data_1DSZ
# 
_entry.id   1DSZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DSZ         
NDB   PD0115       
RCSB  RCSB010339   
WWPDB D_1000010339 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DSZ 
_pdbx_database_status.recvd_initial_deposition_date   2000-01-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rastinejad, F.'     1 
'Wagner, T.'         2 
'Zhao, Q.'           3 
'Khorasanizadeh, S.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            19 
_citation.page_first                1045 
_citation.page_last                 1054 
_citation.year                      2000 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10698945 
_citation.pdbx_database_id_DOI      10.1093/emboj/19.5.1045 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rastinejad, F.'     1 
primary 'Wagner, T.'         2 
primary 'Zhao, Q.'           3 
primary 'Khorasanizadeh, S.' 4 
# 
_cell.entry_id           1DSZ 
_cell.length_a           80.660 
_cell.length_b           33.900 
_cell.length_c           101.860 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DSZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*CP*AP*GP*GP*TP*CP*AP*AP*AP*GP*GP*TP*CP*AP*G)-3')
;
4643.037  1   ? ? ?                  ? 
2 polymer     syn 
;DNA (5'-D(*CP*TP*GP*AP*CP*CP*TP*TP*TP*GP*AP*CP*CP*TP*G)-3')
;
4535.946  1   ? ? ?                  ? 
3 polymer     man 'RETINOIC ACID RECEPTOR ALPHA'                                10220.006 1   ? ? 'RESIDUES 82-167'  ? 
4 polymer     man 'RETINOIC ACID RECEPTOR RXR-ALPHA'                            9993.584  1   ? ? 'RESIDUES 129-212' ? 
5 non-polymer syn 'ZINC ION'                                                    65.409    4   ? ? ?                  ? 
6 water       nat water                                                         18.015    338 ? ? ?                  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 RAR-ALPHA 
4 RXR-ALPHA 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DA)(DG)(DG)(DT)(DC)(DA)(DA)(DA)(DG)(DG)(DT)(DC)(DA)(DG)'                            
CAGGTCAAAGGTCAG                                                                           C ? 
2 polydeoxyribonucleotide no no '(DC)(DT)(DG)(DA)(DC)(DC)(DT)(DT)(DT)(DG)(DA)(DC)(DC)(DT)(DG)'                            
CTGACCTTTGACCTG                                                                           D ? 
3 'polypeptide(L)'        no no 
;PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRND
RNKKKK
;
;PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRND
RNKKKK
;
A ? 
4 'polypeptide(L)'        no no 
;GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRG
;
;GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQE
ERQRG
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DC  n 
1 2  DA  n 
1 3  DG  n 
1 4  DG  n 
1 5  DT  n 
1 6  DC  n 
1 7  DA  n 
1 8  DA  n 
1 9  DA  n 
1 10 DG  n 
1 11 DG  n 
1 12 DT  n 
1 13 DC  n 
1 14 DA  n 
1 15 DG  n 
2 1  DC  n 
2 2  DT  n 
2 3  DG  n 
2 4  DA  n 
2 5  DC  n 
2 6  DC  n 
2 7  DT  n 
2 8  DT  n 
2 9  DT  n 
2 10 DG  n 
2 11 DA  n 
2 12 DC  n 
2 13 DC  n 
2 14 DT  n 
2 15 DG  n 
3 1  PRO n 
3 2  ARG n 
3 3  ILE n 
3 4  TYR n 
3 5  LYS n 
3 6  PRO n 
3 7  CYS n 
3 8  PHE n 
3 9  VAL n 
3 10 CYS n 
3 11 GLN n 
3 12 ASP n 
3 13 LYS n 
3 14 SER n 
3 15 SER n 
3 16 GLY n 
3 17 TYR n 
3 18 HIS n 
3 19 TYR n 
3 20 GLY n 
3 21 VAL n 
3 22 SER n 
3 23 ALA n 
3 24 CYS n 
3 25 GLU n 
3 26 GLY n 
3 27 CYS n 
3 28 LYS n 
3 29 GLY n 
3 30 PHE n 
3 31 PHE n 
3 32 ARG n 
3 33 ARG n 
3 34 SER n 
3 35 ILE n 
3 36 GLN n 
3 37 LYS n 
3 38 ASN n 
3 39 MET n 
3 40 VAL n 
3 41 TYR n 
3 42 THR n 
3 43 CYS n 
3 44 HIS n 
3 45 ARG n 
3 46 ASP n 
3 47 LYS n 
3 48 ASN n 
3 49 CYS n 
3 50 ILE n 
3 51 ILE n 
3 52 ASN n 
3 53 LYS n 
3 54 VAL n 
3 55 THR n 
3 56 ARG n 
3 57 ASN n 
3 58 ARG n 
3 59 CYS n 
3 60 GLN n 
3 61 TYR n 
3 62 CYS n 
3 63 ARG n 
3 64 LEU n 
3 65 GLN n 
3 66 LYS n 
3 67 CYS n 
3 68 PHE n 
3 69 GLU n 
3 70 VAL n 
3 71 GLY n 
3 72 MET n 
3 73 SER n 
3 74 LYS n 
3 75 GLU n 
3 76 SER n 
3 77 VAL n 
3 78 ARG n 
3 79 ASN n 
3 80 ASP n 
3 81 ARG n 
3 82 ASN n 
3 83 LYS n 
3 84 LYS n 
3 85 LYS n 
3 86 LYS n 
4 1  GLY n 
4 2  SER n 
4 3  PHE n 
4 4  THR n 
4 5  LYS n 
4 6  HIS n 
4 7  ILE n 
4 8  CYS n 
4 9  ALA n 
4 10 ILE n 
4 11 CYS n 
4 12 GLY n 
4 13 ASP n 
4 14 ARG n 
4 15 SER n 
4 16 SER n 
4 17 GLY n 
4 18 LYS n 
4 19 HIS n 
4 20 TYR n 
4 21 GLY n 
4 22 VAL n 
4 23 TYR n 
4 24 SER n 
4 25 CYS n 
4 26 GLU n 
4 27 GLY n 
4 28 CYS n 
4 29 LYS n 
4 30 GLY n 
4 31 PHE n 
4 32 PHE n 
4 33 LYS n 
4 34 ARG n 
4 35 THR n 
4 36 VAL n 
4 37 ARG n 
4 38 LYS n 
4 39 ASP n 
4 40 LEU n 
4 41 THR n 
4 42 TYR n 
4 43 THR n 
4 44 CYS n 
4 45 ARG n 
4 46 ASP n 
4 47 ASN n 
4 48 LYS n 
4 49 ASP n 
4 50 CYS n 
4 51 LEU n 
4 52 ILE n 
4 53 ASP n 
4 54 LYS n 
4 55 ARG n 
4 56 GLN n 
4 57 ARG n 
4 58 ASN n 
4 59 ARG n 
4 60 CYS n 
4 61 GLN n 
4 62 TYR n 
4 63 CYS n 
4 64 ARG n 
4 65 TYR n 
4 66 GLN n 
4 67 LYS n 
4 68 CYS n 
4 69 LEU n 
4 70 ALA n 
4 71 MET n 
4 72 GLY n 
4 73 MET n 
4 74 LYS n 
4 75 ARG n 
4 76 GLU n 
4 77 ALA n 
4 78 VAL n 
4 79 GLN n 
4 80 GLU n 
4 81 GLU n 
4 82 ARG n 
4 83 GLN n 
4 84 ARG n 
4 85 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? PLASMID ? ? ? PGEX-2T ? ? 
4 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? PLASMID ? ? ? PGEX-2T ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP RARA_HUMAN P10276 3 82  ? ? 
2 UNP RXRA_HUMAN P19793 4 129 ? ? 
3 PDB 1DSZ       1DSZ   1 ?   ? ? 
4 PDB 1DSZ       1DSZ   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DSZ A 1 ? 86 ? P10276 82   ? 167  ? 1129 1214 
2 2 1DSZ B 2 ? 85 ? P19793 129  ? 212  ? 1229 1312 
3 3 1DSZ C 1 ? 15 ? 1DSZ   1495 ? 1509 ? 1495 1509 
4 4 1DSZ D 1 ? 15 ? 1DSZ   1531 ? 1545 ? 1531 1545 
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             1DSZ 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           B 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P19793 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      INSERTION 
_struct_ref_seq_dif.pdbx_auth_seq_num            1228 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          1DSZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   47.43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            281 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;18-23% PEG 3350, 25 mM Tris buffer, 5 mM MgCl2, 0.4 M NH4CL,  
RXR and RAR proteins each at 0.45 mM, DNA duplex at 0.45 mM, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 281K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'Tris buffer' ? ? ? 
1 2 1 NH4Cl         ? ? ? 
1 3 1 MgCl2         ? ? ? 
1 4 1 'PEG 3350'    ? ? ? 
1 5 2 'PEG 3350'    ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-05-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             0.9800 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DSZ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   29834 
_reflns.number_all                   29834 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            0.0710000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.9 
_reflns.B_iso_Wilson_estimate        11 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   98 
_reflns_shell.Rmerge_I_obs           0.1700000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1DSZ 
_refine.ls_number_reflns_obs                     28332 
_refine.ls_number_reflns_all                     29834 
_refine.pdbx_ls_sigma_I                          1.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2010000 
_refine.ls_R_factor_all                          0.2010000 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       0.2670000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  1416 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       X-PLOR 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1244 
_refine_hist.pdbx_number_atoms_nucleic_acid   609 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             339 
_refine_hist.number_atoms_total               2196 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1DSZ 
_struct.title                     
'STRUCTURE OF THE RXR/RAR DNA-BINDING DOMAIN HETERODIMER IN COMPLEX WITH THE RETINOIC ACID RESPONSE ELEMENT DR1' 
_struct.pdbx_descriptor           'RETINOIC ACID RECEPTOR RXR ALPHA AND RAR ALPHA/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DSZ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'RXR, RAR, nuclear receptor, protein-DNA, retinoic acid, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS C 24 ? LYS C 37 ? CYS A 1152 LYS A 1165 1 ? 14 
HELX_P HELX_P2 2 THR C 55 ? ARG C 58 ? THR A 1183 ARG A 1186 5 ? 4  
HELX_P HELX_P3 3 CYS C 59 ? VAL C 70 ? CYS A 1187 VAL A 1198 1 ? 12 
HELX_P HELX_P4 4 SER C 73 ? VAL C 77 ? SER A 1201 VAL A 1205 5 ? 5  
HELX_P HELX_P5 5 CYS D 25 ? ASP D 39 ? CYS B 1252 ASP B 1266 1 ? 15 
HELX_P HELX_P6 6 CYS D 60 ? MET D 71 ? CYS B 1287 MET B 1298 1 ? 12 
HELX_P HELX_P7 7 LYS D 74 ? VAL D 78 ? LYS B 1301 VAL B 1305 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 24 SG ? ? A ZN 1121 A CYS 1152 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc2  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 7  SG ? ? A ZN 1121 A CYS 1135 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc3  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 10 SG ? ? A ZN 1121 A CYS 1138 1_555 ? ? ? ? ? ? ?            2.285 ? 
metalc4  metalc ? ? E ZN .  ZN ? ? ? 1_555 C CYS 27 SG ? ? A ZN 1121 A CYS 1155 1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc5  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 59 SG ? ? A ZN 1122 A CYS 1187 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc6  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 62 SG ? ? A ZN 1122 A CYS 1190 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc7  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 43 SG ? ? A ZN 1122 A CYS 1171 1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc8  metalc ? ? F ZN .  ZN ? ? ? 1_555 C CYS 49 SG ? ? A ZN 1122 A CYS 1177 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc9  metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 8  SG ? ? B ZN 1221 B CYS 1235 1_555 ? ? ? ? ? ? ?            2.324 ? 
metalc10 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 25 SG ? ? B ZN 1221 B CYS 1252 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc11 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 28 SG ? ? B ZN 1221 B CYS 1255 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc12 metalc ? ? G ZN .  ZN ? ? ? 1_555 D CYS 11 SG ? ? B ZN 1221 B CYS 1238 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc13 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 44 SG ? ? B ZN 1222 B CYS 1271 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc14 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 60 SG ? ? B ZN 1222 B CYS 1287 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc15 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 63 SG ? ? B ZN 1222 B CYS 1290 1_555 ? ? ? ? ? ? ?            2.308 ? 
metalc16 metalc ? ? H ZN .  ZN ? ? ? 1_555 D CYS 50 SG ? ? B ZN 1222 B CYS 1277 1_555 ? ? ? ? ? ? ?            2.374 ? 
hydrog1  hydrog ? ? A DC 1  N3 ? ? ? 1_555 B DG  15 N1 ? ? C DC 1495 D DG  1545 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DC 1  N4 ? ? ? 1_555 B DG  15 O6 ? ? C DC 1495 D DG  1545 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DC 1  O2 ? ? ? 1_555 B DG  15 N2 ? ? C DC 1495 D DG  1545 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA 2  N1 ? ? ? 1_555 B DT  14 N3 ? ? C DA 1496 D DT  1544 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA 2  N6 ? ? ? 1_555 B DT  14 O4 ? ? C DA 1496 D DT  1544 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  13 N3 ? ? C DG 1497 D DC  1543 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC  13 O2 ? ? C DG 1497 D DC  1543 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC  13 N4 ? ? C DG 1497 D DC  1543 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC  12 N3 ? ? C DG 1498 D DC  1542 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC  12 O2 ? ? C DG 1498 D DC  1542 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC  12 N4 ? ? C DG 1498 D DC  1542 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA  11 N1 ? ? C DT 1499 D DA  1541 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA  11 N6 ? ? C DT 1499 D DA  1541 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG  10 N1 ? ? C DC 1500 D DG  1540 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG  10 O6 ? ? C DC 1500 D DG  1540 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG  10 N2 ? ? C DC 1500 D DG  1540 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  9  N3 ? ? C DA 1501 D DT  1539 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  9  O4 ? ? C DA 1501 D DT  1539 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT  8  N3 ? ? C DA 1502 D DT  1538 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT  8  O4 ? ? C DA 1502 D DT  1538 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT  7  N3 ? ? C DA 1503 D DT  1537 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT  7  O4 ? ? C DA 1503 D DT  1537 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC  6  N3 ? ? C DG 1504 D DC  1536 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC  6  O2 ? ? C DG 1504 D DC  1536 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC  6  N4 ? ? C DG 1504 D DC  1536 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC  5  N3 ? ? C DG 1505 D DC  1535 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC  5  O2 ? ? C DG 1505 D DC  1535 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC  5  N4 ? ? C DG 1505 D DC  1535 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA  4  N1 ? ? C DT 1506 D DA  1534 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA  4  N6 ? ? C DT 1506 D DA  1534 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG  3  N1 ? ? C DC 1507 D DG  1533 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG  3  O6 ? ? C DC 1507 D DG  1533 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG  3  N2 ? ? C DC 1507 D DG  1533 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT  2  N3 ? ? C DA 1508 D DT  1532 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT  2  O4 ? ? C DA 1508 D DT  1532 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC  1  N3 ? ? C DG 1509 D DC  1531 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC  1  O2 ? ? C DG 1509 D DC  1531 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC  1  N4 ? ? C DG 1509 D DC  1531 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 17 ? HIS C 18 ? TYR A 1145 HIS A 1146 
A 2 VAL C 21 ? SER C 22 ? VAL A 1149 SER A 1150 
B 1 HIS D 6  ? ILE D 7  ? HIS B 1233 ILE B 1234 
B 2 ARG D 14 ? SER D 15 ? ARG B 1241 SER B 1242 
C 1 LYS D 18 ? HIS D 19 ? LYS B 1245 HIS B 1246 
C 2 VAL D 22 ? TYR D 23 ? VAL B 1249 TYR B 1250 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS C 18 ? N HIS A 1146 O VAL C 21 ? O VAL A 1149 
B 1 2 O HIS D 6  ? O HIS B 1233 N SER D 15 ? N SER B 1242 
C 1 2 N HIS D 19 ? N HIS B 1246 O VAL D 22 ? O VAL B 1249 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1121' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1122' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1221' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1222' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS C 7  ? CYS A 1135 . ? 1_555 ? 
2  AC1 4 CYS C 10 ? CYS A 1138 . ? 1_555 ? 
3  AC1 4 CYS C 24 ? CYS A 1152 . ? 1_555 ? 
4  AC1 4 CYS C 27 ? CYS A 1155 . ? 1_555 ? 
5  AC2 4 CYS C 43 ? CYS A 1171 . ? 1_555 ? 
6  AC2 4 CYS C 49 ? CYS A 1177 . ? 1_555 ? 
7  AC2 4 CYS C 59 ? CYS A 1187 . ? 1_555 ? 
8  AC2 4 CYS C 62 ? CYS A 1190 . ? 1_555 ? 
9  AC3 4 CYS D 8  ? CYS B 1235 . ? 1_555 ? 
10 AC3 4 CYS D 11 ? CYS B 1238 . ? 1_555 ? 
11 AC3 4 CYS D 25 ? CYS B 1252 . ? 1_555 ? 
12 AC3 4 CYS D 28 ? CYS B 1255 . ? 1_555 ? 
13 AC4 4 CYS D 44 ? CYS B 1271 . ? 1_555 ? 
14 AC4 4 CYS D 50 ? CYS B 1277 . ? 1_555 ? 
15 AC4 4 CYS D 60 ? CYS B 1287 . ? 1_555 ? 
16 AC4 4 CYS D 63 ? CYS B 1290 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DSZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DSZ 
_atom_sites.fract_transf_matrix[1][1]   0.012398 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.029499 
_atom_sites.fract_transf_matrix[2][3]   -0.000001 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009817 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DC  A 1 1  ? 20.475 7.391   -10.299 1.00 41.02 ? 1495 DC  C "O5'" 1 
ATOM   2    C  "C5'" . DC  A 1 1  ? 19.230 7.588   -9.650  1.00 22.43 ? 1495 DC  C "C5'" 1 
ATOM   3    C  "C4'" . DC  A 1 1  ? 18.592 6.339   -9.100  1.00 23.11 ? 1495 DC  C "C4'" 1 
ATOM   4    O  "O4'" . DC  A 1 1  ? 19.513 5.219   -9.097  1.00 25.95 ? 1495 DC  C "O4'" 1 
ATOM   5    C  "C3'" . DC  A 1 1  ? 18.114 6.475   -7.652  1.00 24.84 ? 1495 DC  C "C3'" 1 
ATOM   6    O  "O3'" . DC  A 1 1  ? 16.835 5.900   -7.564  1.00 29.24 ? 1495 DC  C "O3'" 1 
ATOM   7    C  "C2'" . DC  A 1 1  ? 19.154 5.676   -6.867  1.00 31.64 ? 1495 DC  C "C2'" 1 
ATOM   8    C  "C1'" . DC  A 1 1  ? 19.465 4.543   -7.853  1.00 27.42 ? 1495 DC  C "C1'" 1 
ATOM   9    N  N1    . DC  A 1 1  ? 20.749 3.871   -7.660  1.00 24.91 ? 1495 DC  C N1    1 
ATOM   10   C  C2    . DC  A 1 1  ? 20.812 2.471   -7.675  1.00 15.18 ? 1495 DC  C C2    1 
ATOM   11   O  O2    . DC  A 1 1  ? 19.761 1.825   -7.817  1.00 24.90 ? 1495 DC  C O2    1 
ATOM   12   N  N3    . DC  A 1 1  ? 22.008 1.860   -7.525  1.00 16.96 ? 1495 DC  C N3    1 
ATOM   13   C  C4    . DC  A 1 1  ? 23.104 2.577   -7.290  1.00 14.06 ? 1495 DC  C C4    1 
ATOM   14   N  N4    . DC  A 1 1  ? 24.267 1.942   -7.161  1.00 24.31 ? 1495 DC  C N4    1 
ATOM   15   C  C5    . DC  A 1 1  ? 23.066 4.002   -7.251  1.00 24.25 ? 1495 DC  C C5    1 
ATOM   16   C  C6    . DC  A 1 1  ? 21.893 4.595   -7.450  1.00 20.05 ? 1495 DC  C C6    1 
ATOM   17   P  P     . DA  A 1 2  ? 15.675 6.378   -6.580  1.00 26.14 ? 1496 DA  C P     1 
ATOM   18   O  OP1   . DA  A 1 2  ? 14.901 7.421   -7.313  1.00 39.57 ? 1496 DA  C OP1   1 
ATOM   19   O  OP2   . DA  A 1 2  ? 16.316 6.941   -5.357  1.00 21.57 ? 1496 DA  C OP2   1 
ATOM   20   O  "O5'" . DA  A 1 2  ? 14.808 5.062   -6.372  1.00 25.90 ? 1496 DA  C "O5'" 1 
ATOM   21   C  "C5'" . DA  A 1 2  ? 14.998 4.292   -5.207  1.00 30.44 ? 1496 DA  C "C5'" 1 
ATOM   22   C  "C4'" . DA  A 1 2  ? 15.092 2.829   -5.530  1.00 23.20 ? 1496 DA  C "C4'" 1 
ATOM   23   O  "O4'" . DA  A 1 2  ? 16.366 2.539   -6.147  1.00 23.84 ? 1496 DA  C "O4'" 1 
ATOM   24   C  "C3'" . DA  A 1 2  ? 15.051 1.986   -4.257  1.00 20.41 ? 1496 DA  C "C3'" 1 
ATOM   25   O  "O3'" . DA  A 1 2  ? 13.712 1.674   -3.932  1.00 17.97 ? 1496 DA  C "O3'" 1 
ATOM   26   C  "C2'" . DA  A 1 2  ? 15.881 0.766   -4.635  1.00 25.62 ? 1496 DA  C "C2'" 1 
ATOM   27   C  "C1'" . DA  A 1 2  ? 16.876 1.306   -5.637  1.00 23.30 ? 1496 DA  C "C1'" 1 
ATOM   28   N  N9    . DA  A 1 2  ? 18.228 1.641   -5.188  1.00 22.76 ? 1496 DA  C N9    1 
ATOM   29   C  C8    . DA  A 1 2  ? 18.722 2.883   -4.910  1.00 21.62 ? 1496 DA  C C8    1 
ATOM   30   N  N7    . DA  A 1 2  ? 19.981 2.920   -4.563  1.00 17.85 ? 1496 DA  C N7    1 
ATOM   31   C  C5    . DA  A 1 2  ? 20.326 1.572   -4.505  1.00 21.32 ? 1496 DA  C C5    1 
ATOM   32   C  C6    . DA  A 1 2  ? 21.545 0.913   -4.297  1.00 22.24 ? 1496 DA  C C6    1 
ATOM   33   N  N6    . DA  A 1 2  ? 22.685 1.512   -3.948  1.00 31.52 ? 1496 DA  C N6    1 
ATOM   34   N  N1    . DA  A 1 2  ? 21.544 -0.436  -4.386  1.00 22.79 ? 1496 DA  C N1    1 
ATOM   35   C  C2    . DA  A 1 2  ? 20.433 -1.072  -4.757  1.00 20.88 ? 1496 DA  C C2    1 
ATOM   36   N  N3    . DA  A 1 2  ? 19.248 -0.557  -5.034  1.00 30.05 ? 1496 DA  C N3    1 
ATOM   37   C  C4    . DA  A 1 2  ? 19.260 0.782   -4.911  1.00 25.61 ? 1496 DA  C C4    1 
ATOM   38   P  P     . DG  A 1 3  ? 13.286 1.393   -2.406  1.00 19.85 ? 1497 DG  C P     1 
ATOM   39   O  OP1   . DG  A 1 3  ? 11.842 1.270   -2.279  1.00 22.65 ? 1497 DG  C OP1   1 
ATOM   40   O  OP2   . DG  A 1 3  ? 13.904 2.503   -1.600  1.00 21.99 ? 1497 DG  C OP2   1 
ATOM   41   O  "O5'" . DG  A 1 3  ? 14.047 0.011   -2.064  1.00 27.33 ? 1497 DG  C "O5'" 1 
ATOM   42   C  "C5'" . DG  A 1 3  ? 13.745 -1.135  -2.872  1.00 25.49 ? 1497 DG  C "C5'" 1 
ATOM   43   C  "C4'" . DG  A 1 3  ? 14.528 -2.290  -2.289  1.00 20.15 ? 1497 DG  C "C4'" 1 
ATOM   44   O  "O4'" . DG  A 1 3  ? 15.935 -2.065  -2.501  1.00 19.23 ? 1497 DG  C "O4'" 1 
ATOM   45   C  "C3'" . DG  A 1 3  ? 14.264 -2.397  -0.784  1.00 25.74 ? 1497 DG  C "C3'" 1 
ATOM   46   O  "O3'" . DG  A 1 3  ? 14.187 -3.750  -0.389  1.00 25.57 ? 1497 DG  C "O3'" 1 
ATOM   47   C  "C2'" . DG  A 1 3  ? 15.474 -1.702  -0.203  1.00 18.44 ? 1497 DG  C "C2'" 1 
ATOM   48   C  "C1'" . DG  A 1 3  ? 16.569 -1.984  -1.248  1.00 22.62 ? 1497 DG  C "C1'" 1 
ATOM   49   N  N9    . DG  A 1 3  ? 17.568 -0.925  -1.241  1.00 18.41 ? 1497 DG  C N9    1 
ATOM   50   C  C8    . DG  A 1 3  ? 17.382 0.430   -1.264  1.00 16.52 ? 1497 DG  C C8    1 
ATOM   51   N  N7    . DG  A 1 3  ? 18.498 1.107   -1.270  1.00 16.52 ? 1497 DG  C N7    1 
ATOM   52   C  C5    . DG  A 1 3  ? 19.478 0.131   -1.264  1.00 22.06 ? 1497 DG  C C5    1 
ATOM   53   C  C6    . DG  A 1 3  ? 20.883 0.236   -1.138  1.00 19.97 ? 1497 DG  C C6    1 
ATOM   54   O  O6    . DG  A 1 3  ? 21.647 1.211   -1.176  1.00 22.67 ? 1497 DG  C O6    1 
ATOM   55   N  N1    . DG  A 1 3  ? 21.460 -1.028  -1.084  1.00 18.00 ? 1497 DG  C N1    1 
ATOM   56   C  C2    . DG  A 1 3  ? 20.804 -2.228  -1.133  1.00 17.57 ? 1497 DG  C C2    1 
ATOM   57   N  N2    . DG  A 1 3  ? 21.602 -3.309  -1.154  1.00 21.50 ? 1497 DG  C N2    1 
ATOM   58   N  N3    . DG  A 1 3  ? 19.494 -2.349  -1.251  1.00 21.75 ? 1497 DG  C N3    1 
ATOM   59   C  C4    . DG  A 1 3  ? 18.912 -1.127  -1.191  1.00 20.10 ? 1497 DG  C C4    1 
ATOM   60   P  P     . DG  A 1 4  ? 14.058 -4.250  1.117   1.00 25.25 ? 1498 DG  C P     1 
ATOM   61   O  OP1   . DG  A 1 4  ? 13.037 -5.318  1.103   1.00 26.35 ? 1498 DG  C OP1   1 
ATOM   62   O  OP2   . DG  A 1 4  ? 13.733 -3.116  2.010   1.00 29.04 ? 1498 DG  C OP2   1 
ATOM   63   O  "O5'" . DG  A 1 4  ? 15.526 -4.812  1.456   1.00 23.71 ? 1498 DG  C "O5'" 1 
ATOM   64   C  "C5'" . DG  A 1 4  ? 16.007 -5.986  0.808   1.00 25.25 ? 1498 DG  C "C5'" 1 
ATOM   65   C  "C4'" . DG  A 1 4  ? 17.336 -6.421  1.383   1.00 17.40 ? 1498 DG  C "C4'" 1 
ATOM   66   O  "O4'" . DG  A 1 4  ? 18.352 -5.403  1.165   1.00 19.93 ? 1498 DG  C "O4'" 1 
ATOM   67   C  "C3'" . DG  A 1 4  ? 17.300 -6.734  2.879   1.00 21.71 ? 1498 DG  C "C3'" 1 
ATOM   68   O  "O3'" . DG  A 1 4  ? 18.019 -7.937  3.148   1.00 23.67 ? 1498 DG  C "O3'" 1 
ATOM   69   C  "C2'" . DG  A 1 4  ? 17.993 -5.534  3.505   1.00 21.96 ? 1498 DG  C "C2'" 1 
ATOM   70   C  "C1'" . DG  A 1 4  ? 18.956 -5.077  2.411   1.00 20.83 ? 1498 DG  C "C1'" 1 
ATOM   71   N  N9    . DG  A 1 4  ? 19.183 -3.639  2.335   1.00 15.48 ? 1498 DG  C N9    1 
ATOM   72   C  C8    . DG  A 1 4  ? 18.248 -2.640  2.236   1.00 20.62 ? 1498 DG  C C8    1 
ATOM   73   N  N7    . DG  A 1 4  ? 18.789 -1.450  2.210   1.00 17.85 ? 1498 DG  C N7    1 
ATOM   74   C  C5    . DG  A 1 4  ? 20.147 -1.681  2.212   1.00 11.00 ? 1498 DG  C C5    1 
ATOM   75   C  C6    . DG  A 1 4  ? 21.244 -0.781  2.279   1.00 18.13 ? 1498 DG  C C6    1 
ATOM   76   O  O6    . DG  A 1 4  ? 21.262 0.451   2.108   1.00 21.04 ? 1498 DG  C O6    1 
ATOM   77   N  N1    . DG  A 1 4  ? 22.454 -1.461  2.345   1.00 20.91 ? 1498 DG  C N1    1 
ATOM   78   C  C2    . DG  A 1 4  ? 22.597 -2.822  2.486   1.00 16.84 ? 1498 DG  C C2    1 
ATOM   79   N  N2    . DG  A 1 4  ? 23.854 -3.270  2.528   1.00 18.62 ? 1498 DG  C N2    1 
ATOM   80   N  N3    . DG  A 1 4  ? 21.583 -3.671  2.433   1.00 16.21 ? 1498 DG  C N3    1 
ATOM   81   C  C4    . DG  A 1 4  ? 20.409 -3.037  2.311   1.00 13.10 ? 1498 DG  C C4    1 
ATOM   82   P  P     . DT  A 1 5  ? 18.166 -8.464  4.678   1.00 21.78 ? 1499 DT  C P     1 
ATOM   83   O  OP1   . DT  A 1 5  ? 18.143 -9.964  4.578   1.00 22.29 ? 1499 DT  C OP1   1 
ATOM   84   O  OP2   . DT  A 1 5  ? 17.065 -7.894  5.443   1.00 19.62 ? 1499 DT  C OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5  ? 19.610 -7.966  5.092   1.00 18.16 ? 1499 DT  C "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5  ? 20.714 -8.320  4.258   1.00 16.37 ? 1499 DT  C "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5  ? 21.978 -7.813  4.914   1.00 19.25 ? 1499 DT  C "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5  ? 22.083 -6.388  4.779   1.00 18.21 ? 1499 DT  C "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5  ? 22.046 -8.111  6.417   1.00 19.78 ? 1499 DT  C "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5  ? 23.300 -8.739  6.620   1.00 18.46 ? 1499 DT  C "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5  ? 21.959 -6.749  7.094   1.00 20.67 ? 1499 DT  C "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5  ? 22.482 -5.806  6.029   1.00 19.21 ? 1499 DT  C "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5  ? 21.936 -4.448  5.945   1.00 12.39 ? 1499 DT  C N1    1 
ATOM   94   C  C2    . DT  A 1 5  ? 22.862 -3.421  5.886   1.00 12.72 ? 1499 DT  C C2    1 
ATOM   95   O  O2    . DT  A 1 5  ? 24.054 -3.610  5.918   1.00 18.22 ? 1499 DT  C O2    1 
ATOM   96   N  N3    . DT  A 1 5  ? 22.307 -2.165  5.835   1.00 17.19 ? 1499 DT  C N3    1 
ATOM   97   C  C4    . DT  A 1 5  ? 20.971 -1.841  5.735   1.00 18.59 ? 1499 DT  C C4    1 
ATOM   98   O  O4    . DT  A 1 5  ? 20.647 -0.663  5.598   1.00 14.41 ? 1499 DT  C O4    1 
ATOM   99   C  C5    . DT  A 1 5  ? 20.061 -2.955  5.862   1.00 15.31 ? 1499 DT  C C5    1 
ATOM   100  C  C7    . DT  A 1 5  ? 18.586 -2.713  5.885   1.00 15.98 ? 1499 DT  C C7    1 
ATOM   101  C  C6    . DT  A 1 5  ? 20.601 -4.184  5.917   1.00 16.45 ? 1499 DT  C C6    1 
ATOM   102  P  P     . DC  A 1 6  ? 23.563 -9.548  7.985   1.00 19.45 ? 1500 DC  C P     1 
ATOM   103  O  OP1   . DC  A 1 6  ? 24.519 -10.610 7.608   1.00 24.67 ? 1500 DC  C OP1   1 
ATOM   104  O  OP2   . DC  A 1 6  ? 22.275 -9.936  8.571   1.00 15.06 ? 1500 DC  C OP2   1 
ATOM   105  O  "O5'" . DC  A 1 6  ? 24.270 -8.448  8.942   1.00 17.13 ? 1500 DC  C "O5'" 1 
ATOM   106  C  "C5'" . DC  A 1 6  ? 25.596 -8.034  8.621   1.00 20.15 ? 1500 DC  C "C5'" 1 
ATOM   107  C  "C4'" . DC  A 1 6  ? 25.868 -6.887  9.577   1.00 18.03 ? 1500 DC  C "C4'" 1 
ATOM   108  O  "O4'" . DC  A 1 6  ? 24.948 -5.801  9.312   1.00 16.92 ? 1500 DC  C "O4'" 1 
ATOM   109  C  "C3'" . DC  A 1 6  ? 25.630 -7.249  11.043  1.00 21.91 ? 1500 DC  C "C3'" 1 
ATOM   110  O  "O3'" . DC  A 1 6  ? 26.648 -6.608  11.794  1.00 23.71 ? 1500 DC  C "O3'" 1 
ATOM   111  C  "C2'" . DC  A 1 6  ? 24.254 -6.659  11.342  1.00 16.34 ? 1500 DC  C "C2'" 1 
ATOM   112  C  "C1'" . DC  A 1 6  ? 24.363 -5.372  10.534  1.00 16.14 ? 1500 DC  C "C1'" 1 
ATOM   113  N  N1    . DC  A 1 6  ? 23.135 -4.663  10.213  1.00 12.35 ? 1500 DC  C N1    1 
ATOM   114  C  C2    . DC  A 1 6  ? 23.249 -3.307  9.818   1.00 10.97 ? 1500 DC  C C2    1 
ATOM   115  O  O2    . DC  A 1 6  ? 24.375 -2.811  9.779   1.00 15.20 ? 1500 DC  C O2    1 
ATOM   116  N  N3    . DC  A 1 6  ? 22.135 -2.620  9.511   1.00 13.05 ? 1500 DC  C N3    1 
ATOM   117  C  C4    . DC  A 1 6  ? 20.944 -3.214  9.524   1.00 12.09 ? 1500 DC  C C4    1 
ATOM   118  N  N4    . DC  A 1 6  ? 19.857 -2.463  9.314   1.00 14.09 ? 1500 DC  C N4    1 
ATOM   119  C  C5    . DC  A 1 6  ? 20.793 -4.573  9.944   1.00 16.95 ? 1500 DC  C C5    1 
ATOM   120  C  C6    . DC  A 1 6  ? 21.902 -5.233  10.266  1.00 12.60 ? 1500 DC  C C6    1 
ATOM   121  P  P     . DA  A 1 7  ? 27.541 -7.461  12.830  1.00 23.86 ? 1501 DA  C P     1 
ATOM   122  O  OP1   . DA  A 1 7  ? 28.284 -8.469  12.068  1.00 29.08 ? 1501 DA  C OP1   1 
ATOM   123  O  OP2   . DA  A 1 7  ? 26.624 -7.934  13.872  1.00 19.96 ? 1501 DA  C OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7  ? 28.546 -6.319  13.366  1.00 18.47 ? 1501 DA  C "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7  ? 29.401 -5.675  12.413  1.00 26.76 ? 1501 DA  C "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7  ? 29.541 -4.225  12.817  1.00 18.57 ? 1501 DA  C "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7  ? 28.327 -3.498  12.583  1.00 15.76 ? 1501 DA  C "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7  ? 29.839 -4.038  14.326  1.00 13.19 ? 1501 DA  C "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7  ? 30.793 -2.995  14.393  1.00 14.84 ? 1501 DA  C "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7  ? 28.480 -3.722  14.888  1.00 10.63 ? 1501 DA  C "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7  ? 27.790 -2.947  13.776  1.00 14.34 ? 1501 DA  C "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7  ? 26.344 -3.098  13.728  1.00 18.24 ? 1501 DA  C N9    1 
ATOM   133  C  C8    . DA  A 1 7  ? 25.573 -4.164  14.114  1.00 13.43 ? 1501 DA  C C8    1 
ATOM   134  N  N7    . DA  A 1 7  ? 24.290 -4.035  13.921  1.00 14.30 ? 1501 DA  C N7    1 
ATOM   135  C  C5    . DA  A 1 7  ? 24.211 -2.756  13.370  1.00 12.06 ? 1501 DA  C C5    1 
ATOM   136  C  C6    . DA  A 1 7  ? 23.094 -1.981  12.994  1.00 16.19 ? 1501 DA  C C6    1 
ATOM   137  N  N6    . DA  A 1 7  ? 21.858 -2.427  13.145  1.00 15.01 ? 1501 DA  C N6    1 
ATOM   138  N  N1    . DA  A 1 7  ? 23.336 -0.751  12.495  1.00 14.81 ? 1501 DA  C N1    1 
ATOM   139  C  C2    . DA  A 1 7  ? 24.601 -0.314  12.442  1.00 12.23 ? 1501 DA  C C2    1 
ATOM   140  N  N3    . DA  A 1 7  ? 25.718 -0.923  12.830  1.00 12.78 ? 1501 DA  C N3    1 
ATOM   141  C  C4    . DA  A 1 7  ? 25.444 -2.170  13.248  1.00 14.73 ? 1501 DA  C C4    1 
ATOM   142  P  P     . DA  A 1 8  ? 31.424 -2.490  15.806  1.00 15.20 ? 1502 DA  C P     1 
ATOM   143  O  OP1   . DA  A 1 8  ? 32.763 -2.022  15.449  1.00 13.81 ? 1502 DA  C OP1   1 
ATOM   144  O  OP2   . DA  A 1 8  ? 31.317 -3.647  16.723  1.00 14.50 ? 1502 DA  C OP2   1 
ATOM   145  O  "O5'" . DA  A 1 8  ? 30.427 -1.305  16.227  1.00 15.09 ? 1502 DA  C "O5'" 1 
ATOM   146  C  "C5'" . DA  A 1 8  ? 30.463 -0.084  15.471  1.00 13.17 ? 1502 DA  C "C5'" 1 
ATOM   147  C  "C4'" . DA  A 1 8  ? 29.322 0.804   15.897  1.00 10.04 ? 1502 DA  C "C4'" 1 
ATOM   148  O  "O4'" . DA  A 1 8  ? 28.047 0.160   15.619  1.00 11.66 ? 1502 DA  C "O4'" 1 
ATOM   149  C  "C3'" . DA  A 1 8  ? 29.296 1.095   17.404  1.00 14.47 ? 1502 DA  C "C3'" 1 
ATOM   150  O  "O3'" . DA  A 1 8  ? 28.978 2.456   17.632  1.00 13.80 ? 1502 DA  C "O3'" 1 
ATOM   151  C  "C2'" . DA  A 1 8  ? 28.133 0.259   17.916  1.00 12.35 ? 1502 DA  C "C2'" 1 
ATOM   152  C  "C1'" . DA  A 1 8  ? 27.189 0.403   16.688  1.00 10.06 ? 1502 DA  C "C1'" 1 
ATOM   153  N  N9    . DA  A 1 8  ? 26.085 -0.523  16.760  1.00 13.19 ? 1502 DA  C N9    1 
ATOM   154  C  C8    . DA  A 1 8  ? 26.076 -1.808  17.253  1.00 13.48 ? 1502 DA  C C8    1 
ATOM   155  N  N7    . DA  A 1 8  ? 24.901 -2.386  17.189  1.00 13.84 ? 1502 DA  C N7    1 
ATOM   156  C  C5    . DA  A 1 8  ? 24.083 -1.422  16.608  1.00 11.94 ? 1502 DA  C C5    1 
ATOM   157  C  C6    . DA  A 1 8  ? 22.740 -1.428  16.237  1.00 14.46 ? 1502 DA  C C6    1 
ATOM   158  N  N6    . DA  A 1 8  ? 21.910 -2.455  16.483  1.00 13.56 ? 1502 DA  C N6    1 
ATOM   159  N  N1    . DA  A 1 8  ? 22.252 -0.283  15.709  1.00 11.36 ? 1502 DA  C N1    1 
ATOM   160  C  C2    . DA  A 1 8  ? 23.063 0.740   15.468  1.00 10.79 ? 1502 DA  C C2    1 
ATOM   161  N  N3    . DA  A 1 8  ? 24.358 0.849   15.731  1.00 11.67 ? 1502 DA  C N3    1 
ATOM   162  C  C4    . DA  A 1 8  ? 24.803 -0.270  16.338  1.00 11.00 ? 1502 DA  C C4    1 
ATOM   163  P  P     . DA  A 1 9  ? 29.820 3.399   18.626  1.00 12.00 ? 1503 DA  C P     1 
ATOM   164  O  OP1   . DA  A 1 9  ? 31.186 3.559   18.139  1.00 11.33 ? 1503 DA  C OP1   1 
ATOM   165  O  OP2   . DA  A 1 9  ? 29.685 2.778   19.984  1.00 15.11 ? 1503 DA  C OP2   1 
ATOM   166  O  "O5'" . DA  A 1 9  ? 28.977 4.760   18.561  1.00 9.41  ? 1503 DA  C "O5'" 1 
ATOM   167  C  "C5'" . DA  A 1 9  ? 27.924 4.951   19.495  1.00 10.91 ? 1503 DA  C "C5'" 1 
ATOM   168  C  "C4'" . DA  A 1 9  ? 26.703 5.493   18.810  1.00 14.71 ? 1503 DA  C "C4'" 1 
ATOM   169  O  "O4'" . DA  A 1 9  ? 26.244 4.582   17.761  1.00 12.46 ? 1503 DA  C "O4'" 1 
ATOM   170  C  "C3'" . DA  A 1 9  ? 25.502 5.671   19.737  1.00 13.45 ? 1503 DA  C "C3'" 1 
ATOM   171  O  "O3'" . DA  A 1 9  ? 25.603 6.905   20.443  1.00 14.21 ? 1503 DA  C "O3'" 1 
ATOM   172  C  "C2'" . DA  A 1 9  ? 24.342 5.613   18.742  1.00 8.88  ? 1503 DA  C "C2'" 1 
ATOM   173  C  "C1'" . DA  A 1 9  ? 24.838 4.480   17.833  1.00 9.66  ? 1503 DA  C "C1'" 1 
ATOM   174  N  N9    . DA  A 1 9  ? 24.509 3.154   18.363  1.00 11.93 ? 1503 DA  C N9    1 
ATOM   175  C  C8    . DA  A 1 9  ? 25.362 2.246   18.945  1.00 15.95 ? 1503 DA  C C8    1 
ATOM   176  N  N7    . DA  A 1 9  ? 24.742 1.161   19.363  1.00 9.78  ? 1503 DA  C N7    1 
ATOM   177  C  C5    . DA  A 1 9  ? 23.436 1.340   18.953  1.00 11.98 ? 1503 DA  C C5    1 
ATOM   178  C  C6    . DA  A 1 9  ? 22.277 0.546   19.049  1.00 12.01 ? 1503 DA  C C6    1 
ATOM   179  N  N6    . DA  A 1 9  ? 22.339 -0.665  19.608  1.00 16.29 ? 1503 DA  C N6    1 
ATOM   180  N  N1    . DA  A 1 9  ? 21.095 1.036   18.637  1.00 13.10 ? 1503 DA  C N1    1 
ATOM   181  C  C2    . DA  A 1 9  ? 21.059 2.256   18.087  1.00 16.10 ? 1503 DA  C C2    1 
ATOM   182  N  N3    . DA  A 1 9  ? 22.108 3.047   17.870  1.00 9.88  ? 1503 DA  C N3    1 
ATOM   183  C  C4    . DA  A 1 9  ? 23.250 2.591   18.394  1.00 9.67  ? 1503 DA  C C4    1 
ATOM   184  P  P     . DG  A 1 10 ? 25.040 7.016   21.946  1.00 12.78 ? 1504 DG  C P     1 
ATOM   185  O  OP1   . DG  A 1 10 ? 25.513 8.307   22.504  1.00 11.39 ? 1504 DG  C OP1   1 
ATOM   186  O  OP2   . DG  A 1 10 ? 25.443 5.771   22.666  1.00 12.40 ? 1504 DG  C OP2   1 
ATOM   187  O  "O5'" . DG  A 1 10 ? 23.474 7.018   21.760  1.00 8.98  ? 1504 DG  C "O5'" 1 
ATOM   188  C  "C5'" . DG  A 1 10 ? 22.827 8.031   20.998  1.00 9.05  ? 1504 DG  C "C5'" 1 
ATOM   189  C  "C4'" . DG  A 1 10 ? 21.443 7.571   20.657  1.00 11.60 ? 1504 DG  C "C4'" 1 
ATOM   190  O  "O4'" . DG  A 1 10 ? 21.497 6.330   19.892  1.00 11.27 ? 1504 DG  C "O4'" 1 
ATOM   191  C  "C3'" . DG  A 1 10 ? 20.559 7.239   21.845  1.00 11.23 ? 1504 DG  C "C3'" 1 
ATOM   192  O  "O3'" . DG  A 1 10 ? 19.974 8.414   22.392  1.00 12.72 ? 1504 DG  C "O3'" 1 
ATOM   193  C  "C2'" . DG  A 1 10 ? 19.520 6.346   21.157  1.00 17.69 ? 1504 DG  C "C2'" 1 
ATOM   194  C  "C1'" . DG  A 1 10 ? 20.418 5.500   20.265  1.00 10.68 ? 1504 DG  C "C1'" 1 
ATOM   195  N  N9    . DG  A 1 10 ? 20.995 4.326   20.920  1.00 13.01 ? 1504 DG  C N9    1 
ATOM   196  C  C8    . DG  A 1 10 ? 22.288 4.078   21.303  1.00 14.17 ? 1504 DG  C C8    1 
ATOM   197  N  N7    . DG  A 1 10 ? 22.440 2.940   21.915  1.00 14.57 ? 1504 DG  C N7    1 
ATOM   198  C  C5    . DG  A 1 10 ? 21.201 2.341   21.824  1.00 14.22 ? 1504 DG  C C5    1 
ATOM   199  C  C6    . DG  A 1 10 ? 20.728 1.092   22.314  1.00 16.62 ? 1504 DG  C C6    1 
ATOM   200  O  O6    . DG  A 1 10 ? 21.366 0.178   22.844  1.00 17.19 ? 1504 DG  C O6    1 
ATOM   201  N  N1    . DG  A 1 10 ? 19.366 0.965   22.084  1.00 15.51 ? 1504 DG  C N1    1 
ATOM   202  C  C2    . DG  A 1 10 ? 18.537 1.904   21.542  1.00 14.62 ? 1504 DG  C C2    1 
ATOM   203  N  N2    . DG  A 1 10 ? 17.240 1.623   21.483  1.00 15.04 ? 1504 DG  C N2    1 
ATOM   204  N  N3    . DG  A 1 10 ? 18.971 3.033   20.990  1.00 13.70 ? 1504 DG  C N3    1 
ATOM   205  C  C4    . DG  A 1 10 ? 20.289 3.185   21.218  1.00 14.29 ? 1504 DG  C C4    1 
ATOM   206  P  P     . DG  A 1 11 ? 19.719 8.486   23.978  1.00 16.15 ? 1505 DG  C P     1 
ATOM   207  O  OP1   . DG  A 1 11 ? 19.175 9.837   24.261  1.00 19.60 ? 1505 DG  C OP1   1 
ATOM   208  O  OP2   . DG  A 1 11 ? 20.959 8.111   24.669  1.00 13.62 ? 1505 DG  C OP2   1 
ATOM   209  O  "O5'" . DG  A 1 11 ? 18.594 7.369   24.234  1.00 16.16 ? 1505 DG  C "O5'" 1 
ATOM   210  C  "C5'" . DG  A 1 11 ? 17.265 7.617   23.780  1.00 20.39 ? 1505 DG  C "C5'" 1 
ATOM   211  C  "C4'" . DG  A 1 11 ? 16.498 6.357   24.100  1.00 18.24 ? 1505 DG  C "C4'" 1 
ATOM   212  O  "O4'" . DG  A 1 11 ? 17.186 5.203   23.572  1.00 20.85 ? 1505 DG  C "O4'" 1 
ATOM   213  C  "C3'" . DG  A 1 11 ? 16.386 6.093   25.603  1.00 17.38 ? 1505 DG  C "C3'" 1 
ATOM   214  O  "O3'" . DG  A 1 11 ? 15.253 6.798   26.076  1.00 21.12 ? 1505 DG  C "O3'" 1 
ATOM   215  C  "C2'" . DG  A 1 11 ? 16.187 4.589   25.645  1.00 26.90 ? 1505 DG  C "C2'" 1 
ATOM   216  C  "C1'" . DG  A 1 11 ? 16.895 4.093   24.395  1.00 21.14 ? 1505 DG  C "C1'" 1 
ATOM   217  N  N9    . DG  A 1 11 ? 18.158 3.465   24.751  1.00 15.44 ? 1505 DG  C N9    1 
ATOM   218  C  C8    . DG  A 1 11 ? 19.436 3.930   24.709  1.00 11.50 ? 1505 DG  C C8    1 
ATOM   219  N  N7    . DG  A 1 11 ? 20.302 3.074   25.202  1.00 13.43 ? 1505 DG  C N7    1 
ATOM   220  C  C5    . DG  A 1 11 ? 19.549 1.942   25.468  1.00 15.94 ? 1505 DG  C C5    1 
ATOM   221  C  C6    . DG  A 1 11 ? 19.911 0.656   25.967  1.00 15.33 ? 1505 DG  C C6    1 
ATOM   222  O  O6    . DG  A 1 11 ? 21.050 0.237   26.208  1.00 16.83 ? 1505 DG  C O6    1 
ATOM   223  N  N1    . DG  A 1 11 ? 18.779 -0.146  26.051  1.00 13.16 ? 1505 DG  C N1    1 
ATOM   224  C  C2    . DG  A 1 11 ? 17.485 0.221   25.847  1.00 12.27 ? 1505 DG  C C2    1 
ATOM   225  N  N2    . DG  A 1 11 ? 16.520 -0.663  26.137  1.00 13.76 ? 1505 DG  C N2    1 
ATOM   226  N  N3    . DG  A 1 11 ? 17.113 1.411   25.407  1.00 13.30 ? 1505 DG  C N3    1 
ATOM   227  C  C4    . DG  A 1 11 ? 18.212 2.185   25.262  1.00 15.33 ? 1505 DG  C C4    1 
ATOM   228  P  P     . DT  A 1 12 ? 14.824 6.780   27.609  1.00 24.17 ? 1506 DT  C P     1 
ATOM   229  O  OP1   . DT  A 1 12 ? 13.853 7.885   27.769  1.00 30.76 ? 1506 DT  C OP1   1 
ATOM   230  O  OP2   . DT  A 1 12 ? 16.059 6.969   28.416  1.00 21.92 ? 1506 DT  C OP2   1 
ATOM   231  O  "O5'" . DT  A 1 12 ? 14.204 5.343   27.891  1.00 21.07 ? 1506 DT  C "O5'" 1 
ATOM   232  C  "C5'" . DT  A 1 12 ? 13.097 4.791   27.209  1.00 24.58 ? 1506 DT  C "C5'" 1 
ATOM   233  C  "C4'" . DT  A 1 12 ? 12.812 3.397   27.740  1.00 27.06 ? 1506 DT  C "C4'" 1 
ATOM   234  O  "O4'" . DT  A 1 12 ? 14.008 2.586   27.654  1.00 19.69 ? 1506 DT  C "O4'" 1 
ATOM   235  C  "C3'" . DT  A 1 12 ? 12.360 3.387   29.196  1.00 25.28 ? 1506 DT  C "C3'" 1 
ATOM   236  O  "O3'" . DT  A 1 12 ? 11.259 2.515   29.340  1.00 21.55 ? 1506 DT  C "O3'" 1 
ATOM   237  C  "C2'" . DT  A 1 12 ? 13.574 2.841   29.934  1.00 20.93 ? 1506 DT  C "C2'" 1 
ATOM   238  C  "C1'" . DT  A 1 12 ? 14.250 1.952   28.909  1.00 17.78 ? 1506 DT  C "C1'" 1 
ATOM   239  N  N1    . DT  A 1 12 ? 15.716 1.840   29.018  1.00 14.50 ? 1506 DT  C N1    1 
ATOM   240  C  C2    . DT  A 1 12 ? 16.296 0.632   29.324  1.00 14.70 ? 1506 DT  C C2    1 
ATOM   241  O  O2    . DT  A 1 12 ? 15.665 -0.384  29.579  1.00 17.14 ? 1506 DT  C O2    1 
ATOM   242  N  N3    . DT  A 1 12 ? 17.675 0.633   29.370  1.00 17.13 ? 1506 DT  C N3    1 
ATOM   243  C  C4    . DT  A 1 12 ? 18.501 1.733   29.225  1.00 12.51 ? 1506 DT  C C4    1 
ATOM   244  O  O4    . DT  A 1 12 ? 19.702 1.570   29.231  1.00 14.98 ? 1506 DT  C O4    1 
ATOM   245  C  C5    . DT  A 1 12 ? 17.834 2.969   28.874  1.00 11.56 ? 1506 DT  C C5    1 
ATOM   246  C  C7    . DT  A 1 12 ? 18.676 4.201   28.688  1.00 16.22 ? 1506 DT  C C7    1 
ATOM   247  C  C6    . DT  A 1 12 ? 16.503 2.963   28.823  1.00 10.61 ? 1506 DT  C C6    1 
ATOM   248  P  P     . DC  A 1 13 ? 10.193 2.602   30.538  1.00 28.14 ? 1507 DC  C P     1 
ATOM   249  O  OP1   . DC  A 1 13 ? 8.947  2.007   29.977  1.00 26.96 ? 1507 DC  C OP1   1 
ATOM   250  O  OP2   . DC  A 1 13 ? 10.083 3.997   30.984  1.00 22.50 ? 1507 DC  C OP2   1 
ATOM   251  O  "O5'" . DC  A 1 13 ? 10.791 1.643   31.682  1.00 27.84 ? 1507 DC  C "O5'" 1 
ATOM   252  C  "C5'" . DC  A 1 13 ? 10.914 0.251   31.334  1.00 23.29 ? 1507 DC  C "C5'" 1 
ATOM   253  C  "C4'" . DC  A 1 13 ? 11.651 -0.413  32.478  1.00 22.17 ? 1507 DC  C "C4'" 1 
ATOM   254  O  "O4'" . DC  A 1 13 ? 13.064 -0.127  32.350  1.00 20.66 ? 1507 DC  C "O4'" 1 
ATOM   255  C  "C3'" . DC  A 1 13 ? 11.234 0.087   33.852  1.00 23.19 ? 1507 DC  C "C3'" 1 
ATOM   256  O  "O3'" . DC  A 1 13 ? 11.251 -0.979  34.780  1.00 22.09 ? 1507 DC  C "O3'" 1 
ATOM   257  C  "C2'" . DC  A 1 13 ? 12.365 1.049   34.225  1.00 25.31 ? 1507 DC  C "C2'" 1 
ATOM   258  C  "C1'" . DC  A 1 13 ? 13.554 0.308   33.616  1.00 18.02 ? 1507 DC  C "C1'" 1 
ATOM   259  N  N1    . DC  A 1 13 ? 14.770 1.075   33.370  1.00 17.24 ? 1507 DC  C N1    1 
ATOM   260  C  C2    . DC  A 1 13 ? 15.986 0.370   33.281  1.00 19.26 ? 1507 DC  C C2    1 
ATOM   261  O  O2    . DC  A 1 13 ? 15.965 -0.863  33.432  1.00 18.01 ? 1507 DC  C O2    1 
ATOM   262  N  N3    . DC  A 1 13 ? 17.130 1.036   33.010  1.00 14.23 ? 1507 DC  C N3    1 
ATOM   263  C  C4    . DC  A 1 13 ? 17.120 2.368   32.929  1.00 16.38 ? 1507 DC  C C4    1 
ATOM   264  N  N4    . DC  A 1 13 ? 18.254 2.993   32.616  1.00 15.31 ? 1507 DC  C N4    1 
ATOM   265  C  C5    . DC  A 1 13 ? 15.908 3.112   33.027  1.00 18.61 ? 1507 DC  C C5    1 
ATOM   266  C  C6    . DC  A 1 13 ? 14.784 2.437   33.243  1.00 22.71 ? 1507 DC  C C6    1 
ATOM   267  P  P     . DA  A 1 14 ? 9.876  -1.642  35.292  1.00 31.17 ? 1508 DA  C P     1 
ATOM   268  O  OP1   . DA  A 1 14 ? 8.769  -1.015  34.540  1.00 36.36 ? 1508 DA  C OP1   1 
ATOM   269  O  OP2   . DA  A 1 14 ? 9.839  -1.414  36.746  1.00 33.21 ? 1508 DA  C OP2   1 
ATOM   270  O  "O5'" . DA  A 1 14 ? 10.117 -3.157  34.822  1.00 46.42 ? 1508 DA  C "O5'" 1 
ATOM   271  C  "C5'" . DA  A 1 14 ? 10.288 -4.154  35.779  1.00 44.91 ? 1508 DA  C "C5'" 1 
ATOM   272  C  "C4'" . DA  A 1 14 ? 11.600 -4.853  35.890  1.00 33.90 ? 1508 DA  C "C4'" 1 
ATOM   273  O  "O4'" . DA  A 1 14 ? 12.802 -4.071  35.726  1.00 26.91 ? 1508 DA  C "O4'" 1 
ATOM   274  C  "C3'" . DA  A 1 14 ? 11.661 -5.404  37.333  1.00 29.75 ? 1508 DA  C "C3'" 1 
ATOM   275  O  "O3'" . DA  A 1 14 ? 12.166 -6.719  37.235  1.00 40.09 ? 1508 DA  C "O3'" 1 
ATOM   276  C  "C2'" . DA  A 1 14 ? 12.563 -4.403  38.041  1.00 20.21 ? 1508 DA  C "C2'" 1 
ATOM   277  C  "C1'" . DA  A 1 14 ? 13.532 -3.973  36.946  1.00 18.02 ? 1508 DA  C "C1'" 1 
ATOM   278  N  N9    . DA  A 1 14 ? 14.009 -2.589  36.974  1.00 21.97 ? 1508 DA  C N9    1 
ATOM   279  C  C8    . DA  A 1 14 ? 13.302 -1.434  37.194  1.00 20.48 ? 1508 DA  C C8    1 
ATOM   280  N  N7    . DA  A 1 14 ? 14.038 -0.343  37.157  1.00 14.11 ? 1508 DA  C N7    1 
ATOM   281  C  C5    . DA  A 1 14 ? 15.312 -0.808  36.885  1.00 15.08 ? 1508 DA  C C5    1 
ATOM   282  C  C6    . DA  A 1 14 ? 16.540 -0.149  36.710  1.00 14.39 ? 1508 DA  C C6    1 
ATOM   283  N  N6    . DA  A 1 14 ? 16.661 1.181   36.675  1.00 17.62 ? 1508 DA  C N6    1 
ATOM   284  N  N1    . DA  A 1 14 ? 17.628 -0.919  36.534  1.00 12.86 ? 1508 DA  C N1    1 
ATOM   285  C  C2    . DA  A 1 14 ? 17.498 -2.240  36.426  1.00 16.84 ? 1508 DA  C C2    1 
ATOM   286  N  N3    . DA  A 1 14 ? 16.386 -2.948  36.524  1.00 17.07 ? 1508 DA  C N3    1 
ATOM   287  C  C4    . DA  A 1 14 ? 15.319 -2.187  36.785  1.00 17.60 ? 1508 DA  C C4    1 
ATOM   288  P  P     . DG  A 1 15 ? 12.152 -7.640  38.551  1.00 38.81 ? 1509 DG  C P     1 
ATOM   289  O  OP1   . DG  A 1 15 ? 12.129 -9.032  38.030  1.00 47.99 ? 1509 DG  C OP1   1 
ATOM   290  O  OP2   . DG  A 1 15 ? 10.959 -7.247  39.333  1.00 49.35 ? 1509 DG  C OP2   1 
ATOM   291  O  "O5'" . DG  A 1 15 ? 13.535 -7.289  39.263  1.00 35.90 ? 1509 DG  C "O5'" 1 
ATOM   292  C  "C5'" . DG  A 1 15 ? 14.733 -7.739  38.633  1.00 32.16 ? 1509 DG  C "C5'" 1 
ATOM   293  C  "C4'" . DG  A 1 15 ? 15.913 -7.123  39.340  1.00 27.85 ? 1509 DG  C "C4'" 1 
ATOM   294  O  "O4'" . DG  A 1 15 ? 15.882 -5.683  39.143  1.00 28.05 ? 1509 DG  C "O4'" 1 
ATOM   295  C  "C3'" . DG  A 1 15 ? 15.908 -7.354  40.845  1.00 30.53 ? 1509 DG  C "C3'" 1 
ATOM   296  O  "O3'" . DG  A 1 15 ? 17.148 -7.926  41.254  1.00 47.80 ? 1509 DG  C "O3'" 1 
ATOM   297  C  "C2'" . DG  A 1 15 ? 15.735 -5.952  41.430  1.00 27.99 ? 1509 DG  C "C2'" 1 
ATOM   298  C  "C1'" . DG  A 1 15 ? 16.371 -5.089  40.341  1.00 25.72 ? 1509 DG  C "C1'" 1 
ATOM   299  N  N9    . DG  A 1 15 ? 16.004 -3.681  40.306  1.00 22.50 ? 1509 DG  C N9    1 
ATOM   300  C  C8    . DG  A 1 15 ? 14.765 -3.115  40.419  1.00 20.70 ? 1509 DG  C C8    1 
ATOM   301  N  N7    . DG  A 1 15 ? 14.789 -1.812  40.427  1.00 18.97 ? 1509 DG  C N7    1 
ATOM   302  C  C5    . DG  A 1 15 ? 16.117 -1.510  40.137  1.00 14.95 ? 1509 DG  C C5    1 
ATOM   303  C  C6    . DG  A 1 15 ? 16.763 -0.252  39.998  1.00 14.00 ? 1509 DG  C C6    1 
ATOM   304  O  O6    . DG  A 1 15 ? 16.211 0.854   39.974  1.00 18.28 ? 1509 DG  C O6    1 
ATOM   305  N  N1    . DG  A 1 15 ? 18.136 -0.388  39.915  1.00 16.48 ? 1509 DG  C N1    1 
ATOM   306  C  C2    . DG  A 1 15 ? 18.815 -1.578  39.883  1.00 18.80 ? 1509 DG  C C2    1 
ATOM   307  N  N2    . DG  A 1 15 ? 20.139 -1.508  39.720  1.00 19.24 ? 1509 DG  C N2    1 
ATOM   308  N  N3    . DG  A 1 15 ? 18.220 -2.762  39.963  1.00 19.30 ? 1509 DG  C N3    1 
ATOM   309  C  C4    . DG  A 1 15 ? 16.893 -2.640  40.140  1.00 17.44 ? 1509 DG  C C4    1 
ATOM   310  O  "O5'" . DC  B 2 1  ? 24.801 6.842   41.806  1.00 48.39 ? 1531 DC  D "O5'" 1 
ATOM   311  C  "C5'" . DC  B 2 1  ? 24.194 6.212   40.681  1.00 26.12 ? 1531 DC  D "C5'" 1 
ATOM   312  C  "C4'" . DC  B 2 1  ? 24.643 4.767   40.630  1.00 26.17 ? 1531 DC  D "C4'" 1 
ATOM   313  O  "O4'" . DC  B 2 1  ? 23.499 3.904   40.846  1.00 20.70 ? 1531 DC  D "O4'" 1 
ATOM   314  C  "C3'" . DC  B 2 1  ? 25.260 4.337   39.294  1.00 18.99 ? 1531 DC  D "C3'" 1 
ATOM   315  O  "O3'" . DC  B 2 1  ? 26.378 3.498   39.581  1.00 13.69 ? 1531 DC  D "O3'" 1 
ATOM   316  C  "C2'" . DC  B 2 1  ? 24.082 3.671   38.591  1.00 10.39 ? 1531 DC  D "C2'" 1 
ATOM   317  C  "C1'" . DC  B 2 1  ? 23.229 3.101   39.689  1.00 19.85 ? 1531 DC  D "C1'" 1 
ATOM   318  N  N1    . DC  B 2 1  ? 21.770 3.150   39.525  1.00 13.17 ? 1531 DC  D N1    1 
ATOM   319  C  C2    . DC  B 2 1  ? 21.047 1.956   39.639  1.00 12.52 ? 1531 DC  D C2    1 
ATOM   320  O  O2    . DC  B 2 1  ? 21.669 0.907   39.842  1.00 15.74 ? 1531 DC  D O2    1 
ATOM   321  N  N3    . DC  B 2 1  ? 19.707 1.978   39.473  1.00 16.56 ? 1531 DC  D N3    1 
ATOM   322  C  C4    . DC  B 2 1  ? 19.081 3.134   39.222  1.00 17.25 ? 1531 DC  D C4    1 
ATOM   323  N  N4    . DC  B 2 1  ? 17.748 3.130   39.212  1.00 15.76 ? 1531 DC  D N4    1 
ATOM   324  C  C5    . DC  B 2 1  ? 19.795 4.364   39.112  1.00 16.69 ? 1531 DC  D C5    1 
ATOM   325  C  C6    . DC  B 2 1  ? 21.124 4.314   39.238  1.00 14.63 ? 1531 DC  D C6    1 
ATOM   326  P  P     . DT  B 2 2  ? 27.259 2.858   38.369  1.00 12.84 ? 1532 DT  D P     1 
ATOM   327  O  OP1   . DT  B 2 2  ? 28.586 2.620   38.961  1.00 11.44 ? 1532 DT  D OP1   1 
ATOM   328  O  OP2   . DT  B 2 2  ? 27.155 3.770   37.204  1.00 14.24 ? 1532 DT  D OP2   1 
ATOM   329  O  "O5'" . DT  B 2 2  ? 26.471 1.505   38.033  1.00 11.70 ? 1532 DT  D "O5'" 1 
ATOM   330  C  "C5'" . DT  B 2 2  ? 26.387 0.498   39.048  1.00 13.42 ? 1532 DT  D "C5'" 1 
ATOM   331  C  "C4'" . DT  B 2 2  ? 25.572 -0.633  38.461  1.00 8.06  ? 1532 DT  D "C4'" 1 
ATOM   332  O  "O4'" . DT  B 2 2  ? 24.200 -0.219  38.264  1.00 10.95 ? 1532 DT  D "O4'" 1 
ATOM   333  C  "C3'" . DT  B 2 2  ? 26.067 -1.156  37.106  1.00 8.92  ? 1532 DT  D "C3'" 1 
ATOM   334  O  "O3'" . DT  B 2 2  ? 26.565 -2.470  37.325  1.00 14.33 ? 1532 DT  D "O3'" 1 
ATOM   335  C  "C2'" . DT  B 2 2  ? 24.845 -1.128  36.222  1.00 11.02 ? 1532 DT  D "C2'" 1 
ATOM   336  C  "C1'" . DT  B 2 2  ? 23.663 -0.952  37.168  1.00 15.18 ? 1532 DT  D "C1'" 1 
ATOM   337  N  N1    . DT  B 2 2  ? 22.512 -0.137  36.760  1.00 12.47 ? 1532 DT  D N1    1 
ATOM   338  C  C2    . DT  B 2 2  ? 21.268 -0.711  36.678  1.00 13.32 ? 1532 DT  D C2    1 
ATOM   339  O  O2    . DT  B 2 2  ? 21.102 -1.910  36.874  1.00 14.64 ? 1532 DT  D O2    1 
ATOM   340  N  N3    . DT  B 2 2  ? 20.253 0.140   36.337  1.00 12.84 ? 1532 DT  D N3    1 
ATOM   341  C  C4    . DT  B 2 2  ? 20.323 1.481   36.004  1.00 11.00 ? 1532 DT  D C4    1 
ATOM   342  O  O4    . DT  B 2 2  ? 19.315 2.127   35.724  1.00 16.16 ? 1532 DT  D O4    1 
ATOM   343  C  C5    . DT  B 2 2  ? 21.661 1.994   36.047  1.00 9.34  ? 1532 DT  D C5    1 
ATOM   344  C  C7    . DT  B 2 2  ? 21.852 3.455   35.726  1.00 15.01 ? 1532 DT  D C7    1 
ATOM   345  C  C6    . DT  B 2 2  ? 22.674 1.182   36.380  1.00 12.47 ? 1532 DT  D C6    1 
ATOM   346  P  P     . DG  B 2 3  ? 27.363 -3.297  36.207  1.00 11.30 ? 1533 DG  D P     1 
ATOM   347  O  OP1   . DG  B 2 3  ? 28.150 -4.338  36.888  1.00 11.78 ? 1533 DG  D OP1   1 
ATOM   348  O  OP2   . DG  B 2 3  ? 28.155 -2.322  35.423  1.00 11.96 ? 1533 DG  D OP2   1 
ATOM   349  O  "O5'" . DG  B 2 3  ? 26.242 -3.916  35.247  1.00 10.51 ? 1533 DG  D "O5'" 1 
ATOM   350  C  "C5'" . DG  B 2 3  ? 25.366 -4.934  35.722  1.00 11.33 ? 1533 DG  D "C5'" 1 
ATOM   351  C  "C4'" . DG  B 2 3  ? 24.252 -5.208  34.754  1.00 11.37 ? 1533 DG  D "C4'" 1 
ATOM   352  O  "O4'" . DG  B 2 3  ? 23.375 -4.059  34.596  1.00 13.21 ? 1533 DG  D "O4'" 1 
ATOM   353  C  "C3'" . DG  B 2 3  ? 24.705 -5.542  33.336  1.00 12.39 ? 1533 DG  D "C3'" 1 
ATOM   354  O  "O3'" . DG  B 2 3  ? 23.762 -6.451  32.787  1.00 17.41 ? 1533 DG  D "O3'" 1 
ATOM   355  C  "C2'" . DG  B 2 3  ? 24.585 -4.207  32.613  1.00 9.80  ? 1533 DG  D "C2'" 1 
ATOM   356  C  "C1'" . DG  B 2 3  ? 23.272 -3.736  33.227  1.00 10.37 ? 1533 DG  D "C1'" 1 
ATOM   357  N  N9    . DG  B 2 3  ? 23.032 -2.316  33.055  1.00 11.93 ? 1533 DG  D N9    1 
ATOM   358  C  C8    . DG  B 2 3  ? 23.920 -1.284  32.880  1.00 15.78 ? 1533 DG  D C8    1 
ATOM   359  N  N7    . DG  B 2 3  ? 23.330 -0.123  32.772  1.00 12.39 ? 1533 DG  D N7    1 
ATOM   360  C  C5    . DG  B 2 3  ? 21.977 -0.399  32.929  1.00 11.65 ? 1533 DG  D C5    1 
ATOM   361  C  C6    . DG  B 2 3  ? 20.808 0.398   32.829  1.00 16.75 ? 1533 DG  D C6    1 
ATOM   362  O  O6    . DG  B 2 3  ? 20.664 1.603   32.601  1.00 12.28 ? 1533 DG  D O6    1 
ATOM   363  N  N1    . DG  B 2 3  ? 19.641 -0.361  32.954  1.00 14.18 ? 1533 DG  D N1    1 
ATOM   364  C  C2    . DG  B 2 3  ? 19.575 -1.715  33.160  1.00 11.51 ? 1533 DG  D C2    1 
ATOM   365  N  N2    . DG  B 2 3  ? 18.350 -2.263  33.239  1.00 17.15 ? 1533 DG  D N2    1 
ATOM   366  N  N3    . DG  B 2 3  ? 20.631 -2.480  33.223  1.00 11.60 ? 1533 DG  D N3    1 
ATOM   367  C  C4    . DG  B 2 3  ? 21.778 -1.764  33.060  1.00 11.81 ? 1533 DG  D C4    1 
ATOM   368  P  P     . DA  B 2 4  ? 24.173 -7.830  32.102  1.00 14.58 ? 1534 DA  D P     1 
ATOM   369  O  OP1   . DA  B 2 4  ? 24.772 -8.717  33.128  1.00 12.41 ? 1534 DA  D OP1   1 
ATOM   370  O  OP2   . DA  B 2 4  ? 25.074 -7.530  30.961  1.00 14.56 ? 1534 DA  D OP2   1 
ATOM   371  O  "O5'" . DA  B 2 4  ? 22.767 -8.357  31.577  1.00 12.26 ? 1534 DA  D "O5'" 1 
ATOM   372  C  "C5'" . DA  B 2 4  ? 21.751 -8.669  32.543  1.00 14.15 ? 1534 DA  D "C5'" 1 
ATOM   373  C  "C4'" . DA  B 2 4  ? 20.397 -8.560  31.889  1.00 14.72 ? 1534 DA  D "C4'" 1 
ATOM   374  O  "O4'" . DA  B 2 4  ? 20.015 -7.167  31.695  1.00 19.08 ? 1534 DA  D "O4'" 1 
ATOM   375  C  "C3'" . DA  B 2 4  ? 20.339 -9.224  30.516  1.00 13.36 ? 1534 DA  D "C3'" 1 
ATOM   376  O  "O3'" . DA  B 2 4  ? 19.041 -9.778  30.406  1.00 18.98 ? 1534 DA  D "O3'" 1 
ATOM   377  C  "C2'" . DA  B 2 4  ? 20.582 -8.044  29.574  1.00 13.53 ? 1534 DA  D "C2'" 1 
ATOM   378  C  "C1'" . DA  B 2 4  ? 19.908 -6.887  30.304  1.00 17.62 ? 1534 DA  D "C1'" 1 
ATOM   379  N  N9    . DA  B 2 4  ? 20.516 -5.567  30.119  1.00 17.58 ? 1534 DA  D N9    1 
ATOM   380  C  C8    . DA  B 2 4  ? 21.842 -5.258  29.998  1.00 16.25 ? 1534 DA  D C8    1 
ATOM   381  N  N7    . DA  B 2 4  ? 22.056 -3.969  29.869  1.00 13.60 ? 1534 DA  D N7    1 
ATOM   382  C  C5    . DA  B 2 4  ? 20.807 -3.396  29.895  1.00 14.80 ? 1534 DA  D C5    1 
ATOM   383  C  C6    . DA  B 2 4  ? 20.346 -2.067  29.772  1.00 14.50 ? 1534 DA  D C6    1 
ATOM   384  N  N6    . DA  B 2 4  ? 21.157 -1.017  29.593  1.00 15.93 ? 1534 DA  D N6    1 
ATOM   385  N  N1    . DA  B 2 4  ? 19.027 -1.859  29.809  1.00 15.00 ? 1534 DA  D N1    1 
ATOM   386  C  C2    . DA  B 2 4  ? 18.190 -2.890  29.948  1.00 17.60 ? 1534 DA  D C2    1 
ATOM   387  N  N3    . DA  B 2 4  ? 18.520 -4.160  30.097  1.00 13.07 ? 1534 DA  D N3    1 
ATOM   388  C  C4    . DA  B 2 4  ? 19.834 -4.377  30.018  1.00 13.75 ? 1534 DA  D C4    1 
ATOM   389  P  P     . DC  B 2 5  ? 18.535 -10.593 29.140  1.00 22.26 ? 1535 DC  D P     1 
ATOM   390  O  OP1   . DC  B 2 5  ? 17.592 -11.621 29.665  1.00 32.90 ? 1535 DC  D OP1   1 
ATOM   391  O  OP2   . DC  B 2 5  ? 19.667 -11.131 28.375  1.00 21.78 ? 1535 DC  D OP2   1 
ATOM   392  O  "O5'" . DC  B 2 5  ? 17.711 -9.556  28.240  1.00 23.43 ? 1535 DC  D "O5'" 1 
ATOM   393  C  "C5'" . DC  B 2 5  ? 16.470 -9.007  28.676  1.00 23.57 ? 1535 DC  D "C5'" 1 
ATOM   394  C  "C4'" . DC  B 2 5  ? 16.151 -7.830  27.785  1.00 21.45 ? 1535 DC  D "C4'" 1 
ATOM   395  O  "O4'" . DC  B 2 5  ? 17.162 -6.791  27.948  1.00 18.11 ? 1535 DC  D "O4'" 1 
ATOM   396  C  "C3'" . DC  B 2 5  ? 16.150 -8.151  26.287  1.00 26.47 ? 1535 DC  D "C3'" 1 
ATOM   397  O  "O3'" . DC  B 2 5  ? 14.833 -7.985  25.800  1.00 28.98 ? 1535 DC  D "O3'" 1 
ATOM   398  C  "C2'" . DC  B 2 5  ? 17.091 -7.126  25.668  1.00 29.38 ? 1535 DC  D "C2'" 1 
ATOM   399  C  "C1'" . DC  B 2 5  ? 17.126 -6.041  26.748  1.00 25.09 ? 1535 DC  D "C1'" 1 
ATOM   400  N  N1    . DC  B 2 5  ? 18.298 -5.171  26.701  1.00 16.47 ? 1535 DC  D N1    1 
ATOM   401  C  C2    . DC  B 2 5  ? 18.115 -3.782  26.757  1.00 12.47 ? 1535 DC  D C2    1 
ATOM   402  O  O2    . DC  B 2 5  ? 16.966 -3.333  26.895  1.00 13.63 ? 1535 DC  D O2    1 
ATOM   403  N  N3    . DC  B 2 5  ? 19.193 -2.978  26.686  1.00 12.39 ? 1535 DC  D N3    1 
ATOM   404  C  C4    . DC  B 2 5  ? 20.415 -3.502  26.625  1.00 11.15 ? 1535 DC  D C4    1 
ATOM   405  N  N4    . DC  B 2 5  ? 21.461 -2.670  26.557  1.00 12.71 ? 1535 DC  D N4    1 
ATOM   406  C  C5    . DC  B 2 5  ? 20.637 -4.913  26.584  1.00 15.32 ? 1535 DC  D C5    1 
ATOM   407  C  C6    . DC  B 2 5  ? 19.558 -5.698  26.622  1.00 21.20 ? 1535 DC  D C6    1 
ATOM   408  P  P     . DC  B 2 6  ? 14.395 -8.239  24.279  1.00 30.72 ? 1536 DC  D P     1 
ATOM   409  O  OP1   . DC  B 2 6  ? 13.147 -9.043  24.383  1.00 38.06 ? 1536 DC  D OP1   1 
ATOM   410  O  OP2   . DC  B 2 6  ? 15.492 -8.885  23.549  1.00 23.92 ? 1536 DC  D OP2   1 
ATOM   411  O  "O5'" . DC  B 2 6  ? 14.117 -6.768  23.702  1.00 26.58 ? 1536 DC  D "O5'" 1 
ATOM   412  C  "C5'" . DC  B 2 6  ? 13.147 -5.914  24.305  1.00 31.89 ? 1536 DC  D "C5'" 1 
ATOM   413  C  "C4'" . DC  B 2 6  ? 13.202 -4.566  23.608  1.00 23.20 ? 1536 DC  D "C4'" 1 
ATOM   414  O  "O4'" . DC  B 2 6  ? 14.439 -3.906  24.003  1.00 19.82 ? 1536 DC  D "O4'" 1 
ATOM   415  C  "C3'" . DC  B 2 6  ? 13.195 -4.646  22.084  1.00 23.49 ? 1536 DC  D "C3'" 1 
ATOM   416  O  "O3'" . DC  B 2 6  ? 12.131 -3.879  21.536  1.00 22.56 ? 1536 DC  D "O3'" 1 
ATOM   417  C  "C2'" . DC  B 2 6  ? 14.516 -4.033  21.654  1.00 22.65 ? 1536 DC  D "C2'" 1 
ATOM   418  C  "C1'" . DC  B 2 6  ? 14.940 -3.213  22.881  1.00 22.25 ? 1536 DC  D "C1'" 1 
ATOM   419  N  N1    . DC  B 2 6  ? 16.398 -3.093  23.013  1.00 14.99 ? 1536 DC  D N1    1 
ATOM   420  C  C2    . DC  B 2 6  ? 16.960 -1.804  22.897  1.00 11.15 ? 1536 DC  D C2    1 
ATOM   421  O  O2    . DC  B 2 6  ? 16.189 -0.871  22.653  1.00 14.50 ? 1536 DC  D O2    1 
ATOM   422  N  N3    . DC  B 2 6  ? 18.292 -1.672  22.994  1.00 13.10 ? 1536 DC  D N3    1 
ATOM   423  C  C4    . DC  B 2 6  ? 19.073 -2.727  23.220  1.00 17.44 ? 1536 DC  D C4    1 
ATOM   424  N  N4    . DC  B 2 6  ? 20.385 -2.555  23.310  1.00 14.69 ? 1536 DC  D N4    1 
ATOM   425  C  C5    . DC  B 2 6  ? 18.526 -4.050  23.336  1.00 19.25 ? 1536 DC  D C5    1 
ATOM   426  C  C6    . DC  B 2 6  ? 17.199 -4.156  23.248  1.00 10.66 ? 1536 DC  D C6    1 
ATOM   427  P  P     . DT  B 2 7  ? 11.989 -3.714  19.932  1.00 24.21 ? 1537 DT  D P     1 
ATOM   428  O  OP1   . DT  B 2 7  ? 10.521 -3.696  19.767  1.00 31.92 ? 1537 DT  D OP1   1 
ATOM   429  O  OP2   . DT  B 2 7  ? 12.777 -4.767  19.299  1.00 20.92 ? 1537 DT  D OP2   1 
ATOM   430  O  "O5'" . DT  B 2 7  ? 12.673 -2.288  19.587  1.00 20.16 ? 1537 DT  D "O5'" 1 
ATOM   431  C  "C5'" . DT  B 2 7  ? 12.138 -1.073  20.122  1.00 16.75 ? 1537 DT  D "C5'" 1 
ATOM   432  C  "C4'" . DT  B 2 7  ? 12.832 0.098   19.465  1.00 16.96 ? 1537 DT  D "C4'" 1 
ATOM   433  O  "O4'" . DT  B 2 7  ? 14.255 0.104   19.780  1.00 18.49 ? 1537 DT  D "O4'" 1 
ATOM   434  C  "C3'" . DT  B 2 7  ? 12.713 0.043   17.939  1.00 19.65 ? 1537 DT  D "C3'" 1 
ATOM   435  O  "O3'" . DT  B 2 7  ? 12.272 1.302   17.455  1.00 18.04 ? 1537 DT  D "O3'" 1 
ATOM   436  C  "C2'" . DT  B 2 7  ? 14.128 -0.285  17.473  1.00 20.63 ? 1537 DT  D "C2'" 1 
ATOM   437  C  "C1'" . DT  B 2 7  ? 15.030 0.228   18.587  1.00 14.50 ? 1537 DT  D "C1'" 1 
ATOM   438  N  N1    . DT  B 2 7  ? 16.290 -0.484  18.797  1.00 14.57 ? 1537 DT  D N1    1 
ATOM   439  C  C2    . DT  B 2 7  ? 17.470 0.225   18.685  1.00 18.52 ? 1537 DT  D C2    1 
ATOM   440  O  O2    . DT  B 2 7  ? 17.488 1.402   18.337  1.00 17.37 ? 1537 DT  D O2    1 
ATOM   441  N  N3    . DT  B 2 7  ? 18.628 -0.479  18.893  1.00 15.53 ? 1537 DT  D N3    1 
ATOM   442  C  C4    . DT  B 2 7  ? 18.759 -1.813  19.264  1.00 14.27 ? 1537 DT  D C4    1 
ATOM   443  O  O4    . DT  B 2 7  ? 19.877 -2.310  19.376  1.00 13.98 ? 1537 DT  D O4    1 
ATOM   444  C  C5    . DT  B 2 7  ? 17.489 -2.511  19.302  1.00 13.90 ? 1537 DT  D C5    1 
ATOM   445  C  C7    . DT  B 2 7  ? 17.493 -3.987  19.577  1.00 15.40 ? 1537 DT  D C7    1 
ATOM   446  C  C6    . DT  B 2 7  ? 16.358 -1.831  19.086  1.00 11.05 ? 1537 DT  D C6    1 
ATOM   447  P  P     . DT  B 2 8  ? 12.344 1.748   15.929  1.00 18.41 ? 1538 DT  D P     1 
ATOM   448  O  OP1   . DT  B 2 8  ? 11.262 2.745   15.806  1.00 20.26 ? 1538 DT  D OP1   1 
ATOM   449  O  OP2   . DT  B 2 8  ? 12.312 0.535   15.082  1.00 22.00 ? 1538 DT  D OP2   1 
ATOM   450  O  "O5'" . DT  B 2 8  ? 13.784 2.436   15.705  1.00 19.58 ? 1538 DT  D "O5'" 1 
ATOM   451  C  "C5'" . DT  B 2 8  ? 14.045 3.672   16.378  1.00 18.03 ? 1538 DT  D "C5'" 1 
ATOM   452  C  "C4'" . DT  B 2 8  ? 15.350 4.236   15.883  1.00 12.94 ? 1538 DT  D "C4'" 1 
ATOM   453  O  "O4'" . DT  B 2 8  ? 16.453 3.322   16.112  1.00 14.02 ? 1538 DT  D "O4'" 1 
ATOM   454  C  "C3'" . DT  B 2 8  ? 15.351 4.543   14.379  1.00 12.81 ? 1538 DT  D "C3'" 1 
ATOM   455  O  "O3'" . DT  B 2 8  ? 15.818 5.881   14.270  1.00 15.84 ? 1538 DT  D "O3'" 1 
ATOM   456  C  "C2'" . DT  B 2 8  ? 16.297 3.508   13.791  1.00 13.16 ? 1538 DT  D "C2'" 1 
ATOM   457  C  "C1'" . DT  B 2 8  ? 17.230 3.166   14.930  1.00 14.32 ? 1538 DT  D "C1'" 1 
ATOM   458  N  N1    . DT  B 2 8  ? 17.749 1.790   15.052  1.00 13.39 ? 1538 DT  D N1    1 
ATOM   459  C  C2    . DT  B 2 8  ? 19.091 1.609   15.206  1.00 12.06 ? 1538 DT  D C2    1 
ATOM   460  O  O2    . DT  B 2 8  ? 19.955 2.472   15.159  1.00 12.06 ? 1538 DT  D O2    1 
ATOM   461  N  N3    . DT  B 2 8  ? 19.510 0.294   15.275  1.00 12.69 ? 1538 DT  D N3    1 
ATOM   462  C  C4    . DT  B 2 8  ? 18.683 -0.810  15.324  1.00 13.01 ? 1538 DT  D C4    1 
ATOM   463  O  O4    . DT  B 2 8  ? 19.210 -1.911  15.524  1.00 14.29 ? 1538 DT  D O4    1 
ATOM   464  C  C5    . DT  B 2 8  ? 17.286 -0.549  15.123  1.00 12.70 ? 1538 DT  D C5    1 
ATOM   465  C  C7    . DT  B 2 8  ? 16.378 -1.726  15.002  1.00 14.75 ? 1538 DT  D C7    1 
ATOM   466  C  C6    . DT  B 2 8  ? 16.876 0.720   14.951  1.00 15.50 ? 1538 DT  D C6    1 
ATOM   467  P  P     . DT  B 2 9  ? 16.106 6.646   12.912  1.00 16.85 ? 1539 DT  D P     1 
ATOM   468  O  OP1   . DT  B 2 9  ? 15.643 8.044   13.175  1.00 17.17 ? 1539 DT  D OP1   1 
ATOM   469  O  OP2   . DT  B 2 9  ? 15.356 5.911   11.857  1.00 17.54 ? 1539 DT  D OP2   1 
ATOM   470  O  "O5'" . DT  B 2 9  ? 17.656 6.586   12.601  1.00 15.25 ? 1539 DT  D "O5'" 1 
ATOM   471  C  "C5'" . DT  B 2 9  ? 18.559 7.057   13.606  1.00 14.84 ? 1539 DT  D "C5'" 1 
ATOM   472  C  "C4'" . DT  B 2 9  ? 19.950 6.661   13.249  1.00 12.61 ? 1539 DT  D "C4'" 1 
ATOM   473  O  "O4'" . DT  B 2 9  ? 20.106 5.218   13.333  1.00 14.45 ? 1539 DT  D "O4'" 1 
ATOM   474  C  "C3'" . DT  B 2 9  ? 20.329 7.040   11.812  1.00 15.03 ? 1539 DT  D "C3'" 1 
ATOM   475  O  "O3'" . DT  B 2 9  ? 21.376 7.972   11.935  1.00 13.25 ? 1539 DT  D "O3'" 1 
ATOM   476  C  "C2'" . DT  B 2 9  ? 20.761 5.739   11.152  1.00 11.80 ? 1539 DT  D "C2'" 1 
ATOM   477  C  "C1'" . DT  B 2 9  ? 21.012 4.806   12.324  1.00 17.54 ? 1539 DT  D "C1'" 1 
ATOM   478  N  N1    . DT  B 2 9  ? 20.701 3.378   12.163  1.00 15.65 ? 1539 DT  D N1    1 
ATOM   479  C  C2    . DT  B 2 9  ? 21.730 2.479   12.358  1.00 10.93 ? 1539 DT  D C2    1 
ATOM   480  O  O2    . DT  B 2 9  ? 22.874 2.794   12.621  1.00 12.81 ? 1539 DT  D O2    1 
ATOM   481  N  N3    . DT  B 2 9  ? 21.351 1.178   12.128  1.00 12.39 ? 1539 DT  D N3    1 
ATOM   482  C  C4    . DT  B 2 9  ? 20.098 0.680   11.868  1.00 14.64 ? 1539 DT  D C4    1 
ATOM   483  O  O4    . DT  B 2 9  ? 19.945 -0.547  11.820  1.00 16.09 ? 1539 DT  D O4    1 
ATOM   484  C  C5    . DT  B 2 9  ? 19.084 1.688   11.610  1.00 10.16 ? 1539 DT  D C5    1 
ATOM   485  C  C7    . DT  B 2 9  ? 17.674 1.291   11.343  1.00 12.94 ? 1539 DT  D C7    1 
ATOM   486  C  C6    . DT  B 2 9  ? 19.446 2.981   11.754  1.00 16.52 ? 1539 DT  D C6    1 
ATOM   487  P  P     . DG  B 2 10 ? 21.855 8.889   10.707  1.00 13.84 ? 1540 DG  D P     1 
ATOM   488  O  OP1   . DG  B 2 10 ? 22.563 10.044  11.344  1.00 17.30 ? 1540 DG  D OP1   1 
ATOM   489  O  OP2   . DG  B 2 10 ? 20.580 9.200   10.035  1.00 14.41 ? 1540 DG  D OP2   1 
ATOM   490  O  "O5'" . DG  B 2 10 ? 22.890 7.987   9.918   1.00 11.32 ? 1540 DG  D "O5'" 1 
ATOM   491  C  "C5'" . DG  B 2 10 ? 24.164 7.664   10.468  1.00 11.45 ? 1540 DG  D "C5'" 1 
ATOM   492  C  "C4'" . DG  B 2 10 ? 24.851 6.640   9.610   1.00 14.70 ? 1540 DG  D "C4'" 1 
ATOM   493  O  "O4'" . DG  B 2 10 ? 24.068 5.415   9.622   1.00 15.96 ? 1540 DG  D "O4'" 1 
ATOM   494  C  "C3'" . DG  B 2 10 ? 25.008 7.024   8.139   1.00 19.51 ? 1540 DG  D "C3'" 1 
ATOM   495  O  "O3'" . DG  B 2 10 ? 26.233 6.492   7.696   1.00 15.91 ? 1540 DG  D "O3'" 1 
ATOM   496  C  "C2'" . DG  B 2 10 ? 23.861 6.280   7.457   1.00 15.45 ? 1540 DG  D "C2'" 1 
ATOM   497  C  "C1'" . DG  B 2 10 ? 23.907 4.988   8.262   1.00 18.34 ? 1540 DG  D "C1'" 1 
ATOM   498  N  N9    . DG  B 2 10 ? 22.731 4.150   8.276   1.00 13.61 ? 1540 DG  D N9    1 
ATOM   499  C  C8    . DG  B 2 10 ? 21.415 4.450   8.074   1.00 16.24 ? 1540 DG  D C8    1 
ATOM   500  N  N7    . DG  B 2 10 ? 20.620 3.437   8.272   1.00 15.68 ? 1540 DG  D N7    1 
ATOM   501  C  C5    . DG  B 2 10 ? 21.491 2.363   8.426   1.00 13.54 ? 1540 DG  D C5    1 
ATOM   502  C  C6    . DG  B 2 10 ? 21.200 0.985   8.638   1.00 9.99  ? 1540 DG  D C6    1 
ATOM   503  O  O6    . DG  B 2 10 ? 20.070 0.476   8.648   1.00 14.34 ? 1540 DG  D O6    1 
ATOM   504  N  N1    . DG  B 2 10 ? 22.379 0.292   8.889   1.00 12.01 ? 1540 DG  D N1    1 
ATOM   505  C  C2    . DG  B 2 10 ? 23.630 0.832   9.017   1.00 13.28 ? 1540 DG  D C2    1 
ATOM   506  N  N2    . DG  B 2 10 ? 24.642 -0.024  9.218   1.00 12.39 ? 1540 DG  D N2    1 
ATOM   507  N  N3    . DG  B 2 10 ? 23.919 2.108   8.780   1.00 14.87 ? 1540 DG  D N3    1 
ATOM   508  C  C4    . DG  B 2 10 ? 22.786 2.790   8.518   1.00 11.58 ? 1540 DG  D C4    1 
ATOM   509  P  P     . DA  B 2 11 ? 27.330 7.323   6.939   1.00 17.85 ? 1541 DA  D P     1 
ATOM   510  O  OP1   . DA  B 2 11 ? 27.791 8.385   7.871   1.00 20.10 ? 1541 DA  D OP1   1 
ATOM   511  O  OP2   . DA  B 2 11 ? 26.732 7.846   5.689   1.00 33.35 ? 1541 DA  D OP2   1 
ATOM   512  O  "O5'" . DA  B 2 11 ? 28.501 6.263   6.635   1.00 20.89 ? 1541 DA  D "O5'" 1 
ATOM   513  C  "C5'" . DA  B 2 11 ? 29.098 5.577   7.736   1.00 23.22 ? 1541 DA  D "C5'" 1 
ATOM   514  C  "C4'" . DA  B 2 11 ? 29.549 4.209   7.279   1.00 19.49 ? 1541 DA  D "C4'" 1 
ATOM   515  O  "O4'" . DA  B 2 11 ? 28.379 3.364   7.140   1.00 17.73 ? 1541 DA  D "O4'" 1 
ATOM   516  C  "C3'" . DA  B 2 11 ? 30.270 4.233   5.932   1.00 20.24 ? 1541 DA  D "C3'" 1 
ATOM   517  O  "O3'" . DA  B 2 11 ? 31.327 3.294   5.969   1.00 19.03 ? 1541 DA  D "O3'" 1 
ATOM   518  C  "C2'" . DA  B 2 11 ? 29.160 3.862   4.956   1.00 17.70 ? 1541 DA  D "C2'" 1 
ATOM   519  C  "C1'" . DA  B 2 11 ? 28.271 2.944   5.771   1.00 18.68 ? 1541 DA  D "C1'" 1 
ATOM   520  N  N9    . DA  B 2 11 ? 26.837 2.993   5.535   1.00 17.84 ? 1541 DA  D N9    1 
ATOM   521  C  C8    . DA  B 2 11 ? 26.044 4.048   5.178   1.00 13.36 ? 1541 DA  D C8    1 
ATOM   522  N  N7    . DA  B 2 11 ? 24.777 3.735   5.081   1.00 16.41 ? 1541 DA  D N7    1 
ATOM   523  C  C5    . DA  B 2 11 ? 24.739 2.367   5.337   1.00 17.72 ? 1541 DA  D C5    1 
ATOM   524  C  C6    . DA  B 2 11 ? 23.688 1.432   5.402   1.00 13.63 ? 1541 DA  D C6    1 
ATOM   525  N  N6    . DA  B 2 11 ? 22.430 1.782   5.183   1.00 17.70 ? 1541 DA  D N6    1 
ATOM   526  N  N1    . DA  B 2 11 ? 23.989 0.141   5.687   1.00 13.14 ? 1541 DA  D N1    1 
ATOM   527  C  C2    . DA  B 2 11 ? 25.258 -0.158  5.929   1.00 16.27 ? 1541 DA  D C2    1 
ATOM   528  N  N3    . DA  B 2 11 ? 26.324 0.637   5.940   1.00 15.10 ? 1541 DA  D N3    1 
ATOM   529  C  C4    . DA  B 2 11 ? 25.982 1.914   5.705   1.00 16.99 ? 1541 DA  D C4    1 
ATOM   530  P  P     . DC  B 2 12 ? 32.304 2.959   4.755   1.00 26.99 ? 1542 DC  D P     1 
ATOM   531  O  OP1   . DC  B 2 12 ? 33.554 2.465   5.409   1.00 27.48 ? 1542 DC  D OP1   1 
ATOM   532  O  OP2   . DC  B 2 12 ? 32.485 4.156   3.915   1.00 26.82 ? 1542 DC  D OP2   1 
ATOM   533  O  "O5'" . DC  B 2 12 ? 31.582 1.761   3.966   1.00 23.20 ? 1542 DC  D "O5'" 1 
ATOM   534  C  "C5'" . DC  B 2 12 ? 31.414 0.518   4.671   1.00 25.74 ? 1542 DC  D "C5'" 1 
ATOM   535  C  "C4'" . DC  B 2 12 ? 30.577 -0.405  3.820   1.00 22.43 ? 1542 DC  D "C4'" 1 
ATOM   536  O  "O4'" . DC  B 2 12 ? 29.193 0.042   3.839   1.00 21.81 ? 1542 DC  D "O4'" 1 
ATOM   537  C  "C3'" . DC  B 2 12 ? 30.981 -0.453  2.338   1.00 27.39 ? 1542 DC  D "C3'" 1 
ATOM   538  O  "O3'" . DC  B 2 12 ? 31.476 -1.753  2.050   1.00 33.09 ? 1542 DC  D "O3'" 1 
ATOM   539  C  "C2'" . DC  B 2 12 ? 29.693 -0.145  1.584   1.00 23.35 ? 1542 DC  D "C2'" 1 
ATOM   540  C  "C1'" . DC  B 2 12 ? 28.621 -0.435  2.628   1.00 21.74 ? 1542 DC  D "C1'" 1 
ATOM   541  N  N1    . DC  B 2 12 ? 27.347 0.258   2.452   1.00 18.19 ? 1542 DC  D N1    1 
ATOM   542  C  C2    . DC  B 2 12 ? 26.160 -0.475  2.497   1.00 15.58 ? 1542 DC  D C2    1 
ATOM   543  O  O2    . DC  B 2 12 ? 26.233 -1.692  2.751   1.00 17.26 ? 1542 DC  D O2    1 
ATOM   544  N  N3    . DC  B 2 12 ? 24.979 0.147   2.299   1.00 16.70 ? 1542 DC  D N3    1 
ATOM   545  C  C4    . DC  B 2 12 ? 24.948 1.470   2.086   1.00 12.33 ? 1542 DC  D C4    1 
ATOM   546  N  N4    . DC  B 2 12 ? 23.762 2.065   2.007   1.00 14.38 ? 1542 DC  D N4    1 
ATOM   547  C  C5    . DC  B 2 12 ? 26.143 2.250   2.131   1.00 15.28 ? 1542 DC  D C5    1 
ATOM   548  C  C6    . DC  B 2 12 ? 27.300 1.616   2.274   1.00 24.04 ? 1542 DC  D C6    1 
ATOM   549  P  P     . DC  B 2 13 ? 32.167 -2.133  0.652   1.00 36.39 ? 1543 DC  D P     1 
ATOM   550  O  OP1   . DC  B 2 13 ? 33.371 -2.919  0.989   1.00 54.46 ? 1543 DC  D OP1   1 
ATOM   551  O  OP2   . DC  B 2 13 ? 32.434 -0.881  -0.100  1.00 37.07 ? 1543 DC  D OP2   1 
ATOM   552  O  "O5'" . DC  B 2 13 ? 31.034 -2.991  -0.088  1.00 38.85 ? 1543 DC  D "O5'" 1 
ATOM   553  C  "C5'" . DC  B 2 13 ? 30.479 -4.101  0.632   1.00 39.26 ? 1543 DC  D "C5'" 1 
ATOM   554  C  "C4'" . DC  B 2 13 ? 29.151 -4.412  0.006   1.00 34.75 ? 1543 DC  D "C4'" 1 
ATOM   555  O  "O4'" . DC  B 2 13 ? 28.235 -3.324  0.344   1.00 30.16 ? 1543 DC  D "O4'" 1 
ATOM   556  C  "C3'" . DC  B 2 13 ? 29.120 -4.452  -1.515  1.00 34.61 ? 1543 DC  D "C3'" 1 
ATOM   557  O  "O3'" . DC  B 2 13 ? 29.445 -5.743  -2.016  1.00 33.21 ? 1543 DC  D "O3'" 1 
ATOM   558  C  "C2'" . DC  B 2 13 ? 27.661 -4.129  -1.813  1.00 37.67 ? 1543 DC  D "C2'" 1 
ATOM   559  C  "C1'" . DC  B 2 13 ? 27.141 -3.480  -0.539  1.00 33.87 ? 1543 DC  D "C1'" 1 
ATOM   560  N  N1    . DC  B 2 13 ? 26.538 -2.149  -0.732  1.00 29.10 ? 1543 DC  D N1    1 
ATOM   561  C  C2    . DC  B 2 13 ? 25.151 -2.074  -0.872  1.00 21.08 ? 1543 DC  D C2    1 
ATOM   562  O  O2    . DC  B 2 13 ? 24.502 -3.132  -0.819  1.00 23.12 ? 1543 DC  D O2    1 
ATOM   563  N  N3    . DC  B 2 13 ? 24.566 -0.863  -1.022  1.00 20.90 ? 1543 DC  D N3    1 
ATOM   564  C  C4    . DC  B 2 13 ? 25.332 0.231   -1.095  1.00 19.79 ? 1543 DC  D C4    1 
ATOM   565  N  N4    . DC  B 2 13 ? 24.723 1.415   -1.249  1.00 24.41 ? 1543 DC  D N4    1 
ATOM   566  C  C5    . DC  B 2 13 ? 26.745 0.179   -0.931  1.00 27.80 ? 1543 DC  D C5    1 
ATOM   567  C  C6    . DC  B 2 13 ? 27.309 -1.027  -0.795  1.00 26.64 ? 1543 DC  D C6    1 
ATOM   568  P  P     . DT  B 2 14 ? 29.369 -6.045  -3.602  1.00 27.61 ? 1544 DT  D P     1 
ATOM   569  O  OP1   . DT  B 2 14 ? 30.330 -7.172  -3.755  1.00 35.44 ? 1544 DT  D OP1   1 
ATOM   570  O  OP2   . DT  B 2 14 ? 29.796 -4.808  -4.301  1.00 52.29 ? 1544 DT  D OP2   1 
ATOM   571  O  "O5'" . DT  B 2 14 ? 27.881 -6.436  -3.934  1.00 24.92 ? 1544 DT  D "O5'" 1 
ATOM   572  C  "C5'" . DT  B 2 14 ? 27.257 -7.528  -3.261  1.00 30.66 ? 1544 DT  D "C5'" 1 
ATOM   573  C  "C4'" . DT  B 2 14 ? 25.799 -7.523  -3.657  1.00 34.53 ? 1544 DT  D "C4'" 1 
ATOM   574  O  "O4'" . DT  B 2 14 ? 25.243 -6.200  -3.475  1.00 29.99 ? 1544 DT  D "O4'" 1 
ATOM   575  C  "C3'" . DT  B 2 14 ? 25.583 -7.881  -5.126  1.00 38.28 ? 1544 DT  D "C3'" 1 
ATOM   576  O  "O3'" . DT  B 2 14 ? 24.482 -8.783  -5.195  1.00 33.60 ? 1544 DT  D "O3'" 1 
ATOM   577  C  "C2'" . DT  B 2 14 ? 25.283 -6.539  -5.783  1.00 35.24 ? 1544 DT  D "C2'" 1 
ATOM   578  C  "C1'" . DT  B 2 14 ? 24.590 -5.769  -4.663  1.00 33.03 ? 1544 DT  D "C1'" 1 
ATOM   579  N  N1    . DT  B 2 14 ? 24.723 -4.303  -4.644  1.00 24.64 ? 1544 DT  D N1    1 
ATOM   580  C  C2    . DT  B 2 14 ? 23.583 -3.535  -4.583  1.00 22.16 ? 1544 DT  D C2    1 
ATOM   581  O  O2    . DT  B 2 14 ? 22.444 -3.953  -4.543  1.00 24.79 ? 1544 DT  D O2    1 
ATOM   582  N  N3    . DT  B 2 14 ? 23.825 -2.183  -4.606  1.00 22.25 ? 1544 DT  D N3    1 
ATOM   583  C  C4    . DT  B 2 14 ? 25.048 -1.552  -4.590  1.00 23.28 ? 1544 DT  D C4    1 
ATOM   584  O  O4    . DT  B 2 14 ? 25.125 -0.323  -4.522  1.00 22.76 ? 1544 DT  D O4    1 
ATOM   585  C  C5    . DT  B 2 14 ? 26.208 -2.412  -4.722  1.00 22.55 ? 1544 DT  D C5    1 
ATOM   586  C  C7    . DT  B 2 14 ? 27.547 -1.739  -4.713  1.00 33.84 ? 1544 DT  D C7    1 
ATOM   587  C  C6    . DT  B 2 14 ? 25.976 -3.729  -4.701  1.00 23.11 ? 1544 DT  D C6    1 
ATOM   588  P  P     . DG  B 2 15 ? 24.244 -9.564  -6.582  1.00 43.99 ? 1545 DG  D P     1 
ATOM   589  O  OP1   . DG  B 2 15 ? 23.895 -10.952 -6.181  1.00 70.56 ? 1545 DG  D OP1   1 
ATOM   590  O  OP2   . DG  B 2 15 ? 25.505 -9.446  -7.356  1.00 33.31 ? 1545 DG  D OP2   1 
ATOM   591  O  "O5'" . DG  B 2 15 ? 23.019 -8.812  -7.278  1.00 30.21 ? 1545 DG  D "O5'" 1 
ATOM   592  C  "C5'" . DG  B 2 15 ? 21.783 -8.672  -6.587  1.00 27.89 ? 1545 DG  D "C5'" 1 
ATOM   593  C  "C4'" . DG  B 2 15 ? 20.812 -7.873  -7.414  1.00 37.60 ? 1545 DG  D "C4'" 1 
ATOM   594  O  "O4'" . DG  B 2 15 ? 21.112 -6.459  -7.306  1.00 38.47 ? 1545 DG  D "O4'" 1 
ATOM   595  C  "C3'" . DG  B 2 15 ? 20.855 -8.184  -8.910  1.00 35.47 ? 1545 DG  D "C3'" 1 
ATOM   596  O  "O3'" . DG  B 2 15 ? 19.535 -8.106  -9.436  1.00 62.94 ? 1545 DG  D "O3'" 1 
ATOM   597  C  "C2'" . DG  B 2 15 ? 21.733 -7.078  -9.486  1.00 25.30 ? 1545 DG  D "C2'" 1 
ATOM   598  C  "C1'" . DG  B 2 15 ? 21.358 -5.898  -8.585  1.00 24.00 ? 1545 DG  D "C1'" 1 
ATOM   599  N  N9    . DG  B 2 15 ? 22.392 -4.899  -8.417  1.00 17.96 ? 1545 DG  D N9    1 
ATOM   600  C  C8    . DG  B 2 15 ? 23.748 -5.014  -8.392  1.00 21.97 ? 1545 DG  D C8    1 
ATOM   601  N  N7    . DG  B 2 15 ? 24.371 -3.871  -8.307  1.00 25.51 ? 1545 DG  D N7    1 
ATOM   602  C  C5    . DG  B 2 15 ? 23.351 -2.954  -8.121  1.00 19.30 ? 1545 DG  D C5    1 
ATOM   603  C  C6    . DG  B 2 15 ? 23.405 -1.549  -7.890  1.00 24.26 ? 1545 DG  D C6    1 
ATOM   604  O  O6    . DG  B 2 15 ? 24.414 -0.844  -7.791  1.00 27.67 ? 1545 DG  D O6    1 
ATOM   605  N  N1    . DG  B 2 15 ? 22.130 -1.013  -7.867  1.00 21.05 ? 1545 DG  D N1    1 
ATOM   606  C  C2    . DG  B 2 15 ? 20.961 -1.710  -7.993  1.00 17.27 ? 1545 DG  D C2    1 
ATOM   607  N  N2    . DG  B 2 15 ? 19.812 -1.027  -8.084  1.00 22.01 ? 1545 DG  D N2    1 
ATOM   608  N  N3    . DG  B 2 15 ? 20.894 -3.029  -8.164  1.00 22.06 ? 1545 DG  D N3    1 
ATOM   609  C  C4    . DG  B 2 15 ? 22.131 -3.562  -8.178  1.00 17.92 ? 1545 DG  D C4    1 
ATOM   610  N  N     . PRO C 3 6  ? 25.876 18.873  -1.488  1.00 38.02 ? 1134 PRO A N     1 
ATOM   611  C  CA    . PRO C 3 6  ? 25.506 18.450  -0.131  1.00 32.45 ? 1134 PRO A CA    1 
ATOM   612  C  C     . PRO C 3 6  ? 24.061 17.966  -0.091  1.00 28.02 ? 1134 PRO A C     1 
ATOM   613  O  O     . PRO C 3 6  ? 23.290 18.307  -0.987  1.00 30.24 ? 1134 PRO A O     1 
ATOM   614  C  CB    . PRO C 3 6  ? 25.638 19.732  0.695   1.00 33.18 ? 1134 PRO A CB    1 
ATOM   615  C  CG    . PRO C 3 6  ? 26.679 20.517  -0.053  1.00 39.98 ? 1134 PRO A CG    1 
ATOM   616  C  CD    . PRO C 3 6  ? 26.338 20.277  -1.503  1.00 40.61 ? 1134 PRO A CD    1 
ATOM   617  N  N     . CYS C 3 7  ? 23.739 17.201  0.939   1.00 21.03 ? 1135 CYS A N     1 
ATOM   618  C  CA    . CYS C 3 7  ? 22.396 16.668  1.146   1.00 17.62 ? 1135 CYS A CA    1 
ATOM   619  C  C     . CYS C 3 7  ? 21.371 17.787  1.232   1.00 16.75 ? 1135 CYS A C     1 
ATOM   620  O  O     . CYS C 3 7  ? 21.567 18.690  2.060   1.00 26.15 ? 1135 CYS A O     1 
ATOM   621  C  CB    . CYS C 3 7  ? 22.379 15.825  2.425   1.00 16.00 ? 1135 CYS A CB    1 
ATOM   622  S  SG    . CYS C 3 7  ? 20.738 15.180  2.878   1.00 16.26 ? 1135 CYS A SG    1 
ATOM   623  N  N     . PHE C 3 8  ? 20.295 17.796  0.461   1.00 16.57 ? 1136 PHE A N     1 
ATOM   624  C  CA    . PHE C 3 8  ? 19.312 18.877  0.539   1.00 20.14 ? 1136 PHE A CA    1 
ATOM   625  C  C     . PHE C 3 8  ? 18.608 18.951  1.885   1.00 27.59 ? 1136 PHE A C     1 
ATOM   626  O  O     . PHE C 3 8  ? 18.067 19.991  2.296   1.00 21.86 ? 1136 PHE A O     1 
ATOM   627  C  CB    . PHE C 3 8  ? 18.251 18.705  -0.546  1.00 24.73 ? 1136 PHE A CB    1 
ATOM   628  C  CG    . PHE C 3 8  ? 18.524 19.350  -1.887  1.00 40.80 ? 1136 PHE A CG    1 
ATOM   629  C  CD1   . PHE C 3 8  ? 17.507 19.426  -2.832  1.00 45.36 ? 1136 PHE A CD1   1 
ATOM   630  C  CD2   . PHE C 3 8  ? 19.761 19.876  -2.207  1.00 41.94 ? 1136 PHE A CD2   1 
ATOM   631  C  CE1   . PHE C 3 8  ? 17.718 20.000  -4.071  1.00 53.49 ? 1136 PHE A CE1   1 
ATOM   632  C  CE2   . PHE C 3 8  ? 19.980 20.462  -3.442  1.00 52.08 ? 1136 PHE A CE2   1 
ATOM   633  C  CZ    . PHE C 3 8  ? 18.959 20.531  -4.373  1.00 57.13 ? 1136 PHE A CZ    1 
ATOM   634  N  N     . VAL C 3 9  ? 18.571 17.827  2.601   1.00 27.19 ? 1137 VAL A N     1 
ATOM   635  C  CA    . VAL C 3 9  ? 17.867 17.816  3.888   1.00 21.76 ? 1137 VAL A CA    1 
ATOM   636  C  C     . VAL C 3 9  ? 18.765 18.295  5.025   1.00 23.34 ? 1137 VAL A C     1 
ATOM   637  O  O     . VAL C 3 9  ? 18.333 19.106  5.842   1.00 18.53 ? 1137 VAL A O     1 
ATOM   638  C  CB    . VAL C 3 9  ? 17.347 16.412  4.250   1.00 18.02 ? 1137 VAL A CB    1 
ATOM   639  C  CG1   . VAL C 3 9  ? 16.587 16.428  5.561   1.00 18.11 ? 1137 VAL A CG1   1 
ATOM   640  C  CG2   . VAL C 3 9  ? 16.474 15.904  3.106   1.00 20.93 ? 1137 VAL A CG2   1 
ATOM   641  N  N     . CYS C 3 10 ? 19.998 17.799  5.078   1.00 21.11 ? 1138 CYS A N     1 
ATOM   642  C  CA    . CYS C 3 10 ? 20.822 18.081  6.257   1.00 22.08 ? 1138 CYS A CA    1 
ATOM   643  C  C     . CYS C 3 10 ? 22.202 18.640  5.986   1.00 20.91 ? 1138 CYS A C     1 
ATOM   644  O  O     . CYS C 3 10 ? 22.957 18.958  6.911   1.00 18.54 ? 1138 CYS A O     1 
ATOM   645  C  CB    . CYS C 3 10 ? 20.913 16.746  7.040   1.00 20.49 ? 1138 CYS A CB    1 
ATOM   646  S  SG    . CYS C 3 10 ? 22.209 15.653  6.425   1.00 17.60 ? 1138 CYS A SG    1 
ATOM   647  N  N     . GLN C 3 11 ? 22.588 18.797  4.730   1.00 19.57 ? 1139 GLN A N     1 
ATOM   648  C  CA    . GLN C 3 11 ? 23.821 19.401  4.252   1.00 21.03 ? 1139 GLN A CA    1 
ATOM   649  C  C     . GLN C 3 11 ? 25.046 18.519  4.486   1.00 25.79 ? 1139 GLN A C     1 
ATOM   650  O  O     . GLN C 3 11 ? 26.191 18.886  4.175   1.00 20.91 ? 1139 GLN A O     1 
ATOM   651  C  CB    . GLN C 3 11 ? 23.989 20.796  4.860   1.00 20.65 ? 1139 GLN A CB    1 
ATOM   652  C  CG    . GLN C 3 11 ? 22.772 21.695  4.879   1.00 18.55 ? 1139 GLN A CG    1 
ATOM   653  C  CD    . GLN C 3 11 ? 22.053 21.861  3.554   1.00 27.44 ? 1139 GLN A CD    1 
ATOM   654  O  OE1   . GLN C 3 11 ? 20.818 21.894  3.507   1.00 39.71 ? 1139 GLN A OE1   1 
ATOM   655  N  NE2   . GLN C 3 11 ? 22.795 21.975  2.461   1.00 26.48 ? 1139 GLN A NE2   1 
ATOM   656  N  N     . ASP C 3 12 ? 24.859 17.300  5.007   1.00 21.95 ? 1140 ASP A N     1 
ATOM   657  C  CA    . ASP C 3 12 ? 25.972 16.337  5.050   1.00 17.35 ? 1140 ASP A CA    1 
ATOM   658  C  C     . ASP C 3 12 ? 26.404 15.966  3.642   1.00 23.38 ? 1140 ASP A C     1 
ATOM   659  O  O     . ASP C 3 12 ? 25.702 16.292  2.678   1.00 28.43 ? 1140 ASP A O     1 
ATOM   660  C  CB    . ASP C 3 12 ? 25.552 15.109  5.856   1.00 23.50 ? 1140 ASP A CB    1 
ATOM   661  C  CG    . ASP C 3 12 ? 26.681 14.180  6.231   1.00 33.64 ? 1140 ASP A CG    1 
ATOM   662  O  OD1   . ASP C 3 12 ? 26.367 13.106  6.799   1.00 31.11 ? 1140 ASP A OD1   1 
ATOM   663  O  OD2   . ASP C 3 12 ? 27.871 14.477  5.988   1.00 22.87 ? 1140 ASP A OD2   1 
ATOM   664  N  N     . LYS C 3 13 ? 27.539 15.298  3.484   1.00 23.80 ? 1141 LYS A N     1 
ATOM   665  C  CA    . LYS C 3 13 ? 27.973 14.863  2.160   1.00 19.24 ? 1141 LYS A CA    1 
ATOM   666  C  C     . LYS C 3 13 ? 26.923 13.945  1.549   1.00 24.70 ? 1141 LYS A C     1 
ATOM   667  O  O     . LYS C 3 13 ? 26.384 13.040  2.203   1.00 28.50 ? 1141 LYS A O     1 
ATOM   668  C  CB    . LYS C 3 13 ? 29.337 14.184  2.228   1.00 27.39 ? 1141 LYS A CB    1 
ATOM   669  N  N     . SER C 3 14 ? 26.622 14.190  0.280   1.00 20.11 ? 1142 SER A N     1 
ATOM   670  C  CA    . SER C 3 14 ? 25.644 13.421  -0.467  1.00 23.06 ? 1142 SER A CA    1 
ATOM   671  C  C     . SER C 3 14 ? 26.300 12.191  -1.076  1.00 19.07 ? 1142 SER A C     1 
ATOM   672  O  O     . SER C 3 14 ? 27.505 12.206  -1.299  1.00 24.52 ? 1142 SER A O     1 
ATOM   673  C  CB    . SER C 3 14 ? 25.018 14.262  -1.586  1.00 30.76 ? 1142 SER A CB    1 
ATOM   674  O  OG    . SER C 3 14 ? 24.285 13.448  -2.478  1.00 34.92 ? 1142 SER A OG    1 
ATOM   675  N  N     . SER C 3 15 ? 25.479 11.170  -1.327  1.00 24.26 ? 1143 SER A N     1 
ATOM   676  C  CA    . SER C 3 15 ? 25.990 9.970   -1.992  1.00 26.84 ? 1143 SER A CA    1 
ATOM   677  C  C     . SER C 3 15 ? 25.341 9.818   -3.369  1.00 27.71 ? 1143 SER A C     1 
ATOM   678  O  O     . SER C 3 15 ? 25.452 8.780   -4.015  1.00 25.18 ? 1143 SER A O     1 
ATOM   679  C  CB    . SER C 3 15 ? 25.773 8.710   -1.169  1.00 28.32 ? 1143 SER A CB    1 
ATOM   680  O  OG    . SER C 3 15 ? 24.418 8.397   -0.942  1.00 21.17 ? 1143 SER A OG    1 
ATOM   681  N  N     . GLY C 3 16 ? 24.674 10.878  -3.802  1.00 28.40 ? 1144 GLY A N     1 
ATOM   682  C  CA    . GLY C 3 16 ? 23.992 10.959  -5.073  1.00 31.37 ? 1144 GLY A CA    1 
ATOM   683  C  C     . GLY C 3 16 ? 22.515 11.261  -4.892  1.00 32.64 ? 1144 GLY A C     1 
ATOM   684  O  O     . GLY C 3 16 ? 22.056 11.552  -3.788  1.00 28.71 ? 1144 GLY A O     1 
ATOM   685  N  N     . TYR C 3 17 ? 21.749 11.194  -5.979  1.00 23.04 ? 1145 TYR A N     1 
ATOM   686  C  CA    . TYR C 3 17 ? 20.316 11.415  -5.890  1.00 17.49 ? 1145 TYR A CA    1 
ATOM   687  C  C     . TYR C 3 17 ? 19.606 10.191  -5.326  1.00 21.48 ? 1145 TYR A C     1 
ATOM   688  O  O     . TYR C 3 17 ? 19.900 9.034   -5.643  1.00 21.89 ? 1145 TYR A O     1 
ATOM   689  C  CB    . TYR C 3 17 ? 19.744 11.782  -7.268  1.00 27.06 ? 1145 TYR A CB    1 
ATOM   690  C  CG    . TYR C 3 17 ? 19.733 13.289  -7.465  1.00 40.31 ? 1145 TYR A CG    1 
ATOM   691  C  CD1   . TYR C 3 17 ? 20.920 14.009  -7.482  1.00 40.95 ? 1145 TYR A CD1   1 
ATOM   692  C  CD2   . TYR C 3 17 ? 18.537 13.973  -7.621  1.00 45.23 ? 1145 TYR A CD2   1 
ATOM   693  C  CE1   . TYR C 3 17 ? 20.920 15.381  -7.655  1.00 41.95 ? 1145 TYR A CE1   1 
ATOM   694  C  CE2   . TYR C 3 17 ? 18.525 15.346  -7.796  1.00 49.49 ? 1145 TYR A CE2   1 
ATOM   695  C  CZ    . TYR C 3 17 ? 19.717 16.037  -7.810  1.00 50.50 ? 1145 TYR A CZ    1 
ATOM   696  O  OH    . TYR C 3 17 ? 19.705 17.404  -7.981  1.00 65.33 ? 1145 TYR A OH    1 
ATOM   697  N  N     . HIS C 3 18 ? 18.682 10.454  -4.418  1.00 17.29 ? 1146 HIS A N     1 
ATOM   698  C  CA    . HIS C 3 18 ? 17.847 9.491   -3.728  1.00 15.60 ? 1146 HIS A CA    1 
ATOM   699  C  C     . HIS C 3 18 ? 16.460 10.107  -3.553  1.00 18.82 ? 1146 HIS A C     1 
ATOM   700  O  O     . HIS C 3 18 ? 16.351 11.149  -2.919  1.00 20.72 ? 1146 HIS A O     1 
ATOM   701  C  CB    . HIS C 3 18 ? 18.380 9.051   -2.346  1.00 16.35 ? 1146 HIS A CB    1 
ATOM   702  C  CG    . HIS C 3 18 ? 19.813 8.644   -2.442  1.00 21.02 ? 1146 HIS A CG    1 
ATOM   703  N  ND1   . HIS C 3 18 ? 20.833 9.417   -1.956  1.00 22.42 ? 1146 HIS A ND1   1 
ATOM   704  C  CD2   . HIS C 3 18 ? 20.405 7.588   -3.048  1.00 13.71 ? 1146 HIS A CD2   1 
ATOM   705  C  CE1   . HIS C 3 18 ? 21.982 8.832   -2.224  1.00 18.40 ? 1146 HIS A CE1   1 
ATOM   706  N  NE2   . HIS C 3 18 ? 21.754 7.706   -2.879  1.00 16.37 ? 1146 HIS A NE2   1 
ATOM   707  N  N     . TYR C 3 19 ? 15.468 9.441   -4.128  1.00 18.64 ? 1147 TYR A N     1 
ATOM   708  C  CA    . TYR C 3 19 ? 14.072 9.762   -4.089  1.00 16.35 ? 1147 TYR A CA    1 
ATOM   709  C  C     . TYR C 3 19 ? 13.849 11.179  -4.628  1.00 16.83 ? 1147 TYR A C     1 
ATOM   710  O  O     . TYR C 3 19 ? 12.931 11.854  -4.206  1.00 20.43 ? 1147 TYR A O     1 
ATOM   711  C  CB    . TYR C 3 19 ? 13.563 9.585   -2.658  1.00 19.57 ? 1147 TYR A CB    1 
ATOM   712  C  CG    . TYR C 3 19 ? 13.994 8.236   -2.105  1.00 18.68 ? 1147 TYR A CG    1 
ATOM   713  C  CD1   . TYR C 3 19 ? 13.388 7.061   -2.537  1.00 20.06 ? 1147 TYR A CD1   1 
ATOM   714  C  CD2   . TYR C 3 19 ? 14.999 8.142   -1.164  1.00 23.74 ? 1147 TYR A CD2   1 
ATOM   715  C  CE1   . TYR C 3 19 ? 13.768 5.824   -2.045  1.00 24.62 ? 1147 TYR A CE1   1 
ATOM   716  C  CE2   . TYR C 3 19 ? 15.388 6.916   -0.658  1.00 24.98 ? 1147 TYR A CE2   1 
ATOM   717  C  CZ    . TYR C 3 19 ? 14.771 5.762   -1.095  1.00 23.26 ? 1147 TYR A CZ    1 
ATOM   718  O  OH    . TYR C 3 19 ? 15.186 4.550   -0.580  1.00 20.98 ? 1147 TYR A OH    1 
ATOM   719  N  N     . GLY C 3 20 ? 14.710 11.576  -5.558  1.00 26.46 ? 1148 GLY A N     1 
ATOM   720  C  CA    . GLY C 3 20 ? 14.513 12.806  -6.309  1.00 28.64 ? 1148 GLY A CA    1 
ATOM   721  C  C     . GLY C 3 20 ? 15.399 13.959  -5.900  1.00 34.60 ? 1148 GLY A C     1 
ATOM   722  O  O     . GLY C 3 20 ? 15.352 15.031  -6.512  1.00 38.98 ? 1148 GLY A O     1 
ATOM   723  N  N     . VAL C 3 21 ? 16.218 13.804  -4.861  1.00 20.74 ? 1149 VAL A N     1 
ATOM   724  C  CA    . VAL C 3 21 ? 17.092 14.880  -4.424  1.00 18.23 ? 1149 VAL A CA    1 
ATOM   725  C  C     . VAL C 3 21 ? 18.476 14.360  -4.073  1.00 16.70 ? 1149 VAL A C     1 
ATOM   726  O  O     . VAL C 3 21 ? 18.668 13.200  -3.732  1.00 23.65 ? 1149 VAL A O     1 
ATOM   727  C  CB    . VAL C 3 21 ? 16.561 15.667  -3.205  1.00 23.38 ? 1149 VAL A CB    1 
ATOM   728  C  CG1   . VAL C 3 21 ? 15.143 16.159  -3.457  1.00 34.82 ? 1149 VAL A CG1   1 
ATOM   729  C  CG2   . VAL C 3 21 ? 16.616 14.825  -1.941  1.00 20.10 ? 1149 VAL A CG2   1 
ATOM   730  N  N     . SER C 3 22 ? 19.448 15.267  -4.165  1.00 19.14 ? 1150 SER A N     1 
ATOM   731  C  CA    . SER C 3 22 ? 20.766 14.961  -3.635  1.00 17.13 ? 1150 SER A CA    1 
ATOM   732  C  C     . SER C 3 22 ? 20.643 14.694  -2.135  1.00 19.28 ? 1150 SER A C     1 
ATOM   733  O  O     . SER C 3 22 ? 20.105 15.561  -1.443  1.00 19.68 ? 1150 SER A O     1 
ATOM   734  C  CB    . SER C 3 22 ? 21.737 16.110  -3.896  1.00 24.90 ? 1150 SER A CB    1 
ATOM   735  O  OG    . SER C 3 22 ? 23.056 15.709  -3.524  1.00 31.71 ? 1150 SER A OG    1 
ATOM   736  N  N     . ALA C 3 23 ? 21.109 13.541  -1.655  1.00 22.66 ? 1151 ALA A N     1 
ATOM   737  C  CA    . ALA C 3 23 ? 20.920 13.190  -0.242  1.00 16.21 ? 1151 ALA A CA    1 
ATOM   738  C  C     . ALA C 3 23 ? 22.035 12.334  0.320   1.00 17.63 ? 1151 ALA A C     1 
ATOM   739  O  O     . ALA C 3 23 ? 22.710 11.546  -0.366  1.00 17.98 ? 1151 ALA A O     1 
ATOM   740  C  CB    . ALA C 3 23 ? 19.575 12.482  -0.111  1.00 17.38 ? 1151 ALA A CB    1 
ATOM   741  N  N     . CYS C 3 24 ? 22.269 12.469  1.626   1.00 16.24 ? 1152 CYS A N     1 
ATOM   742  C  CA    . CYS C 3 24 ? 23.243 11.584  2.270   1.00 18.42 ? 1152 CYS A CA    1 
ATOM   743  C  C     . CYS C 3 24 ? 22.633 10.210  2.557   1.00 13.48 ? 1152 CYS A C     1 
ATOM   744  O  O     . CYS C 3 24 ? 21.422 10.063  2.516   1.00 16.16 ? 1152 CYS A O     1 
ATOM   745  C  CB    . CYS C 3 24 ? 23.753 12.163  3.593   1.00 19.45 ? 1152 CYS A CB    1 
ATOM   746  S  SG    . CYS C 3 24 ? 22.473 12.313  4.867   1.00 15.81 ? 1152 CYS A SG    1 
ATOM   747  N  N     . GLU C 3 25 ? 23.508 9.252   2.853   1.00 15.53 ? 1153 GLU A N     1 
ATOM   748  C  CA    . GLU C 3 25 ? 23.033 7.895   3.148   1.00 17.22 ? 1153 GLU A CA    1 
ATOM   749  C  C     . GLU C 3 25 ? 22.089 7.865   4.330   1.00 19.94 ? 1153 GLU A C     1 
ATOM   750  O  O     . GLU C 3 25 ? 21.120 7.096   4.295   1.00 13.80 ? 1153 GLU A O     1 
ATOM   751  C  CB    . GLU C 3 25 ? 24.228 6.954   3.317   1.00 14.23 ? 1153 GLU A CB    1 
ATOM   752  C  CG    . GLU C 3 25 ? 24.913 6.657   1.987   1.00 17.68 ? 1153 GLU A CG    1 
ATOM   753  C  CD    . GLU C 3 25 ? 24.012 5.904   1.024   1.00 28.37 ? 1153 GLU A CD    1 
ATOM   754  O  OE1   . GLU C 3 25 ? 23.945 6.238   -0.188  1.00 21.29 ? 1153 GLU A OE1   1 
ATOM   755  O  OE2   . GLU C 3 25 ? 23.347 4.951   1.482   1.00 18.22 ? 1153 GLU A OE2   1 
ATOM   756  N  N     . GLY C 3 26 ? 22.290 8.690   5.358   1.00 17.84 ? 1154 GLY A N     1 
ATOM   757  C  CA    . GLY C 3 26 ? 21.336 8.755   6.452   1.00 14.27 ? 1154 GLY A CA    1 
ATOM   758  C  C     . GLY C 3 26 ? 19.946 9.225   6.131   1.00 13.43 ? 1154 GLY A C     1 
ATOM   759  O  O     . GLY C 3 26 ? 18.957 8.646   6.550   1.00 12.53 ? 1154 GLY A O     1 
ATOM   760  N  N     . CYS C 3 27 ? 19.816 10.319  5.363   1.00 13.95 ? 1155 CYS A N     1 
ATOM   761  C  CA    . CYS C 3 27 ? 18.509 10.849  5.042   1.00 12.21 ? 1155 CYS A CA    1 
ATOM   762  C  C     . CYS C 3 27 ? 17.839 9.897   4.051   1.00 15.17 ? 1155 CYS A C     1 
ATOM   763  O  O     . CYS C 3 27 ? 16.639 9.664   4.142   1.00 14.87 ? 1155 CYS A O     1 
ATOM   764  C  CB    . CYS C 3 27 ? 18.656 12.292  4.539   1.00 16.72 ? 1155 CYS A CB    1 
ATOM   765  S  SG    . CYS C 3 27 ? 19.177 13.499  5.815   1.00 16.54 ? 1155 CYS A SG    1 
ATOM   766  N  N     . LYS C 3 28 ? 18.635 9.338   3.140   1.00 13.47 ? 1156 LYS A N     1 
ATOM   767  C  CA    . LYS C 3 28 ? 18.148 8.280   2.237   1.00 9.95  ? 1156 LYS A CA    1 
ATOM   768  C  C     . LYS C 3 28 ? 17.528 7.125   3.004   1.00 16.51 ? 1156 LYS A C     1 
ATOM   769  O  O     . LYS C 3 28 ? 16.375 6.720   2.812   1.00 14.79 ? 1156 LYS A O     1 
ATOM   770  C  CB    . LYS C 3 28 ? 19.324 7.812   1.383   1.00 14.29 ? 1156 LYS A CB    1 
ATOM   771  C  CG    . LYS C 3 28 ? 19.049 6.502   0.649   1.00 12.64 ? 1156 LYS A CG    1 
ATOM   772  C  CD    . LYS C 3 28 ? 20.294 5.926   0.046   1.00 16.52 ? 1156 LYS A CD    1 
ATOM   773  C  CE    . LYS C 3 28 ? 20.253 4.438   -0.235  1.00 15.86 ? 1156 LYS A CE    1 
ATOM   774  N  NZ    . LYS C 3 28 ? 21.631 3.939   -0.536  1.00 18.56 ? 1156 LYS A NZ    1 
ATOM   775  N  N     . GLY C 3 29 ? 18.282 6.547   3.940   1.00 16.70 ? 1157 GLY A N     1 
ATOM   776  C  CA    . GLY C 3 29 ? 17.787 5.409   4.717   1.00 13.40 ? 1157 GLY A CA    1 
ATOM   777  C  C     . GLY C 3 29 ? 16.617 5.743   5.583   1.00 9.14  ? 1157 GLY A C     1 
ATOM   778  O  O     . GLY C 3 29 ? 15.621 5.018   5.723   1.00 14.24 ? 1157 GLY A O     1 
ATOM   779  N  N     . PHE C 3 30 ? 16.668 6.922   6.230   1.00 13.85 ? 1158 PHE A N     1 
ATOM   780  C  CA    . PHE C 3 30 ? 15.592 7.379   7.078   1.00 13.06 ? 1158 PHE A CA    1 
ATOM   781  C  C     . PHE C 3 30 ? 14.274 7.528   6.338   1.00 15.48 ? 1158 PHE A C     1 
ATOM   782  O  O     . PHE C 3 30 ? 13.214 7.084   6.774   1.00 14.54 ? 1158 PHE A O     1 
ATOM   783  C  CB    . PHE C 3 30 ? 16.003 8.727   7.699   1.00 15.92 ? 1158 PHE A CB    1 
ATOM   784  C  CG    . PHE C 3 30 ? 14.878 9.404   8.454   1.00 14.27 ? 1158 PHE A CG    1 
ATOM   785  C  CD1   . PHE C 3 30 ? 14.549 9.001   9.732   1.00 14.23 ? 1158 PHE A CD1   1 
ATOM   786  C  CD2   . PHE C 3 30 ? 14.154 10.436  7.891   1.00 14.85 ? 1158 PHE A CD2   1 
ATOM   787  C  CE1   . PHE C 3 30 ? 13.517 9.592   10.433  1.00 16.10 ? 1158 PHE A CE1   1 
ATOM   788  C  CE2   . PHE C 3 30 ? 13.137 11.044  8.575   1.00 15.16 ? 1158 PHE A CE2   1 
ATOM   789  C  CZ    . PHE C 3 30 ? 12.822 10.649  9.863   1.00 17.01 ? 1158 PHE A CZ    1 
ATOM   790  N  N     . PHE C 3 31 ? 14.347 8.196   5.185   1.00 13.94 ? 1159 PHE A N     1 
ATOM   791  C  CA    . PHE C 3 31 ? 13.165 8.338   4.343   1.00 12.86 ? 1159 PHE A CA    1 
ATOM   792  C  C     . PHE C 3 31 ? 12.564 6.990   3.926   1.00 10.61 ? 1159 PHE A C     1 
ATOM   793  O  O     . PHE C 3 31 ? 11.360 6.793   4.109   1.00 14.48 ? 1159 PHE A O     1 
ATOM   794  C  CB    . PHE C 3 31 ? 13.504 9.171   3.095   1.00 12.19 ? 1159 PHE A CB    1 
ATOM   795  C  CG    . PHE C 3 31 ? 12.253 9.583   2.332   1.00 16.59 ? 1159 PHE A CG    1 
ATOM   796  C  CD1   . PHE C 3 31 ? 11.929 8.929   1.155   1.00 23.54 ? 1159 PHE A CD1   1 
ATOM   797  C  CD2   . PHE C 3 31 ? 11.429 10.586  2.797   1.00 15.73 ? 1159 PHE A CD2   1 
ATOM   798  C  CE1   . PHE C 3 31 ? 10.787 9.298   0.465   1.00 22.57 ? 1159 PHE A CE1   1 
ATOM   799  C  CE2   . PHE C 3 31 ? 10.292 10.965  2.109   1.00 27.93 ? 1159 PHE A CE2   1 
ATOM   800  C  CZ    . PHE C 3 31 ? 9.976  10.309  0.930   1.00 27.28 ? 1159 PHE A CZ    1 
ATOM   801  N  N     . ARG C 3 32 ? 13.399 6.123   3.369   1.00 12.97 ? 1160 ARG A N     1 
ATOM   802  C  CA    . ARG C 3 32 ? 12.982 4.791   2.962   1.00 11.41 ? 1160 ARG A CA    1 
ATOM   803  C  C     . ARG C 3 32 ? 12.267 4.063   4.092   1.00 11.58 ? 1160 ARG A C     1 
ATOM   804  O  O     . ARG C 3 32 ? 11.170 3.546   3.952   1.00 13.82 ? 1160 ARG A O     1 
ATOM   805  C  CB    . ARG C 3 32 ? 14.197 3.971   2.514   1.00 19.85 ? 1160 ARG A CB    1 
ATOM   806  C  CG    . ARG C 3 32 ? 13.837 2.543   2.147   1.00 26.96 ? 1160 ARG A CG    1 
ATOM   807  C  CD    . ARG C 3 32 ? 15.013 1.751   1.611   1.00 25.77 ? 1160 ARG A CD    1 
ATOM   808  N  NE    . ARG C 3 32 ? 16.178 1.732   2.482   1.00 34.11 ? 1160 ARG A NE    1 
ATOM   809  C  CZ    . ARG C 3 32 ? 16.259 1.178   3.684   1.00 40.52 ? 1160 ARG A CZ    1 
ATOM   810  N  NH1   . ARG C 3 32 ? 15.225 0.557   4.234   1.00 29.67 ? 1160 ARG A NH1   1 
ATOM   811  N  NH2   . ARG C 3 32 ? 17.407 1.243   4.362   1.00 70.78 ? 1160 ARG A NH2   1 
ATOM   812  N  N     . ARG C 3 33 ? 12.902 4.029   5.276   1.00 12.56 ? 1161 ARG A N     1 
ATOM   813  C  CA    . ARG C 3 33 ? 12.251 3.352   6.394   1.00 13.32 ? 1161 ARG A CA    1 
ATOM   814  C  C     . ARG C 3 33 ? 10.926 3.997   6.756   1.00 18.69 ? 1161 ARG A C     1 
ATOM   815  O  O     . ARG C 3 33 ? 9.954  3.324   7.078   1.00 17.41 ? 1161 ARG A O     1 
ATOM   816  C  CB    . ARG C 3 33 ? 13.149 3.371   7.637   1.00 14.11 ? 1161 ARG A CB    1 
ATOM   817  C  CG    . ARG C 3 33 ? 14.366 2.476   7.586   1.00 17.20 ? 1161 ARG A CG    1 
ATOM   818  C  CD    . ARG C 3 33 ? 14.978 2.339   8.970   1.00 14.81 ? 1161 ARG A CD    1 
ATOM   819  N  NE    . ARG C 3 33 ? 15.700 3.506   9.415   1.00 13.89 ? 1161 ARG A NE    1 
ATOM   820  C  CZ    . ARG C 3 33 ? 16.851 4.027   9.070   1.00 13.84 ? 1161 ARG A CZ    1 
ATOM   821  N  NH1   . ARG C 3 33 ? 17.659 3.536   8.140   1.00 17.13 ? 1161 ARG A NH1   1 
ATOM   822  N  NH2   . ARG C 3 33 ? 17.243 5.141   9.705   1.00 19.76 ? 1161 ARG A NH2   1 
ATOM   823  N  N     . SER C 3 34 ? 10.907 5.331   6.752   1.00 14.17 ? 1162 SER A N     1 
ATOM   824  C  CA    . SER C 3 34 ? 9.711  6.048   7.185   1.00 11.83 ? 1162 SER A CA    1 
ATOM   825  C  C     . SER C 3 34 ? 8.524  5.666   6.300   1.00 14.76 ? 1162 SER A C     1 
ATOM   826  O  O     . SER C 3 34 ? 7.393  5.473   6.753   1.00 19.72 ? 1162 SER A O     1 
ATOM   827  C  CB    . SER C 3 34 ? 9.943  7.551   7.169   1.00 20.92 ? 1162 SER A CB    1 
ATOM   828  O  OG    . SER C 3 34 ? 11.034 7.922   8.005   1.00 23.33 ? 1162 SER A OG    1 
ATOM   829  N  N     . ILE C 3 35 ? 8.810  5.545   5.013   1.00 14.98 ? 1163 ILE A N     1 
ATOM   830  C  CA    . ILE C 3 35 ? 7.753  5.255   4.051   1.00 14.25 ? 1163 ILE A CA    1 
ATOM   831  C  C     . ILE C 3 35 ? 7.373  3.780   4.040   1.00 16.42 ? 1163 ILE A C     1 
ATOM   832  O  O     . ILE C 3 35 ? 6.197  3.423   4.116   1.00 18.91 ? 1163 ILE A O     1 
ATOM   833  C  CB    . ILE C 3 35 ? 8.192  5.676   2.632   1.00 17.87 ? 1163 ILE A CB    1 
ATOM   834  C  CG1   . ILE C 3 35 ? 8.490  7.175   2.520   1.00 13.72 ? 1163 ILE A CG1   1 
ATOM   835  C  CG2   . ILE C 3 35 ? 7.143  5.248   1.616   1.00 27.01 ? 1163 ILE A CG2   1 
ATOM   836  C  CD1   . ILE C 3 35 ? 7.292  8.011   2.921   1.00 22.15 ? 1163 ILE A CD1   1 
ATOM   837  N  N     . GLN C 3 36 ? 8.391  2.927   3.933   1.00 17.95 ? 1164 GLN A N     1 
ATOM   838  C  CA    . GLN C 3 36 ? 8.159  1.489   3.909   1.00 15.35 ? 1164 GLN A CA    1 
ATOM   839  C  C     . GLN C 3 36 ? 7.310  1.053   5.100   1.00 21.63 ? 1164 GLN A C     1 
ATOM   840  O  O     . GLN C 3 36 ? 6.423  0.210   4.959   1.00 23.13 ? 1164 GLN A O     1 
ATOM   841  C  CB    . GLN C 3 36 ? 9.458  0.692   3.906   1.00 20.15 ? 1164 GLN A CB    1 
ATOM   842  C  CG    . GLN C 3 36 ? 10.296 0.768   2.634   1.00 26.04 ? 1164 GLN A CG    1 
ATOM   843  C  CD    . GLN C 3 36 ? 11.549 -0.086  2.791   1.00 25.00 ? 1164 GLN A CD    1 
ATOM   844  O  OE1   . GLN C 3 36 ? 12.210 0.014   3.828   1.00 26.84 ? 1164 GLN A OE1   1 
ATOM   845  N  NE2   . GLN C 3 36 ? 11.853 -0.889  1.790   1.00 29.06 ? 1164 GLN A NE2   1 
ATOM   846  N  N     . LYS C 3 37 ? 7.578  1.632   6.271   1.00 21.11 ? 1165 LYS A N     1 
ATOM   847  C  CA    . LYS C 3 37 ? 6.845  1.240   7.471   1.00 18.23 ? 1165 LYS A CA    1 
ATOM   848  C  C     . LYS C 3 37 ? 5.736  2.201   7.880   1.00 22.05 ? 1165 LYS A C     1 
ATOM   849  O  O     . LYS C 3 37 ? 5.147  2.063   8.959   1.00 30.21 ? 1165 LYS A O     1 
ATOM   850  C  CB    . LYS C 3 37 ? 7.840  1.069   8.621   1.00 23.69 ? 1165 LYS A CB    1 
ATOM   851  C  CG    . LYS C 3 37 ? 9.186  0.454   8.307   1.00 29.37 ? 1165 LYS A CG    1 
ATOM   852  C  CD    . LYS C 3 37 ? 10.343 1.245   8.906   1.00 34.36 ? 1165 LYS A CD    1 
ATOM   853  C  CE    . LYS C 3 37 ? 10.751 0.726   10.263  1.00 39.10 ? 1165 LYS A CE    1 
ATOM   854  N  NZ    . LYS C 3 37 ? 12.069 0.045   10.246  1.00 44.97 ? 1165 LYS A NZ    1 
ATOM   855  N  N     . ASN C 3 38 ? 5.391  3.171   7.045   1.00 19.76 ? 1166 ASN A N     1 
ATOM   856  C  CA    . ASN C 3 38 ? 4.333  4.129   7.338   1.00 22.44 ? 1166 ASN A CA    1 
ATOM   857  C  C     . ASN C 3 38 ? 4.496  4.768   8.712   1.00 25.90 ? 1166 ASN A C     1 
ATOM   858  O  O     . ASN C 3 38 ? 3.532  4.924   9.456   1.00 31.03 ? 1166 ASN A O     1 
ATOM   859  C  CB    . ASN C 3 38 ? 2.968  3.441   7.229   1.00 30.06 ? 1166 ASN A CB    1 
ATOM   860  C  CG    . ASN C 3 38 ? 2.787  2.667   5.934   1.00 34.86 ? 1166 ASN A CG    1 
ATOM   861  O  OD1   . ASN C 3 38 ? 2.685  1.440   5.935   1.00 55.40 ? 1166 ASN A OD1   1 
ATOM   862  N  ND2   . ASN C 3 38 ? 2.752  3.363   4.803   1.00 42.59 ? 1166 ASN A ND2   1 
ATOM   863  N  N     . MET C 3 39 ? 5.727  5.124   9.067   1.00 27.01 ? 1167 MET A N     1 
ATOM   864  C  CA    . MET C 3 39 ? 5.990  5.725   10.365  1.00 23.53 ? 1167 MET A CA    1 
ATOM   865  C  C     . MET C 3 39 ? 5.220  7.026   10.559  1.00 24.13 ? 1167 MET A C     1 
ATOM   866  O  O     . MET C 3 39 ? 5.042  7.850   9.663   1.00 36.46 ? 1167 MET A O     1 
ATOM   867  C  CB    . MET C 3 39 ? 7.479  6.030   10.536  1.00 21.73 ? 1167 MET A CB    1 
ATOM   868  C  CG    . MET C 3 39 ? 8.391  4.818   10.456  1.00 19.82 ? 1167 MET A CG    1 
ATOM   869  S  SD    . MET C 3 39 ? 7.914  3.558   11.669  1.00 32.20 ? 1167 MET A SD    1 
ATOM   870  C  CE    . MET C 3 39 ? 7.524  4.587   13.085  1.00 40.05 ? 1167 MET A CE    1 
ATOM   871  N  N     . VAL C 3 40 ? 4.758  7.234   11.783  1.00 21.60 ? 1168 VAL A N     1 
ATOM   872  C  CA    . VAL C 3 40 ? 4.097  8.497   12.112  1.00 26.82 ? 1168 VAL A CA    1 
ATOM   873  C  C     . VAL C 3 40 ? 4.872  9.118   13.263  1.00 29.11 ? 1168 VAL A C     1 
ATOM   874  O  O     . VAL C 3 40 ? 5.050  8.508   14.317  1.00 27.24 ? 1168 VAL A O     1 
ATOM   875  C  CB    . VAL C 3 40 ? 2.629  8.290   12.443  1.00 48.52 ? 1168 VAL A CB    1 
ATOM   876  N  N     . TYR C 3 41 ? 5.378  10.337  13.060  1.00 24.97 ? 1169 TYR A N     1 
ATOM   877  C  CA    . TYR C 3 41 ? 6.209  10.885  14.133  1.00 23.75 ? 1169 TYR A CA    1 
ATOM   878  C  C     . TYR C 3 41 ? 5.510  12.079  14.776  1.00 21.51 ? 1169 TYR A C     1 
ATOM   879  O  O     . TYR C 3 41 ? 4.593  12.627  14.183  1.00 21.84 ? 1169 TYR A O     1 
ATOM   880  C  CB    . TYR C 3 41 ? 7.577  11.292  13.600  1.00 19.67 ? 1169 TYR A CB    1 
ATOM   881  C  CG    . TYR C 3 41 ? 8.376  10.231  12.890  1.00 22.52 ? 1169 TYR A CG    1 
ATOM   882  C  CD1   . TYR C 3 41 ? 8.682  10.358  11.536  1.00 20.13 ? 1169 TYR A CD1   1 
ATOM   883  C  CD2   . TYR C 3 41 ? 8.847  9.101   13.550  1.00 24.52 ? 1169 TYR A CD2   1 
ATOM   884  C  CE1   . TYR C 3 41 ? 9.417  9.396   10.873  1.00 18.31 ? 1169 TYR A CE1   1 
ATOM   885  C  CE2   . TYR C 3 41 ? 9.586  8.136   12.882  1.00 19.88 ? 1169 TYR A CE2   1 
ATOM   886  C  CZ    . TYR C 3 41 ? 9.870  8.280   11.541  1.00 22.03 ? 1169 TYR A CZ    1 
ATOM   887  O  OH    . TYR C 3 41 ? 10.611 7.330   10.861  1.00 18.99 ? 1169 TYR A OH    1 
ATOM   888  N  N     . THR C 3 42 ? 5.992  12.457  15.952  1.00 24.72 ? 1170 THR A N     1 
ATOM   889  C  CA    . THR C 3 42 ? 5.499  13.666  16.603  1.00 24.76 ? 1170 THR A CA    1 
ATOM   890  C  C     . THR C 3 42 ? 6.625  14.593  17.034  1.00 29.94 ? 1170 THR A C     1 
ATOM   891  O  O     . THR C 3 42 ? 7.721  14.158  17.425  1.00 24.89 ? 1170 THR A O     1 
ATOM   892  C  CB    . THR C 3 42 ? 4.649  13.272  17.828  1.00 26.21 ? 1170 THR A CB    1 
ATOM   893  O  OG1   . THR C 3 42 ? 3.457  12.643  17.338  1.00 44.66 ? 1170 THR A OG1   1 
ATOM   894  C  CG2   . THR C 3 42 ? 4.227  14.487  18.634  1.00 45.59 ? 1170 THR A CG2   1 
ATOM   895  N  N     . CYS C 3 43 ? 6.345  15.895  16.953  1.00 28.71 ? 1171 CYS A N     1 
ATOM   896  C  CA    . CYS C 3 43 ? 7.320  16.897  17.367  1.00 30.22 ? 1171 CYS A CA    1 
ATOM   897  C  C     . CYS C 3 43 ? 7.009  17.375  18.794  1.00 25.21 ? 1171 CYS A C     1 
ATOM   898  O  O     . CYS C 3 43 ? 5.900  17.801  19.073  1.00 33.20 ? 1171 CYS A O     1 
ATOM   899  C  CB    . CYS C 3 43 ? 7.376  18.125  16.461  1.00 22.84 ? 1171 CYS A CB    1 
ATOM   900  S  SG    . CYS C 3 43 ? 8.743  19.258  16.834  1.00 25.67 ? 1171 CYS A SG    1 
ATOM   901  N  N     . HIS C 3 44 ? 8.023  17.277  19.631  1.00 37.57 ? 1172 HIS A N     1 
ATOM   902  C  CA    . HIS C 3 44 ? 7.953  17.625  21.043  1.00 44.93 ? 1172 HIS A CA    1 
ATOM   903  C  C     . HIS C 3 44 ? 8.222  19.108  21.269  1.00 45.48 ? 1172 HIS A C     1 
ATOM   904  O  O     . HIS C 3 44 ? 8.143  19.596  22.396  1.00 38.13 ? 1172 HIS A O     1 
ATOM   905  C  CB    . HIS C 3 44 ? 8.964  16.785  21.812  1.00 45.80 ? 1172 HIS A CB    1 
ATOM   906  N  N     . ARG C 3 45 ? 8.553  19.809  20.188  1.00 45.31 ? 1173 ARG A N     1 
ATOM   907  C  CA    . ARG C 3 45 ? 8.870  21.236  20.268  1.00 47.09 ? 1173 ARG A CA    1 
ATOM   908  C  C     . ARG C 3 45 ? 7.898  22.020  19.400  1.00 37.67 ? 1173 ARG A C     1 
ATOM   909  O  O     . ARG C 3 45 ? 6.692  21.973  19.671  1.00 33.02 ? 1173 ARG A O     1 
ATOM   910  C  CB    . ARG C 3 45 ? 10.325 21.474  19.901  1.00 55.46 ? 1173 ARG A CB    1 
ATOM   911  N  N     . ASP C 3 46 ? 8.343  22.732  18.364  1.00 33.94 ? 1174 ASP A N     1 
ATOM   912  C  CA    . ASP C 3 46 ? 7.379  23.548  17.619  1.00 38.07 ? 1174 ASP A CA    1 
ATOM   913  C  C     . ASP C 3 46 ? 7.224  23.199  16.149  1.00 30.69 ? 1174 ASP A C     1 
ATOM   914  O  O     . ASP C 3 46 ? 6.801  24.044  15.356  1.00 25.35 ? 1174 ASP A O     1 
ATOM   915  C  CB    . ASP C 3 46 ? 7.804  25.023  17.725  1.00 52.59 ? 1174 ASP A CB    1 
ATOM   916  C  CG    . ASP C 3 46 ? 7.315  25.627  19.031  1.00 57.94 ? 1174 ASP A CG    1 
ATOM   917  O  OD1   . ASP C 3 46 ? 8.161  26.204  19.746  1.00 67.30 ? 1174 ASP A OD1   1 
ATOM   918  O  OD2   . ASP C 3 46 ? 6.101  25.510  19.302  1.00 50.73 ? 1174 ASP A OD2   1 
ATOM   919  N  N     . LYS C 3 47 ? 7.564  21.975  15.766  1.00 26.26 ? 1175 LYS A N     1 
ATOM   920  C  CA    . LYS C 3 47 ? 7.484  21.557  14.375  1.00 25.48 ? 1175 LYS A CA    1 
ATOM   921  C  C     . LYS C 3 47 ? 8.305  22.479  13.477  1.00 23.54 ? 1175 LYS A C     1 
ATOM   922  O  O     . LYS C 3 47 ? 7.942  22.646  12.314  1.00 27.09 ? 1175 LYS A O     1 
ATOM   923  C  CB    . LYS C 3 47 ? 6.021  21.490  13.923  1.00 27.99 ? 1175 LYS A CB    1 
ATOM   924  C  CG    . LYS C 3 47 ? 5.286  20.287  14.501  1.00 28.11 ? 1175 LYS A CG    1 
ATOM   925  C  CD    . LYS C 3 47 ? 3.893  20.149  13.919  1.00 37.72 ? 1175 LYS A CD    1 
ATOM   926  C  CE    . LYS C 3 47 ? 2.812  20.553  14.904  1.00 44.67 ? 1175 LYS A CE    1 
ATOM   927  N  NZ    . LYS C 3 47 ? 2.747  19.662  16.093  1.00 48.48 ? 1175 LYS A NZ    1 
ATOM   928  N  N     . ASN C 3 48 ? 9.375  23.037  14.027  1.00 18.52 ? 1176 ASN A N     1 
ATOM   929  C  CA    . ASN C 3 48 ? 10.309 23.913  13.346  1.00 34.78 ? 1176 ASN A CA    1 
ATOM   930  C  C     . ASN C 3 48 ? 11.764 23.611  13.675  1.00 36.62 ? 1176 ASN A C     1 
ATOM   931  O  O     . ASN C 3 48 ? 12.666 24.448  13.583  1.00 24.18 ? 1176 ASN A O     1 
ATOM   932  C  CB    . ASN C 3 48 ? 10.034 25.380  13.703  1.00 44.33 ? 1176 ASN A CB    1 
ATOM   933  C  CG    . ASN C 3 48 ? 10.038 26.233  12.452  1.00 47.71 ? 1176 ASN A CG    1 
ATOM   934  O  OD1   . ASN C 3 48 ? 10.886 27.112  12.301  1.00 45.68 ? 1176 ASN A OD1   1 
ATOM   935  N  ND2   . ASN C 3 48 ? 9.086  25.967  11.561  1.00 57.65 ? 1176 ASN A ND2   1 
ATOM   936  N  N     . CYS C 3 49 ? 12.007 22.365  14.064  1.00 32.71 ? 1177 CYS A N     1 
ATOM   937  C  CA    . CYS C 3 49 ? 13.336 21.961  14.492  1.00 27.82 ? 1177 CYS A CA    1 
ATOM   938  C  C     . CYS C 3 49 ? 14.407 22.099  13.426  1.00 19.66 ? 1177 CYS A C     1 
ATOM   939  O  O     . CYS C 3 49 ? 14.254 21.784  12.253  1.00 24.45 ? 1177 CYS A O     1 
ATOM   940  C  CB    . CYS C 3 49 ? 13.258 20.503  14.973  1.00 25.43 ? 1177 CYS A CB    1 
ATOM   941  S  SG    . CYS C 3 49 ? 12.273 20.301  16.473  1.00 24.72 ? 1177 CYS A SG    1 
ATOM   942  N  N     . ILE C 3 50 ? 15.570 22.586  13.849  1.00 21.06 ? 1178 ILE A N     1 
ATOM   943  C  CA    . ILE C 3 50 ? 16.705 22.671  12.943  1.00 21.58 ? 1178 ILE A CA    1 
ATOM   944  C  C     . ILE C 3 50 ? 17.210 21.279  12.582  1.00 29.43 ? 1178 ILE A C     1 
ATOM   945  O  O     . ILE C 3 50 ? 17.397 20.426  13.448  1.00 18.65 ? 1178 ILE A O     1 
ATOM   946  C  CB    . ILE C 3 50 ? 17.840 23.503  13.562  1.00 23.12 ? 1178 ILE A CB    1 
ATOM   947  C  CG1   . ILE C 3 50 ? 17.381 24.910  13.940  1.00 32.00 ? 1178 ILE A CG1   1 
ATOM   948  C  CG2   . ILE C 3 50 ? 19.043 23.508  12.646  1.00 27.01 ? 1178 ILE A CG2   1 
ATOM   949  C  CD1   . ILE C 3 50 ? 18.018 26.039  13.176  1.00 47.28 ? 1178 ILE A CD1   1 
ATOM   950  N  N     . ILE C 3 51 ? 17.414 21.085  11.282  1.00 18.07 ? 1179 ILE A N     1 
ATOM   951  C  CA    . ILE C 3 51 ? 17.874 19.810  10.750  1.00 18.41 ? 1179 ILE A CA    1 
ATOM   952  C  C     . ILE C 3 51 ? 19.140 20.055  9.942   1.00 20.41 ? 1179 ILE A C     1 
ATOM   953  O  O     . ILE C 3 51 ? 19.072 20.594  8.830   1.00 17.69 ? 1179 ILE A O     1 
ATOM   954  C  CB    . ILE C 3 51 ? 16.857 19.088  9.843   1.00 16.04 ? 1179 ILE A CB    1 
ATOM   955  C  CG1   . ILE C 3 51 ? 15.489 18.844  10.459  1.00 20.21 ? 1179 ILE A CG1   1 
ATOM   956  C  CG2   . ILE C 3 51 ? 17.473 17.789  9.314   1.00 19.56 ? 1179 ILE A CG2   1 
ATOM   957  C  CD1   . ILE C 3 51 ? 15.456 18.098  11.771  1.00 24.43 ? 1179 ILE A CD1   1 
ATOM   958  N  N     . ASN C 3 52 ? 20.259 19.656  10.536  1.00 13.91 ? 1180 ASN A N     1 
ATOM   959  C  CA    . ASN C 3 52 ? 21.534 19.681  9.828   1.00 20.20 ? 1180 ASN A CA    1 
ATOM   960  C  C     . ASN C 3 52 ? 22.341 18.432  10.180  1.00 13.44 ? 1180 ASN A C     1 
ATOM   961  O  O     . ASN C 3 52 ? 21.839 17.500  10.814  1.00 21.50 ? 1180 ASN A O     1 
ATOM   962  C  CB    . ASN C 3 52 ? 22.291 20.983  10.081  1.00 26.26 ? 1180 ASN A CB    1 
ATOM   963  C  CG    . ASN C 3 52 ? 22.686 21.165  11.529  1.00 27.57 ? 1180 ASN A CG    1 
ATOM   964  O  OD1   . ASN C 3 52 ? 23.058 20.213  12.207  1.00 21.55 ? 1180 ASN A OD1   1 
ATOM   965  N  ND2   . ASN C 3 52 ? 22.593 22.399  12.025  1.00 25.81 ? 1180 ASN A ND2   1 
ATOM   966  N  N     . LYS C 3 53 ? 23.585 18.391  9.741   1.00 16.65 ? 1181 LYS A N     1 
ATOM   967  C  CA    . LYS C 3 53 ? 24.343 17.153  9.877   1.00 20.45 ? 1181 LYS A CA    1 
ATOM   968  C  C     . LYS C 3 53 ? 24.479 16.737  11.333  1.00 24.80 ? 1181 LYS A C     1 
ATOM   969  O  O     . LYS C 3 53 ? 24.531 15.541  11.637  1.00 24.52 ? 1181 LYS A O     1 
ATOM   970  C  CB    . LYS C 3 53 ? 25.712 17.337  9.216   1.00 22.90 ? 1181 LYS A CB    1 
ATOM   971  C  CG    . LYS C 3 53 ? 26.633 16.150  9.406   1.00 21.46 ? 1181 LYS A CG    1 
ATOM   972  C  CD    . LYS C 3 53 ? 27.859 16.243  8.518   1.00 30.66 ? 1181 LYS A CD    1 
ATOM   973  C  CE    . LYS C 3 53 ? 28.708 14.989  8.701   1.00 35.43 ? 1181 LYS A CE    1 
ATOM   974  N  NZ    . LYS C 3 53 ? 30.037 15.151  8.040   1.00 32.19 ? 1181 LYS A NZ    1 
ATOM   975  N  N     . VAL C 3 54 ? 24.532 17.709  12.245  1.00 21.37 ? 1182 VAL A N     1 
ATOM   976  C  CA    . VAL C 3 54 ? 24.734 17.338  13.650  1.00 20.31 ? 1182 VAL A CA    1 
ATOM   977  C  C     . VAL C 3 54 ? 23.468 17.293  14.473  1.00 22.66 ? 1182 VAL A C     1 
ATOM   978  O  O     . VAL C 3 54 ? 23.461 16.875  15.635  1.00 27.24 ? 1182 VAL A O     1 
ATOM   979  C  CB    . VAL C 3 54 ? 25.721 18.329  14.319  1.00 26.30 ? 1182 VAL A CB    1 
ATOM   980  C  CG1   . VAL C 3 54 ? 27.064 18.228  13.635  1.00 27.14 ? 1182 VAL A CG1   1 
ATOM   981  C  CG2   . VAL C 3 54 ? 25.149 19.740  14.287  1.00 31.79 ? 1182 VAL A CG2   1 
ATOM   982  N  N     . THR C 3 55 ? 22.332 17.719  13.937  1.00 19.69 ? 1183 THR A N     1 
ATOM   983  C  CA    . THR C 3 55 ? 21.100 17.723  14.713  1.00 17.42 ? 1183 THR A CA    1 
ATOM   984  C  C     . THR C 3 55 ? 20.009 16.833  14.135  1.00 13.29 ? 1183 THR A C     1 
ATOM   985  O  O     . THR C 3 55 ? 18.935 16.693  14.707  1.00 19.48 ? 1183 THR A O     1 
ATOM   986  C  CB    . THR C 3 55 ? 20.484 19.137  14.814  1.00 19.92 ? 1183 THR A CB    1 
ATOM   987  O  OG1   . THR C 3 55 ? 19.881 19.455  13.551  1.00 22.52 ? 1183 THR A OG1   1 
ATOM   988  C  CG2   . THR C 3 55 ? 21.521 20.220  15.083  1.00 20.38 ? 1183 THR A CG2   1 
ATOM   989  N  N     . ARG C 3 56 ? 20.231 16.213  12.978  1.00 14.10 ? 1184 ARG A N     1 
ATOM   990  C  CA    . ARG C 3 56 ? 19.119 15.540  12.288  1.00 13.53 ? 1184 ARG A CA    1 
ATOM   991  C  C     . ARG C 3 56 ? 18.405 14.473  13.091  1.00 16.99 ? 1184 ARG A C     1 
ATOM   992  O  O     . ARG C 3 56 ? 17.234 14.162  12.873  1.00 17.38 ? 1184 ARG A O     1 
ATOM   993  C  CB    . ARG C 3 56 ? 19.635 14.946  10.961  1.00 13.07 ? 1184 ARG A CB    1 
ATOM   994  C  CG    . ARG C 3 56 ? 20.807 14.006  11.065  1.00 12.79 ? 1184 ARG A CG    1 
ATOM   995  C  CD    . ARG C 3 56 ? 21.532 13.723  9.769   1.00 10.88 ? 1184 ARG A CD    1 
ATOM   996  N  NE    . ARG C 3 56 ? 22.532 12.678  9.895   1.00 12.24 ? 1184 ARG A NE    1 
ATOM   997  C  CZ    . ARG C 3 56 ? 23.633 12.514  9.203   1.00 21.11 ? 1184 ARG A CZ    1 
ATOM   998  N  NH1   . ARG C 3 56 ? 23.954 13.361  8.231   1.00 18.24 ? 1184 ARG A NH1   1 
ATOM   999  N  NH2   . ARG C 3 56 ? 24.430 11.489  9.483   1.00 23.94 ? 1184 ARG A NH2   1 
ATOM   1000 N  N     . ASN C 3 57 ? 19.073 13.861  14.064  1.00 16.29 ? 1185 ASN A N     1 
ATOM   1001 C  CA    . ASN C 3 57 ? 18.405 12.778  14.781  1.00 13.92 ? 1185 ASN A CA    1 
ATOM   1002 C  C     . ASN C 3 57 ? 17.629 13.250  15.991  1.00 18.16 ? 1185 ASN A C     1 
ATOM   1003 O  O     . ASN C 3 57 ? 16.964 12.446  16.643  1.00 21.60 ? 1185 ASN A O     1 
ATOM   1004 C  CB    . ASN C 3 57 ? 19.467 11.747  15.191  1.00 11.76 ? 1185 ASN A CB    1 
ATOM   1005 C  CG    . ASN C 3 57 ? 19.958 10.898  14.025  1.00 15.06 ? 1185 ASN A CG    1 
ATOM   1006 O  OD1   . ASN C 3 57 ? 19.170 10.502  13.157  1.00 17.17 ? 1185 ASN A OD1   1 
ATOM   1007 N  ND2   . ASN C 3 57 ? 21.250 10.618  14.053  1.00 20.43 ? 1185 ASN A ND2   1 
ATOM   1008 N  N     . ARG C 3 58 ? 17.676 14.548  16.282  1.00 19.85 ? 1186 ARG A N     1 
ATOM   1009 C  CA    . ARG C 3 58 ? 16.931 15.062  17.427  1.00 22.11 ? 1186 ARG A CA    1 
ATOM   1010 C  C     . ARG C 3 58 ? 15.424 15.107  17.236  1.00 22.54 ? 1186 ARG A C     1 
ATOM   1011 O  O     . ARG C 3 58 ? 14.688 15.143  18.231  1.00 26.08 ? 1186 ARG A O     1 
ATOM   1012 C  CB    . ARG C 3 58 ? 17.429 16.469  17.765  1.00 26.35 ? 1186 ARG A CB    1 
ATOM   1013 N  N     . CYS C 3 59 ? 14.930 15.101  16.001  1.00 15.63 ? 1187 CYS A N     1 
ATOM   1014 C  CA    . CYS C 3 59 ? 13.489 15.112  15.761  1.00 21.18 ? 1187 CYS A CA    1 
ATOM   1015 C  C     . CYS C 3 59 ? 13.126 14.450  14.430  1.00 17.87 ? 1187 CYS A C     1 
ATOM   1016 O  O     . CYS C 3 59 ? 13.358 15.004  13.359  1.00 16.27 ? 1187 CYS A O     1 
ATOM   1017 C  CB    . CYS C 3 59 ? 12.929 16.536  15.774  1.00 22.11 ? 1187 CYS A CB    1 
ATOM   1018 S  SG    . CYS C 3 59 ? 11.151 16.653  15.507  1.00 20.12 ? 1187 CYS A SG    1 
ATOM   1019 N  N     . GLN C 3 60 ? 12.558 13.253  14.528  1.00 15.53 ? 1188 GLN A N     1 
ATOM   1020 C  CA    . GLN C 3 60 ? 12.173 12.475  13.360  1.00 17.52 ? 1188 GLN A CA    1 
ATOM   1021 C  C     . GLN C 3 60 ? 11.037 13.157  12.604  1.00 21.19 ? 1188 GLN A C     1 
ATOM   1022 O  O     . GLN C 3 60 ? 11.015 13.138  11.376  1.00 18.52 ? 1188 GLN A O     1 
ATOM   1023 C  CB    . GLN C 3 60 ? 11.741 11.068  13.791  1.00 19.32 ? 1188 GLN A CB    1 
ATOM   1024 C  CG    . GLN C 3 60 ? 12.860 10.309  14.508  1.00 19.26 ? 1188 GLN A CG    1 
ATOM   1025 C  CD    . GLN C 3 60 ? 12.406 8.953   14.996  1.00 15.09 ? 1188 GLN A CD    1 
ATOM   1026 O  OE1   . GLN C 3 60 ? 11.443 8.837   15.746  1.00 20.54 ? 1188 GLN A OE1   1 
ATOM   1027 N  NE2   . GLN C 3 60 ? 13.094 7.910   14.562  1.00 20.92 ? 1188 GLN A NE2   1 
ATOM   1028 N  N     . TYR C 3 61 ? 10.095 13.755  13.330  1.00 14.92 ? 1189 TYR A N     1 
ATOM   1029 C  CA    . TYR C 3 61 ? 9.010  14.478  12.681  1.00 16.64 ? 1189 TYR A CA    1 
ATOM   1030 C  C     . TYR C 3 61 ? 9.542  15.541  11.731  1.00 21.67 ? 1189 TYR A C     1 
ATOM   1031 O  O     . TYR C 3 61 ? 9.188  15.625  10.557  1.00 24.07 ? 1189 TYR A O     1 
ATOM   1032 C  CB    . TYR C 3 61 ? 8.076  15.151  13.701  1.00 18.26 ? 1189 TYR A CB    1 
ATOM   1033 C  CG    . TYR C 3 61 ? 6.950  15.917  13.035  1.00 23.59 ? 1189 TYR A CG    1 
ATOM   1034 C  CD1   . TYR C 3 61 ? 5.820  15.250  12.576  1.00 33.06 ? 1189 TYR A CD1   1 
ATOM   1035 C  CD2   . TYR C 3 61 ? 7.003  17.297  12.858  1.00 26.50 ? 1189 TYR A CD2   1 
ATOM   1036 C  CE1   . TYR C 3 61 ? 4.783  15.931  11.965  1.00 34.46 ? 1189 TYR A CE1   1 
ATOM   1037 C  CE2   . TYR C 3 61 ? 5.971  17.983  12.244  1.00 26.00 ? 1189 TYR A CE2   1 
ATOM   1038 C  CZ    . TYR C 3 61 ? 4.866  17.292  11.801  1.00 29.99 ? 1189 TYR A CZ    1 
ATOM   1039 O  OH    . TYR C 3 61 ? 3.843  17.987  11.195  1.00 35.78 ? 1189 TYR A OH    1 
ATOM   1040 N  N     . CYS C 3 62 ? 10.401 16.400  12.285  1.00 20.15 ? 1190 CYS A N     1 
ATOM   1041 C  CA    . CYS C 3 62 ? 10.899 17.514  11.478  1.00 22.23 ? 1190 CYS A CA    1 
ATOM   1042 C  C     . CYS C 3 62 ? 11.840 17.008  10.406  1.00 16.23 ? 1190 CYS A C     1 
ATOM   1043 O  O     . CYS C 3 62 ? 11.918 17.583  9.311   1.00 23.26 ? 1190 CYS A O     1 
ATOM   1044 C  CB    . CYS C 3 62 ? 11.542 18.560  12.390  1.00 21.60 ? 1190 CYS A CB    1 
ATOM   1045 S  SG    . CYS C 3 62 ? 10.319 19.537  13.313  1.00 23.57 ? 1190 CYS A SG    1 
ATOM   1046 N  N     . ARG C 3 63 ? 12.569 15.912  10.662  1.00 13.89 ? 1191 ARG A N     1 
ATOM   1047 C  CA    . ARG C 3 63 ? 13.457 15.400  9.626   1.00 11.24 ? 1191 ARG A CA    1 
ATOM   1048 C  C     . ARG C 3 63 ? 12.648 14.948  8.401   1.00 11.95 ? 1191 ARG A C     1 
ATOM   1049 O  O     . ARG C 3 63 ? 13.026 15.230  7.265   1.00 18.58 ? 1191 ARG A O     1 
ATOM   1050 C  CB    . ARG C 3 63 ? 14.326 14.239  10.106  1.00 12.90 ? 1191 ARG A CB    1 
ATOM   1051 C  CG    . ARG C 3 63 ? 15.499 13.953  9.157   1.00 12.32 ? 1191 ARG A CG    1 
ATOM   1052 C  CD    . ARG C 3 63 ? 16.210 12.676  9.610   1.00 13.85 ? 1191 ARG A CD    1 
ATOM   1053 N  NE    . ARG C 3 63 ? 17.429 12.398  8.905   1.00 14.51 ? 1191 ARG A NE    1 
ATOM   1054 C  CZ    . ARG C 3 63 ? 18.386 11.530  9.231   1.00 12.17 ? 1191 ARG A CZ    1 
ATOM   1055 N  NH1   . ARG C 3 63 ? 18.258 10.793  10.340  1.00 17.04 ? 1191 ARG A NH1   1 
ATOM   1056 N  NH2   . ARG C 3 63 ? 19.456 11.395  8.479   1.00 11.61 ? 1191 ARG A NH2   1 
ATOM   1057 N  N     . LEU C 3 64 ? 11.575 14.228  8.683   1.00 13.83 ? 1192 LEU A N     1 
ATOM   1058 C  CA    . LEU C 3 64 ? 10.745 13.700  7.605   1.00 18.31 ? 1192 LEU A CA    1 
ATOM   1059 C  C     . LEU C 3 64 ? 10.115 14.871  6.853   1.00 21.65 ? 1192 LEU A C     1 
ATOM   1060 O  O     . LEU C 3 64 ? 10.144 14.941  5.630   1.00 18.77 ? 1192 LEU A O     1 
ATOM   1061 C  CB    . LEU C 3 64 ? 9.659  12.761  8.136   1.00 16.24 ? 1192 LEU A CB    1 
ATOM   1062 C  CG    . LEU C 3 64 ? 8.807  12.049  7.076   1.00 24.22 ? 1192 LEU A CG    1 
ATOM   1063 C  CD1   . LEU C 3 64 ? 9.684  11.289  6.086   1.00 20.87 ? 1192 LEU A CD1   1 
ATOM   1064 C  CD2   . LEU C 3 64 ? 7.787  11.114  7.707   1.00 16.10 ? 1192 LEU A CD2   1 
ATOM   1065 N  N     . GLN C 3 65 ? 9.552  15.771  7.653   1.00 22.39 ? 1193 GLN A N     1 
ATOM   1066 C  CA    . GLN C 3 65 ? 8.919  16.972  7.103   1.00 22.89 ? 1193 GLN A CA    1 
ATOM   1067 C  C     . GLN C 3 65 ? 9.873  17.686  6.168   1.00 22.78 ? 1193 GLN A C     1 
ATOM   1068 O  O     . GLN C 3 65 ? 9.498  18.096  5.061   1.00 24.76 ? 1193 GLN A O     1 
ATOM   1069 C  CB    . GLN C 3 65 ? 8.454  17.844  8.269   1.00 29.50 ? 1193 GLN A CB    1 
ATOM   1070 C  CG    . GLN C 3 65 ? 7.639  19.073  7.908   1.00 41.13 ? 1193 GLN A CG    1 
ATOM   1071 C  CD    . GLN C 3 65 ? 7.499  20.007  9.103   1.00 50.75 ? 1193 GLN A CD    1 
ATOM   1072 O  OE1   . GLN C 3 65 ? 8.505  20.439  9.680   1.00 39.28 ? 1193 GLN A OE1   1 
ATOM   1073 N  NE2   . GLN C 3 65 ? 6.254  20.311  9.464   1.00 35.91 ? 1193 GLN A NE2   1 
ATOM   1074 N  N     . LYS C 3 66 ? 11.140 17.846  6.558   1.00 15.46 ? 1194 LYS A N     1 
ATOM   1075 C  CA    . LYS C 3 66 ? 12.074 18.485  5.638   1.00 14.66 ? 1194 LYS A CA    1 
ATOM   1076 C  C     . LYS C 3 66 ? 12.329 17.594  4.418   1.00 26.05 ? 1194 LYS A C     1 
ATOM   1077 O  O     . LYS C 3 66 ? 12.558 18.104  3.305   1.00 21.93 ? 1194 LYS A O     1 
ATOM   1078 C  CB    . LYS C 3 66 ? 13.365 18.864  6.349   1.00 15.86 ? 1194 LYS A CB    1 
ATOM   1079 C  CG    . LYS C 3 66 ? 14.376 19.604  5.498   1.00 22.13 ? 1194 LYS A CG    1 
ATOM   1080 C  CD    . LYS C 3 66 ? 15.179 20.627  6.260   1.00 26.97 ? 1194 LYS A CD    1 
ATOM   1081 C  CE    . LYS C 3 66 ? 16.070 21.474  5.361   1.00 30.76 ? 1194 LYS A CE    1 
ATOM   1082 N  NZ    . LYS C 3 66 ? 17.306 21.878  6.091   1.00 26.78 ? 1194 LYS A NZ    1 
ATOM   1083 N  N     . CYS C 3 67 ? 12.309 16.268  4.582   1.00 25.33 ? 1195 CYS A N     1 
ATOM   1084 C  CA    . CYS C 3 67 ? 12.563 15.396  3.429   1.00 19.98 ? 1195 CYS A CA    1 
ATOM   1085 C  C     . CYS C 3 67 ? 11.554 15.691  2.307   1.00 19.94 ? 1195 CYS A C     1 
ATOM   1086 O  O     . CYS C 3 67 ? 11.881 15.796  1.127   1.00 24.03 ? 1195 CYS A O     1 
ATOM   1087 C  CB    . CYS C 3 67 ? 12.462 13.920  3.789   1.00 18.61 ? 1195 CYS A CB    1 
ATOM   1088 S  SG    . CYS C 3 67 ? 13.907 13.216  4.637   1.00 19.76 ? 1195 CYS A SG    1 
ATOM   1089 N  N     . PHE C 3 68 ? 10.302 15.807  2.712   1.00 19.78 ? 1196 PHE A N     1 
ATOM   1090 C  CA    . PHE C 3 68 ? 9.253  16.110  1.745   1.00 27.10 ? 1196 PHE A CA    1 
ATOM   1091 C  C     . PHE C 3 68 ? 9.423  17.528  1.210   1.00 27.20 ? 1196 PHE A C     1 
ATOM   1092 O  O     . PHE C 3 68 ? 9.359  17.755  -0.001  1.00 23.92 ? 1196 PHE A O     1 
ATOM   1093 C  CB    . PHE C 3 68 ? 7.885  15.927  2.370   1.00 21.63 ? 1196 PHE A CB    1 
ATOM   1094 C  CG    . PHE C 3 68 ? 7.416  14.513  2.621   1.00 25.83 ? 1196 PHE A CG    1 
ATOM   1095 C  CD1   . PHE C 3 68 ? 7.295  13.608  1.582   1.00 21.50 ? 1196 PHE A CD1   1 
ATOM   1096 C  CD2   . PHE C 3 68 ? 7.086  14.105  3.903   1.00 27.80 ? 1196 PHE A CD2   1 
ATOM   1097 C  CE1   . PHE C 3 68 ? 6.845  12.325  1.816   1.00 27.03 ? 1196 PHE A CE1   1 
ATOM   1098 C  CE2   . PHE C 3 68 ? 6.642  12.819  4.150   1.00 26.63 ? 1196 PHE A CE2   1 
ATOM   1099 C  CZ    . PHE C 3 68 ? 6.527  11.927  3.100   1.00 30.08 ? 1196 PHE A CZ    1 
ATOM   1100 N  N     . GLU C 3 69 ? 9.635  18.483  2.107   1.00 27.86 ? 1197 GLU A N     1 
ATOM   1101 C  CA    . GLU C 3 69 ? 9.741  19.886  1.724   1.00 28.37 ? 1197 GLU A CA    1 
ATOM   1102 C  C     . GLU C 3 69 ? 10.744 20.132  0.613   1.00 21.97 ? 1197 GLU A C     1 
ATOM   1103 O  O     . GLU C 3 69 ? 10.508 20.924  -0.308  1.00 23.43 ? 1197 GLU A O     1 
ATOM   1104 C  CB    . GLU C 3 69 ? 10.136 20.734  2.933   1.00 32.93 ? 1197 GLU A CB    1 
ATOM   1105 N  N     . VAL C 3 70 ? 11.888 19.468  0.695   1.00 18.99 ? 1198 VAL A N     1 
ATOM   1106 C  CA    . VAL C 3 70 ? 12.978 19.667  -0.239  1.00 20.50 ? 1198 VAL A CA    1 
ATOM   1107 C  C     . VAL C 3 70 ? 12.729 18.864  -1.521  1.00 18.39 ? 1198 VAL A C     1 
ATOM   1108 O  O     . VAL C 3 70 ? 13.467 19.020  -2.485  1.00 20.02 ? 1198 VAL A O     1 
ATOM   1109 C  CB    . VAL C 3 70 ? 14.373 19.295  0.301   1.00 29.30 ? 1198 VAL A CB    1 
ATOM   1110 C  CG1   . VAL C 3 70 ? 14.889 20.394  1.230   1.00 33.82 ? 1198 VAL A CG1   1 
ATOM   1111 C  CG2   . VAL C 3 70 ? 14.386 17.956  1.019   1.00 25.14 ? 1198 VAL A CG2   1 
ATOM   1112 N  N     . GLY C 3 71 ? 11.699 18.033  -1.483  1.00 21.13 ? 1199 GLY A N     1 
ATOM   1113 C  CA    . GLY C 3 71 ? 11.269 17.338  -2.672  1.00 33.67 ? 1199 GLY A CA    1 
ATOM   1114 C  C     . GLY C 3 71 ? 11.493 15.852  -2.712  1.00 36.81 ? 1199 GLY A C     1 
ATOM   1115 O  O     . GLY C 3 71 ? 11.475 15.258  -3.800  1.00 25.86 ? 1199 GLY A O     1 
ATOM   1116 N  N     . MET C 3 72 ? 11.698 15.191  -1.568  1.00 28.00 ? 1200 MET A N     1 
ATOM   1117 C  CA    . MET C 3 72 ? 11.781 13.732  -1.656  1.00 25.99 ? 1200 MET A CA    1 
ATOM   1118 C  C     . MET C 3 72 ? 10.417 13.147  -1.981  1.00 17.25 ? 1200 MET A C     1 
ATOM   1119 O  O     . MET C 3 72 ? 9.389  13.625  -1.526  1.00 23.50 ? 1200 MET A O     1 
ATOM   1120 C  CB    . MET C 3 72 ? 12.334 13.131  -0.364  1.00 21.30 ? 1200 MET A CB    1 
ATOM   1121 C  CG    . MET C 3 72 ? 13.856 13.159  -0.364  1.00 19.68 ? 1200 MET A CG    1 
ATOM   1122 S  SD    . MET C 3 72 ? 14.474 12.305  1.092   1.00 28.07 ? 1200 MET A SD    1 
ATOM   1123 C  CE    . MET C 3 72 ? 16.237 12.408  0.889   1.00 26.49 ? 1200 MET A CE    1 
ATOM   1124 N  N     . SER C 3 73 ? 10.420 12.107  -2.819  1.00 23.57 ? 1201 SER A N     1 
ATOM   1125 C  CA    . SER C 3 73 ? 9.165  11.578  -3.346  1.00 19.66 ? 1201 SER A CA    1 
ATOM   1126 C  C     . SER C 3 73 ? 8.815  10.214  -2.782  1.00 17.86 ? 1201 SER A C     1 
ATOM   1127 O  O     . SER C 3 73 ? 9.520  9.227   -3.025  1.00 23.07 ? 1201 SER A O     1 
ATOM   1128 C  CB    . SER C 3 73 ? 9.296  11.482  -4.878  1.00 27.92 ? 1201 SER A CB    1 
ATOM   1129 O  OG    . SER C 3 73 ? 8.225  10.709  -5.383  1.00 34.08 ? 1201 SER A OG    1 
ATOM   1130 N  N     . LYS C 3 74 ? 7.748  10.094  -2.024  1.00 18.16 ? 1202 LYS A N     1 
ATOM   1131 C  CA    . LYS C 3 74 ? 7.426  8.784   -1.446  1.00 18.41 ? 1202 LYS A CA    1 
ATOM   1132 C  C     . LYS C 3 74 ? 7.026  7.784   -2.519  1.00 23.19 ? 1202 LYS A C     1 
ATOM   1133 O  O     . LYS C 3 74 ? 7.059  6.569   -2.330  1.00 20.17 ? 1202 LYS A O     1 
ATOM   1134 C  CB    . LYS C 3 74 ? 6.353  8.996   -0.390  1.00 24.46 ? 1202 LYS A CB    1 
ATOM   1135 C  CG    . LYS C 3 74 ? 4.970  9.308   -0.935  1.00 27.82 ? 1202 LYS A CG    1 
ATOM   1136 C  CD    . LYS C 3 74 ? 3.928  8.928   0.114   1.00 40.14 ? 1202 LYS A CD    1 
ATOM   1137 C  CE    . LYS C 3 74 ? 2.973  10.085  0.353   1.00 49.24 ? 1202 LYS A CE    1 
ATOM   1138 N  NZ    . LYS C 3 74 ? 2.195  10.410  -0.881  1.00 69.54 ? 1202 LYS A NZ    1 
ATOM   1139 N  N     . GLU C 3 75 ? 6.665  8.290   -3.697  1.00 25.21 ? 1203 GLU A N     1 
ATOM   1140 C  CA    . GLU C 3 75 ? 6.304  7.434   -4.826  1.00 19.85 ? 1203 GLU A CA    1 
ATOM   1141 C  C     . GLU C 3 75 ? 7.513  6.759   -5.442  1.00 20.83 ? 1203 GLU A C     1 
ATOM   1142 O  O     . GLU C 3 75 ? 7.381  5.907   -6.332  1.00 23.45 ? 1203 GLU A O     1 
ATOM   1143 C  CB    . GLU C 3 75 ? 5.553  8.283   -5.861  1.00 22.11 ? 1203 GLU A CB    1 
ATOM   1144 C  CG    . GLU C 3 75 ? 4.120  8.612   -5.488  1.00 26.09 ? 1203 GLU A CG    1 
ATOM   1145 C  CD    . GLU C 3 75 ? 4.023  9.829   -4.589  1.00 27.08 ? 1203 GLU A CD    1 
ATOM   1146 O  OE1   . GLU C 3 75 ? 4.940  10.678  -4.622  1.00 25.71 ? 1203 GLU A OE1   1 
ATOM   1147 O  OE2   . GLU C 3 75 ? 3.033  9.932   -3.840  1.00 28.87 ? 1203 GLU A OE2   1 
ATOM   1148 N  N     . SER C 3 76 ? 8.736  7.083   -5.035  1.00 16.30 ? 1204 SER A N     1 
ATOM   1149 C  CA    . SER C 3 76 ? 9.916  6.374   -5.527  1.00 16.27 ? 1204 SER A CA    1 
ATOM   1150 C  C     . SER C 3 76 ? 10.339 5.276   -4.538  1.00 21.25 ? 1204 SER A C     1 
ATOM   1151 O  O     . SER C 3 76 ? 11.317 4.564   -4.794  1.00 19.76 ? 1204 SER A O     1 
ATOM   1152 C  CB    . SER C 3 76 ? 11.074 7.333   -5.800  1.00 29.00 ? 1204 SER A CB    1 
ATOM   1153 O  OG    . SER C 3 76 ? 10.774 8.243   -6.847  1.00 33.20 ? 1204 SER A OG    1 
ATOM   1154 N  N     . VAL C 3 77 ? 9.601  5.149   -3.441  1.00 19.32 ? 1205 VAL A N     1 
ATOM   1155 C  CA    . VAL C 3 77 ? 9.703  4.031   -2.503  1.00 17.77 ? 1205 VAL A CA    1 
ATOM   1156 C  C     . VAL C 3 77 ? 8.814  2.916   -3.036  1.00 17.76 ? 1205 VAL A C     1 
ATOM   1157 O  O     . VAL C 3 77 ? 7.596  3.043   -3.092  1.00 20.87 ? 1205 VAL A O     1 
ATOM   1158 C  CB    . VAL C 3 77 ? 9.330  4.410   -1.066  1.00 20.97 ? 1205 VAL A CB    1 
ATOM   1159 C  CG1   . VAL C 3 77 ? 9.462  3.221   -0.123  1.00 23.67 ? 1205 VAL A CG1   1 
ATOM   1160 C  CG2   . VAL C 3 77 ? 10.195 5.558   -0.557  1.00 23.92 ? 1205 VAL A CG2   1 
ATOM   1161 N  N     . ARG C 3 78 ? 9.439  1.826   -3.479  1.00 18.07 ? 1206 ARG A N     1 
ATOM   1162 C  CA    . ARG C 3 78 ? 8.695  0.745   -4.123  1.00 17.06 ? 1206 ARG A CA    1 
ATOM   1163 C  C     . ARG C 3 78 ? 7.905  -0.104  -3.135  1.00 22.27 ? 1206 ARG A C     1 
ATOM   1164 O  O     . ARG C 3 78 ? 8.320  -0.359  -1.999  1.00 23.74 ? 1206 ARG A O     1 
ATOM   1165 C  CB    . ARG C 3 78 ? 9.680  -0.125  -4.914  1.00 18.71 ? 1206 ARG A CB    1 
ATOM   1166 C  CG    . ARG C 3 78 ? 10.513 0.667   -5.901  1.00 21.41 ? 1206 ARG A CG    1 
ATOM   1167 C  CD    . ARG C 3 78 ? 11.694 -0.103  -6.447  1.00 27.95 ? 1206 ARG A CD    1 
ATOM   1168 N  NE    . ARG C 3 78 ? 12.345 0.713   -7.479  1.00 34.24 ? 1206 ARG A NE    1 
ATOM   1169 C  CZ    . ARG C 3 78 ? 13.490 0.421   -8.069  1.00 41.14 ? 1206 ARG A CZ    1 
ATOM   1170 N  NH1   . ARG C 3 78 ? 14.148 -0.684  -7.737  1.00 26.72 ? 1206 ARG A NH1   1 
ATOM   1171 N  NH2   . ARG C 3 78 ? 13.938 1.271   -8.987  1.00 32.93 ? 1206 ARG A NH2   1 
ATOM   1172 N  N     . ASN C 3 79 ? 6.739  -0.545  -3.578  1.00 15.47 ? 1207 ASN A N     1 
ATOM   1173 C  CA    . ASN C 3 79 ? 5.873  -1.430  -2.823  1.00 16.03 ? 1207 ASN A CA    1 
ATOM   1174 C  C     . ASN C 3 79 ? 6.626  -2.707  -2.447  1.00 18.17 ? 1207 ASN A C     1 
ATOM   1175 O  O     . ASN C 3 79 ? 7.602  -3.067  -3.109  1.00 18.81 ? 1207 ASN A O     1 
ATOM   1176 C  CB    . ASN C 3 79 ? 4.631  -1.778  -3.628  1.00 22.66 ? 1207 ASN A CB    1 
ATOM   1177 C  CG    . ASN C 3 79 ? 3.599  -0.670  -3.698  1.00 21.40 ? 1207 ASN A CG    1 
ATOM   1178 O  OD1   . ASN C 3 79 ? 3.740  0.390   -3.089  1.00 27.76 ? 1207 ASN A OD1   1 
ATOM   1179 N  ND2   . ASN C 3 79 ? 2.555  -0.957  -4.467  1.00 19.51 ? 1207 ASN A ND2   1 
ATOM   1180 N  N     . ASP C 3 80 ? 6.153  -3.337  -1.378  1.00 24.48 ? 1208 ASP A N     1 
ATOM   1181 C  CA    . ASP C 3 80 ? 6.723  -4.572  -0.852  1.00 38.59 ? 1208 ASP A CA    1 
ATOM   1182 C  C     . ASP C 3 80 ? 6.827  -5.668  -1.904  1.00 51.10 ? 1208 ASP A C     1 
ATOM   1183 O  O     . ASP C 3 80 ? 7.965  -6.043  -2.267  1.00 59.92 ? 1208 ASP A O     1 
ATOM   1184 C  CB    . ASP C 3 80 ? 5.884  -5.044  0.331   1.00 48.28 ? 1208 ASP A CB    1 
ATOM   1185 N  N     . GLY D 4 1  ? 24.434 -18.821 17.306  1.00 24.34 ? 1228 GLY B N     1 
ATOM   1186 C  CA    . GLY D 4 1  ? 25.862 -18.911 16.982  1.00 22.75 ? 1228 GLY B CA    1 
ATOM   1187 C  C     . GLY D 4 1  ? 26.618 -19.462 18.178  1.00 15.93 ? 1228 GLY B C     1 
ATOM   1188 O  O     . GLY D 4 1  ? 25.976 -19.955 19.097  1.00 15.98 ? 1228 GLY B O     1 
ATOM   1189 N  N     . SER D 4 2  ? 27.923 -19.338 18.141  1.00 16.64 ? 1229 SER B N     1 
ATOM   1190 C  CA    . SER D 4 2  ? 28.779 -19.705 19.255  1.00 15.43 ? 1229 SER B CA    1 
ATOM   1191 C  C     . SER D 4 2  ? 28.451 -18.876 20.492  1.00 12.92 ? 1229 SER B C     1 
ATOM   1192 O  O     . SER D 4 2  ? 28.060 -17.717 20.347  1.00 14.31 ? 1229 SER B O     1 
ATOM   1193 C  CB    . SER D 4 2  ? 30.235 -19.498 18.844  1.00 16.90 ? 1229 SER B CB    1 
ATOM   1194 O  OG    . SER D 4 2  ? 31.146 -19.702 19.909  1.00 15.96 ? 1229 SER B OG    1 
ATOM   1195 N  N     . PHE D 4 3  ? 28.603 -19.437 21.682  1.00 12.90 ? 1230 PHE B N     1 
ATOM   1196 C  CA    . PHE D 4 3  ? 28.416 -18.715 22.940  1.00 12.03 ? 1230 PHE B CA    1 
ATOM   1197 C  C     . PHE D 4 3  ? 29.565 -17.736 23.180  1.00 12.80 ? 1230 PHE B C     1 
ATOM   1198 O  O     . PHE D 4 3  ? 29.517 -16.833 24.031  1.00 18.73 ? 1230 PHE B O     1 
ATOM   1199 C  CB    . PHE D 4 3  ? 28.331 -19.697 24.109  1.00 14.60 ? 1230 PHE B CB    1 
ATOM   1200 C  CG    . PHE D 4 3  ? 27.962 -19.037 25.426  1.00 18.12 ? 1230 PHE B CG    1 
ATOM   1201 C  CD1   . PHE D 4 3  ? 28.926 -18.813 26.388  1.00 17.07 ? 1230 PHE B CD1   1 
ATOM   1202 C  CD2   . PHE D 4 3  ? 26.652 -18.645 25.656  1.00 22.51 ? 1230 PHE B CD2   1 
ATOM   1203 C  CE1   . PHE D 4 3  ? 28.608 -18.216 27.591  1.00 19.41 ? 1230 PHE B CE1   1 
ATOM   1204 C  CE2   . PHE D 4 3  ? 26.329 -18.046 26.860  1.00 17.39 ? 1230 PHE B CE2   1 
ATOM   1205 C  CZ    . PHE D 4 3  ? 27.311 -17.828 27.797  1.00 18.66 ? 1230 PHE B CZ    1 
ATOM   1206 N  N     . THR D 4 4  ? 30.638 -17.944 22.436  1.00 12.01 ? 1231 THR B N     1 
ATOM   1207 C  CA    . THR D 4 4  ? 31.775 -17.029 22.403  1.00 12.55 ? 1231 THR B CA    1 
ATOM   1208 C  C     . THR D 4 4  ? 31.531 -16.022 21.277  1.00 19.98 ? 1231 THR B C     1 
ATOM   1209 O  O     . THR D 4 4  ? 31.486 -16.455 20.123  1.00 14.96 ? 1231 THR B O     1 
ATOM   1210 C  CB    . THR D 4 4  ? 33.113 -17.746 22.171  1.00 15.19 ? 1231 THR B CB    1 
ATOM   1211 O  OG1   . THR D 4 4  ? 33.419 -18.590 23.290  1.00 17.12 ? 1231 THR B OG1   1 
ATOM   1212 C  CG2   . THR D 4 4  ? 34.273 -16.760 22.044  1.00 18.72 ? 1231 THR B CG2   1 
ATOM   1213 N  N     . LYS D 4 5  ? 31.382 -14.740 21.604  1.00 16.48 ? 1232 LYS B N     1 
ATOM   1214 C  CA    . LYS D 4 5  ? 31.426 -13.715 20.535  1.00 12.64 ? 1232 LYS B CA    1 
ATOM   1215 C  C     . LYS D 4 5  ? 32.651 -12.853 20.790  1.00 10.44 ? 1232 LYS B C     1 
ATOM   1216 O  O     . LYS D 4 5  ? 33.712 -13.102 20.208  1.00 11.95 ? 1232 LYS B O     1 
ATOM   1217 C  CB    . LYS D 4 5  ? 30.129 -12.934 20.430  1.00 17.17 ? 1232 LYS B CB    1 
ATOM   1218 C  CG    . LYS D 4 5  ? 28.888 -13.817 20.429  1.00 28.30 ? 1232 LYS B CG    1 
ATOM   1219 C  CD    . LYS D 4 5  ? 28.129 -13.696 19.123  1.00 42.16 ? 1232 LYS B CD    1 
ATOM   1220 C  CE    . LYS D 4 5  ? 26.631 -13.896 19.360  1.00 40.66 ? 1232 LYS B CE    1 
ATOM   1221 N  NZ    . LYS D 4 5  ? 25.905 -13.601 18.089  1.00 48.11 ? 1232 LYS B NZ    1 
ATOM   1222 N  N     . HIS D 4 6  ? 32.617 -11.874 21.661  1.00 9.80  ? 1233 HIS B N     1 
ATOM   1223 C  CA    . HIS D 4 6  ? 33.773 -11.091 22.043  1.00 9.49  ? 1233 HIS B CA    1 
ATOM   1224 C  C     . HIS D 4 6  ? 33.862 -10.984 23.572  1.00 8.56  ? 1233 HIS B C     1 
ATOM   1225 O  O     . HIS D 4 6  ? 32.951 -11.466 24.260  1.00 9.67  ? 1233 HIS B O     1 
ATOM   1226 C  CB    . HIS D 4 6  ? 33.693 -9.702  21.412  1.00 8.49  ? 1233 HIS B CB    1 
ATOM   1227 C  CG    . HIS D 4 6  ? 33.642 -9.773  19.922  1.00 8.04  ? 1233 HIS B CG    1 
ATOM   1228 N  ND1   . HIS D 4 6  ? 32.526 -9.444  19.192  1.00 17.39 ? 1233 HIS B ND1   1 
ATOM   1229 C  CD2   . HIS D 4 6  ? 34.609 -10.152 19.045  1.00 9.46  ? 1233 HIS B CD2   1 
ATOM   1230 C  CE1   . HIS D 4 6  ? 32.819 -9.617  17.910  1.00 10.71 ? 1233 HIS B CE1   1 
ATOM   1231 N  NE2   . HIS D 4 6  ? 34.062 -10.048 17.793  1.00 17.95 ? 1233 HIS B NE2   1 
ATOM   1232 N  N     . ILE D 4 7  ? 34.908 -10.321 24.016  1.00 8.77  ? 1234 ILE B N     1 
ATOM   1233 C  CA    . ILE D 4 7  ? 35.159 -10.164 25.448  1.00 8.24  ? 1234 ILE B CA    1 
ATOM   1234 C  C     . ILE D 4 7  ? 35.425 -8.697  25.743  1.00 10.74 ? 1234 ILE B C     1 
ATOM   1235 O  O     . ILE D 4 7  ? 36.072 -8.032  24.937  1.00 9.41  ? 1234 ILE B O     1 
ATOM   1236 C  CB    . ILE D 4 7  ? 36.319 -11.066 25.883  1.00 7.62  ? 1234 ILE B CB    1 
ATOM   1237 C  CG1   . ILE D 4 7  ? 35.931 -12.546 25.810  1.00 8.07  ? 1234 ILE B CG1   1 
ATOM   1238 C  CG2   . ILE D 4 7  ? 36.806 -10.709 27.278  1.00 15.84 ? 1234 ILE B CG2   1 
ATOM   1239 C  CD1   . ILE D 4 7  ? 34.938 -12.969 26.844  1.00 11.11 ? 1234 ILE B CD1   1 
ATOM   1240 N  N     . CYS D 4 8  ? 34.910 -8.227  26.862  1.00 8.41  ? 1235 CYS B N     1 
ATOM   1241 C  CA    . CYS D 4 8  ? 35.102 -6.855  27.304  1.00 7.89  ? 1235 CYS B CA    1 
ATOM   1242 C  C     . CYS D 4 8  ? 36.548 -6.641  27.660  1.00 7.71  ? 1235 CYS B C     1 
ATOM   1243 O  O     . CYS D 4 8  ? 37.150 -7.326  28.480  1.00 10.35 ? 1235 CYS B O     1 
ATOM   1244 C  CB    . CYS D 4 8  ? 34.158 -6.511  28.468  1.00 8.96  ? 1235 CYS B CB    1 
ATOM   1245 S  SG    . CYS D 4 8  ? 34.369 -4.829  29.132  1.00 9.33  ? 1235 CYS B SG    1 
ATOM   1246 N  N     . ALA D 4 9  ? 37.162 -5.635  27.024  1.00 8.07  ? 1236 ALA B N     1 
ATOM   1247 C  CA    . ALA D 4 9  ? 38.530 -5.305  27.276  1.00 6.63  ? 1236 ALA B CA    1 
ATOM   1248 C  C     . ALA D 4 9  ? 38.746 -4.650  28.645  1.00 6.64  ? 1236 ALA B C     1 
ATOM   1249 O  O     . ALA D 4 9  ? 39.888 -4.660  29.111  1.00 9.25  ? 1236 ALA B O     1 
ATOM   1250 C  CB    . ALA D 4 9  ? 39.111 -4.380  26.200  1.00 12.30 ? 1236 ALA B CB    1 
ATOM   1251 N  N     . ILE D 4 10 ? 37.628 -4.146  29.185  1.00 9.10  ? 1237 ILE B N     1 
ATOM   1252 C  CA    . ILE D 4 10 ? 37.765 -3.474  30.479  1.00 7.30  ? 1237 ILE B CA    1 
ATOM   1253 C  C     . ILE D 4 10 ? 37.687 -4.494  31.613  1.00 9.93  ? 1237 ILE B C     1 
ATOM   1254 O  O     . ILE D 4 10 ? 38.513 -4.461  32.509  1.00 11.86 ? 1237 ILE B O     1 
ATOM   1255 C  CB    . ILE D 4 10 ? 36.712 -2.379  30.667  1.00 7.44  ? 1237 ILE B CB    1 
ATOM   1256 C  CG1   . ILE D 4 10 ? 36.687 -1.283  29.593  1.00 20.69 ? 1237 ILE B CG1   1 
ATOM   1257 C  CG2   . ILE D 4 10 ? 36.849 -1.771  32.055  1.00 11.11 ? 1237 ILE B CG2   1 
ATOM   1258 C  CD1   . ILE D 4 10 ? 37.959 -1.104  28.822  1.00 29.09 ? 1237 ILE B CD1   1 
ATOM   1259 N  N     . CYS D 4 11 ? 36.731 -5.408  31.583  1.00 8.88  ? 1238 CYS B N     1 
ATOM   1260 C  CA    . CYS D 4 11 ? 36.510 -6.253  32.770  1.00 11.28 ? 1238 CYS B CA    1 
ATOM   1261 C  C     . CYS D 4 11 ? 36.457 -7.730  32.470  1.00 11.56 ? 1238 CYS B C     1 
ATOM   1262 O  O     . CYS D 4 11 ? 36.374 -8.564  33.384  1.00 11.02 ? 1238 CYS B O     1 
ATOM   1263 C  CB    . CYS D 4 11 ? 35.198 -5.823  33.431  1.00 11.41 ? 1238 CYS B CB    1 
ATOM   1264 S  SG    . CYS D 4 11 ? 33.701 -6.425  32.586  1.00 8.89  ? 1238 CYS B SG    1 
ATOM   1265 N  N     . GLY D 4 12 ? 36.478 -8.132  31.203  1.00 9.78  ? 1239 GLY B N     1 
ATOM   1266 C  CA    . GLY D 4 12 ? 36.517 -9.557  30.955  1.00 11.62 ? 1239 GLY B CA    1 
ATOM   1267 C  C     . GLY D 4 12 ? 35.173 -10.204 30.785  1.00 10.51 ? 1239 GLY B C     1 
ATOM   1268 O  O     . GLY D 4 12 ? 35.108 -11.402 30.439  1.00 14.60 ? 1239 GLY B O     1 
ATOM   1269 N  N     . ASP D 4 13 ? 34.069 -9.494  30.976  1.00 8.30  ? 1240 ASP B N     1 
ATOM   1270 C  CA    . ASP D 4 13 ? 32.734 -10.046 30.775  1.00 10.13 ? 1240 ASP B CA    1 
ATOM   1271 C  C     . ASP D 4 13 ? 32.489 -10.235 29.281  1.00 9.50  ? 1240 ASP B C     1 
ATOM   1272 O  O     . ASP D 4 13 ? 33.314 -9.729  28.524  1.00 11.19 ? 1240 ASP B O     1 
ATOM   1273 C  CB    . ASP D 4 13 ? 31.711 -9.116  31.400  1.00 9.51  ? 1240 ASP B CB    1 
ATOM   1274 C  CG    . ASP D 4 13 ? 30.317 -9.642  31.596  1.00 11.11 ? 1240 ASP B CG    1 
ATOM   1275 O  OD1   . ASP D 4 13 ? 29.426 -8.823  31.945  1.00 12.80 ? 1240 ASP B OD1   1 
ATOM   1276 O  OD2   . ASP D 4 13 ? 30.033 -10.848 31.392  1.00 12.27 ? 1240 ASP B OD2   1 
ATOM   1277 N  N     . ARG D 4 14 ? 31.425 -10.902 28.915  1.00 7.79  ? 1241 ARG B N     1 
ATOM   1278 C  CA    . ARG D 4 14 ? 31.000 -11.112 27.543  1.00 13.94 ? 1241 ARG B CA    1 
ATOM   1279 C  C     . ARG D 4 14 ? 30.690 -9.798  26.835  1.00 15.26 ? 1241 ARG B C     1 
ATOM   1280 O  O     . ARG D 4 14 ? 30.237 -8.862  27.485  1.00 10.10 ? 1241 ARG B O     1 
ATOM   1281 C  CB    . ARG D 4 14 ? 29.729 -11.983 27.476  1.00 12.88 ? 1241 ARG B CB    1 
ATOM   1282 C  CG    . ARG D 4 14 ? 29.992 -13.406 27.945  1.00 19.45 ? 1241 ARG B CG    1 
ATOM   1283 C  CD    . ARG D 4 14 ? 28.767 -14.277 27.679  1.00 35.46 ? 1241 ARG B CD    1 
ATOM   1284 N  NE    . ARG D 4 14 ? 27.674 -13.992 28.602  1.00 44.23 ? 1241 ARG B NE    1 
ATOM   1285 C  CZ    . ARG D 4 14 ? 26.377 -14.108 28.371  1.00 49.70 ? 1241 ARG B CZ    1 
ATOM   1286 N  NH1   . ARG D 4 14 ? 25.917 -14.525 27.196  1.00 36.95 ? 1241 ARG B NH1   1 
ATOM   1287 N  NH2   . ARG D 4 14 ? 25.516 -13.803 29.338  1.00 47.89 ? 1241 ARG B NH2   1 
ATOM   1288 N  N     . SER D 4 15 ? 30.926 -9.778  25.533  1.00 10.27 ? 1242 SER B N     1 
ATOM   1289 C  CA    . SER D 4 15 ? 30.703 -8.608  24.714  1.00 12.86 ? 1242 SER B CA    1 
ATOM   1290 C  C     . SER D 4 15 ? 30.156 -8.999  23.342  1.00 8.56  ? 1242 SER B C     1 
ATOM   1291 O  O     . SER D 4 15 ? 30.596 -10.023 22.813  1.00 14.09 ? 1242 SER B O     1 
ATOM   1292 C  CB    . SER D 4 15 ? 32.026 -7.862  24.525  1.00 15.94 ? 1242 SER B CB    1 
ATOM   1293 O  OG    . SER D 4 15 ? 31.897 -6.875  23.513  1.00 11.38 ? 1242 SER B OG    1 
ATOM   1294 N  N     . SER D 4 16 ? 29.233 -8.190  22.841  1.00 8.31  ? 1243 SER B N     1 
ATOM   1295 C  CA    . SER D 4 16 ? 28.647 -8.410  21.526  1.00 13.13 ? 1243 SER B CA    1 
ATOM   1296 C  C     . SER D 4 16 ? 29.432 -7.697  20.440  1.00 19.98 ? 1243 SER B C     1 
ATOM   1297 O  O     . SER D 4 16 ? 29.296 -7.986  19.247  1.00 16.25 ? 1243 SER B O     1 
ATOM   1298 C  CB    . SER D 4 16 ? 27.177 -7.959  21.506  1.00 14.32 ? 1243 SER B CB    1 
ATOM   1299 O  OG    . SER D 4 16 ? 27.106 -6.540  21.488  1.00 17.47 ? 1243 SER B OG    1 
ATOM   1300 N  N     . GLY D 4 17 ? 30.281 -6.757  20.813  1.00 12.78 ? 1244 GLY B N     1 
ATOM   1301 C  CA    . GLY D 4 17 ? 31.039 -5.983  19.855  1.00 8.53  ? 1244 GLY B CA    1 
ATOM   1302 C  C     . GLY D 4 17 ? 31.612 -4.735  20.506  1.00 12.42 ? 1244 GLY B C     1 
ATOM   1303 O  O     . GLY D 4 17 ? 31.629 -4.627  21.734  1.00 10.34 ? 1244 GLY B O     1 
ATOM   1304 N  N     . LYS D 4 18 ? 32.091 -3.834  19.655  1.00 9.59  ? 1245 LYS B N     1 
ATOM   1305 C  CA    . LYS D 4 18 ? 32.692 -2.603  20.166  1.00 12.30 ? 1245 LYS B CA    1 
ATOM   1306 C  C     . LYS D 4 18 ? 31.645 -1.567  20.536  1.00 9.77  ? 1245 LYS B C     1 
ATOM   1307 O  O     . LYS D 4 18 ? 30.561 -1.455  19.976  1.00 9.01  ? 1245 LYS B O     1 
ATOM   1308 C  CB    . LYS D 4 18 ? 33.694 -2.023  19.148  1.00 9.12  ? 1245 LYS B CB    1 
ATOM   1309 C  CG    . LYS D 4 18 ? 34.853 -2.961  18.871  1.00 11.10 ? 1245 LYS B CG    1 
ATOM   1310 C  CD    . LYS D 4 18 ? 35.946 -2.361  18.007  1.00 12.02 ? 1245 LYS B CD    1 
ATOM   1311 C  CE    . LYS D 4 18 ? 36.986 -3.452  17.742  1.00 20.86 ? 1245 LYS B CE    1 
ATOM   1312 N  NZ    . LYS D 4 18 ? 38.137 -2.919  16.970  1.00 29.02 ? 1245 LYS B NZ    1 
ATOM   1313 N  N     . HIS D 4 19 ? 32.015 -0.760  21.538  1.00 10.87 ? 1246 HIS B N     1 
ATOM   1314 C  CA    . HIS D 4 19 ? 31.215 0.392   21.928  1.00 8.42  ? 1246 HIS B CA    1 
ATOM   1315 C  C     . HIS D 4 19 ? 32.197 1.530   22.229  1.00 6.91  ? 1246 HIS B C     1 
ATOM   1316 O  O     . HIS D 4 19 ? 33.172 1.339   22.956  1.00 7.94  ? 1246 HIS B O     1 
ATOM   1317 C  CB    . HIS D 4 19 ? 30.310 0.081   23.117  1.00 11.90 ? 1246 HIS B CB    1 
ATOM   1318 C  CG    . HIS D 4 19 ? 29.401 -1.088  22.911  1.00 9.17  ? 1246 HIS B CG    1 
ATOM   1319 N  ND1   . HIS D 4 19 ? 28.210 -1.011  22.237  1.00 11.58 ? 1246 HIS B ND1   1 
ATOM   1320 C  CD2   . HIS D 4 19 ? 29.523 -2.398  23.279  1.00 16.02 ? 1246 HIS B CD2   1 
ATOM   1321 C  CE1   . HIS D 4 19 ? 27.607 -2.185  22.198  1.00 11.45 ? 1246 HIS B CE1   1 
ATOM   1322 N  NE2   . HIS D 4 19 ? 28.396 -3.059  22.824  1.00 10.92 ? 1246 HIS B NE2   1 
ATOM   1323 N  N     . TYR D 4 20 ? 31.954 2.684   21.626  1.00 8.75  ? 1247 TYR B N     1 
ATOM   1324 C  CA    . TYR D 4 20 ? 32.817 3.845   21.827  1.00 8.89  ? 1247 TYR B CA    1 
ATOM   1325 C  C     . TYR D 4 20 ? 34.273 3.537   21.523  1.00 7.62  ? 1247 TYR B C     1 
ATOM   1326 O  O     . TYR D 4 20 ? 35.197 4.101   22.060  1.00 8.81  ? 1247 TYR B O     1 
ATOM   1327 C  CB    . TYR D 4 20 ? 32.592 4.433   23.229  1.00 10.37 ? 1247 TYR B CB    1 
ATOM   1328 C  CG    . TYR D 4 20 ? 31.132 4.570   23.544  1.00 9.71  ? 1247 TYR B CG    1 
ATOM   1329 C  CD1   . TYR D 4 20 ? 30.219 5.313   22.794  1.00 8.86  ? 1247 TYR B CD1   1 
ATOM   1330 C  CD2   . TYR D 4 20 ? 30.580 3.930   24.647  1.00 7.15  ? 1247 TYR B CD2   1 
ATOM   1331 C  CE1   . TYR D 4 20 ? 28.890 5.411   23.121  1.00 8.24  ? 1247 TYR B CE1   1 
ATOM   1332 C  CE2   . TYR D 4 20 ? 29.276 4.006   24.984  1.00 7.82  ? 1247 TYR B CE2   1 
ATOM   1333 C  CZ    . TYR D 4 20 ? 28.370 4.759   24.227  1.00 7.63  ? 1247 TYR B CZ    1 
ATOM   1334 O  OH    . TYR D 4 20 ? 27.048 4.815   24.583  1.00 9.51  ? 1247 TYR B OH    1 
ATOM   1335 N  N     . GLY D 4 21 ? 34.490 2.598   20.587  1.00 10.44 ? 1248 GLY B N     1 
ATOM   1336 C  CA    . GLY D 4 21 ? 35.788 2.250   20.077  1.00 13.25 ? 1248 GLY B CA    1 
ATOM   1337 C  C     . GLY D 4 21 ? 36.431 0.982   20.580  1.00 8.63  ? 1248 GLY B C     1 
ATOM   1338 O  O     . GLY D 4 21 ? 37.508 0.629   20.096  1.00 11.01 ? 1248 GLY B O     1 
ATOM   1339 N  N     . VAL D 4 22 ? 35.812 0.307   21.546  1.00 9.32  ? 1249 VAL B N     1 
ATOM   1340 C  CA    . VAL D 4 22 ? 36.487 -0.787  22.244  1.00 6.51  ? 1249 VAL B CA    1 
ATOM   1341 C  C     . VAL D 4 22 ? 35.541 -1.931  22.549  1.00 6.28  ? 1249 VAL B C     1 
ATOM   1342 O  O     . VAL D 4 22 ? 34.403 -1.695  22.962  1.00 8.96  ? 1249 VAL B O     1 
ATOM   1343 C  CB    . VAL D 4 22 ? 37.040 -0.289  23.602  1.00 9.74  ? 1249 VAL B CB    1 
ATOM   1344 C  CG1   . VAL D 4 22 ? 37.530 -1.411  24.506  1.00 24.90 ? 1249 VAL B CG1   1 
ATOM   1345 C  CG2   . VAL D 4 22 ? 38.165 0.720   23.374  1.00 12.79 ? 1249 VAL B CG2   1 
ATOM   1346 N  N     . TYR D 4 23 ? 35.999 -3.173  22.378  1.00 10.15 ? 1250 TYR B N     1 
ATOM   1347 C  CA    . TYR D 4 23 ? 35.180 -4.302  22.820  1.00 8.48  ? 1250 TYR B CA    1 
ATOM   1348 C  C     . TYR D 4 23 ? 34.793 -4.133  24.280  1.00 5.96  ? 1250 TYR B C     1 
ATOM   1349 O  O     . TYR D 4 23 ? 35.700 -4.033  25.136  1.00 10.10 ? 1250 TYR B O     1 
ATOM   1350 C  CB    . TYR D 4 23 ? 35.923 -5.635  22.681  1.00 9.66  ? 1250 TYR B CB    1 
ATOM   1351 C  CG    . TYR D 4 23 ? 36.089 -6.101  21.250  1.00 5.76  ? 1250 TYR B CG    1 
ATOM   1352 C  CD1   . TYR D 4 23 ? 34.951 -6.252  20.488  1.00 8.71  ? 1250 TYR B CD1   1 
ATOM   1353 C  CD2   . TYR D 4 23 ? 37.319 -6.391  20.703  1.00 10.57 ? 1250 TYR B CD2   1 
ATOM   1354 C  CE1   . TYR D 4 23 ? 35.057 -6.682  19.170  1.00 11.56 ? 1250 TYR B CE1   1 
ATOM   1355 C  CE2   . TYR D 4 23 ? 37.436 -6.822  19.383  1.00 15.00 ? 1250 TYR B CE2   1 
ATOM   1356 C  CZ    . TYR D 4 23 ? 36.288 -6.961  18.634  1.00 13.66 ? 1250 TYR B CZ    1 
ATOM   1357 O  OH    . TYR D 4 23 ? 36.323 -7.388  17.317  1.00 16.41 ? 1250 TYR B OH    1 
ATOM   1358 N  N     . SER D 4 24 ? 33.489 -4.094  24.494  1.00 8.02  ? 1251 SER B N     1 
ATOM   1359 C  CA    . SER D 4 24 ? 33.016 -3.865  25.866  1.00 12.37 ? 1251 SER B CA    1 
ATOM   1360 C  C     . SER D 4 24 ? 31.677 -4.511  26.159  1.00 10.50 ? 1251 SER B C     1 
ATOM   1361 O  O     . SER D 4 24 ? 30.856 -4.752  25.275  1.00 9.24  ? 1251 SER B O     1 
ATOM   1362 C  CB    . SER D 4 24 ? 32.950 -2.362  26.139  1.00 10.04 ? 1251 SER B CB    1 
ATOM   1363 O  OG    . SER D 4 24 ? 32.325 -1.675  25.092  1.00 15.79 ? 1251 SER B OG    1 
ATOM   1364 N  N     . CYS D 4 25 ? 31.474 -4.745  27.466  1.00 9.02  ? 1252 CYS B N     1 
ATOM   1365 C  CA    . CYS D 4 25 ? 30.212 -5.325  27.901  1.00 8.73  ? 1252 CYS B CA    1 
ATOM   1366 C  C     . CYS D 4 25 ? 29.134 -4.259  28.069  1.00 9.32  ? 1252 CYS B C     1 
ATOM   1367 O  O     . CYS D 4 25 ? 29.386 -3.052  27.993  1.00 11.50 ? 1252 CYS B O     1 
ATOM   1368 C  CB    . CYS D 4 25 ? 30.395 -6.139  29.182  1.00 8.54  ? 1252 CYS B CB    1 
ATOM   1369 S  SG    . CYS D 4 25 ? 30.785 -5.153  30.659  1.00 10.49 ? 1252 CYS B SG    1 
ATOM   1370 N  N     . GLU D 4 26 ? 27.908 -4.721  28.256  1.00 10.15 ? 1253 GLU B N     1 
ATOM   1371 C  CA    . GLU D 4 26 ? 26.750 -3.878  28.507  1.00 6.18  ? 1253 GLU B CA    1 
ATOM   1372 C  C     . GLU D 4 26 ? 27.029 -3.001  29.725  1.00 8.83  ? 1253 GLU B C     1 
ATOM   1373 O  O     . GLU D 4 26 ? 26.721 -1.810  29.741  1.00 10.14 ? 1253 GLU B O     1 
ATOM   1374 C  CB    . GLU D 4 26 ? 25.483 -4.691  28.728  1.00 16.32 ? 1253 GLU B CB    1 
ATOM   1375 C  CG    . GLU D 4 26 ? 25.032 -5.464  27.502  1.00 14.09 ? 1253 GLU B CG    1 
ATOM   1376 C  CD    . GLU D 4 26 ? 24.269 -4.614  26.513  1.00 26.92 ? 1253 GLU B CD    1 
ATOM   1377 O  OE1   . GLU D 4 26 ? 23.649 -5.234  25.622  1.00 31.22 ? 1253 GLU B OE1   1 
ATOM   1378 O  OE2   . GLU D 4 26 ? 24.273 -3.364  26.608  1.00 20.73 ? 1253 GLU B OE2   1 
ATOM   1379 N  N     . GLY D 4 27 ? 27.618 -3.580  30.757  1.00 10.77 ? 1254 GLY B N     1 
ATOM   1380 C  CA    . GLY D 4 27 ? 27.972 -2.794  31.934  1.00 8.76  ? 1254 GLY B CA    1 
ATOM   1381 C  C     . GLY D 4 27 ? 28.942 -1.684  31.633  1.00 12.52 ? 1254 GLY B C     1 
ATOM   1382 O  O     . GLY D 4 27 ? 28.683 -0.527  31.944  1.00 12.83 ? 1254 GLY B O     1 
ATOM   1383 N  N     . CYS D 4 28 ? 30.061 -2.021  31.003  1.00 9.21  ? 1255 CYS B N     1 
ATOM   1384 C  CA    . CYS D 4 28 ? 31.106 -1.000  30.842  1.00 7.38  ? 1255 CYS B CA    1 
ATOM   1385 C  C     . CYS D 4 28 ? 30.631 0.010   29.781  1.00 16.98 ? 1255 CYS B C     1 
ATOM   1386 O  O     . CYS D 4 28 ? 30.921 1.195   30.023  1.00 11.21 ? 1255 CYS B O     1 
ATOM   1387 C  CB    . CYS D 4 28 ? 32.474 -1.603  30.577  1.00 10.30 ? 1255 CYS B CB    1 
ATOM   1388 S  SG    . CYS D 4 28 ? 33.185 -2.615  31.904  1.00 9.76  ? 1255 CYS B SG    1 
ATOM   1389 N  N     . LYS D 4 29 ? 29.947 -0.369  28.705  1.00 8.95  ? 1256 LYS B N     1 
ATOM   1390 C  CA    . LYS D 4 29 ? 29.372 0.593   27.759  1.00 13.63 ? 1256 LYS B CA    1 
ATOM   1391 C  C     . LYS D 4 29 ? 28.478 1.609   28.464  1.00 13.33 ? 1256 LYS B C     1 
ATOM   1392 O  O     . LYS D 4 29 ? 28.560 2.831   28.301  1.00 11.02 ? 1256 LYS B O     1 
ATOM   1393 C  CB    . LYS D 4 29 ? 28.557 -0.090  26.653  1.00 15.61 ? 1256 LYS B CB    1 
ATOM   1394 C  CG    . LYS D 4 29 ? 27.290 0.617   26.222  1.00 27.64 ? 1256 LYS B CG    1 
ATOM   1395 C  CD    . LYS D 4 29 ? 26.408 -0.095  25.220  1.00 35.17 ? 1256 LYS B CD    1 
ATOM   1396 C  CE    . LYS D 4 29 ? 25.361 0.824   24.613  1.00 32.94 ? 1256 LYS B CE    1 
ATOM   1397 N  NZ    . LYS D 4 29 ? 24.295 0.077   23.851  1.00 30.83 ? 1256 LYS B NZ    1 
ATOM   1398 N  N     . GLY D 4 30 ? 27.559 1.105   29.293  1.00 13.51 ? 1257 GLY B N     1 
ATOM   1399 C  CA    . GLY D 4 30 ? 26.597 1.945   29.971  1.00 11.38 ? 1257 GLY B CA    1 
ATOM   1400 C  C     . GLY D 4 30 ? 27.276 2.889   30.952  1.00 9.52  ? 1257 GLY B C     1 
ATOM   1401 O  O     . GLY D 4 30 ? 26.929 4.071   31.002  1.00 9.67  ? 1257 GLY B O     1 
ATOM   1402 N  N     . PHE D 4 31 ? 28.213 2.353   31.731  1.00 9.01  ? 1258 PHE B N     1 
ATOM   1403 C  CA    . PHE D 4 31 ? 28.918 3.138   32.733  1.00 8.12  ? 1258 PHE B CA    1 
ATOM   1404 C  C     . PHE D 4 31 ? 29.702 4.267   32.076  1.00 10.14 ? 1258 PHE B C     1 
ATOM   1405 O  O     . PHE D 4 31 ? 29.718 5.419   32.517  1.00 10.75 ? 1258 PHE B O     1 
ATOM   1406 C  CB    . PHE D 4 31 ? 29.827 2.222   33.522  1.00 9.68  ? 1258 PHE B CB    1 
ATOM   1407 C  CG    . PHE D 4 31 ? 30.854 2.885   34.406  1.00 7.23  ? 1258 PHE B CG    1 
ATOM   1408 C  CD1   . PHE D 4 31 ? 30.488 3.309   35.680  1.00 10.11 ? 1258 PHE B CD1   1 
ATOM   1409 C  CD2   . PHE D 4 31 ? 32.155 3.073   33.984  1.00 8.42  ? 1258 PHE B CD2   1 
ATOM   1410 C  CE1   . PHE D 4 31 ? 31.471 3.880   36.464  1.00 7.32  ? 1258 PHE B CE1   1 
ATOM   1411 C  CE2   . PHE D 4 31 ? 33.131 3.665   34.764  1.00 13.54 ? 1258 PHE B CE2   1 
ATOM   1412 C  CZ    . PHE D 4 31 ? 32.767 4.092   36.029  1.00 10.18 ? 1258 PHE B CZ    1 
ATOM   1413 N  N     . PHE D 4 32 ? 30.359 3.940   30.962  1.00 9.95  ? 1259 PHE B N     1 
ATOM   1414 C  CA    . PHE D 4 32 ? 31.096 4.987   30.238  1.00 9.96  ? 1259 PHE B CA    1 
ATOM   1415 C  C     . PHE D 4 32 ? 30.182 6.072   29.692  1.00 9.61  ? 1259 PHE B C     1 
ATOM   1416 O  O     . PHE D 4 32 ? 30.480 7.267   29.882  1.00 10.08 ? 1259 PHE B O     1 
ATOM   1417 C  CB    . PHE D 4 32 ? 31.935 4.364   29.115  1.00 10.33 ? 1259 PHE B CB    1 
ATOM   1418 C  CG    . PHE D 4 32 ? 32.867 5.329   28.400  1.00 8.43  ? 1259 PHE B CG    1 
ATOM   1419 C  CD1   . PHE D 4 32 ? 34.082 5.686   28.972  1.00 10.28 ? 1259 PHE B CD1   1 
ATOM   1420 C  CD2   . PHE D 4 32 ? 32.528 5.856   27.156  1.00 8.84  ? 1259 PHE B CD2   1 
ATOM   1421 C  CE1   . PHE D 4 32 ? 34.953 6.566   28.344  1.00 10.45 ? 1259 PHE B CE1   1 
ATOM   1422 C  CE2   . PHE D 4 32 ? 33.381 6.740   26.523  1.00 6.07  ? 1259 PHE B CE2   1 
ATOM   1423 C  CZ    . PHE D 4 32 ? 34.601 7.068   27.089  1.00 10.80 ? 1259 PHE B CZ    1 
ATOM   1424 N  N     . LYS D 4 33 ? 29.100 5.716   29.016  1.00 10.31 ? 1260 LYS B N     1 
ATOM   1425 C  CA    . LYS D 4 33 ? 28.116 6.656   28.488  1.00 8.23  ? 1260 LYS B CA    1 
ATOM   1426 C  C     . LYS D 4 33 ? 27.600 7.559   29.610  1.00 11.89 ? 1260 LYS B C     1 
ATOM   1427 O  O     . LYS D 4 33 ? 27.578 8.784   29.479  1.00 12.11 ? 1260 LYS B O     1 
ATOM   1428 C  CB    . LYS D 4 33 ? 26.948 5.937   27.802  1.00 10.33 ? 1260 LYS B CB    1 
ATOM   1429 C  CG    . LYS D 4 33 ? 25.922 6.883   27.191  1.00 11.52 ? 1260 LYS B CG    1 
ATOM   1430 C  CD    . LYS D 4 33 ? 24.723 6.137   26.671  1.00 19.06 ? 1260 LYS B CD    1 
ATOM   1431 C  CE    . LYS D 4 33 ? 23.969 5.343   27.708  1.00 22.88 ? 1260 LYS B CE    1 
ATOM   1432 N  NZ    . LYS D 4 33 ? 22.651 4.859   27.190  1.00 30.50 ? 1260 LYS B NZ    1 
ATOM   1433 N  N     . ARG D 4 34 ? 27.202 6.961   30.737  1.00 9.33  ? 1261 ARG B N     1 
ATOM   1434 C  CA    . ARG D 4 34 ? 26.662 7.810   31.802  1.00 14.02 ? 1261 ARG B CA    1 
ATOM   1435 C  C     . ARG D 4 34 ? 27.711 8.766   32.360  1.00 11.45 ? 1261 ARG B C     1 
ATOM   1436 O  O     . ARG D 4 34 ? 27.450 9.947   32.659  1.00 11.19 ? 1261 ARG B O     1 
ATOM   1437 C  CB    . ARG D 4 34 ? 26.088 6.916   32.911  1.00 15.10 ? 1261 ARG B CB    1 
ATOM   1438 C  CG    . ARG D 4 34 ? 24.849 6.155   32.456  1.00 14.28 ? 1261 ARG B CG    1 
ATOM   1439 C  CD    . ARG D 4 34 ? 24.194 5.450   33.620  1.00 13.77 ? 1261 ARG B CD    1 
ATOM   1440 N  NE    . ARG D 4 34 ? 25.065 4.496   34.293  1.00 12.06 ? 1261 ARG B NE    1 
ATOM   1441 C  CZ    . ARG D 4 34 ? 25.196 3.193   34.042  1.00 10.42 ? 1261 ARG B CZ    1 
ATOM   1442 N  NH1   . ARG D 4 34 ? 24.503 2.623   33.071  1.00 13.57 ? 1261 ARG B NH1   1 
ATOM   1443 N  NH2   . ARG D 4 34 ? 26.055 2.505   34.804  1.00 13.67 ? 1261 ARG B NH2   1 
ATOM   1444 N  N     . THR D 4 35 ? 28.918 8.298   32.546  1.00 8.72  ? 1262 THR B N     1 
ATOM   1445 C  CA    . THR D 4 35 ? 30.023 9.096   33.037  1.00 7.59  ? 1262 THR B CA    1 
ATOM   1446 C  C     . THR D 4 35 ? 30.254 10.318  32.141  1.00 11.42 ? 1262 THR B C     1 
ATOM   1447 O  O     . THR D 4 35 ? 30.359 11.458  32.596  1.00 12.21 ? 1262 THR B O     1 
ATOM   1448 C  CB    . THR D 4 35 ? 31.347 8.316   33.141  1.00 15.75 ? 1262 THR B CB    1 
ATOM   1449 O  OG1   . THR D 4 35 ? 31.149 7.191   34.019  1.00 9.61  ? 1262 THR B OG1   1 
ATOM   1450 C  CG2   . THR D 4 35 ? 32.416 9.211   33.742  1.00 16.53 ? 1262 THR B CG2   1 
ATOM   1451 N  N     . VAL D 4 36 ? 30.309 10.076  30.846  1.00 10.24 ? 1263 VAL B N     1 
ATOM   1452 C  CA    . VAL D 4 36 ? 30.532 11.171  29.899  1.00 10.86 ? 1263 VAL B CA    1 
ATOM   1453 C  C     . VAL D 4 36 ? 29.346 12.124  29.852  1.00 9.59  ? 1263 VAL B C     1 
ATOM   1454 O  O     . VAL D 4 36 ? 29.574 13.348  29.946  1.00 16.61 ? 1263 VAL B O     1 
ATOM   1455 C  CB    . VAL D 4 36 ? 30.866 10.573  28.513  1.00 6.99  ? 1263 VAL B CB    1 
ATOM   1456 C  CG1   . VAL D 4 36 ? 30.945 11.690  27.482  1.00 13.73 ? 1263 VAL B CG1   1 
ATOM   1457 C  CG2   . VAL D 4 36 ? 32.146 9.793   28.552  1.00 8.31  ? 1263 VAL B CG2   1 
ATOM   1458 N  N     . ARG D 4 37 ? 28.123 11.686  29.722  1.00 8.78  ? 1264 ARG B N     1 
ATOM   1459 C  CA    . ARG D 4 37 ? 26.899 12.468  29.611  1.00 16.14 ? 1264 ARG B CA    1 
ATOM   1460 C  C     . ARG D 4 37 ? 26.674 13.360  30.836  1.00 19.29 ? 1264 ARG B C     1 
ATOM   1461 O  O     . ARG D 4 37 ? 26.198 14.494  30.698  1.00 15.45 ? 1264 ARG B O     1 
ATOM   1462 C  CB    . ARG D 4 37 ? 25.629 11.631  29.446  1.00 13.27 ? 1264 ARG B CB    1 
ATOM   1463 C  CG    . ARG D 4 37 ? 25.511 10.920  28.107  1.00 19.07 ? 1264 ARG B CG    1 
ATOM   1464 C  CD    . ARG D 4 37 ? 24.748 11.700  27.067  1.00 19.78 ? 1264 ARG B CD    1 
ATOM   1465 N  NE    . ARG D 4 37 ? 24.532 10.934  25.840  1.00 22.84 ? 1264 ARG B NE    1 
ATOM   1466 C  CZ    . ARG D 4 37 ? 23.511 10.126  25.599  1.00 16.68 ? 1264 ARG B CZ    1 
ATOM   1467 N  NH1   . ARG D 4 37 ? 22.554 9.935   26.490  1.00 14.09 ? 1264 ARG B NH1   1 
ATOM   1468 N  NH2   . ARG D 4 37 ? 23.427 9.487   24.438  1.00 14.56 ? 1264 ARG B NH2   1 
ATOM   1469 N  N     . LYS D 4 38 ? 26.974 12.820  32.003  1.00 15.20 ? 1265 LYS B N     1 
ATOM   1470 C  CA    . LYS D 4 38 ? 26.756 13.584  33.233  1.00 11.43 ? 1265 LYS B CA    1 
ATOM   1471 C  C     . LYS D 4 38 ? 28.025 14.233  33.749  1.00 16.88 ? 1265 LYS B C     1 
ATOM   1472 O  O     . LYS D 4 38 ? 27.942 14.875  34.818  1.00 18.21 ? 1265 LYS B O     1 
ATOM   1473 C  CB    . LYS D 4 38 ? 26.120 12.644  34.260  1.00 20.21 ? 1265 LYS B CB    1 
ATOM   1474 C  CG    . LYS D 4 38 ? 24.836 12.013  33.738  1.00 32.76 ? 1265 LYS B CG    1 
ATOM   1475 C  CD    . LYS D 4 38 ? 24.128 11.220  34.817  1.00 43.30 ? 1265 LYS B CD    1 
ATOM   1476 C  CE    . LYS D 4 38 ? 24.345 9.722   34.680  1.00 45.67 ? 1265 LYS B CE    1 
ATOM   1477 N  NZ    . LYS D 4 38 ? 24.307 9.044   36.011  1.00 51.81 ? 1265 LYS B NZ    1 
ATOM   1478 N  N     . ASP D 4 39 ? 29.150 14.122  33.074  1.00 11.68 ? 1266 ASP B N     1 
ATOM   1479 C  CA    . ASP D 4 39 ? 30.457 14.594  33.486  1.00 18.93 ? 1266 ASP B CA    1 
ATOM   1480 C  C     . ASP D 4 39 ? 30.732 14.275  34.957  1.00 22.95 ? 1266 ASP B C     1 
ATOM   1481 O  O     . ASP D 4 39 ? 31.082 15.126  35.783  1.00 19.54 ? 1266 ASP B O     1 
ATOM   1482 C  CB    . ASP D 4 39 ? 30.648 16.097  33.253  1.00 24.85 ? 1266 ASP B CB    1 
ATOM   1483 C  CG    . ASP D 4 39 ? 32.057 16.555  33.583  1.00 30.58 ? 1266 ASP B CG    1 
ATOM   1484 O  OD1   . ASP D 4 39 ? 33.030 15.770  33.503  1.00 21.73 ? 1266 ASP B OD1   1 
ATOM   1485 O  OD2   . ASP D 4 39 ? 32.210 17.743  33.955  1.00 32.49 ? 1266 ASP B OD2   1 
ATOM   1486 N  N     . LEU D 4 40 ? 30.564 13.004  35.313  1.00 18.85 ? 1267 LEU B N     1 
ATOM   1487 C  CA    . LEU D 4 40 ? 30.845 12.560  36.671  1.00 20.12 ? 1267 LEU B CA    1 
ATOM   1488 C  C     . LEU D 4 40 ? 32.355 12.499  36.897  1.00 19.98 ? 1267 LEU B C     1 
ATOM   1489 O  O     . LEU D 4 40 ? 33.098 12.166  35.978  1.00 17.95 ? 1267 LEU B O     1 
ATOM   1490 C  CB    . LEU D 4 40 ? 30.204 11.201  36.957  1.00 16.89 ? 1267 LEU B CB    1 
ATOM   1491 C  CG    . LEU D 4 40 ? 28.720 11.064  36.635  1.00 13.42 ? 1267 LEU B CG    1 
ATOM   1492 C  CD1   . LEU D 4 40 ? 28.281 9.609   36.745  1.00 25.17 ? 1267 LEU B CD1   1 
ATOM   1493 C  CD2   . LEU D 4 40 ? 27.892 11.924  37.571  1.00 14.68 ? 1267 LEU B CD2   1 
ATOM   1494 N  N     . THR D 4 41 ? 32.743 12.840  38.125  1.00 15.80 ? 1268 THR B N     1 
ATOM   1495 C  CA    . THR D 4 41 ? 34.073 12.782  38.667  1.00 17.63 ? 1268 THR B CA    1 
ATOM   1496 C  C     . THR D 4 41 ? 34.135 11.768  39.801  1.00 14.82 ? 1268 THR B C     1 
ATOM   1497 O  O     . THR D 4 41 ? 33.323 11.729  40.732  1.00 22.34 ? 1268 THR B O     1 
ATOM   1498 C  CB    . THR D 4 41 ? 34.503 14.172  39.187  1.00 28.03 ? 1268 THR B CB    1 
ATOM   1499 O  OG1   . THR D 4 41 ? 34.537 15.084  38.078  1.00 37.16 ? 1268 THR B OG1   1 
ATOM   1500 C  CG2   . THR D 4 41 ? 35.897 14.113  39.779  1.00 39.08 ? 1268 THR B CG2   1 
ATOM   1501 N  N     . TYR D 4 42 ? 35.140 10.912  39.721  1.00 15.22 ? 1269 TYR B N     1 
ATOM   1502 C  CA    . TYR D 4 42 ? 35.329 9.852   40.705  1.00 14.36 ? 1269 TYR B CA    1 
ATOM   1503 C  C     . TYR D 4 42 ? 36.673 10.007  41.408  1.00 18.82 ? 1269 TYR B C     1 
ATOM   1504 O  O     . TYR D 4 42 ? 37.578 10.628  40.857  1.00 18.90 ? 1269 TYR B O     1 
ATOM   1505 C  CB    . TYR D 4 42 ? 35.252 8.482   40.039  1.00 14.61 ? 1269 TYR B CB    1 
ATOM   1506 C  CG    . TYR D 4 42 ? 34.026 8.222   39.189  1.00 14.08 ? 1269 TYR B CG    1 
ATOM   1507 C  CD1   . TYR D 4 42 ? 34.173 7.863   37.855  1.00 13.83 ? 1269 TYR B CD1   1 
ATOM   1508 C  CD2   . TYR D 4 42 ? 32.726 8.306   39.662  1.00 11.29 ? 1269 TYR B CD2   1 
ATOM   1509 C  CE1   . TYR D 4 42 ? 33.089 7.612   37.042  1.00 12.74 ? 1269 TYR B CE1   1 
ATOM   1510 C  CE2   . TYR D 4 42 ? 31.625 8.060   38.868  1.00 15.82 ? 1269 TYR B CE2   1 
ATOM   1511 C  CZ    . TYR D 4 42 ? 31.809 7.706   37.537  1.00 14.36 ? 1269 TYR B CZ    1 
ATOM   1512 O  OH    . TYR D 4 42 ? 30.717 7.460   36.733  1.00 13.10 ? 1269 TYR B OH    1 
ATOM   1513 N  N     . THR D 4 43 ? 36.826 9.456   42.604  1.00 18.30 ? 1270 THR B N     1 
ATOM   1514 C  CA    . THR D 4 43 ? 38.078 9.382   43.334  1.00 18.43 ? 1270 THR B CA    1 
ATOM   1515 C  C     . THR D 4 43 ? 38.323 7.940   43.787  1.00 12.37 ? 1270 THR B C     1 
ATOM   1516 O  O     . THR D 4 43 ? 37.373 7.283   44.200  1.00 19.99 ? 1270 THR B O     1 
ATOM   1517 C  CB    . THR D 4 43 ? 38.107 10.293  44.579  1.00 26.99 ? 1270 THR B CB    1 
ATOM   1518 O  OG1   . THR D 4 43 ? 37.120 9.839   45.509  1.00 31.34 ? 1270 THR B OG1   1 
ATOM   1519 C  CG2   . THR D 4 43 ? 37.743 11.722  44.213  1.00 25.26 ? 1270 THR B CG2   1 
ATOM   1520 N  N     . CYS D 4 44 ? 39.556 7.510   43.683  1.00 14.54 ? 1271 CYS B N     1 
ATOM   1521 C  CA    . CYS D 4 44 ? 40.000 6.203   44.123  1.00 15.09 ? 1271 CYS B CA    1 
ATOM   1522 C  C     . CYS D 4 44 ? 40.364 6.224   45.612  1.00 22.69 ? 1271 CYS B C     1 
ATOM   1523 O  O     . CYS D 4 44 ? 41.162 7.066   46.014  1.00 20.52 ? 1271 CYS B O     1 
ATOM   1524 C  CB    . CYS D 4 44 ? 41.212 5.738   43.324  1.00 13.34 ? 1271 CYS B CB    1 
ATOM   1525 S  SG    . CYS D 4 44 ? 41.789 4.091   43.765  1.00 15.68 ? 1271 CYS B SG    1 
ATOM   1526 N  N     . ARG D 4 45 ? 39.807 5.296   46.387  1.00 19.52 ? 1272 ARG B N     1 
ATOM   1527 C  CA    . ARG D 4 45 ? 40.158 5.228   47.810  1.00 23.37 ? 1272 ARG B CA    1 
ATOM   1528 C  C     . ARG D 4 45 ? 41.433 4.453   48.054  1.00 26.42 ? 1272 ARG B C     1 
ATOM   1529 O  O     . ARG D 4 45 ? 41.823 4.256   49.208  1.00 35.04 ? 1272 ARG B O     1 
ATOM   1530 C  CB    . ARG D 4 45 ? 39.014 4.586   48.593  1.00 34.33 ? 1272 ARG B CB    1 
ATOM   1531 N  N     . ASP D 4 46 ? 42.111 4.003   47.002  1.00 20.90 ? 1273 ASP B N     1 
ATOM   1532 C  CA    . ASP D 4 46 ? 43.349 3.253   47.151  1.00 22.30 ? 1273 ASP B CA    1 
ATOM   1533 C  C     . ASP D 4 46 ? 44.503 3.893   46.401  1.00 22.27 ? 1273 ASP B C     1 
ATOM   1534 O  O     . ASP D 4 46 ? 44.889 5.042   46.653  1.00 27.56 ? 1273 ASP B O     1 
ATOM   1535 C  CB    . ASP D 4 46 ? 43.094 1.814   46.707  1.00 37.39 ? 1273 ASP B CB    1 
ATOM   1536 N  N     . ASN D 4 47 ? 45.110 3.194   45.444  1.00 20.08 ? 1274 ASN B N     1 
ATOM   1537 C  CA    . ASN D 4 47 ? 46.295 3.734   44.823  1.00 13.94 ? 1274 ASN B CA    1 
ATOM   1538 C  C     . ASN D 4 47 ? 46.175 3.953   43.314  1.00 17.60 ? 1274 ASN B C     1 
ATOM   1539 O  O     . ASN D 4 47 ? 47.233 3.978   42.674  1.00 17.01 ? 1274 ASN B O     1 
ATOM   1540 C  CB    . ASN D 4 47 ? 47.481 2.794   45.094  1.00 24.92 ? 1274 ASN B CB    1 
ATOM   1541 C  CG    . ASN D 4 47 ? 47.360 2.169   46.481  1.00 45.98 ? 1274 ASN B CG    1 
ATOM   1542 O  OD1   . ASN D 4 47 ? 46.499 1.315   46.721  1.00 73.00 ? 1274 ASN B OD1   1 
ATOM   1543 N  ND2   . ASN D 4 47 ? 48.214 2.608   47.400  1.00 57.86 ? 1274 ASN B ND2   1 
ATOM   1544 N  N     . LYS D 4 48 ? 44.965 4.115   42.835  1.00 18.98 ? 1275 LYS B N     1 
ATOM   1545 C  CA    . LYS D 4 48 ? 44.641 4.394   41.447  1.00 15.91 ? 1275 LYS B CA    1 
ATOM   1546 C  C     . LYS D 4 48 ? 45.109 3.280   40.523  1.00 12.63 ? 1275 LYS B C     1 
ATOM   1547 O  O     . LYS D 4 48 ? 45.418 3.539   39.355  1.00 17.78 ? 1275 LYS B O     1 
ATOM   1548 C  CB    . LYS D 4 48 ? 45.210 5.752   41.001  1.00 14.54 ? 1275 LYS B CB    1 
ATOM   1549 C  CG    . LYS D 4 48 ? 44.649 6.921   41.810  1.00 15.43 ? 1275 LYS B CG    1 
ATOM   1550 C  CD    . LYS D 4 48 ? 45.285 8.229   41.353  1.00 24.79 ? 1275 LYS B CD    1 
ATOM   1551 C  CE    . LYS D 4 48 ? 44.598 9.409   42.027  1.00 34.33 ? 1275 LYS B CE    1 
ATOM   1552 N  NZ    . LYS D 4 48 ? 45.119 9.619   43.407  1.00 47.74 ? 1275 LYS B NZ    1 
ATOM   1553 N  N     . ASP D 4 49 ? 45.149 2.046   41.021  1.00 15.84 ? 1276 ASP B N     1 
ATOM   1554 C  CA    . ASP D 4 49 ? 45.550 0.915   40.184  1.00 14.28 ? 1276 ASP B CA    1 
ATOM   1555 C  C     . ASP D 4 49 ? 44.746 -0.331  40.569  1.00 19.00 ? 1276 ASP B C     1 
ATOM   1556 O  O     . ASP D 4 49 ? 45.295 -1.428  40.441  1.00 18.53 ? 1276 ASP B O     1 
ATOM   1557 C  CB    . ASP D 4 49 ? 47.043 0.639   40.254  1.00 14.34 ? 1276 ASP B CB    1 
ATOM   1558 C  CG    . ASP D 4 49 ? 47.620 0.279   41.601  1.00 22.42 ? 1276 ASP B CG    1 
ATOM   1559 O  OD1   . ASP D 4 49 ? 46.839 0.189   42.564  1.00 20.67 ? 1276 ASP B OD1   1 
ATOM   1560 O  OD2   . ASP D 4 49 ? 48.859 0.100   41.685  1.00 21.85 ? 1276 ASP B OD2   1 
ATOM   1561 N  N     . CYS D 4 50 ? 43.507 -0.121  40.977  1.00 17.35 ? 1277 CYS B N     1 
ATOM   1562 C  CA    . CYS D 4 50 ? 42.556 -1.170  41.313  1.00 13.93 ? 1277 CYS B CA    1 
ATOM   1563 C  C     . CYS D 4 50 ? 42.368 -2.145  40.152  1.00 24.47 ? 1277 CYS B C     1 
ATOM   1564 O  O     . CYS D 4 50 ? 42.366 -1.749  38.985  1.00 14.34 ? 1277 CYS B O     1 
ATOM   1565 C  CB    . CYS D 4 50 ? 41.204 -0.585  41.719  1.00 14.53 ? 1277 CYS B CB    1 
ATOM   1566 S  SG    . CYS D 4 50 ? 41.262 0.384   43.246  1.00 16.20 ? 1277 CYS B SG    1 
ATOM   1567 N  N     . LEU D 4 51 ? 42.209 -3.414  40.517  1.00 20.75 ? 1278 LEU B N     1 
ATOM   1568 C  CA    . LEU D 4 51 ? 42.029 -4.459  39.518  1.00 29.65 ? 1278 LEU B CA    1 
ATOM   1569 C  C     . LEU D 4 51 ? 40.613 -4.446  38.977  1.00 18.26 ? 1278 LEU B C     1 
ATOM   1570 O  O     . LEU D 4 51 ? 39.668 -4.444  39.761  1.00 20.68 ? 1278 LEU B O     1 
ATOM   1571 C  CB    . LEU D 4 51 ? 42.315 -5.841  40.116  1.00 37.17 ? 1278 LEU B CB    1 
ATOM   1572 C  CG    . LEU D 4 51 ? 41.638 -6.993  39.359  1.00 42.06 ? 1278 LEU B CG    1 
ATOM   1573 C  CD1   . LEU D 4 51 ? 42.581 -7.521  38.291  1.00 34.48 ? 1278 LEU B CD1   1 
ATOM   1574 C  CD2   . LEU D 4 51 ? 41.191 -8.088  40.313  1.00 47.48 ? 1278 LEU B CD2   1 
ATOM   1575 N  N     . ILE D 4 52 ? 40.441 -4.443  37.652  1.00 11.37 ? 1279 ILE B N     1 
ATOM   1576 C  CA    . ILE D 4 52 ? 39.103 -4.432  37.089  1.00 13.33 ? 1279 ILE B CA    1 
ATOM   1577 C  C     . ILE D 4 52 ? 38.820 -5.770  36.405  1.00 15.51 ? 1279 ILE B C     1 
ATOM   1578 O  O     . ILE D 4 52 ? 39.416 -6.127  35.402  1.00 16.29 ? 1279 ILE B O     1 
ATOM   1579 C  CB    . ILE D 4 52 ? 38.859 -3.301  36.067  1.00 11.58 ? 1279 ILE B CB    1 
ATOM   1580 C  CG1   . ILE D 4 52 ? 39.390 -1.942  36.548  1.00 15.07 ? 1279 ILE B CG1   1 
ATOM   1581 C  CG2   . ILE D 4 52 ? 37.396 -3.224  35.672  1.00 12.58 ? 1279 ILE B CG2   1 
ATOM   1582 C  CD1   . ILE D 4 52 ? 38.603 -1.408  37.734  1.00 14.27 ? 1279 ILE B CD1   1 
ATOM   1583 N  N     . ASP D 4 53 ? 37.888 -6.494  36.982  1.00 15.61 ? 1280 ASP B N     1 
ATOM   1584 C  CA    . ASP D 4 53 ? 37.357 -7.734  36.420  1.00 14.41 ? 1280 ASP B CA    1 
ATOM   1585 C  C     . ASP D 4 53 ? 35.875 -7.772  36.691  1.00 12.34 ? 1280 ASP B C     1 
ATOM   1586 O  O     . ASP D 4 53 ? 35.306 -6.872  37.312  1.00 13.87 ? 1280 ASP B O     1 
ATOM   1587 C  CB    . ASP D 4 53 ? 38.125 -8.941  36.962  1.00 15.64 ? 1280 ASP B CB    1 
ATOM   1588 C  CG    . ASP D 4 53 ? 37.964 -9.194  38.449  1.00 20.06 ? 1280 ASP B CG    1 
ATOM   1589 O  OD1   . ASP D 4 53 ? 38.870 -9.855  39.014  1.00 26.93 ? 1280 ASP B OD1   1 
ATOM   1590 O  OD2   . ASP D 4 53 ? 36.977 -8.756  39.060  1.00 17.74 ? 1280 ASP B OD2   1 
ATOM   1591 N  N     . LYS D 4 54 ? 35.216 -8.820  36.201  1.00 11.32 ? 1281 LYS B N     1 
ATOM   1592 C  CA    . LYS D 4 54 ? 33.775 -8.872  36.221  1.00 14.31 ? 1281 LYS B CA    1 
ATOM   1593 C  C     . LYS D 4 54 ? 33.263 -8.783  37.649  1.00 12.62 ? 1281 LYS B C     1 
ATOM   1594 O  O     . LYS D 4 54 ? 32.311 -8.085  37.952  1.00 15.36 ? 1281 LYS B O     1 
ATOM   1595 C  CB    . LYS D 4 54 ? 33.272 -10.154 35.538  1.00 15.67 ? 1281 LYS B CB    1 
ATOM   1596 C  CG    . LYS D 4 54 ? 31.785 -10.225 35.345  1.00 18.75 ? 1281 LYS B CG    1 
ATOM   1597 C  CD    . LYS D 4 54 ? 31.303 -11.543 34.757  1.00 17.45 ? 1281 LYS B CD    1 
ATOM   1598 C  CE    . LYS D 4 54 ? 29.791 -11.561 34.655  1.00 28.15 ? 1281 LYS B CE    1 
ATOM   1599 N  NZ    . LYS D 4 54 ? 29.293 -12.725 33.861  1.00 31.26 ? 1281 LYS B NZ    1 
ATOM   1600 N  N     . ARG D 4 55 ? 33.917 -9.485  38.566  1.00 13.87 ? 1282 ARG B N     1 
ATOM   1601 C  CA    . ARG D 4 55 ? 33.345 -9.492  39.919  1.00 20.17 ? 1282 ARG B CA    1 
ATOM   1602 C  C     . ARG D 4 55 ? 33.630 -8.236  40.723  1.00 20.02 ? 1282 ARG B C     1 
ATOM   1603 O  O     . ARG D 4 55 ? 32.860 -7.939  41.656  1.00 22.07 ? 1282 ARG B O     1 
ATOM   1604 C  CB    . ARG D 4 55 ? 33.878 -10.741 40.636  1.00 33.65 ? 1282 ARG B CB    1 
ATOM   1605 C  CG    . ARG D 4 55 ? 34.421 -10.520 42.028  1.00 49.28 ? 1282 ARG B CG    1 
ATOM   1606 C  CD    . ARG D 4 55 ? 35.607 -11.436 42.314  1.00 60.30 ? 1282 ARG B CD    1 
ATOM   1607 N  NE    . ARG D 4 55 ? 35.444 -12.152 43.579  1.00 65.18 ? 1282 ARG B NE    1 
ATOM   1608 C  CZ    . ARG D 4 55 ? 34.466 -13.017 43.818  1.00 62.61 ? 1282 ARG B CZ    1 
ATOM   1609 N  NH1   . ARG D 4 55 ? 33.567 -13.256 42.870  1.00 66.79 ? 1282 ARG B NH1   1 
ATOM   1610 N  NH2   . ARG D 4 55 ? 34.384 -13.630 44.993  1.00 42.78 ? 1282 ARG B NH2   1 
ATOM   1611 N  N     . GLN D 4 56 ? 34.686 -7.469  40.443  1.00 12.93 ? 1283 GLN B N     1 
ATOM   1612 C  CA    . GLN D 4 56 ? 34.869 -6.260  41.257  1.00 17.06 ? 1283 GLN B CA    1 
ATOM   1613 C  C     . GLN D 4 56 ? 34.772 -4.959  40.467  1.00 17.43 ? 1283 GLN B C     1 
ATOM   1614 O  O     . GLN D 4 56 ? 35.195 -3.922  40.997  1.00 14.33 ? 1283 GLN B O     1 
ATOM   1615 C  CB    . GLN D 4 56 ? 36.182 -6.294  42.019  1.00 21.62 ? 1283 GLN B CB    1 
ATOM   1616 C  CG    . GLN D 4 56 ? 37.492 -6.330  41.280  1.00 22.49 ? 1283 GLN B CG    1 
ATOM   1617 C  CD    . GLN D 4 56 ? 38.681 -6.431  42.227  1.00 33.38 ? 1283 GLN B CD    1 
ATOM   1618 O  OE1   . GLN D 4 56 ? 39.499 -5.519  42.315  1.00 43.18 ? 1283 GLN B OE1   1 
ATOM   1619 N  NE2   . GLN D 4 56 ? 38.758 -7.548  42.945  1.00 30.63 ? 1283 GLN B NE2   1 
ATOM   1620 N  N     . ARG D 4 57 ? 34.233 -4.987  39.250  1.00 16.70 ? 1284 ARG B N     1 
ATOM   1621 C  CA    . ARG D 4 57 ? 34.276 -3.769  38.424  1.00 10.40 ? 1284 ARG B CA    1 
ATOM   1622 C  C     . ARG D 4 57 ? 33.556 -2.599  39.066  1.00 13.63 ? 1284 ARG B C     1 
ATOM   1623 O  O     . ARG D 4 57 ? 33.839 -1.435  38.768  1.00 12.68 ? 1284 ARG B O     1 
ATOM   1624 C  CB    . ARG D 4 57 ? 33.707 -4.102  37.046  1.00 7.79  ? 1284 ARG B CB    1 
ATOM   1625 C  CG    . ARG D 4 57 ? 32.214 -4.364  36.986  1.00 10.41 ? 1284 ARG B CG    1 
ATOM   1626 C  CD    . ARG D 4 57 ? 31.808 -5.008  35.671  1.00 11.56 ? 1284 ARG B CD    1 
ATOM   1627 N  NE    . ARG D 4 57 ? 30.441 -5.516  35.671  1.00 12.97 ? 1284 ARG B NE    1 
ATOM   1628 C  CZ    . ARG D 4 57 ? 29.865 -6.335  34.820  1.00 11.31 ? 1284 ARG B CZ    1 
ATOM   1629 N  NH1   . ARG D 4 57 ? 30.547 -6.814  33.792  1.00 11.50 ? 1284 ARG B NH1   1 
ATOM   1630 N  NH2   . ARG D 4 57 ? 28.606 -6.729  34.952  1.00 15.76 ? 1284 ARG B NH2   1 
ATOM   1631 N  N     . ASN D 4 58 ? 32.593 -2.840  39.967  1.00 12.45 ? 1285 ASN B N     1 
ATOM   1632 C  CA    . ASN D 4 58 ? 31.873 -1.727  40.563  1.00 11.69 ? 1285 ASN B CA    1 
ATOM   1633 C  C     . ASN D 4 58 ? 32.528 -1.181  41.832  1.00 19.43 ? 1285 ASN B C     1 
ATOM   1634 O  O     . ASN D 4 58 ? 32.065 -0.135  42.297  1.00 17.62 ? 1285 ASN B O     1 
ATOM   1635 C  CB    . ASN D 4 58 ? 30.419 -2.115  40.884  1.00 12.87 ? 1285 ASN B CB    1 
ATOM   1636 C  CG    . ASN D 4 58 ? 29.625 -2.362  39.608  1.00 21.19 ? 1285 ASN B CG    1 
ATOM   1637 O  OD1   . ASN D 4 58 ? 29.500 -1.490  38.744  1.00 14.90 ? 1285 ASN B OD1   1 
ATOM   1638 N  ND2   . ASN D 4 58 ? 29.117 -3.580  39.473  1.00 17.02 ? 1285 ASN B ND2   1 
ATOM   1639 N  N     . ARG D 4 59 ? 33.545 -1.839  42.344  1.00 13.06 ? 1286 ARG B N     1 
ATOM   1640 C  CA    . ARG D 4 59 ? 34.164 -1.432  43.607  1.00 12.74 ? 1286 ARG B CA    1 
ATOM   1641 C  C     . ARG D 4 59 ? 34.807 -0.054  43.554  1.00 16.52 ? 1286 ARG B C     1 
ATOM   1642 O  O     . ARG D 4 59 ? 34.681 0.708   44.529  1.00 15.36 ? 1286 ARG B O     1 
ATOM   1643 C  CB    . ARG D 4 59 ? 35.202 -2.465  44.075  1.00 17.08 ? 1286 ARG B CB    1 
ATOM   1644 C  CG    . ARG D 4 59 ? 35.437 -2.317  45.579  1.00 22.18 ? 1286 ARG B CG    1 
ATOM   1645 C  CD    . ARG D 4 59 ? 35.817 -3.654  46.206  1.00 38.22 ? 1286 ARG B CD    1 
ATOM   1646 N  NE    . ARG D 4 59 ? 37.218 -3.980  45.986  1.00 45.54 ? 1286 ARG B NE    1 
ATOM   1647 C  CZ    . ARG D 4 59 ? 37.956 -4.914  46.560  1.00 53.30 ? 1286 ARG B CZ    1 
ATOM   1648 N  NH1   . ARG D 4 59 ? 37.478 -5.736  47.483  1.00 37.94 ? 1286 ARG B NH1   1 
ATOM   1649 N  NH2   . ARG D 4 59 ? 39.233 -5.032  46.193  1.00 69.66 ? 1286 ARG B NH2   1 
ATOM   1650 N  N     . CYS D 4 60 ? 35.473 0.283   42.465  1.00 14.36 ? 1287 CYS B N     1 
ATOM   1651 C  CA    . CYS D 4 60 ? 36.157 1.554   42.264  1.00 10.54 ? 1287 CYS B CA    1 
ATOM   1652 C  C     . CYS D 4 60 ? 35.789 2.131   40.875  1.00 14.29 ? 1287 CYS B C     1 
ATOM   1653 O  O     . CYS D 4 60 ? 36.314 1.640   39.879  1.00 14.47 ? 1287 CYS B O     1 
ATOM   1654 C  CB    . CYS D 4 60 ? 37.677 1.473   42.343  1.00 13.80 ? 1287 CYS B CB    1 
ATOM   1655 S  SG    . CYS D 4 60 ? 38.476 3.099   42.230  1.00 15.21 ? 1287 CYS B SG    1 
ATOM   1656 N  N     . GLN D 4 61 ? 34.917 3.120   40.894  1.00 11.91 ? 1288 GLN B N     1 
ATOM   1657 C  CA    . GLN D 4 61 ? 34.435 3.819   39.715  1.00 11.10 ? 1288 GLN B CA    1 
ATOM   1658 C  C     . GLN D 4 61 ? 35.594 4.584   39.078  1.00 16.46 ? 1288 GLN B C     1 
ATOM   1659 O  O     . GLN D 4 61 ? 35.671 4.587   37.849  1.00 12.74 ? 1288 GLN B O     1 
ATOM   1660 C  CB    . GLN D 4 61 ? 33.303 4.774   40.036  1.00 10.77 ? 1288 GLN B CB    1 
ATOM   1661 C  CG    . GLN D 4 61 ? 31.997 4.154   40.531  1.00 12.15 ? 1288 GLN B CG    1 
ATOM   1662 C  CD    . GLN D 4 61 ? 30.981 5.244   40.826  1.00 19.79 ? 1288 GLN B CD    1 
ATOM   1663 O  OE1   . GLN D 4 61 ? 31.244 6.083   41.689  1.00 18.91 ? 1288 GLN B OE1   1 
ATOM   1664 N  NE2   . GLN D 4 61 ? 29.861 5.251   40.108  1.00 20.87 ? 1288 GLN B NE2   1 
ATOM   1665 N  N     . TYR D 4 62 ? 36.460 5.211   39.877  1.00 14.09 ? 1289 TYR B N     1 
ATOM   1666 C  CA    . TYR D 4 62 ? 37.616 5.880   39.303  1.00 11.59 ? 1289 TYR B CA    1 
ATOM   1667 C  C     . TYR D 4 62 ? 38.409 4.965   38.389  1.00 12.25 ? 1289 TYR B C     1 
ATOM   1668 O  O     . TYR D 4 62 ? 38.781 5.281   37.252  1.00 11.53 ? 1289 TYR B O     1 
ATOM   1669 C  CB    . TYR D 4 62 ? 38.575 6.412   40.391  1.00 9.08  ? 1289 TYR B CB    1 
ATOM   1670 C  CG    . TYR D 4 62 ? 39.837 7.028   39.825  1.00 9.15  ? 1289 TYR B CG    1 
ATOM   1671 C  CD1   . TYR D 4 62 ? 39.793 8.367   39.421  1.00 20.09 ? 1289 TYR B CD1   1 
ATOM   1672 C  CD2   . TYR D 4 62 ? 41.049 6.402   39.666  1.00 9.25  ? 1289 TYR B CD2   1 
ATOM   1673 C  CE1   . TYR D 4 62 ? 40.890 9.009   38.896  1.00 15.64 ? 1289 TYR B CE1   1 
ATOM   1674 C  CE2   . TYR D 4 62 ? 42.169 7.012   39.133  1.00 12.31 ? 1289 TYR B CE2   1 
ATOM   1675 C  CZ    . TYR D 4 62 ? 42.078 8.336   38.750  1.00 17.36 ? 1289 TYR B CZ    1 
ATOM   1676 O  OH    . TYR D 4 62 ? 43.172 8.982   38.220  1.00 21.46 ? 1289 TYR B OH    1 
ATOM   1677 N  N     . CYS D 4 63 ? 38.807 3.805   38.929  1.00 11.46 ? 1290 CYS B N     1 
ATOM   1678 C  CA    . CYS D 4 63 ? 39.714 2.944   38.199  1.00 9.06  ? 1290 CYS B CA    1 
ATOM   1679 C  C     . CYS D 4 63 ? 38.968 2.252   37.044  1.00 6.85  ? 1290 CYS B C     1 
ATOM   1680 O  O     . CYS D 4 63 ? 39.561 1.901   36.022  1.00 10.43 ? 1290 CYS B O     1 
ATOM   1681 C  CB    . CYS D 4 63 ? 40.401 1.937   39.130  1.00 12.65 ? 1290 CYS B CB    1 
ATOM   1682 S  SG    . CYS D 4 63 ? 41.660 2.667   40.216  1.00 12.79 ? 1290 CYS B SG    1 
ATOM   1683 N  N     . ARG D 4 64 ? 37.691 2.030   37.167  1.00 8.26  ? 1291 ARG B N     1 
ATOM   1684 C  CA    . ARG D 4 64 ? 36.924 1.454   36.048  1.00 9.81  ? 1291 ARG B CA    1 
ATOM   1685 C  C     . ARG D 4 64 ? 36.917 2.456   34.887  1.00 9.64  ? 1291 ARG B C     1 
ATOM   1686 O  O     . ARG D 4 64 ? 37.156 2.114   33.734  1.00 8.81  ? 1291 ARG B O     1 
ATOM   1687 C  CB    . ARG D 4 64 ? 35.533 1.114   36.503  1.00 7.72  ? 1291 ARG B CB    1 
ATOM   1688 C  CG    . ARG D 4 64 ? 34.681 0.440   35.419  1.00 10.44 ? 1291 ARG B CG    1 
ATOM   1689 C  CD    . ARG D 4 64 ? 33.232 0.237   35.812  1.00 10.11 ? 1291 ARG B CD    1 
ATOM   1690 N  NE    . ARG D 4 64 ? 32.557 -0.729  34.934  1.00 11.92 ? 1291 ARG B NE    1 
ATOM   1691 C  CZ    . ARG D 4 64 ? 31.321 -1.186  35.059  1.00 8.04  ? 1291 ARG B CZ    1 
ATOM   1692 N  NH1   . ARG D 4 64 ? 30.487 -0.800  36.045  1.00 10.28 ? 1291 ARG B NH1   1 
ATOM   1693 N  NH2   . ARG D 4 64 ? 30.818 -2.065  34.201  1.00 10.10 ? 1291 ARG B NH2   1 
ATOM   1694 N  N     . TYR D 4 65 ? 36.620 3.722   35.184  1.00 10.70 ? 1292 TYR B N     1 
ATOM   1695 C  CA    . TYR D 4 65 ? 36.609 4.718   34.106  1.00 12.78 ? 1292 TYR B CA    1 
ATOM   1696 C  C     . TYR D 4 65 ? 37.977 4.927   33.485  1.00 9.02  ? 1292 TYR B C     1 
ATOM   1697 O  O     . TYR D 4 65 ? 38.120 5.063   32.257  1.00 8.29  ? 1292 TYR B O     1 
ATOM   1698 C  CB    . TYR D 4 65 ? 36.091 6.048   34.654  1.00 6.77  ? 1292 TYR B CB    1 
ATOM   1699 C  CG    . TYR D 4 65 ? 36.022 7.140   33.597  1.00 4.87  ? 1292 TYR B CG    1 
ATOM   1700 C  CD1   . TYR D 4 65 ? 35.143 7.032   32.543  1.00 7.65  ? 1292 TYR B CD1   1 
ATOM   1701 C  CD2   . TYR D 4 65 ? 36.856 8.247   33.711  1.00 12.83 ? 1292 TYR B CD2   1 
ATOM   1702 C  CE1   . TYR D 4 65 ? 35.096 8.040   31.590  1.00 15.93 ? 1292 TYR B CE1   1 
ATOM   1703 C  CE2   . TYR D 4 65 ? 36.815 9.259   32.766  1.00 14.61 ? 1292 TYR B CE2   1 
ATOM   1704 C  CZ    . TYR D 4 65 ? 35.930 9.134   31.718  1.00 16.12 ? 1292 TYR B CZ    1 
ATOM   1705 O  OH    . TYR D 4 65 ? 35.889 10.148  30.776  1.00 24.16 ? 1292 TYR B OH    1 
ATOM   1706 N  N     . GLN D 4 66 ? 39.027 4.974   34.297  1.00 7.99  ? 1293 GLN B N     1 
ATOM   1707 C  CA    . GLN D 4 66 ? 40.374 5.157   33.805  1.00 7.50  ? 1293 GLN B CA    1 
ATOM   1708 C  C     . GLN D 4 66 ? 40.737 3.962   32.890  1.00 6.95  ? 1293 GLN B C     1 
ATOM   1709 O  O     . GLN D 4 66 ? 41.444 4.193   31.916  1.00 9.85  ? 1293 GLN B O     1 
ATOM   1710 C  CB    . GLN D 4 66 ? 41.425 5.323   34.887  1.00 13.03 ? 1293 GLN B CB    1 
ATOM   1711 C  CG    . GLN D 4 66 ? 41.325 6.661   35.637  1.00 12.83 ? 1293 GLN B CG    1 
ATOM   1712 C  CD    . GLN D 4 66 ? 41.431 7.878   34.728  1.00 13.45 ? 1293 GLN B CD    1 
ATOM   1713 O  OE1   . GLN D 4 66 ? 42.269 7.961   33.829  1.00 15.86 ? 1293 GLN B OE1   1 
ATOM   1714 N  NE2   . GLN D 4 66 ? 40.577 8.877   34.931  1.00 13.91 ? 1293 GLN B NE2   1 
ATOM   1715 N  N     . LYS D 4 67 ? 40.240 2.765   33.201  1.00 9.56  ? 1294 LYS B N     1 
ATOM   1716 C  CA    . LYS D 4 67 ? 40.557 1.609   32.344  1.00 8.91  ? 1294 LYS B CA    1 
ATOM   1717 C  C     . LYS D 4 67 ? 39.736 1.694   31.062  1.00 8.03  ? 1294 LYS B C     1 
ATOM   1718 O  O     . LYS D 4 67 ? 40.203 1.296   30.003  1.00 11.54 ? 1294 LYS B O     1 
ATOM   1719 C  CB    . LYS D 4 67 ? 40.293 0.275   33.041  1.00 7.88  ? 1294 LYS B CB    1 
ATOM   1720 C  CG    . LYS D 4 67 ? 40.785 -0.929  32.255  1.00 10.68 ? 1294 LYS B CG    1 
ATOM   1721 C  CD    . LYS D 4 67 ? 40.729 -2.217  33.059  1.00 11.63 ? 1294 LYS B CD    1 
ATOM   1722 C  CE    . LYS D 4 67 ? 41.347 -3.377  32.277  1.00 11.46 ? 1294 LYS B CE    1 
ATOM   1723 N  NZ    . LYS D 4 67 ? 41.368 -4.612  33.114  1.00 12.98 ? 1294 LYS B NZ    1 
ATOM   1724 N  N     . CYS D 4 68 ? 38.511 2.210   31.142  1.00 8.01  ? 1295 CYS B N     1 
ATOM   1725 C  CA    . CYS D 4 68 ? 37.742 2.432   29.917  1.00 9.70  ? 1295 CYS B CA    1 
ATOM   1726 C  C     . CYS D 4 68 ? 38.549 3.287   28.944  1.00 9.77  ? 1295 CYS B C     1 
ATOM   1727 O  O     . CYS D 4 68 ? 38.658 2.988   27.753  1.00 8.46  ? 1295 CYS B O     1 
ATOM   1728 C  CB    . CYS D 4 68 ? 36.427 3.116   30.221  1.00 7.07  ? 1295 CYS B CB    1 
ATOM   1729 S  SG    . CYS D 4 68 ? 35.110 2.127   30.965  1.00 9.96  ? 1295 CYS B SG    1 
ATOM   1730 N  N     . LEU D 4 69 ? 39.105 4.371   29.490  1.00 6.26  ? 1296 LEU B N     1 
ATOM   1731 C  CA    . LEU D 4 69 ? 39.918 5.250   28.659  1.00 7.51  ? 1296 LEU B CA    1 
ATOM   1732 C  C     . LEU D 4 69 ? 41.193 4.584   28.188  1.00 9.02  ? 1296 LEU B C     1 
ATOM   1733 O  O     . LEU D 4 69 ? 41.618 4.725   27.033  1.00 11.23 ? 1296 LEU B O     1 
ATOM   1734 C  CB    . LEU D 4 69 ? 40.291 6.543   29.384  1.00 6.74  ? 1296 LEU B CB    1 
ATOM   1735 C  CG    . LEU D 4 69 ? 39.149 7.479   29.745  1.00 9.90  ? 1296 LEU B CG    1 
ATOM   1736 C  CD1   . LEU D 4 69 ? 39.654 8.617   30.641  1.00 13.36 ? 1296 LEU B CD1   1 
ATOM   1737 C  CD2   . LEU D 4 69 ? 38.467 8.007   28.484  1.00 12.35 ? 1296 LEU B CD2   1 
ATOM   1738 N  N     . ALA D 4 70 ? 41.914 3.879   29.029  1.00 7.23  ? 1297 ALA B N     1 
ATOM   1739 C  CA    . ALA D 4 70 ? 43.205 3.315   28.718  1.00 6.69  ? 1297 ALA B CA    1 
ATOM   1740 C  C     . ALA D 4 70 ? 43.125 2.172   27.708  1.00 5.25  ? 1297 ALA B C     1 
ATOM   1741 O  O     . ALA D 4 70 ? 44.137 1.943   27.049  1.00 11.39 ? 1297 ALA B O     1 
ATOM   1742 C  CB    . ALA D 4 70 ? 43.867 2.853   30.004  1.00 10.62 ? 1297 ALA B CB    1 
ATOM   1743 N  N     . MET D 4 71 ? 41.954 1.532   27.652  1.00 7.77  ? 1298 MET B N     1 
ATOM   1744 C  CA    . MET D 4 71 ? 41.745 0.494   26.660  1.00 9.48  ? 1298 MET B CA    1 
ATOM   1745 C  C     . MET D 4 71 ? 41.270 1.086   25.338  1.00 11.07 ? 1298 MET B C     1 
ATOM   1746 O  O     . MET D 4 71 ? 41.201 0.369   24.344  1.00 11.02 ? 1298 MET B O     1 
ATOM   1747 C  CB    . MET D 4 71 ? 40.779 -0.559  27.201  1.00 12.89 ? 1298 MET B CB    1 
ATOM   1748 C  CG    . MET D 4 71 ? 41.290 -1.224  28.483  1.00 8.64  ? 1298 MET B CG    1 
ATOM   1749 S  SD    . MET D 4 71 ? 42.973 -1.860  28.392  1.00 15.25 ? 1298 MET B SD    1 
ATOM   1750 C  CE    . MET D 4 71 ? 42.742 -3.211  27.258  1.00 13.62 ? 1298 MET B CE    1 
ATOM   1751 N  N     . GLY D 4 72 ? 40.960 2.381   25.314  1.00 7.63  ? 1299 GLY B N     1 
ATOM   1752 C  CA    . GLY D 4 72 ? 40.687 3.050   24.059  1.00 7.78  ? 1299 GLY B CA    1 
ATOM   1753 C  C     . GLY D 4 72 ? 39.380 3.736   23.880  1.00 9.18  ? 1299 GLY B C     1 
ATOM   1754 O  O     . GLY D 4 72 ? 39.062 4.248   22.801  1.00 10.63 ? 1299 GLY B O     1 
ATOM   1755 N  N     . MET D 4 73 ? 38.510 3.788   24.892  1.00 9.24  ? 1300 MET B N     1 
ATOM   1756 C  CA    . MET D 4 73 ? 37.189 4.354   24.691  1.00 7.44  ? 1300 MET B CA    1 
ATOM   1757 C  C     . MET D 4 73 ? 37.256 5.854   24.405  1.00 11.44 ? 1300 MET B C     1 
ATOM   1758 O  O     . MET D 4 73 ? 38.016 6.580   25.051  1.00 9.49  ? 1300 MET B O     1 
ATOM   1759 C  CB    . MET D 4 73 ? 36.248 4.098   25.885  1.00 9.65  ? 1300 MET B CB    1 
ATOM   1760 C  CG    . MET D 4 73 ? 35.768 2.645   25.895  1.00 13.03 ? 1300 MET B CG    1 
ATOM   1761 S  SD    . MET D 4 73 ? 34.385 2.422   27.037  1.00 18.68 ? 1300 MET B SD    1 
ATOM   1762 C  CE    . MET D 4 73 ? 33.865 0.769   26.610  1.00 23.54 ? 1300 MET B CE    1 
ATOM   1763 N  N     . LYS D 4 74 ? 36.448 6.250   23.424  1.00 9.42  ? 1301 LYS B N     1 
ATOM   1764 C  CA    . LYS D 4 74 ? 36.431 7.606   22.899  1.00 9.79  ? 1301 LYS B CA    1 
ATOM   1765 C  C     . LYS D 4 74 ? 35.263 8.432   23.414  1.00 8.00  ? 1301 LYS B C     1 
ATOM   1766 O  O     . LYS D 4 74 ? 34.099 8.195   23.080  1.00 9.30  ? 1301 LYS B O     1 
ATOM   1767 C  CB    . LYS D 4 74 ? 36.371 7.482   21.374  1.00 10.47 ? 1301 LYS B CB    1 
ATOM   1768 C  CG    . LYS D 4 74 ? 37.505 6.663   20.774  1.00 12.88 ? 1301 LYS B CG    1 
ATOM   1769 C  CD    . LYS D 4 74 ? 37.261 6.501   19.263  1.00 13.63 ? 1301 LYS B CD    1 
ATOM   1770 C  CE    . LYS D 4 74 ? 38.339 5.609   18.661  1.00 25.81 ? 1301 LYS B CE    1 
ATOM   1771 N  NZ    . LYS D 4 74 ? 37.882 5.084   17.340  1.00 30.10 ? 1301 LYS B NZ    1 
ATOM   1772 N  N     . ARG D 4 75 ? 35.579 9.440   24.240  1.00 7.70  ? 1302 ARG B N     1 
ATOM   1773 C  CA    . ARG D 4 75 ? 34.524 10.294  24.793  1.00 6.12  ? 1302 ARG B CA    1 
ATOM   1774 C  C     . ARG D 4 75 ? 33.657 10.887  23.683  1.00 5.20  ? 1302 ARG B C     1 
ATOM   1775 O  O     . ARG D 4 75 ? 32.441 11.029  23.803  1.00 9.83  ? 1302 ARG B O     1 
ATOM   1776 C  CB    . ARG D 4 75 ? 35.162 11.354  25.697  1.00 14.12 ? 1302 ARG B CB    1 
ATOM   1777 C  CG    . ARG D 4 75 ? 35.693 10.795  27.010  1.00 13.52 ? 1302 ARG B CG    1 
ATOM   1778 C  CD    . ARG D 4 75 ? 36.695 11.765  27.643  1.00 29.96 ? 1302 ARG B CD    1 
ATOM   1779 N  NE    . ARG D 4 75 ? 36.419 13.130  27.318  1.00 33.68 ? 1302 ARG B NE    1 
ATOM   1780 C  CZ    . ARG D 4 75 ? 37.084 14.241  27.120  1.00 18.79 ? 1302 ARG B CZ    1 
ATOM   1781 N  NH1   . ARG D 4 75 ? 38.418 14.400  27.184  1.00 13.25 ? 1302 ARG B NH1   1 
ATOM   1782 N  NH2   . ARG D 4 75 ? 36.363 15.334  26.822  1.00 22.74 ? 1302 ARG B NH2   1 
ATOM   1783 N  N     . GLU D 4 76 ? 34.278 11.249  22.570  1.00 9.61  ? 1303 GLU B N     1 
ATOM   1784 C  CA    . GLU D 4 76 ? 33.594 11.953  21.485  1.00 7.67  ? 1303 GLU B CA    1 
ATOM   1785 C  C     . GLU D 4 76 ? 32.658 11.054  20.686  1.00 9.65  ? 1303 GLU B C     1 
ATOM   1786 O  O     . GLU D 4 76 ? 31.820 11.515  19.898  1.00 10.47 ? 1303 GLU B O     1 
ATOM   1787 C  CB    . GLU D 4 76 ? 34.627 12.624  20.581  1.00 13.16 ? 1303 GLU B CB    1 
ATOM   1788 C  CG    . GLU D 4 76 ? 35.400 11.773  19.615  1.00 14.47 ? 1303 GLU B CG    1 
ATOM   1789 C  CD    . GLU D 4 76 ? 36.639 11.086  20.140  1.00 17.34 ? 1303 GLU B CD    1 
ATOM   1790 O  OE1   . GLU D 4 76 ? 36.782 10.958  21.374  1.00 10.94 ? 1303 GLU B OE1   1 
ATOM   1791 O  OE2   . GLU D 4 76 ? 37.477 10.693  19.286  1.00 16.51 ? 1303 GLU B OE2   1 
ATOM   1792 N  N     . ALA D 4 77 ? 32.771 9.743   20.899  1.00 12.87 ? 1304 ALA B N     1 
ATOM   1793 C  CA    . ALA D 4 77 ? 31.846 8.772   20.301  1.00 11.89 ? 1304 ALA B CA    1 
ATOM   1794 C  C     . ALA D 4 77 ? 30.540 8.699   21.059  1.00 9.53  ? 1304 ALA B C     1 
ATOM   1795 O  O     . ALA D 4 77 ? 29.560 8.130   20.561  1.00 10.23 ? 1304 ALA B O     1 
ATOM   1796 C  CB    . ALA D 4 77 ? 32.451 7.370   20.260  1.00 10.06 ? 1304 ALA B CB    1 
ATOM   1797 N  N     . VAL D 4 78 ? 30.480 9.256   22.264  1.00 8.31  ? 1305 VAL B N     1 
ATOM   1798 C  CA    . VAL D 4 78 ? 29.203 9.435   22.956  1.00 8.16  ? 1305 VAL B CA    1 
ATOM   1799 C  C     . VAL D 4 78 ? 28.468 10.604  22.317  1.00 10.95 ? 1305 VAL B C     1 
ATOM   1800 O  O     . VAL D 4 78 ? 29.091 11.660  22.157  1.00 13.43 ? 1305 VAL B O     1 
ATOM   1801 C  CB    . VAL D 4 78 ? 29.415 9.660   24.466  1.00 15.32 ? 1305 VAL B CB    1 
ATOM   1802 C  CG1   . VAL D 4 78 ? 28.077 9.943   25.127  1.00 11.64 ? 1305 VAL B CG1   1 
ATOM   1803 C  CG2   . VAL D 4 78 ? 30.103 8.455   25.085  1.00 11.43 ? 1305 VAL B CG2   1 
ATOM   1804 N  N     . GLN D 4 79 ? 27.228 10.421  21.921  1.00 8.64  ? 1306 GLN B N     1 
ATOM   1805 C  CA    . GLN D 4 79 ? 26.460 11.436  21.209  1.00 10.09 ? 1306 GLN B CA    1 
ATOM   1806 C  C     . GLN D 4 79 ? 25.572 12.223  22.149  1.00 11.49 ? 1306 GLN B C     1 
ATOM   1807 O  O     . GLN D 4 79 ? 25.453 11.937  23.335  1.00 13.85 ? 1306 GLN B O     1 
ATOM   1808 C  CB    . GLN D 4 79 ? 25.595 10.767  20.127  1.00 11.86 ? 1306 GLN B CB    1 
ATOM   1809 C  CG    . GLN D 4 79 ? 26.429 10.026  19.091  1.00 10.85 ? 1306 GLN B CG    1 
ATOM   1810 C  CD    . GLN D 4 79 ? 25.600 9.397   17.991  1.00 17.04 ? 1306 GLN B CD    1 
ATOM   1811 O  OE1   . GLN D 4 79 ? 24.383 9.492   18.000  1.00 20.48 ? 1306 GLN B OE1   1 
ATOM   1812 N  NE2   . GLN D 4 79 ? 26.257 8.758   17.025  1.00 19.76 ? 1306 GLN B NE2   1 
ATOM   1813 N  N     . GLU D 4 80 ? 24.879 13.210  21.573  1.00 21.54 ? 1307 GLU B N     1 
ATOM   1814 C  CA    . GLU D 4 80 ? 23.899 13.992  22.338  1.00 17.63 ? 1307 GLU B CA    1 
ATOM   1815 C  C     . GLU D 4 80 ? 22.629 13.150  22.509  1.00 15.09 ? 1307 GLU B C     1 
ATOM   1816 O  O     . GLU D 4 80 ? 22.426 12.158  21.813  1.00 19.16 ? 1307 GLU B O     1 
ATOM   1817 C  CB    . GLU D 4 80 ? 23.513 15.284  21.599  1.00 25.12 ? 1307 GLU B CB    1 
ATOM   1818 C  CG    . GLU D 4 80 ? 24.603 16.289  21.311  1.00 26.64 ? 1307 GLU B CG    1 
ATOM   1819 C  CD    . GLU D 4 80 ? 24.087 17.417  20.434  1.00 34.32 ? 1307 GLU B CD    1 
ATOM   1820 O  OE1   . GLU D 4 80 ? 24.076 17.250  19.192  1.00 37.89 ? 1307 GLU B OE1   1 
ATOM   1821 O  OE2   . GLU D 4 80 ? 23.700 18.464  20.989  1.00 37.68 ? 1307 GLU B OE2   1 
ATOM   1822 N  N     . GLU D 4 81 ? 21.844 13.565  23.494  1.00 25.76 ? 1308 GLU B N     1 
ATOM   1823 C  CA    . GLU D 4 81 ? 20.567 12.907  23.780  1.00 26.17 ? 1308 GLU B CA    1 
ATOM   1824 C  C     . GLU D 4 81 ? 19.719 12.960  22.534  1.00 29.08 ? 1308 GLU B C     1 
ATOM   1825 O  O     . GLU D 4 81 ? 19.826 13.895  21.738  1.00 28.55 ? 1308 GLU B O     1 
ATOM   1826 C  CB    . GLU D 4 81 ? 19.829 13.606  24.886  1.00 31.43 ? 1308 GLU B CB    1 
ATOM   1827 C  CG    . GLU D 4 81 ? 20.410 13.300  26.246  1.00 35.08 ? 1308 GLU B CG    1 
ATOM   1828 C  CD    . GLU D 4 81 ? 19.518 13.681  27.394  1.00 47.55 ? 1308 GLU B CD    1 
ATOM   1829 O  OE1   . GLU D 4 81 ? 18.813 12.797  27.909  1.00 47.71 ? 1308 GLU B OE1   1 
ATOM   1830 O  OE2   . GLU D 4 81 ? 19.528 14.874  27.771  1.00 40.08 ? 1308 GLU B OE2   1 
ATOM   1831 N  N     . ARG D 4 82 ? 18.906 11.999  22.306  1.00 28.56 ? 1309 ARG B N     1 
ATOM   1832 C  CA    . ARG D 4 82 ? 18.041 12.077  21.196  1.00 30.53 ? 1309 ARG B CA    1 
ATOM   1833 C  C     . ARG D 4 82 ? 16.773 12.028  21.816  1.00 31.20 ? 1309 ARG B C     1 
ATOM   1834 O  O     . ARG D 4 82 ? 16.598 11.931  23.021  1.00 31.21 ? 1309 ARG B O     1 
ATOM   1835 C  CB    . ARG D 4 82 ? 18.026 10.821  20.326  1.00 21.34 ? 1309 ARG B CB    1 
ATOM   1836 C  CG    . ARG D 4 82 ? 19.024 10.867  19.173  1.00 18.71 ? 1309 ARG B CG    1 
ATOM   1837 C  CD    . ARG D 4 82 ? 19.119 9.525   18.439  1.00 16.47 ? 1309 ARG B CD    1 
ATOM   1838 N  NE    . ARG D 4 82 ? 20.456 9.321   17.886  1.00 19.74 ? 1309 ARG B NE    1 
ATOM   1839 C  CZ    . ARG D 4 82 ? 20.891 8.263   17.187  1.00 15.08 ? 1309 ARG B CZ    1 
ATOM   1840 N  NH1   . ARG D 4 82 ? 20.072 7.252   16.957  1.00 22.14 ? 1309 ARG B NH1   1 
ATOM   1841 N  NH2   . ARG D 4 82 ? 22.139 8.229   16.732  1.00 21.37 ? 1309 ARG B NH2   1 
ATOM   1842 N  N     . GLN D 4 83 ? 15.847 12.064  21.005  1.00 20.00 ? 1310 GLN B N     1 
ATOM   1843 C  CA    . GLN D 4 83 ? 14.538 11.821  21.502  1.00 20.00 ? 1310 GLN B CA    1 
ATOM   1844 C  C     . GLN D 4 83 ? 13.981 11.161  20.305  1.00 20.00 ? 1310 GLN B C     1 
ATOM   1845 O  O     . GLN D 4 83 ? 13.220 10.204  20.304  1.00 20.00 ? 1310 GLN B O     1 
ATOM   1846 C  CB    . GLN D 4 83 ? 13.755 13.096  21.841  1.00 20.00 ? 1310 GLN B CB    1 
ATOM   1847 N  N     . ARG D 4 84 ? 14.482 11.824  19.236  1.00 20.00 ? 1311 ARG B N     1 
ATOM   1848 C  CA    . ARG D 4 84 ? 14.270 11.551  17.826  1.00 20.00 ? 1311 ARG B CA    1 
ATOM   1849 C  C     . ARG D 4 84 ? 12.810 11.643  17.456  1.00 20.00 ? 1311 ARG B C     1 
ATOM   1850 O  O     . ARG D 4 84 ? 12.313 12.711  17.099  1.00 20.00 ? 1311 ARG B O     1 
ATOM   1851 C  CB    . ARG D 4 84 ? 14.817 10.175  17.464  1.00 20.00 ? 1311 ARG B CB    1 
HETATM 1852 ZN ZN    . ZN  E 5 .  ? 21.136 14.252  4.974   1.00 17.03 ? 1121 ZN  A ZN    1 
HETATM 1853 ZN ZN    . ZN  F 5 .  ? 10.644 18.923  15.576  1.00 22.37 ? 1122 ZN  A ZN    1 
HETATM 1854 ZN ZN    . ZN  G 5 .  ? 33.053 -4.787  31.047  1.00 9.91  ? 1221 ZN  B ZN    1 
HETATM 1855 ZN ZN    . ZN  H 5 .  ? 40.801 2.535   42.354  1.00 15.24 ? 1222 ZN  B ZN    1 
HETATM 1856 O  O     . HOH I 6 .  ? 27.641 1.575   21.379  1.00 10.86 ? 2001 HOH C O     1 
HETATM 1857 O  O     . HOH I 6 .  ? 32.784 1.341   18.647  1.00 11.19 ? 2003 HOH C O     1 
HETATM 1858 O  O     . HOH I 6 .  ? 25.301 3.070   22.097  1.00 13.00 ? 2004 HOH C O     1 
HETATM 1859 O  O     . HOH I 6 .  ? 25.257 -0.968  20.889  1.00 19.98 ? 2014 HOH C O     1 
HETATM 1860 O  O     . HOH I 6 .  ? 28.089 4.576   15.465  1.00 21.05 ? 2027 HOH C O     1 
HETATM 1861 O  O     . HOH I 6 .  ? 33.870 0.344   16.191  1.00 15.48 ? 2029 HOH C O     1 
HETATM 1862 O  O     . HOH I 6 .  ? 28.064 0.296   12.117  1.00 19.46 ? 2051 HOH C O     1 
HETATM 1863 O  O     . HOH I 6 .  ? 21.026 6.063   31.750  1.00 21.26 ? 2052 HOH C O     1 
HETATM 1864 O  O     . HOH I 6 .  ? 32.286 -6.184  16.618  1.00 17.38 ? 2058 HOH C O     1 
HETATM 1865 O  O     . HOH I 6 .  ? 23.463 1.123   27.321  1.00 20.48 ? 2060 HOH C O     1 
HETATM 1866 O  O     . HOH I 6 .  ? 17.515 3.463   -2.030  1.00 20.53 ? 2065 HOH C O     1 
HETATM 1867 O  O     . HOH I 6 .  ? 17.695 5.766   -3.612  1.00 22.28 ? 2067 HOH C O     1 
HETATM 1868 O  O     . HOH I 6 .  ? 19.528 2.383   2.729   1.00 21.60 ? 2068 HOH C O     1 
HETATM 1869 O  O     . HOH I 6 .  ? 13.650 -1.958  29.589  1.00 32.42 ? 2071 HOH C O     1 
HETATM 1870 O  O     . HOH I 6 .  ? 17.996 -11.137 1.885   1.00 28.55 ? 2072 HOH C O     1 
HETATM 1871 O  O     . HOH I 6 .  ? 15.026 -3.238  4.393   1.00 29.11 ? 2075 HOH C O     1 
HETATM 1872 O  O     . HOH I 6 .  ? 15.969 6.148   30.894  1.00 27.20 ? 2079 HOH C O     1 
HETATM 1873 O  O     . HOH I 6 .  ? 10.742 -0.571  -0.889  1.00 21.67 ? 2084 HOH C O     1 
HETATM 1874 O  O     . HOH I 6 .  ? 21.400 -9.111  10.570  1.00 26.41 ? 2086 HOH C O     1 
HETATM 1875 O  O     . HOH I 6 .  ? 33.590 5.009   18.295  1.00 22.79 ? 2089 HOH C O     1 
HETATM 1876 O  O     . HOH I 6 .  ? 17.010 -3.922  8.952   1.00 28.61 ? 2098 HOH C O     1 
HETATM 1877 O  O     . HOH I 6 .  ? 14.462 -3.215  33.261  1.00 28.53 ? 2104 HOH C O     1 
HETATM 1878 O  O     . HOH I 6 .  ? 27.287 -3.109  10.014  1.00 20.64 ? 2108 HOH C O     1 
HETATM 1879 O  O     . HOH I 6 .  ? 12.223 4.601   33.046  1.00 31.52 ? 2109 HOH C O     1 
HETATM 1880 O  O     . HOH I 6 .  ? 16.600 -5.638  35.729  1.00 26.36 ? 2110 HOH C O     1 
HETATM 1881 O  O     . HOH I 6 .  ? 18.630 8.375   28.523  1.00 36.77 ? 2111 HOH C O     1 
HETATM 1882 O  O     . HOH I 6 .  ? 14.613 3.258   37.293  1.00 29.89 ? 2113 HOH C O     1 
HETATM 1883 O  O     . HOH I 6 .  ? 21.935 4.403   -3.424  1.00 23.96 ? 2120 HOH C O     1 
HETATM 1884 O  O     . HOH I 6 .  ? 25.759 3.012   14.634  1.00 19.43 ? 2133 HOH C O     1 
HETATM 1885 O  O     . HOH I 6 .  ? 28.481 2.757   13.167  1.00 28.62 ? 2134 HOH C O     1 
HETATM 1886 O  O     . HOH I 6 .  ? 22.956 3.607   24.735  1.00 21.98 ? 2149 HOH C O     1 
HETATM 1887 O  O     . HOH I 6 .  ? 30.768 -0.798  11.120  1.00 21.91 ? 2161 HOH C O     1 
HETATM 1888 O  O     . HOH I 6 .  ? 18.343 5.918   32.432  1.00 28.29 ? 2162 HOH C O     1 
HETATM 1889 O  O     . HOH I 6 .  ? 20.817 -5.266  13.632  1.00 27.06 ? 2163 HOH C O     1 
HETATM 1890 O  O     . HOH I 6 .  ? 27.410 4.568   11.344  1.00 27.46 ? 2164 HOH C O     1 
HETATM 1891 O  O     . HOH I 6 .  ? 26.715 -10.141 5.468   1.00 32.43 ? 2165 HOH C O     1 
HETATM 1892 O  O     . HOH I 6 .  ? 22.291 -8.423  13.012  1.00 35.12 ? 2173 HOH C O     1 
HETATM 1893 O  O     . HOH I 6 .  ? 22.057 -6.322  1.213   1.00 29.39 ? 2177 HOH C O     1 
HETATM 1894 O  O     . HOH I 6 .  ? 14.967 3.340   20.527  1.00 37.87 ? 2188 HOH C O     1 
HETATM 1895 O  O     . HOH I 6 .  ? 30.525 -9.478  13.347  1.00 37.94 ? 2209 HOH C O     1 
HETATM 1896 O  O     . HOH I 6 .  ? 26.284 -4.977  5.905   1.00 34.18 ? 2212 HOH C O     1 
HETATM 1897 O  O     . HOH I 6 .  ? 13.899 1.189   25.339  1.00 36.14 ? 2215 HOH C O     1 
HETATM 1898 O  O     . HOH I 6 .  ? 17.442 -9.983  42.241  1.00 46.68 ? 2218 HOH C O     1 
HETATM 1899 O  O     . HOH I 6 .  ? 32.694 -0.759  12.765  1.00 30.70 ? 2222 HOH C O     1 
HETATM 1900 O  O     . HOH I 6 .  ? 19.698 -4.793  39.025  1.00 33.54 ? 2223 HOH C O     1 
HETATM 1901 O  O     . HOH I 6 .  ? 12.275 5.174   -8.663  1.00 40.18 ? 2243 HOH C O     1 
HETATM 1902 O  O     . HOH I 6 .  ? 24.475 -6.086  2.863   1.00 38.84 ? 2244 HOH C O     1 
HETATM 1903 O  O     . HOH I 6 .  ? 13.965 -11.133 42.666  1.00 34.51 ? 2250 HOH C O     1 
HETATM 1904 O  O     . HOH I 6 .  ? 14.017 -2.147  26.364  1.00 39.36 ? 2252 HOH C O     1 
HETATM 1905 O  O     . HOH I 6 .  ? 34.379 -3.743  14.778  1.00 32.58 ? 2258 HOH C O     1 
HETATM 1906 O  O     . HOH I 6 .  ? 24.509 -3.269  20.235  1.00 40.09 ? 2260 HOH C O     1 
HETATM 1907 O  O     . HOH I 6 .  ? 13.641 6.305   32.451  1.00 30.86 ? 2261 HOH C O     1 
HETATM 1908 O  O     . HOH I 6 .  ? 31.599 -9.067  15.461  1.00 35.29 ? 2262 HOH C O     1 
HETATM 1909 O  O     . HOH I 6 .  ? 12.602 -6.931  -1.540  1.00 39.11 ? 2264 HOH C O     1 
HETATM 1910 O  O     . HOH I 6 .  ? 6.769  0.691   30.971  1.00 36.78 ? 2266 HOH C O     1 
HETATM 1911 O  O     . HOH I 6 .  ? 31.257 4.533   15.459  1.00 36.10 ? 2275 HOH C O     1 
HETATM 1912 O  O     . HOH I 6 .  ? 19.921 -11.171 7.535   1.00 38.29 ? 2281 HOH C O     1 
HETATM 1913 O  O     . HOH I 6 .  ? 28.508 -4.568  7.912   1.00 45.53 ? 2286 HOH C O     1 
HETATM 1914 O  O     . HOH I 6 .  ? 19.647 9.654   -11.708 1.00 41.06 ? 2287 HOH C O     1 
HETATM 1915 O  O     . HOH I 6 .  ? 18.019 10.413  26.408  1.00 37.00 ? 2289 HOH C O     1 
HETATM 1916 O  O     . HOH I 6 .  ? 19.514 -9.990  0.607   1.00 51.74 ? 2290 HOH C O     1 
HETATM 1917 O  O     . HOH I 6 .  ? 23.099 -4.677  17.369  1.00 66.39 ? 2292 HOH C O     1 
HETATM 1918 O  O     . HOH I 6 .  ? 18.823 -4.578  -2.157  1.00 38.73 ? 2296 HOH C O     1 
HETATM 1919 O  O     . HOH I 6 .  ? 16.286 -5.382  -3.510  1.00 37.18 ? 2305 HOH C O     1 
HETATM 1920 O  O     . HOH I 6 .  ? 18.212 11.430  -11.960 1.00 52.84 ? 2306 HOH C O     1 
HETATM 1921 O  O     . HOH I 6 .  ? 18.290 14.248  -11.574 1.00 55.81 ? 2325 HOH C O     1 
HETATM 1922 O  O     . HOH J 6 .  ? 22.374 3.434   31.572  1.00 16.02 ? 2019 HOH D O     1 
HETATM 1923 O  O     . HOH J 6 .  ? 28.126 6.370   37.420  1.00 20.56 ? 2021 HOH D O     1 
HETATM 1924 O  O     . HOH J 6 .  ? 27.536 -6.431  31.416  1.00 10.86 ? 2023 HOH D O     1 
HETATM 1925 O  O     . HOH J 6 .  ? 11.702 5.050   14.474  1.00 20.77 ? 2041 HOH D O     1 
HETATM 1926 O  O     . HOH J 6 .  ? 17.554 4.154   18.657  1.00 19.07 ? 2043 HOH D O     1 
HETATM 1927 O  O     . HOH J 6 .  ? 14.030 0.972   12.752  1.00 19.75 ? 2047 HOH D O     1 
HETATM 1928 O  O     . HOH J 6 .  ? 27.401 -8.940  33.783  1.00 12.67 ? 2049 HOH D O     1 
HETATM 1929 O  O     . HOH J 6 .  ? 18.352 -4.438  15.831  1.00 21.46 ? 2053 HOH D O     1 
HETATM 1930 O  O     . HOH J 6 .  ? 12.625 5.547   11.756  1.00 22.35 ? 2070 HOH D O     1 
HETATM 1931 O  O     . HOH J 6 .  ? 20.829 -4.629  19.679  1.00 29.56 ? 2074 HOH D O     1 
HETATM 1932 O  O     . HOH J 6 .  ? 17.701 -2.350  11.795  1.00 19.77 ? 2076 HOH D O     1 
HETATM 1933 O  O     . HOH J 6 .  ? 30.602 0.920   8.995   1.00 25.43 ? 2077 HOH D O     1 
HETATM 1934 O  O     . HOH J 6 .  ? 28.588 -0.242  7.189   1.00 28.13 ? 2078 HOH D O     1 
HETATM 1935 O  O     . HOH J 6 .  ? 17.864 0.674   7.350   1.00 21.40 ? 2085 HOH D O     1 
HETATM 1936 O  O     . HOH J 6 .  ? 26.026 -9.192  29.295  1.00 25.82 ? 2087 HOH D O     1 
HETATM 1937 O  O     . HOH J 6 .  ? 18.563 4.849   35.427  1.00 20.15 ? 2094 HOH D O     1 
HETATM 1938 O  O     . HOH J 6 .  ? 16.085 -5.493  15.909  1.00 22.42 ? 2100 HOH D O     1 
HETATM 1939 O  O     . HOH J 6 .  ? 15.143 -1.215  11.550  1.00 27.54 ? 2107 HOH D O     1 
HETATM 1940 O  O     . HOH J 6 .  ? 16.271 5.842   38.779  1.00 25.89 ? 2112 HOH D O     1 
HETATM 1941 O  O     . HOH J 6 .  ? 23.089 -0.952  41.454  1.00 25.06 ? 2114 HOH D O     1 
HETATM 1942 O  O     . HOH J 6 .  ? 16.493 -5.825  31.038  1.00 22.07 ? 2115 HOH D O     1 
HETATM 1943 O  O     . HOH J 6 .  ? 14.028 -5.927  29.778  1.00 24.65 ? 2116 HOH D O     1 
HETATM 1944 O  O     . HOH J 6 .  ? 24.573 4.699   12.868  1.00 25.46 ? 2117 HOH D O     1 
HETATM 1945 O  O     . HOH J 6 .  ? 28.393 6.681   3.208   1.00 23.15 ? 2118 HOH D O     1 
HETATM 1946 O  O     . HOH J 6 .  ? 25.464 4.127   -1.527  1.00 26.88 ? 2119 HOH D O     1 
HETATM 1947 O  O     . HOH J 6 .  ? 24.641 10.131  13.153  1.00 27.24 ? 2125 HOH D O     1 
HETATM 1948 O  O     . HOH J 6 .  ? 16.095 9.179   15.826  1.00 30.37 ? 2126 HOH D O     1 
HETATM 1949 O  O     . HOH J 6 .  ? 14.254 -3.929  17.060  1.00 22.70 ? 2135 HOH D O     1 
HETATM 1950 O  O     . HOH J 6 .  ? 26.771 2.933   9.154   1.00 25.11 ? 2144 HOH D O     1 
HETATM 1951 O  O     . HOH J 6 .  ? 29.566 1.667   41.607  1.00 26.30 ? 2152 HOH D O     1 
HETATM 1952 O  O     . HOH J 6 .  ? 27.510 -0.211  9.538   1.00 21.84 ? 2158 HOH D O     1 
HETATM 1953 O  O     . HOH J 6 .  ? 26.698 1.414   -4.513  1.00 33.40 ? 2171 HOH D O     1 
HETATM 1954 O  O     . HOH J 6 .  ? 27.661 -6.893  38.212  1.00 26.43 ? 2172 HOH D O     1 
HETATM 1955 O  O     . HOH J 6 .  ? 25.139 -11.493 32.291  1.00 30.47 ? 2176 HOH D O     1 
HETATM 1956 O  O     . HOH J 6 .  ? 13.965 0.864   22.621  1.00 32.01 ? 2180 HOH D O     1 
HETATM 1957 O  O     . HOH J 6 .  ? 10.326 0.252   12.988  1.00 34.28 ? 2185 HOH D O     1 
HETATM 1958 O  O     . HOH J 6 .  ? 12.458 -2.432  15.351  1.00 30.77 ? 2187 HOH D O     1 
HETATM 1959 O  O     . HOH J 6 .  ? 13.685 -3.687  12.985  1.00 33.31 ? 2194 HOH D O     1 
HETATM 1960 O  O     . HOH J 6 .  ? 20.304 -5.825  16.773  1.00 36.42 ? 2200 HOH D O     1 
HETATM 1961 O  O     . HOH J 6 .  ? 9.758  -1.420  22.029  1.00 40.58 ? 2203 HOH D O     1 
HETATM 1962 O  O     . HOH J 6 .  ? 16.037 5.270   36.179  1.00 31.68 ? 2211 HOH D O     1 
HETATM 1963 O  O     . HOH J 6 .  ? 19.147 -5.377  33.664  1.00 44.54 ? 2213 HOH D O     1 
HETATM 1964 O  O     . HOH J 6 .  ? 20.361 -4.253  35.926  1.00 28.15 ? 2217 HOH D O     1 
HETATM 1965 O  O     . HOH J 6 .  ? 28.414 4.705   1.576   1.00 33.02 ? 2219 HOH D O     1 
HETATM 1966 O  O     . HOH J 6 .  ? 16.199 -10.517 31.820  1.00 36.34 ? 2232 HOH D O     1 
HETATM 1967 O  O     . HOH J 6 .  ? 26.732 10.151  12.212  1.00 30.50 ? 2236 HOH D O     1 
HETATM 1968 O  O     . HOH J 6 .  ? 20.450 -8.947  25.875  1.00 31.46 ? 2237 HOH D O     1 
HETATM 1969 O  O     . HOH J 6 .  ? 22.183 -12.101 28.567  1.00 38.01 ? 2239 HOH D O     1 
HETATM 1970 O  O     . HOH J 6 .  ? 20.133 -7.174  23.373  1.00 40.77 ? 2240 HOH D O     1 
HETATM 1971 O  O     . HOH J 6 .  ? 28.035 11.855  10.876  1.00 37.69 ? 2251 HOH D O     1 
HETATM 1972 O  O     . HOH J 6 .  ? 19.463 -14.150 30.639  1.00 37.62 ? 2254 HOH D O     1 
HETATM 1973 O  O     . HOH J 6 .  ? 26.999 6.170   43.134  1.00 45.70 ? 2255 HOH D O     1 
HETATM 1974 O  O     . HOH J 6 .  ? 10.709 4.203   17.868  1.00 32.84 ? 2256 HOH D O     1 
HETATM 1975 O  O     . HOH J 6 .  ? 13.149 6.644   18.153  1.00 35.66 ? 2257 HOH D O     1 
HETATM 1976 O  O     . HOH J 6 .  ? 27.700 4.984   -0.892  1.00 38.33 ? 2263 HOH D O     1 
HETATM 1977 O  O     . HOH J 6 .  ? 13.850 -9.865  31.030  1.00 46.29 ? 2267 HOH D O     1 
HETATM 1978 O  O     . HOH J 6 .  ? 8.472  1.910   16.225  1.00 38.40 ? 2269 HOH D O     1 
HETATM 1979 O  O     . HOH J 6 .  ? 27.345 -3.265  4.058   1.00 33.96 ? 2270 HOH D O     1 
HETATM 1980 O  O     . HOH J 6 .  ? 24.416 -9.802  27.710  1.00 46.28 ? 2274 HOH D O     1 
HETATM 1981 O  O     . HOH J 6 .  ? 16.781 -8.279  32.959  1.00 32.20 ? 2279 HOH D O     1 
HETATM 1982 O  O     . HOH J 6 .  ? 35.117 0.399   4.076   1.00 44.40 ? 2280 HOH D O     1 
HETATM 1983 O  O     . HOH J 6 .  ? 28.070 7.971   10.559  1.00 37.86 ? 2283 HOH D O     1 
HETATM 1984 O  O     . HOH J 6 .  ? 23.813 -8.979  35.646  1.00 50.85 ? 2284 HOH D O     1 
HETATM 1985 O  O     . HOH J 6 .  ? 16.666 -7.071  21.245  1.00 45.24 ? 2288 HOH D O     1 
HETATM 1986 O  O     . HOH J 6 .  ? 30.250 -0.909  -2.295  1.00 38.80 ? 2293 HOH D O     1 
HETATM 1987 O  O     . HOH J 6 .  ? 29.015 7.419   -1.687  1.00 51.37 ? 2295 HOH D O     1 
HETATM 1988 O  O     . HOH J 6 .  ? 27.523 -8.808  -8.225  1.00 66.96 ? 2301 HOH D O     1 
HETATM 1989 O  O     . HOH J 6 .  ? 12.306 -4.179  31.411  1.00 58.31 ? 2309 HOH D O     1 
HETATM 1990 O  O     . HOH J 6 .  ? 16.285 8.457   34.968  1.00 56.23 ? 2310 HOH D O     1 
HETATM 1991 O  O     . HOH J 6 .  ? 30.560 9.788   7.063   1.00 53.92 ? 2311 HOH D O     1 
HETATM 1992 O  O     . HOH J 6 .  ? 30.650 9.257   4.677   1.00 61.52 ? 2326 HOH D O     1 
HETATM 1993 O  O     . HOH J 6 .  ? 27.350 -3.570  -8.879  1.00 49.58 ? 2339 HOH D O     1 
HETATM 1994 O  O     . HOH J 6 .  ? 18.584 -4.599  -6.740  1.00 37.44 ? 2340 HOH D O     1 
HETATM 1995 O  O     . HOH J 6 .  ? 14.476 7.048   35.035  1.00 70.22 ? 2341 HOH D O     1 
HETATM 1996 O  O     . HOH K 6 .  ? 24.479 10.240  6.268   1.00 19.22 ? 2016 HOH A O     1 
HETATM 1997 O  O     . HOH K 6 .  ? 19.307 7.009   8.597   1.00 14.85 ? 2017 HOH A O     1 
HETATM 1998 O  O     . HOH K 6 .  ? 16.742 10.472  12.630  1.00 18.63 ? 2054 HOH A O     1 
HETATM 1999 O  O     . HOH K 6 .  ? 11.243 20.337  9.018   1.00 19.57 ? 2062 HOH A O     1 
HETATM 2000 O  O     . HOH K 6 .  ? 12.063 -0.746  6.394   1.00 26.16 ? 2088 HOH A O     1 
HETATM 2001 O  O     . HOH K 6 .  ? 4.286  16.794  15.856  1.00 30.12 ? 2096 HOH A O     1 
HETATM 2002 O  O     . HOH K 6 .  ? 16.133 -1.072  8.395   1.00 26.75 ? 2099 HOH A O     1 
HETATM 2003 O  O     . HOH K 6 .  ? 5.434  1.863   -1.614  1.00 28.92 ? 2105 HOH A O     1 
HETATM 2004 O  O     . HOH K 6 .  ? 4.830  4.965   -1.663  1.00 25.37 ? 2106 HOH A O     1 
HETATM 2005 O  O     . HOH K 6 .  ? 8.874  9.640   -7.666  1.00 24.50 ? 2122 HOH A O     1 
HETATM 2006 O  O     . HOH K 6 .  ? 26.971 11.222  8.165   1.00 25.37 ? 2124 HOH A O     1 
HETATM 2007 O  O     . HOH K 6 .  ? 7.680  10.626  17.225  1.00 28.43 ? 2127 HOH A O     1 
HETATM 2008 O  O     . HOH K 6 .  ? 10.673 16.349  18.715  1.00 28.64 ? 2128 HOH A O     1 
HETATM 2009 O  O     . HOH K 6 .  ? 16.346 22.838  8.970   1.00 25.11 ? 2129 HOH A O     1 
HETATM 2010 O  O     . HOH K 6 .  ? 21.523 14.369  15.518  1.00 23.38 ? 2130 HOH A O     1 
HETATM 2011 O  O     . HOH K 6 .  ? 15.370 12.101  13.499  1.00 26.60 ? 2146 HOH A O     1 
HETATM 2012 O  O     . HOH K 6 .  ? 4.958  12.144  10.664  1.00 27.51 ? 2147 HOH A O     1 
HETATM 2013 O  O     . HOH K 6 .  ? 25.331 20.650  8.350   1.00 28.07 ? 2148 HOH A O     1 
HETATM 2014 O  O     . HOH K 6 .  ? 11.567 3.639   -7.114  1.00 25.19 ? 2150 HOH A O     1 
HETATM 2015 O  O     . HOH K 6 .  ? 21.562 4.285   3.643   1.00 23.94 ? 2151 HOH A O     1 
HETATM 2016 O  O     . HOH K 6 .  ? 8.023  15.882  -1.631  1.00 27.27 ? 2159 HOH A O     1 
HETATM 2017 O  O     . HOH K 6 .  ? 10.381 23.034  16.701  1.00 27.78 ? 2160 HOH A O     1 
HETATM 2018 O  O     . HOH K 6 .  ? 18.163 27.465  7.605   1.00 26.89 ? 2167 HOH A O     1 
HETATM 2019 O  O     . HOH K 6 .  ? 29.434 11.889  5.320   1.00 28.15 ? 2168 HOH A O     1 
HETATM 2020 O  O     . HOH K 6 .  ? 16.887 10.110  -7.517  1.00 26.72 ? 2181 HOH A O     1 
HETATM 2021 O  O     . HOH K 6 .  ? 13.082 3.200   11.453  1.00 28.91 ? 2184 HOH A O     1 
HETATM 2022 O  O     . HOH K 6 .  ? 12.803 22.381  9.973   1.00 33.31 ? 2186 HOH A O     1 
HETATM 2023 O  O     . HOH K 6 .  ? 15.880 23.411  16.637  1.00 39.25 ? 2189 HOH A O     1 
HETATM 2024 O  O     . HOH K 6 .  ? 18.930 26.380  9.903   1.00 35.80 ? 2190 HOH A O     1 
HETATM 2025 O  O     . HOH K 6 .  ? 14.795 -1.338  6.394   1.00 31.19 ? 2192 HOH A O     1 
HETATM 2026 O  O     . HOH K 6 .  ? 24.203 6.445   -4.826  1.00 41.97 ? 2195 HOH A O     1 
HETATM 2027 O  O     . HOH K 6 .  ? 26.559 10.027  2.384   1.00 33.65 ? 2205 HOH A O     1 
HETATM 2028 O  O     . HOH K 6 .  ? 22.138 8.138   -6.629  1.00 32.10 ? 2208 HOH A O     1 
HETATM 2029 O  O     . HOH K 6 .  ? 2.319  -7.857  -2.563  1.00 46.25 ? 2210 HOH A O     1 
HETATM 2030 O  O     . HOH K 6 .  ? 29.275 19.395  10.220  1.00 37.61 ? 2225 HOH A O     1 
HETATM 2031 O  O     . HOH K 6 .  ? 13.022 9.430   -7.341  1.00 37.42 ? 2227 HOH A O     1 
HETATM 2032 O  O     . HOH K 6 .  ? 22.009 21.555  -0.417  1.00 34.72 ? 2231 HOH A O     1 
HETATM 2033 O  O     . HOH K 6 .  ? 6.897  14.367  9.673   1.00 30.92 ? 2245 HOH A O     1 
HETATM 2034 O  O     . HOH K 6 .  ? 6.051  12.328  -1.422  1.00 29.87 ? 2246 HOH A O     1 
HETATM 2035 O  O     . HOH K 6 .  ? 13.553 -2.708  -5.844  1.00 37.18 ? 2247 HOH A O     1 
HETATM 2036 O  O     . HOH K 6 .  ? 2.597  13.813  10.903  1.00 41.16 ? 2259 HOH A O     1 
HETATM 2037 O  O     . HOH K 6 .  ? 32.578 13.124  7.009   1.00 46.98 ? 2271 HOH A O     1 
HETATM 2038 O  O     . HOH K 6 .  ? 0.659  -0.349  -0.735  1.00 41.84 ? 2273 HOH A O     1 
HETATM 2039 O  O     . HOH K 6 .  ? 9.724  6.795   16.947  1.00 44.19 ? 2282 HOH A O     1 
HETATM 2040 O  O     . HOH K 6 .  ? 3.248  13.460  2.384   1.00 45.14 ? 2285 HOH A O     1 
HETATM 2041 O  O     . HOH K 6 .  ? 27.129 14.002  12.422  1.00 45.93 ? 2291 HOH A O     1 
HETATM 2042 O  O     . HOH K 6 .  ? 26.955 21.366  10.913  1.00 43.78 ? 2294 HOH A O     1 
HETATM 2043 O  O     . HOH K 6 .  ? 11.154 21.118  5.800   1.00 52.13 ? 2297 HOH A O     1 
HETATM 2044 O  O     . HOH K 6 .  ? 29.874 17.393  5.850   1.00 29.96 ? 2299 HOH A O     1 
HETATM 2045 O  O     . HOH K 6 .  ? 24.159 13.581  13.656  1.00 38.36 ? 2300 HOH A O     1 
HETATM 2046 O  O     . HOH K 6 .  ? 1.947  13.690  13.612  1.00 47.34 ? 2302 HOH A O     1 
HETATM 2047 O  O     . HOH K 6 .  ? 15.901 18.344  -6.697  1.00 64.99 ? 2307 HOH A O     1 
HETATM 2048 O  O     . HOH K 6 .  ? 8.787  -2.858  1.771   1.00 34.67 ? 2312 HOH A O     1 
HETATM 2049 O  O     . HOH K 6 .  ? 32.346 15.963  6.027   1.00 33.81 ? 2315 HOH A O     1 
HETATM 2050 O  O     . HOH K 6 .  ? 4.468  12.348  6.886   1.00 40.32 ? 2329 HOH A O     1 
HETATM 2051 O  O     . HOH K 6 .  ? 4.348  -2.094  0.136   1.00 32.85 ? 2331 HOH A O     1 
HETATM 2052 O  O     . HOH K 6 .  ? 8.567  22.627  5.994   1.00 56.06 ? 2342 HOH A O     1 
HETATM 2053 O  O     . HOH L 6 .  ? 29.028 -3.141  18.509  1.00 12.81 ? 2002 HOH B O     1 
HETATM 2054 O  O     . HOH L 6 .  ? 38.449 9.613   24.987  1.00 10.36 ? 2005 HOH B O     1 
HETATM 2055 O  O     . HOH L 6 .  ? 39.056 10.212  22.517  1.00 11.85 ? 2006 HOH B O     1 
HETATM 2056 O  O     . HOH L 6 .  ? 41.230 8.452   21.682  1.00 13.43 ? 2007 HOH B O     1 
HETATM 2057 O  O     . HOH L 6 .  ? 40.814 6.762   25.422  1.00 12.35 ? 2008 HOH B O     1 
HETATM 2058 O  O     . HOH L 6 .  ? 41.939 8.728   26.869  1.00 11.12 ? 2009 HOH B O     1 
HETATM 2059 O  O     . HOH L 6 .  ? 40.294 11.690  33.487  1.00 12.48 ? 2010 HOH B O     1 
HETATM 2060 O  O     . HOH L 6 .  ? 43.237 6.383   31.638  1.00 10.89 ? 2011 HOH B O     1 
HETATM 2061 O  O     . HOH L 6 .  ? 43.671 7.185   28.823  1.00 10.43 ? 2012 HOH B O     1 
HETATM 2062 O  O     . HOH L 6 .  ? 44.709 0.723   24.875  1.00 18.49 ? 2013 HOH B O     1 
HETATM 2063 O  O     . HOH L 6 .  ? 43.279 4.008   20.798  1.00 14.46 ? 2015 HOH B O     1 
HETATM 2064 O  O     . HOH L 6 .  ? 29.219 8.222   17.783  1.00 14.45 ? 2018 HOH B O     1 
HETATM 2065 O  O     . HOH L 6 .  ? 26.936 -0.230  34.057  1.00 11.08 ? 2020 HOH B O     1 
HETATM 2066 O  O     . HOH L 6 .  ? 30.596 0.864   38.436  1.00 12.45 ? 2022 HOH B O     1 
HETATM 2067 O  O     . HOH L 6 .  ? 39.907 9.373   19.276  1.00 16.84 ? 2024 HOH B O     1 
HETATM 2068 O  O     . HOH L 6 .  ? 47.279 2.706   37.513  1.00 20.39 ? 2025 HOH B O     1 
HETATM 2069 O  O     . HOH L 6 .  ? 21.207 5.008   16.129  1.00 18.69 ? 2026 HOH B O     1 
HETATM 2070 O  O     . HOH L 6 .  ? 36.451 -11.220 34.767  1.00 18.61 ? 2028 HOH B O     1 
HETATM 2071 O  O     . HOH L 6 .  ? 35.772 3.757   16.754  1.00 20.66 ? 2030 HOH B O     1 
HETATM 2072 O  O     . HOH L 6 .  ? 36.178 -18.084 18.259  1.00 16.95 ? 2031 HOH B O     1 
HETATM 2073 O  O     . HOH L 6 .  ? 28.659 -5.752  24.202  1.00 18.95 ? 2032 HOH B O     1 
HETATM 2074 O  O     . HOH L 6 .  ? 24.030 -1.290  28.456  1.00 15.41 ? 2033 HOH B O     1 
HETATM 2075 O  O     . HOH L 6 .  ? 36.973 -15.471 17.562  1.00 16.18 ? 2034 HOH B O     1 
HETATM 2076 O  O     . HOH L 6 .  ? 40.917 5.710   21.222  1.00 12.23 ? 2035 HOH B O     1 
HETATM 2077 O  O     . HOH L 6 .  ? 31.924 -20.254 24.794  1.00 16.42 ? 2036 HOH B O     1 
HETATM 2078 O  O     . HOH L 6 .  ? 31.493 -13.702 24.273  1.00 14.74 ? 2037 HOH B O     1 
HETATM 2079 O  O     . HOH L 6 .  ? 43.491 4.099   37.131  1.00 17.96 ? 2038 HOH B O     1 
HETATM 2080 O  O     . HOH L 6 .  ? 42.378 1.720   35.959  1.00 12.56 ? 2039 HOH B O     1 
HETATM 2081 O  O     . HOH L 6 .  ? 33.432 14.381  26.936  1.00 13.14 ? 2040 HOH B O     1 
HETATM 2082 O  O     . HOH L 6 .  ? 42.552 -4.410  35.674  1.00 18.10 ? 2042 HOH B O     1 
HETATM 2083 O  O     . HOH L 6 .  ? 27.507 -11.453 30.599  1.00 19.76 ? 2044 HOH B O     1 
HETATM 2084 O  O     . HOH L 6 .  ? 36.292 -0.978  40.025  1.00 14.93 ? 2045 HOH B O     1 
HETATM 2085 O  O     . HOH L 6 .  ? 38.246 -2.657  41.420  1.00 19.17 ? 2046 HOH B O     1 
HETATM 2086 O  O     . HOH L 6 .  ? 29.750 10.953  17.808  1.00 19.16 ? 2048 HOH B O     1 
HETATM 2087 O  O     . HOH L 6 .  ? 27.693 -7.804  27.708  1.00 14.08 ? 2050 HOH B O     1 
HETATM 2088 O  O     . HOH L 6 .  ? 40.000 -8.425  34.141  1.00 16.14 ? 2055 HOH B O     1 
HETATM 2089 O  O     . HOH L 6 .  ? 39.035 -3.146  21.830  1.00 15.36 ? 2056 HOH B O     1 
HETATM 2090 O  O     . HOH L 6 .  ? 40.165 10.751  26.972  1.00 17.34 ? 2057 HOH B O     1 
HETATM 2091 O  O     . HOH L 6 .  ? 22.112 2.948   28.798  1.00 13.91 ? 2059 HOH B O     1 
HETATM 2092 O  O     . HOH L 6 .  ? 31.756 -5.134  41.616  1.00 20.22 ? 2061 HOH B O     1 
HETATM 2093 O  O     . HOH L 6 .  ? 44.452 0.901   43.842  1.00 20.17 ? 2063 HOH B O     1 
HETATM 2094 O  O     . HOH L 6 .  ? 34.075 18.039  29.841  1.00 17.64 ? 2064 HOH B O     1 
HETATM 2095 O  O     . HOH L 6 .  ? 33.642 -13.705 31.011  1.00 18.89 ? 2066 HOH B O     1 
HETATM 2096 O  O     . HOH L 6 .  ? 31.367 -15.979 25.972  1.00 26.10 ? 2069 HOH B O     1 
HETATM 2097 O  O     . HOH L 6 .  ? 27.042 -4.998  19.567  1.00 23.99 ? 2073 HOH B O     1 
HETATM 2098 O  O     . HOH L 6 .  ? 50.505 0.318   39.435  1.00 23.43 ? 2080 HOH B O     1 
HETATM 2099 O  O     . HOH L 6 .  ? 34.250 -16.694 14.334  1.00 22.35 ? 2081 HOH B O     1 
HETATM 2100 O  O     . HOH L 6 .  ? 30.984 -13.951 31.945  1.00 22.81 ? 2082 HOH B O     1 
HETATM 2101 O  O     . HOH L 6 .  ? 35.692 -11.736 37.883  1.00 24.99 ? 2083 HOH B O     1 
HETATM 2102 O  O     . HOH L 6 .  ? 43.724 1.667   22.145  1.00 23.57 ? 2090 HOH B O     1 
HETATM 2103 O  O     . HOH L 6 .  ? 38.485 8.266   36.688  1.00 23.04 ? 2091 HOH B O     1 
HETATM 2104 O  O     . HOH L 6 .  ? 43.567 -0.221  37.212  1.00 19.46 ? 2092 HOH B O     1 
HETATM 2105 O  O     . HOH L 6 .  ? 44.058 -2.456  35.282  1.00 24.78 ? 2093 HOH B O     1 
HETATM 2106 O  O     . HOH L 6 .  ? 34.725 -6.462  15.496  1.00 23.30 ? 2095 HOH B O     1 
HETATM 2107 O  O     . HOH L 6 .  ? 9.956  13.275  16.375  1.00 27.29 ? 2097 HOH B O     1 
HETATM 2108 O  O     . HOH L 6 .  ? 34.614 -14.145 17.801  1.00 21.12 ? 2101 HOH B O     1 
HETATM 2109 O  O     . HOH L 6 .  ? 33.168 -18.173 18.381  1.00 23.06 ? 2102 HOH B O     1 
HETATM 2110 O  O     . HOH L 6 .  ? 28.632 -12.813 24.022  1.00 23.06 ? 2103 HOH B O     1 
HETATM 2111 O  O     . HOH L 6 .  ? 33.702 11.743  31.095  1.00 29.42 ? 2121 HOH B O     1 
HETATM 2112 O  O     . HOH L 6 .  ? 31.600 -3.540  43.859  1.00 23.41 ? 2123 HOH B O     1 
HETATM 2113 O  O     . HOH L 6 .  ? 27.628 7.206   40.004  1.00 22.42 ? 2131 HOH B O     1 
HETATM 2114 O  O     . HOH L 6 .  ? 22.245 -4.873  23.363  1.00 22.26 ? 2132 HOH B O     1 
HETATM 2115 O  O     . HOH L 6 .  ? 33.434 -16.093 16.399  1.00 26.06 ? 2136 HOH B O     1 
HETATM 2116 O  O     . HOH L 6 .  ? 30.606 -15.595 17.373  1.00 35.88 ? 2137 HOH B O     1 
HETATM 2117 O  O     . HOH L 6 .  ? 27.348 -15.338 24.464  1.00 22.92 ? 2138 HOH B O     1 
HETATM 2118 O  O     . HOH L 6 .  ? 44.618 6.145   36.020  1.00 24.08 ? 2140 HOH B O     1 
HETATM 2119 O  O     . HOH L 6 .  ? 36.879 10.371  37.342  1.00 28.00 ? 2141 HOH B O     1 
HETATM 2120 O  O     . HOH L 6 .  ? 35.599 10.747  35.172  1.00 23.84 ? 2142 HOH B O     1 
HETATM 2121 O  O     . HOH L 6 .  ? 36.564 9.386   16.953  1.00 25.86 ? 2143 HOH B O     1 
HETATM 2122 O  O     . HOH L 6 .  ? 26.919 -7.972  25.238  1.00 21.31 ? 2145 HOH B O     1 
HETATM 2123 O  O     . HOH L 6 .  ? 25.522 6.949   36.421  1.00 21.42 ? 2153 HOH B O     1 
HETATM 2124 O  O     . HOH L 6 .  ? 39.004 -10.882 33.834  1.00 24.86 ? 2154 HOH B O     1 
HETATM 2125 O  O     . HOH L 6 .  ? 29.350 -18.387 15.843  1.00 27.04 ? 2155 HOH B O     1 
HETATM 2126 O  O     . HOH L 6 .  ? 27.369 17.029  31.437  1.00 31.36 ? 2156 HOH B O     1 
HETATM 2127 O  O     . HOH L 6 .  ? 23.784 6.390   14.832  1.00 29.36 ? 2157 HOH B O     1 
HETATM 2128 O  O     . HOH L 6 .  ? 31.581 -16.426 28.700  1.00 29.94 ? 2166 HOH B O     1 
HETATM 2129 O  O     . HOH L 6 .  ? 38.307 12.227  30.974  1.00 25.55 ? 2169 HOH B O     1 
HETATM 2130 O  O     . HOH L 6 .  ? 41.714 9.302   42.889  1.00 26.78 ? 2170 HOH B O     1 
HETATM 2131 O  O     . HOH L 6 .  ? 31.917 14.795  29.426  1.00 26.48 ? 2174 HOH B O     1 
HETATM 2132 O  O     . HOH L 6 .  ? 41.688 12.035  41.612  1.00 35.35 ? 2175 HOH B O     1 
HETATM 2133 O  O     . HOH L 6 .  ? 29.610 18.114  30.701  1.00 27.68 ? 2178 HOH B O     1 
HETATM 2134 O  O     . HOH L 6 .  ? 23.286 9.533   31.154  1.00 29.96 ? 2179 HOH B O     1 
HETATM 2135 O  O     . HOH L 6 .  ? 30.768 14.220  39.931  1.00 34.88 ? 2182 HOH B O     1 
HETATM 2136 O  O     . HOH L 6 .  ? 39.633 3.090   20.262  1.00 31.41 ? 2183 HOH B O     1 
HETATM 2137 O  O     . HOH L 6 .  ? 33.438 9.079   17.265  1.00 41.68 ? 2191 HOH B O     1 
HETATM 2138 O  O     . HOH L 6 .  ? 22.595 15.913  24.629  1.00 32.71 ? 2193 HOH B O     1 
HETATM 2139 O  O     . HOH L 6 .  ? 38.089 7.729   15.844  1.00 30.14 ? 2196 HOH B O     1 
HETATM 2140 O  O     . HOH L 6 .  ? 34.310 13.384  29.351  1.00 41.84 ? 2197 HOH B O     1 
HETATM 2141 O  O     . HOH L 6 .  ? 46.763 -0.168  25.331  1.00 31.75 ? 2198 HOH B O     1 
HETATM 2142 O  O     . HOH L 6 .  ? 39.425 -1.215  19.636  1.00 26.31 ? 2199 HOH B O     1 
HETATM 2143 O  O     . HOH L 6 .  ? 33.635 13.236  33.627  1.00 29.83 ? 2201 HOH B O     1 
HETATM 2144 O  O     . HOH L 6 .  ? 29.958 -7.407  16.530  1.00 34.41 ? 2202 HOH B O     1 
HETATM 2145 O  O     . HOH L 6 .  ? 33.386 -12.624 15.977  1.00 36.43 ? 2204 HOH B O     1 
HETATM 2146 O  O     . HOH L 6 .  ? 34.645 -13.053 33.425  1.00 39.57 ? 2206 HOH B O     1 
HETATM 2147 O  O     . HOH L 6 .  ? 22.729 -8.200  26.514  1.00 35.16 ? 2207 HOH B O     1 
HETATM 2148 O  O     . HOH L 6 .  ? 22.969 15.029  26.990  1.00 45.26 ? 2214 HOH B O     1 
HETATM 2149 O  O     . HOH L 6 .  ? 41.926 -4.019  43.591  1.00 37.48 ? 2216 HOH B O     1 
HETATM 2150 O  O     . HOH L 6 .  ? 21.917 10.853  29.160  1.00 29.99 ? 2220 HOH B O     1 
HETATM 2151 O  O     . HOH L 6 .  ? 42.234 0.057   21.336  1.00 31.83 ? 2221 HOH B O     1 
HETATM 2152 O  O     . HOH L 6 .  ? 22.295 7.541   29.949  1.00 36.89 ? 2224 HOH B O     1 
HETATM 2153 O  O     . HOH L 6 .  ? 24.095 15.252  30.211  1.00 35.58 ? 2226 HOH B O     1 
HETATM 2154 O  O     . HOH L 6 .  ? 42.336 10.957  45.739  1.00 33.49 ? 2228 HOH B O     1 
HETATM 2155 O  O     . HOH L 6 .  ? 22.300 11.476  19.132  1.00 37.91 ? 2229 HOH B O     1 
HETATM 2156 O  O     . HOH L 6 .  ? 17.495 6.641   17.889  1.00 33.53 ? 2233 HOH B O     1 
HETATM 2157 O  O     . HOH L 6 .  ? 43.795 8.234   45.120  1.00 43.86 ? 2234 HOH B O     1 
HETATM 2158 O  O     . HOH L 6 .  ? 27.828 12.022  16.021  1.00 41.56 ? 2235 HOH B O     1 
HETATM 2159 O  O     . HOH L 6 .  ? 15.927 7.711   20.515  1.00 33.49 ? 2238 HOH B O     1 
HETATM 2160 O  O     . HOH L 6 .  ? 39.578 12.332  40.653  1.00 30.39 ? 2241 HOH B O     1 
HETATM 2161 O  O     . HOH L 6 .  ? 28.909 9.759   14.439  1.00 35.90 ? 2242 HOH B O     1 
HETATM 2162 O  O     . HOH L 6 .  ? 24.584 -2.365  24.277  1.00 29.58 ? 2248 HOH B O     1 
HETATM 2163 O  O     . HOH L 6 .  ? 34.723 16.606  31.622  1.00 36.80 ? 2249 HOH B O     1 
HETATM 2164 O  O     . HOH L 6 .  ? 29.863 3.642   43.558  1.00 40.53 ? 2253 HOH B O     1 
HETATM 2165 O  O     . HOH L 6 .  ? 31.189 7.167   16.616  1.00 42.93 ? 2265 HOH B O     1 
HETATM 2166 O  O     . HOH L 6 .  ? 22.940 -12.550 31.155  1.00 30.87 ? 2268 HOH B O     1 
HETATM 2167 O  O     . HOH L 6 .  ? 39.437 12.105  37.580  1.00 33.52 ? 2272 HOH B O     1 
HETATM 2168 O  O     . HOH L 6 .  ? 45.886 -2.652  42.951  1.00 39.77 ? 2276 HOH B O     1 
HETATM 2169 O  O     . HOH L 6 .  ? 32.995 -20.363 16.698  1.00 36.49 ? 2277 HOH B O     1 
HETATM 2170 O  O     . HOH L 6 .  ? 45.536 7.890   37.237  1.00 33.31 ? 2278 HOH B O     1 
HETATM 2171 O  O     . HOH L 6 .  ? 25.423 12.481  15.517  1.00 48.02 ? 2298 HOH B O     1 
HETATM 2172 O  O     . HOH L 6 .  ? 49.838 1.955   37.544  1.00 43.46 ? 2303 HOH B O     1 
HETATM 2173 O  O     . HOH L 6 .  ? 27.486 -9.214  36.686  1.00 47.86 ? 2304 HOH B O     1 
HETATM 2174 O  O     . HOH L 6 .  ? 21.384 20.084  19.102  1.00 61.72 ? 2308 HOH B O     1 
HETATM 2175 O  O     . HOH L 6 .  ? 37.848 3.690   45.285  1.00 20.00 ? 2313 HOH B O     1 
HETATM 2176 O  O     . HOH L 6 .  ? 35.811 5.755   42.744  1.00 17.99 ? 2314 HOH B O     1 
HETATM 2177 O  O     . HOH L 6 .  ? 29.731 -15.722 35.795  1.00 66.10 ? 2316 HOH B O     1 
HETATM 2178 O  O     . HOH L 6 .  ? 27.504 -16.212 18.074  1.00 27.53 ? 2317 HOH B O     1 
HETATM 2179 O  O     . HOH L 6 .  ? 44.686 12.453  43.977  1.00 44.14 ? 2318 HOH B O     1 
HETATM 2180 O  O     . HOH L 6 .  ? 43.705 11.506  39.657  1.00 43.49 ? 2319 HOH B O     1 
HETATM 2181 O  O     . HOH L 6 .  ? 34.096 8.566   43.960  1.00 26.22 ? 2320 HOH B O     1 
HETATM 2182 O  O     . HOH L 6 .  ? 33.301 6.319   43.326  1.00 32.68 ? 2321 HOH B O     1 
HETATM 2183 O  O     . HOH L 6 .  ? 33.473 3.138   43.441  1.00 32.40 ? 2322 HOH B O     1 
HETATM 2184 O  O     . HOH L 6 .  ? 40.853 -4.451  22.248  1.00 22.89 ? 2323 HOH B O     1 
HETATM 2185 O  O     . HOH L 6 .  ? 37.061 17.697  32.903  1.00 57.79 ? 2324 HOH B O     1 
HETATM 2186 O  O     . HOH L 6 .  ? 42.902 -6.580  43.958  1.00 40.29 ? 2327 HOH B O     1 
HETATM 2187 O  O     . HOH L 6 .  ? 23.812 18.993  17.686  1.00 38.23 ? 2328 HOH B O     1 
HETATM 2188 O  O     . HOH L 6 .  ? 23.215 6.832   37.579  1.00 32.48 ? 2332 HOH B O     1 
HETATM 2189 O  O     . HOH L 6 .  ? 28.673 9.943   41.030  1.00 39.69 ? 2333 HOH B O     1 
HETATM 2190 O  O     . HOH L 6 .  ? 34.369 18.693  35.211  1.00 53.76 ? 2334 HOH B O     1 
HETATM 2191 O  O     . HOH L 6 .  ? 26.834 -13.008 33.854  1.00 51.40 ? 2335 HOH B O     1 
HETATM 2192 O  O     . HOH L 6 .  ? 38.926 -3.154  43.552  1.00 49.12 ? 2336 HOH B O     1 
HETATM 2193 O  O     . HOH L 6 .  ? 30.287 8.388   42.425  1.00 30.88 ? 2337 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DC  1  1495 1495 DC  C   C . n 
A 1 2  DA  2  1496 1496 DA  A   C . n 
A 1 3  DG  3  1497 1497 DG  G   C . n 
A 1 4  DG  4  1498 1498 DG  G   C . n 
A 1 5  DT  5  1499 1499 DT  T   C . n 
A 1 6  DC  6  1500 1500 DC  C   C . n 
A 1 7  DA  7  1501 1501 DA  A   C . n 
A 1 8  DA  8  1502 1502 DA  A   C . n 
A 1 9  DA  9  1503 1503 DA  A   C . n 
A 1 10 DG  10 1504 1504 DG  G   C . n 
A 1 11 DG  11 1505 1505 DG  G   C . n 
A 1 12 DT  12 1506 1506 DT  T   C . n 
A 1 13 DC  13 1507 1507 DC  C   C . n 
A 1 14 DA  14 1508 1508 DA  A   C . n 
A 1 15 DG  15 1509 1509 DG  G   C . n 
B 2 1  DC  1  1531 1531 DC  C   D . n 
B 2 2  DT  2  1532 1532 DT  T   D . n 
B 2 3  DG  3  1533 1533 DG  G   D . n 
B 2 4  DA  4  1534 1534 DA  A   D . n 
B 2 5  DC  5  1535 1535 DC  C   D . n 
B 2 6  DC  6  1536 1536 DC  C   D . n 
B 2 7  DT  7  1537 1537 DT  T   D . n 
B 2 8  DT  8  1538 1538 DT  T   D . n 
B 2 9  DT  9  1539 1539 DT  T   D . n 
B 2 10 DG  10 1540 1540 DG  G   D . n 
B 2 11 DA  11 1541 1541 DA  A   D . n 
B 2 12 DC  12 1542 1542 DC  C   D . n 
B 2 13 DC  13 1543 1543 DC  C   D . n 
B 2 14 DT  14 1544 1544 DT  T   D . n 
B 2 15 DG  15 1545 1545 DG  G   D . n 
C 3 1  PRO 1  1129 ?    ?   ?   A . n 
C 3 2  ARG 2  1130 ?    ?   ?   A . n 
C 3 3  ILE 3  1131 ?    ?   ?   A . n 
C 3 4  TYR 4  1132 ?    ?   ?   A . n 
C 3 5  LYS 5  1133 ?    ?   ?   A . n 
C 3 6  PRO 6  1134 1134 PRO PRO A . n 
C 3 7  CYS 7  1135 1135 CYS CYS A . n 
C 3 8  PHE 8  1136 1136 PHE PHE A . n 
C 3 9  VAL 9  1137 1137 VAL VAL A . n 
C 3 10 CYS 10 1138 1138 CYS CYS A . n 
C 3 11 GLN 11 1139 1139 GLN GLN A . n 
C 3 12 ASP 12 1140 1140 ASP ASP A . n 
C 3 13 LYS 13 1141 1141 LYS LYS A . n 
C 3 14 SER 14 1142 1142 SER SER A . n 
C 3 15 SER 15 1143 1143 SER SER A . n 
C 3 16 GLY 16 1144 1144 GLY GLY A . n 
C 3 17 TYR 17 1145 1145 TYR TYR A . n 
C 3 18 HIS 18 1146 1146 HIS HIS A . n 
C 3 19 TYR 19 1147 1147 TYR TYR A . n 
C 3 20 GLY 20 1148 1148 GLY GLY A . n 
C 3 21 VAL 21 1149 1149 VAL VAL A . n 
C 3 22 SER 22 1150 1150 SER SER A . n 
C 3 23 ALA 23 1151 1151 ALA ALA A . n 
C 3 24 CYS 24 1152 1152 CYS CYS A . n 
C 3 25 GLU 25 1153 1153 GLU GLU A . n 
C 3 26 GLY 26 1154 1154 GLY GLY A . n 
C 3 27 CYS 27 1155 1155 CYS CYS A . n 
C 3 28 LYS 28 1156 1156 LYS LYS A . n 
C 3 29 GLY 29 1157 1157 GLY GLY A . n 
C 3 30 PHE 30 1158 1158 PHE PHE A . n 
C 3 31 PHE 31 1159 1159 PHE PHE A . n 
C 3 32 ARG 32 1160 1160 ARG ARG A . n 
C 3 33 ARG 33 1161 1161 ARG ARG A . n 
C 3 34 SER 34 1162 1162 SER SER A . n 
C 3 35 ILE 35 1163 1163 ILE ILE A . n 
C 3 36 GLN 36 1164 1164 GLN GLN A . n 
C 3 37 LYS 37 1165 1165 LYS LYS A . n 
C 3 38 ASN 38 1166 1166 ASN ASN A . n 
C 3 39 MET 39 1167 1167 MET MET A . n 
C 3 40 VAL 40 1168 1168 VAL VAL A . n 
C 3 41 TYR 41 1169 1169 TYR TYR A . n 
C 3 42 THR 42 1170 1170 THR THR A . n 
C 3 43 CYS 43 1171 1171 CYS CYS A . n 
C 3 44 HIS 44 1172 1172 HIS HIS A . n 
C 3 45 ARG 45 1173 1173 ARG ARG A . n 
C 3 46 ASP 46 1174 1174 ASP ASP A . n 
C 3 47 LYS 47 1175 1175 LYS LYS A . n 
C 3 48 ASN 48 1176 1176 ASN ASN A . n 
C 3 49 CYS 49 1177 1177 CYS CYS A . n 
C 3 50 ILE 50 1178 1178 ILE ILE A . n 
C 3 51 ILE 51 1179 1179 ILE ILE A . n 
C 3 52 ASN 52 1180 1180 ASN ASN A . n 
C 3 53 LYS 53 1181 1181 LYS LYS A . n 
C 3 54 VAL 54 1182 1182 VAL VAL A . n 
C 3 55 THR 55 1183 1183 THR THR A . n 
C 3 56 ARG 56 1184 1184 ARG ARG A . n 
C 3 57 ASN 57 1185 1185 ASN ASN A . n 
C 3 58 ARG 58 1186 1186 ARG ARG A . n 
C 3 59 CYS 59 1187 1187 CYS CYS A . n 
C 3 60 GLN 60 1188 1188 GLN GLN A . n 
C 3 61 TYR 61 1189 1189 TYR TYR A . n 
C 3 62 CYS 62 1190 1190 CYS CYS A . n 
C 3 63 ARG 63 1191 1191 ARG ARG A . n 
C 3 64 LEU 64 1192 1192 LEU LEU A . n 
C 3 65 GLN 65 1193 1193 GLN GLN A . n 
C 3 66 LYS 66 1194 1194 LYS LYS A . n 
C 3 67 CYS 67 1195 1195 CYS CYS A . n 
C 3 68 PHE 68 1196 1196 PHE PHE A . n 
C 3 69 GLU 69 1197 1197 GLU GLU A . n 
C 3 70 VAL 70 1198 1198 VAL VAL A . n 
C 3 71 GLY 71 1199 1199 GLY GLY A . n 
C 3 72 MET 72 1200 1200 MET MET A . n 
C 3 73 SER 73 1201 1201 SER SER A . n 
C 3 74 LYS 74 1202 1202 LYS LYS A . n 
C 3 75 GLU 75 1203 1203 GLU GLU A . n 
C 3 76 SER 76 1204 1204 SER SER A . n 
C 3 77 VAL 77 1205 1205 VAL VAL A . n 
C 3 78 ARG 78 1206 1206 ARG ARG A . n 
C 3 79 ASN 79 1207 1207 ASN ASN A . n 
C 3 80 ASP 80 1208 1208 ASP ASP A . n 
C 3 81 ARG 81 1209 ?    ?   ?   A . n 
C 3 82 ASN 82 1210 ?    ?   ?   A . n 
C 3 83 LYS 83 1211 ?    ?   ?   A . n 
C 3 84 LYS 84 1212 ?    ?   ?   A . n 
C 3 85 LYS 85 1213 ?    ?   ?   A . n 
C 3 86 LYS 86 1214 ?    ?   ?   A . n 
D 4 1  GLY 1  1228 1228 GLY GLY B . n 
D 4 2  SER 2  1229 1229 SER SER B . n 
D 4 3  PHE 3  1230 1230 PHE PHE B . n 
D 4 4  THR 4  1231 1231 THR THR B . n 
D 4 5  LYS 5  1232 1232 LYS LYS B . n 
D 4 6  HIS 6  1233 1233 HIS HIS B . n 
D 4 7  ILE 7  1234 1234 ILE ILE B . n 
D 4 8  CYS 8  1235 1235 CYS CYS B . n 
D 4 9  ALA 9  1236 1236 ALA ALA B . n 
D 4 10 ILE 10 1237 1237 ILE ILE B . n 
D 4 11 CYS 11 1238 1238 CYS CYS B . n 
D 4 12 GLY 12 1239 1239 GLY GLY B . n 
D 4 13 ASP 13 1240 1240 ASP ASP B . n 
D 4 14 ARG 14 1241 1241 ARG ARG B . n 
D 4 15 SER 15 1242 1242 SER SER B . n 
D 4 16 SER 16 1243 1243 SER SER B . n 
D 4 17 GLY 17 1244 1244 GLY GLY B . n 
D 4 18 LYS 18 1245 1245 LYS LYS B . n 
D 4 19 HIS 19 1246 1246 HIS HIS B . n 
D 4 20 TYR 20 1247 1247 TYR TYR B . n 
D 4 21 GLY 21 1248 1248 GLY GLY B . n 
D 4 22 VAL 22 1249 1249 VAL VAL B . n 
D 4 23 TYR 23 1250 1250 TYR TYR B . n 
D 4 24 SER 24 1251 1251 SER SER B . n 
D 4 25 CYS 25 1252 1252 CYS CYS B . n 
D 4 26 GLU 26 1253 1253 GLU GLU B . n 
D 4 27 GLY 27 1254 1254 GLY GLY B . n 
D 4 28 CYS 28 1255 1255 CYS CYS B . n 
D 4 29 LYS 29 1256 1256 LYS LYS B . n 
D 4 30 GLY 30 1257 1257 GLY GLY B . n 
D 4 31 PHE 31 1258 1258 PHE PHE B . n 
D 4 32 PHE 32 1259 1259 PHE PHE B . n 
D 4 33 LYS 33 1260 1260 LYS LYS B . n 
D 4 34 ARG 34 1261 1261 ARG ARG B . n 
D 4 35 THR 35 1262 1262 THR THR B . n 
D 4 36 VAL 36 1263 1263 VAL VAL B . n 
D 4 37 ARG 37 1264 1264 ARG ARG B . n 
D 4 38 LYS 38 1265 1265 LYS LYS B . n 
D 4 39 ASP 39 1266 1266 ASP ASP B . n 
D 4 40 LEU 40 1267 1267 LEU LEU B . n 
D 4 41 THR 41 1268 1268 THR THR B . n 
D 4 42 TYR 42 1269 1269 TYR TYR B . n 
D 4 43 THR 43 1270 1270 THR THR B . n 
D 4 44 CYS 44 1271 1271 CYS CYS B . n 
D 4 45 ARG 45 1272 1272 ARG ARG B . n 
D 4 46 ASP 46 1273 1273 ASP ASP B . n 
D 4 47 ASN 47 1274 1274 ASN ASN B . n 
D 4 48 LYS 48 1275 1275 LYS LYS B . n 
D 4 49 ASP 49 1276 1276 ASP ASP B . n 
D 4 50 CYS 50 1277 1277 CYS CYS B . n 
D 4 51 LEU 51 1278 1278 LEU LEU B . n 
D 4 52 ILE 52 1279 1279 ILE ILE B . n 
D 4 53 ASP 53 1280 1280 ASP ASP B . n 
D 4 54 LYS 54 1281 1281 LYS LYS B . n 
D 4 55 ARG 55 1282 1282 ARG ARG B . n 
D 4 56 GLN 56 1283 1283 GLN GLN B . n 
D 4 57 ARG 57 1284 1284 ARG ARG B . n 
D 4 58 ASN 58 1285 1285 ASN ASN B . n 
D 4 59 ARG 59 1286 1286 ARG ARG B . n 
D 4 60 CYS 60 1287 1287 CYS CYS B . n 
D 4 61 GLN 61 1288 1288 GLN GLN B . n 
D 4 62 TYR 62 1289 1289 TYR TYR B . n 
D 4 63 CYS 63 1290 1290 CYS CYS B . n 
D 4 64 ARG 64 1291 1291 ARG ARG B . n 
D 4 65 TYR 65 1292 1292 TYR TYR B . n 
D 4 66 GLN 66 1293 1293 GLN GLN B . n 
D 4 67 LYS 67 1294 1294 LYS LYS B . n 
D 4 68 CYS 68 1295 1295 CYS CYS B . n 
D 4 69 LEU 69 1296 1296 LEU LEU B . n 
D 4 70 ALA 70 1297 1297 ALA ALA B . n 
D 4 71 MET 71 1298 1298 MET MET B . n 
D 4 72 GLY 72 1299 1299 GLY GLY B . n 
D 4 73 MET 73 1300 1300 MET MET B . n 
D 4 74 LYS 74 1301 1301 LYS LYS B . n 
D 4 75 ARG 75 1302 1302 ARG ARG B . n 
D 4 76 GLU 76 1303 1303 GLU GLU B . n 
D 4 77 ALA 77 1304 1304 ALA ALA B . n 
D 4 78 VAL 78 1305 1305 VAL VAL B . n 
D 4 79 GLN 79 1306 1306 GLN GLN B . n 
D 4 80 GLU 80 1307 1307 GLU GLU B . n 
D 4 81 GLU 81 1308 1308 GLU GLU B . n 
D 4 82 ARG 82 1309 1309 ARG ARG B . n 
D 4 83 GLN 83 1310 1310 GLN GLN B . n 
D 4 84 ARG 84 1311 1311 ARG ARG B . n 
D 4 85 GLY 85 1312 ?    ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? C CYS 24 ? A CYS 1152 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 7  ? A CYS 1135 ? 1_555 112.6 ? 
2  SG ? C CYS 24 ? A CYS 1152 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 10 ? A CYS 1138 ? 1_555 105.5 ? 
3  SG ? C CYS 7  ? A CYS 1135 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 10 ? A CYS 1138 ? 1_555 114.1 ? 
4  SG ? C CYS 24 ? A CYS 1152 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 27 ? A CYS 1155 ? 1_555 103.6 ? 
5  SG ? C CYS 7  ? A CYS 1135 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 27 ? A CYS 1155 ? 1_555 108.6 ? 
6  SG ? C CYS 10 ? A CYS 1138 ? 1_555 ZN ? E ZN . ? A ZN 1121 ? 1_555 SG ? C CYS 27 ? A CYS 1155 ? 1_555 112.0 ? 
7  SG ? C CYS 59 ? A CYS 1187 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 62 ? A CYS 1190 ? 1_555 104.7 ? 
8  SG ? C CYS 59 ? A CYS 1187 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 43 ? A CYS 1171 ? 1_555 109.7 ? 
9  SG ? C CYS 62 ? A CYS 1190 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 43 ? A CYS 1171 ? 1_555 111.8 ? 
10 SG ? C CYS 59 ? A CYS 1187 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 49 ? A CYS 1177 ? 1_555 116.0 ? 
11 SG ? C CYS 62 ? A CYS 1190 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 49 ? A CYS 1177 ? 1_555 108.2 ? 
12 SG ? C CYS 43 ? A CYS 1171 ? 1_555 ZN ? F ZN . ? A ZN 1122 ? 1_555 SG ? C CYS 49 ? A CYS 1177 ? 1_555 106.4 ? 
13 SG ? D CYS 8  ? B CYS 1235 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 25 ? B CYS 1252 ? 1_555 114.3 ? 
14 SG ? D CYS 8  ? B CYS 1235 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 28 ? B CYS 1255 ? 1_555 106.7 ? 
15 SG ? D CYS 25 ? B CYS 1252 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 28 ? B CYS 1255 ? 1_555 105.2 ? 
16 SG ? D CYS 8  ? B CYS 1235 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 11 ? B CYS 1238 ? 1_555 111.9 ? 
17 SG ? D CYS 25 ? B CYS 1252 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 11 ? B CYS 1238 ? 1_555 105.6 ? 
18 SG ? D CYS 28 ? B CYS 1255 ? 1_555 ZN ? G ZN . ? B ZN 1221 ? 1_555 SG ? D CYS 11 ? B CYS 1238 ? 1_555 113.2 ? 
19 SG ? D CYS 44 ? B CYS 1271 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 60 ? B CYS 1287 ? 1_555 106.7 ? 
20 SG ? D CYS 44 ? B CYS 1271 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 63 ? B CYS 1290 ? 1_555 111.5 ? 
21 SG ? D CYS 60 ? B CYS 1287 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 63 ? B CYS 1290 ? 1_555 107.4 ? 
22 SG ? D CYS 44 ? B CYS 1271 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 50 ? B CYS 1277 ? 1_555 107.2 ? 
23 SG ? D CYS 60 ? B CYS 1287 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 50 ? B CYS 1277 ? 1_555 114.9 ? 
24 SG ? D CYS 63 ? B CYS 1290 ? 1_555 ZN ? H ZN . ? B ZN 1222 ? 1_555 SG ? D CYS 50 ? B CYS 1277 ? 1_555 109.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
CNS       refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" C DG  1497 ? ? "C1'" C DG  1497 ? ? N9    C DG  1497 ? ? 110.82 108.30 2.52  0.30 N 
2  1 "O4'" C DT  1499 ? ? "C1'" C DT  1499 ? ? N1    C DT  1499 ? ? 102.84 108.00 -5.16 0.70 N 
3  1 "O5'" C DC  1500 ? ? "C5'" C DC  1500 ? ? "C4'" C DC  1500 ? ? 104.14 109.40 -5.26 0.80 N 
4  1 "O4'" C DA  1502 ? ? "C1'" C DA  1502 ? ? N9    C DA  1502 ? ? 113.45 108.30 5.15  0.30 N 
5  1 N1    C DA  1503 ? ? C2    C DA  1503 ? ? N3    C DA  1503 ? ? 125.95 129.30 -3.35 0.50 N 
6  1 C2    C DA  1503 ? ? N3    C DA  1503 ? ? C4    C DA  1503 ? ? 113.99 110.60 3.39  0.50 N 
7  1 C2    C DG  1505 ? ? N3    C DG  1505 ? ? C4    C DG  1505 ? ? 108.80 111.90 -3.10 0.50 N 
8  1 N3    C DG  1505 ? ? C4    C DG  1505 ? ? C5    C DG  1505 ? ? 132.33 128.60 3.73  0.50 N 
9  1 "C5'" C DA  1508 ? ? "C4'" C DA  1508 ? ? "O4'" C DA  1508 ? ? 118.06 109.80 8.26  1.10 N 
10 1 "O4'" D DT  1532 ? ? "C1'" D DT  1532 ? ? N1    D DT  1532 ? ? 102.93 108.00 -5.07 0.70 N 
11 1 "O4'" D DG  1533 ? ? "C1'" D DG  1533 ? ? N9    D DG  1533 ? ? 110.57 108.30 2.27  0.30 N 
12 1 "O4'" D DT  1538 ? ? "C1'" D DT  1538 ? ? N1    D DT  1538 ? ? 103.04 108.00 -4.96 0.70 N 
13 1 N3    D DT  1538 ? ? C2    D DT  1538 ? ? O2    D DT  1538 ? ? 117.36 122.30 -4.94 0.60 N 
14 1 "O4'" D DT  1539 ? ? "C1'" D DT  1539 ? ? N1    D DT  1539 ? ? 103.01 108.00 -4.99 0.70 N 
15 1 N1    D DG  1540 ? ? C6    D DG  1540 ? ? O6    D DG  1540 ? ? 124.54 119.90 4.64  0.60 N 
16 1 "O4'" D DA  1541 ? ? "C1'" D DA  1541 ? ? N9    D DA  1541 ? ? 102.65 108.00 -5.35 0.70 N 
17 1 C6    D DT  1544 ? ? C5    D DT  1544 ? ? C7    D DT  1544 ? ? 126.66 122.90 3.76  0.60 N 
18 1 CD    A ARG 1161 ? ? NE    A ARG 1161 ? ? CZ    A ARG 1161 ? ? 132.87 123.60 9.27  1.40 N 
19 1 NE    A ARG 1161 ? ? CZ    A ARG 1161 ? ? NH1   A ARG 1161 ? ? 124.95 120.30 4.65  0.50 N 
20 1 CB    B TYR 1247 ? ? CG    B TYR 1247 ? ? CD1   B TYR 1247 ? ? 124.93 121.00 3.93  0.60 N 
21 1 NE    B ARG 1261 ? ? CZ    B ARG 1261 ? ? NH2   B ARG 1261 ? ? 117.27 120.30 -3.03 0.50 N 
22 1 CB    B TYR 1289 ? ? CG    B TYR 1289 ? ? CD2   B TYR 1289 ? ? 126.40 121.00 5.40  0.60 N 
23 1 CD    B ARG 1302 ? ? NE    B ARG 1302 ? ? CZ    B ARG 1302 ? ? 138.24 123.60 14.64 1.40 N 
24 1 NE    B ARG 1302 ? ? CZ    B ARG 1302 ? ? NH1   B ARG 1302 ? ? 126.63 120.30 6.33  0.50 N 
25 1 NE    B ARG 1302 ? ? CZ    B ARG 1302 ? ? NH2   B ARG 1302 ? ? 116.83 120.30 -3.47 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 1173 ? ? -120.04 -118.00 
2 1 LYS B 1232 ? ? -115.07 -81.90  
3 1 ASP B 1273 ? ? -123.67 -119.75 
4 1 ASP B 1276 ? ? -144.49 33.12   
5 1 GLN B 1310 ? ? -147.25 -38.81  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 1141 ? CG  ? C LYS 13 CG  
2  1 Y 1 A LYS 1141 ? CD  ? C LYS 13 CD  
3  1 Y 1 A LYS 1141 ? CE  ? C LYS 13 CE  
4  1 Y 1 A LYS 1141 ? NZ  ? C LYS 13 NZ  
5  1 Y 1 A VAL 1168 ? CG1 ? C VAL 40 CG1 
6  1 Y 1 A VAL 1168 ? CG2 ? C VAL 40 CG2 
7  1 Y 1 A HIS 1172 ? CG  ? C HIS 44 CG  
8  1 Y 1 A HIS 1172 ? ND1 ? C HIS 44 ND1 
9  1 Y 1 A HIS 1172 ? CD2 ? C HIS 44 CD2 
10 1 Y 1 A HIS 1172 ? CE1 ? C HIS 44 CE1 
11 1 Y 1 A HIS 1172 ? NE2 ? C HIS 44 NE2 
12 1 Y 1 A ARG 1173 ? CG  ? C ARG 45 CG  
13 1 Y 1 A ARG 1173 ? CD  ? C ARG 45 CD  
14 1 Y 1 A ARG 1173 ? NE  ? C ARG 45 NE  
15 1 Y 1 A ARG 1173 ? CZ  ? C ARG 45 CZ  
16 1 Y 1 A ARG 1173 ? NH1 ? C ARG 45 NH1 
17 1 Y 1 A ARG 1173 ? NH2 ? C ARG 45 NH2 
18 1 Y 1 A ARG 1186 ? CG  ? C ARG 58 CG  
19 1 Y 1 A ARG 1186 ? CD  ? C ARG 58 CD  
20 1 Y 1 A ARG 1186 ? NE  ? C ARG 58 NE  
21 1 Y 1 A ARG 1186 ? CZ  ? C ARG 58 CZ  
22 1 Y 1 A ARG 1186 ? NH1 ? C ARG 58 NH1 
23 1 Y 1 A ARG 1186 ? NH2 ? C ARG 58 NH2 
24 1 Y 1 A GLU 1197 ? CG  ? C GLU 69 CG  
25 1 Y 1 A GLU 1197 ? CD  ? C GLU 69 CD  
26 1 Y 1 A GLU 1197 ? OE1 ? C GLU 69 OE1 
27 1 Y 1 A GLU 1197 ? OE2 ? C GLU 69 OE2 
28 1 Y 1 A ASP 1208 ? CG  ? C ASP 80 CG  
29 1 Y 1 A ASP 1208 ? OD1 ? C ASP 80 OD1 
30 1 Y 1 A ASP 1208 ? OD2 ? C ASP 80 OD2 
31 1 Y 1 B ARG 1272 ? CG  ? D ARG 45 CG  
32 1 Y 1 B ARG 1272 ? CD  ? D ARG 45 CD  
33 1 Y 1 B ARG 1272 ? NE  ? D ARG 45 NE  
34 1 Y 1 B ARG 1272 ? CZ  ? D ARG 45 CZ  
35 1 Y 1 B ARG 1272 ? NH1 ? D ARG 45 NH1 
36 1 Y 1 B ARG 1272 ? NH2 ? D ARG 45 NH2 
37 1 Y 1 B ASP 1273 ? CG  ? D ASP 46 CG  
38 1 Y 1 B ASP 1273 ? OD1 ? D ASP 46 OD1 
39 1 Y 1 B ASP 1273 ? OD2 ? D ASP 46 OD2 
40 1 Y 1 B GLN 1310 ? CG  ? D GLN 83 CG  
41 1 Y 1 B GLN 1310 ? CD  ? D GLN 83 CD  
42 1 Y 1 B GLN 1310 ? OE1 ? D GLN 83 OE1 
43 1 Y 1 B GLN 1310 ? NE2 ? D GLN 83 NE2 
44 1 Y 1 B ARG 1311 ? CG  ? D ARG 84 CG  
45 1 Y 1 B ARG 1311 ? CD  ? D ARG 84 CD  
46 1 Y 1 B ARG 1311 ? NE  ? D ARG 84 NE  
47 1 Y 1 B ARG 1311 ? CZ  ? D ARG 84 CZ  
48 1 Y 1 B ARG 1311 ? NH1 ? D ARG 84 NH1 
49 1 Y 1 B ARG 1311 ? NH2 ? D ARG 84 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 1129 ? C PRO 1  
2  1 Y 1 A ARG 1130 ? C ARG 2  
3  1 Y 1 A ILE 1131 ? C ILE 3  
4  1 Y 1 A TYR 1132 ? C TYR 4  
5  1 Y 1 A LYS 1133 ? C LYS 5  
6  1 Y 1 A ARG 1209 ? C ARG 81 
7  1 Y 1 A ASN 1210 ? C ASN 82 
8  1 Y 1 A LYS 1211 ? C LYS 83 
9  1 Y 1 A LYS 1212 ? C LYS 84 
10 1 Y 1 A LYS 1213 ? C LYS 85 
11 1 Y 1 A LYS 1214 ? C LYS 86 
12 1 Y 1 B GLY 1312 ? D GLY 85 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1DSZ 'double helix'        
1DSZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DC 1  1_555 B DG 15 1_555 0.116  -0.158 0.302  -7.947  -7.861  -1.794 1  C_DC1495:DG1545_D C 1495 ? D 1545 ? 19 1 
1 A DA 2  1_555 B DT 14 1_555 0.184  -0.067 0.318  -11.686 -14.952 2.271  2  C_DA1496:DT1544_D C 1496 ? D 1544 ? 20 1 
1 A DG 3  1_555 B DC 13 1_555 -0.442 0.022  0.197  3.647   -4.723  1.029  3  C_DG1497:DC1543_D C 1497 ? D 1543 ? 19 1 
1 A DG 4  1_555 B DC 12 1_555 -0.102 -0.024 0.112  -0.299  -4.935  0.415  4  C_DG1498:DC1542_D C 1498 ? D 1542 ? 19 1 
1 A DT 5  1_555 B DA 11 1_555 -0.320 -0.059 0.061  -1.760  -11.043 1.811  5  C_DT1499:DA1541_D C 1499 ? D 1541 ? 20 1 
1 A DC 6  1_555 B DG 10 1_555 0.101  -0.048 -0.177 7.118   -0.655  0.115  6  C_DC1500:DG1540_D C 1500 ? D 1540 ? 19 1 
1 A DA 7  1_555 B DT 9  1_555 0.124  -0.168 0.068  12.733  -23.300 2.211  7  C_DA1501:DT1539_D C 1501 ? D 1539 ? 20 1 
1 A DA 8  1_555 B DT 8  1_555 0.246  -0.108 0.061  11.459  -15.488 0.710  8  C_DA1502:DT1538_D C 1502 ? D 1538 ? 20 1 
1 A DA 9  1_555 B DT 7  1_555 0.025  -0.075 0.043  2.222   -13.527 -2.090 9  C_DA1503:DT1537_D C 1503 ? D 1537 ? 20 1 
1 A DG 10 1_555 B DC 6  1_555 -0.322 -0.094 -0.311 -10.798 -14.554 0.032  10 C_DG1504:DC1536_D C 1504 ? D 1536 ? 19 1 
1 A DG 11 1_555 B DC 5  1_555 -0.110 -0.047 -0.338 -20.458 -9.008  1.364  11 C_DG1505:DC1535_D C 1505 ? D 1535 ? 19 1 
1 A DT 12 1_555 B DA 4  1_555 -0.192 -0.057 0.136  -8.774  -1.904  1.418  12 C_DT1506:DA1534_D C 1506 ? D 1534 ? 20 1 
1 A DC 13 1_555 B DG 3  1_555 -0.001 -0.148 -0.129 5.886   0.128   -0.627 13 C_DC1507:DG1533_D C 1507 ? D 1533 ? 19 1 
1 A DA 14 1_555 B DT 2  1_555 0.149  -0.145 0.399  11.135  -23.262 -1.184 14 C_DA1508:DT1532_D C 1508 ? D 1532 ? 20 1 
1 A DG 15 1_555 B DC 1  1_555 0.007  -0.168 0.318  3.549   -14.408 -2.439 15 C_DG1509:DC1531_D C 1509 ? D 1531 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DC 1  1_555 B DG 15 1_555 A DA 2  1_555 B DT 14 1_555 0.021  0.236  3.310 -2.666 -0.172 38.231 0.381  -0.370 3.301 -0.262 
4.064  38.321 1  CC_DC1495DA1496:DT1544DG1545_DD C 1495 ? D 1545 ? C 1496 ? D 1544 ? 
1 A DA 2  1_555 B DT 14 1_555 A DG 3  1_555 B DC 13 1_555 0.182  -0.226 3.091 0.233  6.381  30.214 -1.589 -0.300 2.983 12.072 
-0.441 30.866 2  CC_DA1496DG1497:DC1543DT1544_DD C 1496 ? D 1544 ? C 1497 ? D 1543 ? 
1 A DG 3  1_555 B DC 13 1_555 A DG 4  1_555 B DC 12 1_555 -0.596 -0.560 3.400 0.242  2.525  35.665 -1.289 1.007  3.350 4.117  
-0.394 35.752 3  CC_DG1497DG1498:DC1542DC1543_DD C 1497 ? D 1543 ? C 1498 ? D 1542 ? 
1 A DG 4  1_555 B DC 12 1_555 A DT 5  1_555 B DA 11 1_555 -0.382 -0.735 3.357 0.710  2.238  29.935 -1.886 0.886  3.284 4.325  
-1.371 30.024 4  CC_DG1498DT1499:DA1541DC1542_DD C 1498 ? D 1542 ? C 1499 ? D 1541 ? 
1 A DT 5  1_555 B DA 11 1_555 A DC 6  1_555 B DG 10 1_555 0.971  1.364  3.239 4.905  3.098  39.160 1.643  -0.845 3.425 4.591  
-7.270 39.571 5  CC_DT1499DC1500:DG1540DA1541_DD C 1499 ? D 1541 ? C 1500 ? D 1540 ? 
1 A DC 6  1_555 B DG 10 1_555 A DA 7  1_555 B DT 9  1_555 -0.877 1.532  3.245 -1.961 5.025  36.749 1.715  1.107  3.458 7.917  
3.091  37.129 6  CC_DC1500DA1501:DT1539DG1540_DD C 1500 ? D 1540 ? C 1501 ? D 1539 ? 
1 A DA 7  1_555 B DT 9  1_555 A DA 8  1_555 B DT 8  1_555 0.635  -0.043 3.325 1.617  -2.522 33.934 0.337  -0.821 3.345 -4.311 
-2.765 34.062 7  CC_DA1501DA1502:DT1538DT1539_DD C 1501 ? D 1539 ? C 1502 ? D 1538 ? 
1 A DA 8  1_555 B DT 8  1_555 A DA 9  1_555 B DT 7  1_555 -0.087 -0.221 3.448 -3.341 -5.871 40.890 0.352  -0.255 3.443 -8.334 
4.743  41.421 8  CC_DA1502DA1503:DT1537DT1538_DD C 1502 ? D 1538 ? C 1503 ? D 1537 ? 
1 A DA 9  1_555 B DT 7  1_555 A DG 10 1_555 B DC 6  1_555 0.534  -1.364 3.713 2.645  0.897  33.536 -2.522 -0.432 3.707 1.552  
-4.574 33.649 9  CC_DA1503DG1504:DC1536DT1537_DD C 1503 ? D 1537 ? C 1504 ? D 1536 ? 
1 A DG 10 1_555 B DC 6  1_555 A DG 11 1_555 B DC 5  1_555 0.580  -1.538 3.580 5.017  8.784  32.463 -4.108 -0.151 3.123 15.256 
-8.714 33.962 10 CC_DG1504DG1505:DC1535DC1536_DD C 1504 ? D 1536 ? C 1505 ? D 1535 ? 
1 A DG 11 1_555 B DC 5  1_555 A DT 12 1_555 B DA 4  1_555 -0.489 -0.836 3.132 0.356  1.303  30.730 -1.818 0.988  3.089 2.458  
-0.672 30.759 11 CC_DG1505DT1506:DA1534DC1535_DD C 1505 ? D 1535 ? C 1506 ? D 1534 ? 
1 A DT 12 1_555 B DA 4  1_555 A DC 13 1_555 B DG 3  1_555 0.892  0.823  3.213 6.093  1.417  36.787 1.098  -0.582 3.342 2.225  
-9.569 37.297 12 CC_DT1506DC1507:DG1533DA1534_DD C 1506 ? D 1534 ? C 1507 ? D 1533 ? 
1 A DC 13 1_555 B DG 3  1_555 A DA 14 1_555 B DT 2  1_555 -1.162 1.578  3.322 -4.557 -1.351 38.544 2.543  1.176  3.378 -2.037 
6.872  38.825 13 CC_DC1507DA1508:DT1532DG1533_DD C 1507 ? D 1533 ? C 1508 ? D 1532 ? 
1 A DA 14 1_555 B DT 2  1_555 A DG 15 1_555 B DC 1  1_555 0.300  -0.232 3.433 0.137  1.067  33.378 -0.589 -0.498 3.425 1.857  
-0.239 33.394 14 CC_DA1508DG1509:DC1531DT1532_DD C 1508 ? D 1532 ? C 1509 ? D 1531 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'ZINC ION' ZN  
6 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 ZN  1   1121 1121 ZN  ZN  A . 
F 5 ZN  1   1122 1122 ZN  ZN  A . 
G 5 ZN  1   1221 1221 ZN  ZN  B . 
H 5 ZN  1   1222 1222 ZN  ZN  B . 
I 6 HOH 1   2001 2001 HOH TIP C . 
I 6 HOH 2   2003 2003 HOH TIP C . 
I 6 HOH 3   2004 2004 HOH TIP C . 
I 6 HOH 4   2014 2014 HOH TIP C . 
I 6 HOH 5   2027 2027 HOH TIP C . 
I 6 HOH 6   2029 2029 HOH TIP C . 
I 6 HOH 7   2051 2051 HOH TIP C . 
I 6 HOH 8   2052 2052 HOH TIP C . 
I 6 HOH 9   2058 2058 HOH TIP C . 
I 6 HOH 10  2060 2060 HOH TIP C . 
I 6 HOH 11  2065 2065 HOH TIP C . 
I 6 HOH 12  2067 2067 HOH TIP C . 
I 6 HOH 13  2068 2068 HOH TIP C . 
I 6 HOH 14  2071 2071 HOH TIP C . 
I 6 HOH 15  2072 2072 HOH TIP C . 
I 6 HOH 16  2075 2075 HOH TIP C . 
I 6 HOH 17  2079 2079 HOH TIP C . 
I 6 HOH 18  2084 2084 HOH TIP C . 
I 6 HOH 19  2086 2086 HOH TIP C . 
I 6 HOH 20  2089 2089 HOH TIP C . 
I 6 HOH 21  2098 2098 HOH TIP C . 
I 6 HOH 22  2104 2104 HOH TIP C . 
I 6 HOH 23  2108 2108 HOH TIP C . 
I 6 HOH 24  2109 2109 HOH TIP C . 
I 6 HOH 25  2110 2110 HOH TIP C . 
I 6 HOH 26  2111 2111 HOH TIP C . 
I 6 HOH 27  2113 2113 HOH TIP C . 
I 6 HOH 28  2120 2120 HOH TIP C . 
I 6 HOH 29  2133 2133 HOH TIP C . 
I 6 HOH 30  2134 2134 HOH TIP C . 
I 6 HOH 31  2149 2149 HOH TIP C . 
I 6 HOH 32  2161 2161 HOH TIP C . 
I 6 HOH 33  2162 2162 HOH TIP C . 
I 6 HOH 34  2163 2163 HOH TIP C . 
I 6 HOH 35  2164 2164 HOH TIP C . 
I 6 HOH 36  2165 2165 HOH TIP C . 
I 6 HOH 37  2173 2173 HOH TIP C . 
I 6 HOH 38  2177 2177 HOH TIP C . 
I 6 HOH 39  2188 2188 HOH TIP C . 
I 6 HOH 40  2209 2209 HOH TIP C . 
I 6 HOH 41  2212 2212 HOH TIP C . 
I 6 HOH 42  2215 2215 HOH TIP C . 
I 6 HOH 43  2218 2218 HOH TIP C . 
I 6 HOH 44  2222 2222 HOH TIP C . 
I 6 HOH 45  2223 2223 HOH TIP C . 
I 6 HOH 46  2243 2243 HOH TIP C . 
I 6 HOH 47  2244 2244 HOH TIP C . 
I 6 HOH 48  2250 2250 HOH TIP C . 
I 6 HOH 49  2252 2252 HOH TIP C . 
I 6 HOH 50  2258 2258 HOH TIP C . 
I 6 HOH 51  2260 2260 HOH TIP C . 
I 6 HOH 52  2261 2261 HOH TIP C . 
I 6 HOH 53  2262 2262 HOH TIP C . 
I 6 HOH 54  2264 2264 HOH TIP C . 
I 6 HOH 55  2266 2266 HOH TIP C . 
I 6 HOH 56  2275 2275 HOH TIP C . 
I 6 HOH 57  2281 2281 HOH TIP C . 
I 6 HOH 58  2286 2286 HOH TIP C . 
I 6 HOH 59  2287 2287 HOH TIP C . 
I 6 HOH 60  2289 2289 HOH TIP C . 
I 6 HOH 61  2290 2290 HOH TIP C . 
I 6 HOH 62  2292 2292 HOH TIP C . 
I 6 HOH 63  2296 2296 HOH TIP C . 
I 6 HOH 64  2305 2305 HOH TIP C . 
I 6 HOH 65  2306 2306 HOH TIP C . 
I 6 HOH 66  2325 2325 HOH TIP C . 
J 6 HOH 1   2019 2019 HOH TIP D . 
J 6 HOH 2   2021 2021 HOH TIP D . 
J 6 HOH 3   2023 2023 HOH TIP D . 
J 6 HOH 4   2041 2041 HOH TIP D . 
J 6 HOH 5   2043 2043 HOH TIP D . 
J 6 HOH 6   2047 2047 HOH TIP D . 
J 6 HOH 7   2049 2049 HOH TIP D . 
J 6 HOH 8   2053 2053 HOH TIP D . 
J 6 HOH 9   2070 2070 HOH TIP D . 
J 6 HOH 10  2074 2074 HOH TIP D . 
J 6 HOH 11  2076 2076 HOH TIP D . 
J 6 HOH 12  2077 2077 HOH TIP D . 
J 6 HOH 13  2078 2078 HOH TIP D . 
J 6 HOH 14  2085 2085 HOH TIP D . 
J 6 HOH 15  2087 2087 HOH TIP D . 
J 6 HOH 16  2094 2094 HOH TIP D . 
J 6 HOH 17  2100 2100 HOH TIP D . 
J 6 HOH 18  2107 2107 HOH TIP D . 
J 6 HOH 19  2112 2112 HOH TIP D . 
J 6 HOH 20  2114 2114 HOH TIP D . 
J 6 HOH 21  2115 2115 HOH TIP D . 
J 6 HOH 22  2116 2116 HOH TIP D . 
J 6 HOH 23  2117 2117 HOH TIP D . 
J 6 HOH 24  2118 2118 HOH TIP D . 
J 6 HOH 25  2119 2119 HOH TIP D . 
J 6 HOH 26  2125 2125 HOH TIP D . 
J 6 HOH 27  2126 2126 HOH TIP D . 
J 6 HOH 28  2135 2135 HOH TIP D . 
J 6 HOH 29  2144 2144 HOH TIP D . 
J 6 HOH 30  2152 2152 HOH TIP D . 
J 6 HOH 31  2158 2158 HOH TIP D . 
J 6 HOH 32  2171 2171 HOH TIP D . 
J 6 HOH 33  2172 2172 HOH TIP D . 
J 6 HOH 34  2176 2176 HOH TIP D . 
J 6 HOH 35  2180 2180 HOH TIP D . 
J 6 HOH 36  2185 2185 HOH TIP D . 
J 6 HOH 37  2187 2187 HOH TIP D . 
J 6 HOH 38  2194 2194 HOH TIP D . 
J 6 HOH 39  2200 2200 HOH TIP D . 
J 6 HOH 40  2203 2203 HOH TIP D . 
J 6 HOH 41  2211 2211 HOH TIP D . 
J 6 HOH 42  2213 2213 HOH TIP D . 
J 6 HOH 43  2217 2217 HOH TIP D . 
J 6 HOH 44  2219 2219 HOH TIP D . 
J 6 HOH 45  2232 2232 HOH TIP D . 
J 6 HOH 46  2236 2236 HOH TIP D . 
J 6 HOH 47  2237 2237 HOH TIP D . 
J 6 HOH 48  2239 2239 HOH TIP D . 
J 6 HOH 49  2240 2240 HOH TIP D . 
J 6 HOH 50  2251 2251 HOH TIP D . 
J 6 HOH 51  2254 2254 HOH TIP D . 
J 6 HOH 52  2255 2255 HOH TIP D . 
J 6 HOH 53  2256 2256 HOH TIP D . 
J 6 HOH 54  2257 2257 HOH TIP D . 
J 6 HOH 55  2263 2263 HOH TIP D . 
J 6 HOH 56  2267 2267 HOH TIP D . 
J 6 HOH 57  2269 2269 HOH TIP D . 
J 6 HOH 58  2270 2270 HOH TIP D . 
J 6 HOH 59  2274 2274 HOH TIP D . 
J 6 HOH 60  2279 2279 HOH TIP D . 
J 6 HOH 61  2280 2280 HOH TIP D . 
J 6 HOH 62  2283 2283 HOH TIP D . 
J 6 HOH 63  2284 2284 HOH TIP D . 
J 6 HOH 64  2288 2288 HOH TIP D . 
J 6 HOH 65  2293 2293 HOH TIP D . 
J 6 HOH 66  2295 2295 HOH TIP D . 
J 6 HOH 67  2301 2301 HOH TIP D . 
J 6 HOH 68  2309 2309 HOH TIP D . 
J 6 HOH 69  2310 2310 HOH TIP D . 
J 6 HOH 70  2311 2311 HOH TIP D . 
J 6 HOH 71  2326 2326 HOH TIP D . 
J 6 HOH 72  2339 2339 HOH TIP D . 
J 6 HOH 73  2340 2340 HOH TIP D . 
J 6 HOH 74  2341 2341 HOH TIP D . 
K 6 HOH 1   2016 2016 HOH TIP A . 
K 6 HOH 2   2017 2017 HOH TIP A . 
K 6 HOH 3   2054 2054 HOH TIP A . 
K 6 HOH 4   2062 2062 HOH TIP A . 
K 6 HOH 5   2088 2088 HOH TIP A . 
K 6 HOH 6   2096 2096 HOH TIP A . 
K 6 HOH 7   2099 2099 HOH TIP A . 
K 6 HOH 8   2105 2105 HOH TIP A . 
K 6 HOH 9   2106 2106 HOH TIP A . 
K 6 HOH 10  2122 2122 HOH TIP A . 
K 6 HOH 11  2124 2124 HOH TIP A . 
K 6 HOH 12  2127 2127 HOH TIP A . 
K 6 HOH 13  2128 2128 HOH TIP A . 
K 6 HOH 14  2129 2129 HOH TIP A . 
K 6 HOH 15  2130 2130 HOH TIP A . 
K 6 HOH 16  2146 2146 HOH TIP A . 
K 6 HOH 17  2147 2147 HOH TIP A . 
K 6 HOH 18  2148 2148 HOH TIP A . 
K 6 HOH 19  2150 2150 HOH TIP A . 
K 6 HOH 20  2151 2151 HOH TIP A . 
K 6 HOH 21  2159 2159 HOH TIP A . 
K 6 HOH 22  2160 2160 HOH TIP A . 
K 6 HOH 23  2167 2167 HOH TIP A . 
K 6 HOH 24  2168 2168 HOH TIP A . 
K 6 HOH 25  2181 2181 HOH TIP A . 
K 6 HOH 26  2184 2184 HOH TIP A . 
K 6 HOH 27  2186 2186 HOH TIP A . 
K 6 HOH 28  2189 2189 HOH TIP A . 
K 6 HOH 29  2190 2190 HOH TIP A . 
K 6 HOH 30  2192 2192 HOH TIP A . 
K 6 HOH 31  2195 2195 HOH TIP A . 
K 6 HOH 32  2205 2205 HOH TIP A . 
K 6 HOH 33  2208 2208 HOH TIP A . 
K 6 HOH 34  2210 2210 HOH TIP A . 
K 6 HOH 35  2225 2225 HOH TIP A . 
K 6 HOH 36  2227 2227 HOH TIP A . 
K 6 HOH 37  2231 2231 HOH TIP A . 
K 6 HOH 38  2245 2245 HOH TIP A . 
K 6 HOH 39  2246 2246 HOH TIP A . 
K 6 HOH 40  2247 2247 HOH TIP A . 
K 6 HOH 41  2259 2259 HOH TIP A . 
K 6 HOH 42  2271 2271 HOH TIP A . 
K 6 HOH 43  2273 2273 HOH TIP A . 
K 6 HOH 44  2282 2282 HOH TIP A . 
K 6 HOH 45  2285 2285 HOH TIP A . 
K 6 HOH 46  2291 2291 HOH TIP A . 
K 6 HOH 47  2294 2294 HOH TIP A . 
K 6 HOH 48  2297 2297 HOH TIP A . 
K 6 HOH 49  2299 2299 HOH TIP A . 
K 6 HOH 50  2300 2300 HOH TIP A . 
K 6 HOH 51  2302 2302 HOH TIP A . 
K 6 HOH 52  2307 2307 HOH TIP A . 
K 6 HOH 53  2312 2312 HOH TIP A . 
K 6 HOH 54  2315 2315 HOH TIP A . 
K 6 HOH 55  2329 2329 HOH TIP A . 
K 6 HOH 56  2331 2331 HOH TIP A . 
K 6 HOH 57  2342 2342 HOH TIP A . 
L 6 HOH 1   2002 2002 HOH TIP B . 
L 6 HOH 2   2005 2005 HOH TIP B . 
L 6 HOH 3   2006 2006 HOH TIP B . 
L 6 HOH 4   2007 2007 HOH TIP B . 
L 6 HOH 5   2008 2008 HOH TIP B . 
L 6 HOH 6   2009 2009 HOH TIP B . 
L 6 HOH 7   2010 2010 HOH TIP B . 
L 6 HOH 8   2011 2011 HOH TIP B . 
L 6 HOH 9   2012 2012 HOH TIP B . 
L 6 HOH 10  2013 2013 HOH TIP B . 
L 6 HOH 11  2015 2015 HOH TIP B . 
L 6 HOH 12  2018 2018 HOH TIP B . 
L 6 HOH 13  2020 2020 HOH TIP B . 
L 6 HOH 14  2022 2022 HOH TIP B . 
L 6 HOH 15  2024 2024 HOH TIP B . 
L 6 HOH 16  2025 2025 HOH TIP B . 
L 6 HOH 17  2026 2026 HOH TIP B . 
L 6 HOH 18  2028 2028 HOH TIP B . 
L 6 HOH 19  2030 2030 HOH TIP B . 
L 6 HOH 20  2031 2031 HOH TIP B . 
L 6 HOH 21  2032 2032 HOH TIP B . 
L 6 HOH 22  2033 2033 HOH TIP B . 
L 6 HOH 23  2034 2034 HOH TIP B . 
L 6 HOH 24  2035 2035 HOH TIP B . 
L 6 HOH 25  2036 2036 HOH TIP B . 
L 6 HOH 26  2037 2037 HOH TIP B . 
L 6 HOH 27  2038 2038 HOH TIP B . 
L 6 HOH 28  2039 2039 HOH TIP B . 
L 6 HOH 29  2040 2040 HOH TIP B . 
L 6 HOH 30  2042 2042 HOH TIP B . 
L 6 HOH 31  2044 2044 HOH TIP B . 
L 6 HOH 32  2045 2045 HOH TIP B . 
L 6 HOH 33  2046 2046 HOH TIP B . 
L 6 HOH 34  2048 2048 HOH TIP B . 
L 6 HOH 35  2050 2050 HOH TIP B . 
L 6 HOH 36  2055 2055 HOH TIP B . 
L 6 HOH 37  2056 2056 HOH TIP B . 
L 6 HOH 38  2057 2057 HOH TIP B . 
L 6 HOH 39  2059 2059 HOH TIP B . 
L 6 HOH 40  2061 2061 HOH TIP B . 
L 6 HOH 41  2063 2063 HOH TIP B . 
L 6 HOH 42  2064 2064 HOH TIP B . 
L 6 HOH 43  2066 2066 HOH TIP B . 
L 6 HOH 44  2069 2069 HOH TIP B . 
L 6 HOH 45  2073 2073 HOH TIP B . 
L 6 HOH 46  2080 2080 HOH TIP B . 
L 6 HOH 47  2081 2081 HOH TIP B . 
L 6 HOH 48  2082 2082 HOH TIP B . 
L 6 HOH 49  2083 2083 HOH TIP B . 
L 6 HOH 50  2090 2090 HOH TIP B . 
L 6 HOH 51  2091 2091 HOH TIP B . 
L 6 HOH 52  2092 2092 HOH TIP B . 
L 6 HOH 53  2093 2093 HOH TIP B . 
L 6 HOH 54  2095 2095 HOH TIP B . 
L 6 HOH 55  2097 2097 HOH TIP B . 
L 6 HOH 56  2101 2101 HOH TIP B . 
L 6 HOH 57  2102 2102 HOH TIP B . 
L 6 HOH 58  2103 2103 HOH TIP B . 
L 6 HOH 59  2121 2121 HOH TIP B . 
L 6 HOH 60  2123 2123 HOH TIP B . 
L 6 HOH 61  2131 2131 HOH TIP B . 
L 6 HOH 62  2132 2132 HOH TIP B . 
L 6 HOH 63  2136 2136 HOH TIP B . 
L 6 HOH 64  2137 2137 HOH TIP B . 
L 6 HOH 65  2138 2138 HOH TIP B . 
L 6 HOH 66  2140 2140 HOH TIP B . 
L 6 HOH 67  2141 2141 HOH TIP B . 
L 6 HOH 68  2142 2142 HOH TIP B . 
L 6 HOH 69  2143 2143 HOH TIP B . 
L 6 HOH 70  2145 2145 HOH TIP B . 
L 6 HOH 71  2153 2153 HOH TIP B . 
L 6 HOH 72  2154 2154 HOH TIP B . 
L 6 HOH 73  2155 2155 HOH TIP B . 
L 6 HOH 74  2156 2156 HOH TIP B . 
L 6 HOH 75  2157 2157 HOH TIP B . 
L 6 HOH 76  2166 2166 HOH TIP B . 
L 6 HOH 77  2169 2169 HOH TIP B . 
L 6 HOH 78  2170 2170 HOH TIP B . 
L 6 HOH 79  2174 2174 HOH TIP B . 
L 6 HOH 80  2175 2175 HOH TIP B . 
L 6 HOH 81  2178 2178 HOH TIP B . 
L 6 HOH 82  2179 2179 HOH TIP B . 
L 6 HOH 83  2182 2182 HOH TIP B . 
L 6 HOH 84  2183 2183 HOH TIP B . 
L 6 HOH 85  2191 2191 HOH TIP B . 
L 6 HOH 86  2193 2193 HOH TIP B . 
L 6 HOH 87  2196 2196 HOH TIP B . 
L 6 HOH 88  2197 2197 HOH TIP B . 
L 6 HOH 89  2198 2198 HOH TIP B . 
L 6 HOH 90  2199 2199 HOH TIP B . 
L 6 HOH 91  2201 2201 HOH TIP B . 
L 6 HOH 92  2202 2202 HOH TIP B . 
L 6 HOH 93  2204 2204 HOH TIP B . 
L 6 HOH 94  2206 2206 HOH TIP B . 
L 6 HOH 95  2207 2207 HOH TIP B . 
L 6 HOH 96  2214 2214 HOH TIP B . 
L 6 HOH 97  2216 2216 HOH TIP B . 
L 6 HOH 98  2220 2220 HOH TIP B . 
L 6 HOH 99  2221 2221 HOH TIP B . 
L 6 HOH 100 2224 2224 HOH TIP B . 
L 6 HOH 101 2226 2226 HOH TIP B . 
L 6 HOH 102 2228 2228 HOH TIP B . 
L 6 HOH 103 2229 2229 HOH TIP B . 
L 6 HOH 104 2233 2233 HOH TIP B . 
L 6 HOH 105 2234 2234 HOH TIP B . 
L 6 HOH 106 2235 2235 HOH TIP B . 
L 6 HOH 107 2238 2238 HOH TIP B . 
L 6 HOH 108 2241 2241 HOH TIP B . 
L 6 HOH 109 2242 2242 HOH TIP B . 
L 6 HOH 110 2248 2248 HOH TIP B . 
L 6 HOH 111 2249 2249 HOH TIP B . 
L 6 HOH 112 2253 2253 HOH TIP B . 
L 6 HOH 113 2265 2265 HOH TIP B . 
L 6 HOH 114 2268 2268 HOH TIP B . 
L 6 HOH 115 2272 2272 HOH TIP B . 
L 6 HOH 116 2276 2276 HOH TIP B . 
L 6 HOH 117 2277 2277 HOH TIP B . 
L 6 HOH 118 2278 2278 HOH TIP B . 
L 6 HOH 119 2298 2298 HOH TIP B . 
L 6 HOH 120 2303 2303 HOH TIP B . 
L 6 HOH 121 2304 2304 HOH TIP B . 
L 6 HOH 122 2308 2308 HOH TIP B . 
L 6 HOH 123 2313 2313 HOH TIP B . 
L 6 HOH 124 2314 2314 HOH TIP B . 
L 6 HOH 125 2316 2316 HOH TIP B . 
L 6 HOH 126 2317 2317 HOH TIP B . 
L 6 HOH 127 2318 2318 HOH TIP B . 
L 6 HOH 128 2319 2319 HOH TIP B . 
L 6 HOH 129 2320 2320 HOH TIP B . 
L 6 HOH 130 2321 2321 HOH TIP B . 
L 6 HOH 131 2322 2322 HOH TIP B . 
L 6 HOH 132 2323 2323 HOH TIP B . 
L 6 HOH 133 2324 2324 HOH TIP B . 
L 6 HOH 134 2327 2327 HOH TIP B . 
L 6 HOH 135 2328 2328 HOH TIP B . 
L 6 HOH 136 2332 2332 HOH TIP B . 
L 6 HOH 137 2333 2333 HOH TIP B . 
L 6 HOH 138 2334 2334 HOH TIP B . 
L 6 HOH 139 2335 2335 HOH TIP B . 
L 6 HOH 140 2336 2336 HOH TIP B . 
L 6 HOH 141 2337 2337 HOH TIP B . 
#