data_1DST
# 
_entry.id   1DST 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DST         
WWPDB D_1000172929 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DST 
_pdbx_database_status.recvd_initial_deposition_date   1995-09-13 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Narayana, S.V.L.' 1 
'Volanakis, J.E.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of a complement factor D mutant expressing enhanced catalytic activity.' J.Biol.Chem. 270 24399 24405 
1995 JBCHA3 US 0021-9258 0071 ? 7592653 10.1074/jbc.270.41.24399 
1       'Catalytic Role of a Surface Loop of the Complement Serine Protease Factor D'               J.Immunol.   154 6073  ?     
1995 JOIMA3 US 0022-1767 0952 ? ?       ?                        
2       'Mutational Analysis of the Substrate Binding Site of Human Complement Factor D'            Biochemistry 33  14393 ?     
1994 BICHAW US 0006-2960 0033 ? ?       ?                        
3       'Structure of Human Factor D. A Complement System Protein at 2.0 A Resolution'              J.Mol.Biol.  235 695   ?     
1994 JMOBAK UK 0022-2836 0070 ? ?       ?                        
4       'Crystallization and Preliminary X-Ray Investigation of Factor D of Human Complement'       J.Mol.Biol.  219 1     ?     
1991 JMOBAK UK 0022-2836 0070 ? ?       ?                        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kim, S.'          1  
primary 'Narayana, S.V.'   2  
primary 'Volanakis, J.E.'  3  
1       'Kim, S.'          4  
1       'Narayana, S.V.'   5  
1       'Volanakis, J.E.'  6  
2       'Kim, S.'          7  
2       'Narayana, S.V.'   8  
2       'Volanakis, J.E.'  9  
3       'Narayana, S.V.'   10 
3       'Carson, M.'       11 
3       'El-Kabbani, O.'   12 
3       'Kilpatrick, J.M.' 13 
3       'Moore, D.'        14 
3       'Chen, X.'         15 
3       'Bugg, C.E.'       16 
3       'Volanakis, J.E.'  17 
3       'Delucas, L.J.'    18 
4       'Narayana, S.V.'   19 
4       'Kilpatrick, J.M.' 20 
4       'El-Kabbani, O.'   21 
4       'Babu, Y.S.'       22 
4       'Bugg, C.E.'       23 
4       'Volanakis, J.E.'  24 
4       'Delucas, L.J.'    25 
# 
_cell.entry_id           1DST 
_cell.length_a           45.380 
_cell.length_b           45.380 
_cell.length_c           175.210 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DST 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'FACTOR D' 24600.008 1  3.4.21.46 'S94Y, T214S, S215W' ? ? 
2 water   nat water      18.015    61 ?         ?                    ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
YQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVSWGSRVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
YQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVSWGSRVCGNRKKPGIYTRVASYAAWIDSVLA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   LEU n 
1 3   GLY n 
1 4   GLY n 
1 5   ARG n 
1 6   GLU n 
1 7   ALA n 
1 8   GLU n 
1 9   ALA n 
1 10  HIS n 
1 11  ALA n 
1 12  ARG n 
1 13  PRO n 
1 14  TYR n 
1 15  MET n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  GLN n 
1 20  LEU n 
1 21  ASN n 
1 22  GLY n 
1 23  ALA n 
1 24  HIS n 
1 25  LEU n 
1 26  CYS n 
1 27  GLY n 
1 28  GLY n 
1 29  VAL n 
1 30  LEU n 
1 31  VAL n 
1 32  ALA n 
1 33  GLU n 
1 34  GLN n 
1 35  TRP n 
1 36  VAL n 
1 37  LEU n 
1 38  SER n 
1 39  ALA n 
1 40  ALA n 
1 41  HIS n 
1 42  CYS n 
1 43  LEU n 
1 44  GLU n 
1 45  ASP n 
1 46  ALA n 
1 47  ALA n 
1 48  ASP n 
1 49  GLY n 
1 50  LYS n 
1 51  VAL n 
1 52  GLN n 
1 53  VAL n 
1 54  LEU n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  HIS n 
1 59  SER n 
1 60  LEU n 
1 61  SER n 
1 62  GLN n 
1 63  PRO n 
1 64  GLU n 
1 65  PRO n 
1 66  SER n 
1 67  LYS n 
1 68  ARG n 
1 69  LEU n 
1 70  TYR n 
1 71  ASP n 
1 72  VAL n 
1 73  LEU n 
1 74  ARG n 
1 75  ALA n 
1 76  VAL n 
1 77  PRO n 
1 78  HIS n 
1 79  PRO n 
1 80  ASP n 
1 81  TYR n 
1 82  GLN n 
1 83  PRO n 
1 84  ASP n 
1 85  THR n 
1 86  ILE n 
1 87  ASP n 
1 88  HIS n 
1 89  ASP n 
1 90  LEU n 
1 91  LEU n 
1 92  LEU n 
1 93  LEU n 
1 94  GLN n 
1 95  LEU n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ALA n 
1 100 THR n 
1 101 LEU n 
1 102 GLY n 
1 103 PRO n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 PRO n 
1 108 LEU n 
1 109 PRO n 
1 110 TRP n 
1 111 GLN n 
1 112 ARG n 
1 113 VAL n 
1 114 ASP n 
1 115 ARG n 
1 116 ASP n 
1 117 VAL n 
1 118 ALA n 
1 119 PRO n 
1 120 GLY n 
1 121 THR n 
1 122 LEU n 
1 123 CYS n 
1 124 ASP n 
1 125 VAL n 
1 126 ALA n 
1 127 GLY n 
1 128 TRP n 
1 129 GLY n 
1 130 ILE n 
1 131 VAL n 
1 132 ASN n 
1 133 HIS n 
1 134 ALA n 
1 135 GLY n 
1 136 ARG n 
1 137 ARG n 
1 138 PRO n 
1 139 ASP n 
1 140 SER n 
1 141 LEU n 
1 142 GLN n 
1 143 HIS n 
1 144 VAL n 
1 145 LEU n 
1 146 LEU n 
1 147 PRO n 
1 148 VAL n 
1 149 LEU n 
1 150 ASP n 
1 151 ARG n 
1 152 ALA n 
1 153 THR n 
1 154 CYS n 
1 155 ASN n 
1 156 ARG n 
1 157 ARG n 
1 158 THR n 
1 159 HIS n 
1 160 HIS n 
1 161 ASP n 
1 162 GLY n 
1 163 ALA n 
1 164 ILE n 
1 165 THR n 
1 166 GLU n 
1 167 ARG n 
1 168 LEU n 
1 169 MET n 
1 170 CYS n 
1 171 ALA n 
1 172 GLU n 
1 173 SER n 
1 174 ASN n 
1 175 ARG n 
1 176 ARG n 
1 177 ASP n 
1 178 SER n 
1 179 CYS n 
1 180 LYS n 
1 181 GLY n 
1 182 ASP n 
1 183 SER n 
1 184 GLY n 
1 185 GLY n 
1 186 PRO n 
1 187 LEU n 
1 188 VAL n 
1 189 CYS n 
1 190 GLY n 
1 191 GLY n 
1 192 VAL n 
1 193 LEU n 
1 194 GLU n 
1 195 GLY n 
1 196 VAL n 
1 197 VAL n 
1 198 SER n 
1 199 TRP n 
1 200 GLY n 
1 201 SER n 
1 202 ARG n 
1 203 VAL n 
1 204 CYS n 
1 205 GLY n 
1 206 ASN n 
1 207 ARG n 
1 208 LYS n 
1 209 LYS n 
1 210 PRO n 
1 211 GLY n 
1 212 ILE n 
1 213 TYR n 
1 214 THR n 
1 215 ARG n 
1 216 VAL n 
1 217 ALA n 
1 218 SER n 
1 219 TYR n 
1 220 ALA n 
1 221 ALA n 
1 222 TRP n 
1 223 ILE n 
1 224 ASP n 
1 225 SER n 
1 226 VAL n 
1 227 LEU n 
1 228 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                OVARY 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Chinese hamster' 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     Cricetulus 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CFAD_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00746 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MHSSVYFAVLVLLGAAACAARPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLL
GAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAG
RRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DST 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 228 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00746 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  253 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       243 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1DST TYR A 81  ? UNP P00746 SER 106 ENGINEERED 94  1 
1 1DST SER A 198 ? UNP P00746 THR 223 ENGINEERED 214 2 
1 1DST TRP A 199 ? UNP P00746 SER 224 ENGINEERED 215 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DST 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   42. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.8' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DST 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   14652 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94. 
_reflns.pdbx_Rmerge_I_obs            0.076 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1DST 
_refine.ls_number_reflns_obs                     13311 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.5 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.5 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.213 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THERE IS NO DENSITY FOR THE LOOP 171 TO 175, HENCE THEIR
PSI, PHI VALUES ARE OUT OF THE ALLOWED REGIONS IN
THE RAMACHANDRAN PLOT.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1DST 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1784 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             57 
_refine_hist.number_atoms_total               1841 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        7.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.020 0.025 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.035 0.040 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.056 0.065 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.01  1.50  ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.54  2.00  ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         1.65  2.00  ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        2.10  2.50  ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       2.5   3.5   ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.034 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.200 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.191 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.133 0.400 ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        2.4   ?     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     21.3  15.0  ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    16.5  20.0  ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1DST 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.198 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1DST 
_struct.title                     'MUTANT OF FACTOR D WITH ENHANCED CATALYTIC ACTIVITY' 
_struct.pdbx_descriptor           'FACTOR D' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DST 
_struct_keywords.pdbx_keywords   'HYDROLASE (SERINE PROTEASE)' 
_struct_keywords.text            'COMPLEMENT ACTIVATING ENZYME, HYDROLASE, SERINE PROTEASE, FACTOR D, HYDROLASE (SERINE PROTEASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 40  ? ASP A 45  ? ALA A 56  ASP A 61  5 ? 6  
HELX_P HELX_P2 2 ARG A 151 ? THR A 158 B ARG A 165 THR A 170 1 ? 8  
HELX_P HELX_P3 3 VAL A 216 ? VAL A 226 ? VAL A 231 VAL A 241 5 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26  SG ? ? ? 1_555 A CYS 42  SG ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf2 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 189 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf3 disulf ? ? A CYS 154 SG ? ? ? 1_555 A CYS 170 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf4 disulf ? ? A CYS 179 SG ? ? ? 1_555 A CYS 204 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 1.950 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 2 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 68  ? ASP A 71  ? ARG A 81  ASP A 84  
A 2 VAL A 51  ? LEU A 55  ? VAL A 64  LEU A 68  
A 3 MET A 15  ? LEU A 20  ? MET A 30  LEU A 35  
A 4 ALA A 23  ? ALA A 32  ? ALA A 39  ALA A 48  
A 5 TRP A 35  ? SER A 38  ? TRP A 51  SER A 54  
A 6 LEU A 91  ? LEU A 95  ? LEU A 104 LEU A 108 
A 7 VAL A 72  ? PRO A 77  ? VAL A 85  PRO A 90  
B 1 LEU A 122 ? GLY A 127 ? LEU A 135 GLY A 140 
B 2 GLN A 142 ? PRO A 147 ? GLN A 156 PRO A 161 
C 1 LEU A 168 ? ALA A 171 ? LEU A 180 ALA A 183 
C 2 GLY A 211 ? ARG A 215 ? GLY A 226 ARG A 230 
C 3 VAL A 192 ? VAL A 197 ? VAL A 208 VAL A 213 
C 4 PRO A 186 ? CYS A 189 ? PRO A 198 CYS A 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 68  ? O ARG A 81  N LEU A 55  ? N LEU A 68  
A 2 3 O GLN A 52  ? O GLN A 65  N GLN A 19  ? N GLN A 34  
A 3 4 O ALA A 16  ? O ALA A 31  N GLY A 28  ? N GLY A 44  
A 4 5 O VAL A 29  ? O VAL A 45  N LEU A 37  ? N LEU A 53  
A 5 6 O VAL A 36  ? O VAL A 52  N LEU A 93  ? N LEU A 106 
A 6 7 O LEU A 92  ? O LEU A 105 N VAL A 76  ? N VAL A 89  
B 1 2 O CYS A 123 ? O CYS A 136 N LEU A 146 ? N LEU A 160 
C 1 2 O MET A 169 ? O MET A 181 N TYR A 213 ? N TYR A 228 
C 2 3 O THR A 214 ? O THR A 229 N VAL A 196 ? N VAL A 212 
C 3 4 O VAL A 192 ? O VAL A 208 N CYS A 189 ? N CYS A 201 
# 
_database_PDB_matrix.entry_id          1DST 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DST 
_atom_sites.fract_transf_matrix[1][1]   0.022036 
_atom_sites.fract_transf_matrix[1][2]   0.012723 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025445 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005707 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ILE A 1 1   ? -13.839 22.950 72.603 1.00 6.35  ? 16  ILE A N   1 
ATOM   2    C CA  . ILE A 1 1   ? -14.477 21.910 73.468 1.00 8.81  ? 16  ILE A CA  1 
ATOM   3    C C   . ILE A 1 1   ? -16.004 22.008 73.339 1.00 10.36 ? 16  ILE A C   1 
ATOM   4    O O   . ILE A 1 1   ? -16.604 23.035 73.684 1.00 7.96  ? 16  ILE A O   1 
ATOM   5    C CB  . ILE A 1 1   ? -14.087 22.074 74.992 1.00 9.36  ? 16  ILE A CB  1 
ATOM   6    C CG1 . ILE A 1 1   ? -12.583 21.797 75.236 1.00 8.07  ? 16  ILE A CG1 1 
ATOM   7    C CG2 . ILE A 1 1   ? -14.974 21.154 75.862 1.00 6.79  ? 16  ILE A CG2 1 
ATOM   8    C CD1 . ILE A 1 1   ? -12.129 20.311 75.092 1.00 9.27  ? 16  ILE A CD1 1 
ATOM   9    N N   . LEU A 1 2   ? -16.623 20.955 72.816 1.00 11.38 ? 17  LEU A N   1 
ATOM   10   C CA  . LEU A 1 2   ? -18.074 20.924 72.660 1.00 13.28 ? 17  LEU A CA  1 
ATOM   11   C C   . LEU A 1 2   ? -18.738 20.467 73.968 1.00 12.24 ? 17  LEU A C   1 
ATOM   12   O O   . LEU A 1 2   ? -18.291 19.488 74.590 1.00 10.58 ? 17  LEU A O   1 
ATOM   13   C CB  . LEU A 1 2   ? -18.461 19.953 71.548 1.00 12.74 ? 17  LEU A CB  1 
ATOM   14   C CG  . LEU A 1 2   ? -19.967 19.771 71.330 1.00 17.51 ? 17  LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 2   ? -20.475 20.943 70.474 1.00 15.28 ? 17  LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 2   ? -20.235 18.402 70.639 1.00 16.17 ? 17  LEU A CD2 1 
ATOM   17   N N   . GLY A 1 3   ? -19.763 21.205 74.391 1.00 12.87 ? 18  GLY A N   1 
ATOM   18   C CA  . GLY A 1 3   ? -20.519 20.863 75.594 1.00 13.05 ? 18  GLY A CA  1 
ATOM   19   C C   . GLY A 1 3   ? -19.903 21.037 76.981 1.00 14.47 ? 18  GLY A C   1 
ATOM   20   O O   . GLY A 1 3   ? -20.444 20.529 77.952 1.00 14.45 ? 18  GLY A O   1 
ATOM   21   N N   . GLY A 1 4   ? -18.808 21.780 77.084 1.00 12.50 ? 19  GLY A N   1 
ATOM   22   C CA  . GLY A 1 4   ? -18.165 21.986 78.364 1.00 14.52 ? 19  GLY A CA  1 
ATOM   23   C C   . GLY A 1 4   ? -18.584 23.274 79.034 1.00 16.88 ? 19  GLY A C   1 
ATOM   24   O O   . GLY A 1 4   ? -19.666 23.804 78.785 1.00 17.23 ? 19  GLY A O   1 
ATOM   25   N N   . ARG A 1 5   ? -17.717 23.780 79.895 1.00 17.65 ? 20  ARG A N   1 
ATOM   26   C CA  . ARG A 1 5   ? -17.980 25.013 80.618 1.00 19.70 ? 20  ARG A CA  1 
ATOM   27   C C   . ARG A 1 5   ? -16.629 25.737 80.756 1.00 14.77 ? 20  ARG A C   1 
ATOM   28   O O   . ARG A 1 5   ? -15.584 25.181 80.395 1.00 14.75 ? 20  ARG A O   1 
ATOM   29   C CB  . ARG A 1 5   ? -18.588 24.692 81.997 1.00 25.36 ? 20  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 5   ? -17.707 23.804 82.885 1.00 34.66 ? 20  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 5   ? -18.503 22.972 83.890 1.00 38.37 ? 20  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 5   ? -17.623 22.446 84.944 1.00 41.28 ? 20  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 5   ? -17.947 21.489 85.821 1.00 44.81 ? 20  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 5   ? -19.013 21.619 86.601 1.00 45.99 ? 20  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 5   ? -17.200 20.386 85.907 1.00 41.25 ? 20  ARG A NH2 1 
ATOM   36   N N   . GLU A 1 6   ? -16.662 26.984 81.217 1.00 15.17 ? 21  GLU A N   1 
ATOM   37   C CA  . GLU A 1 6   ? -15.442 27.748 81.428 1.00 16.40 ? 21  GLU A CA  1 
ATOM   38   C C   . GLU A 1 6   ? -14.627 27.176 82.625 1.00 15.54 ? 21  GLU A C   1 
ATOM   39   O O   . GLU A 1 6   ? -15.167 26.935 83.709 1.00 15.80 ? 21  GLU A O   1 
ATOM   40   C CB  . GLU A 1 6   ? -15.763 29.232 81.684 1.00 19.36 ? 21  GLU A CB  1 
ATOM   41   C CG  . GLU A 1 6   ? -14.535 30.133 81.559 1.00 22.76 ? 21  GLU A CG  1 
ATOM   42   C CD  . GLU A 1 6   ? -14.803 31.600 81.870 1.00 28.11 ? 21  GLU A CD  1 
ATOM   43   O OE1 . GLU A 1 6   ? -15.873 32.127 81.465 1.00 31.23 ? 21  GLU A OE1 1 
ATOM   44   O OE2 . GLU A 1 6   ? -13.920 32.220 82.518 1.00 29.28 ? 21  GLU A OE2 1 
ATOM   45   N N   . ALA A 1 7   ? -13.335 26.941 82.406 1.00 14.57 ? 22  ALA A N   1 
ATOM   46   C CA  . ALA A 1 7   ? -12.495 26.432 83.480 1.00 15.68 ? 22  ALA A CA  1 
ATOM   47   C C   . ALA A 1 7   ? -12.255 27.557 84.482 1.00 18.41 ? 22  ALA A C   1 
ATOM   48   O O   . ALA A 1 7   ? -12.492 28.730 84.181 1.00 20.02 ? 22  ALA A O   1 
ATOM   49   C CB  . ALA A 1 7   ? -11.180 25.908 82.945 1.00 14.96 ? 22  ALA A CB  1 
ATOM   50   N N   . GLU A 1 8   ? -11.828 27.186 85.683 1.00 18.60 ? 23  GLU A N   1 
ATOM   51   C CA  . GLU A 1 8   ? -11.530 28.163 86.729 1.00 20.75 ? 23  GLU A CA  1 
ATOM   52   C C   . GLU A 1 8   ? -10.131 28.676 86.391 1.00 19.08 ? 23  GLU A C   1 
ATOM   53   O O   . GLU A 1 8   ? -9.214  27.879 86.140 1.00 17.80 ? 23  GLU A O   1 
ATOM   54   C CB  . GLU A 1 8   ? -11.532 27.518 88.120 1.00 24.87 ? 23  GLU A CB  1 
ATOM   55   C CG  . GLU A 1 8   ? -12.811 26.775 88.486 1.00 33.20 ? 23  GLU A CG  1 
ATOM   56   C CD  . GLU A 1 8   ? -12.996 25.464 87.727 1.00 37.70 ? 23  GLU A CD  1 
ATOM   57   O OE1 . GLU A 1 8   ? -11.993 24.888 87.267 1.00 41.18 ? 23  GLU A OE1 1 
ATOM   58   O OE2 . GLU A 1 8   ? -14.149 25.007 87.587 1.00 36.54 ? 23  GLU A OE2 1 
ATOM   59   N N   . ALA A 1 9   ? -9.982  30.000 86.383 1.00 21.79 ? 24  ALA A N   1 
ATOM   60   C CA  . ALA A 1 9   ? -8.722  30.649 86.042 1.00 20.94 ? 24  ALA A CA  1 
ATOM   61   C C   . ALA A 1 9   ? -7.471  30.086 86.707 1.00 23.44 ? 24  ALA A C   1 
ATOM   62   O O   . ALA A 1 9   ? -7.327  30.118 87.916 1.00 27.89 ? 24  ALA A O   1 
ATOM   63   C CB  . ALA A 1 9   ? -8.823  32.159 86.269 1.00 24.58 ? 24  ALA A CB  1 
ATOM   64   N N   . HIS A 1 10  ? -6.575  29.549 85.889 1.00 21.27 ? 25  HIS A N   1 
ATOM   65   C CA  . HIS A 1 10  ? -5.299  28.986 86.344 1.00 19.86 ? 25  HIS A CA  1 
ATOM   66   C C   . HIS A 1 10  ? -5.384  27.788 87.293 1.00 22.23 ? 25  HIS A C   1 
ATOM   67   O O   . HIS A 1 10  ? -4.432  27.496 87.997 1.00 21.60 ? 25  HIS A O   1 
ATOM   68   C CB  . HIS A 1 10  ? -4.412  30.082 86.948 1.00 18.84 ? 25  HIS A CB  1 
ATOM   69   C CG  . HIS A 1 10  ? -4.337  31.313 86.108 1.00 16.45 ? 25  HIS A CG  1 
ATOM   70   N ND1 . HIS A 1 10  ? -4.959  32.490 86.460 1.00 16.34 ? 25  HIS A ND1 1 
ATOM   71   C CD2 . HIS A 1 10  ? -3.799  31.526 84.885 1.00 14.50 ? 25  HIS A CD2 1 
ATOM   72   C CE1 . HIS A 1 10  ? -4.815  33.372 85.488 1.00 13.87 ? 25  HIS A CE1 1 
ATOM   73   N NE2 . HIS A 1 10  ? -4.115  32.810 84.520 1.00 14.24 ? 25  HIS A NE2 1 
ATOM   74   N N   . ALA A 1 11  ? -6.511  27.085 87.298 1.00 21.90 ? 26  ALA A N   1 
ATOM   75   C CA  . ALA A 1 11  ? -6.650  25.899 88.148 1.00 20.01 ? 26  ALA A CA  1 
ATOM   76   C C   . ALA A 1 11  ? -5.975  24.677 87.488 1.00 17.59 ? 26  ALA A C   1 
ATOM   77   O O   . ALA A 1 11  ? -5.781  23.658 88.136 1.00 15.50 ? 26  ALA A O   1 
ATOM   78   C CB  . ALA A 1 11  ? -8.145  25.609 88.459 1.00 21.31 ? 26  ALA A CB  1 
ATOM   79   N N   . ARG A 1 12  ? -5.687  24.754 86.188 1.00 16.85 ? 27  ARG A N   1 
ATOM   80   C CA  . ARG A 1 12  ? -5.005  23.672 85.469 1.00 14.65 ? 27  ARG A CA  1 
ATOM   81   C C   . ARG A 1 12  ? -3.735  24.340 84.949 1.00 14.44 ? 27  ARG A C   1 
ATOM   82   O O   . ARG A 1 12  ? -3.596  24.600 83.746 1.00 15.38 ? 27  ARG A O   1 
ATOM   83   C CB  . ARG A 1 12  ? -5.859  23.146 84.290 1.00 16.18 ? 27  ARG A CB  1 
ATOM   84   C CG  . ARG A 1 12  ? -7.176  22.530 84.711 1.00 20.65 ? 27  ARG A CG  1 
ATOM   85   C CD  . ARG A 1 12  ? -8.155  22.449 83.581 1.00 22.17 ? 27  ARG A CD  1 
ATOM   86   N NE  . ARG A 1 12  ? -9.333  21.714 84.003 1.00 31.12 ? 27  ARG A NE  1 
ATOM   87   C CZ  . ARG A 1 12  ? -10.238 22.185 84.852 1.00 28.93 ? 27  ARG A CZ  1 
ATOM   88   N NH1 . ARG A 1 12  ? -10.124 23.416 85.328 1.00 30.00 ? 27  ARG A NH1 1 
ATOM   89   N NH2 . ARG A 1 12  ? -11.270 21.434 85.202 1.00 30.57 ? 27  ARG A NH2 1 
ATOM   90   N N   . PRO A 1 13  ? -2.763  24.551 85.844 1.00 12.90 ? 28  PRO A N   1 
ATOM   91   C CA  . PRO A 1 13  ? -1.495  25.194 85.519 1.00 11.23 ? 28  PRO A CA  1 
ATOM   92   C C   . PRO A 1 13  ? -0.590  24.557 84.458 1.00 10.28 ? 28  PRO A C   1 
ATOM   93   O O   . PRO A 1 13  ? 0.340   25.207 83.981 1.00 12.28 ? 28  PRO A O   1 
ATOM   94   C CB  . PRO A 1 13  ? -0.842  25.329 86.890 1.00 11.37 ? 28  PRO A CB  1 
ATOM   95   C CG  . PRO A 1 13  ? -1.347  24.137 87.616 1.00 12.89 ? 28  PRO A CG  1 
ATOM   96   C CD  . PRO A 1 13  ? -2.781  24.130 87.255 1.00 10.98 ? 28  PRO A CD  1 
ATOM   97   N N   . TYR A 1 14  ? -0.874  23.304 84.086 1.00 12.11 ? 29  TYR A N   1 
ATOM   98   C CA  . TYR A 1 14  ? -0.113  22.554 83.063 1.00 9.89  ? 29  TYR A CA  1 
ATOM   99   C C   . TYR A 1 14  ? -0.585  22.834 81.625 1.00 12.20 ? 29  TYR A C   1 
ATOM   100  O O   . TYR A 1 14  ? 0.013   22.357 80.674 1.00 11.43 ? 29  TYR A O   1 
ATOM   101  C CB  . TYR A 1 14  ? -0.251  21.038 83.299 1.00 11.73 ? 29  TYR A CB  1 
ATOM   102  C CG  . TYR A 1 14  ? -1.693  20.596 83.475 1.00 11.37 ? 29  TYR A CG  1 
ATOM   103  C CD1 . TYR A 1 14  ? -2.534  20.364 82.363 1.00 14.03 ? 29  TYR A CD1 1 
ATOM   104  C CD2 . TYR A 1 14  ? -2.243  20.458 84.761 1.00 12.04 ? 29  TYR A CD2 1 
ATOM   105  C CE1 . TYR A 1 14  ? -3.878  20.022 82.539 1.00 15.15 ? 29  TYR A CE1 1 
ATOM   106  C CE2 . TYR A 1 14  ? -3.594  20.107 84.939 1.00 15.92 ? 29  TYR A CE2 1 
ATOM   107  C CZ  . TYR A 1 14  ? -4.398  19.899 83.830 1.00 16.61 ? 29  TYR A CZ  1 
ATOM   108  O OH  . TYR A 1 14  ? -5.724  19.605 84.039 1.00 17.92 ? 29  TYR A OH  1 
ATOM   109  N N   . MET A 1 15  ? -1.690  23.559 81.495 1.00 13.49 ? 30  MET A N   1 
ATOM   110  C CA  . MET A 1 15  ? -2.276  23.871 80.203 1.00 14.58 ? 30  MET A CA  1 
ATOM   111  C C   . MET A 1 15  ? -1.454  24.863 79.382 1.00 14.75 ? 30  MET A C   1 
ATOM   112  O O   . MET A 1 15  ? -1.061  25.923 79.862 1.00 15.18 ? 30  MET A O   1 
ATOM   113  C CB  . MET A 1 15  ? -3.696  24.385 80.404 1.00 14.11 ? 30  MET A CB  1 
ATOM   114  C CG  . MET A 1 15  ? -4.566  24.264 79.198 1.00 19.32 ? 30  MET A CG  1 
ATOM   115  S SD  . MET A 1 15  ? -4.835  22.535 78.718 1.00 14.08 ? 30  MET A SD  1 
ATOM   116  C CE  . MET A 1 15  ? -5.261  22.872 77.051 1.00 13.41 ? 30  MET A CE  1 
ATOM   117  N N   . ALA A 1 16  ? -1.166  24.479 78.146 1.00 14.33 ? 31  ALA A N   1 
ATOM   118  C CA  . ALA A 1 16  ? -0.388  25.309 77.249 1.00 13.51 ? 31  ALA A CA  1 
ATOM   119  C C   . ALA A 1 16  ? -1.161  25.565 75.977 1.00 14.47 ? 31  ALA A C   1 
ATOM   120  O O   . ALA A 1 16  ? -2.027  24.780 75.607 1.00 14.04 ? 31  ALA A O   1 
ATOM   121  C CB  . ALA A 1 16  ? 0.910   24.628 76.916 1.00 11.95 ? 31  ALA A CB  1 
ATOM   122  N N   . SER A 1 17  ? -0.891  26.698 75.352 1.00 12.39 ? 32  SER A N   1 
ATOM   123  C CA  . SER A 1 17  ? -1.506  27.045 74.078 1.00 11.85 ? 32  SER A CA  1 
ATOM   124  C C   . SER A 1 17  ? -0.346  27.079 73.091 1.00 11.98 ? 32  SER A C   1 
ATOM   125  O O   . SER A 1 17  ? 0.610   27.812 73.268 1.00 14.69 ? 32  SER A O   1 
ATOM   126  C CB  . SER A 1 17  ? -2.172  28.424 74.119 1.00 14.20 ? 32  SER A CB  1 
ATOM   127  O OG  . SER A 1 17  ? -2.623  28.820 72.819 1.00 9.42  ? 32  SER A OG  1 
ATOM   128  N N   . VAL A 1 18  ? -0.412  26.232 72.086 1.00 9.59  ? 33  VAL A N   1 
ATOM   129  C CA  . VAL A 1 18  ? 0.618   26.177 71.066 1.00 9.14  ? 33  VAL A CA  1 
ATOM   130  C C   . VAL A 1 18  ? 0.077   27.141 70.024 1.00 11.27 ? 33  VAL A C   1 
ATOM   131  O O   . VAL A 1 18  ? -1.000  26.908 69.456 1.00 12.00 ? 33  VAL A O   1 
ATOM   132  C CB  . VAL A 1 18  ? 0.750   24.768 70.489 1.00 7.50  ? 33  VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 18  ? 1.686   24.772 69.322 1.00 9.37  ? 33  VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 18  ? 1.239   23.784 71.563 1.00 10.75 ? 33  VAL A CG2 1 
ATOM   135  N N   . GLN A 1 19  ? 0.804   28.231 69.794 1.00 13.41 ? 34  GLN A N   1 
ATOM   136  C CA  . GLN A 1 19  ? 0.381   29.270 68.852 1.00 15.31 ? 34  GLN A CA  1 
ATOM   137  C C   . GLN A 1 19  ? 1.176   29.420 67.549 1.00 18.16 ? 34  GLN A C   1 
ATOM   138  O O   . GLN A 1 19  ? 2.414   29.278 67.521 1.00 18.83 ? 34  GLN A O   1 
ATOM   139  C CB  . GLN A 1 19  ? 0.379   30.613 69.555 1.00 13.75 ? 34  GLN A CB  1 
ATOM   140  C CG  . GLN A 1 19  ? -0.066  30.532 70.976 1.00 18.08 ? 34  GLN A CG  1 
ATOM   141  C CD  . GLN A 1 19  ? -0.715  31.793 71.414 1.00 18.98 ? 34  GLN A CD  1 
ATOM   142  O OE1 . GLN A 1 19  ? -1.801  31.759 72.003 1.00 21.38 ? 34  GLN A OE1 1 
ATOM   143  N NE2 . GLN A 1 19  ? -0.080  32.933 71.117 1.00 19.81 ? 34  GLN A NE2 1 
ATOM   144  N N   . LEU A 1 20  ? 0.453   29.767 66.491 1.00 19.74 ? 35  LEU A N   1 
ATOM   145  C CA  . LEU A 1 20  ? 1.034   29.966 65.175 1.00 22.40 ? 35  LEU A CA  1 
ATOM   146  C C   . LEU A 1 20  ? 0.844   31.429 64.792 1.00 24.35 ? 35  LEU A C   1 
ATOM   147  O O   . LEU A 1 20  ? -0.254  31.867 64.473 1.00 23.98 ? 35  LEU A O   1 
ATOM   148  C CB  . LEU A 1 20  ? 0.354   29.041 64.167 1.00 22.87 ? 35  LEU A CB  1 
ATOM   149  C CG  . LEU A 1 20  ? 0.777   29.162 62.711 1.00 22.40 ? 35  LEU A CG  1 
ATOM   150  C CD1 . LEU A 1 20  ? 2.263   29.097 62.617 1.00 23.60 ? 35  LEU A CD1 1 
ATOM   151  C CD2 . LEU A 1 20  ? 0.141   28.063 61.878 1.00 24.71 ? 35  LEU A CD2 1 
ATOM   152  N N   . ASN A 1 21  ? 1.932   32.186 64.882 1.00 25.51 ? 36  ASN A N   1 
ATOM   153  C CA  . ASN A 1 21  ? 1.930   33.618 64.557 1.00 26.88 ? 36  ASN A CA  1 
ATOM   154  C C   . ASN A 1 21  ? 0.860   34.318 65.384 1.00 26.58 ? 36  ASN A C   1 
ATOM   155  O O   . ASN A 1 21  ? -0.018  35.008 64.850 1.00 28.70 ? 36  ASN A O   1 
ATOM   156  C CB  . ASN A 1 21  ? 1.698   33.868 63.051 1.00 27.64 ? 36  ASN A CB  1 
ATOM   157  C CG  . ASN A 1 21  ? 2.873   33.409 62.181 1.00 29.70 ? 36  ASN A CG  1 
ATOM   158  O OD1 . ASN A 1 21  ? 4.023   33.853 62.358 1.00 28.22 ? 36  ASN A OD1 1 
ATOM   159  N ND2 . ASN A 1 21  ? 2.584   32.519 61.229 1.00 33.18 ? 36  ASN A ND2 1 
ATOM   160  N N   . GLY A 1 22  ? 0.881   34.042 66.685 1.00 25.42 ? 38  GLY A N   1 
ATOM   161  C CA  . GLY A 1 22  ? -0.069  34.676 67.580 1.00 22.14 ? 38  GLY A CA  1 
ATOM   162  C C   . GLY A 1 22  ? -1.453  34.064 67.724 1.00 21.11 ? 38  GLY A C   1 
ATOM   163  O O   . GLY A 1 22  ? -2.124  34.334 68.704 1.00 23.97 ? 38  GLY A O   1 
ATOM   164  N N   . ALA A 1 23  ? -1.896  33.264 66.767 1.00 17.68 ? 39  ALA A N   1 
ATOM   165  C CA  . ALA A 1 23  ? -3.195  32.636 66.876 1.00 14.37 ? 39  ALA A CA  1 
ATOM   166  C C   . ALA A 1 23  ? -3.032  31.250 67.532 1.00 13.02 ? 39  ALA A C   1 
ATOM   167  O O   . ALA A 1 23  ? -2.007  30.575 67.361 1.00 14.59 ? 39  ALA A O   1 
ATOM   168  C CB  . ALA A 1 23  ? -3.822  32.516 65.511 1.00 14.19 ? 39  ALA A CB  1 
ATOM   169  N N   . HIS A 1 24  ? -3.975  30.894 68.387 1.00 10.09 ? 40  HIS A N   1 
ATOM   170  C CA  . HIS A 1 24  ? -3.943  29.609 69.050 1.00 11.97 ? 40  HIS A CA  1 
ATOM   171  C C   . HIS A 1 24  ? -4.111  28.572 67.950 1.00 11.32 ? 40  HIS A C   1 
ATOM   172  O O   . HIS A 1 24  ? -5.022  28.681 67.134 1.00 12.47 ? 40  HIS A O   1 
ATOM   173  C CB  . HIS A 1 24  ? -5.095  29.499 70.055 1.00 10.02 ? 40  HIS A CB  1 
ATOM   174  C CG  . HIS A 1 24  ? -5.352  28.106 70.531 1.00 11.89 ? 40  HIS A CG  1 
ATOM   175  N ND1 . HIS A 1 24  ? -4.634  27.516 71.547 1.00 8.59  ? 40  HIS A ND1 1 
ATOM   176  C CD2 . HIS A 1 24  ? -6.268  27.188 70.137 1.00 6.75  ? 40  HIS A CD2 1 
ATOM   177  C CE1 . HIS A 1 24  ? -5.097  26.298 71.767 1.00 7.24  ? 40  HIS A CE1 1 
ATOM   178  N NE2 . HIS A 1 24  ? -6.091  26.076 70.924 1.00 8.62  ? 40  HIS A NE2 1 
ATOM   179  N N   . LEU A 1 25  ? -3.214  27.598 67.924 1.00 12.14 ? 41  LEU A N   1 
ATOM   180  C CA  . LEU A 1 25  ? -3.233  26.525 66.927 1.00 11.97 ? 41  LEU A CA  1 
ATOM   181  C C   . LEU A 1 25  ? -3.652  25.181 67.560 1.00 11.94 ? 41  LEU A C   1 
ATOM   182  O O   . LEU A 1 25  ? -4.558  24.515 67.083 1.00 12.50 ? 41  LEU A O   1 
ATOM   183  C CB  . LEU A 1 25  ? -1.842  26.372 66.288 1.00 11.64 ? 41  LEU A CB  1 
ATOM   184  C CG  . LEU A 1 25  ? -1.720  25.305 65.186 1.00 13.64 ? 41  LEU A CG  1 
ATOM   185  C CD1 . LEU A 1 25  ? -2.574  25.730 64.017 1.00 11.78 ? 41  LEU A CD1 1 
ATOM   186  C CD2 . LEU A 1 25  ? -0.261  25.125 64.766 1.00 15.80 ? 41  LEU A CD2 1 
ATOM   187  N N   . CYS A 1 26  ? -3.026  24.819 68.666 1.00 11.65 ? 42  CYS A N   1 
ATOM   188  C CA  . CYS A 1 26  ? -3.310  23.556 69.329 1.00 13.29 ? 42  CYS A CA  1 
ATOM   189  C C   . CYS A 1 26  ? -3.069  23.661 70.814 1.00 13.07 ? 42  CYS A C   1 
ATOM   190  O O   . CYS A 1 26  ? -2.448  24.607 71.270 1.00 15.84 ? 42  CYS A O   1 
ATOM   191  C CB  . CYS A 1 26  ? -2.381  22.467 68.802 1.00 17.27 ? 42  CYS A CB  1 
ATOM   192  S SG  . CYS A 1 26  ? -2.853  21.779 67.196 1.00 24.33 ? 42  CYS A SG  1 
ATOM   193  N N   . GLY A 1 27  ? -3.618  22.698 71.548 1.00 9.76  ? 43  GLY A N   1 
ATOM   194  C CA  . GLY A 1 27  ? -3.430  22.614 72.972 1.00 8.32  ? 43  GLY A CA  1 
ATOM   195  C C   . GLY A 1 27  ? -2.082  21.935 73.164 1.00 8.72  ? 43  GLY A C   1 
ATOM   196  O O   . GLY A 1 27  ? -1.477  21.464 72.187 1.00 9.40  ? 43  GLY A O   1 
ATOM   197  N N   . GLY A 1 28  ? -1.635  21.895 74.415 1.00 7.58  ? 44  GLY A N   1 
ATOM   198  C CA  . GLY A 1 28  ? -0.372  21.302 74.830 1.00 10.63 ? 44  GLY A CA  1 
ATOM   199  C C   . GLY A 1 28  ? -0.364  21.085 76.350 1.00 9.47  ? 44  GLY A C   1 
ATOM   200  O O   . GLY A 1 28  ? -1.214  21.612 77.077 1.00 10.20 ? 44  GLY A O   1 
ATOM   201  N N   . VAL A 1 29  ? 0.586   20.290 76.822 1.00 10.41 ? 45  VAL A N   1 
ATOM   202  C CA  . VAL A 1 29  ? 0.738   19.965 78.238 1.00 10.02 ? 45  VAL A CA  1 
ATOM   203  C C   . VAL A 1 29  ? 2.205   20.136 78.691 1.00 11.30 ? 45  VAL A C   1 
ATOM   204  O O   . VAL A 1 29  ? 3.123   19.547 78.128 1.00 12.85 ? 45  VAL A O   1 
ATOM   205  C CB  . VAL A 1 29  ? 0.346   18.509 78.560 1.00 12.44 ? 45  VAL A CB  1 
ATOM   206  C CG1 . VAL A 1 29  ? 0.266   18.313 80.060 1.00 11.75 ? 45  VAL A CG1 1 
ATOM   207  C CG2 . VAL A 1 29  ? -0.933  18.155 77.930 1.00 6.10  ? 45  VAL A CG2 1 
ATOM   208  N N   . LEU A 1 30  ? 2.409   20.957 79.709 1.00 10.53 ? 46  LEU A N   1 
ATOM   209  C CA  . LEU A 1 30  ? 3.737   21.151 80.255 1.00 11.49 ? 46  LEU A CA  1 
ATOM   210  C C   . LEU A 1 30  ? 4.058   19.870 81.035 1.00 10.92 ? 46  LEU A C   1 
ATOM   211  O O   . LEU A 1 30  ? 3.382   19.542 82.031 1.00 9.79  ? 46  LEU A O   1 
ATOM   212  C CB  . LEU A 1 30  ? 3.746   22.375 81.181 1.00 8.83  ? 46  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 30  ? 5.085   22.928 81.640 1.00 8.59  ? 46  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 30  ? 5.903   23.574 80.516 1.00 10.52 ? 46  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 30  ? 4.780   23.938 82.697 1.00 11.22 ? 46  LEU A CD2 1 
ATOM   216  N N   . VAL A 1 31  ? 5.040   19.118 80.543 1.00 12.60 ? 47  VAL A N   1 
ATOM   217  C CA  . VAL A 1 31  ? 5.454   17.861 81.178 1.00 16.27 ? 47  VAL A CA  1 
ATOM   218  C C   . VAL A 1 31  ? 6.793   17.998 81.909 1.00 17.26 ? 47  VAL A C   1 
ATOM   219  O O   . VAL A 1 31  ? 7.232   17.110 82.625 1.00 15.49 ? 47  VAL A O   1 
ATOM   220  C CB  . VAL A 1 31  ? 5.501   16.663 80.157 1.00 17.75 ? 47  VAL A CB  1 
ATOM   221  C CG1 . VAL A 1 31  ? 4.087   16.182 79.839 1.00 16.92 ? 47  VAL A CG1 1 
ATOM   222  C CG2 . VAL A 1 31  ? 6.230   17.048 78.878 1.00 23.17 ? 47  VAL A CG2 1 
ATOM   223  N N   . ALA A 1 32  ? 7.437   19.137 81.725 1.00 14.27 ? 48  ALA A N   1 
ATOM   224  C CA  . ALA A 1 32  ? 8.706   19.406 82.374 1.00 13.69 ? 48  ALA A CA  1 
ATOM   225  C C   . ALA A 1 32  ? 8.963   20.905 82.248 1.00 15.32 ? 48  ALA A C   1 
ATOM   226  O O   . ALA A 1 32  ? 8.263   21.596 81.496 1.00 14.60 ? 48  ALA A O   1 
ATOM   227  C CB  . ALA A 1 32  ? 9.824   18.604 81.737 1.00 11.26 ? 48  ALA A CB  1 
ATOM   228  N N   . GLU A 1 33  ? 10.007  21.375 82.941 1.00 16.25 ? 49  GLU A N   1 
ATOM   229  C CA  . GLU A 1 33  ? 10.396  22.789 82.974 1.00 17.30 ? 49  GLU A CA  1 
ATOM   230  C C   . GLU A 1 33  ? 10.595  23.380 81.591 1.00 15.15 ? 49  GLU A C   1 
ATOM   231  O O   . GLU A 1 33  ? 10.221  24.511 81.334 1.00 15.04 ? 49  GLU A O   1 
ATOM   232  C CB  . GLU A 1 33  ? 11.685  22.958 83.793 1.00 22.45 ? 49  GLU A CB  1 
ATOM   233  C CG  . GLU A 1 33  ? 11.592  24.027 84.879 1.00 28.42 ? 49  GLU A CG  1 
ATOM   234  C CD  . GLU A 1 33  ? 12.946  24.506 85.370 1.00 34.43 ? 49  GLU A CD  1 
ATOM   235  O OE1 . GLU A 1 33  ? 13.861  23.657 85.516 1.00 38.68 ? 49  GLU A OE1 1 
ATOM   236  O OE2 . GLU A 1 33  ? 13.095  25.738 85.612 1.00 34.03 ? 49  GLU A OE2 1 
ATOM   237  N N   . GLN A 1 34  ? 11.133  22.584 80.688 1.00 12.87 ? 50  GLN A N   1 
ATOM   238  C CA  . GLN A 1 34  ? 11.385  23.085 79.364 1.00 14.23 ? 50  GLN A CA  1 
ATOM   239  C C   . GLN A 1 34  ? 10.709  22.296 78.249 1.00 14.09 ? 50  GLN A C   1 
ATOM   240  O O   . GLN A 1 34  ? 11.038  22.479 77.080 1.00 13.20 ? 50  GLN A O   1 
ATOM   241  C CB  . GLN A 1 34  ? 12.894  23.125 79.125 1.00 18.41 ? 50  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 34  ? 13.315  24.224 78.161 1.00 23.29 ? 50  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 34  ? 14.817  24.349 78.004 1.00 28.45 ? 50  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 34  ? 15.297  25.212 77.278 1.00 30.92 ? 50  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 34  ? 15.566  23.500 78.690 1.00 30.68 ? 50  GLN A NE2 1 
ATOM   246  N N   . TRP A 1 35  ? 9.714   21.481 78.578 1.00 13.40 ? 51  TRP A N   1 
ATOM   247  C CA  . TRP A 1 35  ? 9.075   20.669 77.545 1.00 10.75 ? 51  TRP A CA  1 
ATOM   248  C C   . TRP A 1 35  ? 7.563   20.690 77.546 1.00 10.44 ? 51  TRP A C   1 
ATOM   249  O O   . TRP A 1 35  ? 6.926   20.557 78.619 1.00 11.11 ? 51  TRP A O   1 
ATOM   250  C CB  . TRP A 1 35  ? 9.565   19.234 77.660 1.00 13.06 ? 51  TRP A CB  1 
ATOM   251  C CG  . TRP A 1 35  ? 11.014  19.120 77.380 1.00 14.62 ? 51  TRP A CG  1 
ATOM   252  C CD1 . TRP A 1 35  ? 12.042  19.285 78.270 1.00 12.23 ? 51  TRP A CD1 1 
ATOM   253  C CD2 . TRP A 1 35  ? 11.617  18.857 76.106 1.00 14.13 ? 51  TRP A CD2 1 
ATOM   254  N NE1 . TRP A 1 35  ? 13.256  19.152 77.624 1.00 13.47 ? 51  TRP A NE1 1 
ATOM   255  C CE2 . TRP A 1 35  ? 13.030  18.883 76.297 1.00 13.73 ? 51  TRP A CE2 1 
ATOM   256  C CE3 . TRP A 1 35  ? 11.105  18.600 74.819 1.00 15.38 ? 51  TRP A CE3 1 
ATOM   257  C CZ2 . TRP A 1 35  ? 13.940  18.661 75.247 1.00 12.90 ? 51  TRP A CZ2 1 
ATOM   258  C CZ3 . TRP A 1 35  ? 12.020  18.375 73.755 1.00 15.15 ? 51  TRP A CZ3 1 
ATOM   259  C CH2 . TRP A 1 35  ? 13.421  18.409 73.985 1.00 14.46 ? 51  TRP A CH2 1 
ATOM   260  N N   . VAL A 1 36  ? 7.003   20.844 76.347 1.00 11.85 ? 52  VAL A N   1 
ATOM   261  C CA  . VAL A 1 36  ? 5.560   20.872 76.153 1.00 10.16 ? 52  VAL A CA  1 
ATOM   262  C C   . VAL A 1 36  ? 5.154   19.734 75.229 1.00 9.44  ? 52  VAL A C   1 
ATOM   263  O O   . VAL A 1 36  ? 5.667   19.647 74.120 1.00 9.76  ? 52  VAL A O   1 
ATOM   264  C CB  . VAL A 1 36  ? 5.092   22.229 75.535 1.00 9.17  ? 52  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 36  ? 3.691   22.097 74.905 1.00 11.06 ? 52  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 36  ? 5.031   23.288 76.627 1.00 8.52  ? 52  VAL A CG2 1 
ATOM   267  N N   . LEU A 1 37  ? 4.250   18.875 75.699 1.00 7.09  ? 53  LEU A N   1 
ATOM   268  C CA  . LEU A 1 37  ? 3.745   17.729 74.945 1.00 8.72  ? 53  LEU A CA  1 
ATOM   269  C C   . LEU A 1 37  ? 2.470   18.151 74.230 1.00 8.76  ? 53  LEU A C   1 
ATOM   270  O O   . LEU A 1 37  ? 1.614   18.796 74.839 1.00 11.54 ? 53  LEU A O   1 
ATOM   271  C CB  . LEU A 1 37  ? 3.448   16.571 75.888 1.00 9.50  ? 53  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 37  ? 2.964   15.282 75.236 1.00 14.43 ? 53  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 37  ? 4.064   14.574 74.458 1.00 13.09 ? 53  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 37  ? 2.470   14.399 76.347 1.00 10.96 ? 53  LEU A CD2 1 
ATOM   275  N N   . SER A 1 38  ? 2.336   17.775 72.956 1.00 9.53  ? 54  SER A N   1 
ATOM   276  C CA  . SER A 1 38  ? 1.184   18.147 72.113 1.00 12.06 ? 54  SER A CA  1 
ATOM   277  C C   . SER A 1 38  ? 1.057   17.074 71.024 1.00 14.19 ? 54  SER A C   1 
ATOM   278  O O   . SER A 1 38  ? 1.685   16.021 71.133 1.00 12.42 ? 54  SER A O   1 
ATOM   279  C CB  . SER A 1 38  ? 1.452   19.536 71.483 1.00 13.67 ? 54  SER A CB  1 
ATOM   280  O OG  . SER A 1 38  ? 0.378   20.011 70.694 1.00 13.84 ? 54  SER A OG  1 
ATOM   281  N N   . ALA A 1 39  ? 0.296   17.339 69.966 1.00 12.16 ? 55  ALA A N   1 
ATOM   282  C CA  . ALA A 1 39  ? 0.122   16.369 68.882 1.00 14.18 ? 55  ALA A CA  1 
ATOM   283  C C   . ALA A 1 39  ? 0.951   16.756 67.646 1.00 13.60 ? 55  ALA A C   1 
ATOM   284  O O   . ALA A 1 39  ? 1.030   17.935 67.297 1.00 13.93 ? 55  ALA A O   1 
ATOM   285  C CB  . ALA A 1 39  ? -1.338  16.249 68.525 1.00 10.07 ? 55  ALA A CB  1 
ATOM   286  N N   . ALA A 1 40  ? 1.591   15.762 67.015 1.00 12.79 ? 56  ALA A N   1 
ATOM   287  C CA  . ALA A 1 40  ? 2.436   15.950 65.815 1.00 13.62 ? 56  ALA A CA  1 
ATOM   288  C C   . ALA A 1 40  ? 1.752   16.620 64.607 1.00 15.30 ? 56  ALA A C   1 
ATOM   289  O O   . ALA A 1 40  ? 2.321   17.513 63.971 1.00 19.17 ? 56  ALA A O   1 
ATOM   290  C CB  . ALA A 1 40  ? 3.064   14.597 65.379 1.00 12.45 ? 56  ALA A CB  1 
ATOM   291  N N   . HIS A 1 41  ? 0.527   16.202 64.301 1.00 16.87 ? 57  HIS A N   1 
ATOM   292  C CA  . HIS A 1 41  ? -0.206  16.769 63.163 1.00 19.73 ? 57  HIS A CA  1 
ATOM   293  C C   . HIS A 1 41  ? -0.364  18.293 63.236 1.00 24.13 ? 57  HIS A C   1 
ATOM   294  O O   . HIS A 1 41  ? -0.590  18.941 62.200 1.00 25.21 ? 57  HIS A O   1 
ATOM   295  C CB  . HIS A 1 41  ? -1.573  16.070 62.938 1.00 22.30 ? 57  HIS A CB  1 
ATOM   296  C CG  . HIS A 1 41  ? -2.684  16.559 63.824 1.00 24.50 ? 57  HIS A CG  1 
ATOM   297  N ND1 . HIS A 1 41  ? -3.079  15.888 64.959 1.00 24.45 ? 57  HIS A ND1 1 
ATOM   298  C CD2 . HIS A 1 41  ? -3.507  17.634 63.719 1.00 24.41 ? 57  HIS A CD2 1 
ATOM   299  C CE1 . HIS A 1 41  ? -4.093  16.523 65.519 1.00 23.00 ? 57  HIS A CE1 1 
ATOM   300  N NE2 . HIS A 1 41  ? -4.373  17.586 64.786 1.00 25.04 ? 57  HIS A NE2 1 
ATOM   301  N N   . CYS A 1 42  ? -0.235  18.857 64.446 1.00 24.22 ? 58  CYS A N   1 
ATOM   302  C CA  . CYS A 1 42  ? -0.334  20.313 64.639 1.00 26.34 ? 58  CYS A CA  1 
ATOM   303  C C   . CYS A 1 42  ? 0.766   21.006 63.831 1.00 28.22 ? 58  CYS A C   1 
ATOM   304  O O   . CYS A 1 42  ? 0.527   22.082 63.290 1.00 29.89 ? 58  CYS A O   1 
ATOM   305  C CB  . CYS A 1 42  ? -0.244  20.693 66.119 1.00 26.71 ? 58  CYS A CB  1 
ATOM   306  S SG  . CYS A 1 42  ? -1.687  20.130 67.092 1.00 24.36 ? 58  CYS A SG  1 
ATOM   307  N N   . LEU A 1 43  ? 1.938   20.361 63.707 1.00 30.05 ? 59  LEU A N   1 
ATOM   308  C CA  . LEU A 1 43  ? 3.051   20.903 62.914 1.00 32.67 ? 59  LEU A CA  1 
ATOM   309  C C   . LEU A 1 43  ? 2.751   20.911 61.406 1.00 33.29 ? 59  LEU A C   1 
ATOM   310  O O   . LEU A 1 43  ? 3.274   21.739 60.681 1.00 31.90 ? 59  LEU A O   1 
ATOM   311  C CB  . LEU A 1 43  ? 4.345   20.117 63.140 1.00 34.47 ? 59  LEU A CB  1 
ATOM   312  C CG  . LEU A 1 43  ? 5.238   20.385 64.350 1.00 36.13 ? 59  LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 43  ? 6.483   19.553 64.233 1.00 38.22 ? 59  LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 43  ? 5.620   21.829 64.432 1.00 37.03 ? 59  LEU A CD2 1 
ATOM   315  N N   . GLU A 1 44  ? 1.925   19.981 60.936 1.00 36.14 ? 60  GLU A N   1 
ATOM   316  C CA  . GLU A 1 44  ? 1.585   19.908 59.520 1.00 40.05 ? 60  GLU A CA  1 
ATOM   317  C C   . GLU A 1 44  ? 0.847   21.155 59.130 1.00 41.98 ? 60  GLU A C   1 
ATOM   318  O O   . GLU A 1 44  ? 1.010   21.678 58.028 1.00 41.74 ? 60  GLU A O   1 
ATOM   319  C CB  . GLU A 1 44  ? 0.674   18.718 59.238 1.00 41.89 ? 60  GLU A CB  1 
ATOM   320  C CG  . GLU A 1 44  ? 1.364   17.373 59.208 1.00 47.09 ? 60  GLU A CG  1 
ATOM   321  C CD  . GLU A 1 44  ? 0.389   16.201 59.115 1.00 52.33 ? 60  GLU A CD  1 
ATOM   322  O OE1 . GLU A 1 44  ? -0.737  16.344 58.573 1.00 53.69 ? 60  GLU A OE1 1 
ATOM   323  O OE2 . GLU A 1 44  ? 0.766   15.114 59.586 1.00 56.19 ? 60  GLU A OE2 1 
ATOM   324  N N   . ASP A 1 45  ? 0.003   21.612 60.041 1.00 46.30 ? 61  ASP A N   1 
ATOM   325  C CA  . ASP A 1 45  ? -0.808  22.792 59.803 1.00 49.26 ? 61  ASP A CA  1 
ATOM   326  C C   . ASP A 1 45  ? 0.043   24.065 59.726 1.00 50.18 ? 61  ASP A C   1 
ATOM   327  O O   . ASP A 1 45  ? -0.380  25.037 59.108 1.00 50.55 ? 61  ASP A O   1 
ATOM   328  C CB  . ASP A 1 45  ? -1.912  22.929 60.884 1.00 51.51 ? 61  ASP A CB  1 
ATOM   329  C CG  . ASP A 1 45  ? -2.668  21.604 61.163 1.00 53.33 ? 61  ASP A CG  1 
ATOM   330  O OD1 . ASP A 1 45  ? -2.583  20.653 60.349 1.00 53.52 ? 61  ASP A OD1 1 
ATOM   331  O OD2 . ASP A 1 45  ? -3.344  21.510 62.217 1.00 55.17 ? 61  ASP A OD2 1 
ATOM   332  N N   . ALA A 1 46  A 1.245   24.044 60.309 1.00 50.62 ? 61  ALA A N   1 
ATOM   333  C CA  . ALA A 1 46  A 2.147   25.203 60.314 1.00 51.36 ? 61  ALA A CA  1 
ATOM   334  C C   . ALA A 1 46  A 3.304   25.050 59.317 1.00 53.18 ? 61  ALA A C   1 
ATOM   335  O O   . ALA A 1 46  A 4.457   24.911 59.722 1.00 54.48 ? 61  ALA A O   1 
ATOM   336  C CB  . ALA A 1 46  A 2.696   25.409 61.719 1.00 50.75 ? 61  ALA A CB  1 
ATOM   337  N N   . ALA A 1 47  B 3.011   25.164 58.022 1.00 53.50 ? 61  ALA A N   1 
ATOM   338  C CA  . ALA A 1 47  B 4.029   24.988 56.972 1.00 54.28 ? 61  ALA A CA  1 
ATOM   339  C C   . ALA A 1 47  B 5.166   26.013 56.828 1.00 54.77 ? 61  ALA A C   1 
ATOM   340  O O   . ALA A 1 47  B 6.251   25.659 56.361 1.00 56.78 ? 61  ALA A O   1 
ATOM   341  C CB  . ALA A 1 47  B 3.359   24.766 55.615 1.00 54.81 ? 61  ALA A CB  1 
ATOM   342  N N   . ASP A 1 48  C 4.921   27.276 57.173 1.00 55.35 ? 61  ASP A N   1 
ATOM   343  C CA  . ASP A 1 48  C 5.965   28.309 57.044 1.00 54.31 ? 61  ASP A CA  1 
ATOM   344  C C   . ASP A 1 48  C 5.992   29.323 58.202 1.00 51.96 ? 61  ASP A C   1 
ATOM   345  O O   . ASP A 1 48  C 6.740   30.302 58.146 1.00 53.77 ? 61  ASP A O   1 
ATOM   346  C CB  . ASP A 1 48  C 5.788   29.123 55.742 1.00 57.40 ? 61  ASP A CB  1 
ATOM   347  C CG  . ASP A 1 48  C 5.125   28.333 54.611 1.00 59.13 ? 61  ASP A CG  1 
ATOM   348  O OD1 . ASP A 1 48  C 5.857   27.620 53.886 1.00 60.83 ? 61  ASP A OD1 1 
ATOM   349  O OD2 . ASP A 1 48  C 3.884   28.457 54.433 1.00 60.40 ? 61  ASP A OD2 1 
ATOM   350  N N   . GLY A 1 49  ? 5.207   29.080 59.251 1.00 46.77 ? 62  GLY A N   1 
ATOM   351  C CA  . GLY A 1 49  ? 5.131   30.030 60.347 1.00 42.08 ? 62  GLY A CA  1 
ATOM   352  C C   . GLY A 1 49  ? 5.952   29.819 61.605 1.00 38.65 ? 62  GLY A C   1 
ATOM   353  O O   . GLY A 1 49  ? 6.649   28.811 61.747 1.00 39.53 ? 62  GLY A O   1 
ATOM   354  N N   . LYS A 1 50  ? 5.843   30.789 62.523 1.00 35.52 ? 63  LYS A N   1 
ATOM   355  C CA  . LYS A 1 50  ? 6.547   30.772 63.804 1.00 33.26 ? 63  LYS A CA  1 
ATOM   356  C C   . LYS A 1 50  ? 5.646   30.209 64.869 1.00 29.28 ? 63  LYS A C   1 
ATOM   357  O O   . LYS A 1 50  ? 4.609   30.813 65.196 1.00 27.37 ? 63  LYS A O   1 
ATOM   358  C CB  . LYS A 1 50  ? 6.973   32.184 64.242 1.00 33.04 ? 63  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 50  ? 7.886   32.199 65.480 1.00 36.49 ? 63  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 50  ? 7.862   33.537 66.209 1.00 40.27 ? 63  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 50  ? 9.241   34.204 66.233 1.00 41.38 ? 63  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 50  ? 10.278  33.539 67.092 1.00 43.83 ? 63  LYS A NZ  1 
ATOM   363  N N   . VAL A 1 51  ? 6.047   29.059 65.401 1.00 26.63 ? 64  VAL A N   1 
ATOM   364  C CA  . VAL A 1 51  ? 5.307   28.388 66.478 1.00 24.13 ? 64  VAL A CA  1 
ATOM   365  C C   . VAL A 1 51  ? 5.920   28.809 67.818 1.00 23.32 ? 64  VAL A C   1 
ATOM   366  O O   . VAL A 1 51  ? 7.142   28.839 67.979 1.00 23.10 ? 64  VAL A O   1 
ATOM   367  C CB  . VAL A 1 51  ? 5.364   26.817 66.368 1.00 25.04 ? 64  VAL A CB  1 
ATOM   368  C CG1 . VAL A 1 51  ? 4.835   26.169 67.661 1.00 22.09 ? 64  VAL A CG1 1 
ATOM   369  C CG2 . VAL A 1 51  ? 4.554   26.323 65.165 1.00 26.57 ? 64  VAL A CG2 1 
ATOM   370  N N   . GLN A 1 52  ? 5.059   29.190 68.745 1.00 22.46 ? 65  GLN A N   1 
ATOM   371  C CA  . GLN A 1 52  ? 5.477   29.604 70.080 1.00 20.03 ? 65  GLN A CA  1 
ATOM   372  C C   . GLN A 1 52  ? 4.445   29.015 71.039 1.00 18.65 ? 65  GLN A C   1 
ATOM   373  O O   . GLN A 1 52  ? 3.397   28.547 70.599 1.00 16.08 ? 65  GLN A O   1 
ATOM   374  C CB  . GLN A 1 52  ? 5.469   31.130 70.190 1.00 19.30 ? 65  GLN A CB  1 
ATOM   375  C CG  . GLN A 1 52  ? 6.253   31.869 69.090 1.00 22.42 ? 65  GLN A CG  1 
ATOM   376  C CD  . GLN A 1 52  ? 6.166   33.374 69.213 1.00 27.13 ? 65  GLN A CD  1 
ATOM   377  O OE1 . GLN A 1 52  ? 7.170   34.039 69.379 1.00 29.64 ? 65  GLN A OE1 1 
ATOM   378  N NE2 . GLN A 1 52  ? 4.961   33.909 69.143 1.00 29.86 ? 65  GLN A NE2 1 
ATOM   379  N N   . VAL A 1 53  ? 4.748   28.967 72.327 1.00 17.48 ? 66  VAL A N   1 
ATOM   380  C CA  . VAL A 1 53  ? 3.775   28.427 73.270 1.00 14.64 ? 66  VAL A CA  1 
ATOM   381  C C   . VAL A 1 53  ? 3.522   29.373 74.447 1.00 15.22 ? 66  VAL A C   1 
ATOM   382  O O   . VAL A 1 53  ? 4.446   29.969 75.010 1.00 17.12 ? 66  VAL A O   1 
ATOM   383  C CB  . VAL A 1 53  ? 4.075   26.926 73.685 1.00 16.46 ? 66  VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 53  ? 5.333   26.417 73.040 1.00 16.53 ? 66  VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 53  ? 4.084   26.725 75.191 1.00 14.12 ? 66  VAL A CG2 1 
ATOM   386  N N   . LEU A 1 54  ? 2.243   29.618 74.691 1.00 13.42 ? 67  LEU A N   1 
ATOM   387  C CA  . LEU A 1 54  ? 1.779   30.499 75.744 1.00 11.98 ? 67  LEU A CA  1 
ATOM   388  C C   . LEU A 1 54  ? 1.434   29.686 76.994 1.00 11.79 ? 67  LEU A C   1 
ATOM   389  O O   . LEU A 1 54  ? 0.660   28.728 76.923 1.00 12.96 ? 67  LEU A O   1 
ATOM   390  C CB  . LEU A 1 54  ? 0.542   31.257 75.234 1.00 8.90  ? 67  LEU A CB  1 
ATOM   391  C CG  . LEU A 1 54  ? -0.206  32.195 76.184 1.00 10.04 ? 67  LEU A CG  1 
ATOM   392  C CD1 . LEU A 1 54  ? 0.677   33.367 76.487 1.00 11.70 ? 67  LEU A CD1 1 
ATOM   393  C CD2 . LEU A 1 54  ? -1.523  32.654 75.580 1.00 11.14 ? 67  LEU A CD2 1 
ATOM   394  N N   . LEU A 1 55  ? 2.049   30.052 78.112 1.00 13.86 ? 68  LEU A N   1 
ATOM   395  C CA  . LEU A 1 55  ? 1.839   29.405 79.402 1.00 12.52 ? 68  LEU A CA  1 
ATOM   396  C C   . LEU A 1 55  ? 1.199   30.413 80.401 1.00 13.94 ? 68  LEU A C   1 
ATOM   397  O O   . LEU A 1 55  ? 1.192   31.610 80.142 1.00 14.53 ? 68  LEU A O   1 
ATOM   398  C CB  . LEU A 1 55  ? 3.181   28.869 79.962 1.00 14.08 ? 68  LEU A CB  1 
ATOM   399  C CG  . LEU A 1 55  ? 4.013   27.790 79.231 1.00 14.30 ? 68  LEU A CG  1 
ATOM   400  C CD1 . LEU A 1 55  ? 5.252   27.453 80.032 1.00 17.79 ? 68  LEU A CD1 1 
ATOM   401  C CD2 . LEU A 1 55  ? 3.214   26.512 79.012 1.00 14.87 ? 68  LEU A CD2 1 
ATOM   402  N N   . GLY A 1 56  ? 0.657   29.899 81.511 1.00 15.51 ? 69  GLY A N   1 
ATOM   403  C CA  . GLY A 1 56  ? 0.051   30.722 82.549 1.00 11.46 ? 69  GLY A CA  1 
ATOM   404  C C   . GLY A 1 56  ? -1.207  31.467 82.167 1.00 12.91 ? 69  GLY A C   1 
ATOM   405  O O   . GLY A 1 56  ? -1.647  32.385 82.859 1.00 11.40 ? 69  GLY A O   1 
ATOM   406  N N   . ALA A 1 57  ? -1.839  31.019 81.090 1.00 13.31 ? 70  ALA A N   1 
ATOM   407  C CA  . ALA A 1 57  ? -3.043  31.687 80.582 1.00 14.21 ? 70  ALA A CA  1 
ATOM   408  C C   . ALA A 1 57  ? -4.406  31.089 80.890 1.00 13.80 ? 70  ALA A C   1 
ATOM   409  O O   . ALA A 1 57  ? -4.558  29.878 81.106 1.00 11.48 ? 70  ALA A O   1 
ATOM   410  C CB  . ALA A 1 57  ? -2.933  31.861 79.063 1.00 12.25 ? 70  ALA A CB  1 
ATOM   411  N N   . HIS A 1 58  ? -5.389  31.984 80.917 1.00 12.60 ? 71  HIS A N   1 
ATOM   412  C CA  . HIS A 1 58  ? -6.789  31.605 81.042 1.00 12.07 ? 71  HIS A CA  1 
ATOM   413  C C   . HIS A 1 58  ? -7.441  32.199 79.773 1.00 13.14 ? 71  HIS A C   1 
ATOM   414  O O   . HIS A 1 58  ? -7.910  31.466 78.890 1.00 15.12 ? 71  HIS A O   1 
ATOM   415  C CB  . HIS A 1 58  ? -7.482  32.140 82.302 1.00 12.61 ? 71  HIS A CB  1 
ATOM   416  C CG  . HIS A 1 58  ? -8.876  31.616 82.439 1.00 14.70 ? 71  HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 58  ? -9.988  32.429 82.392 1.00 18.49 ? 71  HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 58  ? -9.340  30.344 82.474 1.00 12.77 ? 71  HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 58  ? -11.075 31.678 82.386 1.00 15.88 ? 71  HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 58  ? -10.711 30.411 82.436 1.00 15.91 ? 71  HIS A NE2 1 
ATOM   421  N N   . SER A 1 59  ? -7.438  33.534 79.704 1.00 13.75 ? 72  SER A N   1 
ATOM   422  C CA  . SER A 1 59  ? -7.952  34.273 78.558 1.00 11.82 ? 72  SER A CA  1 
ATOM   423  C C   . SER A 1 59  ? -6.802  34.399 77.575 1.00 12.43 ? 72  SER A C   1 
ATOM   424  O O   . SER A 1 59  ? -5.685  34.711 77.961 1.00 15.59 ? 72  SER A O   1 
ATOM   425  C CB  . SER A 1 59  ? -8.373  35.676 78.977 1.00 12.84 ? 72  SER A CB  1 
ATOM   426  O OG  . SER A 1 59  ? -8.563  36.512 77.848 1.00 12.83 ? 72  SER A OG  1 
ATOM   427  N N   . LEU A 1 60  ? -7.068  34.113 76.315 1.00 12.44 ? 73  LEU A N   1 
ATOM   428  C CA  . LEU A 1 60  ? -6.051  34.228 75.281 1.00 13.27 ? 73  LEU A CA  1 
ATOM   429  C C   . LEU A 1 60  ? -5.733  35.703 74.935 1.00 15.49 ? 73  LEU A C   1 
ATOM   430  O O   . LEU A 1 60  ? -4.655  35.998 74.417 1.00 17.10 ? 73  LEU A O   1 
ATOM   431  C CB  . LEU A 1 60  ? -6.495  33.497 74.001 1.00 13.02 ? 73  LEU A CB  1 
ATOM   432  C CG  . LEU A 1 60  ? -6.542  31.957 73.918 1.00 12.22 ? 73  LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 60  ? -7.221  31.532 72.606 1.00 10.76 ? 73  LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 60  ? -5.160  31.333 74.032 1.00 14.17 ? 73  LEU A CD2 1 
ATOM   435  N N   . SER A 1 61  ? -6.653  36.623 75.209 1.00 19.85 ? 74  SER A N   1 
ATOM   436  C CA  . SER A 1 61  ? -6.399  38.018 74.863 1.00 20.84 ? 74  SER A CA  1 
ATOM   437  C C   . SER A 1 61  ? -6.147  38.974 76.016 1.00 22.19 ? 74  SER A C   1 
ATOM   438  O O   . SER A 1 61  ? -5.433  39.958 75.869 1.00 20.32 ? 74  SER A O   1 
ATOM   439  C CB  . SER A 1 61  ? -7.536  38.567 74.000 1.00 22.22 ? 74  SER A CB  1 
ATOM   440  O OG  . SER A 1 61  ? -8.784  38.551 74.680 1.00 26.55 ? 74  SER A OG  1 
ATOM   441  N N   . GLN A 1 62  ? -6.742  38.706 77.161 1.00 23.69 ? 75  GLN A N   1 
ATOM   442  C CA  . GLN A 1 62  ? -6.578  39.599 78.282 1.00 24.05 ? 75  GLN A CA  1 
ATOM   443  C C   . GLN A 1 62  ? -5.245  39.465 78.965 1.00 21.95 ? 75  GLN A C   1 
ATOM   444  O O   . GLN A 1 62  ? -4.667  38.396 79.003 1.00 20.24 ? 75  GLN A O   1 
ATOM   445  C CB  . GLN A 1 62  ? -7.656  39.331 79.319 1.00 28.41 ? 75  GLN A CB  1 
ATOM   446  C CG  . GLN A 1 62  ? -9.044  39.673 78.862 1.00 38.37 ? 75  GLN A CG  1 
ATOM   447  C CD  . GLN A 1 62  ? -10.060 39.420 79.945 1.00 43.87 ? 75  GLN A CD  1 
ATOM   448  O OE1 . GLN A 1 62  ? -11.260 39.642 79.756 1.00 47.54 ? 75  GLN A OE1 1 
ATOM   449  N NE2 . GLN A 1 62  ? -9.590  38.933 81.091 1.00 41.70 ? 75  GLN A NE2 1 
ATOM   450  N N   . PRO A 1 63  ? -4.701  40.577 79.460 1.00 21.13 ? 76  PRO A N   1 
ATOM   451  C CA  . PRO A 1 63  ? -3.421  40.505 80.157 1.00 22.69 ? 76  PRO A CA  1 
ATOM   452  C C   . PRO A 1 63  ? -3.649  39.822 81.520 1.00 21.06 ? 76  PRO A C   1 
ATOM   453  O O   . PRO A 1 63  ? -4.666  40.056 82.196 1.00 22.04 ? 76  PRO A O   1 
ATOM   454  C CB  . PRO A 1 63  ? -3.039  41.982 80.317 1.00 21.09 ? 76  PRO A CB  1 
ATOM   455  C CG  . PRO A 1 63  ? -4.346  42.678 80.373 1.00 18.40 ? 76  PRO A CG  1 
ATOM   456  C CD  . PRO A 1 63  ? -5.101  41.980 79.255 1.00 21.53 ? 76  PRO A CD  1 
ATOM   457  N N   . GLU A 1 64  ? -2.732  38.930 81.882 1.00 20.45 ? 77  GLU A N   1 
ATOM   458  C CA  . GLU A 1 64  ? -2.822  38.215 83.152 1.00 21.36 ? 77  GLU A CA  1 
ATOM   459  C C   . GLU A 1 64  ? -1.452  38.118 83.757 1.00 19.66 ? 77  GLU A C   1 
ATOM   460  O O   . GLU A 1 64  ? -0.490  37.965 83.039 1.00 18.73 ? 77  GLU A O   1 
ATOM   461  C CB  . GLU A 1 64  ? -3.384  36.816 82.947 1.00 20.20 ? 77  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 64  ? -4.820  36.811 82.473 1.00 14.57 ? 77  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 64  ? -5.233  35.454 81.983 1.00 16.90 ? 77  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 64  ? -4.311  34.638 81.749 1.00 15.62 ? 77  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 64  ? -6.452  35.204 81.843 1.00 20.22 ? 77  GLU A OE2 1 
ATOM   466  N N   . PRO A 1 65  ? -1.352  38.217 85.089 1.00 20.64 ? 78  PRO A N   1 
ATOM   467  C CA  . PRO A 1 65  ? -0.080  38.146 85.838 1.00 20.70 ? 78  PRO A CA  1 
ATOM   468  C C   . PRO A 1 65  ? 0.837   36.951 85.588 1.00 21.09 ? 78  PRO A C   1 
ATOM   469  O O   . PRO A 1 65  ? 2.040   37.036 85.804 1.00 17.42 ? 78  PRO A O   1 
ATOM   470  C CB  . PRO A 1 65  ? -0.526  38.214 87.323 1.00 24.12 ? 78  PRO A CB  1 
ATOM   471  C CG  . PRO A 1 65  ? -2.068  37.960 87.292 1.00 21.28 ? 78  PRO A CG  1 
ATOM   472  C CD  . PRO A 1 65  ? -2.458  38.623 85.979 1.00 20.41 ? 78  PRO A CD  1 
ATOM   473  N N   . SER A 1 66  ? 0.273   35.828 85.178 1.00 22.10 ? 79  SER A N   1 
ATOM   474  C CA  . SER A 1 66  ? 1.093   34.645 84.945 1.00 20.82 ? 79  SER A CA  1 
ATOM   475  C C   . SER A 1 66  ? 1.383   34.297 83.479 1.00 19.52 ? 79  SER A C   1 
ATOM   476  O O   . SER A 1 66  ? 2.150   33.381 83.228 1.00 21.03 ? 79  SER A O   1 
ATOM   477  C CB  . SER A 1 66  ? 0.483   33.437 85.673 1.00 22.49 ? 79  SER A CB  1 
ATOM   478  O OG  . SER A 1 66  ? -0.869  33.252 85.291 1.00 24.45 ? 79  SER A OG  1 
ATOM   479  N N   . LYS A 1 67  ? 0.780   35.012 82.528 1.00 19.36 ? 80  LYS A N   1 
ATOM   480  C CA  . LYS A 1 67  ? 1.018   34.722 81.106 1.00 18.25 ? 80  LYS A CA  1 
ATOM   481  C C   . LYS A 1 67  ? 2.463   35.027 80.698 1.00 19.36 ? 80  LYS A C   1 
ATOM   482  O O   . LYS A 1 67  ? 3.041   36.071 81.051 1.00 19.21 ? 80  LYS A O   1 
ATOM   483  C CB  . LYS A 1 67  ? 0.073   35.494 80.175 1.00 16.32 ? 80  LYS A CB  1 
ATOM   484  C CG  . LYS A 1 67  ? -1.388  35.071 80.208 1.00 18.04 ? 80  LYS A CG  1 
ATOM   485  C CD  . LYS A 1 67  ? -2.258  36.044 79.418 1.00 15.80 ? 80  LYS A CD  1 
ATOM   486  C CE  . LYS A 1 67  ? -2.564  35.534 78.036 1.00 14.40 ? 80  LYS A CE  1 
ATOM   487  N NZ  . LYS A 1 67  ? -3.351  36.506 77.242 1.00 18.68 ? 80  LYS A NZ  1 
ATOM   488  N N   . ARG A 1 68  ? 3.042   34.090 79.965 1.00 18.78 ? 81  ARG A N   1 
ATOM   489  C CA  . ARG A 1 68  ? 4.391   34.210 79.464 1.00 21.17 ? 81  ARG A CA  1 
ATOM   490  C C   . ARG A 1 68  ? 4.422   33.458 78.143 1.00 20.70 ? 81  ARG A C   1 
ATOM   491  O O   . ARG A 1 68  ? 3.939   32.319 78.064 1.00 18.04 ? 81  ARG A O   1 
ATOM   492  C CB  . ARG A 1 68  ? 5.381   33.610 80.459 1.00 26.73 ? 81  ARG A CB  1 
ATOM   493  C CG  . ARG A 1 68  ? 5.470   34.393 81.765 1.00 33.51 ? 81  ARG A CG  1 
ATOM   494  C CD  . ARG A 1 68  ? 6.181   35.735 81.603 1.00 39.41 ? 81  ARG A CD  1 
ATOM   495  N NE  . ARG A 1 68  ? 7.630   35.560 81.589 1.00 43.89 ? 81  ARG A NE  1 
ATOM   496  C CZ  . ARG A 1 68  ? 8.305   35.005 80.589 1.00 45.68 ? 81  ARG A CZ  1 
ATOM   497  N NH1 . ARG A 1 68  ? 7.838   35.067 79.352 1.00 46.78 ? 81  ARG A NH1 1 
ATOM   498  N NH2 . ARG A 1 68  ? 9.434   34.362 80.828 1.00 47.34 ? 81  ARG A NH2 1 
ATOM   499  N N   . LEU A 1 69  ? 4.925   34.132 77.108 1.00 18.46 ? 82  LEU A N   1 
ATOM   500  C CA  . LEU A 1 69  ? 5.042   33.558 75.770 1.00 17.73 ? 82  LEU A CA  1 
ATOM   501  C C   . LEU A 1 69  ? 6.483   33.078 75.570 1.00 18.15 ? 82  LEU A C   1 
ATOM   502  O O   . LEU A 1 69  ? 7.426   33.788 75.920 1.00 15.87 ? 82  LEU A O   1 
ATOM   503  C CB  . LEU A 1 69  ? 4.699   34.602 74.710 1.00 23.49 ? 82  LEU A CB  1 
ATOM   504  C CG  . LEU A 1 69  ? 4.687   34.067 73.287 1.00 27.18 ? 82  LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 69  ? 3.464   33.184 73.095 1.00 25.84 ? 82  LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 69  ? 4.725   35.206 72.308 1.00 30.13 ? 82  LEU A CD2 1 
ATOM   507  N N   . TYR A 1 70  ? 6.664   31.882 75.021 1.00 18.87 ? 83  TYR A N   1 
ATOM   508  C CA  . TYR A 1 70  ? 7.999   31.350 74.809 1.00 19.12 ? 83  TYR A CA  1 
ATOM   509  C C   . TYR A 1 70  ? 8.181   30.913 73.375 1.00 18.95 ? 83  TYR A C   1 
ATOM   510  O O   . TYR A 1 70  ? 7.208   30.527 72.698 1.00 17.69 ? 83  TYR A O   1 
ATOM   511  C CB  . TYR A 1 70  ? 8.248   30.138 75.713 1.00 18.62 ? 83  TYR A CB  1 
ATOM   512  C CG  . TYR A 1 70  ? 8.263   30.450 77.187 1.00 16.96 ? 83  TYR A CG  1 
ATOM   513  C CD1 . TYR A 1 70  ? 7.075   30.561 77.906 1.00 17.04 ? 83  TYR A CD1 1 
ATOM   514  C CD2 . TYR A 1 70  ? 9.465   30.624 77.867 1.00 17.47 ? 83  TYR A CD2 1 
ATOM   515  C CE1 . TYR A 1 70  ? 7.073   30.836 79.270 1.00 17.86 ? 83  TYR A CE1 1 
ATOM   516  C CE2 . TYR A 1 70  ? 9.485   30.906 79.236 1.00 17.22 ? 83  TYR A CE2 1 
ATOM   517  C CZ  . TYR A 1 70  ? 8.277   31.005 79.939 1.00 17.97 ? 83  TYR A CZ  1 
ATOM   518  O OH  . TYR A 1 70  ? 8.288   31.220 81.305 1.00 21.90 ? 83  TYR A OH  1 
ATOM   519  N N   . ASP A 1 71  ? 9.429   30.966 72.911 1.00 17.81 ? 84  ASP A N   1 
ATOM   520  C CA  . ASP A 1 71  ? 9.760   30.536 71.549 1.00 19.12 ? 84  ASP A CA  1 
ATOM   521  C C   . ASP A 1 71  ? 10.112  29.047 71.681 1.00 18.09 ? 84  ASP A C   1 
ATOM   522  O O   . ASP A 1 71  ? 10.509  28.597 72.756 1.00 16.75 ? 84  ASP A O   1 
ATOM   523  C CB  . ASP A 1 71  ? 10.967  31.313 70.977 1.00 22.33 ? 84  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 71  ? 10.620  32.747 70.514 1.00 25.70 ? 84  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 71  ? 9.782   32.919 69.602 1.00 27.31 ? 84  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 71  ? 11.231  33.707 71.040 1.00 29.73 ? 84  ASP A OD2 1 
ATOM   527  N N   . VAL A 1 72  ? 9.968   28.290 70.602 1.00 20.04 ? 85  VAL A N   1 
ATOM   528  C CA  . VAL A 1 72  ? 10.294  26.863 70.624 1.00 20.28 ? 85  VAL A CA  1 
ATOM   529  C C   . VAL A 1 72  ? 11.658  26.642 70.001 1.00 22.92 ? 85  VAL A C   1 
ATOM   530  O O   . VAL A 1 72  ? 11.877  26.974 68.849 1.00 25.07 ? 85  VAL A O   1 
ATOM   531  C CB  . VAL A 1 72  ? 9.247   26.050 69.861 1.00 20.47 ? 85  VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 72  ? 9.694   24.605 69.714 1.00 18.30 ? 85  VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 72  ? 7.904   26.151 70.582 1.00 19.63 ? 85  VAL A CG2 1 
ATOM   534  N N   . LEU A 1 73  ? 12.556  26.074 70.791 1.00 20.88 ? 86  LEU A N   1 
ATOM   535  C CA  . LEU A 1 73  ? 13.941  25.794 70.420 1.00 23.91 ? 86  LEU A CA  1 
ATOM   536  C C   . LEU A 1 73  ? 14.054  24.616 69.459 1.00 25.43 ? 86  LEU A C   1 
ATOM   537  O O   . LEU A 1 73  ? 14.837  24.649 68.515 1.00 26.31 ? 86  LEU A O   1 
ATOM   538  C CB  . LEU A 1 73  ? 14.722  25.440 71.698 1.00 26.03 ? 86  LEU A CB  1 
ATOM   539  C CG  . LEU A 1 73  ? 16.213  25.745 71.876 1.00 29.08 ? 86  LEU A CG  1 
ATOM   540  C CD1 . LEU A 1 73  ? 16.331  27.198 72.242 1.00 30.27 ? 86  LEU A CD1 1 
ATOM   541  C CD2 . LEU A 1 73  ? 16.815  24.907 73.001 1.00 29.00 ? 86  LEU A CD2 1 
ATOM   542  N N   . ARG A 1 74  ? 13.298  23.557 69.752 1.00 25.17 ? 87  ARG A N   1 
ATOM   543  C CA  . ARG A 1 74  ? 13.309  22.328 68.979 1.00 24.68 ? 87  ARG A CA  1 
ATOM   544  C C   . ARG A 1 74  ? 11.954  21.681 69.026 1.00 22.34 ? 87  ARG A C   1 
ATOM   545  O O   . ARG A 1 74  ? 11.328  21.632 70.078 1.00 21.74 ? 87  ARG A O   1 
ATOM   546  C CB  . ARG A 1 74  ? 14.286  21.344 69.603 1.00 23.87 ? 87  ARG A CB  1 
ATOM   547  C CG  . ARG A 1 74  ? 15.719  21.766 69.497 1.00 22.83 ? 87  ARG A CG  1 
ATOM   548  C CD  . ARG A 1 74  ? 16.652  20.800 70.195 1.00 22.87 ? 87  ARG A CD  1 
ATOM   549  N NE  . ARG A 1 74  ? 18.079  21.153 70.131 1.00 21.28 ? 87  ARG A NE  1 
ATOM   550  C CZ  . ARG A 1 74  ? 19.087  20.454 70.671 1.00 25.77 ? 87  ARG A CZ  1 
ATOM   551  N NH1 . ARG A 1 74  ? 18.870  19.280 71.277 1.00 25.18 ? 87  ARG A NH1 1 
ATOM   552  N NH2 . ARG A 1 74  ? 20.338  20.898 70.532 1.00 24.25 ? 87  ARG A NH2 1 
ATOM   553  N N   . ALA A 1 75  ? 11.515  21.166 67.885 1.00 18.49 ? 88  ALA A N   1 
ATOM   554  C CA  . ALA A 1 75  ? 10.237  20.475 67.791 1.00 21.81 ? 88  ALA A CA  1 
ATOM   555  C C   . ALA A 1 75  ? 10.596  19.019 67.495 1.00 21.90 ? 88  ALA A C   1 
ATOM   556  O O   . ALA A 1 75  ? 11.272  18.749 66.512 1.00 21.13 ? 88  ALA A O   1 
ATOM   557  C CB  . ALA A 1 75  ? 9.385   21.066 66.669 1.00 20.28 ? 88  ALA A CB  1 
ATOM   558  N N   . VAL A 1 76  ? 10.169  18.097 68.355 1.00 18.10 ? 89  VAL A N   1 
ATOM   559  C CA  . VAL A 1 76  ? 10.472  16.682 68.195 1.00 17.51 ? 89  VAL A CA  1 
ATOM   560  C C   . VAL A 1 76  ? 9.217   15.805 68.031 1.00 18.22 ? 89  VAL A C   1 
ATOM   561  O O   . VAL A 1 76  ? 8.653   15.332 69.032 1.00 15.88 ? 89  VAL A O   1 
ATOM   562  C CB  . VAL A 1 76  ? 11.268  16.155 69.420 1.00 16.13 ? 89  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 76  ? 11.760  14.718 69.170 1.00 14.21 ? 89  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 76  ? 12.424  17.106 69.764 1.00 18.49 ? 89  VAL A CG2 1 
ATOM   565  N N   . PRO A 1 77  ? 8.750   15.600 66.776 1.00 20.33 ? 90  PRO A N   1 
ATOM   566  C CA  . PRO A 1 77  ? 7.559   14.766 66.520 1.00 21.38 ? 90  PRO A CA  1 
ATOM   567  C C   . PRO A 1 77  ? 7.962   13.308 66.699 1.00 24.04 ? 90  PRO A C   1 
ATOM   568  O O   . PRO A 1 77  ? 9.137   12.983 66.578 1.00 23.18 ? 90  PRO A O   1 
ATOM   569  C CB  . PRO A 1 77  ? 7.255   15.046 65.044 1.00 23.07 ? 90  PRO A CB  1 
ATOM   570  C CG  . PRO A 1 77  ? 8.665   15.222 64.455 1.00 22.24 ? 90  PRO A CG  1 
ATOM   571  C CD  . PRO A 1 77  ? 9.366   16.062 65.507 1.00 20.25 ? 90  PRO A CD  1 
ATOM   572  N N   . HIS A 1 78  ? 7.014   12.436 67.014 1.00 24.75 ? 91  HIS A N   1 
ATOM   573  C CA  . HIS A 1 78  ? 7.346   11.030 67.169 1.00 25.10 ? 91  HIS A CA  1 
ATOM   574  C C   . HIS A 1 78  ? 7.995   10.551 65.857 1.00 24.67 ? 91  HIS A C   1 
ATOM   575  O O   . HIS A 1 78  ? 7.500   10.836 64.754 1.00 22.94 ? 91  HIS A O   1 
ATOM   576  C CB  . HIS A 1 78  ? 6.100   10.200 67.493 1.00 24.17 ? 91  HIS A CB  1 
ATOM   577  C CG  . HIS A 1 78  ? 6.415   8.857  68.075 1.00 21.03 ? 91  HIS A CG  1 
ATOM   578  N ND1 . HIS A 1 78  ? 6.583   7.726  67.302 1.00 22.58 ? 91  HIS A ND1 1 
ATOM   579  C CD2 . HIS A 1 78  ? 6.643   8.472  69.357 1.00 22.63 ? 91  HIS A CD2 1 
ATOM   580  C CE1 . HIS A 1 78  ? 6.906   6.704  68.080 1.00 24.32 ? 91  HIS A CE1 1 
ATOM   581  N NE2 . HIS A 1 78  ? 6.949   7.133  69.330 1.00 23.78 ? 91  HIS A NE2 1 
ATOM   582  N N   . PRO A 1 79  ? 9.119   9.816  65.961 1.00 27.87 ? 92  PRO A N   1 
ATOM   583  C CA  . PRO A 1 79  ? 9.851   9.292  64.803 1.00 30.18 ? 92  PRO A CA  1 
ATOM   584  C C   . PRO A 1 79  ? 9.039   8.494  63.803 1.00 32.45 ? 92  PRO A C   1 
ATOM   585  O O   . PRO A 1 79  ? 9.371   8.524  62.576 1.00 38.32 ? 92  PRO A O   1 
ATOM   586  C CB  . PRO A 1 79  ? 10.955  8.448  65.463 1.00 29.00 ? 92  PRO A CB  1 
ATOM   587  C CG  . PRO A 1 79  ? 10.798  8.570  66.977 1.00 27.38 ? 92  PRO A CG  1 
ATOM   588  C CD  . PRO A 1 79  ? 9.645   9.483  67.284 1.00 27.33 ? 92  PRO A CD  1 
ATOM   589  N N   . ASP A 1 80  ? 8.015   7.793  64.245 1.00 30.68 ? 93  ASP A N   1 
ATOM   590  C CA  . ASP A 1 80  ? 7.237   6.931  63.323 1.00 28.39 ? 93  ASP A CA  1 
ATOM   591  C C   . ASP A 1 80  ? 5.937   7.592  62.827 1.00 26.67 ? 93  ASP A C   1 
ATOM   592  O O   . ASP A 1 80  ? 5.094   6.948  62.186 1.00 21.80 ? 93  ASP A O   1 
ATOM   593  C CB  . ASP A 1 80  ? 6.848   5.624  64.011 1.00 29.57 ? 93  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 80  ? 8.047   4.873  64.591 1.00 32.44 ? 93  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 80  ? 9.171   4.859  63.957 1.00 29.16 ? 93  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 80  ? 7.935   4.254  65.717 1.00 34.07 ? 93  ASP A OD2 1 
ATOM   597  N N   . TYR A 1 81  ? 5.785   8.908  63.073 1.00 11.58 ? 94  TYR A N   1 
ATOM   598  C CA  . TYR A 1 81  ? 4.550   9.589  62.657 1.00 11.20 ? 94  TYR A CA  1 
ATOM   599  C C   . TYR A 1 81  ? 4.565   9.826  61.139 1.00 11.73 ? 94  TYR A C   1 
ATOM   600  O O   . TYR A 1 81  ? 5.532   10.371 60.589 1.00 11.77 ? 94  TYR A O   1 
ATOM   601  C CB  . TYR A 1 81  ? 4.430   10.937 63.367 1.00 10.06 ? 94  TYR A CB  1 
ATOM   602  C CG  . TYR A 1 81  ? 3.188   11.705 62.931 1.00 9.37  ? 94  TYR A CG  1 
ATOM   603  C CD1 . TYR A 1 81  ? 1.921   11.181 63.200 1.00 8.69  ? 94  TYR A CD1 1 
ATOM   604  C CD2 . TYR A 1 81  ? 3.320   12.924 62.260 1.00 8.57  ? 94  TYR A CD2 1 
ATOM   605  C CE1 . TYR A 1 81  ? 0.780   11.871 62.786 1.00 9.08  ? 94  TYR A CE1 1 
ATOM   606  C CE2 . TYR A 1 81  ? 2.178   13.614 61.842 1.00 8.18  ? 94  TYR A CE2 1 
ATOM   607  C CZ  . TYR A 1 81  ? 0.908   13.086 62.103 1.00 8.50  ? 94  TYR A CZ  1 
ATOM   608  O OH  . TYR A 1 81  ? -0.203  13.752 61.691 1.00 10.72 ? 94  TYR A OH  1 
ATOM   609  N N   . GLN A 1 82  ? 3.475   9.404  60.511 1.00 37.50 ? 95  GLN A N   1 
ATOM   610  C CA  . GLN A 1 82  ? 3.280   9.519  59.049 1.00 40.92 ? 95  GLN A CA  1 
ATOM   611  C C   . GLN A 1 82  ? 2.086   10.432 58.738 1.00 43.27 ? 95  GLN A C   1 
ATOM   612  O O   . GLN A 1 82  ? 0.931   10.099 59.047 1.00 45.70 ? 95  GLN A O   1 
ATOM   613  C CB  . GLN A 1 82  ? 2.990   8.138  58.450 1.00 44.08 ? 95  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 82  ? 4.237   7.262  58.325 1.00 47.68 ? 95  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 82  ? 5.254   7.817  57.329 1.00 49.09 ? 95  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 82  ? 4.878   8.237  56.236 1.00 50.65 ? 95  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 82  ? 6.535   7.845  57.643 1.00 48.02 ? 95  GLN A NE2 1 
ATOM   618  N N   . PRO A 1 83  ? 2.278   11.608 58.104 1.00 42.83 ? 96  PRO A N   1 
ATOM   619  C CA  . PRO A 1 83  ? 1.166   12.507 57.825 1.00 39.40 ? 96  PRO A CA  1 
ATOM   620  C C   . PRO A 1 83  ? 0.068   11.781 57.078 1.00 37.86 ? 96  PRO A C   1 
ATOM   621  O O   . PRO A 1 83  ? 0.386   11.028 56.103 1.00 35.28 ? 96  PRO A O   1 
ATOM   622  C CB  . PRO A 1 83  ? 1.797   13.650 57.071 1.00 39.84 ? 96  PRO A CB  1 
ATOM   623  C CG  . PRO A 1 83  ? 3.291   13.382 56.986 1.00 40.03 ? 96  PRO A CG  1 
ATOM   624  C CD  . PRO A 1 83  ? 3.591   12.077 57.661 1.00 41.49 ? 96  PRO A CD  1 
ATOM   625  N N   . ASP A 1 84  ? -1.128  12.060 57.579 1.00 38.33 ? 97  ASP A N   1 
ATOM   626  C CA  . ASP A 1 84  ? -2.422  11.476 57.156 1.00 38.09 ? 97  ASP A CA  1 
ATOM   627  C C   . ASP A 1 84  ? -2.436  9.983  57.457 1.00 39.09 ? 97  ASP A C   1 
ATOM   628  O O   . ASP A 1 84  ? -2.525  9.150  56.537 1.00 39.39 ? 97  ASP A O   1 
ATOM   629  C CB  . ASP A 1 84  ? -2.762  11.746 55.702 1.00 37.19 ? 97  ASP A CB  1 
ATOM   630  C CG  . ASP A 1 84  ? -4.268  12.016 55.548 1.00 35.08 ? 97  ASP A CG  1 
ATOM   631  O OD1 . ASP A 1 84  ? -5.124  11.279 56.182 1.00 35.76 ? 97  ASP A OD1 1 
ATOM   632  O OD2 . ASP A 1 84  ? -4.685  12.982 54.806 1.00 31.79 ? 97  ASP A OD2 1 
ATOM   633  N N   . THR A 1 85  ? -2.343  9.825  58.748 1.00 39.60 ? 98  THR A N   1 
ATOM   634  C CA  . THR A 1 85  ? -2.365  8.585  59.517 1.00 35.54 ? 98  THR A CA  1 
ATOM   635  C C   . THR A 1 85  ? -2.637  9.060  60.942 1.00 32.95 ? 98  THR A C   1 
ATOM   636  O O   . THR A 1 85  ? -2.358  10.217 61.287 1.00 29.52 ? 98  THR A O   1 
ATOM   637  C CB  . THR A 1 85  ? -1.026  7.857  59.381 1.00 38.58 ? 98  THR A CB  1 
ATOM   638  O OG1 . THR A 1 85  ? -0.865  7.374  58.055 1.00 44.24 ? 98  THR A OG1 1 
ATOM   639  C CG2 . THR A 1 85  ? -0.904  6.655  60.321 1.00 45.01 ? 98  THR A CG2 1 
ATOM   640  N N   . ILE A 1 86  ? -3.174  8.212  61.784 1.00 29.87 ? 99  ILE A N   1 
ATOM   641  C CA  . ILE A 1 86  ? -3.562  8.672  63.130 1.00 33.24 ? 99  ILE A CA  1 
ATOM   642  C C   . ILE A 1 86  ? -2.617  8.224  64.261 1.00 38.09 ? 99  ILE A C   1 
ATOM   643  O O   . ILE A 1 86  ? -2.564  8.837  65.332 1.00 34.76 ? 99  ILE A O   1 
ATOM   644  C CB  . ILE A 1 86  ? -4.958  8.172  63.490 1.00 28.64 ? 99  ILE A CB  1 
ATOM   645  C CG1 . ILE A 1 86  ? -5.009  6.667  63.741 1.00 26.85 ? 99  ILE A CG1 1 
ATOM   646  C CG2 . ILE A 1 86  ? -5.994  8.450  62.400 1.00 30.83 ? 99  ILE A CG2 1 
ATOM   647  C CD1 . ILE A 1 86  ? -6.436  6.129  63.847 1.00 19.22 ? 99  ILE A CD1 1 
ATOM   648  N N   . ASP A 1 87  ? -1.859  7.165  64.073 1.00 42.68 ? 100 ASP A N   1 
ATOM   649  C CA  . ASP A 1 87  ? -0.986  6.673  65.167 1.00 44.16 ? 100 ASP A CA  1 
ATOM   650  C C   . ASP A 1 87  ? 0.295   7.520  65.301 1.00 41.94 ? 100 ASP A C   1 
ATOM   651  O O   . ASP A 1 87  ? 0.687   8.241  64.373 1.00 44.59 ? 100 ASP A O   1 
ATOM   652  C CB  . ASP A 1 87  ? -0.594  5.218  64.930 1.00 47.29 ? 100 ASP A CB  1 
ATOM   653  C CG  . ASP A 1 87  ? 0.204   5.017  63.648 1.00 50.46 ? 100 ASP A CG  1 
ATOM   654  O OD1 . ASP A 1 87  ? 0.539   6.035  62.934 1.00 49.36 ? 100 ASP A OD1 1 
ATOM   655  O OD2 . ASP A 1 87  ? 0.538   3.827  63.283 1.00 55.06 ? 100 ASP A OD2 1 
ATOM   656  N N   . HIS A 1 88  ? 0.895   7.388  66.481 1.00 41.84 ? 101 HIS A N   1 
ATOM   657  C CA  . HIS A 1 88  ? 2.144   8.084  66.856 1.00 39.81 ? 101 HIS A CA  1 
ATOM   658  C C   . HIS A 1 88  ? 1.990   9.596  66.698 1.00 35.69 ? 101 HIS A C   1 
ATOM   659  O O   . HIS A 1 88  ? 2.985   10.336 66.634 1.00 32.17 ? 101 HIS A O   1 
ATOM   660  C CB  . HIS A 1 88  ? 3.296   7.616  65.967 1.00 42.69 ? 101 HIS A CB  1 
ATOM   661  C CG  . HIS A 1 88  ? 3.326   6.101  65.789 1.00 45.41 ? 101 HIS A CG  1 
ATOM   662  N ND1 . HIS A 1 88  ? 3.294   5.234  66.876 1.00 48.33 ? 101 HIS A ND1 1 
ATOM   663  C CD2 . HIS A 1 88  ? 3.381   5.320  64.679 1.00 48.53 ? 101 HIS A CD2 1 
ATOM   664  C CE1 . HIS A 1 88  ? 3.326   3.997  66.414 1.00 47.63 ? 101 HIS A CE1 1 
ATOM   665  N NE2 . HIS A 1 88  ? 3.378   4.031  65.106 1.00 50.45 ? 101 HIS A NE2 1 
ATOM   666  N N   . ASP A 1 89  ? 0.807   10.082 66.993 1.00 32.69 ? 102 ASP A N   1 
ATOM   667  C CA  . ASP A 1 89  ? 0.504   11.493 66.921 1.00 30.06 ? 102 ASP A CA  1 
ATOM   668  C C   . ASP A 1 89  ? 0.957   12.231 68.191 1.00 23.58 ? 102 ASP A C   1 
ATOM   669  O O   . ASP A 1 89  ? 0.150   12.797 68.938 1.00 21.17 ? 102 ASP A O   1 
ATOM   670  C CB  . ASP A 1 89  ? -1.000  11.669 66.651 1.00 35.72 ? 102 ASP A CB  1 
ATOM   671  C CG  . ASP A 1 89  ? -1.351  13.009 66.009 1.00 40.60 ? 102 ASP A CG  1 
ATOM   672  O OD1 . ASP A 1 89  ? -0.450  13.780 65.630 1.00 31.45 ? 102 ASP A OD1 1 
ATOM   673  O OD2 . ASP A 1 89  ? -2.556  13.275 65.873 1.00 42.52 ? 102 ASP A OD2 1 
ATOM   674  N N   . LEU A 1 90  ? 2.257   12.218 68.441 1.00 19.39 ? 103 LEU A N   1 
ATOM   675  C CA  . LEU A 1 90  ? 2.788   12.925 69.589 1.00 16.80 ? 103 LEU A CA  1 
ATOM   676  C C   . LEU A 1 90  ? 3.955   13.826 69.179 1.00 15.11 ? 103 LEU A C   1 
ATOM   677  O O   . LEU A 1 90  ? 4.781   13.453 68.337 1.00 11.58 ? 103 LEU A O   1 
ATOM   678  C CB  . LEU A 1 90  ? 3.193   11.958 70.689 1.00 18.56 ? 103 LEU A CB  1 
ATOM   679  C CG  . LEU A 1 90  ? 2.100   11.252 71.496 1.00 17.71 ? 103 LEU A CG  1 
ATOM   680  C CD1 . LEU A 1 90  ? 2.764   10.540 72.687 1.00 16.32 ? 103 LEU A CD1 1 
ATOM   681  C CD2 . LEU A 1 90  ? 1.056   12.244 71.997 1.00 20.13 ? 103 LEU A CD2 1 
ATOM   682  N N   . LEU A 1 91  ? 3.989   15.027 69.759 1.00 12.68 ? 104 LEU A N   1 
ATOM   683  C CA  . LEU A 1 91  ? 5.019   16.033 69.481 1.00 14.10 ? 104 LEU A CA  1 
ATOM   684  C C   . LEU A 1 91  ? 5.573   16.641 70.776 1.00 11.75 ? 104 LEU A C   1 
ATOM   685  O O   . LEU A 1 91  ? 4.830   17.015 71.671 1.00 11.79 ? 104 LEU A O   1 
ATOM   686  C CB  . LEU A 1 91  ? 4.427   17.143 68.607 1.00 20.82 ? 104 LEU A CB  1 
ATOM   687  C CG  . LEU A 1 91  ? 5.200   18.449 68.425 1.00 22.41 ? 104 LEU A CG  1 
ATOM   688  C CD1 . LEU A 1 91  ? 6.496   18.186 67.678 1.00 25.32 ? 104 LEU A CD1 1 
ATOM   689  C CD2 . LEU A 1 91  ? 4.330   19.451 67.689 1.00 23.42 ? 104 LEU A CD2 1 
ATOM   690  N N   . LEU A 1 92  ? 6.884   16.655 70.908 1.00 10.81 ? 105 LEU A N   1 
ATOM   691  C CA  . LEU A 1 92  ? 7.516   17.227 72.089 1.00 13.44 ? 105 LEU A CA  1 
ATOM   692  C C   . LEU A 1 92  ? 8.168   18.557 71.691 1.00 14.56 ? 105 LEU A C   1 
ATOM   693  O O   . LEU A 1 92  ? 8.946   18.621 70.738 1.00 18.08 ? 105 LEU A O   1 
ATOM   694  C CB  . LEU A 1 92  ? 8.534   16.253 72.710 1.00 13.02 ? 105 LEU A CB  1 
ATOM   695  C CG  . LEU A 1 92  ? 7.937   15.312 73.770 1.00 13.85 ? 105 LEU A CG  1 
ATOM   696  C CD1 . LEU A 1 92  ? 8.909   14.216 74.136 1.00 11.04 ? 105 LEU A CD1 1 
ATOM   697  C CD2 . LEU A 1 92  ? 7.505   16.096 75.020 1.00 8.19  ? 105 LEU A CD2 1 
ATOM   698  N N   . LEU A 1 93  ? 7.762   19.622 72.367 1.00 13.77 ? 106 LEU A N   1 
ATOM   699  C CA  . LEU A 1 93  ? 8.283   20.940 72.094 1.00 14.04 ? 106 LEU A CA  1 
ATOM   700  C C   . LEU A 1 93  ? 9.201   21.392 73.208 1.00 14.30 ? 106 LEU A C   1 
ATOM   701  O O   . LEU A 1 93  ? 8.850   21.315 74.397 1.00 16.32 ? 106 LEU A O   1 
ATOM   702  C CB  . LEU A 1 93  ? 7.143   21.951 71.931 1.00 15.20 ? 106 LEU A CB  1 
ATOM   703  C CG  . LEU A 1 93  ? 6.305   21.820 70.678 1.00 16.29 ? 106 LEU A CG  1 
ATOM   704  C CD1 . LEU A 1 93  ? 5.219   22.837 70.710 1.00 20.57 ? 106 LEU A CD1 1 
ATOM   705  C CD2 . LEU A 1 93  ? 7.168   22.035 69.457 1.00 18.91 ? 106 LEU A CD2 1 
ATOM   706  N N   . GLN A 1 94  ? 10.391  21.829 72.818 1.00 14.36 ? 107 GLN A N   1 
ATOM   707  C CA  . GLN A 1 94  ? 11.356  22.345 73.780 1.00 15.53 ? 107 GLN A CA  1 
ATOM   708  C C   . GLN A 1 94  ? 11.273  23.870 73.730 1.00 15.84 ? 107 GLN A C   1 
ATOM   709  O O   . GLN A 1 94  ? 11.291  24.472 72.652 1.00 18.37 ? 107 GLN A O   1 
ATOM   710  C CB  . GLN A 1 94  ? 12.794  21.884 73.477 1.00 14.95 ? 107 GLN A CB  1 
ATOM   711  C CG  . GLN A 1 94  ? 13.804  22.419 74.513 1.00 16.36 ? 107 GLN A CG  1 
ATOM   712  C CD  . GLN A 1 94  ? 15.200  21.876 74.314 1.00 18.19 ? 107 GLN A CD  1 
ATOM   713  O OE1 . GLN A 1 94  ? 15.942  21.655 75.273 1.00 22.27 ? 107 GLN A OE1 1 
ATOM   714  N NE2 . GLN A 1 94  ? 15.572  21.668 73.078 1.00 18.97 ? 107 GLN A NE2 1 
ATOM   715  N N   . LEU A 1 95  ? 11.145  24.485 74.891 1.00 14.38 ? 108 LEU A N   1 
ATOM   716  C CA  . LEU A 1 95  ? 11.058  25.938 74.978 1.00 15.75 ? 108 LEU A CA  1 
ATOM   717  C C   . LEU A 1 95  ? 12.443  26.590 74.895 1.00 20.65 ? 108 LEU A C   1 
ATOM   718  O O   . LEU A 1 95  ? 13.441  25.983 75.279 1.00 17.98 ? 108 LEU A O   1 
ATOM   719  C CB  . LEU A 1 95  ? 10.375  26.322 76.283 1.00 10.38 ? 108 LEU A CB  1 
ATOM   720  C CG  . LEU A 1 95  ? 8.838   26.321 76.358 1.00 10.18 ? 108 LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 95  ? 8.179   25.718 75.145 1.00 10.90 ? 108 LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 95  ? 8.380   25.671 77.645 1.00 10.73 ? 108 LEU A CD2 1 
ATOM   723  N N   . SER A 1 96  ? 12.476  27.843 74.436 1.00 24.21 ? 109 SER A N   1 
ATOM   724  C CA  . SER A 1 96  ? 13.710  28.628 74.297 1.00 27.52 ? 109 SER A CA  1 
ATOM   725  C C   . SER A 1 96  ? 14.443  28.767 75.624 1.00 29.27 ? 109 SER A C   1 
ATOM   726  O O   . SER A 1 96  ? 15.604  29.148 75.653 1.00 31.93 ? 109 SER A O   1 
ATOM   727  C CB  . SER A 1 96  ? 13.378  30.029 73.802 1.00 25.09 ? 109 SER A CB  1 
ATOM   728  O OG  . SER A 1 96  ? 12.436  30.645 74.675 1.00 28.49 ? 109 SER A OG  1 
ATOM   729  N N   . GLU A 1 97  ? 13.718  28.558 76.716 1.00 30.26 ? 110 GLU A N   1 
ATOM   730  C CA  . GLU A 1 97  ? 14.270  28.636 78.061 1.00 31.36 ? 110 GLU A CA  1 
ATOM   731  C C   . GLU A 1 97  ? 13.367  27.833 78.985 1.00 30.97 ? 110 GLU A C   1 
ATOM   732  O O   . GLU A 1 97  ? 12.245  27.484 78.606 1.00 30.68 ? 110 GLU A O   1 
ATOM   733  C CB  . GLU A 1 97  ? 14.303  30.080 78.534 1.00 33.68 ? 110 GLU A CB  1 
ATOM   734  C CG  . GLU A 1 97  ? 15.618  30.463 79.138 1.00 35.46 ? 110 GLU A CG  1 
ATOM   735  C CD  . GLU A 1 97  ? 15.482  31.581 80.146 1.00 38.65 ? 110 GLU A CD  1 
ATOM   736  O OE1 . GLU A 1 97  ? 15.494  32.764 79.720 1.00 40.38 ? 110 GLU A OE1 1 
ATOM   737  O OE2 . GLU A 1 97  ? 15.365  31.270 81.367 1.00 39.32 ? 110 GLU A OE2 1 
ATOM   738  N N   . LYS A 1 98  ? 13.860  27.530 80.182 1.00 28.75 ? 111 LYS A N   1 
ATOM   739  C CA  . LYS A 1 98  ? 13.073  26.780 81.158 1.00 28.77 ? 111 LYS A CA  1 
ATOM   740  C C   . LYS A 1 98  ? 11.954  27.699 81.632 1.00 29.01 ? 111 LYS A C   1 
ATOM   741  O O   . LYS A 1 98  ? 12.200  28.880 81.870 1.00 26.80 ? 111 LYS A O   1 
ATOM   742  C CB  . LYS A 1 98  ? 13.932  26.368 82.357 1.00 30.51 ? 111 LYS A CB  1 
ATOM   743  C CG  . LYS A 1 98  ? 15.187  25.599 81.990 1.00 33.96 ? 111 LYS A CG  1 
ATOM   744  C CD  . LYS A 1 98  ? 16.355  26.526 81.696 1.00 37.20 ? 111 LYS A CD  1 
ATOM   745  C CE  . LYS A 1 98  ? 16.625  27.421 82.911 1.00 41.46 ? 111 LYS A CE  1 
ATOM   746  N NZ  . LYS A 1 98  ? 16.674  26.654 84.209 1.00 46.01 ? 111 LYS A NZ  1 
ATOM   747  N N   . ALA A 1 99  ? 10.742  27.170 81.778 1.00 28.54 ? 112 ALA A N   1 
ATOM   748  C CA  . ALA A 1 99  ? 9.601   27.974 82.205 1.00 25.74 ? 112 ALA A CA  1 
ATOM   749  C C   . ALA A 1 99  ? 9.662   28.437 83.665 1.00 25.43 ? 112 ALA A C   1 
ATOM   750  O O   . ALA A 1 99  ? 10.223  27.754 84.527 1.00 27.27 ? 112 ALA A O   1 
ATOM   751  C CB  . ALA A 1 99  ? 8.307   27.208 81.951 1.00 28.80 ? 112 ALA A CB  1 
ATOM   752  N N   . THR A 1 100 ? 9.113   29.623 83.924 1.00 22.21 ? 113 THR A N   1 
ATOM   753  C CA  . THR A 1 100 ? 9.048   30.160 85.278 1.00 22.17 ? 113 THR A CA  1 
ATOM   754  C C   . THR A 1 100 ? 7.855   29.476 85.938 1.00 21.58 ? 113 THR A C   1 
ATOM   755  O O   . THR A 1 100 ? 6.699   29.709 85.582 1.00 21.58 ? 113 THR A O   1 
ATOM   756  C CB  . THR A 1 100 ? 8.851   31.685 85.300 1.00 24.83 ? 113 THR A CB  1 
ATOM   757  O OG1 . THR A 1 100 ? 9.948   32.313 84.637 1.00 25.67 ? 113 THR A OG1 1 
ATOM   758  C CG2 . THR A 1 100 ? 8.821   32.179 86.712 1.00 23.18 ? 113 THR A CG2 1 
ATOM   759  N N   . LEU A 1 101 ? 8.153   28.565 86.846 1.00 20.05 ? 114 LEU A N   1 
ATOM   760  C CA  . LEU A 1 101 ? 7.115   27.812 87.530 1.00 18.54 ? 114 LEU A CA  1 
ATOM   761  C C   . LEU A 1 101 ? 6.509   28.593 88.703 1.00 19.09 ? 114 LEU A C   1 
ATOM   762  O O   . LEU A 1 101 ? 7.154   29.460 89.302 1.00 19.21 ? 114 LEU A O   1 
ATOM   763  C CB  . LEU A 1 101 ? 7.676   26.459 87.982 1.00 21.19 ? 114 LEU A CB  1 
ATOM   764  C CG  . LEU A 1 101 ? 8.485   25.769 86.873 1.00 21.73 ? 114 LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 101 ? 8.981   24.427 87.373 1.00 21.15 ? 114 LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 101 ? 7.660   25.612 85.602 1.00 22.51 ? 114 LEU A CD2 1 
ATOM   767  N N   . GLY A 1 102 ? 5.262   28.281 89.017 1.00 15.03 ? 115 GLY A N   1 
ATOM   768  C CA  . GLY A 1 102 ? 4.568   28.959 90.088 1.00 19.22 ? 115 GLY A CA  1 
ATOM   769  C C   . GLY A 1 102 ? 3.178   28.380 90.156 1.00 18.40 ? 115 GLY A C   1 
ATOM   770  O O   . GLY A 1 102 ? 2.882   27.441 89.419 1.00 21.06 ? 115 GLY A O   1 
ATOM   771  N N   . PRO A 1 103 ? 2.294   28.910 91.011 1.00 21.20 ? 118 PRO A N   1 
ATOM   772  C CA  . PRO A 1 103 ? 0.943   28.337 91.075 1.00 23.04 ? 118 PRO A CA  1 
ATOM   773  C C   . PRO A 1 103 ? 0.196   28.235 89.741 1.00 24.68 ? 118 PRO A C   1 
ATOM   774  O O   . PRO A 1 103 ? -0.522  27.274 89.515 1.00 27.49 ? 118 PRO A O   1 
ATOM   775  C CB  . PRO A 1 103 ? 0.231   29.251 92.079 1.00 21.95 ? 118 PRO A CB  1 
ATOM   776  C CG  . PRO A 1 103 ? 1.354   29.643 93.028 1.00 22.85 ? 118 PRO A CG  1 
ATOM   777  C CD  . PRO A 1 103 ? 2.491   29.940 92.055 1.00 24.01 ? 118 PRO A CD  1 
ATOM   778  N N   . ALA A 1 104 ? 0.392   29.196 88.850 1.00 23.25 ? 119 ALA A N   1 
ATOM   779  C CA  . ALA A 1 104 ? -0.313  29.170 87.573 1.00 19.69 ? 119 ALA A CA  1 
ATOM   780  C C   . ALA A 1 104 ? 0.405   28.393 86.492 1.00 19.94 ? 119 ALA A C   1 
ATOM   781  O O   . ALA A 1 104 ? -0.184  28.160 85.439 1.00 18.61 ? 119 ALA A O   1 
ATOM   782  C CB  . ALA A 1 104 ? -0.606  30.578 87.085 1.00 18.19 ? 119 ALA A CB  1 
ATOM   783  N N   . VAL A 1 105 ? 1.672   28.029 86.724 1.00 19.07 ? 120 VAL A N   1 
ATOM   784  C CA  . VAL A 1 105 ? 2.485   27.278 85.740 1.00 17.84 ? 120 VAL A CA  1 
ATOM   785  C C   . VAL A 1 105 ? 3.210   26.150 86.457 1.00 17.11 ? 120 VAL A C   1 
ATOM   786  O O   . VAL A 1 105 ? 4.165   26.387 87.181 1.00 16.27 ? 120 VAL A O   1 
ATOM   787  C CB  . VAL A 1 105 ? 3.573   28.160 85.028 1.00 17.92 ? 120 VAL A CB  1 
ATOM   788  C CG1 . VAL A 1 105 ? 4.185   27.398 83.861 1.00 16.85 ? 120 VAL A CG1 1 
ATOM   789  C CG2 . VAL A 1 105 ? 2.992   29.484 84.538 1.00 15.32 ? 120 VAL A CG2 1 
ATOM   790  N N   . ARG A 1 106 ? 2.831   24.917 86.156 1.00 15.14 ? 121 ARG A N   1 
ATOM   791  C CA  . ARG A 1 106 ? 3.425   23.767 86.828 1.00 16.76 ? 121 ARG A CA  1 
ATOM   792  C C   . ARG A 1 106 ? 3.210   22.496 85.978 1.00 14.72 ? 121 ARG A C   1 
ATOM   793  O O   . ARG A 1 106 ? 2.165   22.332 85.371 1.00 15.81 ? 121 ARG A O   1 
ATOM   794  C CB  . ARG A 1 106 ? 2.746   23.685 88.211 1.00 17.56 ? 121 ARG A CB  1 
ATOM   795  C CG  . ARG A 1 106 ? 3.129   22.567 89.124 1.00 28.97 ? 121 ARG A CG  1 
ATOM   796  C CD  . ARG A 1 106 ? 2.573   22.871 90.501 1.00 34.48 ? 121 ARG A CD  1 
ATOM   797  N NE  . ARG A 1 106 ? 2.816   21.742 91.406 1.00 40.69 ? 121 ARG A NE  1 
ATOM   798  C CZ  . ARG A 1 106 ? 2.391   21.672 92.669 1.00 45.38 ? 121 ARG A CZ  1 
ATOM   799  N NH1 . ARG A 1 106 ? 1.710   22.683 93.212 1.00 46.59 ? 121 ARG A NH1 1 
ATOM   800  N NH2 . ARG A 1 106 ? 2.661   20.591 93.402 1.00 43.60 ? 121 ARG A NH2 1 
ATOM   801  N N   . PRO A 1 107 ? 4.239   21.635 85.848 1.00 13.23 ? 122 PRO A N   1 
ATOM   802  C CA  . PRO A 1 107 ? 4.102   20.403 85.051 1.00 12.06 ? 122 PRO A CA  1 
ATOM   803  C C   . PRO A 1 107 ? 3.065   19.470 85.671 1.00 12.01 ? 122 PRO A C   1 
ATOM   804  O O   . PRO A 1 107 ? 2.756   19.576 86.858 1.00 11.04 ? 122 PRO A O   1 
ATOM   805  C CB  . PRO A 1 107 ? 5.483   19.776 85.143 1.00 8.73  ? 122 PRO A CB  1 
ATOM   806  C CG  . PRO A 1 107 ? 6.374   20.950 85.351 1.00 8.29  ? 122 PRO A CG  1 
ATOM   807  C CD  . PRO A 1 107 ? 5.612   21.785 86.343 1.00 10.56 ? 122 PRO A CD  1 
ATOM   808  N N   . LEU A 1 108 ? 2.511   18.592 84.859 1.00 14.03 ? 123 LEU A N   1 
ATOM   809  C CA  . LEU A 1 108 ? 1.525   17.627 85.320 1.00 14.26 ? 123 LEU A CA  1 
ATOM   810  C C   . LEU A 1 108 ? 2.201   16.267 85.176 1.00 14.92 ? 123 LEU A C   1 
ATOM   811  O O   . LEU A 1 108 ? 2.938   16.050 84.217 1.00 10.75 ? 123 LEU A O   1 
ATOM   812  C CB  . LEU A 1 108 ? 0.302   17.638 84.397 1.00 17.05 ? 123 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 108 ? -0.773  16.625 84.802 1.00 18.24 ? 123 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 108 ? -1.348  17.053 86.154 1.00 19.82 ? 123 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 108 ? -1.877  16.477 83.766 1.00 15.42 ? 123 LEU A CD2 1 
ATOM   816  N N   . PRO A 1 109 ? 2.055   15.373 86.169 1.00 16.02 ? 124 PRO A N   1 
ATOM   817  C CA  . PRO A 1 109 ? 2.708   14.077 85.974 1.00 15.78 ? 124 PRO A CA  1 
ATOM   818  C C   . PRO A 1 109 ? 1.943   13.266 84.935 1.00 14.38 ? 124 PRO A C   1 
ATOM   819  O O   . PRO A 1 109 ? 0.719   13.429 84.762 1.00 14.04 ? 124 PRO A O   1 
ATOM   820  C CB  . PRO A 1 109 ? 2.640   13.442 87.361 1.00 17.92 ? 124 PRO A CB  1 
ATOM   821  C CG  . PRO A 1 109 ? 1.456   14.096 87.992 1.00 19.18 ? 124 PRO A CG  1 
ATOM   822  C CD  . PRO A 1 109 ? 1.607   15.529 87.562 1.00 17.38 ? 124 PRO A CD  1 
ATOM   823  N N   . TRP A 1 110 A 2.682   12.440 84.198 1.00 15.35 ? 124 TRP A N   1 
ATOM   824  C CA  . TRP A 1 110 A 2.090   11.588 83.166 1.00 18.13 ? 124 TRP A CA  1 
ATOM   825  C C   . TRP A 1 110 A 2.250   10.103 83.522 1.00 18.92 ? 124 TRP A C   1 
ATOM   826  O O   . TRP A 1 110 A 3.194   9.705  84.203 1.00 20.64 ? 124 TRP A O   1 
ATOM   827  C CB  . TRP A 1 110 A 2.666   11.895 81.776 1.00 21.52 ? 124 TRP A CB  1 
ATOM   828  C CG  . TRP A 1 110 A 4.148   11.983 81.733 1.00 23.56 ? 124 TRP A CG  1 
ATOM   829  C CD1 . TRP A 1 110 A 4.905   13.086 81.998 1.00 25.50 ? 124 TRP A CD1 1 
ATOM   830  C CD2 . TRP A 1 110 A 5.064   10.948 81.345 1.00 21.60 ? 124 TRP A CD2 1 
ATOM   831  N NE1 . TRP A 1 110 A 6.235   12.813 81.788 1.00 25.41 ? 124 TRP A NE1 1 
ATOM   832  C CE2 . TRP A 1 110 A 6.364   11.509 81.381 1.00 23.47 ? 124 TRP A CE2 1 
ATOM   833  C CE3 . TRP A 1 110 A 4.916   9.604  80.968 1.00 20.20 ? 124 TRP A CE3 1 
ATOM   834  C CZ2 . TRP A 1 110 A 7.507   10.774 81.051 1.00 25.84 ? 124 TRP A CZ2 1 
ATOM   835  C CZ3 . TRP A 1 110 A 6.054   8.873  80.646 1.00 22.56 ? 124 TRP A CZ3 1 
ATOM   836  C CH2 . TRP A 1 110 A 7.333   9.461  80.686 1.00 25.89 ? 124 TRP A CH2 1 
ATOM   837  N N   . GLN A 1 111 ? 1.267   9.316  83.108 1.00 15.44 ? 125 GLN A N   1 
ATOM   838  C CA  . GLN A 1 111 ? 1.224   7.884  83.364 1.00 17.77 ? 125 GLN A CA  1 
ATOM   839  C C   . GLN A 1 111 ? 2.381   7.114  82.714 1.00 18.48 ? 125 GLN A C   1 
ATOM   840  O O   . GLN A 1 111 ? 2.528   7.113  81.492 1.00 18.11 ? 125 GLN A O   1 
ATOM   841  C CB  . GLN A 1 111 ? -0.094  7.317  82.843 1.00 16.34 ? 125 GLN A CB  1 
ATOM   842  C CG  . GLN A 1 111 ? -0.307  5.905  83.263 1.00 16.44 ? 125 GLN A CG  1 
ATOM   843  C CD  . GLN A 1 111 ? -0.172  5.747  84.761 1.00 17.50 ? 125 GLN A CD  1 
ATOM   844  O OE1 . GLN A 1 111 ? 0.902   5.411  85.265 1.00 19.77 ? 125 GLN A OE1 1 
ATOM   845  N NE2 . GLN A 1 111 ? -1.248  6.019  85.482 1.00 18.05 ? 125 GLN A NE2 1 
ATOM   846  N N   . ARG A 1 112 ? 3.211   6.483  83.535 1.00 20.88 ? 126 ARG A N   1 
ATOM   847  C CA  . ARG A 1 112 ? 4.301   5.696  82.993 1.00 23.15 ? 126 ARG A CA  1 
ATOM   848  C C   . ARG A 1 112 ? 4.021   4.218  83.192 1.00 21.74 ? 126 ARG A C   1 
ATOM   849  O O   . ARG A 1 112 ? 4.814   3.372  82.763 1.00 22.44 ? 126 ARG A O   1 
ATOM   850  C CB  . ARG A 1 112 ? 5.662   6.096  83.583 1.00 29.37 ? 126 ARG A CB  1 
ATOM   851  C CG  . ARG A 1 112 ? 5.734   6.231  85.106 1.00 38.04 ? 126 ARG A CG  1 
ATOM   852  C CD  . ARG A 1 112 ? 7.179   6.446  85.573 1.00 47.11 ? 126 ARG A CD  1 
ATOM   853  N NE  . ARG A 1 112 ? 7.828   7.617  84.974 1.00 52.17 ? 126 ARG A NE  1 
ATOM   854  C CZ  . ARG A 1 112 ? 8.736   7.570  83.997 1.00 53.64 ? 126 ARG A CZ  1 
ATOM   855  N NH1 . ARG A 1 112 ? 9.094   6.409  83.458 1.00 52.27 ? 126 ARG A NH1 1 
ATOM   856  N NH2 . ARG A 1 112 ? 9.271   8.696  83.540 1.00 53.58 ? 126 ARG A NH2 1 
ATOM   857  N N   . VAL A 1 113 ? 2.919   3.908  83.878 1.00 21.16 ? 127 VAL A N   1 
ATOM   858  C CA  . VAL A 1 113 ? 2.523   2.531  84.106 1.00 18.59 ? 127 VAL A CA  1 
ATOM   859  C C   . VAL A 1 113 ? 1.488   2.163  83.045 1.00 16.31 ? 127 VAL A C   1 
ATOM   860  O O   . VAL A 1 113 ? 0.406   2.758  82.944 1.00 15.70 ? 127 VAL A O   1 
ATOM   861  C CB  . VAL A 1 113 ? 1.980   2.327  85.514 1.00 19.32 ? 127 VAL A CB  1 
ATOM   862  C CG1 . VAL A 1 113 ? 1.343   0.946  85.648 1.00 19.83 ? 127 VAL A CG1 1 
ATOM   863  C CG2 . VAL A 1 113 ? 3.105   2.465  86.502 1.00 20.15 ? 127 VAL A CG2 1 
ATOM   864  N N   . ASP A 1 114 ? 1.849   1.210  82.202 1.00 16.75 ? 128 ASP A N   1 
ATOM   865  C CA  . ASP A 1 114 ? 0.960   0.827  81.133 1.00 17.76 ? 128 ASP A CA  1 
ATOM   866  C C   . ASP A 1 114 ? -0.220  -0.022 81.565 1.00 19.62 ? 128 ASP A C   1 
ATOM   867  O O   . ASP A 1 114 ? -0.146  -1.244 81.541 1.00 21.65 ? 128 ASP A O   1 
ATOM   868  C CB  . ASP A 1 114 ? 1.721   0.141  80.008 1.00 19.39 ? 128 ASP A CB  1 
ATOM   869  C CG  . ASP A 1 114 ? 0.906   0.028  78.758 1.00 22.22 ? 128 ASP A CG  1 
ATOM   870  O OD1 . ASP A 1 114 ? -0.019  0.826  78.569 1.00 29.21 ? 128 ASP A OD1 1 
ATOM   871  O OD2 . ASP A 1 114 ? 1.183   -0.852 77.943 1.00 25.11 ? 128 ASP A OD2 1 
ATOM   872  N N   . ARG A 1 115 ? -1.302  0.648  81.948 1.00 19.18 ? 129 ARG A N   1 
ATOM   873  C CA  . ARG A 1 115 ? -2.536  -0.004 82.349 1.00 22.09 ? 129 ARG A CA  1 
ATOM   874  C C   . ARG A 1 115 ? -3.764  0.820  81.875 1.00 22.20 ? 129 ARG A C   1 
ATOM   875  O O   . ARG A 1 115 ? -3.735  2.061  81.782 1.00 23.27 ? 129 ARG A O   1 
ATOM   876  C CB  . ARG A 1 115 ? -2.539  -0.266 83.862 1.00 22.94 ? 129 ARG A CB  1 
ATOM   877  C CG  . ARG A 1 115 ? -3.627  -1.190 84.400 1.00 29.02 ? 129 ARG A CG  1 
ATOM   878  C CD  . ARG A 1 115 ? -3.359  -1.679 85.814 1.00 30.79 ? 129 ARG A CD  1 
ATOM   879  N NE  . ARG A 1 115 ? -3.771  -3.077 85.963 1.00 35.64 ? 129 ARG A NE  1 
ATOM   880  C CZ  . ARG A 1 115 ? -4.284  -3.623 87.075 1.00 35.56 ? 129 ARG A CZ  1 
ATOM   881  N NH1 . ARG A 1 115 ? -4.485  -2.893 88.175 1.00 38.93 ? 129 ARG A NH1 1 
ATOM   882  N NH2 . ARG A 1 115 ? -4.606  -4.921 87.082 1.00 37.76 ? 129 ARG A NH2 1 
ATOM   883  N N   . ASP A 1 116 A -4.823  0.119  81.508 1.00 22.07 ? 129 ASP A N   1 
ATOM   884  C CA  . ASP A 1 116 A -6.017  0.783  81.016 1.00 22.47 ? 129 ASP A CA  1 
ATOM   885  C C   . ASP A 1 116 A -6.836  1.509  82.055 1.00 22.78 ? 129 ASP A C   1 
ATOM   886  O O   . ASP A 1 116 A -7.014  0.994  83.153 1.00 22.67 ? 129 ASP A O   1 
ATOM   887  C CB  . ASP A 1 116 A -6.936  -0.234 80.357 1.00 23.72 ? 129 ASP A CB  1 
ATOM   888  C CG  . ASP A 1 116 A -7.441  -1.264 81.322 1.00 26.80 ? 129 ASP A CG  1 
ATOM   889  O OD1 . ASP A 1 116 A -7.095  -1.135 82.514 1.00 27.48 ? 129 ASP A OD1 1 
ATOM   890  O OD2 . ASP A 1 116 A -8.182  -2.186 80.895 1.00 29.33 ? 129 ASP A OD2 1 
ATOM   891  N N   . VAL A 1 117 ? -7.346  2.688  81.698 1.00 20.48 ? 130 VAL A N   1 
ATOM   892  C CA  . VAL A 1 117 ? -8.228  3.419  82.598 1.00 19.04 ? 130 VAL A CA  1 
ATOM   893  C C   . VAL A 1 117 ? -9.530  2.601  82.579 1.00 18.93 ? 130 VAL A C   1 
ATOM   894  O O   . VAL A 1 117 ? -9.893  2.027  81.539 1.00 18.89 ? 130 VAL A O   1 
ATOM   895  C CB  . VAL A 1 117 ? -8.495  4.891  82.118 1.00 17.78 ? 130 VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 117 ? -9.576  5.564  82.980 1.00 17.03 ? 130 VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 117 ? -7.229  5.702  82.240 1.00 18.35 ? 130 VAL A CG2 1 
ATOM   898  N N   . ALA A 1 118 ? -10.169 2.463  83.744 1.00 16.55 ? 131 ALA A N   1 
ATOM   899  C CA  . ALA A 1 118 ? -11.414 1.711  83.838 1.00 17.83 ? 131 ALA A CA  1 
ATOM   900  C C   . ALA A 1 118 ? -12.521 2.343  82.997 1.00 18.11 ? 131 ALA A C   1 
ATOM   901  O O   . ALA A 1 118 ? -12.744 3.550  83.047 1.00 19.29 ? 131 ALA A O   1 
ATOM   902  C CB  . ALA A 1 118 ? -11.865 1.602  85.281 1.00 15.73 ? 131 ALA A CB  1 
ATOM   903  N N   . PRO A 1 119 ? -13.176 1.534  82.155 1.00 17.63 ? 132 PRO A N   1 
ATOM   904  C CA  . PRO A 1 119 ? -14.269 1.989  81.295 1.00 16.72 ? 132 PRO A CA  1 
ATOM   905  C C   . PRO A 1 119 ? -15.368 2.567  82.197 1.00 15.14 ? 132 PRO A C   1 
ATOM   906  O O   . PRO A 1 119 ? -15.760 1.946  83.203 1.00 14.72 ? 132 PRO A O   1 
ATOM   907  C CB  . PRO A 1 119 ? -14.719 0.688  80.632 1.00 20.54 ? 132 PRO A CB  1 
ATOM   908  C CG  . PRO A 1 119 ? -13.447 -0.047 80.480 1.00 21.37 ? 132 PRO A CG  1 
ATOM   909  C CD  . PRO A 1 119 ? -12.776 0.159  81.807 1.00 18.84 ? 132 PRO A CD  1 
ATOM   910  N N   . GLY A 1 120 ? -15.829 3.767  81.874 1.00 13.09 ? 133 GLY A N   1 
ATOM   911  C CA  . GLY A 1 120 ? -16.848 4.402  82.691 1.00 13.34 ? 133 GLY A CA  1 
ATOM   912  C C   . GLY A 1 120 ? -16.262 5.567  83.480 1.00 15.70 ? 133 GLY A C   1 
ATOM   913  O O   . GLY A 1 120 ? -16.986 6.475  83.882 1.00 16.62 ? 133 GLY A O   1 
ATOM   914  N N   . THR A 1 121 ? -14.945 5.555  83.678 1.00 14.82 ? 134 THR A N   1 
ATOM   915  C CA  . THR A 1 121 ? -14.277 6.633  84.404 1.00 12.64 ? 134 THR A CA  1 
ATOM   916  C C   . THR A 1 121 ? -14.372 7.955  83.666 1.00 12.87 ? 134 THR A C   1 
ATOM   917  O O   . THR A 1 121 ? -14.151 8.004  82.453 1.00 14.75 ? 134 THR A O   1 
ATOM   918  C CB  . THR A 1 121 ? -12.784 6.351  84.611 1.00 14.77 ? 134 THR A CB  1 
ATOM   919  O OG1 . THR A 1 121 ? -12.643 5.173  85.381 1.00 13.21 ? 134 THR A OG1 1 
ATOM   920  C CG2 . THR A 1 121 ? -12.089 7.500  85.383 1.00 14.28 ? 134 THR A CG2 1 
ATOM   921  N N   . LEU A 1 122 ? -14.742 9.004  84.399 1.00 11.62 ? 135 LEU A N   1 
ATOM   922  C CA  . LEU A 1 122 ? -14.812 10.353 83.843 1.00 12.72 ? 135 LEU A CA  1 
ATOM   923  C C   . LEU A 1 122 ? -13.441 11.083 83.968 1.00 12.96 ? 135 LEU A C   1 
ATOM   924  O O   . LEU A 1 122 ? -12.909 11.257 85.078 1.00 13.32 ? 135 LEU A O   1 
ATOM   925  C CB  . LEU A 1 122 ? -15.912 11.164 84.540 1.00 13.61 ? 135 LEU A CB  1 
ATOM   926  C CG  . LEU A 1 122 ? -17.375 10.849 84.194 1.00 17.34 ? 135 LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 122 ? -18.282 11.840 84.884 1.00 16.21 ? 135 LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 122 ? -17.606 10.939 82.696 1.00 19.56 ? 135 LEU A CD2 1 
ATOM   929  N N   . CYS A 1 123 ? -12.854 11.431 82.821 1.00 10.75 ? 136 CYS A N   1 
ATOM   930  C CA  . CYS A 1 123 ? -11.577 12.146 82.770 1.00 10.34 ? 136 CYS A CA  1 
ATOM   931  C C   . CYS A 1 123 ? -11.824 13.562 82.303 1.00 9.74  ? 136 CYS A C   1 
ATOM   932  O O   . CYS A 1 123 ? -12.827 13.819 81.639 1.00 9.45  ? 136 CYS A O   1 
ATOM   933  C CB  . CYS A 1 123 ? -10.609 11.454 81.813 1.00 7.72  ? 136 CYS A CB  1 
ATOM   934  S SG  . CYS A 1 123 ? -10.318 9.758  82.361 1.00 12.43 ? 136 CYS A SG  1 
ATOM   935  N N   . ASP A 1 124 ? -10.911 14.464 82.653 1.00 8.49  ? 137 ASP A N   1 
ATOM   936  C CA  . ASP A 1 124 ? -11.020 15.871 82.279 1.00 9.38  ? 137 ASP A CA  1 
ATOM   937  C C   . ASP A 1 124 ? -10.187 16.246 81.025 1.00 9.27  ? 137 ASP A C   1 
ATOM   938  O O   . ASP A 1 124 ? -9.020  15.875 80.908 1.00 9.07  ? 137 ASP A O   1 
ATOM   939  C CB  . ASP A 1 124 ? -10.631 16.755 83.478 1.00 9.50  ? 137 ASP A CB  1 
ATOM   940  C CG  . ASP A 1 124 ? -11.189 18.174 83.375 1.00 16.78 ? 137 ASP A CG  1 
ATOM   941  O OD1 . ASP A 1 124 ? -12.235 18.365 82.716 1.00 21.39 ? 137 ASP A OD1 1 
ATOM   942  O OD2 . ASP A 1 124 ? -10.574 19.092 83.951 1.00 19.84 ? 137 ASP A OD2 1 
ATOM   943  N N   . VAL A 1 125 ? -10.796 16.977 80.096 1.00 8.58  ? 138 VAL A N   1 
ATOM   944  C CA  . VAL A 1 125 ? -10.134 17.413 78.853 1.00 8.07  ? 138 VAL A CA  1 
ATOM   945  C C   . VAL A 1 125 ? -10.315 18.917 78.813 1.00 7.91  ? 138 VAL A C   1 
ATOM   946  O O   . VAL A 1 125 ? -11.443 19.386 78.945 1.00 8.24  ? 138 VAL A O   1 
ATOM   947  C CB  . VAL A 1 125 ? -10.840 16.844 77.603 1.00 9.89  ? 138 VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 125 ? -10.057 17.177 76.330 1.00 10.44 ? 138 VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 125 ? -11.018 15.366 77.757 1.00 12.23 ? 138 VAL A CG2 1 
ATOM   950  N N   . ALA A 1 126 ? -9.229  19.667 78.608 1.00 8.44  ? 139 ALA A N   1 
ATOM   951  C CA  . ALA A 1 126 ? -9.298  21.135 78.550 1.00 8.13  ? 139 ALA A CA  1 
ATOM   952  C C   . ALA A 1 126 ? -8.813  21.632 77.189 1.00 10.13 ? 139 ALA A C   1 
ATOM   953  O O   . ALA A 1 126 ? -8.118  20.911 76.483 1.00 8.95  ? 139 ALA A O   1 
ATOM   954  C CB  . ALA A 1 126 ? -8.464  21.750 79.657 1.00 9.21  ? 139 ALA A CB  1 
ATOM   955  N N   . GLY A 1 127 ? -9.207  22.841 76.801 1.00 7.75  ? 140 GLY A N   1 
ATOM   956  C CA  . GLY A 1 127 ? -8.770  23.373 75.511 1.00 7.61  ? 140 GLY A CA  1 
ATOM   957  C C   . GLY A 1 127 ? -9.421  24.683 75.089 1.00 10.89 ? 140 GLY A C   1 
ATOM   958  O O   . GLY A 1 127 ? -10.366 25.151 75.748 1.00 7.99  ? 140 GLY A O   1 
ATOM   959  N N   . TRP A 1 128 ? -8.841  25.314 74.065 1.00 10.08 ? 141 TRP A N   1 
ATOM   960  C CA  . TRP A 1 128 ? -9.351  26.565 73.519 1.00 10.71 ? 141 TRP A CA  1 
ATOM   961  C C   . TRP A 1 128 ? -9.870  26.367 72.108 1.00 12.76 ? 141 TRP A C   1 
ATOM   962  O O   . TRP A 1 128 ? -9.800  27.266 71.304 1.00 12.32 ? 141 TRP A O   1 
ATOM   963  C CB  . TRP A 1 128 ? -8.262  27.634 73.479 1.00 11.31 ? 141 TRP A CB  1 
ATOM   964  C CG  . TRP A 1 128 ? -7.907  28.271 74.810 1.00 8.80  ? 141 TRP A CG  1 
ATOM   965  C CD1 . TRP A 1 128 ? -8.538  29.332 75.412 1.00 10.24 ? 141 TRP A CD1 1 
ATOM   966  C CD2 . TRP A 1 128 ? -6.776  27.952 75.639 1.00 10.59 ? 141 TRP A CD2 1 
ATOM   967  N NE1 . TRP A 1 128 ? -7.855  29.702 76.559 1.00 9.45  ? 141 TRP A NE1 1 
ATOM   968  C CE2 . TRP A 1 128 ? -6.774  28.874 76.722 1.00 9.20  ? 141 TRP A CE2 1 
ATOM   969  C CE3 . TRP A 1 128 ? -5.758  26.979 75.573 1.00 8.71  ? 141 TRP A CE3 1 
ATOM   970  C CZ2 . TRP A 1 128 ? -5.798  28.847 77.722 1.00 8.60  ? 141 TRP A CZ2 1 
ATOM   971  C CZ3 . TRP A 1 128 ? -4.784  26.960 76.580 1.00 10.23 ? 141 TRP A CZ3 1 
ATOM   972  C CH2 . TRP A 1 128 ? -4.815  27.887 77.633 1.00 7.36  ? 141 TRP A CH2 1 
ATOM   973  N N   . GLY A 1 129 ? -10.328 25.168 71.793 1.00 13.09 ? 142 GLY A N   1 
ATOM   974  C CA  . GLY A 1 129 ? -10.838 24.886 70.466 1.00 10.57 ? 142 GLY A CA  1 
ATOM   975  C C   . GLY A 1 129 ? -12.281 25.318 70.317 1.00 11.47 ? 142 GLY A C   1 
ATOM   976  O O   . GLY A 1 129 ? -12.840 25.871 71.254 1.00 10.28 ? 142 GLY A O   1 
ATOM   977  N N   . ILE A 1 130 ? -12.861 25.074 69.134 1.00 14.81 ? 143 ILE A N   1 
ATOM   978  C CA  . ILE A 1 130 ? -14.255 25.417 68.808 1.00 16.88 ? 143 ILE A CA  1 
ATOM   979  C C   . ILE A 1 130 ? -15.244 24.835 69.832 1.00 15.82 ? 143 ILE A C   1 
ATOM   980  O O   . ILE A 1 130 ? -15.084 23.697 70.294 1.00 17.75 ? 143 ILE A O   1 
ATOM   981  C CB  . ILE A 1 130 ? -14.591 24.941 67.372 1.00 17.45 ? 143 ILE A CB  1 
ATOM   982  C CG1 . ILE A 1 130 ? -13.906 25.846 66.358 1.00 17.96 ? 143 ILE A CG1 1 
ATOM   983  C CG2 . ILE A 1 130 ? -16.090 24.871 67.130 1.00 16.92 ? 143 ILE A CG2 1 
ATOM   984  C CD1 . ILE A 1 130 ? -13.927 25.250 64.964 1.00 20.93 ? 143 ILE A CD1 1 
ATOM   985  N N   . VAL A 1 131 ? -16.244 25.639 70.193 1.00 14.58 ? 144 VAL A N   1 
ATOM   986  C CA  . VAL A 1 131 ? -17.251 25.253 71.185 1.00 14.12 ? 144 VAL A CA  1 
ATOM   987  C C   . VAL A 1 131 ? -18.623 24.859 70.636 1.00 17.43 ? 144 VAL A C   1 
ATOM   988  O O   . VAL A 1 131 ? -19.415 24.223 71.339 1.00 17.73 ? 144 VAL A O   1 
ATOM   989  C CB  . VAL A 1 131 ? -17.493 26.373 72.270 1.00 14.34 ? 144 VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 131 ? -16.252 26.583 73.122 1.00 17.10 ? 144 VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 131 ? -17.946 27.681 71.614 1.00 15.41 ? 144 VAL A CG2 1 
ATOM   992  N N   . ASN A 1 132 ? -18.925 25.244 69.403 1.00 16.12 ? 145 ASN A N   1 
ATOM   993  C CA  . ASN A 1 132 ? -20.227 24.916 68.839 1.00 14.99 ? 145 ASN A CA  1 
ATOM   994  C C   . ASN A 1 132 ? -20.185 24.669 67.339 1.00 14.63 ? 145 ASN A C   1 
ATOM   995  O O   . ASN A 1 132 ? -19.155 24.887 66.692 1.00 10.94 ? 145 ASN A O   1 
ATOM   996  C CB  . ASN A 1 132 ? -21.283 25.985 69.194 1.00 12.16 ? 145 ASN A CB  1 
ATOM   997  C CG  . ASN A 1 132 ? -20.968 27.346 68.601 1.00 13.35 ? 145 ASN A CG  1 
ATOM   998  O OD1 . ASN A 1 132 ? -20.086 27.496 67.740 1.00 17.37 ? 145 ASN A OD1 1 
ATOM   999  N ND2 . ASN A 1 132 ? -21.692 28.352 69.063 1.00 19.02 ? 145 ASN A ND2 1 
ATOM   1000 N N   . HIS A 1 133 ? -21.305 24.228 66.778 1.00 12.90 ? 146 HIS A N   1 
ATOM   1001 C CA  . HIS A 1 133 ? -21.332 23.911 65.354 1.00 15.91 ? 146 HIS A CA  1 
ATOM   1002 C C   . HIS A 1 133 ? -21.016 25.111 64.455 1.00 14.43 ? 146 HIS A C   1 
ATOM   1003 O O   . HIS A 1 133 ? -20.513 24.948 63.350 1.00 11.82 ? 146 HIS A O   1 
ATOM   1004 C CB  . HIS A 1 133 ? -22.665 23.253 64.980 1.00 17.00 ? 146 HIS A CB  1 
ATOM   1005 C CG  . HIS A 1 133 ? -22.684 22.703 63.588 1.00 21.83 ? 146 HIS A CG  1 
ATOM   1006 N ND1 . HIS A 1 133 ? -22.119 21.487 63.259 1.00 23.82 ? 146 HIS A ND1 1 
ATOM   1007 C CD2 . HIS A 1 133 ? -23.145 23.232 62.428 1.00 21.90 ? 146 HIS A CD2 1 
ATOM   1008 C CE1 . HIS A 1 133 ? -22.226 21.294 61.953 1.00 24.81 ? 146 HIS A CE1 1 
ATOM   1009 N NE2 . HIS A 1 133 ? -22.844 22.337 61.425 1.00 26.46 ? 146 HIS A NE2 1 
ATOM   1010 N N   . ALA A 1 134 ? -21.267 26.319 64.965 1.00 14.07 ? 147 ALA A N   1 
ATOM   1011 C CA  . ALA A 1 134 ? -21.024 27.571 64.220 1.00 13.67 ? 147 ALA A CA  1 
ATOM   1012 C C   . ALA A 1 134 ? -19.535 27.918 64.006 1.00 13.01 ? 147 ALA A C   1 
ATOM   1013 O O   . ALA A 1 134 ? -19.199 28.788 63.183 1.00 14.63 ? 147 ALA A O   1 
ATOM   1014 C CB  . ALA A 1 134 ? -21.764 28.744 64.907 1.00 12.86 ? 147 ALA A CB  1 
ATOM   1015 N N   . GLY A 1 135 ? -18.644 27.238 64.734 1.00 14.51 ? 149 GLY A N   1 
ATOM   1016 C CA  . GLY A 1 135 ? -17.224 27.493 64.567 1.00 14.44 ? 149 GLY A CA  1 
ATOM   1017 C C   . GLY A 1 135 ? -16.727 28.566 65.492 1.00 14.71 ? 149 GLY A C   1 
ATOM   1018 O O   . GLY A 1 135 ? -15.616 29.089 65.329 1.00 15.62 ? 149 GLY A O   1 
ATOM   1019 N N   . ARG A 1 136 ? -17.547 28.862 66.490 1.00 17.69 ? 150 ARG A N   1 
ATOM   1020 C CA  . ARG A 1 136 ? -17.233 29.872 67.495 1.00 17.50 ? 150 ARG A CA  1 
ATOM   1021 C C   . ARG A 1 136 ? -16.023 29.471 68.367 1.00 18.20 ? 150 ARG A C   1 
ATOM   1022 O O   . ARG A 1 136 ? -15.984 28.374 68.929 1.00 16.75 ? 150 ARG A O   1 
ATOM   1023 C CB  . ARG A 1 136 ? -18.488 30.127 68.353 1.00 20.91 ? 150 ARG A CB  1 
ATOM   1024 C CG  . ARG A 1 136 ? -18.273 30.945 69.621 1.00 20.81 ? 150 ARG A CG  1 
ATOM   1025 C CD  . ARG A 1 136 ? -19.577 31.079 70.372 1.00 27.29 ? 150 ARG A CD  1 
ATOM   1026 N NE  . ARG A 1 136 ? -19.403 31.135 71.827 1.00 30.73 ? 150 ARG A NE  1 
ATOM   1027 C CZ  . ARG A 1 136 ? -20.012 32.021 72.618 1.00 34.56 ? 150 ARG A CZ  1 
ATOM   1028 N NH1 . ARG A 1 136 ? -20.806 32.950 72.083 1.00 36.18 ? 150 ARG A NH1 1 
ATOM   1029 N NH2 . ARG A 1 136 ? -19.810 32.008 73.939 1.00 34.31 ? 150 ARG A NH2 1 
ATOM   1030 N N   . ARG A 1 137 ? -15.034 30.361 68.457 1.00 16.62 ? 151 ARG A N   1 
ATOM   1031 C CA  . ARG A 1 137 ? -13.822 30.122 69.250 1.00 18.39 ? 151 ARG A CA  1 
ATOM   1032 C C   . ARG A 1 137 ? -13.813 30.946 70.543 1.00 16.93 ? 151 ARG A C   1 
ATOM   1033 O O   . ARG A 1 137 ? -13.946 32.183 70.513 1.00 14.40 ? 151 ARG A O   1 
ATOM   1034 C CB  . ARG A 1 137 ? -12.555 30.373 68.416 1.00 20.39 ? 151 ARG A CB  1 
ATOM   1035 C CG  . ARG A 1 137 ? -12.341 29.360 67.280 1.00 31.09 ? 151 ARG A CG  1 
ATOM   1036 C CD  . ARG A 1 137 ? -11.103 29.691 66.420 1.00 39.78 ? 151 ARG A CD  1 
ATOM   1037 N NE  . ARG A 1 137 ? -10.921 28.708 65.342 1.00 42.89 ? 151 ARG A NE  1 
ATOM   1038 C CZ  . ARG A 1 137 ? -9.938  28.725 64.433 1.00 39.22 ? 151 ARG A CZ  1 
ATOM   1039 N NH1 . ARG A 1 137 ? -8.985  29.664 64.457 1.00 39.27 ? 151 ARG A NH1 1 
ATOM   1040 N NH2 . ARG A 1 137 ? -9.896  27.765 63.507 1.00 30.19 ? 151 ARG A NH2 1 
ATOM   1041 N N   . PRO A 1 138 ? -13.658 30.265 71.696 1.00 16.68 ? 152 PRO A N   1 
ATOM   1042 C CA  . PRO A 1 138 ? -13.642 30.921 72.996 1.00 15.94 ? 152 PRO A CA  1 
ATOM   1043 C C   . PRO A 1 138 ? -12.342 31.661 73.303 1.00 15.69 ? 152 PRO A C   1 
ATOM   1044 O O   . PRO A 1 138 ? -11.274 31.326 72.790 1.00 18.06 ? 152 PRO A O   1 
ATOM   1045 C CB  . PRO A 1 138 ? -13.910 29.755 73.961 1.00 14.71 ? 152 PRO A CB  1 
ATOM   1046 C CG  . PRO A 1 138 ? -13.177 28.590 73.315 1.00 12.01 ? 152 PRO A CG  1 
ATOM   1047 C CD  . PRO A 1 138 ? -13.464 28.807 71.825 1.00 12.70 ? 152 PRO A CD  1 
ATOM   1048 N N   . ASP A 1 139 ? -12.474 32.710 74.099 1.00 14.96 ? 153 ASP A N   1 
ATOM   1049 C CA  . ASP A 1 139 ? -11.347 33.529 74.532 1.00 17.50 ? 153 ASP A CA  1 
ATOM   1050 C C   . ASP A 1 139 ? -10.691 32.868 75.757 1.00 17.93 ? 153 ASP A C   1 
ATOM   1051 O O   . ASP A 1 139 ? -9.478  32.937 75.921 1.00 20.26 ? 153 ASP A O   1 
ATOM   1052 C CB  . ASP A 1 139 ? -11.850 34.938 74.900 1.00 18.11 ? 153 ASP A CB  1 
ATOM   1053 C CG  . ASP A 1 139 ? -10.865 35.706 75.770 1.00 18.55 ? 153 ASP A CG  1 
ATOM   1054 O OD1 . ASP A 1 139 ? -9.696  35.830 75.315 1.00 15.22 ? 153 ASP A OD1 1 
ATOM   1055 O OD2 . ASP A 1 139 ? -11.243 36.138 76.906 1.00 23.40 ? 153 ASP A OD2 1 
ATOM   1056 N N   . SER A 1 140 ? -11.520 32.255 76.612 1.00 17.22 ? 154 SER A N   1 
ATOM   1057 C CA  . SER A 1 140 ? -11.088 31.588 77.848 1.00 16.72 ? 154 SER A CA  1 
ATOM   1058 C C   . SER A 1 140 ? -11.105 30.059 77.792 1.00 15.08 ? 154 SER A C   1 
ATOM   1059 O O   . SER A 1 140 ? -11.885 29.466 77.068 1.00 14.27 ? 154 SER A O   1 
ATOM   1060 C CB  . SER A 1 140 ? -11.956 32.035 79.015 1.00 18.87 ? 154 SER A CB  1 
ATOM   1061 O OG  . SER A 1 140 ? -11.622 33.351 79.415 1.00 27.46 ? 154 SER A OG  1 
ATOM   1062 N N   . LEU A 1 141 ? -10.242 29.441 78.590 1.00 16.00 ? 155 LEU A N   1 
ATOM   1063 C CA  . LEU A 1 141 ? -10.125 27.990 78.644 1.00 12.63 ? 155 LEU A CA  1 
ATOM   1064 C C   . LEU A 1 141 ? -11.430 27.284 79.030 1.00 11.47 ? 155 LEU A C   1 
ATOM   1065 O O   . LEU A 1 141 ? -12.079 27.644 80.008 1.00 13.10 ? 155 LEU A O   1 
ATOM   1066 C CB  . LEU A 1 141 ? -8.984  27.584 79.598 1.00 11.52 ? 155 LEU A CB  1 
ATOM   1067 C CG  . LEU A 1 141 ? -8.642  26.097 79.668 1.00 8.43  ? 155 LEU A CG  1 
ATOM   1068 C CD1 . LEU A 1 141 ? -7.920  25.681 78.408 1.00 11.96 ? 155 LEU A CD1 1 
ATOM   1069 C CD2 . LEU A 1 141 ? -7.758  25.819 80.877 1.00 10.36 ? 155 LEU A CD2 1 
ATOM   1070 N N   . GLN A 1 142 ? -11.803 26.291 78.230 1.00 10.12 ? 156 GLN A N   1 
ATOM   1071 C CA  . GLN A 1 142 ? -13.009 25.484 78.453 1.00 9.55  ? 156 GLN A CA  1 
ATOM   1072 C C   . GLN A 1 142 ? -12.546 24.106 78.899 1.00 11.78 ? 156 GLN A C   1 
ATOM   1073 O O   . GLN A 1 142 ? -11.366 23.768 78.759 1.00 14.32 ? 156 GLN A O   1 
ATOM   1074 C CB  . GLN A 1 142 ? -13.825 25.327 77.150 1.00 8.39  ? 156 GLN A CB  1 
ATOM   1075 C CG  . GLN A 1 142 ? -14.193 26.650 76.460 1.00 9.14  ? 156 GLN A CG  1 
ATOM   1076 C CD  . GLN A 1 142 ? -15.099 27.546 77.317 1.00 12.14 ? 156 GLN A CD  1 
ATOM   1077 O OE1 . GLN A 1 142 ? -14.830 28.761 77.511 1.00 16.18 ? 156 GLN A OE1 1 
ATOM   1078 N NE2 . GLN A 1 142 ? -16.198 26.963 77.807 1.00 15.76 ? 156 GLN A NE2 1 
ATOM   1079 N N   . HIS A 1 143 ? -13.466 23.315 79.446 1.00 13.10 ? 157 HIS A N   1 
ATOM   1080 C CA  . HIS A 1 143 ? -13.149 21.953 79.871 1.00 11.26 ? 157 HIS A CA  1 
ATOM   1081 C C   . HIS A 1 143 ? -14.404 21.098 79.941 1.00 12.21 ? 157 HIS A C   1 
ATOM   1082 O O   . HIS A 1 143 ? -15.514 21.639 80.040 1.00 12.66 ? 157 HIS A O   1 
ATOM   1083 C CB  . HIS A 1 143 ? -12.378 21.953 81.224 1.00 13.78 ? 157 HIS A CB  1 
ATOM   1084 C CG  . HIS A 1 143 ? -13.242 21.998 82.461 1.00 13.92 ? 157 HIS A CG  1 
ATOM   1085 N ND1 . HIS A 1 143 ? -13.559 20.872 83.193 1.00 12.11 ? 157 HIS A ND1 1 
ATOM   1086 C CD2 . HIS A 1 143 ? -13.812 23.037 83.120 1.00 12.91 ? 157 HIS A CD2 1 
ATOM   1087 C CE1 . HIS A 1 143 ? -14.290 21.210 84.241 1.00 15.68 ? 157 HIS A CE1 1 
ATOM   1088 N NE2 . HIS A 1 143 ? -14.457 22.517 84.220 1.00 14.92 ? 157 HIS A NE2 1 
ATOM   1089 N N   . VAL A 1 144 ? -14.232 19.785 79.769 1.00 10.18 ? 158 VAL A N   1 
ATOM   1090 C CA  . VAL A 1 144 ? -15.339 18.831 79.913 1.00 12.69 ? 158 VAL A CA  1 
ATOM   1091 C C   . VAL A 1 144 ? -14.823 17.551 80.528 1.00 10.92 ? 158 VAL A C   1 
ATOM   1092 O O   . VAL A 1 144 ? -13.635 17.251 80.405 1.00 10.35 ? 158 VAL A O   1 
ATOM   1093 C CB  . VAL A 1 144 ? -16.016 18.319 78.603 1.00 13.19 ? 158 VAL A CB  1 
ATOM   1094 C CG1 . VAL A 1 144 ? -17.318 19.000 78.361 1.00 16.22 ? 158 VAL A CG1 1 
ATOM   1095 C CG2 . VAL A 1 144 ? -15.070 18.288 77.444 1.00 10.63 ? 158 VAL A CG2 1 
ATOM   1096 N N   . LEU A 1 145 ? -15.731 16.817 81.181 1.00 12.34 ? 159 LEU A N   1 
ATOM   1097 C CA  . LEU A 1 145 ? -15.460 15.503 81.790 1.00 12.57 ? 159 LEU A CA  1 
ATOM   1098 C C   . LEU A 1 145 ? -16.061 14.534 80.787 1.00 13.40 ? 159 LEU A C   1 
ATOM   1099 O O   . LEU A 1 145 ? -17.228 14.688 80.398 1.00 12.75 ? 159 LEU A O   1 
ATOM   1100 C CB  . LEU A 1 145 ? -16.153 15.350 83.153 1.00 15.27 ? 159 LEU A CB  1 
ATOM   1101 C CG  . LEU A 1 145 ? -15.572 16.162 84.329 1.00 17.40 ? 159 LEU A CG  1 
ATOM   1102 C CD1 . LEU A 1 145 ? -16.559 16.235 85.490 1.00 20.21 ? 159 LEU A CD1 1 
ATOM   1103 C CD2 . LEU A 1 145 ? -14.260 15.541 84.799 1.00 17.72 ? 159 LEU A CD2 1 
ATOM   1104 N N   . LEU A 1 146 ? -15.237 13.619 80.288 1.00 11.61 ? 160 LEU A N   1 
ATOM   1105 C CA  . LEU A 1 146 ? -15.654 12.625 79.292 1.00 9.89  ? 160 LEU A CA  1 
ATOM   1106 C C   . LEU A 1 146 ? -15.465 11.194 79.813 1.00 9.61  ? 160 LEU A C   1 
ATOM   1107 O O   . LEU A 1 146 ? -14.519 10.924 80.543 1.00 13.41 ? 160 LEU A O   1 
ATOM   1108 C CB  . LEU A 1 146 ? -14.836 12.827 78.013 1.00 7.54  ? 160 LEU A CB  1 
ATOM   1109 C CG  . LEU A 1 146 ? -15.435 13.578 76.822 1.00 8.35  ? 160 LEU A CG  1 
ATOM   1110 C CD1 . LEU A 1 146 ? -16.404 14.680 77.233 1.00 10.20 ? 160 LEU A CD1 1 
ATOM   1111 C CD2 . LEU A 1 146 ? -14.302 14.095 75.951 1.00 10.38 ? 160 LEU A CD2 1 
ATOM   1112 N N   . PRO A 1 147 ? -16.427 10.291 79.542 1.00 9.83  ? 161 PRO A N   1 
ATOM   1113 C CA  . PRO A 1 147 ? -16.254 8.909  80.038 1.00 11.28 ? 161 PRO A CA  1 
ATOM   1114 C C   . PRO A 1 147 ? -15.415 8.084  79.063 1.00 10.23 ? 161 PRO A C   1 
ATOM   1115 O O   . PRO A 1 147 ? -15.589 8.233  77.835 1.00 9.01  ? 161 PRO A O   1 
ATOM   1116 C CB  . PRO A 1 147 ? -17.701 8.387  80.134 1.00 9.69  ? 161 PRO A CB  1 
ATOM   1117 C CG  . PRO A 1 147 ? -18.401 9.104  78.975 1.00 9.77  ? 161 PRO A CG  1 
ATOM   1118 C CD  . PRO A 1 147 ? -17.808 10.531 79.059 1.00 9.60  ? 161 PRO A CD  1 
ATOM   1119 N N   . VAL A 1 148 ? -14.463 7.299  79.580 1.00 9.59  ? 162 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 148 ? -13.655 6.478  78.701 1.00 10.39 ? 162 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 148 ? -14.388 5.164  78.420 1.00 11.53 ? 162 VAL A C   1 
ATOM   1122 O O   . VAL A 1 148 ? -14.980 4.527  79.319 1.00 11.46 ? 162 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 148 ? -12.183 6.259  79.172 1.00 13.09 ? 162 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 148 ? -11.669 7.476  79.954 1.00 12.91 ? 162 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 148 ? -12.027 4.995  79.954 1.00 11.34 ? 162 VAL A CG2 1 
ATOM   1126 N N   . LEU A 1 149 ? -14.435 4.844  77.134 1.00 12.59 ? 163 LEU A N   1 
ATOM   1127 C CA  . LEU A 1 149 ? -15.090 3.654  76.605 1.00 13.82 ? 163 LEU A CA  1 
ATOM   1128 C C   . LEU A 1 149 ? -14.200 2.411  76.796 1.00 14.40 ? 163 LEU A C   1 
ATOM   1129 O O   . LEU A 1 149 ? -12.987 2.547  77.014 1.00 15.76 ? 163 LEU A O   1 
ATOM   1130 C CB  . LEU A 1 149 ? -15.332 3.898  75.104 1.00 14.25 ? 163 LEU A CB  1 
ATOM   1131 C CG  . LEU A 1 149 ? -16.294 5.016  74.712 1.00 15.10 ? 163 LEU A CG  1 
ATOM   1132 C CD1 . LEU A 1 149 ? -16.349 5.191  73.226 1.00 14.36 ? 163 LEU A CD1 1 
ATOM   1133 C CD2 . LEU A 1 149 ? -17.663 4.782  75.306 1.00 17.37 ? 163 LEU A CD2 1 
ATOM   1134 N N   . ASP A 1 150 ? -14.773 1.203  76.786 1.00 15.70 ? 164 ASP A N   1 
ATOM   1135 C CA  . ASP A 1 150 ? -13.879 0.051  76.868 1.00 19.01 ? 164 ASP A CA  1 
ATOM   1136 C C   . ASP A 1 150 ? -13.236 -0.158 75.462 1.00 18.51 ? 164 ASP A C   1 
ATOM   1137 O O   . ASP A 1 150 ? -13.754 0.327  74.435 1.00 17.73 ? 164 ASP A O   1 
ATOM   1138 C CB  . ASP A 1 150 ? -14.510 -1.213 77.499 1.00 21.51 ? 164 ASP A CB  1 
ATOM   1139 C CG  . ASP A 1 150 ? -15.661 -1.785 76.709 1.00 24.82 ? 164 ASP A CG  1 
ATOM   1140 O OD1 . ASP A 1 150 ? -15.965 -1.240 75.633 1.00 28.52 ? 164 ASP A OD1 1 
ATOM   1141 O OD2 . ASP A 1 150 ? -16.298 -2.732 77.170 1.00 24.67 ? 164 ASP A OD2 1 
ATOM   1142 N N   . ARG A 1 151 ? -12.089 -0.819 75.425 1.00 17.18 ? 165 ARG A N   1 
ATOM   1143 C CA  . ARG A 1 151 ? -11.373 -1.000 74.175 1.00 21.04 ? 165 ARG A CA  1 
ATOM   1144 C C   . ARG A 1 151 ? -12.171 -1.641 73.035 1.00 21.95 ? 165 ARG A C   1 
ATOM   1145 O O   . ARG A 1 151 ? -12.177 -1.129 71.923 1.00 21.84 ? 165 ARG A O   1 
ATOM   1146 C CB  . ARG A 1 151 ? -10.037 -1.725 74.430 1.00 22.72 ? 165 ARG A CB  1 
ATOM   1147 C CG  . ARG A 1 151 ? -10.142 -2.950 75.327 1.00 26.08 ? 165 ARG A CG  1 
ATOM   1148 C CD  . ARG A 1 151 ? -8.782  -3.381 75.930 1.00 28.00 ? 165 ARG A CD  1 
ATOM   1149 N NE  . ARG A 1 151 ? -7.671  -2.442 75.662 1.00 23.46 ? 165 ARG A NE  1 
ATOM   1150 C CZ  . ARG A 1 151 ? -7.409  -1.830 74.501 1.00 26.62 ? 165 ARG A CZ  1 
ATOM   1151 N NH1 . ARG A 1 151 ? -7.159  -2.566 73.408 1.00 25.82 ? 165 ARG A NH1 1 
ATOM   1152 N NH2 . ARG A 1 151 ? -7.375  -0.503 74.432 1.00 26.82 ? 165 ARG A NH2 1 
ATOM   1153 N N   . ALA A 1 152 ? -12.887 -2.721 73.318 1.00 21.74 ? 166 ALA A N   1 
ATOM   1154 C CA  . ALA A 1 152 ? -13.665 -3.394 72.288 1.00 21.43 ? 166 ALA A CA  1 
ATOM   1155 C C   . ALA A 1 152 ? -14.698 -2.459 71.650 1.00 19.95 ? 166 ALA A C   1 
ATOM   1156 O O   . ALA A 1 152 ? -14.913 -2.503 70.443 1.00 18.57 ? 166 ALA A O   1 
ATOM   1157 C CB  . ALA A 1 152 ? -14.320 -4.629 72.856 1.00 22.26 ? 166 ALA A CB  1 
ATOM   1158 N N   . THR A 1 153 ? -15.316 -1.594 72.450 1.00 20.86 ? 167 THR A N   1 
ATOM   1159 C CA  . THR A 1 153 ? -16.293 -0.637 71.926 1.00 19.92 ? 167 THR A CA  1 
ATOM   1160 C C   . THR A 1 153 ? -15.565 0.431  71.087 1.00 19.70 ? 167 THR A C   1 
ATOM   1161 O O   . THR A 1 153 ? -16.100 0.914  70.089 1.00 23.22 ? 167 THR A O   1 
ATOM   1162 C CB  . THR A 1 153 ? -17.091 0.034  73.077 1.00 19.35 ? 167 THR A CB  1 
ATOM   1163 O OG1 . THR A 1 153 ? -17.823 -0.975 73.784 1.00 22.93 ? 167 THR A OG1 1 
ATOM   1164 C CG2 . THR A 1 153 ? -18.071 1.082  72.545 1.00 17.47 ? 167 THR A CG2 1 
ATOM   1165 N N   . CYS A 1 154 ? -14.357 0.800  71.527 1.00 17.92 ? 168 CYS A N   1 
ATOM   1166 C CA  . CYS A 1 154 ? -13.495 1.787  70.856 1.00 19.78 ? 168 CYS A CA  1 
ATOM   1167 C C   . CYS A 1 154 ? -13.130 1.188  69.482 1.00 19.89 ? 168 CYS A C   1 
ATOM   1168 O O   . CYS A 1 154 ? -13.410 1.799  68.431 1.00 19.46 ? 168 CYS A O   1 
ATOM   1169 C CB  . CYS A 1 154 ? -12.231 2.026  71.741 1.00 18.74 ? 168 CYS A CB  1 
ATOM   1170 S SG  . CYS A 1 154 ? -10.880 3.208  71.277 1.00 16.92 ? 168 CYS A SG  1 
ATOM   1171 N N   . ASN A 1 155 ? -12.646 -0.068 69.509 1.00 19.90 ? 169 ASN A N   1 
ATOM   1172 C CA  . ASN A 1 155 ? -12.209 -0.826 68.318 1.00 20.51 ? 169 ASN A CA  1 
ATOM   1173 C C   . ASN A 1 155 ? -13.295 -0.860 67.243 1.00 23.04 ? 169 ASN A C   1 
ATOM   1174 O O   . ASN A 1 155 ? -13.078 -0.422 66.103 1.00 24.36 ? 169 ASN A O   1 
ATOM   1175 C CB  . ASN A 1 155 ? -11.880 -2.279 68.669 1.00 20.06 ? 169 ASN A CB  1 
ATOM   1176 C CG  . ASN A 1 155 ? -10.619 -2.422 69.523 1.00 18.47 ? 169 ASN A CG  1 
ATOM   1177 O OD1 . ASN A 1 155 ? -10.123 -1.432 70.058 1.00 24.11 ? 169 ASN A OD1 1 
ATOM   1178 N ND2 . ASN A 1 155 ? -10.064 -3.608 69.687 1.00 13.72 ? 169 ASN A ND2 1 
ATOM   1179 N N   . ARG A 1 156 ? -14.431 -1.330 67.663 1.00 22.44 ? 170 ARG A N   1 
ATOM   1180 C CA  . ARG A 1 156 ? -15.581 -1.580 66.783 1.00 24.98 ? 170 ARG A CA  1 
ATOM   1181 C C   . ARG A 1 156 ? -16.107 -0.265 66.202 1.00 24.43 ? 170 ARG A C   1 
ATOM   1182 O O   . ARG A 1 156 ? -16.341 -0.145 64.992 1.00 20.42 ? 170 ARG A O   1 
ATOM   1183 C CB  . ARG A 1 156 ? -16.718 -2.238 67.569 1.00 29.33 ? 170 ARG A CB  1 
ATOM   1184 C CG  . ARG A 1 156 ? -18.020 -2.331 66.768 1.00 32.81 ? 170 ARG A CG  1 
ATOM   1185 C CD  . ARG A 1 156 ? -19.228 -1.769 67.520 1.00 39.39 ? 170 ARG A CD  1 
ATOM   1186 N NE  . ARG A 1 156 ? -19.400 -2.364 68.852 1.00 43.80 ? 170 ARG A NE  1 
ATOM   1187 C CZ  . ARG A 1 156 ? -20.225 -1.879 69.789 1.00 46.05 ? 170 ARG A CZ  1 
ATOM   1188 N NH1 . ARG A 1 156 ? -20.966 -0.787 69.557 1.00 45.36 ? 170 ARG A NH1 1 
ATOM   1189 N NH2 . ARG A 1 156 ? -20.381 -2.422 71.004 1.00 44.72 ? 170 ARG A NH2 1 
ATOM   1190 N N   . ARG A 1 157 A -16.278 0.700  67.082 1.00 27.26 ? 170 ARG A N   1 
ATOM   1191 C CA  . ARG A 1 157 A -16.826 2.004  66.702 1.00 29.44 ? 170 ARG A CA  1 
ATOM   1192 C C   . ARG A 1 157 A -15.892 2.737  65.743 1.00 28.02 ? 170 ARG A C   1 
ATOM   1193 O O   . ARG A 1 157 A -16.267 3.099  64.625 1.00 27.34 ? 170 ARG A O   1 
ATOM   1194 C CB  . ARG A 1 157 A -17.081 2.854  67.939 1.00 32.79 ? 170 ARG A CB  1 
ATOM   1195 C CG  . ARG A 1 157 A -18.542 2.770  68.380 1.00 37.33 ? 170 ARG A CG  1 
ATOM   1196 C CD  . ARG A 1 157 A -18.882 3.704  69.533 1.00 40.28 ? 170 ARG A CD  1 
ATOM   1197 N NE  . ARG A 1 157 A -18.910 5.117  69.140 1.00 47.67 ? 170 ARG A NE  1 
ATOM   1198 C CZ  . ARG A 1 157 A -18.947 6.126  70.016 1.00 50.16 ? 170 ARG A CZ  1 
ATOM   1199 N NH1 . ARG A 1 157 A -18.964 5.888  71.334 1.00 50.21 ? 170 ARG A NH1 1 
ATOM   1200 N NH2 . ARG A 1 157 A -18.968 7.418  69.670 1.00 50.17 ? 170 ARG A NH2 1 
ATOM   1201 N N   . THR A 1 158 B -14.674 2.957  66.159 1.00 29.51 ? 170 THR A N   1 
ATOM   1202 C CA  . THR A 1 158 B -13.745 3.682  65.304 1.00 28.96 ? 170 THR A CA  1 
ATOM   1203 C C   . THR A 1 158 B -13.486 2.883  63.984 1.00 27.92 ? 170 THR A C   1 
ATOM   1204 O O   . THR A 1 158 B -14.186 3.053  62.983 1.00 25.97 ? 170 THR A O   1 
ATOM   1205 C CB  . THR A 1 158 B -12.458 4.008  66.078 1.00 28.49 ? 170 THR A CB  1 
ATOM   1206 O OG1 . THR A 1 158 B -11.863 2.828  66.582 1.00 29.17 ? 170 THR A OG1 1 
ATOM   1207 C CG2 . THR A 1 158 B -12.703 4.940  67.278 1.00 31.04 ? 170 THR A CG2 1 
ATOM   1208 N N   . HIS A 1 159 ? -12.508 2.002  64.020 1.00 26.85 ? 171 HIS A N   1 
ATOM   1209 C CA  . HIS A 1 159 ? -11.962 1.259  62.829 1.00 23.67 ? 171 HIS A CA  1 
ATOM   1210 C C   . HIS A 1 159 ? -12.987 0.550  61.886 1.00 21.90 ? 171 HIS A C   1 
ATOM   1211 O O   . HIS A 1 159 ? -13.064 0.805  60.657 1.00 19.33 ? 171 HIS A O   1 
ATOM   1212 C CB  . HIS A 1 159 ? -10.989 0.196  63.341 1.00 23.32 ? 171 HIS A CB  1 
ATOM   1213 C CG  . HIS A 1 159 ? -9.805  0.833  64.082 1.00 23.13 ? 171 HIS A CG  1 
ATOM   1214 N ND1 . HIS A 1 159 ? -8.564  0.980  63.477 1.00 23.11 ? 171 HIS A ND1 1 
ATOM   1215 C CD2 . HIS A 1 159 ? -9.677  1.357  65.336 1.00 24.46 ? 171 HIS A CD2 1 
ATOM   1216 C CE1 . HIS A 1 159 ? -7.752  1.570  64.334 1.00 21.25 ? 171 HIS A CE1 1 
ATOM   1217 N NE2 . HIS A 1 159 ? -8.399  1.803  65.446 1.00 22.14 ? 171 HIS A NE2 1 
ATOM   1218 N N   . HIS A 1 160 ? -13.654 -0.251 62.388 1.00 18.73 ? 172 HIS A N   1 
ATOM   1219 C CA  . HIS A 1 160 ? -14.644 -1.141 61.769 1.00 19.38 ? 172 HIS A CA  1 
ATOM   1220 C C   . HIS A 1 160 ? -13.970 -2.448 61.348 1.00 20.91 ? 172 HIS A C   1 
ATOM   1221 O O   . HIS A 1 160 ? -13.249 -2.483 60.323 1.00 24.22 ? 172 HIS A O   1 
ATOM   1222 C CB  . HIS A 1 160 ? -15.282 -0.453 60.563 1.00 11.60 ? 172 HIS A CB  1 
ATOM   1223 C CG  . HIS A 1 160 ? -16.294 -1.337 59.823 1.00 10.06 ? 172 HIS A CG  1 
ATOM   1224 N ND1 . HIS A 1 160 ? -17.467 -1.800 60.423 1.00 11.75 ? 172 HIS A ND1 1 
ATOM   1225 C CD2 . HIS A 1 160 ? -16.301 -1.830 58.558 1.00 10.39 ? 172 HIS A CD2 1 
ATOM   1226 C CE1 . HIS A 1 160 ? -18.121 -2.535 59.537 1.00 12.20 ? 172 HIS A CE1 1 
ATOM   1227 N NE2 . HIS A 1 160 ? -17.438 -2.563 58.420 1.00 10.96 ? 172 HIS A NE2 1 
ATOM   1228 N N   . ASP A 1 161 ? -14.274 -3.390 62.215 1.00 24.96 ? 173 ASP A N   1 
ATOM   1229 C CA  . ASP A 1 161 ? -13.896 -4.801 62.162 1.00 25.64 ? 173 ASP A CA  1 
ATOM   1230 C C   . ASP A 1 161 ? -12.479 -5.047 62.724 1.00 27.55 ? 173 ASP A C   1 
ATOM   1231 O O   . ASP A 1 161 ? -12.308 -5.819 63.681 1.00 31.22 ? 173 ASP A O   1 
ATOM   1232 C CB  . ASP A 1 161 ? -14.078 -5.335 60.742 1.00 25.09 ? 173 ASP A CB  1 
ATOM   1233 C CG  . ASP A 1 161 ? -15.512 -5.843 60.543 1.00 26.25 ? 173 ASP A CG  1 
ATOM   1234 O OD1 . ASP A 1 161 ? -16.238 -6.122 61.579 1.00 23.19 ? 173 ASP A OD1 1 
ATOM   1235 O OD2 . ASP A 1 161 ? -16.002 -5.987 59.362 1.00 27.98 ? 173 ASP A OD2 1 
ATOM   1236 N N   . GLY A 1 162 ? -11.486 -4.366 62.166 1.00 28.06 ? 174 GLY A N   1 
ATOM   1237 C CA  . GLY A 1 162 ? -10.059 -4.634 62.505 1.00 27.36 ? 174 GLY A CA  1 
ATOM   1238 C C   . GLY A 1 162 ? -9.408  -3.647 63.498 1.00 28.81 ? 174 GLY A C   1 
ATOM   1239 O O   . GLY A 1 162 ? -9.216  -2.462 63.164 1.00 28.33 ? 174 GLY A O   1 
ATOM   1240 N N   . ALA A 1 163 ? -9.078  -4.252 64.639 1.00 25.72 ? 175 ALA A N   1 
ATOM   1241 C CA  . ALA A 1 163 ? -8.375  -3.653 65.805 1.00 22.74 ? 175 ALA A CA  1 
ATOM   1242 C C   . ALA A 1 163 ? -8.395  -2.128 65.777 1.00 20.65 ? 175 ALA A C   1 
ATOM   1243 O O   . ALA A 1 163 ? -7.677  -1.488 64.997 1.00 18.98 ? 175 ALA A O   1 
ATOM   1244 C CB  . ALA A 1 163 ? -6.911  -4.125 65.817 1.00 21.60 ? 175 ALA A CB  1 
ATOM   1245 N N   . ILE A 1 164 ? -8.481  -1.603 67.163 1.00 19.09 ? 176 ILE A N   1 
ATOM   1246 C CA  . ILE A 1 164 ? -7.966  -0.266 67.565 1.00 16.80 ? 176 ILE A CA  1 
ATOM   1247 C C   . ILE A 1 164 ? -6.788  -0.581 68.476 1.00 17.67 ? 176 ILE A C   1 
ATOM   1248 O O   . ILE A 1 164 ? -6.941  -1.302 69.479 1.00 21.16 ? 176 ILE A O   1 
ATOM   1249 C CB  . ILE A 1 164 ? -8.887  0.701  68.329 1.00 15.61 ? 176 ILE A CB  1 
ATOM   1250 C CG1 . ILE A 1 164 ? -9.057  2.219  68.195 1.00 12.54 ? 176 ILE A CG1 1 
ATOM   1251 C CG2 . ILE A 1 164 ? -8.342  0.455  69.723 1.00 9.67  ? 176 ILE A CG2 1 
ATOM   1252 C CD1 . ILE A 1 164 ? -10.396 2.741  68.730 1.00 14.44 ? 176 ILE A CD1 1 
ATOM   1253 N N   . THR A 1 165 ? -5.705  0.056  68.087 1.00 19.12 ? 177 THR A N   1 
ATOM   1254 C CA  . THR A 1 165 ? -4.408  -0.311 68.668 1.00 17.56 ? 177 THR A CA  1 
ATOM   1255 C C   . THR A 1 165 ? -4.456  -0.122 70.184 1.00 16.29 ? 177 THR A C   1 
ATOM   1256 O O   . THR A 1 165 ? -5.364  0.542  70.720 1.00 16.15 ? 177 THR A O   1 
ATOM   1257 C CB  . THR A 1 165 ? -3.302  0.530  68.024 1.00 20.37 ? 177 THR A CB  1 
ATOM   1258 O OG1 . THR A 1 165 ? -3.308  1.848  68.542 1.00 21.64 ? 177 THR A OG1 1 
ATOM   1259 C CG2 . THR A 1 165 ? -3.463  0.631  66.503 1.00 21.86 ? 177 THR A CG2 1 
ATOM   1260 N N   . GLU A 1 166 ? -3.481  -0.758 70.798 1.00 20.02 ? 178 GLU A N   1 
ATOM   1261 C CA  . GLU A 1 166 ? -3.317  -0.764 72.246 1.00 23.02 ? 178 GLU A CA  1 
ATOM   1262 C C   . GLU A 1 166 ? -2.713  0.572  72.708 1.00 18.01 ? 178 GLU A C   1 
ATOM   1263 O O   . GLU A 1 166 ? -2.590  0.835  73.911 1.00 16.70 ? 178 GLU A O   1 
ATOM   1264 C CB  . GLU A 1 166 ? -2.393  -1.924 72.671 1.00 33.42 ? 178 GLU A CB  1 
ATOM   1265 C CG  . GLU A 1 166 ? -2.699  -3.265 71.974 1.00 43.69 ? 178 GLU A CG  1 
ATOM   1266 C CD  . GLU A 1 166 ? -4.124  -3.780 72.219 1.00 50.02 ? 178 GLU A CD  1 
ATOM   1267 O OE1 . GLU A 1 166 ? -4.437  -4.330 73.344 1.00 53.85 ? 178 GLU A OE1 1 
ATOM   1268 O OE2 . GLU A 1 166 ? -5.014  -3.666 71.291 1.00 52.52 ? 178 GLU A OE2 1 
ATOM   1269 N N   . ARG A 1 167 ? -2.358  1.405  71.733 1.00 16.07 ? 179 ARG A N   1 
ATOM   1270 C CA  . ARG A 1 167 ? -1.725  2.721  71.997 1.00 17.37 ? 179 ARG A CA  1 
ATOM   1271 C C   . ARG A 1 167 ? -2.742  3.864  71.905 1.00 16.02 ? 179 ARG A C   1 
ATOM   1272 O O   . ARG A 1 167 ? -2.382  5.048  72.046 1.00 16.51 ? 179 ARG A O   1 
ATOM   1273 C CB  . ARG A 1 167 ? -0.614  2.986  70.978 1.00 22.01 ? 179 ARG A CB  1 
ATOM   1274 C CG  . ARG A 1 167 ? 0.471   1.908  70.992 1.00 29.62 ? 179 ARG A CG  1 
ATOM   1275 C CD  . ARG A 1 167 ? 1.658   2.234  70.085 1.00 34.14 ? 179 ARG A CD  1 
ATOM   1276 N NE  . ARG A 1 167 ? 2.803   2.785  70.820 1.00 37.28 ? 179 ARG A NE  1 
ATOM   1277 C CZ  . ARG A 1 167 ? 4.050   2.847  70.339 1.00 39.79 ? 179 ARG A CZ  1 
ATOM   1278 N NH1 . ARG A 1 167 ? 4.342   2.392  69.114 1.00 41.28 ? 179 ARG A NH1 1 
ATOM   1279 N NH2 . ARG A 1 167 ? 5.083   3.359  71.021 1.00 39.11 ? 179 ARG A NH2 1 
ATOM   1280 N N   . LEU A 1 168 ? -4.026  3.581  71.808 1.00 15.03 ? 180 LEU A N   1 
ATOM   1281 C CA  . LEU A 1 168 ? -5.076  4.586  71.731 1.00 13.21 ? 180 LEU A CA  1 
ATOM   1282 C C   . LEU A 1 168 ? -6.190  4.337  72.752 1.00 11.84 ? 180 LEU A C   1 
ATOM   1283 O O   . LEU A 1 168 ? -6.338  3.235  73.290 1.00 11.30 ? 180 LEU A O   1 
ATOM   1284 C CB  . LEU A 1 168 ? -5.685  4.604  70.331 1.00 12.83 ? 180 LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 168 ? -4.844  4.882  69.079 1.00 9.32  ? 180 LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 168 ? -5.766  4.839  67.848 1.00 9.47  ? 180 LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 168 ? -4.169  6.232  69.197 1.00 11.51 ? 180 LEU A CD2 1 
ATOM   1288 N N   . MET A 1 169 ? -6.948  5.374  73.049 1.00 11.91 ? 181 MET A N   1 
ATOM   1289 C CA  . MET A 1 169 ? -8.043  5.226  73.984 1.00 11.29 ? 181 MET A CA  1 
ATOM   1290 C C   . MET A 1 169 ? -9.168  6.109  73.483 1.00 10.41 ? 181 MET A C   1 
ATOM   1291 O O   . MET A 1 169 ? -8.916  7.091  72.792 1.00 8.89  ? 181 MET A O   1 
ATOM   1292 C CB  . MET A 1 169 ? -7.621  5.575  75.417 1.00 12.36 ? 181 MET A CB  1 
ATOM   1293 C CG  . MET A 1 169 ? -7.144  6.996  75.679 1.00 9.01  ? 181 MET A CG  1 
ATOM   1294 S SD  . MET A 1 169 ? -6.599  7.245  77.427 1.00 14.55 ? 181 MET A SD  1 
ATOM   1295 C CE  . MET A 1 169 ? -8.072  6.991  78.338 1.00 13.11 ? 181 MET A CE  1 
ATOM   1296 N N   . CYS A 1 170 ? -10.403 5.672  73.717 1.00 6.62  ? 182 CYS A N   1 
ATOM   1297 C CA  . CYS A 1 170 ? -11.591 6.403  73.293 1.00 8.64  ? 182 CYS A CA  1 
ATOM   1298 C C   . CYS A 1 170 ? -12.412 6.950  74.451 1.00 8.53  ? 182 CYS A C   1 
ATOM   1299 O O   . CYS A 1 170 ? -12.561 6.298  75.498 1.00 9.66  ? 182 CYS A O   1 
ATOM   1300 C CB  . CYS A 1 170 ? -12.528 5.465  72.534 1.00 8.05  ? 182 CYS A CB  1 
ATOM   1301 S SG  . CYS A 1 170 ? -11.557 5.082  70.934 1.00 17.38 ? 182 CYS A SG  1 
ATOM   1302 N N   . ALA A 1 171 ? -13.047 8.089  74.195 1.00 8.50  ? 183 ALA A N   1 
ATOM   1303 C CA  . ALA A 1 171 ? -13.950 8.718  75.153 1.00 10.27 ? 183 ALA A CA  1 
ATOM   1304 C C   . ALA A 1 171 ? -15.155 9.163  74.294 1.00 12.38 ? 183 ALA A C   1 
ATOM   1305 O O   . ALA A 1 171 ? -14.993 9.615  73.151 1.00 10.89 ? 183 ALA A O   1 
ATOM   1306 C CB  . ALA A 1 171 ? -13.303 9.933  75.820 1.00 9.45  ? 183 ALA A CB  1 
ATOM   1307 N N   . GLU A 1 172 ? -16.356 9.025  74.815 1.00 14.41 ? 184 GLU A N   1 
ATOM   1308 C CA  . GLU A 1 172 ? -17.581 9.371  74.052 1.00 13.67 ? 184 GLU A CA  1 
ATOM   1309 C C   . GLU A 1 172 ? -17.454 10.772 73.420 1.00 14.03 ? 184 GLU A C   1 
ATOM   1310 O O   . GLU A 1 172 ? -16.744 11.644 73.944 1.00 14.06 ? 184 GLU A O   1 
ATOM   1311 C CB  . GLU A 1 172 ? -18.793 9.300  74.972 1.00 10.90 ? 184 GLU A CB  1 
ATOM   1312 C CG  . GLU A 1 172 ? -19.134 7.858  75.351 1.00 15.46 ? 184 GLU A CG  1 
ATOM   1313 C CD  . GLU A 1 172 ? -20.418 7.733  76.164 1.00 19.57 ? 184 GLU A CD  1 
ATOM   1314 O OE1 . GLU A 1 172 ? -20.977 8.786  76.652 1.00 23.38 ? 184 GLU A OE1 1 
ATOM   1315 O OE2 . GLU A 1 172 ? -20.940 6.570  76.365 1.00 20.65 ? 184 GLU A OE2 1 
ATOM   1316 N N   . SER A 1 173 ? -18.161 10.942 72.293 1.00 15.52 ? 185 SER A N   1 
ATOM   1317 C CA  . SER A 1 173 ? -18.135 12.203 71.506 1.00 13.63 ? 185 SER A CA  1 
ATOM   1318 C C   . SER A 1 173 ? -19.561 12.749 71.208 1.00 14.44 ? 185 SER A C   1 
ATOM   1319 O O   . SER A 1 173 ? -19.721 13.799 70.574 1.00 15.11 ? 185 SER A O   1 
ATOM   1320 C CB  . SER A 1 173 ? -17.428 11.963 70.154 1.00 11.64 ? 185 SER A CB  1 
ATOM   1321 O OG  . SER A 1 173 ? -18.185 11.073 69.341 1.00 15.36 ? 185 SER A OG  1 
ATOM   1322 N N   . ASN A 1 174 ? -20.591 12.268 71.823 1.00 17.96 ? 186 ASN A N   1 
ATOM   1323 C CA  . ASN A 1 174 ? -22.021 12.278 71.481 1.00 19.44 ? 186 ASN A CA  1 
ATOM   1324 C C   . ASN A 1 174 ? -22.662 13.665 71.736 1.00 19.43 ? 186 ASN A C   1 
ATOM   1325 O O   . ASN A 1 174 ? -23.501 14.136 70.959 1.00 20.78 ? 186 ASN A O   1 
ATOM   1326 C CB  . ASN A 1 174 ? -22.794 11.285 72.349 1.00 22.18 ? 186 ASN A CB  1 
ATOM   1327 C CG  . ASN A 1 174 ? -22.655 9.832  71.895 1.00 27.60 ? 186 ASN A CG  1 
ATOM   1328 O OD1 . ASN A 1 174 ? -22.583 9.564  70.698 1.00 27.62 ? 186 ASN A OD1 1 
ATOM   1329 N ND2 . ASN A 1 174 ? -22.613 8.866  72.794 1.00 32.34 ? 186 ASN A ND2 1 
ATOM   1330 N N   . ARG A 1 175 ? -22.276 14.319 72.832 1.00 18.37 ? 187 ARG A N   1 
ATOM   1331 C CA  . ARG A 1 175 ? -22.884 15.625 73.232 1.00 20.42 ? 187 ARG A CA  1 
ATOM   1332 C C   . ARG A 1 175 ? -21.818 16.597 73.768 1.00 20.59 ? 187 ARG A C   1 
ATOM   1333 O O   . ARG A 1 175 ? -22.060 17.816 73.867 1.00 23.97 ? 187 ARG A O   1 
ATOM   1334 C CB  . ARG A 1 175 ? -23.912 15.371 74.345 1.00 27.35 ? 187 ARG A CB  1 
ATOM   1335 C CG  . ARG A 1 175 ? -25.125 16.306 74.305 1.00 39.40 ? 187 ARG A CG  1 
ATOM   1336 C CD  . ARG A 1 175 ? -24.968 17.517 75.227 1.00 46.70 ? 187 ARG A CD  1 
ATOM   1337 N NE  . ARG A 1 175 ? -26.192 18.331 75.381 1.00 51.47 ? 187 ARG A NE  1 
ATOM   1338 C CZ  . ARG A 1 175 ? -27.420 17.987 74.955 1.00 52.25 ? 187 ARG A CZ  1 
ATOM   1339 N NH1 . ARG A 1 175 ? -27.640 16.837 74.307 1.00 51.90 ? 187 ARG A NH1 1 
ATOM   1340 N NH2 . ARG A 1 175 ? -28.517 18.739 75.154 1.00 53.37 ? 187 ARG A NH2 1 
ATOM   1341 N N   . ARG A 1 176 ? -20.701 15.977 74.096 1.00 18.31 ? 188 ARG A N   1 
ATOM   1342 C CA  . ARG A 1 176 ? -19.480 16.617 74.624 1.00 18.55 ? 188 ARG A CA  1 
ATOM   1343 C C   . ARG A 1 176 ? -18.300 16.021 73.853 1.00 17.29 ? 188 ARG A C   1 
ATOM   1344 O O   . ARG A 1 176 ? -18.248 14.811 73.595 1.00 16.56 ? 188 ARG A O   1 
ATOM   1345 C CB  . ARG A 1 176 ? -19.374 16.331 76.127 1.00 20.62 ? 188 ARG A CB  1 
ATOM   1346 C CG  . ARG A 1 176 ? -20.631 16.762 76.890 1.00 27.90 ? 188 ARG A CG  1 
ATOM   1347 C CD  . ARG A 1 176 ? -20.554 16.523 78.401 1.00 33.04 ? 188 ARG A CD  1 
ATOM   1348 N NE  . ARG A 1 176 ? -21.559 15.560 78.875 1.00 40.42 ? 188 ARG A NE  1 
ATOM   1349 C CZ  . ARG A 1 176 ? -22.888 15.768 78.857 1.00 41.73 ? 188 ARG A CZ  1 
ATOM   1350 N NH1 . ARG A 1 176 ? -23.409 16.984 79.077 1.00 41.28 ? 188 ARG A NH1 1 
ATOM   1351 N NH2 . ARG A 1 176 ? -23.791 14.809 78.605 1.00 44.36 ? 188 ARG A NH2 1 
ATOM   1352 N N   . ASP A 1 177 ? -17.352 16.861 73.486 1.00 14.20 ? 189 ASP A N   1 
ATOM   1353 C CA  . ASP A 1 177 ? -16.255 16.406 72.622 1.00 11.09 ? 189 ASP A CA  1 
ATOM   1354 C C   . ASP A 1 177 ? -15.087 17.399 72.626 1.00 13.80 ? 189 ASP A C   1 
ATOM   1355 O O   . ASP A 1 177 ? -15.195 18.523 73.132 1.00 12.65 ? 189 ASP A O   1 
ATOM   1356 C CB  . ASP A 1 177 ? -16.842 16.293 71.213 1.00 11.62 ? 189 ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 177 ? -16.056 15.419 70.241 1.00 11.53 ? 189 ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 177 ? -14.804 15.206 70.433 1.00 7.38  ? 189 ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 177 ? -16.652 14.918 69.209 1.00 12.30 ? 189 ASP A OD2 1 
ATOM   1360 N N   . SER A 1 178 ? -14.059 17.003 71.898 1.00 10.00 ? 190 SER A N   1 
ATOM   1361 C CA  . SER A 1 178 ? -12.991 17.913 71.561 1.00 12.70 ? 190 SER A CA  1 
ATOM   1362 C C   . SER A 1 178 ? -13.236 18.284 70.099 1.00 12.89 ? 190 SER A C   1 
ATOM   1363 O O   . SER A 1 178 ? -13.647 17.444 69.287 1.00 12.31 ? 190 SER A O   1 
ATOM   1364 C CB  . SER A 1 178 ? -11.648 17.233 71.759 1.00 11.28 ? 190 SER A CB  1 
ATOM   1365 O OG  . SER A 1 178 ? -11.530 16.149 70.856 1.00 16.57 ? 190 SER A OG  1 
ATOM   1366 N N   . CYS A 1 179 ? -13.015 19.533 69.761 1.00 12.24 ? 191 CYS A N   1 
ATOM   1367 C CA  . CYS A 1 179 ? -13.208 19.989 68.374 1.00 12.46 ? 191 CYS A CA  1 
ATOM   1368 C C   . CYS A 1 179 ? -11.930 20.643 67.862 1.00 13.06 ? 191 CYS A C   1 
ATOM   1369 O O   . CYS A 1 179 ? -10.864 20.518 68.479 1.00 13.66 ? 191 CYS A O   1 
ATOM   1370 C CB  . CYS A 1 179 ? -14.362 20.983 68.299 1.00 13.98 ? 191 CYS A CB  1 
ATOM   1371 S SG  . CYS A 1 179 ? -16.019 20.182 68.555 1.00 18.79 ? 191 CYS A SG  1 
ATOM   1372 N N   . LYS A 1 180 ? -11.984 21.167 66.658 1.00 14.97 ? 192 LYS A N   1 
ATOM   1373 C CA  . LYS A 1 180 ? -10.769 21.697 66.082 1.00 12.68 ? 192 LYS A CA  1 
ATOM   1374 C C   . LYS A 1 180 ? -10.200 22.728 67.030 1.00 10.18 ? 192 LYS A C   1 
ATOM   1375 O O   . LYS A 1 180 ? -10.948 23.541 67.626 1.00 10.28 ? 192 LYS A O   1 
ATOM   1376 C CB  . LYS A 1 180 ? -11.004 22.277 64.696 1.00 14.29 ? 192 LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 180 ? -9.687  22.601 63.989 1.00 18.69 ? 192 LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 180 ? -9.828  22.850 62.468 1.00 18.82 ? 192 LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 180 ? -8.446  22.664 61.722 1.00 20.31 ? 192 LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 180 ? -7.226  23.111 62.539 1.00 20.50 ? 192 LYS A NZ  1 
ATOM   1381 N N   . GLY A 1 181 ? -8.891  22.618 67.251 1.00 6.28  ? 193 GLY A N   1 
ATOM   1382 C CA  . GLY A 1 181 ? -8.198  23.539 68.143 1.00 7.11  ? 193 GLY A CA  1 
ATOM   1383 C C   . GLY A 1 181 ? -7.878  22.883 69.464 1.00 6.06  ? 193 GLY A C   1 
ATOM   1384 O O   . GLY A 1 181 ? -7.055  23.393 70.244 1.00 6.65  ? 193 GLY A O   1 
ATOM   1385 N N   . ASP A 1 182 ? -8.520  21.756 69.732 1.00 7.72  ? 194 ASP A N   1 
ATOM   1386 C CA  . ASP A 1 182 ? -8.285  21.014 70.971 1.00 8.48  ? 194 ASP A CA  1 
ATOM   1387 C C   . ASP A 1 182 ? -7.215  19.929 70.895 1.00 9.90  ? 194 ASP A C   1 
ATOM   1388 O O   . ASP A 1 182 ? -6.821  19.364 71.915 1.00 12.69 ? 194 ASP A O   1 
ATOM   1389 C CB  . ASP A 1 182 ? -9.583  20.433 71.483 1.00 8.67  ? 194 ASP A CB  1 
ATOM   1390 C CG  . ASP A 1 182 ? -10.574 21.512 71.944 1.00 9.62  ? 194 ASP A CG  1 
ATOM   1391 O OD1 . ASP A 1 182 ? -10.169 22.479 72.618 1.00 5.73  ? 194 ASP A OD1 1 
ATOM   1392 O OD2 . ASP A 1 182 ? -11.771 21.359 71.645 1.00 6.42  ? 194 ASP A OD2 1 
ATOM   1393 N N   . SER A 1 183 ? -6.759  19.617 69.682 1.00 8.70  ? 195 SER A N   1 
ATOM   1394 C CA  . SER A 1 183 ? -5.696  18.614 69.501 1.00 10.53 ? 195 SER A CA  1 
ATOM   1395 C C   . SER A 1 183 ? -4.447  19.042 70.282 1.00 8.80  ? 195 SER A C   1 
ATOM   1396 O O   . SER A 1 183 ? -4.115  20.233 70.356 1.00 10.78 ? 195 SER A O   1 
ATOM   1397 C CB  . SER A 1 183 ? -5.314  18.516 68.022 1.00 11.52 ? 195 SER A CB  1 
ATOM   1398 O OG  . SER A 1 183 ? -6.481  18.399 67.222 1.00 18.10 ? 195 SER A OG  1 
ATOM   1399 N N   . GLY A 1 184 ? -3.783  18.055 70.854 1.00 7.20  ? 196 GLY A N   1 
ATOM   1400 C CA  . GLY A 1 184 ? -2.537  18.273 71.608 1.00 7.06  ? 196 GLY A CA  1 
ATOM   1401 C C   . GLY A 1 184 ? -2.804  18.549 73.101 1.00 7.43  ? 196 GLY A C   1 
ATOM   1402 O O   . GLY A 1 184 ? -1.875  18.539 73.918 1.00 8.69  ? 196 GLY A O   1 
ATOM   1403 N N   . GLY A 1 185 ? -4.085  18.772 73.493 1.00 7.66  ? 197 GLY A N   1 
ATOM   1404 C CA  . GLY A 1 185 ? -4.545  19.079 74.858 1.00 7.63  ? 197 GLY A CA  1 
ATOM   1405 C C   . GLY A 1 185 ? -4.550  17.803 75.713 1.00 4.90  ? 197 GLY A C   1 
ATOM   1406 O O   . GLY A 1 185 ? -4.580  16.683 75.187 1.00 6.91  ? 197 GLY A O   1 
ATOM   1407 N N   . PRO A 1 186 ? -4.475  17.899 77.055 1.00 8.64  ? 198 PRO A N   1 
ATOM   1408 C CA  . PRO A 1 186 ? -4.506  16.724 77.928 1.00 8.82  ? 198 PRO A CA  1 
ATOM   1409 C C   . PRO A 1 186 ? -5.877  16.094 78.106 1.00 7.49  ? 198 PRO A C   1 
ATOM   1410 O O   . PRO A 1 186 ? -6.916  16.802 77.940 1.00 9.84  ? 198 PRO A O   1 
ATOM   1411 C CB  . PRO A 1 186 ? -4.218  17.264 79.305 1.00 11.84 ? 198 PRO A CB  1 
ATOM   1412 C CG  . PRO A 1 186 ? -4.148  18.776 79.200 1.00 10.49 ? 198 PRO A CG  1 
ATOM   1413 C CD  . PRO A 1 186 ? -4.352  19.177 77.765 1.00 9.51  ? 198 PRO A CD  1 
ATOM   1414 N N   . LEU A 1 187 ? -5.819  14.816 78.445 1.00 6.22  ? 199 LEU A N   1 
ATOM   1415 C CA  . LEU A 1 187 ? -6.964  14.025 78.936 1.00 8.17  ? 199 LEU A CA  1 
ATOM   1416 C C   . LEU A 1 187 ? -6.477  13.520 80.289 1.00 8.09  ? 199 LEU A C   1 
ATOM   1417 O O   . LEU A 1 187 ? -5.646  12.607 80.362 1.00 8.70  ? 199 LEU A O   1 
ATOM   1418 C CB  . LEU A 1 187 ? -7.325  12.852 78.009 1.00 9.12  ? 199 LEU A CB  1 
ATOM   1419 C CG  . LEU A 1 187 ? -8.362  11.905 78.648 1.00 15.37 ? 199 LEU A CG  1 
ATOM   1420 C CD1 . LEU A 1 187 ? -9.783  12.480 78.654 1.00 14.84 ? 199 LEU A CD1 1 
ATOM   1421 C CD2 . LEU A 1 187 ? -8.470  10.552 77.941 1.00 12.68 ? 199 LEU A CD2 1 
ATOM   1422 N N   . VAL A 1 188 ? -6.961  14.157 81.337 1.00 8.23  ? 200 VAL A N   1 
ATOM   1423 C CA  . VAL A 1 188 ? -6.499  13.872 82.710 1.00 10.45 ? 200 VAL A CA  1 
ATOM   1424 C C   . VAL A 1 188 ? -7.510  13.013 83.473 1.00 12.35 ? 200 VAL A C   1 
ATOM   1425 O O   . VAL A 1 188 ? -8.610  13.462 83.815 1.00 12.33 ? 200 VAL A O   1 
ATOM   1426 C CB  . VAL A 1 188 ? -6.271  15.201 83.440 1.00 11.74 ? 200 VAL A CB  1 
ATOM   1427 C CG1 . VAL A 1 188 ? -5.514  15.042 84.758 1.00 10.70 ? 200 VAL A CG1 1 
ATOM   1428 C CG2 . VAL A 1 188 ? -5.455  16.197 82.604 1.00 11.87 ? 200 VAL A CG2 1 
ATOM   1429 N N   . CYS A 1 189 ? -6.977  11.884 84.037 1.00 12.81 ? 201 CYS A N   1 
ATOM   1430 C CA  . CYS A 1 189 ? -7.805  10.999 84.851 1.00 12.62 ? 201 CYS A CA  1 
ATOM   1431 C C   . CYS A 1 189 ? -7.191  10.894 86.218 1.00 12.98 ? 201 CYS A C   1 
ATOM   1432 O O   . CYS A 1 189 ? -6.046  10.475 86.362 1.00 14.60 ? 201 CYS A O   1 
ATOM   1433 C CB  . CYS A 1 189 ? -7.888  9.598  84.260 1.00 9.82  ? 201 CYS A CB  1 
ATOM   1434 S SG  . CYS A 1 189 ? -8.309  9.527  82.486 1.00 14.25 ? 201 CYS A SG  1 
ATOM   1435 N N   . GLY A 1 190 ? -7.936  11.339 87.219 1.00 14.24 ? 202 GLY A N   1 
ATOM   1436 C CA  . GLY A 1 190 ? -7.438  11.273 88.582 1.00 15.04 ? 202 GLY A CA  1 
ATOM   1437 C C   . GLY A 1 190 ? -6.095  11.955 88.828 1.00 14.83 ? 202 GLY A C   1 
ATOM   1438 O O   . GLY A 1 190 ? -5.214  11.357 89.448 1.00 15.37 ? 202 GLY A O   1 
ATOM   1439 N N   . GLY A 1 191 ? -5.927  13.170 88.300 1.00 15.43 ? 207 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 191 ? -4.705  13.937 88.504 1.00 14.66 ? 207 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 191 ? -3.478  13.630 87.667 1.00 14.97 ? 207 GLY A C   1 
ATOM   1442 O O   . GLY A 1 191 ? -2.492  14.348 87.758 1.00 15.48 ? 207 GLY A O   1 
ATOM   1443 N N   . VAL A 1 192 ? -3.545  12.582 86.844 1.00 10.77 ? 208 VAL A N   1 
ATOM   1444 C CA  . VAL A 1 192 ? -2.437  12.164 85.987 1.00 9.89  ? 208 VAL A CA  1 
ATOM   1445 C C   . VAL A 1 192 ? -2.801  12.265 84.514 1.00 7.68  ? 208 VAL A C   1 
ATOM   1446 O O   . VAL A 1 192 ? -3.955  12.051 84.124 1.00 6.97  ? 208 VAL A O   1 
ATOM   1447 C CB  . VAL A 1 192 ? -2.032  10.704 86.297 1.00 12.05 ? 208 VAL A CB  1 
ATOM   1448 C CG1 . VAL A 1 192 ? -0.973  10.226 85.301 1.00 14.76 ? 208 VAL A CG1 1 
ATOM   1449 C CG2 . VAL A 1 192 ? -1.479  10.600 87.755 1.00 15.38 ? 208 VAL A CG2 1 
ATOM   1450 N N   . LEU A 1 193 ? -1.834  12.675 83.710 1.00 7.96  ? 209 LEU A N   1 
ATOM   1451 C CA  . LEU A 1 193 ? -2.035  12.773 82.266 1.00 8.72  ? 209 LEU A CA  1 
ATOM   1452 C C   . LEU A 1 193 ? -2.138  11.344 81.738 1.00 9.06  ? 209 LEU A C   1 
ATOM   1453 O O   . LEU A 1 193 ? -1.177  10.564 81.805 1.00 7.99  ? 209 LEU A O   1 
ATOM   1454 C CB  . LEU A 1 193 ? -0.872  13.479 81.567 1.00 13.19 ? 209 LEU A CB  1 
ATOM   1455 C CG  . LEU A 1 193 ? -1.077  13.587 80.046 1.00 15.62 ? 209 LEU A CG  1 
ATOM   1456 C CD1 . LEU A 1 193 ? -2.281  14.455 79.759 1.00 14.58 ? 209 LEU A CD1 1 
ATOM   1457 C CD2 . LEU A 1 193 ? 0.154   14.156 79.380 1.00 15.51 ? 209 LEU A CD2 1 
ATOM   1458 N N   . GLU A 1 194 ? -3.299  11.016 81.202 1.00 8.57  ? 210 GLU A N   1 
ATOM   1459 C CA  . GLU A 1 194 ? -3.534  9.682  80.686 1.00 9.35  ? 210 GLU A CA  1 
ATOM   1460 C C   . GLU A 1 194 ? -3.437  9.665  79.148 1.00 8.04  ? 210 GLU A C   1 
ATOM   1461 O O   . GLU A 1 194 ? -2.845  8.758  78.552 1.00 9.39  ? 210 GLU A O   1 
ATOM   1462 C CB  . GLU A 1 194 ? -4.895  9.232  81.205 1.00 9.08  ? 210 GLU A CB  1 
ATOM   1463 C CG  . GLU A 1 194 ? -5.058  7.722  81.409 1.00 8.62  ? 210 GLU A CG  1 
ATOM   1464 C CD  . GLU A 1 194 ? -3.968  7.083  82.270 1.00 10.67 ? 210 GLU A CD  1 
ATOM   1465 O OE1 . GLU A 1 194 ? -4.000  7.181  83.555 1.00 13.74 ? 210 GLU A OE1 1 
ATOM   1466 O OE2 . GLU A 1 194 ? -3.020  6.432  81.693 1.00 14.10 ? 210 GLU A OE2 1 
ATOM   1467 N N   . GLY A 1 195 ? -4.003  10.670 78.493 1.00 8.02  ? 211 GLY A N   1 
ATOM   1468 C CA  . GLY A 1 195 ? -3.970  10.722 77.013 1.00 9.74  ? 211 GLY A CA  1 
ATOM   1469 C C   . GLY A 1 195 ? -3.772  12.152 76.491 1.00 9.47  ? 211 GLY A C   1 
ATOM   1470 O O   . GLY A 1 195 ? -3.843  13.128 77.245 1.00 10.11 ? 211 GLY A O   1 
ATOM   1471 N N   . VAL A 1 196 ? -3.513  12.222 75.192 1.00 9.10  ? 212 VAL A N   1 
ATOM   1472 C CA  . VAL A 1 196 ? -3.350  13.499 74.473 1.00 8.81  ? 212 VAL A CA  1 
ATOM   1473 C C   . VAL A 1 196 ? -4.361  13.551 73.331 1.00 10.20 ? 212 VAL A C   1 
ATOM   1474 O O   . VAL A 1 196 ? -4.434  12.636 72.502 1.00 10.21 ? 212 VAL A O   1 
ATOM   1475 C CB  . VAL A 1 196 ? -1.938  13.634 73.889 1.00 11.09 ? 212 VAL A CB  1 
ATOM   1476 C CG1 . VAL A 1 196 ? -1.717  14.980 73.187 1.00 7.16  ? 212 VAL A CG1 1 
ATOM   1477 C CG2 . VAL A 1 196 ? -0.837  13.531 74.945 1.00 10.84 ? 212 VAL A CG2 1 
ATOM   1478 N N   . VAL A 1 197 ? -5.134  14.621 73.312 1.00 10.29 ? 213 VAL A N   1 
ATOM   1479 C CA  . VAL A 1 197 ? -6.172  14.807 72.284 1.00 11.31 ? 213 VAL A CA  1 
ATOM   1480 C C   . VAL A 1 197 ? -5.577  14.608 70.883 1.00 12.25 ? 213 VAL A C   1 
ATOM   1481 O O   . VAL A 1 197 ? -4.581  15.245 70.514 1.00 10.51 ? 213 VAL A O   1 
ATOM   1482 C CB  . VAL A 1 197 ? -6.771  16.217 72.354 1.00 9.44  ? 213 VAL A CB  1 
ATOM   1483 C CG1 . VAL A 1 197 ? -7.978  16.393 71.425 1.00 6.77  ? 213 VAL A CG1 1 
ATOM   1484 C CG2 . VAL A 1 197 ? -7.265  16.594 73.751 1.00 5.79  ? 213 VAL A CG2 1 
ATOM   1485 N N   . SER A 1 198 ? -6.207  13.711 70.136 1.00 11.02 ? 214 SER A N   1 
ATOM   1486 C CA  . SER A 1 198 ? -5.813  13.406 68.743 1.00 10.55 ? 214 SER A CA  1 
ATOM   1487 C C   . SER A 1 198 ? -6.596  14.343 67.820 1.00 11.39 ? 214 SER A C   1 
ATOM   1488 O O   . SER A 1 198 ? -7.062  15.410 68.219 1.00 13.34 ? 214 SER A O   1 
ATOM   1489 C CB  . SER A 1 198 ? -6.108  11.938 68.430 1.00 11.88 ? 214 SER A CB  1 
ATOM   1490 O OG  . SER A 1 198 ? -5.373  11.528 67.285 1.00 15.80 ? 214 SER A OG  1 
ATOM   1491 N N   . TRP A 1 199 ? -6.779  13.994 66.563 1.00 10.71 ? 215 TRP A N   1 
ATOM   1492 C CA  . TRP A 1 199 ? -7.525  14.908 65.681 1.00 11.23 ? 215 TRP A CA  1 
ATOM   1493 C C   . TRP A 1 199 ? -8.836  15.269 66.349 1.00 10.69 ? 215 TRP A C   1 
ATOM   1494 O O   . TRP A 1 199 ? -9.441  14.429 67.021 1.00 11.70 ? 215 TRP A O   1 
ATOM   1495 C CB  . TRP A 1 199 ? -7.798  14.275 64.318 1.00 11.26 ? 215 TRP A CB  1 
ATOM   1496 C CG  . TRP A 1 199 ? -6.529  14.114 63.487 1.00 11.65 ? 215 TRP A CG  1 
ATOM   1497 C CD1 . TRP A 1 199 ? -5.653  13.114 63.578 1.00 12.81 ? 215 TRP A CD1 1 
ATOM   1498 C CD2 . TRP A 1 199 ? -6.074  15.015 62.479 1.00 12.29 ? 215 TRP A CD2 1 
ATOM   1499 N NE1 . TRP A 1 199 ? -4.625  13.367 62.623 1.00 12.52 ? 215 TRP A NE1 1 
ATOM   1500 C CE2 . TRP A 1 199 ? -4.888  14.485 61.987 1.00 12.85 ? 215 TRP A CE2 1 
ATOM   1501 C CE3 . TRP A 1 199 ? -6.554  16.221 61.940 1.00 11.32 ? 215 TRP A CE3 1 
ATOM   1502 C CZ2 . TRP A 1 199 ? -4.136  15.092 60.971 1.00 13.15 ? 215 TRP A CZ2 1 
ATOM   1503 C CZ3 . TRP A 1 199 ? -5.788  16.826 60.917 1.00 11.96 ? 215 TRP A CZ3 1 
ATOM   1504 C CH2 . TRP A 1 199 ? -4.636  16.286 60.456 1.00 12.59 ? 215 TRP A CH2 1 
ATOM   1505 N N   . GLY A 1 200 ? -9.247  16.524 66.252 1.00 26.77 ? 216 GLY A N   1 
ATOM   1506 C CA  . GLY A 1 200 ? -10.503 16.879 66.871 1.00 26.86 ? 216 GLY A CA  1 
ATOM   1507 C C   . GLY A 1 200 ? -11.626 16.439 65.952 1.00 26.92 ? 216 GLY A C   1 
ATOM   1508 O O   . GLY A 1 200 ? -11.397 15.869 64.866 1.00 29.66 ? 216 GLY A O   1 
ATOM   1509 N N   . SER A 1 201 ? -12.847 16.644 66.425 1.00 26.91 ? 217 SER A N   1 
ATOM   1510 C CA  . SER A 1 201 ? -14.041 16.341 65.649 1.00 26.37 ? 217 SER A CA  1 
ATOM   1511 C C   . SER A 1 201 ? -14.023 17.198 64.339 1.00 25.74 ? 217 SER A C   1 
ATOM   1512 O O   . SER A 1 201 ? -13.832 18.418 64.378 1.00 29.67 ? 217 SER A O   1 
ATOM   1513 C CB  . SER A 1 201 ? -15.269 16.666 66.507 1.00 23.27 ? 217 SER A CB  1 
ATOM   1514 O OG  . SER A 1 201 ? -16.452 16.300 65.848 1.00 25.17 ? 217 SER A OG  1 
ATOM   1515 N N   . ARG A 1 202 ? -14.205 16.539 63.194 1.00 21.67 ? 218 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 202 ? -14.213 17.211 61.878 1.00 17.96 ? 218 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 202 ? -15.220 18.375 61.816 1.00 17.33 ? 218 ARG A C   1 
ATOM   1518 O O   . ARG A 1 202 ? -14.881 19.498 61.421 1.00 17.95 ? 218 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 202 ? -14.469 16.145 60.764 1.00 16.90 ? 218 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 202 ? -15.035 16.735 59.457 1.00 17.44 ? 218 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 202 ? -13.987 16.888 58.339 1.00 16.55 ? 218 ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 202 ? -12.985 17.920 58.642 1.00 13.49 ? 218 ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 202 ? -12.192 18.516 57.735 1.00 14.61 ? 218 ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 202 ? -12.267 18.209 56.433 1.00 16.43 ? 218 ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 202 ? -11.266 19.436 58.050 1.00 11.69 ? 218 ARG A NH2 1 
ATOM   1526 N N   . VAL A 1 203 ? -16.439 18.088 62.184 1.00 16.47 ? 219 VAL A N   1 
ATOM   1527 C CA  . VAL A 1 203 ? -17.512 19.095 62.268 1.00 14.97 ? 219 VAL A CA  1 
ATOM   1528 C C   . VAL A 1 203 ? -17.940 19.067 63.729 1.00 14.89 ? 219 VAL A C   1 
ATOM   1529 O O   . VAL A 1 203 ? -18.458 18.069 64.220 1.00 15.99 ? 219 VAL A O   1 
ATOM   1530 C CB  . VAL A 1 203 ? -18.639 18.695 61.315 1.00 17.79 ? 219 VAL A CB  1 
ATOM   1531 C CG1 . VAL A 1 203 ? -19.654 19.813 61.086 1.00 23.96 ? 219 VAL A CG1 1 
ATOM   1532 C CG2 . VAL A 1 203 ? -18.127 18.301 59.926 1.00 15.76 ? 219 VAL A CG2 1 
ATOM   1533 N N   . CYS A 1 204 ? -17.652 20.149 64.437 1.00 14.71 ? 220 CYS A N   1 
ATOM   1534 C CA  . CYS A 1 204 ? -17.960 20.252 65.869 1.00 14.48 ? 220 CYS A CA  1 
ATOM   1535 C C   . CYS A 1 204 ? -19.430 20.102 66.168 1.00 14.93 ? 220 CYS A C   1 
ATOM   1536 O O   . CYS A 1 204 ? -20.224 20.958 65.807 1.00 13.60 ? 220 CYS A O   1 
ATOM   1537 C CB  . CYS A 1 204 ? -17.485 21.588 66.422 1.00 14.08 ? 220 CYS A CB  1 
ATOM   1538 S SG  . CYS A 1 204 ? -17.332 21.586 68.228 1.00 20.58 ? 220 CYS A SG  1 
ATOM   1539 N N   . GLY A 1 205 ? -19.784 18.998 66.815 1.00 15.23 ? 221 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 205 ? -21.168 18.752 67.166 1.00 14.30 ? 221 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 205 ? -21.873 17.650 66.375 1.00 16.23 ? 221 GLY A C   1 
ATOM   1542 O O   . GLY A 1 205 ? -23.023 17.297 66.671 1.00 15.88 ? 221 GLY A O   1 
ATOM   1543 N N   . ASN A 1 206 ? -21.253 17.059 65.366 1.00 16.67 ? 222 ASN A N   1 
ATOM   1544 C CA  . ASN A 1 206 ? -22.015 16.040 64.618 1.00 14.93 ? 222 ASN A CA  1 
ATOM   1545 C C   . ASN A 1 206 ? -21.245 14.772 64.208 1.00 13.09 ? 222 ASN A C   1 
ATOM   1546 O O   . ASN A 1 206 ? -21.522 14.156 63.170 1.00 10.37 ? 222 ASN A O   1 
ATOM   1547 C CB  . ASN A 1 206 ? -22.641 16.617 63.341 1.00 15.21 ? 222 ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 206 ? -21.789 17.651 62.603 1.00 21.67 ? 222 ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 206 ? -21.488 18.710 63.150 1.00 22.51 ? 222 ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 206 ? -21.396 17.407 61.365 1.00 23.74 ? 222 ASN A ND2 1 
ATOM   1551 N N   . ARG A 1 207 ? -20.309 14.335 65.005 1.00 12.99 ? 223 ARG A N   1 
ATOM   1552 C CA  . ARG A 1 207 ? -19.625 13.077 64.704 1.00 16.40 ? 223 ARG A CA  1 
ATOM   1553 C C   . ARG A 1 207 ? -20.187 11.997 65.638 1.00 15.60 ? 223 ARG A C   1 
ATOM   1554 O O   . ARG A 1 207 ? -20.446 12.275 66.829 1.00 18.04 ? 223 ARG A O   1 
ATOM   1555 C CB  . ARG A 1 207 ? -18.129 13.254 64.836 1.00 18.67 ? 223 ARG A CB  1 
ATOM   1556 C CG  . ARG A 1 207 ? -17.595 12.895 66.207 1.00 28.16 ? 223 ARG A CG  1 
ATOM   1557 C CD  . ARG A 1 207 ? -16.096 12.683 66.144 1.00 36.96 ? 223 ARG A CD  1 
ATOM   1558 N NE  . ARG A 1 207 ? -15.357 13.240 67.270 1.00 43.89 ? 223 ARG A NE  1 
ATOM   1559 C CZ  . ARG A 1 207 ? -14.033 13.126 67.382 1.00 46.48 ? 223 ARG A CZ  1 
ATOM   1560 N NH1 . ARG A 1 207 ? -13.259 12.510 66.486 1.00 49.43 ? 223 ARG A NH1 1 
ATOM   1561 N NH2 . ARG A 1 207 ? -13.386 13.652 68.434 1.00 46.03 ? 223 ARG A NH2 1 
ATOM   1562 N N   . LYS A 1 208 A -20.352 10.838 65.011 1.00 16.71 ? 223 LYS A N   1 
ATOM   1563 C CA  . LYS A 1 208 A -20.926 9.618  65.610 1.00 18.54 ? 223 LYS A CA  1 
ATOM   1564 C C   . LYS A 1 208 A -19.817 8.711  66.183 1.00 18.57 ? 223 LYS A C   1 
ATOM   1565 O O   . LYS A 1 208 A -20.037 7.963  67.147 1.00 21.25 ? 223 LYS A O   1 
ATOM   1566 C CB  . LYS A 1 208 A -21.713 8.846  64.533 1.00 21.28 ? 223 LYS A CB  1 
ATOM   1567 C CG  . LYS A 1 208 A -22.496 9.766  63.580 1.00 26.29 ? 223 LYS A CG  1 
ATOM   1568 C CD  . LYS A 1 208 A -22.827 9.111  62.230 1.00 34.21 ? 223 LYS A CD  1 
ATOM   1569 C CE  . LYS A 1 208 A -23.491 10.075 61.240 1.00 37.96 ? 223 LYS A CE  1 
ATOM   1570 N NZ  . LYS A 1 208 A -24.794 10.574 61.708 1.00 39.14 ? 223 LYS A NZ  1 
ATOM   1571 N N   . LYS A 1 209 ? -18.646 8.800  65.568 1.00 17.35 ? 224 LYS A N   1 
ATOM   1572 C CA  . LYS A 1 209 ? -17.453 8.026  65.981 1.00 14.57 ? 224 LYS A CA  1 
ATOM   1573 C C   . LYS A 1 209 ? -16.852 8.630  67.257 1.00 14.02 ? 224 LYS A C   1 
ATOM   1574 O O   . LYS A 1 209 ? -16.733 9.855  67.391 1.00 12.62 ? 224 LYS A O   1 
ATOM   1575 C CB  . LYS A 1 209 ? -16.389 8.088  64.886 1.00 15.11 ? 224 LYS A CB  1 
ATOM   1576 C CG  . LYS A 1 209 ? -16.320 6.819  64.041 1.00 18.55 ? 224 LYS A CG  1 
ATOM   1577 C CD  . LYS A 1 209 ? -17.047 6.948  62.700 1.00 19.86 ? 224 LYS A CD  1 
ATOM   1578 C CE  . LYS A 1 209 ? -16.330 6.210  61.568 1.00 23.62 ? 224 LYS A CE  1 
ATOM   1579 N NZ  . LYS A 1 209 ? -17.097 6.179  60.314 1.00 29.16 ? 224 LYS A NZ  1 
ATOM   1580 N N   . PRO A 1 210 ? -16.480 7.840  68.278 1.00 13.33 ? 225 PRO A N   1 
ATOM   1581 C CA  . PRO A 1 210 ? -15.884 8.394  69.484 1.00 11.09 ? 225 PRO A CA  1 
ATOM   1582 C C   . PRO A 1 210 ? -14.583 9.170  69.267 1.00 11.65 ? 225 PRO A C   1 
ATOM   1583 O O   . PRO A 1 210 ? -13.856 8.952  68.287 1.00 12.49 ? 225 PRO A O   1 
ATOM   1584 C CB  . PRO A 1 210 ? -15.706 7.201  70.394 1.00 10.77 ? 225 PRO A CB  1 
ATOM   1585 C CG  . PRO A 1 210 ? -16.222 5.976  69.660 1.00 10.93 ? 225 PRO A CG  1 
ATOM   1586 C CD  . PRO A 1 210 ? -16.650 6.383  68.280 1.00 9.91  ? 225 PRO A CD  1 
ATOM   1587 N N   . GLY A 1 211 ? -14.246 9.995  70.251 1.00 11.11 ? 226 GLY A N   1 
ATOM   1588 C CA  . GLY A 1 211 ? -13.016 10.754 70.185 1.00 10.67 ? 226 GLY A CA  1 
ATOM   1589 C C   . GLY A 1 211 ? -11.873 9.808  70.487 1.00 10.59 ? 226 GLY A C   1 
ATOM   1590 O O   . GLY A 1 211 ? -12.020 8.897  71.293 1.00 8.62  ? 226 GLY A O   1 
ATOM   1591 N N   . ILE A 1 212 ? -10.720 10.033 69.860 1.00 10.20 ? 227 ILE A N   1 
ATOM   1592 C CA  . ILE A 1 212 ? -9.568  9.175  70.076 1.00 10.03 ? 227 ILE A CA  1 
ATOM   1593 C C   . ILE A 1 212 ? -8.482  10.041 70.718 1.00 7.26  ? 227 ILE A C   1 
ATOM   1594 O O   . ILE A 1 212 ? -8.335  11.237 70.393 1.00 8.67  ? 227 ILE A O   1 
ATOM   1595 C CB  . ILE A 1 212 ? -9.115  8.579  68.731 1.00 14.04 ? 227 ILE A CB  1 
ATOM   1596 C CG1 . ILE A 1 212 ? -8.111  7.451  68.928 1.00 16.17 ? 227 ILE A CG1 1 
ATOM   1597 C CG2 . ILE A 1 212 ? -8.581  9.657  67.855 1.00 9.07  ? 227 ILE A CG2 1 
ATOM   1598 C CD1 . ILE A 1 212 ? -8.794  6.146  69.461 1.00 20.09 ? 227 ILE A CD1 1 
ATOM   1599 N N   . TYR A 1 213 ? -7.777  9.461  71.678 1.00 5.51  ? 228 TYR A N   1 
ATOM   1600 C CA  . TYR A 1 213 ? -6.730  10.148 72.417 1.00 6.07  ? 228 TYR A CA  1 
ATOM   1601 C C   . TYR A 1 213 ? -5.610  9.178  72.515 1.00 6.27  ? 228 TYR A C   1 
ATOM   1602 O O   . TYR A 1 213 ? -5.877  7.975  72.724 1.00 6.30  ? 228 TYR A O   1 
ATOM   1603 C CB  . TYR A 1 213 ? -7.216  10.475 73.828 1.00 6.45  ? 228 TYR A CB  1 
ATOM   1604 C CG  . TYR A 1 213 ? -8.478  11.324 73.834 1.00 7.23  ? 228 TYR A CG  1 
ATOM   1605 C CD1 . TYR A 1 213 ? -9.694  10.802 73.386 1.00 8.24  ? 228 TYR A CD1 1 
ATOM   1606 C CD2 . TYR A 1 213 ? -8.446  12.669 74.253 1.00 10.59 ? 228 TYR A CD2 1 
ATOM   1607 C CE1 . TYR A 1 213 ? -10.831 11.595 73.350 1.00 7.56  ? 228 TYR A CE1 1 
ATOM   1608 C CE2 . TYR A 1 213 ? -9.579  13.459 74.227 1.00 10.36 ? 228 TYR A CE2 1 
ATOM   1609 C CZ  . TYR A 1 213 ? -10.761 12.928 73.771 1.00 10.16 ? 228 TYR A CZ  1 
ATOM   1610 O OH  . TYR A 1 213 ? -11.868 13.727 73.663 1.00 9.44  ? 228 TYR A OH  1 
ATOM   1611 N N   . THR A 1 214 ? -4.373  9.666  72.359 1.00 9.63  ? 229 THR A N   1 
ATOM   1612 C CA  . THR A 1 214 ? -3.173  8.820  72.417 1.00 11.49 ? 229 THR A CA  1 
ATOM   1613 C C   . THR A 1 214 ? -2.804  8.551  73.862 1.00 11.09 ? 229 THR A C   1 
ATOM   1614 O O   . THR A 1 214 ? -2.704  9.485  74.635 1.00 7.48  ? 229 THR A O   1 
ATOM   1615 C CB  . THR A 1 214 ? -1.974  9.497  71.712 1.00 13.69 ? 229 THR A CB  1 
ATOM   1616 O OG1 . THR A 1 214 ? -2.362  9.843  70.371 1.00 16.64 ? 229 THR A OG1 1 
ATOM   1617 C CG2 . THR A 1 214 ? -0.743  8.563  71.656 1.00 8.21  ? 229 THR A CG2 1 
ATOM   1618 N N   . ARG A 1 215 ? -2.586  7.281  74.212 1.00 11.82 ? 230 ARG A N   1 
ATOM   1619 C CA  . ARG A 1 215 ? -2.222  6.881  75.571 1.00 10.81 ? 230 ARG A CA  1 
ATOM   1620 C C   . ARG A 1 215 ? -0.753  7.206  75.738 1.00 10.02 ? 230 ARG A C   1 
ATOM   1621 O O   . ARG A 1 215 ? 0.073   6.709  74.958 1.00 15.42 ? 230 ARG A O   1 
ATOM   1622 C CB  . ARG A 1 215 ? -2.419  5.377  75.745 1.00 13.40 ? 230 ARG A CB  1 
ATOM   1623 C CG  . ARG A 1 215 ? -3.811  4.912  75.471 1.00 14.10 ? 230 ARG A CG  1 
ATOM   1624 C CD  . ARG A 1 215 ? -3.960  3.411  75.694 1.00 13.53 ? 230 ARG A CD  1 
ATOM   1625 N NE  . ARG A 1 215 ? -3.715  3.015  77.080 1.00 16.42 ? 230 ARG A NE  1 
ATOM   1626 C CZ  . ARG A 1 215 ? -2.681  2.275  77.470 1.00 14.75 ? 230 ARG A CZ  1 
ATOM   1627 N NH1 . ARG A 1 215 ? -1.812  1.854  76.565 1.00 13.95 ? 230 ARG A NH1 1 
ATOM   1628 N NH2 . ARG A 1 215 ? -2.521  1.958  78.757 1.00 16.12 ? 230 ARG A NH2 1 
ATOM   1629 N N   . VAL A 1 216 ? -0.405  8.012  76.751 1.00 10.75 ? 231 VAL A N   1 
ATOM   1630 C CA  . VAL A 1 216 ? 1.005   8.365  76.946 1.00 13.44 ? 231 VAL A CA  1 
ATOM   1631 C C   . VAL A 1 216 ? 1.818   7.248  77.586 1.00 16.24 ? 231 VAL A C   1 
ATOM   1632 O O   . VAL A 1 216 ? 3.025   7.161  77.364 1.00 18.53 ? 231 VAL A O   1 
ATOM   1633 C CB  . VAL A 1 216 ? 1.231   9.694  77.739 1.00 11.02 ? 231 VAL A CB  1 
ATOM   1634 C CG1 . VAL A 1 216 ? 0.629   10.876 76.976 1.00 11.40 ? 231 VAL A CG1 1 
ATOM   1635 C CG2 . VAL A 1 216 ? 0.672   9.602  79.150 1.00 14.17 ? 231 VAL A CG2 1 
ATOM   1636 N N   . ALA A 1 217 ? 1.154   6.374  78.334 1.00 15.50 ? 232 ALA A N   1 
ATOM   1637 C CA  . ALA A 1 217 ? 1.856   5.283  79.000 1.00 13.27 ? 232 ALA A CA  1 
ATOM   1638 C C   . ALA A 1 217 ? 2.516   4.363  77.972 1.00 15.13 ? 232 ALA A C   1 
ATOM   1639 O O   . ALA A 1 217 ? 3.582   3.801  78.242 1.00 15.98 ? 232 ALA A O   1 
ATOM   1640 C CB  . ALA A 1 217 ? 0.904   4.509  79.932 1.00 10.08 ? 232 ALA A CB  1 
ATOM   1641 N N   . SER A 1 218 ? 1.908   4.295  76.781 1.00 15.36 ? 233 SER A N   1 
ATOM   1642 C CA  . SER A 1 218 ? 2.385   3.503  75.661 1.00 16.00 ? 233 SER A CA  1 
ATOM   1643 C C   . SER A 1 218 ? 3.665   4.083  75.048 1.00 15.47 ? 233 SER A C   1 
ATOM   1644 O O   . SER A 1 218 ? 4.306   3.436  74.202 1.00 19.07 ? 233 SER A O   1 
ATOM   1645 C CB  . SER A 1 218 ? 1.326   3.450  74.558 1.00 13.94 ? 233 SER A CB  1 
ATOM   1646 O OG  . SER A 1 218 ? 0.123   2.846  74.997 1.00 22.57 ? 233 SER A OG  1 
ATOM   1647 N N   . TYR A 1 219 ? 4.015   5.303  75.453 1.00 17.21 ? 234 TYR A N   1 
ATOM   1648 C CA  . TYR A 1 219 ? 5.180   6.000  74.930 1.00 16.99 ? 234 TYR A CA  1 
ATOM   1649 C C   . TYR A 1 219 ? 6.168   6.499  75.999 1.00 18.56 ? 234 TYR A C   1 
ATOM   1650 O O   . TYR A 1 219 ? 7.124   7.217  75.672 1.00 20.07 ? 234 TYR A O   1 
ATOM   1651 C CB  . TYR A 1 219 ? 4.743   7.175  74.046 1.00 14.95 ? 234 TYR A CB  1 
ATOM   1652 C CG  . TYR A 1 219 ? 4.019   6.788  72.779 1.00 17.06 ? 234 TYR A CG  1 
ATOM   1653 C CD1 . TYR A 1 219 ? 2.651   6.555  72.786 1.00 15.07 ? 234 TYR A CD1 1 
ATOM   1654 C CD2 . TYR A 1 219 ? 4.710   6.650  71.576 1.00 19.19 ? 234 TYR A CD2 1 
ATOM   1655 C CE1 . TYR A 1 219 ? 1.980   6.190  71.627 1.00 12.48 ? 234 TYR A CE1 1 
ATOM   1656 C CE2 . TYR A 1 219 ? 4.059   6.290  70.415 1.00 17.89 ? 234 TYR A CE2 1 
ATOM   1657 C CZ  . TYR A 1 219 ? 2.690   6.058  70.439 1.00 16.59 ? 234 TYR A CZ  1 
ATOM   1658 O OH  . TYR A 1 219 ? 2.047   5.684  69.280 1.00 17.61 ? 234 TYR A OH  1 
ATOM   1659 N N   . ALA A 1 220 ? 5.981   6.070  77.245 1.00 18.94 ? 235 ALA A N   1 
ATOM   1660 C CA  . ALA A 1 220 ? 6.858   6.462  78.341 1.00 18.96 ? 235 ALA A CA  1 
ATOM   1661 C C   . ALA A 1 220 ? 8.344   6.360  77.989 1.00 19.08 ? 235 ALA A C   1 
ATOM   1662 O O   . ALA A 1 220 ? 9.128   7.237  78.353 1.00 18.36 ? 235 ALA A O   1 
ATOM   1663 C CB  . ALA A 1 220 ? 6.558   5.636  79.567 1.00 21.60 ? 235 ALA A CB  1 
ATOM   1664 N N   . ALA A 1 221 ? 8.743   5.312  77.271 1.00 17.93 ? 236 ALA A N   1 
ATOM   1665 C CA  . ALA A 1 221 ? 10.157  5.162  76.898 1.00 19.95 ? 236 ALA A CA  1 
ATOM   1666 C C   . ALA A 1 221 ? 10.622  6.251  75.924 1.00 20.09 ? 236 ALA A C   1 
ATOM   1667 O O   . ALA A 1 221 ? 11.717  6.804  76.086 1.00 22.36 ? 236 ALA A O   1 
ATOM   1668 C CB  . ALA A 1 221 ? 10.435  3.772  76.337 1.00 17.40 ? 236 ALA A CB  1 
ATOM   1669 N N   . TRP A 1 222 ? 9.771   6.607  74.964 1.00 20.10 ? 237 TRP A N   1 
ATOM   1670 C CA  . TRP A 1 222 ? 10.123  7.646  74.001 1.00 20.40 ? 237 TRP A CA  1 
ATOM   1671 C C   . TRP A 1 222 ? 10.254  9.009  74.684 1.00 18.81 ? 237 TRP A C   1 
ATOM   1672 O O   . TRP A 1 222 ? 11.236  9.733  74.498 1.00 19.67 ? 237 TRP A O   1 
ATOM   1673 C CB  . TRP A 1 222 ? 9.077   7.744  72.870 1.00 21.94 ? 237 TRP A CB  1 
ATOM   1674 C CG  . TRP A 1 222 ? 9.376   8.860  71.849 1.00 22.44 ? 237 TRP A CG  1 
ATOM   1675 C CD1 . TRP A 1 222 ? 10.480  8.965  71.034 1.00 22.84 ? 237 TRP A CD1 1 
ATOM   1676 C CD2 . TRP A 1 222 ? 8.575   10.038 71.585 1.00 23.28 ? 237 TRP A CD2 1 
ATOM   1677 N NE1 . TRP A 1 222 ? 10.416  10.130 70.288 1.00 22.71 ? 237 TRP A NE1 1 
ATOM   1678 C CE2 . TRP A 1 222 ? 9.266   10.808 70.604 1.00 22.11 ? 237 TRP A CE2 1 
ATOM   1679 C CE3 . TRP A 1 222 ? 7.348   10.515 72.078 1.00 23.05 ? 237 TRP A CE3 1 
ATOM   1680 C CZ2 . TRP A 1 222 ? 8.772   12.024 70.113 1.00 21.32 ? 237 TRP A CZ2 1 
ATOM   1681 C CZ3 . TRP A 1 222 ? 6.855   11.736 71.577 1.00 22.06 ? 237 TRP A CZ3 1 
ATOM   1682 C CH2 . TRP A 1 222 ? 7.571   12.467 70.609 1.00 20.21 ? 237 TRP A CH2 1 
ATOM   1683 N N   . ILE A 1 223 ? 9.238   9.345  75.474 1.00 16.93 ? 238 ILE A N   1 
ATOM   1684 C CA  . ILE A 1 223 ? 9.195   10.619 76.192 1.00 20.71 ? 238 ILE A CA  1 
ATOM   1685 C C   . ILE A 1 223 ? 10.450  10.775 77.022 1.00 24.08 ? 238 ILE A C   1 
ATOM   1686 O O   . ILE A 1 223 ? 11.110  11.805 76.982 1.00 22.39 ? 238 ILE A O   1 
ATOM   1687 C CB  . ILE A 1 223 ? 7.936   10.727 77.105 1.00 20.12 ? 238 ILE A CB  1 
ATOM   1688 C CG1 . ILE A 1 223 ? 6.663   10.753 76.247 1.00 19.56 ? 238 ILE A CG1 1 
ATOM   1689 C CG2 . ILE A 1 223 ? 8.020   11.979 77.964 1.00 19.41 ? 238 ILE A CG2 1 
ATOM   1690 C CD1 . ILE A 1 223 ? 5.399   10.727 77.045 1.00 23.32 ? 238 ILE A CD1 1 
ATOM   1691 N N   . ASP A 1 224 ? 10.796  9.727  77.745 1.00 26.46 ? 239 ASP A N   1 
ATOM   1692 C CA  . ASP A 1 224 ? 11.973  9.773  78.571 1.00 29.53 ? 239 ASP A CA  1 
ATOM   1693 C C   . ASP A 1 224 ? 13.269  9.983  77.785 1.00 31.30 ? 239 ASP A C   1 
ATOM   1694 O O   . ASP A 1 224 ? 14.105  10.791 78.198 1.00 31.73 ? 239 ASP A O   1 
ATOM   1695 C CB  . ASP A 1 224 ? 12.044  8.535  79.467 1.00 34.51 ? 239 ASP A CB  1 
ATOM   1696 C CG  . ASP A 1 224 ? 11.188  8.672  80.725 1.00 39.10 ? 239 ASP A CG  1 
ATOM   1697 O OD1 . ASP A 1 224 ? 10.886  9.817  81.146 1.00 41.89 ? 239 ASP A OD1 1 
ATOM   1698 O OD2 . ASP A 1 224 ? 10.843  7.626  81.303 1.00 43.16 ? 239 ASP A OD2 1 
ATOM   1699 N N   . SER A 1 225 ? 13.404  9.338  76.626 1.00 28.07 ? 240 SER A N   1 
ATOM   1700 C CA  . SER A 1 225 ? 14.623  9.475  75.827 1.00 30.39 ? 240 SER A CA  1 
ATOM   1701 C C   . SER A 1 225 ? 14.821  10.895 75.281 1.00 29.70 ? 240 SER A C   1 
ATOM   1702 O O   . SER A 1 225 ? 15.965  11.350 75.113 1.00 31.22 ? 240 SER A O   1 
ATOM   1703 C CB  . SER A 1 225 ? 14.662  8.445  74.696 1.00 32.32 ? 240 SER A CB  1 
ATOM   1704 O OG  . SER A 1 225 ? 14.026  8.915  73.523 1.00 36.62 ? 240 SER A OG  1 
ATOM   1705 N N   . VAL A 1 226 ? 13.717  11.598 75.017 1.00 27.38 ? 241 VAL A N   1 
ATOM   1706 C CA  . VAL A 1 226 ? 13.774  12.965 74.497 1.00 25.82 ? 241 VAL A CA  1 
ATOM   1707 C C   . VAL A 1 226 ? 14.120  13.946 75.613 1.00 25.69 ? 241 VAL A C   1 
ATOM   1708 O O   . VAL A 1 226 ? 14.864  14.906 75.393 1.00 27.23 ? 241 VAL A O   1 
ATOM   1709 C CB  . VAL A 1 226 ? 12.454  13.366 73.818 1.00 21.65 ? 241 VAL A CB  1 
ATOM   1710 C CG1 . VAL A 1 226 ? 12.467  14.832 73.435 1.00 23.63 ? 241 VAL A CG1 1 
ATOM   1711 C CG2 . VAL A 1 226 ? 12.224  12.495 72.589 1.00 19.45 ? 241 VAL A CG2 1 
ATOM   1712 N N   . LEU A 1 227 ? 13.630  13.671 76.821 1.00 29.41 ? 242 LEU A N   1 
ATOM   1713 C CA  . LEU A 1 227 ? 13.883  14.536 77.989 1.00 32.71 ? 242 LEU A CA  1 
ATOM   1714 C C   . LEU A 1 227 ? 15.261  14.323 78.666 1.00 37.24 ? 242 LEU A C   1 
ATOM   1715 O O   . LEU A 1 227 ? 15.692  15.129 79.499 1.00 41.01 ? 242 LEU A O   1 
ATOM   1716 C CB  . LEU A 1 227 ? 12.761  14.362 79.032 1.00 29.18 ? 242 LEU A CB  1 
ATOM   1717 C CG  . LEU A 1 227 ? 11.405  15.068 78.857 1.00 27.22 ? 242 LEU A CG  1 
ATOM   1718 C CD1 . LEU A 1 227 ? 10.967  15.159 77.401 1.00 26.43 ? 242 LEU A CD1 1 
ATOM   1719 C CD2 . LEU A 1 227 ? 10.380  14.304 79.655 1.00 22.66 ? 242 LEU A CD2 1 
ATOM   1720 N N   . ALA A 1 228 ? 15.932  13.231 78.311 1.00 41.49 ? 243 ALA A N   1 
ATOM   1721 C CA  . ALA A 1 228 ? 17.240  12.896 78.870 1.00 44.80 ? 243 ALA A CA  1 
ATOM   1722 C C   . ALA A 1 228 ? 18.372  13.823 78.405 1.00 47.21 ? 243 ALA A C   1 
ATOM   1723 O O   . ALA A 1 228 ? 18.577  13.957 77.180 1.00 49.84 ? 243 ALA A O   1 
ATOM   1724 C CB  . ALA A 1 228 ? 17.579  11.432 78.553 1.00 46.03 ? 243 ALA A CB  1 
ATOM   1725 O OXT . ALA A 1 228 ? 19.055  14.395 79.280 1.00 49.51 ? 243 ALA A OXT 1 
HETATM 1726 O O   . HOH B 2 .   ? 5.430   35.237 84.935 0.96 18.58 ? 250 HOH A O   1 
HETATM 1727 O O   . HOH B 2 .   ? 0.150   27.244 82.029 1.26 12.55 ? 251 HOH A O   1 
HETATM 1728 O O   . HOH B 2 .   ? -2.451  28.983 84.322 1.16 8.05  ? 252 HOH A O   1 
HETATM 1729 O O   . HOH B 2 .   ? -3.240  27.652 82.105 1.20 12.35 ? 253 HOH A O   1 
HETATM 1730 O O   . HOH B 2 .   ? -1.652  28.665 78.872 1.02 10.23 ? 254 HOH A O   1 
HETATM 1731 O O   . HOH B 2 .   ? 5.960   30.976 82.934 1.00 8.41  ? 255 HOH A O   1 
HETATM 1732 O O   . HOH B 2 .   ? -0.418  8.114  55.062 1.00 29.65 ? 256 HOH A O   1 
HETATM 1733 O O   . HOH B 2 .   ? 4.767   31.350 86.723 1.04 9.91  ? 257 HOH A O   1 
HETATM 1734 O O   . HOH B 2 .   ? 8.148   12.171 85.350 1.02 24.64 ? 258 HOH A O   1 
HETATM 1735 O O   . HOH B 2 .   ? -4.115  4.107  83.961 1.21 20.43 ? 259 HOH A O   1 
HETATM 1736 O O   . HOH B 2 .   ? -7.655  19.367 82.256 0.97 18.81 ? 260 HOH A O   1 
HETATM 1737 O O   . HOH B 2 .   ? -17.441 24.441 76.191 1.04 14.49 ? 261 HOH A O   1 
HETATM 1738 O O   . HOH B 2 .   ? -14.341 12.802 72.629 1.12 8.02  ? 262 HOH A O   1 
HETATM 1739 O O   . HOH B 2 .   ? -18.285 16.522 67.680 1.17 14.41 ? 263 HOH A O   1 
HETATM 1740 O O   . HOH B 2 .   ? -6.542  21.171 74.036 0.94 4.62  ? 264 HOH A O   1 
HETATM 1741 O O   . HOH B 2 .   ? -6.557  23.857 73.028 0.96 2.91  ? 265 HOH A O   1 
HETATM 1742 O O   . HOH B 2 .   ? -2.565  12.707 69.908 1.10 10.55 ? 266 HOH A O   1 
HETATM 1743 O O   . HOH B 2 .   ? -8.355  25.595 84.590 1.17 9.85  ? 267 HOH A O   1 
HETATM 1744 O O   . HOH B 2 .   ? -6.621  29.035 82.838 0.92 5.95  ? 268 HOH A O   1 
HETATM 1745 O O   . HOH B 2 .   ? -5.979  37.999 88.971 1.17 28.94 ? 269 HOH A O   1 
HETATM 1746 O O   . HOH B 2 .   ? -7.893  35.304 88.314 1.05 10.24 ? 270 HOH A O   1 
HETATM 1747 O O   . HOH B 2 .   ? 7.377   12.343 61.956 1.08 22.77 ? 271 HOH A O   1 
HETATM 1748 O O   . HOH B 2 .   ? -8.123  18.989 64.434 1.09 25.71 ? 272 HOH A O   1 
HETATM 1749 O O   . HOH B 2 .   ? -6.784  21.274 66.315 1.01 27.37 ? 273 HOH A O   1 
HETATM 1750 O O   . HOH B 2 .   ? -2.597  12.929 61.045 1.03 29.93 ? 274 HOH A O   1 
HETATM 1751 O O   . HOH B 2 .   ? -0.923  5.838  68.956 0.97 12.71 ? 275 HOH A O   1 
HETATM 1752 O O   . HOH B 2 .   ? -10.313 13.393 70.050 1.22 23.16 ? 276 HOH A O   1 
HETATM 1753 O O   . HOH B 2 .   ? 10.047  34.820 75.978 1.19 11.49 ? 277 HOH A O   1 
HETATM 1754 O O   . HOH B 2 .   ? 0.903   8.606  61.604 1.28 16.09 ? 278 HOH A O   1 
HETATM 1755 O O   . HOH B 2 .   ? 8.174   7.837  59.992 1.08 29.62 ? 279 HOH A O   1 
HETATM 1756 O O   . HOH B 2 .   ? -1.575  8.554  68.126 0.93 10.97 ? 280 HOH A O   1 
HETATM 1757 O O   . HOH B 2 .   ? 2.686   31.016 88.512 0.98 9.27  ? 281 HOH A O   1 
HETATM 1758 O O   . HOH B 2 .   ? 2.507   6.673  86.961 1.18 17.74 ? 282 HOH A O   1 
HETATM 1759 O O   . HOH B 2 .   ? -18.350 0.820  80.964 0.95 29.89 ? 283 HOH A O   1 
HETATM 1760 O O   . HOH B 2 .   ? -15.415 -0.425 84.783 0.81 9.28  ? 284 HOH A O   1 
HETATM 1761 O O   . HOH B 2 .   ? -10.785 3.555  75.538 1.03 23.13 ? 285 HOH A O   1 
HETATM 1762 O O   . HOH B 2 .   ? -12.774 -2.394 64.442 1.31 35.12 ? 286 HOH A O   1 
HETATM 1763 O O   . HOH B 2 .   ? -9.988  10.386 91.420 1.14 28.01 ? 287 HOH A O   1 
HETATM 1764 O O   . HOH B 2 .   ? -4.975  7.843  86.134 1.21 25.94 ? 288 HOH A O   1 
HETATM 1765 O O   . HOH B 2 .   ? -23.974 19.794 72.917 0.98 13.99 ? 289 HOH A O   1 
HETATM 1766 O O   . HOH B 2 .   ? -14.124 20.985 64.777 1.10 14.46 ? 290 HOH A O   1 
HETATM 1767 O O   . HOH B 2 .   ? -14.311 30.959 85.542 1.14 31.62 ? 291 HOH A O   1 
HETATM 1768 O O   . HOH B 2 .   ? -12.274 31.609 86.891 0.88 28.26 ? 292 HOH A O   1 
HETATM 1769 O O   . HOH B 2 .   ? -6.785  35.758 85.911 1.00 13.24 ? 293 HOH A O   1 
HETATM 1770 O O   . HOH B 2 .   ? -2.600  35.155 86.510 1.04 20.09 ? 294 HOH A O   1 
HETATM 1771 O O   . HOH B 2 .   ? 4.653   32.712 84.410 1.21 27.47 ? 295 HOH A O   1 
HETATM 1772 O O   . HOH B 2 .   ? 3.678   -2.869 82.816 1.10 25.97 ? 296 HOH A O   1 
HETATM 1773 O O   . HOH B 2 .   ? -6.645  3.492  79.028 1.16 18.30 ? 297 HOH A O   1 
HETATM 1774 O O   . HOH B 2 .   ? -17.901 4.236  79.105 1.14 26.02 ? 298 HOH A O   1 
HETATM 1775 O O   . HOH B 2 .   ? -23.734 12.625 83.660 1.12 33.56 ? 299 HOH A O   1 
HETATM 1776 O O   . HOH B 2 .   ? -12.740 25.150 74.020 1.00 15.00 ? 300 HOH A O   1 
HETATM 1777 O O   . HOH B 2 .   ? -5.633  26.571 83.898 1.00 15.00 ? 301 HOH A O   1 
HETATM 1778 O O   . HOH B 2 .   ? -6.115  32.905 68.908 1.00 15.00 ? 302 HOH A O   1 
HETATM 1779 O O   . HOH B 2 .   ? -2.441  34.572 72.977 1.00 15.00 ? 303 HOH A O   1 
HETATM 1780 O O   . HOH B 2 .   ? -1.526  6.228  79.190 1.00 15.00 ? 304 HOH A O   1 
HETATM 1781 O O   . HOH B 2 .   ? -1.698  3.765  80.923 1.00 15.00 ? 305 HOH A O   1 
HETATM 1782 O O   . HOH B 2 .   ? -10.772 1.340  78.865 1.00 15.00 ? 306 HOH A O   1 
HETATM 1783 O O   . HOH B 2 .   ? -19.996 13.585 79.718 1.00 15.00 ? 307 HOH A O   1 
HETATM 1784 O O   . HOH B 2 .   ? -19.766 6.893  83.329 1.00 15.00 ? 308 HOH A O   1 
HETATM 1785 O O   . HOH B 2 .   ? -7.658  6.236  86.660 1.00 15.00 ? 309 HOH A O   1 
HETATM 1786 O O   . HOH B 2 .   ? -9.910  7.836  88.029 1.00 15.00 ? 310 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE A . n 
A 1 2   LEU 2   17  17  LEU LEU A . n 
A 1 3   GLY 3   18  18  GLY GLY A . n 
A 1 4   GLY 4   19  19  GLY GLY A . n 
A 1 5   ARG 5   20  20  ARG ARG A . n 
A 1 6   GLU 6   21  21  GLU GLU A . n 
A 1 7   ALA 7   22  22  ALA ALA A . n 
A 1 8   GLU 8   23  23  GLU GLU A . n 
A 1 9   ALA 9   24  24  ALA ALA A . n 
A 1 10  HIS 10  25  25  HIS HIS A . n 
A 1 11  ALA 11  26  26  ALA ALA A . n 
A 1 12  ARG 12  27  27  ARG ARG A . n 
A 1 13  PRO 13  28  28  PRO PRO A . n 
A 1 14  TYR 14  29  29  TYR TYR A . n 
A 1 15  MET 15  30  30  MET MET A . n 
A 1 16  ALA 16  31  31  ALA ALA A . n 
A 1 17  SER 17  32  32  SER SER A . n 
A 1 18  VAL 18  33  33  VAL VAL A . n 
A 1 19  GLN 19  34  34  GLN GLN A . n 
A 1 20  LEU 20  35  35  LEU LEU A . n 
A 1 21  ASN 21  36  36  ASN ASN A . n 
A 1 22  GLY 22  38  38  GLY GLY A . n 
A 1 23  ALA 23  39  39  ALA ALA A . n 
A 1 24  HIS 24  40  40  HIS HIS A . n 
A 1 25  LEU 25  41  41  LEU LEU A . n 
A 1 26  CYS 26  42  42  CYS CYS A . n 
A 1 27  GLY 27  43  43  GLY GLY A . n 
A 1 28  GLY 28  44  44  GLY GLY A . n 
A 1 29  VAL 29  45  45  VAL VAL A . n 
A 1 30  LEU 30  46  46  LEU LEU A . n 
A 1 31  VAL 31  47  47  VAL VAL A . n 
A 1 32  ALA 32  48  48  ALA ALA A . n 
A 1 33  GLU 33  49  49  GLU GLU A . n 
A 1 34  GLN 34  50  50  GLN GLN A . n 
A 1 35  TRP 35  51  51  TRP TRP A . n 
A 1 36  VAL 36  52  52  VAL VAL A . n 
A 1 37  LEU 37  53  53  LEU LEU A . n 
A 1 38  SER 38  54  54  SER SER A . n 
A 1 39  ALA 39  55  55  ALA ALA A . n 
A 1 40  ALA 40  56  56  ALA ALA A . n 
A 1 41  HIS 41  57  57  HIS HIS A . n 
A 1 42  CYS 42  58  58  CYS CYS A . n 
A 1 43  LEU 43  59  59  LEU LEU A . n 
A 1 44  GLU 44  60  60  GLU GLU A . n 
A 1 45  ASP 45  61  61  ASP ASP A . n 
A 1 46  ALA 46  61  61  ALA ALA A A n 
A 1 47  ALA 47  61  61  ALA ALA A B n 
A 1 48  ASP 48  61  61  ASP ASP A C n 
A 1 49  GLY 49  62  62  GLY GLY A . n 
A 1 50  LYS 50  63  63  LYS LYS A . n 
A 1 51  VAL 51  64  64  VAL VAL A . n 
A 1 52  GLN 52  65  65  GLN GLN A . n 
A 1 53  VAL 53  66  66  VAL VAL A . n 
A 1 54  LEU 54  67  67  LEU LEU A . n 
A 1 55  LEU 55  68  68  LEU LEU A . n 
A 1 56  GLY 56  69  69  GLY GLY A . n 
A 1 57  ALA 57  70  70  ALA ALA A . n 
A 1 58  HIS 58  71  71  HIS HIS A . n 
A 1 59  SER 59  72  72  SER SER A . n 
A 1 60  LEU 60  73  73  LEU LEU A . n 
A 1 61  SER 61  74  74  SER SER A . n 
A 1 62  GLN 62  75  75  GLN GLN A . n 
A 1 63  PRO 63  76  76  PRO PRO A . n 
A 1 64  GLU 64  77  77  GLU GLU A . n 
A 1 65  PRO 65  78  78  PRO PRO A . n 
A 1 66  SER 66  79  79  SER SER A . n 
A 1 67  LYS 67  80  80  LYS LYS A . n 
A 1 68  ARG 68  81  81  ARG ARG A . n 
A 1 69  LEU 69  82  82  LEU LEU A . n 
A 1 70  TYR 70  83  83  TYR TYR A . n 
A 1 71  ASP 71  84  84  ASP ASP A . n 
A 1 72  VAL 72  85  85  VAL VAL A . n 
A 1 73  LEU 73  86  86  LEU LEU A . n 
A 1 74  ARG 74  87  87  ARG ARG A . n 
A 1 75  ALA 75  88  88  ALA ALA A . n 
A 1 76  VAL 76  89  89  VAL VAL A . n 
A 1 77  PRO 77  90  90  PRO PRO A . n 
A 1 78  HIS 78  91  91  HIS HIS A . n 
A 1 79  PRO 79  92  92  PRO PRO A . n 
A 1 80  ASP 80  93  93  ASP ASP A . n 
A 1 81  TYR 81  94  94  TYR TYR A . n 
A 1 82  GLN 82  95  95  GLN GLN A . n 
A 1 83  PRO 83  96  96  PRO PRO A . n 
A 1 84  ASP 84  97  97  ASP ASP A . n 
A 1 85  THR 85  98  98  THR THR A . n 
A 1 86  ILE 86  99  99  ILE ILE A . n 
A 1 87  ASP 87  100 100 ASP ASP A . n 
A 1 88  HIS 88  101 101 HIS HIS A . n 
A 1 89  ASP 89  102 102 ASP ASP A . n 
A 1 90  LEU 90  103 103 LEU LEU A . n 
A 1 91  LEU 91  104 104 LEU LEU A . n 
A 1 92  LEU 92  105 105 LEU LEU A . n 
A 1 93  LEU 93  106 106 LEU LEU A . n 
A 1 94  GLN 94  107 107 GLN GLN A . n 
A 1 95  LEU 95  108 108 LEU LEU A . n 
A 1 96  SER 96  109 109 SER SER A . n 
A 1 97  GLU 97  110 110 GLU GLU A . n 
A 1 98  LYS 98  111 111 LYS LYS A . n 
A 1 99  ALA 99  112 112 ALA ALA A . n 
A 1 100 THR 100 113 113 THR THR A . n 
A 1 101 LEU 101 114 114 LEU LEU A . n 
A 1 102 GLY 102 115 115 GLY GLY A . n 
A 1 103 PRO 103 118 118 PRO PRO A . n 
A 1 104 ALA 104 119 119 ALA ALA A . n 
A 1 105 VAL 105 120 120 VAL VAL A . n 
A 1 106 ARG 106 121 121 ARG ARG A . n 
A 1 107 PRO 107 122 122 PRO PRO A . n 
A 1 108 LEU 108 123 123 LEU LEU A . n 
A 1 109 PRO 109 124 124 PRO PRO A . n 
A 1 110 TRP 110 124 124 TRP TRP A A n 
A 1 111 GLN 111 125 125 GLN GLN A . n 
A 1 112 ARG 112 126 126 ARG ARG A . n 
A 1 113 VAL 113 127 127 VAL VAL A . n 
A 1 114 ASP 114 128 128 ASP ASP A . n 
A 1 115 ARG 115 129 129 ARG ARG A . n 
A 1 116 ASP 116 129 129 ASP ASP A A n 
A 1 117 VAL 117 130 130 VAL VAL A . n 
A 1 118 ALA 118 131 131 ALA ALA A . n 
A 1 119 PRO 119 132 132 PRO PRO A . n 
A 1 120 GLY 120 133 133 GLY GLY A . n 
A 1 121 THR 121 134 134 THR THR A . n 
A 1 122 LEU 122 135 135 LEU LEU A . n 
A 1 123 CYS 123 136 136 CYS CYS A . n 
A 1 124 ASP 124 137 137 ASP ASP A . n 
A 1 125 VAL 125 138 138 VAL VAL A . n 
A 1 126 ALA 126 139 139 ALA ALA A . n 
A 1 127 GLY 127 140 140 GLY GLY A . n 
A 1 128 TRP 128 141 141 TRP TRP A . n 
A 1 129 GLY 129 142 142 GLY GLY A . n 
A 1 130 ILE 130 143 143 ILE ILE A . n 
A 1 131 VAL 131 144 144 VAL VAL A . n 
A 1 132 ASN 132 145 145 ASN ASN A . n 
A 1 133 HIS 133 146 146 HIS HIS A . n 
A 1 134 ALA 134 147 147 ALA ALA A . n 
A 1 135 GLY 135 149 149 GLY GLY A . n 
A 1 136 ARG 136 150 150 ARG ARG A . n 
A 1 137 ARG 137 151 151 ARG ARG A . n 
A 1 138 PRO 138 152 152 PRO PRO A . n 
A 1 139 ASP 139 153 153 ASP ASP A . n 
A 1 140 SER 140 154 154 SER SER A . n 
A 1 141 LEU 141 155 155 LEU LEU A . n 
A 1 142 GLN 142 156 156 GLN GLN A . n 
A 1 143 HIS 143 157 157 HIS HIS A . n 
A 1 144 VAL 144 158 158 VAL VAL A . n 
A 1 145 LEU 145 159 159 LEU LEU A . n 
A 1 146 LEU 146 160 160 LEU LEU A . n 
A 1 147 PRO 147 161 161 PRO PRO A . n 
A 1 148 VAL 148 162 162 VAL VAL A . n 
A 1 149 LEU 149 163 163 LEU LEU A . n 
A 1 150 ASP 150 164 164 ASP ASP A . n 
A 1 151 ARG 151 165 165 ARG ARG A . n 
A 1 152 ALA 152 166 166 ALA ALA A . n 
A 1 153 THR 153 167 167 THR THR A . n 
A 1 154 CYS 154 168 168 CYS CYS A . n 
A 1 155 ASN 155 169 169 ASN ASN A . n 
A 1 156 ARG 156 170 170 ARG ARG A . n 
A 1 157 ARG 157 170 170 ARG ARG A A n 
A 1 158 THR 158 170 170 THR THR A B n 
A 1 159 HIS 159 171 171 HIS HIS A . n 
A 1 160 HIS 160 172 172 HIS HIS A . n 
A 1 161 ASP 161 173 173 ASP ASP A . n 
A 1 162 GLY 162 174 174 GLY GLY A . n 
A 1 163 ALA 163 175 175 ALA ALA A . n 
A 1 164 ILE 164 176 176 ILE ILE A . n 
A 1 165 THR 165 177 177 THR THR A . n 
A 1 166 GLU 166 178 178 GLU GLU A . n 
A 1 167 ARG 167 179 179 ARG ARG A . n 
A 1 168 LEU 168 180 180 LEU LEU A . n 
A 1 169 MET 169 181 181 MET MET A . n 
A 1 170 CYS 170 182 182 CYS CYS A . n 
A 1 171 ALA 171 183 183 ALA ALA A . n 
A 1 172 GLU 172 184 184 GLU GLU A . n 
A 1 173 SER 173 185 185 SER SER A . n 
A 1 174 ASN 174 186 186 ASN ASN A . n 
A 1 175 ARG 175 187 187 ARG ARG A . n 
A 1 176 ARG 176 188 188 ARG ARG A . n 
A 1 177 ASP 177 189 189 ASP ASP A . n 
A 1 178 SER 178 190 190 SER SER A . n 
A 1 179 CYS 179 191 191 CYS CYS A . n 
A 1 180 LYS 180 192 192 LYS LYS A . n 
A 1 181 GLY 181 193 193 GLY GLY A . n 
A 1 182 ASP 182 194 194 ASP ASP A . n 
A 1 183 SER 183 195 195 SER SER A . n 
A 1 184 GLY 184 196 196 GLY GLY A . n 
A 1 185 GLY 185 197 197 GLY GLY A . n 
A 1 186 PRO 186 198 198 PRO PRO A . n 
A 1 187 LEU 187 199 199 LEU LEU A . n 
A 1 188 VAL 188 200 200 VAL VAL A . n 
A 1 189 CYS 189 201 201 CYS CYS A . n 
A 1 190 GLY 190 202 202 GLY GLY A . n 
A 1 191 GLY 191 207 207 GLY GLY A . n 
A 1 192 VAL 192 208 208 VAL VAL A . n 
A 1 193 LEU 193 209 209 LEU LEU A . n 
A 1 194 GLU 194 210 210 GLU GLU A . n 
A 1 195 GLY 195 211 211 GLY GLY A . n 
A 1 196 VAL 196 212 212 VAL VAL A . n 
A 1 197 VAL 197 213 213 VAL VAL A . n 
A 1 198 SER 198 214 214 SER SER A . n 
A 1 199 TRP 199 215 215 TRP TRP A . n 
A 1 200 GLY 200 216 216 GLY GLY A . n 
A 1 201 SER 201 217 217 SER SER A . n 
A 1 202 ARG 202 218 218 ARG ARG A . n 
A 1 203 VAL 203 219 219 VAL VAL A . n 
A 1 204 CYS 204 220 220 CYS CYS A . n 
A 1 205 GLY 205 221 221 GLY GLY A . n 
A 1 206 ASN 206 222 222 ASN ASN A . n 
A 1 207 ARG 207 223 223 ARG ARG A . n 
A 1 208 LYS 208 223 223 LYS LYS A A n 
A 1 209 LYS 209 224 224 LYS LYS A . n 
A 1 210 PRO 210 225 225 PRO PRO A . n 
A 1 211 GLY 211 226 226 GLY GLY A . n 
A 1 212 ILE 212 227 227 ILE ILE A . n 
A 1 213 TYR 213 228 228 TYR TYR A . n 
A 1 214 THR 214 229 229 THR THR A . n 
A 1 215 ARG 215 230 230 ARG ARG A . n 
A 1 216 VAL 216 231 231 VAL VAL A . n 
A 1 217 ALA 217 232 232 ALA ALA A . n 
A 1 218 SER 218 233 233 SER SER A . n 
A 1 219 TYR 219 234 234 TYR TYR A . n 
A 1 220 ALA 220 235 235 ALA ALA A . n 
A 1 221 ALA 221 236 236 ALA ALA A . n 
A 1 222 TRP 222 237 237 TRP TRP A . n 
A 1 223 ILE 223 238 238 ILE ILE A . n 
A 1 224 ASP 224 239 239 ASP ASP A . n 
A 1 225 SER 225 240 240 SER SER A . n 
A 1 226 VAL 226 241 241 VAL VAL A . n 
A 1 227 LEU 227 242 242 LEU LEU A . n 
A 1 228 ALA 228 243 243 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  250 250 HOH HOH A . 
B 2 HOH 2  251 251 HOH HOH A . 
B 2 HOH 3  252 252 HOH HOH A . 
B 2 HOH 4  253 253 HOH HOH A . 
B 2 HOH 5  254 254 HOH HOH A . 
B 2 HOH 6  255 255 HOH HOH A . 
B 2 HOH 7  256 256 HOH HOH A . 
B 2 HOH 8  257 257 HOH HOH A . 
B 2 HOH 9  258 258 HOH HOH A . 
B 2 HOH 10 259 259 HOH HOH A . 
B 2 HOH 11 260 260 HOH HOH A . 
B 2 HOH 12 261 261 HOH HOH A . 
B 2 HOH 13 262 262 HOH HOH A . 
B 2 HOH 14 263 263 HOH HOH A . 
B 2 HOH 15 264 264 HOH HOH A . 
B 2 HOH 16 265 265 HOH HOH A . 
B 2 HOH 17 266 266 HOH HOH A . 
B 2 HOH 18 267 267 HOH HOH A . 
B 2 HOH 19 268 268 HOH HOH A . 
B 2 HOH 20 269 269 HOH HOH A . 
B 2 HOH 21 270 270 HOH HOH A . 
B 2 HOH 22 271 271 HOH HOH A . 
B 2 HOH 23 272 272 HOH HOH A . 
B 2 HOH 24 273 273 HOH HOH A . 
B 2 HOH 25 274 274 HOH HOH A . 
B 2 HOH 26 275 275 HOH HOH A . 
B 2 HOH 27 276 276 HOH HOH A . 
B 2 HOH 28 277 277 HOH HOH A . 
B 2 HOH 29 278 278 HOH HOH A . 
B 2 HOH 30 279 279 HOH HOH A . 
B 2 HOH 31 280 280 HOH HOH A . 
B 2 HOH 32 281 281 HOH HOH A . 
B 2 HOH 33 282 282 HOH HOH A . 
B 2 HOH 34 283 283 HOH HOH A . 
B 2 HOH 35 284 284 HOH HOH A . 
B 2 HOH 36 285 285 HOH HOH A . 
B 2 HOH 37 286 286 HOH HOH A . 
B 2 HOH 38 287 287 HOH HOH A . 
B 2 HOH 39 288 288 HOH HOH A . 
B 2 HOH 40 289 289 HOH HOH A . 
B 2 HOH 41 290 290 HOH HOH A . 
B 2 HOH 42 291 291 HOH HOH A . 
B 2 HOH 43 292 292 HOH HOH A . 
B 2 HOH 44 293 293 HOH HOH A . 
B 2 HOH 45 294 294 HOH HOH A . 
B 2 HOH 46 295 295 HOH HOH A . 
B 2 HOH 47 296 296 HOH HOH A . 
B 2 HOH 48 297 297 HOH HOH A . 
B 2 HOH 49 298 298 HOH HOH A . 
B 2 HOH 50 299 299 HOH HOH A . 
B 2 HOH 51 300 300 HOH HOH A . 
B 2 HOH 52 301 301 HOH HOH A . 
B 2 HOH 53 302 302 HOH HOH A . 
B 2 HOH 54 303 303 HOH HOH A . 
B 2 HOH 55 304 304 HOH HOH A . 
B 2 HOH 56 305 305 HOH HOH A . 
B 2 HOH 57 306 306 HOH HOH A . 
B 2 HOH 58 307 307 HOH HOH A . 
B 2 HOH 59 308 308 HOH HOH A . 
B 2 HOH 60 309 309 HOH HOH A . 
B 2 HOH 61 310 310 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-07-11 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' . ? 1 
XENGEN 'data reduction'  . ? 2 
PROLSQ refinement        . ? 3 
XENGEN 'data scaling'    . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A HIS 171 ? ? N A HIS 172 ? ? 1.157 1.336 -0.179 0.023 Y 
2 1 C A ALA 175 ? ? N A ILE 176 ? ? 1.485 1.336 0.149  0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA A CYS 168 ? ? CB A CYS 168 ? ? SG  A CYS 168 ? ? 123.07 114.20 8.87   1.10 N 
2  1 NE A ARG 170 ? ? CZ A ARG 170 ? ? NH2 A ARG 170 ? ? 124.01 120.30 3.71   0.50 N 
3  1 NE A ARG 170 A ? CZ A ARG 170 A ? NH2 A ARG 170 A ? 124.05 120.30 3.75   0.50 N 
4  1 CA A ILE 176 ? ? CB A ILE 176 ? ? CG1 A ILE 176 ? ? 130.18 111.00 19.18  1.90 N 
5  1 CA A ILE 176 ? ? CB A ILE 176 ? ? CG2 A ILE 176 ? ? 98.01  110.90 -12.89 2.00 N 
6  1 NE A ARG 179 ? ? CZ A ARG 179 ? ? NH2 A ARG 179 ? ? 123.60 120.30 3.30   0.50 N 
7  1 CA A CYS 182 ? ? CB A CYS 182 ? ? SG  A CYS 182 ? ? 103.15 114.00 -10.85 1.80 N 
8  1 NE A ARG 187 ? ? CZ A ARG 187 ? ? NH2 A ARG 187 ? ? 123.72 120.30 3.42   0.50 N 
9  1 NE A ARG 188 ? ? CZ A ARG 188 ? ? NH2 A ARG 188 ? ? 123.86 120.30 3.56   0.50 N 
10 1 NE A ARG 218 ? ? CZ A ARG 218 ? ? NH2 A ARG 218 ? ? 123.53 120.30 3.23   0.50 N 
11 1 NE A ARG 223 ? ? CZ A ARG 223 ? ? NH1 A ARG 223 ? ? 123.97 120.30 3.67   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 61  A ? -104.11 72.63   
2 1 HIS A 71  ? ? -121.44 -65.37  
3 1 ASP A 97  ? ? 64.50   63.17   
4 1 THR A 170 B ? -62.97  -88.06  
5 1 HIS A 172 ? ? 90.58   103.08  
6 1 ASP A 173 ? ? 83.15   -56.37  
7 1 ALA A 175 ? ? 16.90   145.62  
8 1 GLU A 184 ? ? -49.32  151.77  
9 1 SER A 214 ? ? -90.20  -157.23 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ALA 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              175 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -19.76 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 20  ? ? 0.241 'SIDE CHAIN' 
2 1 ARG A 81  ? ? 0.141 'SIDE CHAIN' 
3 1 ARG A 165 ? ? 0.243 'SIDE CHAIN' 
4 1 ARG A 188 ? ? 0.172 'SIDE CHAIN' 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   HIS 
_pdbx_validate_polymer_linkage.auth_seq_id_1    171 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   HIS 
_pdbx_validate_polymer_linkage.auth_seq_id_2    172 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.16 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#