 13  LYS A HZ2  6  
ATOM 11527 H HZ3  . LYS A 1 13  ? -2.499  2.837   -2.766  1.00 0.00 ? 13  LYS A HZ3  6  
ATOM 11528 N N    . GLU A 1 14  ? -4.635  6.052   -6.323  1.00 0.00 ? 14  GLU A N    6  
ATOM 11529 C CA   . GLU A 1 14  ? -5.835  6.688   -5.757  1.00 0.00 ? 14  GLU A CA   6  
ATOM 11530 C C    . GLU A 1 14  ? -6.952  6.620   -6.771  1.00 0.00 ? 14  GLU A C    6  
ATOM 11531 O O    . GLU A 1 14  ? -7.994  6.056   -6.516  1.00 0.00 ? 14  GLU A O    6  
ATOM 11532 C CB   . GLU A 1 14  ? -5.514  8.160   -5.457  1.00 0.00 ? 14  GLU A CB   6  
ATOM 11533 C CG   . GLU A 1 14  ? -6.435  8.658   -4.343  1.00 0.00 ? 14  GLU A CG   6  
ATOM 11534 C CD   . GLU A 1 14  ? -6.497  10.186  -4.383  1.00 0.00 ? 14  GLU A CD   6  
ATOM 11535 O OE1  . GLU A 1 14  ? -7.238  10.676  -5.218  1.00 0.00 ? 14  GLU A OE1  6  
ATOM 11536 O OE2  . GLU A 1 14  ? -5.799  10.777  -3.574  1.00 0.00 ? 14  GLU A OE2  6  
ATOM 11537 H H    . GLU A 1 14  ? -3.794  6.550   -6.393  1.00 0.00 ? 14  GLU A H    6  
ATOM 11538 H HA   . GLU A 1 14  ? -6.133  6.156   -4.858  1.00 0.00 ? 14  GLU A HA   6  
ATOM 11539 H HB2  . GLU A 1 14  ? -4.484  8.250   -5.144  1.00 0.00 ? 14  GLU A HB2  6  
ATOM 11540 H HB3  . GLU A 1 14  ? -5.666  8.752   -6.347  1.00 0.00 ? 14  GLU A HB3  6  
ATOM 11541 H HG2  . GLU A 1 14  ? -7.428  8.257   -4.484  1.00 0.00 ? 14  GLU A HG2  6  
ATOM 11542 H HG3  . GLU A 1 14  ? -6.054  8.341   -3.384  1.00 0.00 ? 14  GLU A HG3  6  
ATOM 11543 N N    . ALA A 1 15  ? -6.710  7.193   -7.915  1.00 0.00 ? 15  ALA A N    6  
ATOM 11544 C CA   . ALA A 1 15  ? -7.746  7.175   -8.971  1.00 0.00 ? 15  ALA A CA   6  
ATOM 11545 C C    . ALA A 1 15  ? -8.123  5.742   -9.282  1.00 0.00 ? 15  ALA A C    6  
ATOM 11546 O O    . ALA A 1 15  ? -9.272  5.360   -9.207  1.00 0.00 ? 15  ALA A O    6  
ATOM 11547 C CB   . ALA A 1 15  ? -7.153  7.813   -10.242 1.00 0.00 ? 15  ALA A CB   6  
ATOM 11548 H H    . ALA A 1 15  ? -5.847  7.631   -8.075  1.00 0.00 ? 15  ALA A H    6  
ATOM 11549 H HA   . ALA A 1 15  ? -8.624  7.713   -8.627  1.00 0.00 ? 15  ALA A HA   6  
ATOM 11550 H HB1  . ALA A 1 15  ? -6.556  8.671   -9.976  1.00 0.00 ? 15  ALA A HB1  6  
ATOM 11551 H HB2  . ALA A 1 15  ? -6.526  7.092   -10.754 1.00 0.00 ? 15  ALA A HB2  6  
ATOM 11552 H HB3  . ALA A 1 15  ? -7.948  8.122   -10.902 1.00 0.00 ? 15  ALA A HB3  6  
ATOM 11553 N N    . PHE A 1 16  ? -7.134  4.976   -9.617  1.00 0.00 ? 16  PHE A N    6  
ATOM 11554 C CA   . PHE A 1 16  ? -7.377  3.557   -9.943  1.00 0.00 ? 16  PHE A CA   6  
ATOM 11555 C C    . PHE A 1 16  ? -8.127  2.856   -8.811  1.00 0.00 ? 16  PHE A C    6  
ATOM 11556 O O    . PHE A 1 16  ? -8.847  1.905   -9.038  1.00 0.00 ? 16  PHE A O    6  
ATOM 11557 C CB   . PHE A 1 16  ? -6.002  2.891   -10.123 1.00 0.00 ? 16  PHE A CB   6  
ATOM 11558 C CG   . PHE A 1 16  ? -6.167  1.485   -10.687 1.00 0.00 ? 16  PHE A CG   6  
ATOM 11559 C CD1  . PHE A 1 16  ? -6.336  0.409   -9.838  1.00 0.00 ? 16  PHE A CD1  6  
ATOM 11560 C CD2  . PHE A 1 16  ? -6.117  1.264   -12.053 1.00 0.00 ? 16  PHE A CD2  6  
ATOM 11561 C CE1  . PHE A 1 16  ? -6.451  -0.867  -10.343 1.00 0.00 ? 16  PHE A CE1  6  
ATOM 11562 C CE2  . PHE A 1 16  ? -6.232  -0.012  -12.557 1.00 0.00 ? 16  PHE A CE2  6  
ATOM 11563 C CZ   . PHE A 1 16  ? -6.399  -1.078  -11.706 1.00 0.00 ? 16  PHE A CZ   6  
ATOM 11564 H H    . PHE A 1 16  ? -6.225  5.340   -9.655  1.00 0.00 ? 16  PHE A H    6  
ATOM 11565 H HA   . PHE A 1 16  ? -7.967  3.495   -10.859 1.00 0.00 ? 16  PHE A HA   6  
ATOM 11566 H HB2  . PHE A 1 16  ? -5.400  3.477   -10.801 1.00 0.00 ? 16  PHE A HB2  6  
ATOM 11567 H HB3  . PHE A 1 16  ? -5.501  2.831   -9.168  1.00 0.00 ? 16  PHE A HB3  6  
ATOM 11568 H HD1  . PHE A 1 16  ? -6.379  0.568   -8.771  1.00 0.00 ? 16  PHE A HD1  6  
ATOM 11569 H HD2  . PHE A 1 16  ? -5.987  2.098   -12.727 1.00 0.00 ? 16  PHE A HD2  6  
ATOM 11570 H HE1  . PHE A 1 16  ? -6.573  -1.700  -9.669  1.00 0.00 ? 16  PHE A HE1  6  
ATOM 11571 H HE2  . PHE A 1 16  ? -6.182  -0.176  -13.621 1.00 0.00 ? 16  PHE A HE2  6  
ATOM 11572 H HZ   . PHE A 1 16  ? -6.490  -2.079  -12.104 1.00 0.00 ? 16  PHE A HZ   6  
ATOM 11573 N N    . SER A 1 17  ? -7.945  3.344   -7.612  1.00 0.00 ? 17  SER A N    6  
ATOM 11574 C CA   . SER A 1 17  ? -8.638  2.719   -6.460  1.00 0.00 ? 17  SER A CA   6  
ATOM 11575 C C    . SER A 1 17  ? -9.992  3.374   -6.223  1.00 0.00 ? 17  SER A C    6  
ATOM 11576 O O    . SER A 1 17  ? -10.880 2.781   -5.643  1.00 0.00 ? 17  SER A O    6  
ATOM 11577 C CB   . SER A 1 17  ? -7.765  2.909   -5.208  1.00 0.00 ? 17  SER A CB   6  
ATOM 11578 O OG   . SER A 1 17  ? -8.598  2.503   -4.132  1.00 0.00 ? 17  SER A OG   6  
ATOM 11579 H H    . SER A 1 17  ? -7.362  4.116   -7.476  1.00 0.00 ? 17  SER A H    6  
ATOM 11580 H HA   . SER A 1 17  ? -8.787  1.662   -6.669  1.00 0.00 ? 17  SER A HA   6  
ATOM 11581 H HB2  . SER A 1 17  ? -6.887  2.282   -5.257  1.00 0.00 ? 17  SER A HB2  6  
ATOM 11582 H HB3  . SER A 1 17  ? -7.484  3.945   -5.093  1.00 0.00 ? 17  SER A HB3  6  
ATOM 11583 H HG   . SER A 1 17  ? -9.502  2.472   -4.451  1.00 0.00 ? 17  SER A HG   6  
ATOM 11584 N N    . LEU A 1 18  ? -10.130 4.588   -6.682  1.00 0.00 ? 18  LEU A N    6  
ATOM 1158