data_1DUX
# 
_entry.id   1DUX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DUX         
NDB   PD0116       
RCSB  RCSB010391   
WWPDB D_1000010391 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DUX 
_pdbx_database_status.recvd_initial_deposition_date   2000-01-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mo, Y.'          1 
'Vaessen, B.'     2 
'Johnston, K.'    3 
'Marmorstein, R.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            7 
_citation.page_first                292 
_citation.page_last                 297 
_citation.year                      2000 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10742173 
_citation.pdbx_database_id_DOI      10.1038/74055 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mo, Y.'          1 
primary 'Vaessen, B.'     2 
primary 'Johnston, K.'    3 
primary 'Marmorstein, R.' 4 
# 
_cell.entry_id           1DUX 
_cell.length_a           33.245 
_cell.length_b           140.523 
_cell.length_c           38.620 
_cell.angle_alpha        90.00 
_cell.angle_beta         115.52 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DUX 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     monoclinic 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*GP*AP*CP*CP*GP*GP*AP*AP*GP*TP*GP*T)-3')
;
4031.634  2   ? ? ?               ? 
2 polymer syn 
;DNA (5'-D(*AP*CP*AP*CP*TP*TP*CP*CP*GP*GP*TP*CP*A)-3')
;
3911.562  2   ? ? ?               ? 
3 polymer man 'ETS-DOMAIN PROTEIN ELK-1'                              11067.706 2   ? ? 'RESIDUES 1-94' ? 
4 water   nat water                                                   18.015    225 ? ? ?               ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'TRANSFORMING PROTEIN ELK-1, ELK1, MEMBER OF ETS ONCOGENE FAMILY' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DA)(DC)(DC)(DG)(DG)(DA)(DA)(DG)(DT)(DG)(DT)'                                            
TGACCGGAAGTGT                                                                                     A,D ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DA)(DC)(DT)(DT)(DC)(DC)(DG)(DG)(DT)(DC)(DA)'                                            
ACACTTCCGGTCA                                                                                     B,E ? 
3 'polypeptide(L)'        no no 
;MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQK
FVYKFVSYPEVAGC
;
;MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQK
FVYKFVSYPEVAGC
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DT  n 
1 2  DG  n 
1 3  DA  n 
1 4  DC  n 
1 5  DC  n 
1 6  DG  n 
1 7  DG  n 
1 8  DA  n 
1 9  DA  n 
1 10 DG  n 
1 11 DT  n 
1 12 DG  n 
1 13 DT  n 
2 1  DA  n 
2 2  DC  n 
2 3  DA  n 
2 4  DC  n 
2 5  DT  n 
2 6  DT  n 
2 7  DC  n 
2 8  DC  n 
2 9  DG  n 
2 10 DG  n 
2 11 DT  n 
2 12 DC  n 
2 13 DA  n 
3 1  MET n 
3 2  ASP n 
3 3  PRO n 
3 4  SER n 
3 5  VAL n 
3 6  THR n 
3 7  LEU n 
3 8  TRP n 
3 9  GLN n 
3 10 PHE n 
3 11 LEU n 
3 12 LEU n 
3 13 GLN n 
3 14 LEU n 
3 15 LEU n 
3 16 ARG n 
3 17 GLU n 
3 18 GLN n 
3 19 GLY n 
3 20 ASN n 
3 21 GLY n 
3 22 HIS n 
3 23 ILE n 
3 24 ILE n 
3 25 SER n 
3 26 TRP n 
3 27 THR n 
3 28 SER n 
3 29 ARG n 
3 30 ASP n 
3 31 GLY n 
3 32 GLY n 
3 33 GLU n 
3 34 PHE n 
3 35 LYS n 
3 36 LEU n 
3 37 VAL n 
3 38 ASP n 
3 39 ALA n 
3 40 GLU n 
3 41 GLU n 
3 42 VAL n 
3 43 ALA n 
3 44 ARG n 
3 45 LEU n 
3 46 TRP n 
3 47 GLY n 
3 48 LEU n 
3 49 ARG n 
3 50 LYS n 
3 51 ASN n 
3 52 LYS n 
3 53 THR n 
3 54 ASN n 
3 55 MET n 
3 56 ASN n 
3 57 TYR n 
3 58 ASP n 
3 59 LYS n 
3 60 LEU n 
3 61 SER n 
3 62 ARG n 
3 63 ALA n 
3 64 LEU n 
3 65 ARG n 
3 66 TYR n 
3 67 TYR n 
3 68 TYR n 
3 69 ASP n 
3 70 LYS n 
3 71 ASN n 
3 72 ILE n 
3 73 ILE n 
3 74 ARG n 
3 75 LYS n 
3 76 VAL n 
3 77 SER n 
3 78 GLY n 
3 79 GLN n 
3 80 LYS n 
3 81 PHE n 
3 82 VAL n 
3 83 TYR n 
3 84 LYS n 
3 85 PHE n 
3 86 VAL n 
3 87 SER n 
3 88 TYR n 
3 89 PRO n 
3 90 GLU n 
3 91 VAL n 
3 92 ALA n 
3 93 GLY n 
3 94 CYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PRSETA 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP ELK1_HUMAN 3 P19419 1 
;MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQK
FVYKFVSYPEVAGCST
;
? 
2 PDB 1DUX       1 1DUX   ? ?                                                                                                   ? 
3 PDB 1DUX       2 1DUX   ? ?                                                                                                   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DUX C 1 ? 94 ? P19419 1 ? 94 ? 1 94 
2 1 1DUX F 1 ? 94 ? P19419 1 ? 94 ? 1 94 
3 2 1DUX A 1 ? 13 ? 1DUX   1 ? 13 ? 1 13 
4 3 1DUX B 1 ? 13 ? 1DUX   1 ? 13 ? 1 13 
5 2 1DUX D 1 ? 13 ? 1DUX   1 ? 13 ? 1 13 
6 3 1DUX E 1 ? 13 ? 1DUX   1 ? 13 ? 1 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1DUX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.58 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
'50 mM sodium Cacodylate, 10% PEG 2000, 100 mM MgCl2, 100 mM NaCl, 3 mM ZnCl2, pH 5.6, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'sodium Cacodylate' ? ? ? 
1 2 1 MgCl2               ? ? ? 
1 3 1 NaCl                ? ? ? 
1 4 1 ZnCl2               ? ? ? 
1 5 1 'PEG 2000'          ? ? ? 
1 6 2 'PEG 2000'          ? ? ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 110 ? 1 
2 110 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 'IMAGE PLATE' 'RIGAKU RAXIS IV' 1998-02-15 ? 
2 'IMAGE PLATE' MARRESEARCH       1998-07-14 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9791  1.0 
2 0.98165 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'NSLS BEAMLINE X4A' NSLS X4A 0.9791  ? 
2 SYNCHROTRON 'NSLS BEAMLINE X8C' NSLS X8C 0.98165 ? 
# 
_reflns.entry_id                     1DUX 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   17831 
_reflns.number_all                   18614 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            0.0420000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.1 
_reflns.B_iso_Wilson_estimate        28.5 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_k_min                  ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.18 
_reflns_shell.percent_possible_all   77.6 
_reflns_shell.Rmerge_I_obs           0.0920000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.01 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1443 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1DUX 
_refine.ls_number_reflns_obs                     17831 
_refine.ls_number_reflns_all                     18614 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    95.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2020000 
_refine.ls_R_factor_R_free                       0.2360000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  1827 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1498 
_refine_hist.pdbx_number_atoms_nucleic_acid   1054 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             225 
_refine_hist.number_atoms_total               2777 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.089 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1DUX 
_struct.title                     'ELK-1/DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM DNA-BINDING SURFACE AFFECT DNA-RECOGNITION' 
_struct.pdbx_descriptor           'ETS-DOMAIN PROTEIN ELK-1/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DUX 
_struct_keywords.pdbx_keywords   Transcription/DNA 
_struct_keywords.text            
'ETS-DOMAIN, DNA-BINDING DOMAIN, WINGED HELIX-TURN-HELIX, DNA-BINDING SPECIFICITY, Transcription-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR E 6  ? GLN E 18 ? THR C 6  GLN C 18 1 ? 13 
HELX_P HELX_P2 2 ASP E 38 ? ARG E 49 ? ASP C 38 ARG C 49 1 ? 12 
HELX_P HELX_P3 3 ASN E 56 ? TYR E 68 ? ASN C 56 TYR C 68 1 ? 13 
HELX_P HELX_P4 4 ASP E 69 ? ASN E 71 ? ASP C 69 ASN C 71 5 ? 3  
HELX_P HELX_P5 5 THR F 6  ? GLN F 18 ? THR F 6  GLN F 18 1 ? 13 
HELX_P HELX_P6 6 ASP F 38 ? LYS F 50 ? ASP F 38 LYS F 50 1 ? 13 
HELX_P HELX_P7 7 ASN F 56 ? TYR F 68 ? ASN F 56 TYR F 68 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 1  N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT 1  B DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT 1  B DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 12 N3 ? ? A DG 2  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 12 O2 ? ? A DG 2  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 12 N4 ? ? A DG 2  B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DA 3  N1 ? ? ? 1_555 B DT 11 N3 ? ? A DA 3  B DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 3  N6 ? ? ? 1_555 B DT 11 O4 ? ? A DA 3  B DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 10 N1 ? ? A DC 4  B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 10 O6 ? ? A DC 4  B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 10 N2 ? ? A DC 4  B DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG 9  N1 ? ? A DC 5  B DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG 9  O6 ? ? A DC 5  B DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 9  N2 ? ? A DC 5  B DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 8  N3 ? ? A DG 6  B DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 8  O2 ? ? A DG 6  B DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 8  N4 ? ? A DG 6  B DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DG 7  N1 ? ? ? 1_555 B DC 7  N3 ? ? A DG 7  B DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DG 7  N2 ? ? ? 1_555 B DC 7  O2 ? ? A DG 7  B DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 7  O6 ? ? ? 1_555 B DC 7  N4 ? ? A DG 7  B DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 6  N3 ? ? A DA 8  B DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 6  O4 ? ? A DA 8  B DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 5  N3 ? ? A DA 9  B DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 5  O4 ? ? A DA 9  B DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DG 10 N1 ? ? ? 1_555 B DC 4  N3 ? ? A DG 10 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 10 N2 ? ? ? 1_555 B DC 4  O2 ? ? A DG 10 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 10 O6 ? ? ? 1_555 B DC 4  N4 ? ? A DG 10 B DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 3  N1 ? ? A DT 11 B DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 3  N6 ? ? A DT 11 B DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 2  N3 ? ? A DG 12 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 2  O2 ? ? A DG 12 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 2  N4 ? ? A DG 12 B DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 1  N1 ? ? A DT 13 B DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 1  N6 ? ? A DT 13 B DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DT 1  N3 ? ? ? 1_555 D DA 13 N1 ? ? D DT 1  E DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DT 1  O4 ? ? ? 1_555 D DA 13 N6 ? ? D DT 1  E DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 12 N3 ? ? D DG 2  E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC 12 O2 ? ? D DG 2  E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC 12 N4 ? ? D DG 2  E DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 11 N3 ? ? D DA 3  E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 11 O4 ? ? D DA 3  E DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C DC 4  N3 ? ? ? 1_555 D DG 10 N1 ? ? D DC 4  E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DC 4  N4 ? ? ? 1_555 D DG 10 O6 ? ? D DC 4  E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C DC 4  O2 ? ? ? 1_555 D DG 10 N2 ? ? D DC 4  E DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C DC 5  N3 ? ? ? 1_555 D DG 9  N1 ? ? D DC 5  E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C DC 5  N4 ? ? ? 1_555 D DG 9  O6 ? ? D DC 5  E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C DC 5  O2 ? ? ? 1_555 D DG 9  N2 ? ? D DC 5  E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 8  N3 ? ? D DG 6  E DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 8  O2 ? ? D DG 6  E DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 8  N4 ? ? D DG 6  E DC 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? C DG 7  N1 ? ? ? 1_555 D DC 7  N3 ? ? D DG 7  E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? C DG 7  N2 ? ? ? 1_555 D DC 7  O2 ? ? D DG 7  E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? C DG 7  O6 ? ? ? 1_555 D DC 7  N4 ? ? D DG 7  E DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 6  N3 ? ? D DA 8  E DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 6  O4 ? ? D DA 8  E DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 5  N3 ? ? D DA 9  E DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 5  O4 ? ? D DA 9  E DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 4  N3 ? ? D DG 10 E DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 4  O2 ? ? D DG 10 E DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 4  N4 ? ? D DG 10 E DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 3  N1 ? ? D DT 11 E DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 3  N6 ? ? D DT 11 E DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? C DG 12 N1 ? ? ? 1_555 D DC 2  N3 ? ? D DG 12 E DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? C DG 12 N2 ? ? ? 1_555 D DC 2  O2 ? ? D DG 12 E DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? C DG 12 O6 ? ? ? 1_555 D DC 2  N4 ? ? D DG 12 E DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? C DT 13 N3 ? ? ? 1_555 D DA 1  N1 ? ? D DT 13 E DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? C DT 13 O4 ? ? ? 1_555 D DA 1  N6 ? ? D DT 13 E DA 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER E 25 ? SER E 28 ? SER C 25 SER C 28 
A 2 GLU E 33 ? LYS E 35 ? GLU C 33 LYS C 35 
A 3 VAL E 82 ? PHE E 85 ? VAL C 82 PHE C 85 
A 4 ILE E 73 ? LYS E 75 ? ILE C 73 LYS C 75 
B 1 SER F 25 ? SER F 28 ? SER F 25 SER F 28 
B 2 GLU F 33 ? LYS F 35 ? GLU F 33 LYS F 35 
B 3 VAL F 82 ? PHE F 85 ? VAL F 82 PHE F 85 
B 4 ILE F 73 ? LYS F 75 ? ILE F 73 LYS F 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR E 27 ? N THR C 27 O GLU E 33 ? O GLU C 33 
A 2 3 O PHE E 34 ? O PHE C 34 N TYR E 83 ? N TYR C 83 
A 3 4 N LYS E 84 ? N LYS C 84 O ARG E 74 ? O ARG C 74 
B 1 2 N THR F 27 ? N THR F 27 O GLU F 33 ? O GLU F 33 
B 2 3 O PHE F 34 ? O PHE F 34 N TYR F 83 ? N TYR F 83 
B 3 4 N LYS F 84 ? N LYS F 84 O ARG F 74 ? O ARG F 74 
# 
_database_PDB_matrix.entry_id          1DUX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DUX 
_atom_sites.fract_transf_matrix[1][1]   0.030080 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.014360 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007116 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028693 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1  ? 2.806   -13.571 -4.001 1.00 54.11 ? 1   DT  A "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1  ? 1.955   -14.304 -3.117 1.00 53.09 ? 1   DT  A "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1  ? 2.071   -13.831 -1.686 1.00 52.20 ? 1   DT  A "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1  ? 1.069   -14.493 -0.877 1.00 51.68 ? 1   DT  A "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1  ? 3.416   -14.126 -1.014 1.00 52.18 ? 1   DT  A "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1  ? 3.734   -13.075 -0.091 1.00 52.20 ? 1   DT  A "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1  ? 3.113   -15.377 -0.209 1.00 51.30 ? 1   DT  A "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1  ? 1.708   -15.051 0.257  1.00 50.16 ? 1   DT  A "C1'" 1 
ATOM   9    N N1    . DT  A 1 1  ? 0.890   -16.173 0.761  1.00 47.66 ? 1   DT  A N1    1 
ATOM   10   C C2    . DT  A 1 1  ? -0.464  -16.175 0.508  1.00 46.34 ? 1   DT  A C2    1 
ATOM   11   O O2    . DT  A 1 1  ? -1.025  -15.327 -0.164 1.00 46.16 ? 1   DT  A O2    1 
ATOM   12   N N3    . DT  A 1 1  ? -1.147  -17.220 1.075  1.00 45.68 ? 1   DT  A N3    1 
ATOM   13   C C4    . DT  A 1 1  ? -0.626  -18.242 1.842  1.00 45.27 ? 1   DT  A C4    1 
ATOM   14   O O4    . DT  A 1 1  ? -1.372  -19.102 2.300  1.00 44.71 ? 1   DT  A O4    1 
ATOM   15   C C5    . DT  A 1 1  ? 0.802   -18.192 2.044  1.00 45.72 ? 1   DT  A C5    1 
ATOM   16   C C7    . DT  A 1 1  ? 1.460   -19.266 2.852  1.00 46.77 ? 1   DT  A C7    1 
ATOM   17   C C6    . DT  A 1 1  ? 1.479   -17.177 1.499  1.00 46.95 ? 1   DT  A C6    1 
ATOM   18   P P     . DG  A 1 2  ? 4.359   -11.693 -0.629 1.00 52.26 ? 2   DG  A P     1 
ATOM   19   O OP1   . DG  A 1 2  ? 4.322   -11.721 -2.111 1.00 52.21 ? 2   DG  A OP1   1 
ATOM   20   O OP2   . DG  A 1 2  ? 5.645   -11.438 0.072  1.00 52.63 ? 2   DG  A OP2   1 
ATOM   21   O "O5'" . DG  A 1 2  ? 3.303   -10.600 -0.153 1.00 49.96 ? 2   DG  A "O5'" 1 
ATOM   22   C "C5'" . DG  A 1 2  ? 2.213   -10.232 -0.995 1.00 44.94 ? 2   DG  A "C5'" 1 
ATOM   23   C "C4'" . DG  A 1 2  ? 1.012   -9.853  -0.162 1.00 42.05 ? 2   DG  A "C4'" 1 
ATOM   24   O "O4'" . DG  A 1 2  ? 0.388   -11.030 0.409  1.00 40.55 ? 2   DG  A "O4'" 1 
ATOM   25   C "C3'" . DG  A 1 2  ? 1.306   -8.919  1.012  1.00 40.12 ? 2   DG  A "C3'" 1 
ATOM   26   O "O3'" . DG  A 1 2  ? 0.237   -7.977  1.131  1.00 39.65 ? 2   DG  A "O3'" 1 
ATOM   27   C "C2'" . DG  A 1 2  ? 1.300   -9.856  2.206  1.00 39.10 ? 2   DG  A "C2'" 1 
ATOM   28   C "C1'" . DG  A 1 2  ? 0.221   -10.844 1.803  1.00 38.31 ? 2   DG  A "C1'" 1 
ATOM   29   N N9    . DG  A 1 2  ? 0.295   -12.151 2.448  1.00 36.16 ? 2   DG  A N9    1 
ATOM   30   C C8    . DG  A 1 2  ? 1.427   -12.838 2.814  1.00 35.84 ? 2   DG  A C8    1 
ATOM   31   N N7    . DG  A 1 2  ? 1.169   -13.987 3.382  1.00 35.23 ? 2   DG  A N7    1 
ATOM   32   C C5    . DG  A 1 2  ? -0.219  -14.064 3.389  1.00 35.60 ? 2   DG  A C5    1 
ATOM   33   C C6    . DG  A 1 2  ? -1.083  -15.081 3.880  1.00 35.21 ? 2   DG  A C6    1 
ATOM   34   O O6    . DG  A 1 2  ? -0.784  -16.154 4.419  1.00 35.38 ? 2   DG  A O6    1 
ATOM   35   N N1    . DG  A 1 2  ? -2.422  -14.750 3.691  1.00 35.18 ? 2   DG  A N1    1 
ATOM   36   C C2    . DG  A 1 2  ? -2.874  -13.596 3.102  1.00 35.42 ? 2   DG  A C2    1 
ATOM   37   N N2    . DG  A 1 2  ? -4.207  -13.467 3.005  1.00 35.49 ? 2   DG  A N2    1 
ATOM   38   N N3    . DG  A 1 2  ? -2.081  -12.642 2.640  1.00 36.16 ? 2   DG  A N3    1 
ATOM   39   C C4    . DG  A 1 2  ? -0.774  -12.939 2.816  1.00 35.98 ? 2   DG  A C4    1 
ATOM   40   P P     . DA  A 1 3  ? 0.422   -6.668  2.039  1.00 36.42 ? 3   DA  A P     1 
ATOM   41   O OP1   . DA  A 1 3  ? 0.655   -5.514  1.136  1.00 38.67 ? 3   DA  A OP1   1 
ATOM   42   O OP2   . DA  A 1 3  ? 1.406   -6.977  3.105  1.00 36.81 ? 3   DA  A OP2   1 
ATOM   43   O "O5'" . DA  A 1 3  ? -1.003  -6.496  2.725  1.00 34.63 ? 3   DA  A "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3  ? -2.192  -6.624  1.960  1.00 29.22 ? 3   DA  A "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3  ? -3.328  -7.095  2.835  1.00 26.96 ? 3   DA  A "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3  ? -3.110  -8.471  3.233  1.00 24.99 ? 3   DA  A "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3  ? -3.534  -6.301  4.128  1.00 24.99 ? 3   DA  A "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3  ? -4.932  -6.100  4.333  1.00 23.47 ? 3   DA  A "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3  ? -2.965  -7.213  5.202  1.00 25.12 ? 3   DA  A "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3  ? -3.236  -8.601  4.639  1.00 23.97 ? 3   DA  A "C1'" 1 
ATOM   51   N N9    . DA  A 1 3  ? -2.291  -9.629  5.081  1.00 25.33 ? 3   DA  A N9    1 
ATOM   52   C C8    . DA  A 1 3  ? -0.918  -9.559  5.101  1.00 24.84 ? 3   DA  A C8    1 
ATOM   53   N N7    . DA  A 1 3  ? -0.338  -10.644 5.559  1.00 24.56 ? 3   DA  A N7    1 
ATOM   54   C C5    . DA  A 1 3  ? -1.398  -11.490 5.857  1.00 24.82 ? 3   DA  A C5    1 
ATOM   55   C C6    . DA  A 1 3  ? -1.451  -12.800 6.377  1.00 25.05 ? 3   DA  A C6    1 
ATOM   56   N N6    . DA  A 1 3  ? -0.373  -13.523 6.689  1.00 25.25 ? 3   DA  A N6    1 
ATOM   57   N N1    . DA  A 1 3  ? -2.668  -13.351 6.565  1.00 26.12 ? 3   DA  A N1    1 
ATOM   58   C C2    . DA  A 1 3  ? -3.752  -12.635 6.242  1.00 25.22 ? 3   DA  A C2    1 
ATOM   59   N N3    . DA  A 1 3  ? -3.831  -11.404 5.742  1.00 25.52 ? 3   DA  A N3    1 
ATOM   60   C C4    . DA  A 1 3  ? -2.607  -10.879 5.571  1.00 24.98 ? 3   DA  A C4    1 
ATOM   61   P P     . DC  A 1 4  ? -5.445  -5.261  5.602  1.00 24.35 ? 4   DC  A P     1 
ATOM   62   O OP1   . DC  A 1 4  ? -6.743  -4.640  5.234  1.00 23.62 ? 4   DC  A OP1   1 
ATOM   63   O OP2   . DC  A 1 4  ? -4.324  -4.411  6.094  1.00 23.22 ? 4   DC  A OP2   1 
ATOM   64   O "O5'" . DC  A 1 4  ? -5.749  -6.386  6.677  1.00 23.22 ? 4   DC  A "O5'" 1 
ATOM   65   C "C5'" . DC  A 1 4  ? -6.613  -7.463  6.343  1.00 23.28 ? 4   DC  A "C5'" 1 
ATOM   66   C "C4'" . DC  A 1 4  ? -6.758  -8.401  7.514  1.00 23.09 ? 4   DC  A "C4'" 1 
ATOM   67   O "O4'" . DC  A 1 4  ? -5.637  -9.318  7.588  1.00 24.17 ? 4   DC  A "O4'" 1 
ATOM   68   C "C3'" . DC  A 1 4  ? -6.846  -7.707  8.873  1.00 23.23 ? 4   DC  A "C3'" 1 
ATOM   69   O "O3'" . DC  A 1 4  ? -8.021  -8.143  9.546  1.00 22.44 ? 4   DC  A "O3'" 1 
ATOM   70   C "C2'" . DC  A 1 4  ? -5.585  -8.158  9.604  1.00 23.54 ? 4   DC  A "C2'" 1 
ATOM   71   C "C1'" . DC  A 1 4  ? -5.265  -9.489  8.942  1.00 22.83 ? 4   DC  A "C1'" 1 
ATOM   72   N N1    . DC  A 1 4  ? -3.846  -9.895  8.980  1.00 23.12 ? 4   DC  A N1    1 
ATOM   73   C C2    . DC  A 1 4  ? -3.520  -11.211 9.383  1.00 23.24 ? 4   DC  A C2    1 
ATOM   74   O O2    . DC  A 1 4  ? -4.435  -12.000 9.679  1.00 23.36 ? 4   DC  A O2    1 
ATOM   75   N N3    . DC  A 1 4  ? -2.223  -11.582 9.441  1.00 21.81 ? 4   DC  A N3    1 
ATOM   76   C C4    . DC  A 1 4  ? -1.264  -10.710 9.123  1.00 22.90 ? 4   DC  A C4    1 
ATOM   77   N N4    . DC  A 1 4  ? 0.004   -11.119 9.219  1.00 21.07 ? 4   DC  A N4    1 
ATOM   78   C C5    . DC  A 1 4  ? -1.563  -9.376  8.698  1.00 22.10 ? 4   DC  A C5    1 
ATOM   79   C C6    . DC  A 1 4  ? -2.853  -9.016  8.643  1.00 22.34 ? 4   DC  A C6    1 
ATOM   80   P P     . DC  A 1 5  ? -8.409  -7.508  10.962 1.00 23.60 ? 5   DC  A P     1 
ATOM   81   O OP1   . DC  A 1 5  ? -9.885  -7.358  10.995 1.00 21.92 ? 5   DC  A OP1   1 
ATOM   82   O OP2   . DC  A 1 5  ? -7.539  -6.321  11.218 1.00 20.87 ? 5   DC  A OP2   1 
ATOM   83   O "O5'" . DC  A 1 5  ? -7.994  -8.675  11.960 1.00 22.95 ? 5   DC  A "O5'" 1 
ATOM   84   C "C5'" . DC  A 1 5  ? -8.388  -10.019 11.687 1.00 25.45 ? 5   DC  A "C5'" 1 
ATOM   85   C "C4'" . DC  A 1 5  ? -7.867  -10.949 12.755 1.00 27.94 ? 5   DC  A "C4'" 1 
ATOM   86   O "O4'" . DC  A 1 5  ? -6.512  -11.372 12.460 1.00 26.71 ? 5   DC  A "O4'" 1 
ATOM   87   C "C3'" . DC  A 1 5  ? -7.839  -10.315 14.144 1.00 29.48 ? 5   DC  A "C3'" 1 
ATOM   88   O "O3'" . DC  A 1 5  ? -8.524  -11.115 15.091 1.00 34.35 ? 5   DC  A "O3'" 1 
ATOM   89   C "C2'" . DC  A 1 5  ? -6.363  -10.225 14.488 1.00 29.73 ? 5   DC  A "C2'" 1 
ATOM   90   C "C1'" . DC  A 1 5  ? -5.728  -11.311 13.639 1.00 27.92 ? 5   DC  A "C1'" 1 
ATOM   91   N N1    . DC  A 1 5  ? -4.339  -11.002 13.252 1.00 26.45 ? 5   DC  A N1    1 
ATOM   92   C C2    . DC  A 1 5  ? -3.307  -11.846 13.689 1.00 26.38 ? 5   DC  A C2    1 
ATOM   93   O O2    . DC  A 1 5  ? -3.591  -12.833 14.382 1.00 27.48 ? 5   DC  A O2    1 
ATOM   94   N N3    . DC  A 1 5  ? -2.028  -11.558 13.356 1.00 24.82 ? 5   DC  A N3    1 
ATOM   95   C C4    . DC  A 1 5  ? -1.758  -10.472 12.627 1.00 24.80 ? 5   DC  A C4    1 
ATOM   96   N N4    . DC  A 1 5  ? -0.478  -10.213 12.342 1.00 21.59 ? 5   DC  A N4    1 
ATOM   97   C C5    . DC  A 1 5  ? -2.788  -9.599  12.162 1.00 24.25 ? 5   DC  A C5    1 
ATOM   98   C C6    . DC  A 1 5  ? -4.052  -9.903  12.491 1.00 26.16 ? 5   DC  A C6    1 
ATOM   99   P P     . DG  A 1 6  ? -9.126  -10.424 16.408 1.00 38.05 ? 6   DG  A P     1 
ATOM   100  O OP1   . DG  A 1 6  ? -10.471 -11.009 16.650 1.00 38.99 ? 6   DG  A OP1   1 
ATOM   101  O OP2   . DG  A 1 6  ? -8.971  -8.953  16.287 1.00 37.05 ? 6   DG  A OP2   1 
ATOM   102  O "O5'" . DG  A 1 6  ? -8.141  -10.927 17.550 1.00 37.08 ? 6   DG  A "O5'" 1 
ATOM   103  C "C5'" . DG  A 1 6  ? -8.012  -12.316 17.817 1.00 35.18 ? 6   DG  A "C5'" 1 
ATOM   104  C "C4'" . DG  A 1 6  ? -6.823  -12.569 18.708 1.00 34.11 ? 6   DG  A "C4'" 1 
ATOM   105  O "O4'" . DG  A 1 6  ? -5.589  -12.316 17.995 1.00 32.80 ? 6   DG  A "O4'" 1 
ATOM   106  C "C3'" . DG  A 1 6  ? -6.766  -11.709 19.969 1.00 34.45 ? 6   DG  A "C3'" 1 
ATOM   107  O "O3'" . DG  A 1 6  ? -6.246  -12.520 21.015 1.00 36.34 ? 6   DG  A "O3'" 1 
ATOM   108  C "C2'" . DG  A 1 6  ? -5.745  -10.644 19.615 1.00 32.66 ? 6   DG  A "C2'" 1 
ATOM   109  C "C1'" . DG  A 1 6  ? -4.779  -11.439 18.755 1.00 30.89 ? 6   DG  A "C1'" 1 
ATOM   110  N N9    . DG  A 1 6  ? -3.976  -10.649 17.828 1.00 28.76 ? 6   DG  A N9    1 
ATOM   111  C C8    . DG  A 1 6  ? -4.340  -9.487  17.190 1.00 27.50 ? 6   DG  A C8    1 
ATOM   112  N N7    . DG  A 1 6  ? -3.395  -9.003  16.431 1.00 26.41 ? 6   DG  A N7    1 
ATOM   113  C C5    . DG  A 1 6  ? -2.345  -9.900  16.573 1.00 26.17 ? 6   DG  A C5    1 
ATOM   114  C C6    . DG  A 1 6  ? -1.046  -9.899  15.997 1.00 25.88 ? 6   DG  A C6    1 
ATOM   115  O O6    . DG  A 1 6  ? -0.542  -9.075  15.224 1.00 24.24 ? 6   DG  A O6    1 
ATOM   116  N N1    . DG  A 1 6  ? -0.302  -11.001 16.412 1.00 26.31 ? 6   DG  A N1    1 
ATOM   117  C C2    . DG  A 1 6  ? -0.742  -11.971 17.277 1.00 27.04 ? 6   DG  A C2    1 
ATOM   118  N N2    . DG  A 1 6  ? 0.136   -12.941 17.575 1.00 29.22 ? 6   DG  A N2    1 
ATOM   119  N N3    . DG  A 1 6  ? -1.950  -11.986 17.818 1.00 27.17 ? 6   DG  A N3    1 
ATOM   120  C C4    . DG  A 1 6  ? -2.691  -10.926 17.427 1.00 27.09 ? 6   DG  A C4    1 
ATOM   121  P P     . DG  A 1 7  ? -6.520  -12.135 22.542 1.00 36.12 ? 7   DG  A P     1 
ATOM   122  O OP1   . DG  A 1 7  ? -7.856  -12.658 22.925 1.00 36.84 ? 7   DG  A OP1   1 
ATOM   123  O OP2   . DG  A 1 7  ? -6.214  -10.694 22.727 1.00 37.88 ? 7   DG  A OP2   1 
ATOM   124  O "O5'" . DG  A 1 7  ? -5.400  -12.984 23.281 1.00 37.61 ? 7   DG  A "O5'" 1 
ATOM   125  C "C5'" . DG  A 1 7  ? -5.090  -14.300 22.830 1.00 36.26 ? 7   DG  A "C5'" 1 
ATOM   126  C "C4'" . DG  A 1 7  ? -3.631  -14.607 23.069 1.00 36.17 ? 7   DG  A "C4'" 1 
ATOM   127  O "O4'" . DG  A 1 7  ? -2.792  -13.958 22.084 1.00 34.89 ? 7   DG  A "O4'" 1 
ATOM   128  C "C3'" . DG  A 1 7  ? -3.111  -14.164 24.432 1.00 36.88 ? 7   DG  A "C3'" 1 
ATOM   129  O "O3'" . DG  A 1 7  ? -2.278  -15.185 24.972 1.00 39.82 ? 7   DG  A "O3'" 1 
ATOM   130  C "C2'" . DG  A 1 7  ? -2.312  -12.909 24.123 1.00 34.82 ? 7   DG  A "C2'" 1 
ATOM   131  C "C1'" . DG  A 1 7  ? -1.790  -13.177 22.721 1.00 33.01 ? 7   DG  A "C1'" 1 
ATOM   132  N N9    . DG  A 1 7  ? -1.584  -11.984 21.902 1.00 30.43 ? 7   DG  A N9    1 
ATOM   133  C C8    . DG  A 1 7  ? -2.525  -11.034 21.585 1.00 28.91 ? 7   DG  A C8    1 
ATOM   134  N N7    . DG  A 1 7  ? -2.071  -10.111 20.783 1.00 28.60 ? 7   DG  A N7    1 
ATOM   135  C C5    . DG  A 1 7  ? -0.747  -10.465 20.562 1.00 27.59 ? 7   DG  A C5    1 
ATOM   136  C C6    . DG  A 1 7  ? 0.244   -9.851  19.752 1.00 26.57 ? 7   DG  A C6    1 
ATOM   137  O O6    . DG  A 1 7  ? 0.143   -8.851  19.036 1.00 26.11 ? 7   DG  A O6    1 
ATOM   138  N N1    . DG  A 1 7  ? 1.455   -10.533 19.820 1.00 26.63 ? 7   DG  A N1    1 
ATOM   139  C C2    . DG  A 1 7  ? 1.679   -11.669 20.562 1.00 27.88 ? 7   DG  A C2    1 
ATOM   140  N N2    . DG  A 1 7  ? 2.913   -12.191 20.491 1.00 26.31 ? 7   DG  A N2    1 
ATOM   141  N N3    . DG  A 1 7  ? 0.759   -12.254 21.313 1.00 28.02 ? 7   DG  A N3    1 
ATOM   142  C C4    . DG  A 1 7  ? -0.423  -11.605 21.264 1.00 28.70 ? 7   DG  A C4    1 
ATOM   143  P P     . DA  A 1 8  ? -1.931  -15.175 26.535 1.00 41.62 ? 8   DA  A P     1 
ATOM   144  O OP1   . DA  A 1 8  ? -1.710  -16.579 26.968 1.00 42.14 ? 8   DA  A OP1   1 
ATOM   145  O OP2   . DA  A 1 8  ? -2.948  -14.343 27.221 1.00 41.46 ? 8   DA  A OP2   1 
ATOM   146  O "O5'" . DA  A 1 8  ? -0.538  -14.411 26.584 1.00 41.43 ? 8   DA  A "O5'" 1 
ATOM   147  C "C5'" . DA  A 1 8  ? 0.602   -14.959 25.936 1.00 41.52 ? 8   DA  A "C5'" 1 
ATOM   148  C "C4'" . DA  A 1 8  ? 1.767   -14.007 26.047 1.00 41.97 ? 8   DA  A "C4'" 1 
ATOM   149  O "O4'" . DA  A 1 8  ? 1.683   -12.964 25.043 1.00 41.28 ? 8   DA  A "O4'" 1 
ATOM   150  C "C3'" . DA  A 1 8  ? 1.860   -13.297 27.398 1.00 42.66 ? 8   DA  A "C3'" 1 
ATOM   151  O "O3'" . DA  A 1 8  ? 3.219   -13.266 27.816 1.00 45.37 ? 8   DA  A "O3'" 1 
ATOM   152  C "C2'" . DA  A 1 8  ? 1.392   -11.886 27.087 1.00 41.49 ? 8   DA  A "C2'" 1 
ATOM   153  C "C1'" . DA  A 1 8  ? 1.895   -11.710 25.668 1.00 40.08 ? 8   DA  A "C1'" 1 
ATOM   154  N N9    . DA  A 1 8  ? 1.218   -10.682 24.876 1.00 38.05 ? 8   DA  A N9    1 
ATOM   155  C C8    . DA  A 1 8  ? -0.092  -10.274 24.936 1.00 37.15 ? 8   DA  A C8    1 
ATOM   156  N N7    . DA  A 1 8  ? -0.388  -9.320  24.085 1.00 35.90 ? 8   DA  A N7    1 
ATOM   157  C C5    . DA  A 1 8  ? 0.808   -9.086  23.419 1.00 35.65 ? 8   DA  A C5    1 
ATOM   158  C C6    . DA  A 1 8  ? 1.162   -8.193  22.389 1.00 34.27 ? 8   DA  A C6    1 
ATOM   159  N N6    . DA  A 1 8  ? 0.308   -7.337  21.821 1.00 32.94 ? 8   DA  A N6    1 
ATOM   160  N N1    . DA  A 1 8  ? 2.440   -8.211  21.955 1.00 35.09 ? 8   DA  A N1    1 
ATOM   161  C C2    . DA  A 1 8  ? 3.296   -9.076  22.515 1.00 35.68 ? 8   DA  A C2    1 
ATOM   162  N N3    . DA  A 1 8  ? 3.082   -9.965  23.481 1.00 36.50 ? 8   DA  A N3    1 
ATOM   163  C C4    . DA  A 1 8  ? 1.804   -9.918  23.895 1.00 36.14 ? 8   DA  A C4    1 
ATOM   164  P P     . DA  A 1 9  ? 3.579   -12.977 29.353 1.00 46.70 ? 9   DA  A P     1 
ATOM   165  O OP1   . DA  A 1 9  ? 3.965   -14.271 29.970 1.00 46.88 ? 9   DA  A OP1   1 
ATOM   166  O OP2   . DA  A 1 9  ? 2.505   -12.159 29.972 1.00 46.36 ? 9   DA  A OP2   1 
ATOM   167  O "O5'" . DA  A 1 9  ? 4.873   -12.066 29.221 1.00 46.48 ? 9   DA  A "O5'" 1 
ATOM   168  C "C5'" . DA  A 1 9  ? 5.842   -12.341 28.215 1.00 45.70 ? 9   DA  A "C5'" 1 
ATOM   169  C "C4'" . DA  A 1 9  ? 6.525   -11.066 27.786 1.00 45.65 ? 9   DA  A "C4'" 1 
ATOM   170  O "O4'" . DA  A 1 9  ? 5.672   -10.303 26.895 1.00 44.36 ? 9   DA  A "O4'" 1 
ATOM   171  C "C3'" . DA  A 1 9  ? 6.883   -10.131 28.944 1.00 45.95 ? 9   DA  A "C3'" 1 
ATOM   172  O "O3'" . DA  A 1 9  ? 8.184   -9.584  28.744 1.00 48.40 ? 9   DA  A "O3'" 1 
ATOM   173  C "C2'" . DA  A 1 9  ? 5.844   -9.031  28.841 1.00 44.82 ? 9   DA  A "C2'" 1 
ATOM   174  C "C1'" . DA  A 1 9  ? 5.630   -8.958  27.343 1.00 43.01 ? 9   DA  A "C1'" 1 
ATOM   175  N N9    . DA  A 1 9  ? 4.353   -8.371  26.937 1.00 40.75 ? 9   DA  A N9    1 
ATOM   176  C C8    . DA  A 1 9  ? 3.116   -8.547  27.504 1.00 39.68 ? 9   DA  A C8    1 
ATOM   177  N N7    . DA  A 1 9  ? 2.168   -7.846  26.931 1.00 37.93 ? 9   DA  A N7    1 
ATOM   178  C C5    . DA  A 1 9  ? 2.823   -7.169  25.912 1.00 37.52 ? 9   DA  A C5    1 
ATOM   179  C C6    . DA  A 1 9  ? 2.375   -6.256  24.938 1.00 36.01 ? 9   DA  A C6    1 
ATOM   180  N N6    . DA  A 1 9  ? 1.108   -5.848  24.831 1.00 34.75 ? 9   DA  A N6    1 
ATOM   181  N N1    . DA  A 1 9  ? 3.285   -5.770  24.069 1.00 34.67 ? 9   DA  A N1    1 
ATOM   182  C C2    . DA  A 1 9  ? 4.556   -6.175  24.177 1.00 35.38 ? 9   DA  A C2    1 
ATOM   183  N N3    . DA  A 1 9  ? 5.098   -7.024  25.045 1.00 36.87 ? 9   DA  A N3    1 
ATOM   184  C C4    . DA  A 1 9  ? 4.167   -7.491  25.897 1.00 38.52 ? 9   DA  A C4    1 
ATOM   185  P P     . DG  A 1 10 ? 8.810   -8.593  29.843 1.00 50.93 ? 10  DG  A P     1 
ATOM   186  O OP1   . DG  A 1 10 ? 10.116  -9.156  30.274 1.00 51.33 ? 10  DG  A OP1   1 
ATOM   187  O OP2   . DG  A 1 10 ? 7.772   -8.273  30.863 1.00 50.68 ? 10  DG  A OP2   1 
ATOM   188  O "O5'" . DG  A 1 10 ? 9.091   -7.274  29.007 1.00 49.50 ? 10  DG  A "O5'" 1 
ATOM   189  C "C5'" . DG  A 1 10 ? 9.728   -7.350  27.738 1.00 47.20 ? 10  DG  A "C5'" 1 
ATOM   190  C "C4'" . DG  A 1 10 ? 9.707   -5.996  27.076 1.00 45.38 ? 10  DG  A "C4'" 1 
ATOM   191  O "O4'" . DG  A 1 10 ? 8.368   -5.700  26.602 1.00 43.12 ? 10  DG  A "O4'" 1 
ATOM   192  C "C3'" . DG  A 1 10 ? 10.080  -4.867  28.034 1.00 44.80 ? 10  DG  A "C3'" 1 
ATOM   193  O "O3'" . DG  A 1 10 ? 10.908  -3.915  27.372 1.00 45.32 ? 10  DG  A "O3'" 1 
ATOM   194  C "C2'" . DG  A 1 10 ? 8.739   -4.259  28.404 1.00 43.88 ? 10  DG  A "C2'" 1 
ATOM   195  C "C1'" . DG  A 1 10 ? 7.933   -4.460  27.132 1.00 41.44 ? 10  DG  A "C1'" 1 
ATOM   196  N N9    . DG  A 1 10 ? 6.490   -4.538  27.337 1.00 38.64 ? 10  DG  A N9    1 
ATOM   197  C C8    . DG  A 1 10 ? 5.813   -5.415  28.149 1.00 37.94 ? 10  DG  A C8    1 
ATOM   198  N N7    . DG  A 1 10 ? 4.520   -5.232  28.134 1.00 36.79 ? 10  DG  A N7    1 
ATOM   199  C C5    . DG  A 1 10 ? 4.332   -4.172  27.258 1.00 35.64 ? 10  DG  A C5    1 
ATOM   200  C C6    . DG  A 1 10 ? 3.139   -3.524  26.841 1.00 34.81 ? 10  DG  A C6    1 
ATOM   201  O O6    . DG  A 1 10 ? 1.971   -3.764  27.177 1.00 33.74 ? 10  DG  A O6    1 
ATOM   202  N N1    . DG  A 1 10 ? 3.404   -2.499  25.939 1.00 34.33 ? 10  DG  A N1    1 
ATOM   203  C C2    . DG  A 1 10 ? 4.652   -2.142  25.493 1.00 34.67 ? 10  DG  A C2    1 
ATOM   204  N N2    . DG  A 1 10 ? 4.699   -1.127  24.617 1.00 33.20 ? 10  DG  A N2    1 
ATOM   205  N N3    . DG  A 1 10 ? 5.771   -2.736  25.875 1.00 35.55 ? 10  DG  A N3    1 
ATOM   206  C C4    . DG  A 1 10 ? 5.537   -3.735  26.753 1.00 36.55 ? 10  DG  A C4    1 
ATOM   207  P P     . DT  A 1 11 ? 11.501  -2.675  28.196 1.00 46.62 ? 11  DT  A P     1 
ATOM   208  O OP1   . DT  A 1 11 ? 12.943  -2.536  27.872 1.00 46.90 ? 11  DT  A OP1   1 
ATOM   209  O OP2   . DT  A 1 11 ? 11.074  -2.811  29.612 1.00 46.50 ? 11  DT  A OP2   1 
ATOM   210  O "O5'" . DT  A 1 11 ? 10.741  -1.429  27.565 1.00 46.39 ? 11  DT  A "O5'" 1 
ATOM   211  C "C5'" . DT  A 1 11 ? 10.792  -1.196  26.163 1.00 44.27 ? 11  DT  A "C5'" 1 
ATOM   212  C "C4'" . DT  A 1 11 ? 10.111  0.106   25.826 1.00 42.69 ? 11  DT  A "C4'" 1 
ATOM   213  O "O4'" . DT  A 1 11 ? 8.677   -0.032  25.958 1.00 40.84 ? 11  DT  A "O4'" 1 
ATOM   214  C "C3'" . DT  A 1 11 ? 10.514  1.270   26.727 1.00 43.04 ? 11  DT  A "C3'" 1 
ATOM   215  O "O3'" . DT  A 1 11 ? 10.693  2.439   25.934 1.00 44.98 ? 11  DT  A "O3'" 1 
ATOM   216  C "C2'" . DT  A 1 11 ? 9.334   1.419   27.675 1.00 41.18 ? 11  DT  A "C2'" 1 
ATOM   217  C "C1'" . DT  A 1 11 ? 8.165   0.978   26.810 1.00 39.13 ? 11  DT  A "C1'" 1 
ATOM   218  N N1    . DT  A 1 11 ? 7.003   0.408   27.524 1.00 36.25 ? 11  DT  A N1    1 
ATOM   219  C C2    . DT  A 1 11 ? 5.758   0.920   27.230 1.00 35.02 ? 11  DT  A C2    1 
ATOM   220  O O2    . DT  A 1 11 ? 5.587   1.854   26.465 1.00 33.98 ? 11  DT  A O2    1 
ATOM   221  N N3    . DT  A 1 11 ? 4.715   0.295   27.870 1.00 32.91 ? 11  DT  A N3    1 
ATOM   222  C C4    . DT  A 1 11 ? 4.794   -0.757  28.761 1.00 33.93 ? 11  DT  A C4    1 
ATOM   223  O O4    . DT  A 1 11 ? 3.766   -1.243  29.227 1.00 32.31 ? 11  DT  A O4    1 
ATOM   224  C C5    . DT  A 1 11 ? 6.135   -1.213  29.061 1.00 33.85 ? 11  DT  A C5    1 
ATOM   225  C C7    . DT  A 1 11 ? 6.320   -2.316  30.054 1.00 33.51 ? 11  DT  A C7    1 
ATOM   226  C C6    . DT  A 1 11 ? 7.158   -0.617  28.432 1.00 35.30 ? 11  DT  A C6    1 
ATOM   227  P P     . DG  A 1 12 ? 11.665  3.601   26.455 1.00 47.06 ? 12  DG  A P     1 
ATOM   228  O OP1   . DG  A 1 12 ? 12.495  4.048   25.308 1.00 46.88 ? 12  DG  A OP1   1 
ATOM   229  O OP2   . DG  A 1 12 ? 12.321  3.128   27.703 1.00 47.41 ? 12  DG  A OP2   1 
ATOM   230  O "O5'" . DG  A 1 12 ? 10.662  4.779   26.815 1.00 45.99 ? 12  DG  A "O5'" 1 
ATOM   231  C "C5'" . DG  A 1 12 ? 9.873   5.379   25.797 1.00 45.30 ? 12  DG  A "C5'" 1 
ATOM   232  C "C4'" . DG  A 1 12 ? 8.772   6.207   26.414 1.00 44.87 ? 12  DG  A "C4'" 1 
ATOM   233  O "O4'" . DG  A 1 12 ? 7.732   5.358   26.959 1.00 43.20 ? 12  DG  A "O4'" 1 
ATOM   234  C "C3'" . DG  A 1 12 ? 9.226   7.117   27.555 1.00 45.32 ? 12  DG  A "C3'" 1 
ATOM   235  O "O3'" . DG  A 1 12 ? 8.587   8.381   27.406 1.00 48.40 ? 12  DG  A "O3'" 1 
ATOM   236  C "C2'" . DG  A 1 12 ? 8.717   6.403   28.798 1.00 43.49 ? 12  DG  A "C2'" 1 
ATOM   237  C "C1'" . DG  A 1 12 ? 7.440   5.760   28.286 1.00 41.60 ? 12  DG  A "C1'" 1 
ATOM   238  N N9    . DG  A 1 12 ? 6.975   4.585   29.022 1.00 38.81 ? 12  DG  A N9    1 
ATOM   239  C C8    . DG  A 1 12 ? 7.742   3.622   29.632 1.00 37.54 ? 12  DG  A C8    1 
ATOM   240  N N7    . DG  A 1 12 ? 7.031   2.687   30.204 1.00 36.12 ? 12  DG  A N7    1 
ATOM   241  C C5    . DG  A 1 12 ? 5.714   3.053   29.957 1.00 35.56 ? 12  DG  A C5    1 
ATOM   242  C C6    . DG  A 1 12 ? 4.494   2.422   30.330 1.00 34.45 ? 12  DG  A C6    1 
ATOM   243  O O6    . DG  A 1 12 ? 4.328   1.377   30.969 1.00 33.45 ? 12  DG  A O6    1 
ATOM   244  N N1    . DG  A 1 12 ? 3.391   3.136   29.878 1.00 34.07 ? 12  DG  A N1    1 
ATOM   245  C C2    . DG  A 1 12 ? 3.447   4.304   29.157 1.00 35.27 ? 12  DG  A C2    1 
ATOM   246  N N2    . DG  A 1 12 ? 2.269   4.845   28.816 1.00 34.58 ? 12  DG  A N2    1 
ATOM   247  N N3    . DG  A 1 12 ? 4.575   4.899   28.799 1.00 36.23 ? 12  DG  A N3    1 
ATOM   248  C C4    . DG  A 1 12 ? 5.662   4.224   29.232 1.00 36.66 ? 12  DG  A C4    1 
ATOM   249  P P     . DT  A 1 13 ? 9.073   9.631   28.284 1.00 49.70 ? 13  DT  A P     1 
ATOM   250  O OP1   . DT  A 1 13 ? 9.541   10.661  27.322 1.00 51.19 ? 13  DT  A OP1   1 
ATOM   251  O OP2   . DT  A 1 13 ? 9.982   9.162   29.360 1.00 50.65 ? 13  DT  A OP2   1 
ATOM   252  O "O5'" . DT  A 1 13 ? 7.717   10.141  28.941 1.00 49.45 ? 13  DT  A "O5'" 1 
ATOM   253  C "C5'" . DT  A 1 13 ? 6.566   10.353  28.129 1.00 48.08 ? 13  DT  A "C5'" 1 
ATOM   254  C "C4'" . DT  A 1 13 ? 5.315   10.363  28.973 1.00 47.11 ? 13  DT  A "C4'" 1 
ATOM   255  O "O4'" . DT  A 1 13 ? 4.975   9.023   29.411 1.00 45.76 ? 13  DT  A "O4'" 1 
ATOM   256  C "C3'" . DT  A 1 13 ? 5.393   11.220  30.239 1.00 46.76 ? 13  DT  A "C3'" 1 
ATOM   257  O "O3'" . DT  A 1 13 ? 4.130   11.855  30.452 1.00 48.56 ? 13  DT  A "O3'" 1 
ATOM   258  C "C2'" . DT  A 1 13 ? 5.561   10.189  31.341 1.00 45.53 ? 13  DT  A "C2'" 1 
ATOM   259  C "C1'" . DT  A 1 13 ? 4.709   9.055   30.802 1.00 43.96 ? 13  DT  A "C1'" 1 
ATOM   260  N N1    . DT  A 1 13 ? 4.981   7.718   31.369 1.00 40.84 ? 13  DT  A N1    1 
ATOM   261  C C2    . DT  A 1 13 ? 3.903   6.892   31.595 1.00 39.16 ? 13  DT  A C2    1 
ATOM   262  O O2    . DT  A 1 13 ? 2.761   7.195   31.300 1.00 38.35 ? 13  DT  A O2    1 
ATOM   263  N N3    . DT  A 1 13 ? 4.214   5.687   32.175 1.00 37.52 ? 13  DT  A N3    1 
ATOM   264  C C4    . DT  A 1 13 ? 5.467   5.232   32.528 1.00 37.25 ? 13  DT  A C4    1 
ATOM   265  O O4    . DT  A 1 13 ? 5.588   4.131   33.056 1.00 36.77 ? 13  DT  A O4    1 
ATOM   266  C C5    . DT  A 1 13 ? 6.559   6.136   32.231 1.00 37.33 ? 13  DT  A C5    1 
ATOM   267  C C7    . DT  A 1 13 ? 7.959   5.715   32.547 1.00 36.70 ? 13  DT  A C7    1 
ATOM   268  C C6    . DT  A 1 13 ? 6.264   7.319   31.678 1.00 39.10 ? 13  DT  A C6    1 
ATOM   269  O "O5'" . DA  B 2 1  ? -3.092  3.138   38.739 1.00 41.51 ? 1   DA  B "O5'" 1 
ATOM   270  C "C5'" . DA  B 2 1  ? -3.874  2.472   37.740 1.00 39.15 ? 1   DA  B "C5'" 1 
ATOM   271  C "C4'" . DA  B 2 1  ? -4.265  3.395   36.609 1.00 37.35 ? 1   DA  B "C4'" 1 
ATOM   272  O "O4'" . DA  B 2 1  ? -3.072  3.937   35.996 1.00 36.32 ? 1   DA  B "O4'" 1 
ATOM   273  C "C3'" . DA  B 2 1  ? -5.033  2.710   35.485 1.00 37.22 ? 1   DA  B "C3'" 1 
ATOM   274  O "O3'" . DA  B 2 1  ? -5.999  3.609   34.930 1.00 38.89 ? 1   DA  B "O3'" 1 
ATOM   275  C "C2'" . DA  B 2 1  ? -3.950  2.344   34.486 1.00 35.22 ? 1   DA  B "C2'" 1 
ATOM   276  C "C1'" . DA  B 2 1  ? -2.896  3.424   34.681 1.00 33.60 ? 1   DA  B "C1'" 1 
ATOM   277  N N9    . DA  B 2 1  ? -1.527  2.915   34.599 1.00 32.03 ? 1   DA  B N9    1 
ATOM   278  C C8    . DA  B 2 1  ? -1.036  1.766   35.177 1.00 30.14 ? 1   DA  B C8    1 
ATOM   279  N N7    . DA  B 2 1  ? 0.241   1.570   34.960 1.00 29.61 ? 1   DA  B N7    1 
ATOM   280  C C5    . DA  B 2 1  ? 0.620   2.657   34.184 1.00 28.08 ? 1   DA  B C5    1 
ATOM   281  C C6    . DA  B 2 1  ? 1.852   3.036   33.624 1.00 26.68 ? 1   DA  B C6    1 
ATOM   282  N N6    . DA  B 2 1  ? 2.978   2.337   33.769 1.00 24.57 ? 1   DA  B N6    1 
ATOM   283  N N1    . DA  B 2 1  ? 1.888   4.173   32.901 1.00 26.76 ? 1   DA  B N1    1 
ATOM   284  C C2    . DA  B 2 1  ? 0.760   4.878   32.758 1.00 27.66 ? 1   DA  B C2    1 
ATOM   285  N N3    . DA  B 2 1  ? -0.457  4.629   33.235 1.00 28.77 ? 1   DA  B N3    1 
ATOM   286  C C4    . DA  B 2 1  ? -0.461  3.490   33.948 1.00 29.33 ? 1   DA  B C4    1 
ATOM   287  P P     . DC  B 2 2  ? -6.840  3.172   33.633 1.00 40.03 ? 2   DC  B P     1 
ATOM   288  O OP1   . DC  B 2 2  ? -7.989  4.103   33.518 1.00 40.69 ? 2   DC  B OP1   1 
ATOM   289  O OP2   . DC  B 2 2  ? -7.081  1.704   33.669 1.00 40.62 ? 2   DC  B OP2   1 
ATOM   290  O "O5'" . DC  B 2 2  ? -5.835  3.511   32.451 1.00 38.75 ? 2   DC  B "O5'" 1 
ATOM   291  C "C5'" . DC  B 2 2  ? -5.277  4.815   32.366 1.00 37.19 ? 2   DC  B "C5'" 1 
ATOM   292  C "C4'" . DC  B 2 2  ? -4.508  4.982   31.079 1.00 35.17 ? 2   DC  B "C4'" 1 
ATOM   293  O "O4'" . DC  B 2 2  ? -3.161  4.481   31.201 1.00 33.61 ? 2   DC  B "O4'" 1 
ATOM   294  C "C3'" . DC  B 2 2  ? -5.110  4.315   29.844 1.00 35.03 ? 2   DC  B "C3'" 1 
ATOM   295  O "O3'" . DC  B 2 2  ? -5.058  5.262   28.782 1.00 35.09 ? 2   DC  B "O3'" 1 
ATOM   296  C "C2'" . DC  B 2 2  ? -4.163  3.152   29.575 1.00 33.12 ? 2   DC  B "C2'" 1 
ATOM   297  C "C1'" . DC  B 2 2  ? -2.838  3.731   30.048 1.00 31.71 ? 2   DC  B "C1'" 1 
ATOM   298  N N1    . DC  B 2 2  ? -1.762  2.792   30.414 1.00 29.43 ? 2   DC  B N1    1 
ATOM   299  C C2    . DC  B 2 2  ? -0.446  3.134   30.081 1.00 27.21 ? 2   DC  B C2    1 
ATOM   300  O O2    . DC  B 2 2  ? -0.240  4.179   29.450 1.00 28.10 ? 2   DC  B O2    1 
ATOM   301  N N3    . DC  B 2 2  ? 0.566   2.322   30.449 1.00 25.13 ? 2   DC  B N3    1 
ATOM   302  C C4    . DC  B 2 2  ? 0.312   1.202   31.116 1.00 25.47 ? 2   DC  B C4    1 
ATOM   303  N N4    . DC  B 2 2  ? 1.351   0.444   31.470 1.00 24.12 ? 2   DC  B N4    1 
ATOM   304  C C5    . DC  B 2 2  ? -1.023  0.809   31.452 1.00 26.90 ? 2   DC  B C5    1 
ATOM   305  C C6    . DC  B 2 2  ? -2.021  1.628   31.081 1.00 28.14 ? 2   DC  B C6    1 
ATOM   306  P P     . DA  B 2 3  ? -6.060  5.132   27.540 1.00 34.58 ? 3   DA  B P     1 
ATOM   307  O OP1   . DA  B 2 3  ? -6.883  6.368   27.492 1.00 35.18 ? 3   DA  B OP1   1 
ATOM   308  O OP2   . DA  B 2 3  ? -6.723  3.805   27.574 1.00 33.37 ? 3   DA  B OP2   1 
ATOM   309  O "O5'" . DA  B 2 3  ? -5.059  5.160   26.305 1.00 30.72 ? 3   DA  B "O5'" 1 
ATOM   310  C "C5'" . DA  B 2 3  ? -4.068  6.176   26.207 1.00 25.79 ? 3   DA  B "C5'" 1 
ATOM   311  C "C4'" . DA  B 2 3  ? -2.950  5.725   25.298 1.00 22.63 ? 3   DA  B "C4'" 1 
ATOM   312  O "O4'" . DA  B 2 3  ? -2.078  4.797   25.988 1.00 21.93 ? 3   DA  B "O4'" 1 
ATOM   313  C "C3'" . DA  B 2 3  ? -3.410  5.013   24.023 1.00 19.84 ? 3   DA  B "C3'" 1 
ATOM   314  O "O3'" . DA  B 2 3  ? -2.596  5.439   22.929 1.00 17.87 ? 3   DA  B "O3'" 1 
ATOM   315  C "C2'" . DA  B 2 3  ? -3.134  3.550   24.326 1.00 21.31 ? 3   DA  B "C2'" 1 
ATOM   316  C "C1'" . DA  B 2 3  ? -1.870  3.670   25.158 1.00 21.71 ? 3   DA  B "C1'" 1 
ATOM   317  N N9    . DA  B 2 3  ? -1.527  2.527   26.006 1.00 22.06 ? 3   DA  B N9    1 
ATOM   318  C C8    . DA  B 2 3  ? -2.352  1.590   26.578 1.00 22.54 ? 3   DA  B C8    1 
ATOM   319  N N7    . DA  B 2 3  ? -1.708  0.666   27.255 1.00 22.53 ? 3   DA  B N7    1 
ATOM   320  C C5    . DA  B 2 3  ? -0.372  1.023   27.123 1.00 22.34 ? 3   DA  B C5    1 
ATOM   321  C C6    . DA  B 2 3  ? 0.818   0.446   27.607 1.00 23.69 ? 3   DA  B C6    1 
ATOM   322  N N6    . DA  B 2 3  ? 0.859   -0.680  28.328 1.00 22.16 ? 3   DA  B N6    1 
ATOM   323  N N1    . DA  B 2 3  ? 1.982   1.067   27.312 1.00 24.07 ? 3   DA  B N1    1 
ATOM   324  C C2    . DA  B 2 3  ? 1.943   2.181   26.570 1.00 23.81 ? 3   DA  B C2    1 
ATOM   325  N N3    . DA  B 2 3  ? 0.893   2.810   26.050 1.00 22.29 ? 3   DA  B N3    1 
ATOM   326  C C4    . DA  B 2 3  ? -0.249  2.174   26.368 1.00 21.77 ? 3   DA  B C4    1 
ATOM   327  P P     . DC  B 2 4  ? -3.136  5.290   21.426 1.00 18.69 ? 4   DC  B P     1 
ATOM   328  O OP1   . DC  B 2 4  ? -2.171  5.980   20.536 1.00 16.94 ? 4   DC  B OP1   1 
ATOM   329  O OP2   . DC  B 2 4  ? -4.558  5.708   21.416 1.00 18.13 ? 4   DC  B OP2   1 
ATOM   330  O "O5'" . DC  B 2 4  ? -3.097  3.713   21.184 1.00 16.52 ? 4   DC  B "O5'" 1 
ATOM   331  C "C5'" . DC  B 2 4  ? -2.091  3.097   20.384 1.00 17.86 ? 4   DC  B "C5'" 1 
ATOM   332  C "C4'" . DC  B 2 4  ? -0.751  3.138   21.082 1.00 18.85 ? 4   DC  B "C4'" 1 
ATOM   333  O "O4'" . DC  B 2 4  ? -0.795  2.444   22.358 1.00 20.37 ? 4   DC  B "O4'" 1 
ATOM   334  C "C3'" . DC  B 2 4  ? 0.378   2.484   20.280 1.00 19.42 ? 4   DC  B "C3'" 1 
ATOM   335  O "O3'" . DC  B 2 4  ? 1.491   3.367   20.150 1.00 18.68 ? 4   DC  B "O3'" 1 
ATOM   336  C "C2'" . DC  B 2 4  ? 0.767   1.265   21.099 1.00 20.42 ? 4   DC  B "C2'" 1 
ATOM   337  C "C1'" . DC  B 2 4  ? 0.387   1.665   22.507 1.00 20.45 ? 4   DC  B "C1'" 1 
ATOM   338  N N1    . DC  B 2 4  ? 0.091   0.504   23.373 1.00 21.02 ? 4   DC  B N1    1 
ATOM   339  C C2    . DC  B 2 4  ? 1.149   -0.101  24.064 1.00 21.20 ? 4   DC  B C2    1 
ATOM   340  O O2    . DC  B 2 4  ? 2.280   0.390   23.972 1.00 21.72 ? 4   DC  B O2    1 
ATOM   341  N N3    . DC  B 2 4  ? 0.911   -1.199  24.818 1.00 20.46 ? 4   DC  B N3    1 
ATOM   342  C C4    . DC  B 2 4  ? -0.326  -1.685  24.918 1.00 21.72 ? 4   DC  B C4    1 
ATOM   343  N N4    . DC  B 2 4  ? -0.513  -2.767  25.684 1.00 20.78 ? 4   DC  B N4    1 
ATOM   344  C C5    . DC  B 2 4  ? -1.428  -1.082  24.241 1.00 22.03 ? 4   DC  B C5    1 
ATOM   345  C C6    . DC  B 2 4  ? -1.177  0.006   23.488 1.00 22.18 ? 4   DC  B C6    1 
ATOM   346  P P     . DT  B 2 5  ? 2.468   3.223   18.884 1.00 17.66 ? 5   DT  B P     1 
ATOM   347  O OP1   . DT  B 2 5  ? 3.150   4.528   18.692 1.00 17.23 ? 5   DT  B OP1   1 
ATOM   348  O OP2   . DT  B 2 5  ? 1.698   2.624   17.764 1.00 18.37 ? 5   DT  B OP2   1 
ATOM   349  O "O5'" . DT  B 2 5  ? 3.547   2.160   19.373 1.00 18.89 ? 5   DT  B "O5'" 1 
ATOM   350  C "C5'" . DT  B 2 5  ? 4.435   2.489   20.436 1.00 20.11 ? 5   DT  B "C5'" 1 
ATOM   351  C "C4'" . DT  B 2 5  ? 5.386   1.348   20.710 1.00 21.11 ? 5   DT  B "C4'" 1 
ATOM   352  O "O4'" . DT  B 2 5  ? 4.710   0.295   21.426 1.00 21.79 ? 5   DT  B "O4'" 1 
ATOM   353  C "C3'" . DT  B 2 5  ? 6.029   0.697   19.486 1.00 22.17 ? 5   DT  B "C3'" 1 
ATOM   354  O "O3'" . DT  B 2 5  ? 7.414   0.510   19.774 1.00 22.88 ? 5   DT  B "O3'" 1 
ATOM   355  C "C2'" . DT  B 2 5  ? 5.287   -0.630  19.358 1.00 22.42 ? 5   DT  B "C2'" 1 
ATOM   356  C "C1'" . DT  B 2 5  ? 4.969   -0.954  20.808 1.00 22.35 ? 5   DT  B "C1'" 1 
ATOM   357  N N1    . DT  B 2 5  ? 3.812   -1.834  21.098 1.00 21.79 ? 5   DT  B N1    1 
ATOM   358  C C2    . DT  B 2 5  ? 4.028   -2.910  21.937 1.00 21.63 ? 5   DT  B C2    1 
ATOM   359  O O2    . DT  B 2 5  ? 5.136   -3.245  22.318 1.00 23.71 ? 5   DT  B O2    1 
ATOM   360  N N3    . DT  B 2 5  ? 2.894   -3.590  22.303 1.00 19.96 ? 5   DT  B N3    1 
ATOM   361  C C4    . DT  B 2 5  ? 1.601   -3.329  21.896 1.00 20.79 ? 5   DT  B C4    1 
ATOM   362  O O4    . DT  B 2 5  ? 0.668   -3.980  22.359 1.00 20.06 ? 5   DT  B O4    1 
ATOM   363  C C5    . DT  B 2 5  ? 1.459   -2.254  20.941 1.00 19.82 ? 5   DT  B C5    1 
ATOM   364  C C7    . DT  B 2 5  ? 0.105   -1.972  20.374 1.00 18.44 ? 5   DT  B C7    1 
ATOM   365  C C6    . DT  B 2 5  ? 2.558   -1.562  20.598 1.00 20.30 ? 5   DT  B C6    1 
ATOM   366  P P     . DT  B 2 6  ? 8.435   0.109   18.607 1.00 23.64 ? 6   DT  B P     1 
ATOM   367  O OP1   . DT  B 2 6  ? 9.755   0.683   18.967 1.00 24.79 ? 6   DT  B OP1   1 
ATOM   368  O OP2   . DT  B 2 6  ? 7.844   0.406   17.277 1.00 24.74 ? 6   DT  B OP2   1 
ATOM   369  O "O5'" . DT  B 2 6  ? 8.529   -1.473  18.758 1.00 25.36 ? 6   DT  B "O5'" 1 
ATOM   370  C "C5'" . DT  B 2 6  ? 8.991   -2.035  19.981 1.00 26.61 ? 6   DT  B "C5'" 1 
ATOM   371  C "C4'" . DT  B 2 6  ? 8.923   -3.543  19.942 1.00 27.20 ? 6   DT  B "C4'" 1 
ATOM   372  O "O4'" . DT  B 2 6  ? 7.621   -4.030  20.342 1.00 27.18 ? 6   DT  B "O4'" 1 
ATOM   373  C "C3'" . DT  B 2 6  ? 9.256   -4.215  18.609 1.00 28.53 ? 6   DT  B "C3'" 1 
ATOM   374  O "O3'" . DT  B 2 6  ? 10.257  -5.208  18.840 1.00 32.36 ? 6   DT  B "O3'" 1 
ATOM   375  C "C2'" . DT  B 2 6  ? 7.940   -4.861  18.194 1.00 27.13 ? 6   DT  B "C2'" 1 
ATOM   376  C "C1'" . DT  B 2 6  ? 7.271   -5.137  19.532 1.00 26.15 ? 6   DT  B "C1'" 1 
ATOM   377  N N1    . DT  B 2 6  ? 5.791   -5.236  19.521 1.00 25.63 ? 6   DT  B N1    1 
ATOM   378  C C2    . DT  B 2 6  ? 5.194   -6.185  20.329 1.00 25.45 ? 6   DT  B C2    1 
ATOM   379  O O2    . DT  B 2 6  ? 5.829   -6.960  21.028 1.00 26.95 ? 6   DT  B O2    1 
ATOM   380  N N3    . DT  B 2 6  ? 3.818   -6.189  20.294 1.00 24.54 ? 6   DT  B N3    1 
ATOM   381  C C4    . DT  B 2 6  ? 2.999   -5.351  19.553 1.00 23.76 ? 6   DT  B C4    1 
ATOM   382  O O4    . DT  B 2 6  ? 1.771   -5.444  19.652 1.00 22.41 ? 6   DT  B O4    1 
ATOM   383  C C5    . DT  B 2 6  ? 3.693   -4.398  18.712 1.00 23.38 ? 6   DT  B C5    1 
ATOM   384  C C7    . DT  B 2 6  ? 2.893   -3.463  17.858 1.00 21.54 ? 6   DT  B C7    1 
ATOM   385  C C6    . DT  B 2 6  ? 5.033   -4.392  18.736 1.00 23.59 ? 6   DT  B C6    1 
ATOM   386  P P     . DC  B 2 7  ? 11.089  -5.820  17.611 1.00 35.17 ? 7   DC  B P     1 
ATOM   387  O OP1   . DC  B 2 7  ? 12.536  -5.749  17.946 1.00 35.29 ? 7   DC  B OP1   1 
ATOM   388  O OP2   . DC  B 2 7  ? 10.593  -5.244  16.336 1.00 34.65 ? 7   DC  B OP2   1 
ATOM   389  O "O5'" . DC  B 2 7  ? 10.637  -7.337  17.647 1.00 35.67 ? 7   DC  B "O5'" 1 
ATOM   390  C "C5'" . DC  B 2 7  ? 9.374   -7.654  18.194 1.00 37.10 ? 7   DC  B "C5'" 1 
ATOM   391  C "C4'" . DC  B 2 7  ? 9.317   -9.102  18.596 1.00 36.10 ? 7   DC  B "C4'" 1 
ATOM   392  O "O4'" . DC  B 2 7  ? 7.988   -9.309  19.118 1.00 34.96 ? 7   DC  B "O4'" 1 
ATOM   393  C "C3'" . DC  B 2 7  ? 9.464   -10.047 17.409 1.00 37.37 ? 7   DC  B "C3'" 1 
ATOM   394  O "O3'" . DC  B 2 7  ? 10.131  -11.250 17.799 1.00 40.31 ? 7   DC  B "O3'" 1 
ATOM   395  C "C2'" . DC  B 2 7  ? 8.034   -10.292 16.965 1.00 35.28 ? 7   DC  B "C2'" 1 
ATOM   396  C "C1'" . DC  B 2 7  ? 7.212   -10.103 18.234 1.00 34.43 ? 7   DC  B "C1'" 1 
ATOM   397  N N1    . DC  B 2 7  ? 5.935   -9.407  18.005 1.00 31.66 ? 7   DC  B N1    1 
ATOM   398  C C2    . DC  B 2 7  ? 4.784   -9.896  18.617 1.00 31.54 ? 7   DC  B C2    1 
ATOM   399  O O2    . DC  B 2 7  ? 4.884   -10.861 19.392 1.00 31.11 ? 7   DC  B O2    1 
ATOM   400  N N3    . DC  B 2 7  ? 3.591   -9.308  18.356 1.00 30.78 ? 7   DC  B N3    1 
ATOM   401  C C4    . DC  B 2 7  ? 3.531   -8.258  17.533 1.00 30.49 ? 7   DC  B C4    1 
ATOM   402  N N4    . DC  B 2 7  ? 2.329   -7.729  17.281 1.00 29.87 ? 7   DC  B N4    1 
ATOM   403  C C5    . DC  B 2 7  ? 4.697   -7.711  16.925 1.00 30.45 ? 7   DC  B C5    1 
ATOM   404  C C6    . DC  B 2 7  ? 5.868   -8.310  17.187 1.00 32.09 ? 7   DC  B C6    1 
ATOM   405  P P     . DC  B 2 8  ? 10.470  -12.363 16.692 1.00 43.23 ? 8   DC  B P     1 
ATOM   406  O OP1   . DC  B 2 8  ? 11.443  -13.316 17.288 1.00 43.19 ? 8   DC  B OP1   1 
ATOM   407  O OP2   . DC  B 2 8  ? 10.791  -11.681 15.412 1.00 42.50 ? 8   DC  B OP2   1 
ATOM   408  O "O5'" . DC  B 2 8  ? 9.077   -13.104 16.508 1.00 43.53 ? 8   DC  B "O5'" 1 
ATOM   409  C "C5'" . DC  B 2 8  ? 8.361   -13.563 17.647 1.00 45.20 ? 8   DC  B "C5'" 1 
ATOM   410  C "C4'" . DC  B 2 8  ? 7.036   -14.140 17.220 1.00 46.23 ? 8   DC  B "C4'" 1 
ATOM   411  O "O4'" . DC  B 2 8  ? 6.012   -13.116 17.122 1.00 45.41 ? 8   DC  B "O4'" 1 
ATOM   412  C "C3'" . DC  B 2 8  ? 7.103   -14.819 15.852 1.00 46.51 ? 8   DC  B "C3'" 1 
ATOM   413  O "O3'" . DC  B 2 8  ? 6.443   -16.075 15.912 1.00 48.68 ? 8   DC  B "O3'" 1 
ATOM   414  C "C2'" . DC  B 2 8  ? 6.328   -13.875 14.951 1.00 46.29 ? 8   DC  B "C2'" 1 
ATOM   415  C "C1'" . DC  B 2 8  ? 5.300   -13.327 15.920 1.00 45.29 ? 8   DC  B "C1'" 1 
ATOM   416  N N1    . DC  B 2 8  ? 4.652   -12.068 15.522 1.00 43.26 ? 8   DC  B N1    1 
ATOM   417  C C2    . DC  B 2 8  ? 3.345   -11.832 15.947 1.00 42.84 ? 8   DC  B C2    1 
ATOM   418  O O2    . DC  B 2 8  ? 2.807   -12.651 16.707 1.00 42.17 ? 8   DC  B O2    1 
ATOM   419  N N3    . DC  B 2 8  ? 2.702   -10.720 15.526 1.00 42.59 ? 8   DC  B N3    1 
ATOM   420  C C4    . DC  B 2 8  ? 3.325   -9.854  14.724 1.00 43.18 ? 8   DC  B C4    1 
ATOM   421  N N4    . DC  B 2 8  ? 2.644   -8.784  14.310 1.00 43.53 ? 8   DC  B N4    1 
ATOM   422  C C5    . DC  B 2 8  ? 4.674   -10.050 14.308 1.00 43.56 ? 8   DC  B C5    1 
ATOM   423  C C6    . DC  B 2 8  ? 5.295   -11.159 14.729 1.00 43.93 ? 8   DC  B C6    1 
ATOM   424  P P     . DG  B 2 9  ? 7.261   -17.414 15.578 1.00 48.54 ? 9   DG  B P     1 
ATOM   425  O OP1   . DG  B 2 9  ? 8.299   -17.599 16.625 1.00 48.85 ? 9   DG  B OP1   1 
ATOM   426  O OP2   . DG  B 2 9  ? 7.661   -17.347 14.149 1.00 48.17 ? 9   DG  B OP2   1 
ATOM   427  O "O5'" . DG  B 2 9  ? 6.161   -18.546 15.758 1.00 47.47 ? 9   DG  B "O5'" 1 
ATOM   428  C "C5'" . DG  B 2 9  ? 5.467   -18.692 16.993 1.00 46.50 ? 9   DG  B "C5'" 1 
ATOM   429  C "C4'" . DG  B 2 9  ? 3.998   -18.929 16.736 1.00 45.73 ? 9   DG  B "C4'" 1 
ATOM   430  O "O4'" . DG  B 2 9  ? 3.337   -17.681 16.400 1.00 44.50 ? 9   DG  B "O4'" 1 
ATOM   431  C "C3'" . DG  B 2 9  ? 3.726   -19.886 15.575 1.00 46.36 ? 9   DG  B "C3'" 1 
ATOM   432  O "O3'" . DG  B 2 9  ? 2.664   -20.786 15.904 1.00 48.34 ? 9   DG  B "O3'" 1 
ATOM   433  C "C2'" . DG  B 2 9  ? 3.323   -18.962 14.438 1.00 44.35 ? 9   DG  B "C2'" 1 
ATOM   434  C "C1'" . DG  B 2 9  ? 2.630   -17.830 15.177 1.00 42.40 ? 9   DG  B "C1'" 1 
ATOM   435  N N9    . DG  B 2 9  ? 2.657   -16.549 14.475 1.00 38.98 ? 9   DG  B N9    1 
ATOM   436  C C8    . DG  B 2 9  ? 3.683   -16.040 13.715 1.00 37.86 ? 9   DG  B C8    1 
ATOM   437  N N7    . DG  B 2 9  ? 3.404   -14.877 13.192 1.00 37.44 ? 9   DG  B N7    1 
ATOM   438  C C5    . DG  B 2 9  ? 2.119   -14.596 13.639 1.00 35.47 ? 9   DG  B C5    1 
ATOM   439  C C6    . DG  B 2 9  ? 1.284   -13.474 13.395 1.00 33.18 ? 9   DG  B C6    1 
ATOM   440  O O6    . DG  B 2 9  ? 1.519   -12.474 12.706 1.00 31.41 ? 9   DG  B O6    1 
ATOM   441  N N1    . DG  B 2 9  ? 0.063   -13.595 14.047 1.00 31.38 ? 9   DG  B N1    1 
ATOM   442  C C2    . DG  B 2 9  ? -0.314  -14.656 14.829 1.00 32.67 ? 9   DG  B C2    1 
ATOM   443  N N2    . DG  B 2 9  ? -1.538  -14.579 15.377 1.00 29.71 ? 9   DG  B N2    1 
ATOM   444  N N3    . DG  B 2 9  ? 0.451   -15.713 15.059 1.00 33.72 ? 9   DG  B N3    1 
ATOM   445  C C4    . DG  B 2 9  ? 1.645   -15.615 14.437 1.00 36.03 ? 9   DG  B C4    1 
ATOM   446  P P     . DG  B 2 10 ? 2.170   -21.864 14.818 1.00 49.91 ? 10  DG  B P     1 
ATOM   447  O OP1   . DG  B 2 10 ? 1.892   -23.137 15.530 1.00 49.10 ? 10  DG  B OP1   1 
ATOM   448  O OP2   . DG  B 2 10 ? 3.113   -21.850 13.667 1.00 49.12 ? 10  DG  B OP2   1 
ATOM   449  O "O5'" . DG  B 2 10 ? 0.788   -21.256 14.322 1.00 48.78 ? 10  DG  B "O5'" 1 
ATOM   450  C "C5'" . DG  B 2 10 ? -0.217  -20.903 15.262 1.00 47.24 ? 10  DG  B "C5'" 1 
ATOM   451  C "C4'" . DG  B 2 10 ? -1.410  -20.321 14.547 1.00 46.14 ? 10  DG  B "C4'" 1 
ATOM   452  O "O4'" . DG  B 2 10 ? -1.129  -18.948 14.164 1.00 44.87 ? 10  DG  B "O4'" 1 
ATOM   453  C "C3'" . DG  B 2 10 ? -1.786  -21.068 13.263 1.00 45.38 ? 10  DG  B "C3'" 1 
ATOM   454  O "O3'" . DG  B 2 10 ? -3.193  -21.327 13.221 1.00 46.19 ? 10  DG  B "O3'" 1 
ATOM   455  C "C2'" . DG  B 2 10 ? -1.372  -20.110 12.160 1.00 44.72 ? 10  DG  B "C2'" 1 
ATOM   456  C "C1'" . DG  B 2 10 ? -1.529  -18.753 12.823 1.00 42.80 ? 10  DG  B "C1'" 1 
ATOM   457  N N9    . DG  B 2 10 ? -0.705  -17.700 12.234 1.00 39.54 ? 10  DG  B N9    1 
ATOM   458  C C8    . DG  B 2 10 ? 0.638   -17.749 11.953 1.00 38.81 ? 10  DG  B C8    1 
ATOM   459  N N7    . DG  B 2 10 ? 1.073   -16.682 11.339 1.00 37.74 ? 10  DG  B N7    1 
ATOM   460  C C5    . DG  B 2 10 ? -0.047  -15.870 11.223 1.00 36.62 ? 10  DG  B C5    1 
ATOM   461  C C6    . DG  B 2 10 ? -0.204  -14.593 10.619 1.00 34.95 ? 10  DG  B C6    1 
ATOM   462  O O6    . DG  B 2 10 ? 0.641   -13.906 10.032 1.00 34.65 ? 10  DG  B O6    1 
ATOM   463  N N1    . DG  B 2 10 ? -1.509  -14.131 10.736 1.00 33.99 ? 10  DG  B N1    1 
ATOM   464  C C2    . DG  B 2 10 ? -2.538  -14.809 11.346 1.00 34.63 ? 10  DG  B C2    1 
ATOM   465  N N2    . DG  B 2 10 ? -3.732  -14.196 11.364 1.00 31.98 ? 10  DG  B N2    1 
ATOM   466  N N3    . DG  B 2 10 ? -2.407  -16.001 11.899 1.00 35.43 ? 10  DG  B N3    1 
ATOM   467  C C4    . DG  B 2 10 ? -1.146  -16.471 11.798 1.00 37.46 ? 10  DG  B C4    1 
ATOM   468  P P     . DT  B 2 11 ? -3.861  -21.927 11.885 1.00 46.71 ? 11  DT  B P     1 
ATOM   469  O OP1   . DT  B 2 11 ? -4.750  -23.054 12.264 1.00 47.62 ? 11  DT  B OP1   1 
ATOM   470  O OP2   . DT  B 2 11 ? -2.811  -22.138 10.855 1.00 46.76 ? 11  DT  B OP2   1 
ATOM   471  O "O5'" . DT  B 2 11 ? -4.781  -20.728 11.394 1.00 46.01 ? 11  DT  B "O5'" 1 
ATOM   472  C "C5'" . DT  B 2 11 ? -5.548  -19.979 12.333 1.00 44.09 ? 11  DT  B "C5'" 1 
ATOM   473  C "C4'" . DT  B 2 11 ? -6.422  -18.987 11.609 1.00 43.18 ? 11  DT  B "C4'" 1 
ATOM   474  O "O4'" . DT  B 2 11 ? -5.616  -17.899 11.095 1.00 41.72 ? 11  DT  B "O4'" 1 
ATOM   475  C "C3'" . DT  B 2 11 ? -7.137  -19.589 10.404 1.00 43.67 ? 11  DT  B "C3'" 1 
ATOM   476  O "O3'" . DT  B 2 11 ? -8.456  -19.062 10.310 1.00 47.10 ? 11  DT  B "O3'" 1 
ATOM   477  C "C2'" . DT  B 2 11 ? -6.290  -19.144 9.226  1.00 41.86 ? 11  DT  B "C2'" 1 
ATOM   478  C "C1'" . DT  B 2 11 ? -5.778  -17.792 9.687  1.00 39.59 ? 11  DT  B "C1'" 1 
ATOM   479  N N1    . DT  B 2 11 ? -4.476  -17.397 9.115  1.00 36.81 ? 11  DT  B N1    1 
ATOM   480  C C2    . DT  B 2 11 ? -4.405  -16.210 8.421  1.00 34.48 ? 11  DT  B C2    1 
ATOM   481  O O2    . DT  B 2 11 ? -5.374  -15.499 8.220  1.00 33.62 ? 11  DT  B O2    1 
ATOM   482  N N3    . DT  B 2 11 ? -3.152  -15.890 7.960  1.00 33.10 ? 11  DT  B N3    1 
ATOM   483  C C4    . DT  B 2 11 ? -1.993  -16.629 8.109  1.00 33.46 ? 11  DT  B C4    1 
ATOM   484  O O4    . DT  B 2 11 ? -0.933  -16.205 7.656  1.00 33.32 ? 11  DT  B O4    1 
ATOM   485  C C5    . DT  B 2 11 ? -2.146  -17.878 8.817  1.00 34.29 ? 11  DT  B C5    1 
ATOM   486  C C7    . DT  B 2 11 ? -0.951  -18.761 8.994  1.00 34.55 ? 11  DT  B C7    1 
ATOM   487  C C6    . DT  B 2 11 ? -3.362  -18.194 9.284  1.00 35.26 ? 11  DT  B C6    1 
ATOM   488  P P     . DC  B 2 12 ? -9.440  -19.603 9.167  1.00 50.33 ? 12  DC  B P     1 
ATOM   489  O OP1   . DC  B 2 12 ? -10.818 -19.601 9.725  1.00 50.70 ? 12  DC  B OP1   1 
ATOM   490  O OP2   . DC  B 2 12 ? -8.865  -20.863 8.628  1.00 50.02 ? 12  DC  B OP2   1 
ATOM   491  O "O5'" . DC  B 2 12 ? -9.345  -18.474 8.050  1.00 50.83 ? 12  DC  B "O5'" 1 
ATOM   492  C "C5'" . DC  B 2 12 ? -9.573  -17.107 8.389  1.00 51.67 ? 12  DC  B "C5'" 1 
ATOM   493  C "C4'" . DC  B 2 12 ? -9.529  -16.248 7.148  1.00 51.66 ? 12  DC  B "C4'" 1 
ATOM   494  O "O4'" . DC  B 2 12 ? -8.161  -16.000 6.742  1.00 51.37 ? 12  DC  B "O4'" 1 
ATOM   495  C "C3'" . DC  B 2 12 ? -10.225 -16.878 5.945  1.00 52.33 ? 12  DC  B "C3'" 1 
ATOM   496  O "O3'" . DC  B 2 12 ? -10.965 -15.886 5.238  1.00 54.15 ? 12  DC  B "O3'" 1 
ATOM   497  C "C2'" . DC  B 2 12 ? -9.076  -17.412 5.105  1.00 51.22 ? 12  DC  B "C2'" 1 
ATOM   498  C "C1'" . DC  B 2 12 ? -7.950  -16.436 5.406  1.00 49.30 ? 12  DC  B "C1'" 1 
ATOM   499  N N1    . DC  B 2 12 ? -6.596  -17.014 5.342  1.00 46.80 ? 12  DC  B N1    1 
ATOM   500  C C2    . DC  B 2 12 ? -5.553  -16.235 4.832  1.00 45.20 ? 12  DC  B C2    1 
ATOM   501  O O2    . DC  B 2 12 ? -5.807  -15.104 4.395  1.00 45.22 ? 12  DC  B O2    1 
ATOM   502  N N3    . DC  B 2 12 ? -4.297  -16.734 4.826  1.00 44.19 ? 12  DC  B N3    1 
ATOM   503  C C4    . DC  B 2 12 ? -4.063  -17.960 5.297  1.00 43.73 ? 12  DC  B C4    1 
ATOM   504  N N4    . DC  B 2 12 ? -2.801  -18.396 5.306  1.00 43.25 ? 12  DC  B N4    1 
ATOM   505  C C5    . DC  B 2 12 ? -5.110  -18.788 5.790  1.00 43.70 ? 12  DC  B C5    1 
ATOM   506  C C6    . DC  B 2 12 ? -6.350  -18.282 5.793  1.00 45.64 ? 12  DC  B C6    1 
ATOM   507  P P     . DA  B 2 13 ? -11.992 -16.334 4.092  1.00 55.21 ? 13  DA  B P     1 
ATOM   508  O OP1   . DA  B 2 13 ? -13.298 -15.690 4.382  1.00 55.59 ? 13  DA  B OP1   1 
ATOM   509  O OP2   . DA  B 2 13 ? -11.914 -17.814 3.950  1.00 54.86 ? 13  DA  B OP2   1 
ATOM   510  O "O5'" . DA  B 2 13 ? -11.373 -15.681 2.778  1.00 54.38 ? 13  DA  B "O5'" 1 
ATOM   511  C "C5'" . DA  B 2 13 ? -10.970 -14.315 2.763  1.00 52.44 ? 13  DA  B "C5'" 1 
ATOM   512  C "C4'" . DA  B 2 13 ? -10.133 -14.034 1.538  1.00 51.43 ? 13  DA  B "C4'" 1 
ATOM   513  O "O4'" . DA  B 2 13 ? -8.808  -14.600 1.696  1.00 50.03 ? 13  DA  B "O4'" 1 
ATOM   514  C "C3'" . DA  B 2 13 ? -10.695 -14.628 0.244  1.00 51.21 ? 13  DA  B "C3'" 1 
ATOM   515  O "O3'" . DA  B 2 13 ? -10.373 -13.797 -0.877 1.00 52.88 ? 13  DA  B "O3'" 1 
ATOM   516  C "C2'" . DA  B 2 13 ? -9.891  -15.905 0.083  1.00 49.85 ? 13  DA  B "C2'" 1 
ATOM   517  C "C1'" . DA  B 2 13 ? -8.532  -15.471 0.607  1.00 48.24 ? 13  DA  B "C1'" 1 
ATOM   518  N N9    . DA  B 2 13 ? -7.670  -16.552 1.090  1.00 45.35 ? 13  DA  B N9    1 
ATOM   519  C C8    . DA  B 2 13 ? -8.042  -17.738 1.674  1.00 44.66 ? 13  DA  B C8    1 
ATOM   520  N N7    . DA  B 2 13 ? -7.031  -18.513 1.991  1.00 43.42 ? 13  DA  B N7    1 
ATOM   521  C C5    . DA  B 2 13 ? -5.917  -17.788 1.593  1.00 42.90 ? 13  DA  B C5    1 
ATOM   522  C C6    . DA  B 2 13 ? -4.536  -18.061 1.657  1.00 42.56 ? 13  DA  B C6    1 
ATOM   523  N N6    . DA  B 2 13 ? -4.024  -19.186 2.167  1.00 41.34 ? 13  DA  B N6    1 
ATOM   524  N N1    . DA  B 2 13 ? -3.689  -17.127 1.172  1.00 42.16 ? 13  DA  B N1    1 
ATOM   525  C C2    . DA  B 2 13 ? -4.203  -15.999 0.659  1.00 43.28 ? 13  DA  B C2    1 
ATOM   526  N N3    . DA  B 2 13 ? -5.479  -15.629 0.543  1.00 43.46 ? 13  DA  B N3    1 
ATOM   527  C C4    . DA  B 2 13 ? -6.295  -16.578 1.036  1.00 44.09 ? 13  DA  B C4    1 
ATOM   528  O "O5'" . DT  C 1 1  ? -2.818  46.939  -3.998 1.00 54.25 ? 1   DT  D "O5'" 1 
ATOM   529  C "C5'" . DT  C 1 1  ? -1.972  47.676  -3.112 1.00 53.37 ? 1   DT  D "C5'" 1 
ATOM   530  C "C4'" . DT  C 1 1  ? -2.089  47.204  -1.682 1.00 52.44 ? 1   DT  D "C4'" 1 
ATOM   531  O "O4'" . DT  C 1 1  ? -1.088  47.866  -0.871 1.00 51.68 ? 1   DT  D "O4'" 1 
ATOM   532  C "C3'" . DT  C 1 1  ? -3.434  47.499  -1.008 1.00 52.15 ? 1   DT  D "C3'" 1 
ATOM   533  O "O3'" . DT  C 1 1  ? -3.750  46.449  -0.084 1.00 52.14 ? 1   DT  D "O3'" 1 
ATOM   534  C "C2'" . DT  C 1 1  ? -3.132  48.751  -0.205 1.00 51.17 ? 1   DT  D "C2'" 1 
ATOM   535  C "C1'" . DT  C 1 1  ? -1.728  48.427  0.260  1.00 50.16 ? 1   DT  D "C1'" 1 
ATOM   536  N N1    . DT  C 1 1  ? -0.911  49.549  0.765  1.00 47.55 ? 1   DT  D N1    1 
ATOM   537  C C2    . DT  C 1 1  ? 0.445   49.552  0.513  1.00 46.15 ? 1   DT  D C2    1 
ATOM   538  O O2    . DT  C 1 1  ? 1.005   48.704  -0.160 1.00 45.86 ? 1   DT  D O2    1 
ATOM   539  N N3    . DT  C 1 1  ? 1.127   50.597  1.080  1.00 45.21 ? 1   DT  D N3    1 
ATOM   540  C C4    . DT  C 1 1  ? 0.606   51.619  1.848  1.00 45.44 ? 1   DT  D C4    1 
ATOM   541  O O4    . DT  C 1 1  ? 1.351   52.482  2.308  1.00 44.33 ? 1   DT  D O4    1 
ATOM   542  C C5    . DT  C 1 1  ? -0.824  51.568  2.050  1.00 45.96 ? 1   DT  D C5    1 
ATOM   543  C C7    . DT  C 1 1  ? -1.483  52.641  2.859  1.00 46.51 ? 1   DT  D C7    1 
ATOM   544  C C6    . DT  C 1 1  ? -1.501  50.552  1.503  1.00 46.90 ? 1   DT  D C6    1 
ATOM   545  P P     . DG  C 1 2  ? -4.372  45.065  -0.619 1.00 52.04 ? 2   DG  D P     1 
ATOM   546  O OP1   . DG  C 1 2  ? -4.334  45.092  -2.102 1.00 52.20 ? 2   DG  D OP1   1 
ATOM   547  O OP2   . DG  C 1 2  ? -5.657  44.804  0.082  1.00 52.43 ? 2   DG  D OP2   1 
ATOM   548  O "O5'" . DG  C 1 2  ? -3.316  43.974  -0.144 1.00 49.75 ? 2   DG  D "O5'" 1 
ATOM   549  C "C5'" . DG  C 1 2  ? -2.228  43.606  -0.987 1.00 44.96 ? 2   DG  D "C5'" 1 
ATOM   550  C "C4'" . DG  C 1 2  ? -1.026  43.228  -0.154 1.00 42.04 ? 2   DG  D "C4'" 1 
ATOM   551  O "O4'" . DG  C 1 2  ? -0.406  44.405  0.419  1.00 40.06 ? 2   DG  D "O4'" 1 
ATOM   552  C "C3'" . DG  C 1 2  ? -1.321  42.294  1.019  1.00 39.89 ? 2   DG  D "C3'" 1 
ATOM   553  O "O3'" . DG  C 1 2  ? -0.255  41.352  1.137  1.00 39.11 ? 2   DG  D "O3'" 1 
ATOM   554  C "C2'" . DG  C 1 2  ? -1.318  43.230  2.214  1.00 38.77 ? 2   DG  D "C2'" 1 
ATOM   555  C "C1'" . DG  C 1 2  ? -0.241  44.218  1.813  1.00 38.15 ? 2   DG  D "C1'" 1 
ATOM   556  N N9    . DG  C 1 2  ? -0.314  45.524  2.460  1.00 36.29 ? 2   DG  D N9    1 
ATOM   557  C C8    . DG  C 1 2  ? -1.445  46.210  2.829  1.00 35.85 ? 2   DG  D C8    1 
ATOM   558  N N7    . DG  C 1 2  ? -1.188  47.357  3.398  1.00 35.16 ? 2   DG  D N7    1 
ATOM   559  C C5    . DG  C 1 2  ? 0.199   47.436  3.402  1.00 35.62 ? 2   DG  D C5    1 
ATOM   560  C C6    . DG  C 1 2  ? 1.064   48.451  3.893  1.00 35.29 ? 2   DG  D C6    1 
ATOM   561  O O6    . DG  C 1 2  ? 0.766   49.523  4.435  1.00 35.75 ? 2   DG  D O6    1 
ATOM   562  N N1    . DG  C 1 2  ? 2.402   48.123  3.698  1.00 35.66 ? 2   DG  D N1    1 
ATOM   563  C C2    . DG  C 1 2  ? 2.854   46.970  3.107  1.00 35.65 ? 2   DG  D C2    1 
ATOM   564  N N2    . DG  C 1 2  ? 4.185   46.839  3.005  1.00 35.98 ? 2   DG  D N2    1 
ATOM   565  N N3    . DG  C 1 2  ? 2.061   46.015  2.646  1.00 36.21 ? 2   DG  D N3    1 
ATOM   566  C C4    . DG  C 1 2  ? 0.754   46.312  2.826  1.00 36.07 ? 2   DG  D C4    1 
ATOM   567  P P     . DA  C 1 3  ? -0.440  40.042  2.043  1.00 36.79 ? 3   DA  D P     1 
ATOM   568  O OP1   . DA  C 1 3  ? -0.667  38.886  1.139  1.00 38.47 ? 3   DA  D OP1   1 
ATOM   569  O OP2   . DA  C 1 3  ? -1.424  40.346  3.109  1.00 36.26 ? 3   DA  D OP2   1 
ATOM   570  O "O5'" . DA  C 1 3  ? 0.986   39.872  2.731  1.00 34.47 ? 3   DA  D "O5'" 1 
ATOM   571  C "C5'" . DA  C 1 3  ? 2.177   39.997  1.965  1.00 28.97 ? 3   DA  D "C5'" 1 
ATOM   572  C "C4'" . DA  C 1 3  ? 3.314   40.466  2.840  1.00 26.35 ? 3   DA  D "C4'" 1 
ATOM   573  O "O4'" . DA  C 1 3  ? 3.097   41.842  3.235  1.00 24.67 ? 3   DA  D "O4'" 1 
ATOM   574  C "C3'" . DA  C 1 3  ? 3.519   39.673  4.133  1.00 24.19 ? 3   DA  D "C3'" 1 
ATOM   575  O "O3'" . DA  C 1 3  ? 4.916   39.459  4.330  1.00 22.95 ? 3   DA  D "O3'" 1 
ATOM   576  C "C2'" . DA  C 1 3  ? 2.956   40.588  5.208  1.00 24.38 ? 3   DA  D "C2'" 1 
ATOM   577  C "C1'" . DA  C 1 3  ? 3.221   41.976  4.641  1.00 23.63 ? 3   DA  D "C1'" 1 
ATOM   578  N N9    . DA  C 1 3  ? 2.276   43.006  5.083  1.00 25.10 ? 3   DA  D N9    1 
ATOM   579  C C8    . DA  C 1 3  ? 0.902   42.932  5.103  1.00 24.98 ? 3   DA  D C8    1 
ATOM   580  N N7    . DA  C 1 3  ? 0.321   44.016  5.564  1.00 25.16 ? 3   DA  D N7    1 
ATOM   581  C C5    . DA  C 1 3  ? 1.379   44.864  5.862  1.00 25.00 ? 3   DA  D C5    1 
ATOM   582  C C6    . DA  C 1 3  ? 1.428   46.173  6.384  1.00 25.17 ? 3   DA  D C6    1 
ATOM   583  N N6    . DA  C 1 3  ? 0.348   46.890  6.697  1.00 24.99 ? 3   DA  D N6    1 
ATOM   584  N N1    . DA  C 1 3  ? 2.644   46.729  6.571  1.00 25.88 ? 3   DA  D N1    1 
ATOM   585  C C2    . DA  C 1 3  ? 3.731   46.015  6.248  1.00 25.33 ? 3   DA  D C2    1 
ATOM   586  N N3    . DA  C 1 3  ? 3.812   44.784  5.745  1.00 25.73 ? 3   DA  D N3    1 
ATOM   587  C C4    . DA  C 1 3  ? 2.589   44.256  5.574  1.00 24.93 ? 3   DA  D C4    1 
ATOM   588  P P     . DC  C 1 4  ? 5.433   38.634  5.609  1.00 22.82 ? 4   DC  D P     1 
ATOM   589  O OP1   . DC  C 1 4  ? 6.732   38.017  5.246  1.00 22.85 ? 4   DC  D OP1   1 
ATOM   590  O OP2   . DC  C 1 4  ? 4.319   37.782  6.110  1.00 22.92 ? 4   DC  D OP2   1 
ATOM   591  O "O5'" . DC  C 1 4  ? 5.721   39.771  6.676  1.00 23.08 ? 4   DC  D "O5'" 1 
ATOM   592  C "C5'" . DC  C 1 4  ? 6.597   40.842  6.350  1.00 22.67 ? 4   DC  D "C5'" 1 
ATOM   593  C "C4'" . DC  C 1 4  ? 6.737   41.777  7.525  1.00 22.93 ? 4   DC  D "C4'" 1 
ATOM   594  O "O4'" . DC  C 1 4  ? 5.612   42.690  7.598  1.00 23.61 ? 4   DC  D "O4'" 1 
ATOM   595  C "C3'" . DC  C 1 4  ? 6.824   41.081  8.885  1.00 22.74 ? 4   DC  D "C3'" 1 
ATOM   596  O "O3'" . DC  C 1 4  ? 7.997   41.519  9.559  1.00 22.01 ? 4   DC  D "O3'" 1 
ATOM   597  C "C2'" . DC  C 1 4  ? 5.564   41.533  9.614  1.00 23.59 ? 4   DC  D "C2'" 1 
ATOM   598  C "C1'" . DC  C 1 4  ? 5.243   42.865  8.950  1.00 22.78 ? 4   DC  D "C1'" 1 
ATOM   599  N N1    . DC  C 1 4  ? 3.824   43.273  8.990  1.00 23.01 ? 4   DC  D N1    1 
ATOM   600  C C2    . DC  C 1 4  ? 3.497   44.593  9.387  1.00 23.50 ? 4   DC  D C2    1 
ATOM   601  O O2    . DC  C 1 4  ? 4.410   45.390  9.673  1.00 24.20 ? 4   DC  D O2    1 
ATOM   602  N N3    . DC  C 1 4  ? 2.197   44.961  9.448  1.00 22.82 ? 4   DC  D N3    1 
ATOM   603  C C4    . DC  C 1 4  ? 1.238   44.085  9.132  1.00 23.15 ? 4   DC  D C4    1 
ATOM   604  N N4    . DC  C 1 4  ? -0.030  44.491  9.230  1.00 21.26 ? 4   DC  D N4    1 
ATOM   605  C C5    . DC  C 1 4  ? 1.539   42.752  8.709  1.00 22.63 ? 4   DC  D C5    1 
ATOM   606  C C6    . DC  C 1 4  ? 2.832   42.393  8.655  1.00 22.94 ? 4   DC  D C6    1 
ATOM   607  P P     . DC  C 1 5  ? 8.386   40.889  10.982 1.00 22.42 ? 5   DC  D P     1 
ATOM   608  O OP1   . DC  C 1 5  ? 9.864   40.749  11.006 1.00 22.49 ? 5   DC  D OP1   1 
ATOM   609  O OP2   . DC  C 1 5  ? 7.531   39.698  11.249 1.00 21.03 ? 5   DC  D OP2   1 
ATOM   610  O "O5'" . DC  C 1 5  ? 7.963   42.056  11.971 1.00 22.33 ? 5   DC  D "O5'" 1 
ATOM   611  C "C5'" . DC  C 1 5  ? 8.366   43.397  11.700 1.00 25.48 ? 5   DC  D "C5'" 1 
ATOM   612  C "C4'" . DC  C 1 5  ? 7.847   44.329  12.766 1.00 27.61 ? 5   DC  D "C4'" 1 
ATOM   613  O "O4'" . DC  C 1 5  ? 6.491   44.750  12.469 1.00 26.78 ? 5   DC  D "O4'" 1 
ATOM   614  C "C3'" . DC  C 1 5  ? 7.816   43.694  14.153 1.00 29.21 ? 5   DC  D "C3'" 1 
ATOM   615  O "O3'" . DC  C 1 5  ? 8.499   44.494  15.100 1.00 34.22 ? 5   DC  D "O3'" 1 
ATOM   616  C "C2'" . DC  C 1 5  ? 6.340   43.601  14.494 1.00 29.48 ? 5   DC  D "C2'" 1 
ATOM   617  C "C1'" . DC  C 1 5  ? 5.705   44.689  13.646 1.00 27.82 ? 5   DC  D "C1'" 1 
ATOM   618  N N1    . DC  C 1 5  ? 4.316   44.381  13.257 1.00 26.51 ? 5   DC  D N1    1 
ATOM   619  C C2    . DC  C 1 5  ? 3.285   45.226  13.693 1.00 26.15 ? 5   DC  D C2    1 
ATOM   620  O O2    . DC  C 1 5  ? 3.566   46.212  14.388 1.00 27.18 ? 5   DC  D O2    1 
ATOM   621  N N3    . DC  C 1 5  ? 2.007   44.938  13.356 1.00 24.72 ? 5   DC  D N3    1 
ATOM   622  C C4    . DC  C 1 5  ? 1.736   43.851  12.630 1.00 24.70 ? 5   DC  D C4    1 
ATOM   623  N N4    . DC  C 1 5  ? 0.455   43.594  12.346 1.00 22.03 ? 5   DC  D N4    1 
ATOM   624  C C5    . DC  C 1 5  ? 2.766   42.975  12.168 1.00 24.11 ? 5   DC  D C5    1 
ATOM   625  C C6    . DC  C 1 5  ? 4.030   43.280  12.497 1.00 26.53 ? 5   DC  D C6    1 
ATOM   626  P P     . DG  C 1 6  ? 9.105   43.803  16.417 1.00 37.58 ? 6   DG  D P     1 
ATOM   627  O OP1   . DG  C 1 6  ? 10.449  44.391  16.656 1.00 38.46 ? 6   DG  D OP1   1 
ATOM   628  O OP2   . DG  C 1 6  ? 8.954   42.334  16.295 1.00 35.98 ? 6   DG  D OP2   1 
ATOM   629  O "O5'" . DG  C 1 6  ? 8.124   44.308  17.565 1.00 36.64 ? 6   DG  D "O5'" 1 
ATOM   630  C "C5'" . DG  C 1 6  ? 7.990   45.698  17.824 1.00 34.92 ? 6   DG  D "C5'" 1 
ATOM   631  C "C4'" . DG  C 1 6  ? 6.798   45.953  18.714 1.00 33.99 ? 6   DG  D "C4'" 1 
ATOM   632  O "O4'" . DG  C 1 6  ? 5.565   45.696  17.999 1.00 32.54 ? 6   DG  D "O4'" 1 
ATOM   633  C "C3'" . DG  C 1 6  ? 6.739   45.097  19.978 1.00 34.78 ? 6   DG  D "C3'" 1 
ATOM   634  O "O3'" . DG  C 1 6  ? 6.225   45.908  21.025 1.00 36.53 ? 6   DG  D "O3'" 1 
ATOM   635  C "C2'" . DG  C 1 6  ? 5.719   44.030  19.624 1.00 33.09 ? 6   DG  D "C2'" 1 
ATOM   636  C "C1'" . DG  C 1 6  ? 4.754   44.822  18.761 1.00 30.90 ? 6   DG  D "C1'" 1 
ATOM   637  N N9    . DG  C 1 6  ? 3.954   44.030  17.835 1.00 29.30 ? 6   DG  D N9    1 
ATOM   638  C C8    . DG  C 1 6  ? 4.322   42.870  17.196 1.00 27.68 ? 6   DG  D C8    1 
ATOM   639  N N7    . DG  C 1 6  ? 3.379   42.385  16.435 1.00 27.11 ? 6   DG  D N7    1 
ATOM   640  C C5    . DG  C 1 6  ? 2.326   43.280  16.578 1.00 27.10 ? 6   DG  D C5    1 
ATOM   641  C C6    . DG  C 1 6  ? 1.027   43.276  16.003 1.00 26.86 ? 6   DG  D C6    1 
ATOM   642  O O6    . DG  C 1 6  ? 0.527   42.450  15.230 1.00 26.88 ? 6   DG  D O6    1 
ATOM   643  N N1    . DG  C 1 6  ? 0.280   44.374  16.419 1.00 26.82 ? 6   DG  D N1    1 
ATOM   644  C C2    . DG  C 1 6  ? 0.719   45.345  17.285 1.00 27.44 ? 6   DG  D C2    1 
ATOM   645  N N2    . DG  C 1 6  ? -0.159  46.315  17.581 1.00 29.14 ? 6   DG  D N2    1 
ATOM   646  N N3    . DG  C 1 6  ? 1.925   45.360  17.826 1.00 27.31 ? 6   DG  D N3    1 
ATOM   647  C C4    . DG  C 1 6  ? 2.669   44.305  17.433 1.00 27.49 ? 6   DG  D C4    1 
ATOM   648  P P     . DG  C 1 7  ? 6.495   45.517  22.551 1.00 36.62 ? 7   DG  D P     1 
ATOM   649  O OP1   . DG  C 1 7  ? 7.833   46.033  22.933 1.00 37.68 ? 7   DG  D OP1   1 
ATOM   650  O OP2   . DG  C 1 7  ? 6.186   44.077  22.733 1.00 38.57 ? 7   DG  D OP2   1 
ATOM   651  O "O5'" . DG  C 1 7  ? 5.376   46.365  23.292 1.00 37.81 ? 7   DG  D "O5'" 1 
ATOM   652  C "C5'" . DG  C 1 7  ? 5.064   47.681  22.842 1.00 36.68 ? 7   DG  D "C5'" 1 
ATOM   653  C "C4'" . DG  C 1 7  ? 3.604   47.986  23.077 1.00 36.36 ? 7   DG  D "C4'" 1 
ATOM   654  O "O4'" . DG  C 1 7  ? 2.767   47.337  22.089 1.00 34.85 ? 7   DG  D "O4'" 1 
ATOM   655  C "C3'" . DG  C 1 7  ? 3.083   47.543  24.439 1.00 37.20 ? 7   DG  D "C3'" 1 
ATOM   656  O "O3'" . DG  C 1 7  ? 2.249   48.564  24.978 1.00 39.62 ? 7   DG  D "O3'" 1 
ATOM   657  C "C2'" . DG  C 1 7  ? 2.286   46.286  24.129 1.00 35.10 ? 7   DG  D "C2'" 1 
ATOM   658  C "C1'" . DG  C 1 7  ? 1.765   46.554  22.725 1.00 33.15 ? 7   DG  D "C1'" 1 
ATOM   659  N N9    . DG  C 1 7  ? 1.560   45.362  21.905 1.00 30.80 ? 7   DG  D N9    1 
ATOM   660  C C8    . DG  C 1 7  ? 2.501   44.412  21.586 1.00 29.11 ? 7   DG  D C8    1 
ATOM   661  N N7    . DG  C 1 7  ? 2.046   43.488  20.785 1.00 28.99 ? 7   DG  D N7    1 
ATOM   662  C C5    . DG  C 1 7  ? 0.722   43.841  20.568 1.00 27.70 ? 7   DG  D C5    1 
ATOM   663  C C6    . DG  C 1 7  ? -0.274  43.225  19.760 1.00 26.63 ? 7   DG  D C6    1 
ATOM   664  O O6    . DG  C 1 7  ? -0.176  42.221  19.047 1.00 26.26 ? 7   DG  D O6    1 
ATOM   665  N N1    . DG  C 1 7  ? -1.484  43.908  19.830 1.00 26.10 ? 7   DG  D N1    1 
ATOM   666  C C2    . DG  C 1 7  ? -1.707  45.045  20.572 1.00 27.35 ? 7   DG  D C2    1 
ATOM   667  N N2    . DG  C 1 7  ? -2.941  45.563  20.510 1.00 25.21 ? 7   DG  D N2    1 
ATOM   668  N N3    . DG  C 1 7  ? -0.784  45.633  21.321 1.00 27.57 ? 7   DG  D N3    1 
ATOM   669  C C4    . DG  C 1 7  ? 0.398   44.984  21.269 1.00 28.54 ? 7   DG  D C4    1 
ATOM   670  P P     . DA  C 1 8  ? 1.903   48.555  26.542 1.00 41.73 ? 8   DA  D P     1 
ATOM   671  O OP1   . DA  C 1 8  ? 1.684   49.961  26.972 1.00 41.48 ? 8   DA  D OP1   1 
ATOM   672  O OP2   . DA  C 1 8  ? 2.919   47.723  27.230 1.00 40.97 ? 8   DA  D OP2   1 
ATOM   673  O "O5'" . DA  C 1 8  ? 0.508   47.794  26.596 1.00 41.38 ? 8   DA  D "O5'" 1 
ATOM   674  C "C5'" . DA  C 1 8  ? -0.632  48.337  25.941 1.00 41.52 ? 8   DA  D "C5'" 1 
ATOM   675  C "C4'" . DA  C 1 8  ? -1.795  47.383  26.053 1.00 41.79 ? 8   DA  D "C4'" 1 
ATOM   676  O "O4'" . DA  C 1 8  ? -1.711  46.341  25.050 1.00 41.04 ? 8   DA  D "O4'" 1 
ATOM   677  C "C3'" . DA  C 1 8  ? -1.888  46.672  27.404 1.00 42.59 ? 8   DA  D "C3'" 1 
ATOM   678  O "O3'" . DA  C 1 8  ? -3.247  46.641  27.821 1.00 45.59 ? 8   DA  D "O3'" 1 
ATOM   679  C "C2'" . DA  C 1 8  ? -1.419  45.261  27.094 1.00 41.15 ? 8   DA  D "C2'" 1 
ATOM   680  C "C1'" . DA  C 1 8  ? -1.923  45.086  25.674 1.00 40.10 ? 8   DA  D "C1'" 1 
ATOM   681  N N9    . DA  C 1 8  ? -1.245  44.059  24.881 1.00 38.27 ? 8   DA  D N9    1 
ATOM   682  C C8    . DA  C 1 8  ? 0.064   43.651  24.943 1.00 37.61 ? 8   DA  D C8    1 
ATOM   683  N N7    . DA  C 1 8  ? 0.362   42.699  24.093 1.00 36.43 ? 8   DA  D N7    1 
ATOM   684  C C5    . DA  C 1 8  ? -0.833  42.465  23.424 1.00 36.08 ? 8   DA  D C5    1 
ATOM   685  C C6    . DA  C 1 8  ? -1.184  41.570  22.394 1.00 34.53 ? 8   DA  D C6    1 
ATOM   686  N N6    . DA  C 1 8  ? -0.329  40.715  21.828 1.00 32.43 ? 8   DA  D N6    1 
ATOM   687  N N1    . DA  C 1 8  ? -2.463  41.589  21.957 1.00 35.07 ? 8   DA  D N1    1 
ATOM   688  C C2    . DA  C 1 8  ? -3.321  42.451  22.519 1.00 36.28 ? 8   DA  D C2    1 
ATOM   689  N N3    . DA  C 1 8  ? -3.108  43.341  23.488 1.00 36.94 ? 8   DA  D N3    1 
ATOM   690  C C4    . DA  C 1 8  ? -1.830  43.295  23.901 1.00 36.46 ? 8   DA  D C4    1 
ATOM   691  P P     . DA  C 1 9  ? -3.608  46.356  29.360 1.00 46.51 ? 9   DA  D P     1 
ATOM   692  O OP1   . DA  C 1 9  ? -3.993  47.652  29.972 1.00 46.86 ? 9   DA  D OP1   1 
ATOM   693  O OP2   . DA  C 1 9  ? -2.534  45.540  29.982 1.00 46.32 ? 9   DA  D OP2   1 
ATOM   694  O "O5'" . DA  C 1 9  ? -4.905  45.446  29.231 1.00 46.50 ? 9   DA  D "O5'" 1 
ATOM   695  C "C5'" . DA  C 1 9  ? -5.872  45.718  28.223 1.00 45.47 ? 9   DA  D "C5'" 1 
ATOM   696  C "C4'" . DA  C 1 9  ? -6.552  44.441  27.792 1.00 45.64 ? 9   DA  D "C4'" 1 
ATOM   697  O "O4'" . DA  C 1 9  ? -5.695  43.679  26.902 1.00 44.25 ? 9   DA  D "O4'" 1 
ATOM   698  C "C3'" . DA  C 1 9  ? -6.910  43.506  28.948 1.00 45.96 ? 9   DA  D "C3'" 1 
ATOM   699  O "O3'" . DA  C 1 9  ? -8.213  42.960  28.749 1.00 48.42 ? 9   DA  D "O3'" 1 
ATOM   700  C "C2'" . DA  C 1 9  ? -5.873  42.404  28.844 1.00 44.88 ? 9   DA  D "C2'" 1 
ATOM   701  C "C1'" . DA  C 1 9  ? -5.656  42.335  27.347 1.00 43.06 ? 9   DA  D "C1'" 1 
ATOM   702  N N9    . DA  C 1 9  ? -4.380  41.747  26.943 1.00 40.56 ? 9   DA  D N9    1 
ATOM   703  C C8    . DA  C 1 9  ? -3.143  41.926  27.509 1.00 39.83 ? 9   DA  D C8    1 
ATOM   704  N N7    . DA  C 1 9  ? -2.194  41.226  26.937 1.00 38.31 ? 9   DA  D N7    1 
ATOM   705  C C5    . DA  C 1 9  ? -2.848  40.546  25.920 1.00 37.64 ? 9   DA  D C5    1 
ATOM   706  C C6    . DA  C 1 9  ? -2.398  39.632  24.948 1.00 36.35 ? 9   DA  D C6    1 
ATOM   707  N N6    . DA  C 1 9  ? -1.129  39.228  24.840 1.00 34.75 ? 9   DA  D N6    1 
ATOM   708  N N1    . DA  C 1 9  ? -3.309  39.140  24.080 1.00 35.30 ? 9   DA  D N1    1 
ATOM   709  C C2    . DA  C 1 9  ? -4.580  39.544  24.187 1.00 36.03 ? 9   DA  D C2    1 
ATOM   710  N N3    . DA  C 1 9  ? -5.124  40.395  25.055 1.00 37.08 ? 9   DA  D N3    1 
ATOM   711  C C4    . DA  C 1 9  ? -4.193  40.864  25.905 1.00 38.65 ? 9   DA  D C4    1 
ATOM   712  P P     . DG  C 1 10 ? -8.839  41.967  29.847 1.00 50.98 ? 10  DG  D P     1 
ATOM   713  O OP1   . DG  C 1 10 ? -10.146 42.524  30.283 1.00 51.57 ? 10  DG  D OP1   1 
ATOM   714  O OP2   . DG  C 1 10 ? -7.799  41.647  30.863 1.00 50.95 ? 10  DG  D OP2   1 
ATOM   715  O "O5'" . DG  C 1 10 ? -9.118  40.648  29.009 1.00 49.62 ? 10  DG  D "O5'" 1 
ATOM   716  C "C5'" . DG  C 1 10 ? -9.753  40.724  27.739 1.00 47.09 ? 10  DG  D "C5'" 1 
ATOM   717  C "C4'" . DG  C 1 10 ? -9.731  39.369  27.079 1.00 45.08 ? 10  DG  D "C4'" 1 
ATOM   718  O "O4'" . DG  C 1 10 ? -8.392  39.075  26.607 1.00 43.24 ? 10  DG  D "O4'" 1 
ATOM   719  C "C3'" . DG  C 1 10 ? -10.104 38.242  28.039 1.00 44.68 ? 10  DG  D "C3'" 1 
ATOM   720  O "O3'" . DG  C 1 10 ? -10.934 37.289  27.378 1.00 45.34 ? 10  DG  D "O3'" 1 
ATOM   721  C "C2'" . DG  C 1 10 ? -8.763  37.634  28.409 1.00 43.41 ? 10  DG  D "C2'" 1 
ATOM   722  C "C1'" . DG  C 1 10 ? -7.958  37.834  27.138 1.00 41.45 ? 10  DG  D "C1'" 1 
ATOM   723  N N9    . DG  C 1 10 ? -6.514  37.910  27.341 1.00 38.66 ? 10  DG  D N9    1 
ATOM   724  C C8    . DG  C 1 10 ? -5.837  38.788  28.154 1.00 37.96 ? 10  DG  D C8    1 
ATOM   725  N N7    . DG  C 1 10 ? -4.544  38.608  28.139 1.00 36.63 ? 10  DG  D N7    1 
ATOM   726  C C5    . DG  C 1 10 ? -4.355  37.546  27.265 1.00 35.42 ? 10  DG  D C5    1 
ATOM   727  C C6    . DG  C 1 10 ? -3.161  36.901  26.847 1.00 34.50 ? 10  DG  D C6    1 
ATOM   728  O O6    . DG  C 1 10 ? -1.994  37.146  27.179 1.00 33.47 ? 10  DG  D O6    1 
ATOM   729  N N1    . DG  C 1 10 ? -3.424  35.875  25.945 1.00 34.20 ? 10  DG  D N1    1 
ATOM   730  C C2    . DG  C 1 10 ? -4.671  35.516  25.499 1.00 34.56 ? 10  DG  D C2    1 
ATOM   731  N N2    . DG  C 1 10 ? -4.717  34.504  24.623 1.00 33.03 ? 10  DG  D N2    1 
ATOM   732  N N3    . DG  C 1 10 ? -5.791  36.110  25.882 1.00 35.31 ? 10  DG  D N3    1 
ATOM   733  C C4    . DG  C 1 10 ? -5.560  37.108  26.759 1.00 36.18 ? 10  DG  D C4    1 
ATOM   734  P P     . DT  C 1 11 ? -11.521 36.045  28.202 1.00 47.07 ? 11  DT  D P     1 
ATOM   735  O OP1   . DT  C 1 11 ? -12.964 35.904  27.879 1.00 47.44 ? 11  DT  D OP1   1 
ATOM   736  O OP2   . DT  C 1 11 ? -11.092 36.175  29.617 1.00 47.24 ? 11  DT  D OP2   1 
ATOM   737  O "O5'" . DT  C 1 11 ? -10.759 34.801  27.569 1.00 45.94 ? 11  DT  D "O5'" 1 
ATOM   738  C "C5'" . DT  C 1 11 ? -10.811 34.568  26.167 1.00 44.09 ? 11  DT  D "C5'" 1 
ATOM   739  C "C4'" . DT  C 1 11 ? -10.130 33.266  25.831 1.00 42.73 ? 11  DT  D "C4'" 1 
ATOM   740  O "O4'" . DT  C 1 11 ? -8.696  33.404  25.964 1.00 40.78 ? 11  DT  D "O4'" 1 
ATOM   741  C "C3'" . DT  C 1 11 ? -10.534 32.102  26.730 1.00 43.07 ? 11  DT  D "C3'" 1 
ATOM   742  O "O3'" . DT  C 1 11 ? -10.713 30.934  25.936 1.00 45.45 ? 11  DT  D "O3'" 1 
ATOM   743  C "C2'" . DT  C 1 11 ? -9.354  31.949  27.678 1.00 41.40 ? 11  DT  D "C2'" 1 
ATOM   744  C "C1'" . DT  C 1 11 ? -8.185  32.392  26.816 1.00 39.34 ? 11  DT  D "C1'" 1 
ATOM   745  N N1    . DT  C 1 11 ? -7.025  32.962  27.532 1.00 36.73 ? 11  DT  D N1    1 
ATOM   746  C C2    . DT  C 1 11 ? -5.779  32.457  27.236 1.00 34.91 ? 11  DT  D C2    1 
ATOM   747  O O2    . DT  C 1 11 ? -5.604  31.523  26.471 1.00 33.60 ? 11  DT  D O2    1 
ATOM   748  N N3    . DT  C 1 11 ? -4.739  33.087  27.871 1.00 33.40 ? 11  DT  D N3    1 
ATOM   749  C C4    . DT  C 1 11 ? -4.820  34.139  28.765 1.00 34.36 ? 11  DT  D C4    1 
ATOM   750  O O4    . DT  C 1 11 ? -3.792  34.631  29.230 1.00 33.28 ? 11  DT  D O4    1 
ATOM   751  C C5    . DT  C 1 11 ? -6.160  34.587  29.069 1.00 34.42 ? 11  DT  D C5    1 
ATOM   752  C C7    . DT  C 1 11 ? -6.345  35.690  30.063 1.00 33.71 ? 11  DT  D C7    1 
ATOM   753  C C6    . DT  C 1 11 ? -7.183  33.985  28.444 1.00 35.63 ? 11  DT  D C6    1 
ATOM   754  P P     . DG  C 1 12 ? -11.684 29.771  26.456 1.00 47.33 ? 12  DG  D P     1 
ATOM   755  O OP1   . DG  C 1 12 ? -12.508 29.321  25.307 1.00 47.53 ? 12  DG  D OP1   1 
ATOM   756  O OP2   . DG  C 1 12 ? -12.345 30.246  27.701 1.00 47.69 ? 12  DG  D OP2   1 
ATOM   757  O "O5'" . DG  C 1 12 ? -10.680 28.595  26.819 1.00 46.37 ? 12  DG  D "O5'" 1 
ATOM   758  C "C5'" . DG  C 1 12 ? -9.891  27.993  25.801 1.00 45.18 ? 12  DG  D "C5'" 1 
ATOM   759  C "C4'" . DG  C 1 12 ? -8.790  27.166  26.417 1.00 44.84 ? 12  DG  D "C4'" 1 
ATOM   760  O "O4'" . DG  C 1 12 ? -7.750  28.016  26.961 1.00 43.31 ? 12  DG  D "O4'" 1 
ATOM   761  C "C3'" . DG  C 1 12 ? -9.243  26.258  27.559 1.00 45.35 ? 12  DG  D "C3'" 1 
ATOM   762  O "O3'" . DG  C 1 12 ? -8.604  24.994  27.410 1.00 48.38 ? 12  DG  D "O3'" 1 
ATOM   763  C "C2'" . DG  C 1 12 ? -8.735  26.972  28.803 1.00 43.37 ? 12  DG  D "C2'" 1 
ATOM   764  C "C1'" . DG  C 1 12 ? -7.459  27.617  28.290 1.00 41.74 ? 12  DG  D "C1'" 1 
ATOM   765  N N9    . DG  C 1 12 ? -6.994  28.792  29.023 1.00 39.00 ? 12  DG  D N9    1 
ATOM   766  C C8    . DG  C 1 12 ? -7.762  29.756  29.633 1.00 37.79 ? 12  DG  D C8    1 
ATOM   767  N N7    . DG  C 1 12 ? -7.051  30.689  30.206 1.00 36.71 ? 12  DG  D N7    1 
ATOM   768  C C5    . DG  C 1 12 ? -5.735  30.322  29.961 1.00 35.89 ? 12  DG  D C5    1 
ATOM   769  C C6    . DG  C 1 12 ? -4.514  30.953  30.337 1.00 34.94 ? 12  DG  D C6    1 
ATOM   770  O O6    . DG  C 1 12 ? -4.351  31.997  30.983 1.00 34.08 ? 12  DG  D O6    1 
ATOM   771  N N1    . DG  C 1 12 ? -3.410  30.242  29.884 1.00 33.76 ? 12  DG  D N1    1 
ATOM   772  C C2    . DG  C 1 12 ? -3.465  29.074  29.161 1.00 35.73 ? 12  DG  D C2    1 
ATOM   773  N N2    . DG  C 1 12 ? -2.285  28.534  28.818 1.00 33.66 ? 12  DG  D N2    1 
ATOM   774  N N3    . DG  C 1 12 ? -4.595  28.477  28.802 1.00 36.33 ? 12  DG  D N3    1 
ATOM   775  C C4    . DG  C 1 12 ? -5.681  29.153  29.234 1.00 36.79 ? 12  DG  D C4    1 
ATOM   776  P P     . DT  C 1 13 ? -9.090  23.744  28.284 1.00 49.55 ? 13  DT  D P     1 
ATOM   777  O OP1   . DT  C 1 13 ? -9.557  22.717  27.321 1.00 51.25 ? 13  DT  D OP1   1 
ATOM   778  O OP2   . DT  C 1 13 ? -9.999  24.210  29.362 1.00 50.49 ? 13  DT  D OP2   1 
ATOM   779  O "O5'" . DT  C 1 13 ? -7.733  23.235  28.943 1.00 49.35 ? 13  DT  D "O5'" 1 
ATOM   780  C "C5'" . DT  C 1 13 ? -6.584  23.019  28.131 1.00 48.01 ? 13  DT  D "C5'" 1 
ATOM   781  C "C4'" . DT  C 1 13 ? -5.331  23.010  28.977 1.00 47.20 ? 13  DT  D "C4'" 1 
ATOM   782  O "O4'" . DT  C 1 13 ? -4.989  24.351  29.414 1.00 45.69 ? 13  DT  D "O4'" 1 
ATOM   783  C "C3'" . DT  C 1 13 ? -5.411  22.154  30.243 1.00 46.67 ? 13  DT  D "C3'" 1 
ATOM   784  O "O3'" . DT  C 1 13 ? -4.148  21.518  30.459 1.00 48.46 ? 13  DT  D "O3'" 1 
ATOM   785  C "C2'" . DT  C 1 13 ? -5.583  23.187  31.343 1.00 45.32 ? 13  DT  D "C2'" 1 
ATOM   786  C "C1'" . DT  C 1 13 ? -4.729  24.320  30.805 1.00 43.48 ? 13  DT  D "C1'" 1 
ATOM   787  N N1    . DT  C 1 13 ? -5.002  25.659  31.370 1.00 40.19 ? 13  DT  D N1    1 
ATOM   788  C C2    . DT  C 1 13 ? -3.923  26.486  31.596 1.00 38.60 ? 13  DT  D C2    1 
ATOM   789  O O2    . DT  C 1 13 ? -2.780  26.181  31.301 1.00 36.81 ? 13  DT  D O2    1 
ATOM   790  N N3    . DT  C 1 13 ? -4.235  27.690  32.179 1.00 36.83 ? 13  DT  D N3    1 
ATOM   791  C C4    . DT  C 1 13 ? -5.490  28.143  32.534 1.00 36.37 ? 13  DT  D C4    1 
ATOM   792  O O4    . DT  C 1 13 ? -5.614  29.243  33.064 1.00 35.45 ? 13  DT  D O4    1 
ATOM   793  C C5    . DT  C 1 13 ? -6.579  27.237  32.237 1.00 36.54 ? 13  DT  D C5    1 
ATOM   794  C C7    . DT  C 1 13 ? -7.979  27.654  32.559 1.00 36.19 ? 13  DT  D C7    1 
ATOM   795  C C6    . DT  C 1 13 ? -6.284  26.056  31.680 1.00 38.26 ? 13  DT  D C6    1 
ATOM   796  O "O5'" . DA  D 2 1  ? 3.058   30.243  38.730 1.00 41.58 ? 1   DA  E "O5'" 1 
ATOM   797  C "C5'" . DA  D 2 1  ? 3.852   30.911  37.743 1.00 39.09 ? 1   DA  E "C5'" 1 
ATOM   798  C "C4'" . DA  D 2 1  ? 4.243   29.990  36.611 1.00 37.32 ? 1   DA  E "C4'" 1 
ATOM   799  O "O4'" . DA  D 2 1  ? 3.049   29.450  36.000 1.00 36.50 ? 1   DA  E "O4'" 1 
ATOM   800  C "C3'" . DA  D 2 1  ? 5.010   30.678  35.486 1.00 37.34 ? 1   DA  E "C3'" 1 
ATOM   801  O "O3'" . DA  D 2 1  ? 5.972   29.780  34.928 1.00 39.16 ? 1   DA  E "O3'" 1 
ATOM   802  C "C2'" . DA  D 2 1  ? 3.926   31.045  34.489 1.00 35.58 ? 1   DA  E "C2'" 1 
ATOM   803  C "C1'" . DA  D 2 1  ? 2.872   29.965  34.684 1.00 33.90 ? 1   DA  E "C1'" 1 
ATOM   804  N N9    . DA  D 2 1  ? 1.502   30.473  34.602 1.00 32.14 ? 1   DA  E N9    1 
ATOM   805  C C8    . DA  D 2 1  ? 1.013   31.621  35.178 1.00 30.37 ? 1   DA  E C8    1 
ATOM   806  N N7    . DA  D 2 1  ? -0.264  31.819  34.959 1.00 30.04 ? 1   DA  E N7    1 
ATOM   807  C C5    . DA  D 2 1  ? -0.643  30.730  34.184 1.00 28.36 ? 1   DA  E C5    1 
ATOM   808  C C6    . DA  D 2 1  ? -1.878  30.351  33.628 1.00 26.96 ? 1   DA  E C6    1 
ATOM   809  N N6    . DA  D 2 1  ? -3.005  31.049  33.780 1.00 24.54 ? 1   DA  E N6    1 
ATOM   810  N N1    . DA  D 2 1  ? -1.917  29.213  32.906 1.00 27.16 ? 1   DA  E N1    1 
ATOM   811  C C2    . DA  D 2 1  ? -0.789  28.507  32.761 1.00 28.50 ? 1   DA  E C2    1 
ATOM   812  N N3    . DA  D 2 1  ? 0.431   28.757  33.239 1.00 29.88 ? 1   DA  E N3    1 
ATOM   813  C C4    . DA  D 2 1  ? 0.436   29.897  33.949 1.00 29.75 ? 1   DA  E C4    1 
ATOM   814  P P     . DC  D 2 2  ? 6.810   30.220  33.631 1.00 40.14 ? 2   DC  E P     1 
ATOM   815  O OP1   . DC  D 2 2  ? 7.961   29.290  33.515 1.00 40.45 ? 2   DC  E OP1   1 
ATOM   816  O OP2   . DC  D 2 2  ? 7.051   31.687  33.666 1.00 40.52 ? 2   DC  E OP2   1 
ATOM   817  O "O5'" . DC  D 2 2  ? 5.804   29.880  32.452 1.00 38.71 ? 2   DC  E "O5'" 1 
ATOM   818  C "C5'" . DC  D 2 2  ? 5.250   28.575  32.367 1.00 37.70 ? 2   DC  E "C5'" 1 
ATOM   819  C "C4'" . DC  D 2 2  ? 4.485   28.402  31.080 1.00 35.56 ? 2   DC  E "C4'" 1 
ATOM   820  O "O4'" . DC  D 2 2  ? 3.134   28.903  31.197 1.00 34.19 ? 2   DC  E "O4'" 1 
ATOM   821  C "C3'" . DC  D 2 2  ? 5.091   29.070  29.845 1.00 35.26 ? 2   DC  E "C3'" 1 
ATOM   822  O "O3'" . DC  D 2 2  ? 5.049   28.116  28.788 1.00 35.58 ? 2   DC  E "O3'" 1 
ATOM   823  C "C2'" . DC  D 2 2  ? 4.143   30.233  29.572 1.00 33.69 ? 2   DC  E "C2'" 1 
ATOM   824  C "C1'" . DC  D 2 2  ? 2.816   29.658  30.045 1.00 32.35 ? 2   DC  E "C1'" 1 
ATOM   825  N N1    . DC  D 2 2  ? 1.740   30.597  30.412 1.00 29.93 ? 2   DC  E N1    1 
ATOM   826  C C2    . DC  D 2 2  ? 0.423   30.255  30.079 1.00 28.28 ? 2   DC  E C2    1 
ATOM   827  O O2    . DC  D 2 2  ? 0.218   29.206  29.452 1.00 29.24 ? 2   DC  E O2    1 
ATOM   828  N N3    . DC  D 2 2  ? -0.588  31.067  30.444 1.00 26.24 ? 2   DC  E N3    1 
ATOM   829  C C4    . DC  D 2 2  ? -0.333  32.188  31.112 1.00 26.14 ? 2   DC  E C4    1 
ATOM   830  N N4    . DC  D 2 2  ? -1.372  32.946  31.465 1.00 24.27 ? 2   DC  E N4    1 
ATOM   831  C C5    . DC  D 2 2  ? 1.001   32.579  31.451 1.00 27.44 ? 2   DC  E C5    1 
ATOM   832  C C6    . DC  D 2 2  ? 2.000   31.760  31.080 1.00 28.72 ? 2   DC  E C6    1 
ATOM   833  P P     . DA  D 2 3  ? 6.042   28.252  27.540 1.00 34.97 ? 3   DA  E P     1 
ATOM   834  O OP1   . DA  D 2 3  ? 6.867   27.017  27.479 1.00 35.22 ? 3   DA  E OP1   1 
ATOM   835  O OP2   . DA  D 2 3  ? 6.700   29.582  27.567 1.00 34.46 ? 3   DA  E OP2   1 
ATOM   836  O "O5'" . DA  D 2 3  ? 5.033   28.227  26.309 1.00 31.66 ? 3   DA  E "O5'" 1 
ATOM   837  C "C5'" . DA  D 2 3  ? 4.039   27.214  26.216 1.00 26.67 ? 3   DA  E "C5'" 1 
ATOM   838  C "C4'" . DA  D 2 3  ? 2.925   27.662  25.301 1.00 23.79 ? 3   DA  E "C4'" 1 
ATOM   839  O "O4'" . DA  D 2 3  ? 2.047   28.590  25.981 1.00 23.51 ? 3   DA  E "O4'" 1 
ATOM   840  C "C3'" . DA  D 2 3  ? 3.392   28.372  24.029 1.00 20.60 ? 3   DA  E "C3'" 1 
ATOM   841  O "O3'" . DA  D 2 3  ? 2.583   27.943  22.936 1.00 18.62 ? 3   DA  E "O3'" 1 
ATOM   842  C "C2'" . DA  D 2 3  ? 3.112   29.834  24.327 1.00 21.81 ? 3   DA  E "C2'" 1 
ATOM   843  C "C1'" . DA  D 2 3  ? 1.847   29.716  25.152 1.00 22.74 ? 3   DA  E "C1'" 1 
ATOM   844  N N9    . DA  D 2 3  ? 1.503   30.859  25.998 1.00 23.24 ? 3   DA  E N9    1 
ATOM   845  C C8    . DA  D 2 3  ? 2.326   31.800  26.568 1.00 23.51 ? 3   DA  E C8    1 
ATOM   846  N N7    . DA  D 2 3  ? 1.680   32.723  27.246 1.00 22.90 ? 3   DA  E N7    1 
ATOM   847  C C5    . DA  D 2 3  ? 0.346   32.361  27.116 1.00 23.06 ? 3   DA  E C5    1 
ATOM   848  C C6    . DA  D 2 3  ? -0.846  32.937  27.600 1.00 23.61 ? 3   DA  E C6    1 
ATOM   849  N N6    . DA  D 2 3  ? -0.888  34.058  28.323 1.00 23.14 ? 3   DA  E N6    1 
ATOM   850  N N1    . DA  D 2 3  ? -2.009  32.317  27.306 1.00 24.45 ? 3   DA  E N1    1 
ATOM   851  C C2    . DA  D 2 3  ? -1.968  31.202  26.564 1.00 24.05 ? 3   DA  E C2    1 
ATOM   852  N N3    . DA  D 2 3  ? -0.917  30.573  26.044 1.00 23.03 ? 3   DA  E N3    1 
ATOM   853  C C4    . DA  D 2 3  ? 0.223   31.210  26.362 1.00 22.52 ? 3   DA  E C4    1 
ATOM   854  P P     . DC  D 2 4  ? 3.122   28.100  21.434 1.00 18.45 ? 4   DC  E P     1 
ATOM   855  O OP1   . DC  D 2 4  ? 2.151   27.406  20.540 1.00 18.11 ? 4   DC  E OP1   1 
ATOM   856  O OP2   . DC  D 2 4  ? 4.542   27.687  21.420 1.00 18.27 ? 4   DC  E OP2   1 
ATOM   857  O "O5'" . DC  D 2 4  ? 3.076   29.676  21.196 1.00 16.61 ? 4   DC  E "O5'" 1 
ATOM   858  C "C5'" . DC  D 2 4  ? 2.073   30.289  20.390 1.00 18.14 ? 4   DC  E "C5'" 1 
ATOM   859  C "C4'" . DC  D 2 4  ? 0.730   30.246  21.085 1.00 19.25 ? 4   DC  E "C4'" 1 
ATOM   860  O "O4'" . DC  D 2 4  ? 0.771   30.943  22.361 1.00 20.97 ? 4   DC  E "O4'" 1 
ATOM   861  C "C3'" . DC  D 2 4  ? -0.399  30.896  20.281 1.00 18.98 ? 4   DC  E "C3'" 1 
ATOM   862  O "O3'" . DC  D 2 4  ? -1.512  30.012  20.152 1.00 18.91 ? 4   DC  E "O3'" 1 
ATOM   863  C "C2'" . DC  D 2 4  ? -0.792  32.115  21.098 1.00 20.71 ? 4   DC  E "C2'" 1 
ATOM   864  C "C1'" . DC  D 2 4  ? -0.414  31.717  22.509 1.00 20.37 ? 4   DC  E "C1'" 1 
ATOM   865  N N1    . DC  D 2 4  ? -0.119  32.880  23.371 1.00 21.34 ? 4   DC  E N1    1 
ATOM   866  C C2    . DC  D 2 4  ? -1.174  33.481  24.070 1.00 21.36 ? 4   DC  E C2    1 
ATOM   867  O O2    . DC  D 2 4  ? -2.306  32.992  23.981 1.00 21.74 ? 4   DC  E O2    1 
ATOM   868  N N3    . DC  D 2 4  ? -0.934  34.578  24.826 1.00 20.78 ? 4   DC  E N3    1 
ATOM   869  C C4    . DC  D 2 4  ? 0.303   35.070  24.914 1.00 22.08 ? 4   DC  E C4    1 
ATOM   870  N N4    . DC  D 2 4  ? 0.490   36.153  25.679 1.00 21.19 ? 4   DC  E N4    1 
ATOM   871  C C5    . DC  D 2 4  ? 1.401   34.473  24.227 1.00 22.17 ? 4   DC  E C5    1 
ATOM   872  C C6    . DC  D 2 4  ? 1.148   33.385  23.475 1.00 22.23 ? 4   DC  E C6    1 
ATOM   873  P P     . DT  D 2 5  ? -2.491  30.154  18.880 1.00 17.01 ? 5   DT  E P     1 
ATOM   874  O OP1   . DT  D 2 5  ? -3.170  28.848  18.690 1.00 17.42 ? 5   DT  E OP1   1 
ATOM   875  O OP2   . DT  D 2 5  ? -1.718  30.746  17.761 1.00 17.01 ? 5   DT  E OP2   1 
ATOM   876  O "O5'" . DT  D 2 5  ? -3.568  31.217  19.370 1.00 18.21 ? 5   DT  E "O5'" 1 
ATOM   877  C "C5'" . DT  D 2 5  ? -4.452  30.889  20.437 1.00 19.79 ? 5   DT  E "C5'" 1 
ATOM   878  C "C4'" . DT  D 2 5  ? -5.406  32.028  20.709 1.00 20.96 ? 5   DT  E "C4'" 1 
ATOM   879  O "O4'" . DT  D 2 5  ? -4.737  33.083  21.430 1.00 22.05 ? 5   DT  E "O4'" 1 
ATOM   880  C "C3'" . DT  D 2 5  ? -6.048  32.679  19.483 1.00 22.00 ? 5   DT  E "C3'" 1 
ATOM   881  O "O3'" . DT  D 2 5  ? -7.434  32.866  19.765 1.00 22.95 ? 5   DT  E "O3'" 1 
ATOM   882  C "C2'" . DT  D 2 5  ? -5.313  34.010  19.359 1.00 21.63 ? 5   DT  E "C2'" 1 
ATOM   883  C "C1'" . DT  D 2 5  ? -4.993  34.332  20.809 1.00 22.65 ? 5   DT  E "C1'" 1 
ATOM   884  N N1    . DT  D 2 5  ? -3.837  35.213  21.096 1.00 21.61 ? 5   DT  E N1    1 
ATOM   885  C C2    . DT  D 2 5  ? -4.052  36.287  21.935 1.00 21.98 ? 5   DT  E C2    1 
ATOM   886  O O2    . DT  D 2 5  ? -5.162  36.619  22.321 1.00 22.27 ? 5   DT  E O2    1 
ATOM   887  N N3    . DT  D 2 5  ? -2.916  36.968  22.296 1.00 20.12 ? 5   DT  E N3    1 
ATOM   888  C C4    . DT  D 2 5  ? -1.623  36.710  21.885 1.00 20.88 ? 5   DT  E C4    1 
ATOM   889  O O4    . DT  D 2 5  ? -0.688  37.361  22.346 1.00 20.00 ? 5   DT  E O4    1 
ATOM   890  C C5    . DT  D 2 5  ? -1.484  35.638  20.929 1.00 20.40 ? 5   DT  E C5    1 
ATOM   891  C C7    . DT  D 2 5  ? -0.130  35.363  20.354 1.00 18.89 ? 5   DT  E C7    1 
ATOM   892  C C6    . DT  D 2 5  ? -2.582  34.944  20.592 1.00 20.82 ? 5   DT  E C6    1 
ATOM   893  P P     . DT  D 2 6  ? -8.450  33.272  18.592 1.00 23.37 ? 6   DT  E P     1 
ATOM   894  O OP1   . DT  D 2 6  ? -9.772  32.698  18.959 1.00 25.07 ? 6   DT  E OP1   1 
ATOM   895  O OP2   . DT  D 2 6  ? -7.857  32.960  17.269 1.00 24.09 ? 6   DT  E OP2   1 
ATOM   896  O "O5'" . DT  D 2 6  ? -8.543  34.853  18.743 1.00 24.49 ? 6   DT  E "O5'" 1 
ATOM   897  C "C5'" . DT  D 2 6  ? -9.020  35.412  19.963 1.00 26.07 ? 6   DT  E "C5'" 1 
ATOM   898  C "C4'" . DT  D 2 6  ? -8.944  36.919  19.934 1.00 27.04 ? 6   DT  E "C4'" 1 
ATOM   899  O "O4'" . DT  D 2 6  ? -7.639  37.400  20.335 1.00 26.05 ? 6   DT  E "O4'" 1 
ATOM   900  C "C3'" . DT  D 2 6  ? -9.277  37.597  18.604 1.00 28.34 ? 6   DT  E "C3'" 1 
ATOM   901  O "O3'" . DT  D 2 6  ? -10.276 38.588  18.836 1.00 31.85 ? 6   DT  E "O3'" 1 
ATOM   902  C "C2'" . DT  D 2 6  ? -7.960  38.241  18.190 1.00 26.87 ? 6   DT  E "C2'" 1 
ATOM   903  C "C1'" . DT  D 2 6  ? -7.288  38.510  19.529 1.00 25.99 ? 6   DT  E "C1'" 1 
ATOM   904  N N1    . DT  D 2 6  ? -5.809  38.610  19.518 1.00 24.63 ? 6   DT  E N1    1 
ATOM   905  C C2    . DT  D 2 6  ? -5.215  39.558  20.326 1.00 24.59 ? 6   DT  E C2    1 
ATOM   906  O O2    . DT  D 2 6  ? -5.850  40.329  21.026 1.00 26.30 ? 6   DT  E O2    1 
ATOM   907  N N3    . DT  D 2 6  ? -3.838  39.565  20.290 1.00 23.57 ? 6   DT  E N3    1 
ATOM   908  C C4    . DT  D 2 6  ? -3.019  38.730  19.552 1.00 22.74 ? 6   DT  E C4    1 
ATOM   909  O O4    . DT  D 2 6  ? -1.793  38.825  19.651 1.00 21.47 ? 6   DT  E O4    1 
ATOM   910  C C5    . DT  D 2 6  ? -3.712  37.775  18.710 1.00 22.36 ? 6   DT  E C5    1 
ATOM   911  C C7    . DT  D 2 6  ? -2.912  36.839  17.859 1.00 20.79 ? 6   DT  E C7    1 
ATOM   912  C C6    . DT  D 2 6  ? -5.052  37.768  18.733 1.00 22.84 ? 6   DT  E C6    1 
ATOM   913  P P     . DC  D 2 7  ? -11.107 39.200  17.607 1.00 34.19 ? 7   DC  E P     1 
ATOM   914  O OP1   . DC  D 2 7  ? -12.552 39.130  17.945 1.00 35.07 ? 7   DC  E OP1   1 
ATOM   915  O OP2   . DC  D 2 7  ? -10.612 38.622  16.330 1.00 33.72 ? 7   DC  E OP2   1 
ATOM   916  O "O5'" . DC  D 2 7  ? -10.652 40.716  17.639 1.00 35.59 ? 7   DC  E "O5'" 1 
ATOM   917  C "C5'" . DC  D 2 7  ? -9.386  41.034  18.179 1.00 36.72 ? 7   DC  E "C5'" 1 
ATOM   918  C "C4'" . DC  D 2 7  ? -9.333  42.481  18.585 1.00 36.21 ? 7   DC  E "C4'" 1 
ATOM   919  O "O4'" . DC  D 2 7  ? -8.006  42.695  19.111 1.00 35.17 ? 7   DC  E "O4'" 1 
ATOM   920  C "C3'" . DC  D 2 7  ? -9.482  43.426  17.398 1.00 37.53 ? 7   DC  E "C3'" 1 
ATOM   921  O "O3'" . DC  D 2 7  ? -10.148 44.627  17.787 1.00 40.34 ? 7   DC  E "O3'" 1 
ATOM   922  C "C2'" . DC  D 2 7  ? -8.053  43.670  16.953 1.00 35.34 ? 7   DC  E "C2'" 1 
ATOM   923  C "C1'" . DC  D 2 7  ? -7.231  43.486  18.224 1.00 34.51 ? 7   DC  E "C1'" 1 
ATOM   924  N N1    . DC  D 2 7  ? -5.953  42.787  17.996 1.00 31.58 ? 7   DC  E N1    1 
ATOM   925  C C2    . DC  D 2 7  ? -4.802  43.280  18.606 1.00 31.34 ? 7   DC  E C2    1 
ATOM   926  O O2    . DC  D 2 7  ? -4.902  44.248  19.377 1.00 30.86 ? 7   DC  E O2    1 
ATOM   927  N N3    . DC  D 2 7  ? -3.609  42.692  18.348 1.00 30.36 ? 7   DC  E N3    1 
ATOM   928  C C4    . DC  D 2 7  ? -3.547  41.641  17.526 1.00 30.96 ? 7   DC  E C4    1 
ATOM   929  N N4    . DC  D 2 7  ? -2.343  41.112  17.275 1.00 30.12 ? 7   DC  E N4    1 
ATOM   930  C C5    . DC  D 2 7  ? -4.715  41.091  16.918 1.00 30.17 ? 7   DC  E C5    1 
ATOM   931  C C6    . DC  D 2 7  ? -5.886  41.689  17.180 1.00 31.79 ? 7   DC  E C6    1 
ATOM   932  P P     . DC  D 2 8  ? -10.486 45.738  16.680 1.00 43.51 ? 8   DC  E P     1 
ATOM   933  O OP1   . DC  D 2 8  ? -11.460 46.689  17.277 1.00 43.41 ? 8   DC  E OP1   1 
ATOM   934  O OP2   . DC  D 2 8  ? -10.807 45.055  15.401 1.00 42.14 ? 8   DC  E OP2   1 
ATOM   935  O "O5'" . DC  D 2 8  ? -9.096  46.484  16.497 1.00 43.66 ? 8   DC  E "O5'" 1 
ATOM   936  C "C5'" . DC  D 2 8  ? -8.378  46.938  17.636 1.00 45.52 ? 8   DC  E "C5'" 1 
ATOM   937  C "C4'" . DC  D 2 8  ? -7.054  47.517  17.208 1.00 46.37 ? 8   DC  E "C4'" 1 
ATOM   938  O "O4'" . DC  D 2 8  ? -6.028  46.496  17.112 1.00 45.60 ? 8   DC  E "O4'" 1 
ATOM   939  C "C3'" . DC  D 2 8  ? -7.120  48.196  15.841 1.00 46.75 ? 8   DC  E "C3'" 1 
ATOM   940  O "O3'" . DC  D 2 8  ? -6.460  49.451  15.903 1.00 48.71 ? 8   DC  E "O3'" 1 
ATOM   941  C "C2'" . DC  D 2 8  ? -6.346  47.251  14.939 1.00 46.50 ? 8   DC  E "C2'" 1 
ATOM   942  C "C1'" . DC  D 2 8  ? -5.317  46.705  15.910 1.00 45.56 ? 8   DC  E "C1'" 1 
ATOM   943  N N1    . DC  D 2 8  ? -4.670  45.444  15.515 1.00 43.81 ? 8   DC  E N1    1 
ATOM   944  C C2    . DC  D 2 8  ? -3.366  45.208  15.941 1.00 43.34 ? 8   DC  E C2    1 
ATOM   945  O O2    . DC  D 2 8  ? -2.829  46.028  16.702 1.00 42.57 ? 8   DC  E O2    1 
ATOM   946  N N3    . DC  D 2 8  ? -2.722  44.096  15.520 1.00 43.03 ? 8   DC  E N3    1 
ATOM   947  C C4    . DC  D 2 8  ? -3.342  43.231  14.717 1.00 43.51 ? 8   DC  E C4    1 
ATOM   948  N N4    . DC  D 2 8  ? -2.659  42.161  14.303 1.00 44.26 ? 8   DC  E N4    1 
ATOM   949  C C5    . DC  D 2 8  ? -4.691  43.427  14.299 1.00 43.87 ? 8   DC  E C5    1 
ATOM   950  C C6    . DC  D 2 8  ? -5.312  44.534  14.720 1.00 44.03 ? 8   DC  E C6    1 
ATOM   951  P P     . DG  D 2 9  ? -7.276  50.790  15.567 1.00 48.91 ? 9   DG  E P     1 
ATOM   952  O OP1   . DG  D 2 9  ? -8.315  50.979  16.614 1.00 48.93 ? 9   DG  E OP1   1 
ATOM   953  O OP2   . DG  D 2 9  ? -7.676  50.717  14.136 1.00 48.47 ? 9   DG  E OP2   1 
ATOM   954  O "O5'" . DG  D 2 9  ? -6.178  51.923  15.743 1.00 47.40 ? 9   DG  E "O5'" 1 
ATOM   955  C "C5'" . DG  D 2 9  ? -5.484  52.071  16.977 1.00 46.72 ? 9   DG  E "C5'" 1 
ATOM   956  C "C4'" . DG  D 2 9  ? -4.015  52.306  16.719 1.00 45.77 ? 9   DG  E "C4'" 1 
ATOM   957  O "O4'" . DG  D 2 9  ? -3.358  51.057  16.381 1.00 44.49 ? 9   DG  E "O4'" 1 
ATOM   958  C "C3'" . DG  D 2 9  ? -3.744  53.261  15.556 1.00 46.20 ? 9   DG  E "C3'" 1 
ATOM   959  O "O3'" . DG  D 2 9  ? -2.680  54.159  15.883 1.00 48.18 ? 9   DG  E "O3'" 1 
ATOM   960  C "C2'" . DG  D 2 9  ? -3.342  52.335  14.421 1.00 44.14 ? 9   DG  E "C2'" 1 
ATOM   961  C "C1'" . DG  D 2 9  ? -2.649  51.204  15.160 1.00 42.20 ? 9   DG  E "C1'" 1 
ATOM   962  N N9    . DG  D 2 9  ? -2.676  49.922  14.461 1.00 39.13 ? 9   DG  E N9    1 
ATOM   963  C C8    . DG  D 2 9  ? -3.701  49.412  13.701 1.00 37.67 ? 9   DG  E C8    1 
ATOM   964  N N7    . DG  D 2 9  ? -3.423  48.248  13.179 1.00 37.30 ? 9   DG  E N7    1 
ATOM   965  C C5    . DG  D 2 9  ? -2.137  47.968  13.627 1.00 35.50 ? 9   DG  E C5    1 
ATOM   966  C C6    . DG  D 2 9  ? -1.303  46.842  13.385 1.00 33.75 ? 9   DG  E C6    1 
ATOM   967  O O6    . DG  D 2 9  ? -1.539  45.838  12.699 1.00 31.34 ? 9   DG  E O6    1 
ATOM   968  N N1    . DG  D 2 9  ? -0.082  46.964  14.037 1.00 31.82 ? 9   DG  E N1    1 
ATOM   969  C C2    . DG  D 2 9  ? 0.295   48.029  14.817 1.00 33.26 ? 9   DG  E C2    1 
ATOM   970  N N2    . DG  D 2 9  ? 1.519   47.956  15.366 1.00 29.81 ? 9   DG  E N2    1 
ATOM   971  N N3    . DG  D 2 9  ? -0.469  49.087  15.043 1.00 34.06 ? 9   DG  E N3    1 
ATOM   972  C C4    . DG  D 2 9  ? -1.664  48.989  14.423 1.00 36.13 ? 9   DG  E C4    1 
ATOM   973  P P     . DG  D 2 10 ? -2.187  55.238  14.798 1.00 49.66 ? 10  DG  E P     1 
ATOM   974  O OP1   . DG  D 2 10 ? -1.914  56.512  15.512 1.00 49.19 ? 10  DG  E OP1   1 
ATOM   975  O OP2   . DG  D 2 10 ? -3.126  55.224  13.643 1.00 48.93 ? 10  DG  E OP2   1 
ATOM   976  O "O5'" . DG  D 2 10 ? -0.803  54.634  14.304 1.00 48.71 ? 10  DG  E "O5'" 1 
ATOM   977  C "C5'" . DG  D 2 10 ? 0.200   54.280  15.245 1.00 47.35 ? 10  DG  E "C5'" 1 
ATOM   978  C "C4'" . DG  D 2 10 ? 1.394   53.697  14.530 1.00 45.90 ? 10  DG  E "C4'" 1 
ATOM   979  O "O4'" . DG  D 2 10 ? 1.117   52.322  14.151 1.00 44.74 ? 10  DG  E "O4'" 1 
ATOM   980  C "C3'" . DG  D 2 10 ? 1.768   54.443  13.246 1.00 45.28 ? 10  DG  E "C3'" 1 
ATOM   981  O "O3'" . DG  D 2 10 ? 3.174   54.701  13.203 1.00 46.12 ? 10  DG  E "O3'" 1 
ATOM   982  C "C2'" . DG  D 2 10 ? 1.356   53.483  12.143 1.00 44.57 ? 10  DG  E "C2'" 1 
ATOM   983  C "C1'" . DG  D 2 10 ? 1.516   52.127  12.808 1.00 42.69 ? 10  DG  E "C1'" 1 
ATOM   984  N N9    . DG  D 2 10 ? 0.690   51.074  12.220 1.00 39.70 ? 10  DG  E N9    1 
ATOM   985  C C8    . DG  D 2 10 ? -0.654  51.123  11.941 1.00 38.71 ? 10  DG  E C8    1 
ATOM   986  N N7    . DG  D 2 10 ? -1.088  50.055  11.328 1.00 37.46 ? 10  DG  E N7    1 
ATOM   987  C C5    . DG  D 2 10 ? 0.032   49.244  11.211 1.00 36.50 ? 10  DG  E C5    1 
ATOM   988  C C6    . DG  D 2 10 ? 0.186   47.965  10.609 1.00 35.12 ? 10  DG  E C6    1 
ATOM   989  O O6    . DG  D 2 10 ? -0.661  47.279  10.025 1.00 34.74 ? 10  DG  E O6    1 
ATOM   990  N N1    . DG  D 2 10 ? 1.490   47.502  10.724 1.00 34.38 ? 10  DG  E N1    1 
ATOM   991  C C2    . DG  D 2 10 ? 2.520   48.181  11.331 1.00 34.99 ? 10  DG  E C2    1 
ATOM   992  N N2    . DG  D 2 10 ? 3.714   47.568  11.350 1.00 32.28 ? 10  DG  E N2    1 
ATOM   993  N N3    . DG  D 2 10 ? 2.392   49.375  11.881 1.00 35.95 ? 10  DG  E N3    1 
ATOM   994  C C4    . DG  D 2 10 ? 1.131   49.844  11.783 1.00 37.61 ? 10  DG  E C4    1 
ATOM   995  P P     . DT  D 2 11 ? 3.842   55.302  11.866 1.00 46.59 ? 11  DT  E P     1 
ATOM   996  O OP1   . DT  D 2 11 ? 4.729   56.429  12.248 1.00 47.72 ? 11  DT  E OP1   1 
ATOM   997  O OP2   . DT  D 2 11 ? 2.793   55.516  10.839 1.00 46.61 ? 11  DT  E OP2   1 
ATOM   998  O "O5'" . DT  D 2 11 ? 4.765   54.104  11.377 1.00 45.69 ? 11  DT  E "O5'" 1 
ATOM   999  C "C5'" . DT  D 2 11 ? 5.530   53.355  12.317 1.00 43.89 ? 11  DT  E "C5'" 1 
ATOM   1000 C "C4'" . DT  D 2 11 ? 6.405   52.364  11.593 1.00 43.20 ? 11  DT  E "C4'" 1 
ATOM   1001 O "O4'" . DT  D 2 11 ? 5.602   51.274  11.080 1.00 42.04 ? 11  DT  E "O4'" 1 
ATOM   1002 C "C3'" . DT  D 2 11 ? 7.120   52.965  10.388 1.00 43.70 ? 11  DT  E "C3'" 1 
ATOM   1003 O "O3'" . DT  D 2 11 ? 8.439   52.437  10.294 1.00 47.44 ? 11  DT  E "O3'" 1 
ATOM   1004 C "C2'" . DT  D 2 11 ? 6.273   52.517  9.210  1.00 42.02 ? 11  DT  E "C2'" 1 
ATOM   1005 C "C1'" . DT  D 2 11 ? 5.761   51.167  9.675  1.00 39.77 ? 11  DT  E "C1'" 1 
ATOM   1006 N N1    . DT  D 2 11 ? 4.458   50.770  9.104  1.00 37.02 ? 11  DT  E N1    1 
ATOM   1007 C C2    . DT  D 2 11 ? 4.389   49.582  8.412  1.00 34.62 ? 11  DT  E C2    1 
ATOM   1008 O O2    . DT  D 2 11 ? 5.359   48.872  8.212  1.00 33.35 ? 11  DT  E O2    1 
ATOM   1009 N N3    . DT  D 2 11 ? 3.136   49.259  7.952  1.00 33.60 ? 11  DT  E N3    1 
ATOM   1010 C C4    . DT  D 2 11 ? 1.976   49.995  8.100  1.00 33.88 ? 11  DT  E C4    1 
ATOM   1011 O O4    . DT  D 2 11 ? 0.916   49.565  7.651  1.00 32.96 ? 11  DT  E O4    1 
ATOM   1012 C C5    . DT  D 2 11 ? 2.127   51.248  8.806  1.00 34.88 ? 11  DT  E C5    1 
ATOM   1013 C C7    . DT  D 2 11 ? 0.931   52.131  8.978  1.00 34.60 ? 11  DT  E C7    1 
ATOM   1014 C C6    . DT  D 2 11 ? 3.343   51.566  9.272  1.00 35.71 ? 11  DT  E C6    1 
ATOM   1015 P P     . DC  D 2 12 ? 9.424   52.974  9.151  1.00 50.63 ? 12  DC  E P     1 
ATOM   1016 O OP1   . DC  D 2 12 ? 10.801  52.970  9.709  1.00 51.10 ? 12  DC  E OP1   1 
ATOM   1017 O OP2   . DC  D 2 12 ? 8.852   54.235  8.610  1.00 50.20 ? 12  DC  E OP2   1 
ATOM   1018 O "O5'" . DC  D 2 12 ? 9.330   51.843  8.037  1.00 50.69 ? 12  DC  E "O5'" 1 
ATOM   1019 C "C5'" . DC  D 2 12 ? 9.557   50.478  8.379  1.00 51.67 ? 12  DC  E "C5'" 1 
ATOM   1020 C "C4'" . DC  D 2 12 ? 9.514   49.617  7.140  1.00 51.60 ? 12  DC  E "C4'" 1 
ATOM   1021 O "O4'" . DC  D 2 12 ? 8.146   49.369  6.736  1.00 51.46 ? 12  DC  E "O4'" 1 
ATOM   1022 C "C3'" . DC  D 2 12 ? 10.209  50.247  5.937  1.00 52.39 ? 12  DC  E "C3'" 1 
ATOM   1023 O "O3'" . DC  D 2 12 ? 10.949  49.254  5.230  1.00 54.23 ? 12  DC  E "O3'" 1 
ATOM   1024 C "C2'" . DC  D 2 12 ? 9.060   50.781  5.098  1.00 51.35 ? 12  DC  E "C2'" 1 
ATOM   1025 C "C1'" . DC  D 2 12 ? 7.934   49.805  5.399  1.00 49.47 ? 12  DC  E "C1'" 1 
ATOM   1026 N N1    . DC  D 2 12 ? 6.579   50.381  5.335  1.00 47.11 ? 12  DC  E N1    1 
ATOM   1027 C C2    . DC  D 2 12 ? 5.538   49.600  4.827  1.00 45.71 ? 12  DC  E C2    1 
ATOM   1028 O O2    . DC  D 2 12 ? 5.793   48.468  4.395  1.00 45.57 ? 12  DC  E O2    1 
ATOM   1029 N N3    . DC  D 2 12 ? 4.280   50.098  4.821  1.00 44.77 ? 12  DC  E N3    1 
ATOM   1030 C C4    . DC  D 2 12 ? 4.047   51.325  5.288  1.00 43.99 ? 12  DC  E C4    1 
ATOM   1031 N N4    . DC  D 2 12 ? 2.784   51.761  5.292  1.00 42.90 ? 12  DC  E N4    1 
ATOM   1032 C C5    . DC  D 2 12 ? 5.094   52.156  5.778  1.00 44.11 ? 12  DC  E C5    1 
ATOM   1033 C C6    . DC  D 2 12 ? 6.334   51.650  5.782  1.00 45.95 ? 12  DC  E C6    1 
ATOM   1034 P P     . DA  D 2 13 ? 11.975  49.703  4.086  1.00 55.38 ? 13  DA  E P     1 
ATOM   1035 O OP1   . DA  D 2 13 ? 13.279  49.056  4.375  1.00 55.68 ? 13  DA  E OP1   1 
ATOM   1036 O OP2   . DA  D 2 13 ? 11.899  51.183  3.944  1.00 55.22 ? 13  DA  E OP2   1 
ATOM   1037 O "O5'" . DA  D 2 13 ? 11.355  49.049  2.772  1.00 54.65 ? 13  DA  E "O5'" 1 
ATOM   1038 C "C5'" . DA  D 2 13 ? 10.952  47.682  2.757  1.00 52.57 ? 13  DA  E "C5'" 1 
ATOM   1039 C "C4'" . DA  D 2 13 ? 10.116  47.399  1.530  1.00 51.60 ? 13  DA  E "C4'" 1 
ATOM   1040 O "O4'" . DA  D 2 13 ? 8.790   47.964  1.686  1.00 49.79 ? 13  DA  E "O4'" 1 
ATOM   1041 C "C3'" . DA  D 2 13 ? 10.678  47.991  0.236  1.00 51.34 ? 13  DA  E "C3'" 1 
ATOM   1042 O "O3'" . DA  D 2 13 ? 10.354  47.161  -0.885 1.00 53.02 ? 13  DA  E "O3'" 1 
ATOM   1043 C "C2'" . DA  D 2 13 ? 9.875   49.269  0.075  1.00 49.88 ? 13  DA  E "C2'" 1 
ATOM   1044 C "C1'" . DA  D 2 13 ? 8.517   48.835  0.597  1.00 48.32 ? 13  DA  E "C1'" 1 
ATOM   1045 N N9    . DA  D 2 13 ? 7.657   49.917  1.080  1.00 45.43 ? 13  DA  E N9    1 
ATOM   1046 C C8    . DA  D 2 13 ? 8.030   51.103  1.663  1.00 44.78 ? 13  DA  E C8    1 
ATOM   1047 N N7    . DA  D 2 13 ? 7.020   51.880  1.979  1.00 43.54 ? 13  DA  E N7    1 
ATOM   1048 C C5    . DA  D 2 13 ? 5.905   51.153  1.582  1.00 43.08 ? 13  DA  E C5    1 
ATOM   1049 C C6    . DA  D 2 13 ? 4.526   51.426  1.647  1.00 42.73 ? 13  DA  E C6    1 
ATOM   1050 N N6    . DA  D 2 13 ? 4.014   52.552  2.156  1.00 41.60 ? 13  DA  E N6    1 
ATOM   1051 N N1    . DA  D 2 13 ? 3.678   50.490  1.164  1.00 42.69 ? 13  DA  E N1    1 
ATOM   1052 C C2    . DA  D 2 13 ? 4.192   49.364  0.650  1.00 43.71 ? 13  DA  E C2    1 
ATOM   1053 N N3    . DA  D 2 13 ? 5.468   48.993  0.535  1.00 43.72 ? 13  DA  E N3    1 
ATOM   1054 C C4    . DA  D 2 13 ? 6.283   49.943  1.026  1.00 44.08 ? 13  DA  E C4    1 
ATOM   1055 N N     . VAL E 3 5  ? -0.061  12.498  21.661 1.00 30.18 ? 5   VAL C N     1 
ATOM   1056 C CA    . VAL E 3 5  ? -1.076  12.391  20.614 1.00 28.00 ? 5   VAL C CA    1 
ATOM   1057 C C     . VAL E 3 5  ? -1.398  10.925  20.349 1.00 25.83 ? 5   VAL C C     1 
ATOM   1058 O O     . VAL E 3 5  ? -0.495  10.109  20.199 1.00 27.71 ? 5   VAL C O     1 
ATOM   1059 C CB    . VAL E 3 5  ? -0.577  13.020  19.307 1.00 29.74 ? 5   VAL C CB    1 
ATOM   1060 C CG1   . VAL E 3 5  ? 0.723   12.352  18.886 1.00 31.78 ? 5   VAL C CG1   1 
ATOM   1061 C CG2   . VAL E 3 5  ? -1.632  12.876  18.215 1.00 30.16 ? 5   VAL C CG2   1 
ATOM   1062 N N     . THR E 3 6  ? -2.680  10.584  20.293 1.00 22.19 ? 6   THR C N     1 
ATOM   1063 C CA    . THR E 3 6  ? -3.066  9.203   20.034 1.00 19.83 ? 6   THR C CA    1 
ATOM   1064 C C     . THR E 3 6  ? -3.040  8.878   18.541 1.00 17.47 ? 6   THR C C     1 
ATOM   1065 O O     . THR E 3 6  ? -3.036  9.773   17.687 1.00 16.27 ? 6   THR C O     1 
ATOM   1066 C CB    . THR E 3 6  ? -4.482  8.899   20.575 1.00 19.51 ? 6   THR C CB    1 
ATOM   1067 O OG1   . THR E 3 6  ? -5.436  9.747   19.926 1.00 19.35 ? 6   THR C OG1   1 
ATOM   1068 C CG2   . THR E 3 6  ? -4.541  9.141   22.082 1.00 21.62 ? 6   THR C CG2   1 
ATOM   1069 N N     . LEU E 3 7  ? -3.019  7.586   18.242 1.00 15.97 ? 7   LEU C N     1 
ATOM   1070 C CA    . LEU E 3 7  ? -2.997  7.110   16.867 1.00 15.66 ? 7   LEU C CA    1 
ATOM   1071 C C     . LEU E 3 7  ? -4.241  7.610   16.149 1.00 14.57 ? 7   LEU C C     1 
ATOM   1072 O O     . LEU E 3 7  ? -4.142  8.129   15.054 1.00 14.07 ? 7   LEU C O     1 
ATOM   1073 C CB    . LEU E 3 7  ? -2.993  5.581   16.824 1.00 16.37 ? 7   LEU C CB    1 
ATOM   1074 C CG    . LEU E 3 7  ? -2.370  4.856   15.622 1.00 17.23 ? 7   LEU C CG    1 
ATOM   1075 C CD1   . LEU E 3 7  ? -3.003  3.484   15.519 1.00 17.37 ? 7   LEU C CD1   1 
ATOM   1076 C CD2   . LEU E 3 7  ? -2.559  5.617   14.327 1.00 16.80 ? 7   LEU C CD2   1 
ATOM   1077 N N     . TRP E 3 8  ? -5.412  7.463   16.762 1.00 15.97 ? 8   TRP C N     1 
ATOM   1078 C CA    . TRP E 3 8  ? -6.629  7.908   16.090 1.00 18.09 ? 8   TRP C CA    1 
ATOM   1079 C C     . TRP E 3 8  ? -6.644  9.418   15.841 1.00 18.06 ? 8   TRP C C     1 
ATOM   1080 O O     . TRP E 3 8  ? -7.108  9.870   14.789 1.00 17.34 ? 8   TRP C O     1 
ATOM   1081 C CB    . TRP E 3 8  ? -7.890  7.462   16.852 1.00 19.40 ? 8   TRP C CB    1 
ATOM   1082 C CG    . TRP E 3 8  ? -8.073  8.031   18.225 1.00 20.75 ? 8   TRP C CG    1 
ATOM   1083 C CD1   . TRP E 3 8  ? -7.747  7.435   19.409 1.00 20.75 ? 8   TRP C CD1   1 
ATOM   1084 C CD2   . TRP E 3 8  ? -8.667  9.291   18.562 1.00 20.65 ? 8   TRP C CD2   1 
ATOM   1085 N NE1   . TRP E 3 8  ? -8.103  8.241   20.462 1.00 20.40 ? 8   TRP C NE1   1 
ATOM   1086 C CE2   . TRP E 3 8  ? -8.666  9.389   19.972 1.00 21.28 ? 8   TRP C CE2   1 
ATOM   1087 C CE3   . TRP E 3 8  ? -9.196  10.351  17.810 1.00 21.94 ? 8   TRP C CE3   1 
ATOM   1088 C CZ2   . TRP E 3 8  ? -9.179  10.505  20.650 1.00 22.21 ? 8   TRP C CZ2   1 
ATOM   1089 C CZ3   . TRP E 3 8  ? -9.707  11.462  18.484 1.00 21.49 ? 8   TRP C CZ3   1 
ATOM   1090 C CH2   . TRP E 3 8  ? -9.691  11.528  19.892 1.00 22.04 ? 8   TRP C CH2   1 
ATOM   1091 N N     . GLN E 3 9  ? -6.117  10.196  16.781 1.00 17.71 ? 9   GLN C N     1 
ATOM   1092 C CA    . GLN E 3 9  ? -6.069  11.649  16.600 1.00 18.61 ? 9   GLN C CA    1 
ATOM   1093 C C     . GLN E 3 9  ? -5.141  11.973  15.441 1.00 17.55 ? 9   GLN C C     1 
ATOM   1094 O O     . GLN E 3 9  ? -5.443  12.831  14.609 1.00 17.58 ? 9   GLN C O     1 
ATOM   1095 C CB    . GLN E 3 9  ? -5.549  12.350  17.857 1.00 21.99 ? 9   GLN C CB    1 
ATOM   1096 C CG    . GLN E 3 9  ? -6.466  12.247  19.052 1.00 27.85 ? 9   GLN C CG    1 
ATOM   1097 C CD    . GLN E 3 9  ? -5.889  12.915  20.289 1.00 30.75 ? 9   GLN C CD    1 
ATOM   1098 O OE1   . GLN E 3 9  ? -4.868  12.481  20.829 1.00 31.09 ? 9   GLN C OE1   1 
ATOM   1099 N NE2   . GLN E 3 9  ? -6.542  13.980  20.743 1.00 32.94 ? 9   GLN C NE2   1 
ATOM   1100 N N     . PHE E 3 10 ? -4.003  11.288  15.400 1.00 16.07 ? 10  PHE C N     1 
ATOM   1101 C CA    . PHE E 3 10 ? -3.016  11.483  14.340 1.00 14.87 ? 10  PHE C CA    1 
ATOM   1102 C C     . PHE E 3 10 ? -3.639  11.191  12.981 1.00 14.43 ? 10  PHE C C     1 
ATOM   1103 O O     . PHE E 3 10 ? -3.467  11.955  12.035 1.00 14.18 ? 10  PHE C O     1 
ATOM   1104 C CB    . PHE E 3 10 ? -1.817  10.553  14.556 1.00 13.78 ? 10  PHE C CB    1 
ATOM   1105 C CG    . PHE E 3 10 ? -0.896  10.459  13.375 1.00 13.66 ? 10  PHE C CG    1 
ATOM   1106 C CD1   . PHE E 3 10 ? -0.147  11.558  12.967 1.00 15.02 ? 10  PHE C CD1   1 
ATOM   1107 C CD2   . PHE E 3 10 ? -0.760  9.263   12.679 1.00 15.33 ? 10  PHE C CD2   1 
ATOM   1108 C CE1   . PHE E 3 10 ? 0.724   11.471  11.884 1.00 15.62 ? 10  PHE C CE1   1 
ATOM   1109 C CE2   . PHE E 3 10 ? 0.111   9.162   11.589 1.00 15.64 ? 10  PHE C CE2   1 
ATOM   1110 C CZ    . PHE E 3 10 ? 0.855   10.265  11.191 1.00 15.68 ? 10  PHE C CZ    1 
ATOM   1111 N N     . LEU E 3 11 ? -4.351  10.075  12.881 1.00 13.48 ? 11  LEU C N     1 
ATOM   1112 C CA    . LEU E 3 11 ? -4.984  9.714   11.618 1.00 14.94 ? 11  LEU C CA    1 
ATOM   1113 C C     . LEU E 3 11 ? -5.956  10.826  11.182 1.00 14.73 ? 11  LEU C C     1 
ATOM   1114 O O     . LEU E 3 11 ? -6.012  11.197  10.002 1.00 15.57 ? 11  LEU C O     1 
ATOM   1115 C CB    . LEU E 3 11 ? -5.721  8.384   11.776 1.00 15.44 ? 11  LEU C CB    1 
ATOM   1116 C CG    . LEU E 3 11 ? -5.119  7.079   11.227 1.00 18.65 ? 11  LEU C CG    1 
ATOM   1117 C CD1   . LEU E 3 11 ? -3.615  7.171   11.012 1.00 15.33 ? 11  LEU C CD1   1 
ATOM   1118 C CD2   . LEU E 3 11 ? -5.485  5.956   12.179 1.00 16.43 ? 11  LEU C CD2   1 
ATOM   1119 N N     . LEU E 3 12 ? -6.714  11.345  12.139 1.00 12.96 ? 12  LEU C N     1 
ATOM   1120 C CA    . LEU E 3 12 ? -7.670  12.417  11.875 1.00 15.28 ? 12  LEU C CA    1 
ATOM   1121 C C     . LEU E 3 12 ? -6.920  13.656  11.363 1.00 15.09 ? 12  LEU C C     1 
ATOM   1122 O O     . LEU E 3 12 ? -7.369  14.335  10.434 1.00 14.24 ? 12  LEU C O     1 
ATOM   1123 C CB    . LEU E 3 12 ? -8.443  12.732  13.161 1.00 16.83 ? 12  LEU C CB    1 
ATOM   1124 C CG    . LEU E 3 12 ? -9.966  12.535  13.217 1.00 20.80 ? 12  LEU C CG    1 
ATOM   1125 C CD1   . LEU E 3 12 ? -10.444 11.534  12.182 1.00 20.24 ? 12  LEU C CD1   1 
ATOM   1126 C CD2   . LEU E 3 12 ? -10.354 12.091  14.625 1.00 20.45 ? 12  LEU C CD2   1 
ATOM   1127 N N     . GLN E 3 13 ? -5.764  13.939  11.961 1.00 13.83 ? 13  GLN C N     1 
ATOM   1128 C CA    . GLN E 3 13 ? -4.955  15.072  11.533 1.00 15.08 ? 13  GLN C CA    1 
ATOM   1129 C C     . GLN E 3 13 ? -4.474  14.900  10.090 1.00 15.01 ? 13  GLN C C     1 
ATOM   1130 O O     . GLN E 3 13 ? -4.565  15.831  9.291  1.00 15.50 ? 13  GLN C O     1 
ATOM   1131 C CB    . GLN E 3 13 ? -3.770  15.264  12.491 1.00 14.06 ? 13  GLN C CB    1 
ATOM   1132 C CG    . GLN E 3 13 ? -4.229  15.793  13.849 1.00 15.78 ? 13  GLN C CG    1 
ATOM   1133 C CD    . GLN E 3 13 ? -3.124  15.903  14.888 1.00 17.57 ? 13  GLN C CD    1 
ATOM   1134 O OE1   . GLN E 3 13 ? -3.385  16.276  16.040 1.00 17.09 ? 13  GLN C OE1   1 
ATOM   1135 N NE2   . GLN E 3 13 ? -1.893  15.579  14.499 1.00 15.70 ? 13  GLN C NE2   1 
ATOM   1136 N N     . LEU E 3 14 ? -3.971  13.715  9.755  1.00 15.16 ? 14  LEU C N     1 
ATOM   1137 C CA    . LEU E 3 14 ? -3.498  13.448  8.396  1.00 15.75 ? 14  LEU C CA    1 
ATOM   1138 C C     . LEU E 3 14 ? -4.600  13.629  7.363  1.00 15.11 ? 14  LEU C C     1 
ATOM   1139 O O     . LEU E 3 14 ? -4.385  14.223  6.306  1.00 15.05 ? 14  LEU C O     1 
ATOM   1140 C CB    . LEU E 3 14 ? -2.966  12.018  8.267  1.00 18.26 ? 14  LEU C CB    1 
ATOM   1141 C CG    . LEU E 3 14 ? -1.523  11.729  8.662  1.00 20.16 ? 14  LEU C CG    1 
ATOM   1142 C CD1   . LEU E 3 14 ? -1.181  10.299  8.212  1.00 19.70 ? 14  LEU C CD1   1 
ATOM   1143 C CD2   . LEU E 3 14 ? -0.590  12.741  7.996  1.00 18.71 ? 14  LEU C CD2   1 
ATOM   1144 N N     . LEU E 3 15 ? -5.775  13.096  7.669  1.00 15.20 ? 15  LEU C N     1 
ATOM   1145 C CA    . LEU E 3 15 ? -6.916  13.187  6.765  1.00 18.26 ? 15  LEU C CA    1 
ATOM   1146 C C     . LEU E 3 15 ? -7.344  14.629  6.550  1.00 19.54 ? 15  LEU C C     1 
ATOM   1147 O O     . LEU E 3 15 ? -7.776  15.012  5.465  1.00 19.47 ? 15  LEU C O     1 
ATOM   1148 C CB    . LEU E 3 15 ? -8.090  12.381  7.326  1.00 16.68 ? 15  LEU C CB    1 
ATOM   1149 C CG    . LEU E 3 15 ? -7.979  10.868  7.107  1.00 17.24 ? 15  LEU C CG    1 
ATOM   1150 C CD1   . LEU E 3 15 ? -8.862  10.132  8.099  1.00 16.13 ? 15  LEU C CD1   1 
ATOM   1151 C CD2   . LEU E 3 15 ? -8.364  10.536  5.671  1.00 16.32 ? 15  LEU C CD2   1 
ATOM   1152 N N     . ARG E 3 16 ? -7.209  15.428  7.595  1.00 20.70 ? 16  ARG C N     1 
ATOM   1153 C CA    . ARG E 3 16 ? -7.595  16.825  7.537  1.00 22.49 ? 16  ARG C CA    1 
ATOM   1154 C C     . ARG E 3 16 ? -6.507  17.680  6.888  1.00 23.22 ? 16  ARG C C     1 
ATOM   1155 O O     . ARG E 3 16 ? -6.802  18.593  6.116  1.00 22.48 ? 16  ARG C O     1 
ATOM   1156 C CB    . ARG E 3 16 ? -7.876  17.305  8.967  1.00 23.35 ? 16  ARG C CB    1 
ATOM   1157 C CG    . ARG E 3 16 ? -8.420  18.702  9.107  1.00 26.28 ? 16  ARG C CG    1 
ATOM   1158 C CD    . ARG E 3 16 ? -8.888  18.939  10.534 1.00 26.53 ? 16  ARG C CD    1 
ATOM   1159 N NE    . ARG E 3 16 ? -7.782  19.010  11.483 1.00 27.43 ? 16  ARG C NE    1 
ATOM   1160 C CZ    . ARG E 3 16 ? -7.726  18.325  12.620 1.00 28.26 ? 16  ARG C CZ    1 
ATOM   1161 N NH1   . ARG E 3 16 ? -8.714  17.505  12.954 1.00 27.98 ? 16  ARG C NH1   1 
ATOM   1162 N NH2   . ARG E 3 16 ? -6.687  18.471  13.432 1.00 27.29 ? 16  ARG C NH2   1 
ATOM   1163 N N     . GLU E 3 17 ? -5.250  17.341  7.162  1.00 23.61 ? 17  GLU C N     1 
ATOM   1164 C CA    . GLU E 3 17 ? -4.118  18.118  6.671  1.00 23.99 ? 17  GLU C CA    1 
ATOM   1165 C C     . GLU E 3 17 ? -3.482  17.789  5.324  1.00 25.37 ? 17  GLU C C     1 
ATOM   1166 O O     . GLU E 3 17 ? -2.909  18.675  4.693  1.00 25.53 ? 17  GLU C O     1 
ATOM   1167 C CB    . GLU E 3 17 ? -3.049  18.157  7.771  1.00 23.41 ? 17  GLU C CB    1 
ATOM   1168 C CG    . GLU E 3 17 ? -3.476  19.050  8.938  1.00 22.36 ? 17  GLU C CG    1 
ATOM   1169 C CD    . GLU E 3 17 ? -2.781  18.748  10.264 1.00 21.74 ? 17  GLU C CD    1 
ATOM   1170 O OE1   . GLU E 3 17 ? -1.688  18.144  10.267 1.00 19.43 ? 17  GLU C OE1   1 
ATOM   1171 O OE2   . GLU E 3 17 ? -3.338  19.142  11.315 1.00 20.66 ? 17  GLU C OE2   1 
ATOM   1172 N N     . GLN E 3 18 ? -3.564  16.537  4.880  1.00 27.17 ? 18  GLN C N     1 
ATOM   1173 C CA    . GLN E 3 18 ? -2.988  16.154  3.588  1.00 28.63 ? 18  GLN C CA    1 
ATOM   1174 C C     . GLN E 3 18 ? -3.714  16.907  2.470  1.00 29.67 ? 18  GLN C C     1 
ATOM   1175 O O     . GLN E 3 18 ? -4.933  17.070  2.516  1.00 29.36 ? 18  GLN C O     1 
ATOM   1176 C CB    . GLN E 3 18 ? -3.132  14.641  3.360  1.00 29.09 ? 18  GLN C CB    1 
ATOM   1177 C CG    . GLN E 3 18 ? -2.218  13.773  4.219  1.00 29.55 ? 18  GLN C CG    1 
ATOM   1178 C CD    . GLN E 3 18 ? -0.784  13.755  3.724  1.00 30.77 ? 18  GLN C CD    1 
ATOM   1179 O OE1   . GLN E 3 18 ? -0.483  13.194  2.667  1.00 31.86 ? 18  GLN C OE1   1 
ATOM   1180 N NE2   . GLN E 3 18 ? 0.109   14.371  4.485  1.00 30.89 ? 18  GLN C NE2   1 
ATOM   1181 N N     . GLY E 3 19 ? -2.972  17.368  1.469  1.00 30.58 ? 19  GLY C N     1 
ATOM   1182 C CA    . GLY E 3 19 ? -3.610  18.089  0.379  1.00 32.38 ? 19  GLY C CA    1 
ATOM   1183 C C     . GLY E 3 19 ? -4.241  17.161  -0.649 1.00 33.57 ? 19  GLY C C     1 
ATOM   1184 O O     . GLY E 3 19 ? -4.961  17.607  -1.547 1.00 33.82 ? 19  GLY C O     1 
ATOM   1185 N N     . ASN E 3 20 ? -3.985  15.863  -0.506 1.00 32.66 ? 20  ASN C N     1 
ATOM   1186 C CA    . ASN E 3 20 ? -4.494  14.866  -1.442 1.00 32.35 ? 20  ASN C CA    1 
ATOM   1187 C C     . ASN E 3 20 ? -4.650  13.503  -0.776 1.00 31.50 ? 20  ASN C C     1 
ATOM   1188 O O     . ASN E 3 20 ? -4.451  13.361  0.433  1.00 30.13 ? 20  ASN C O     1 
ATOM   1189 C CB    . ASN E 3 20 ? -3.524  14.739  -2.609 1.00 32.60 ? 20  ASN C CB    1 
ATOM   1190 C CG    . ASN E 3 20 ? -2.105  14.469  -2.145 1.00 34.33 ? 20  ASN C CG    1 
ATOM   1191 O OD1   . ASN E 3 20 ? -1.814  13.411  -1.577 1.00 33.10 ? 20  ASN C OD1   1 
ATOM   1192 N ND2   . ASN E 3 20 ? -1.218  15.434  -2.363 1.00 34.07 ? 20  ASN C ND2   1 
ATOM   1193 N N     . GLY E 3 21 ? -4.991  12.501  -1.580 1.00 30.36 ? 21  GLY C N     1 
ATOM   1194 C CA    . GLY E 3 21 ? -5.178  11.161  -1.058 1.00 29.63 ? 21  GLY C CA    1 
ATOM   1195 C C     . GLY E 3 21 ? -4.069  10.200  -1.437 1.00 28.73 ? 21  GLY C C     1 
ATOM   1196 O O     . GLY E 3 21 ? -4.309  9.006   -1.565 1.00 28.80 ? 21  GLY C O     1 
ATOM   1197 N N     . HIS E 3 22 ? -2.855  10.713  -1.610 1.00 28.46 ? 22  HIS C N     1 
ATOM   1198 C CA    . HIS E 3 22 ? -1.725  9.870   -1.975 1.00 27.94 ? 22  HIS C CA    1 
ATOM   1199 C C     . HIS E 3 22 ? -1.300  8.872   -0.885 1.00 25.76 ? 22  HIS C C     1 
ATOM   1200 O O     . HIS E 3 22 ? -0.782  7.811   -1.209 1.00 26.02 ? 22  HIS C O     1 
ATOM   1201 C CB    . HIS E 3 22 ? -0.525  10.733  -2.385 1.00 30.77 ? 22  HIS C CB    1 
ATOM   1202 C CG    . HIS E 3 22 ? -0.696  11.430  -3.702 1.00 35.28 ? 22  HIS C CG    1 
ATOM   1203 N ND1   . HIS E 3 22 ? 0.272   12.252  -4.239 1.00 36.57 ? 22  HIS C ND1   1 
ATOM   1204 C CD2   . HIS E 3 22 ? -1.724  11.434  -4.585 1.00 36.14 ? 22  HIS C CD2   1 
ATOM   1205 C CE1   . HIS E 3 22 ? -0.152  12.733  -5.395 1.00 37.44 ? 22  HIS C CE1   1 
ATOM   1206 N NE2   . HIS E 3 22 ? -1.360  12.252  -5.628 1.00 38.12 ? 22  HIS C NE2   1 
ATOM   1207 N N     . ILE E 3 23 ? -1.486  9.198   0.395  1.00 23.01 ? 23  ILE C N     1 
ATOM   1208 C CA    . ILE E 3 23 ? -1.112  8.244   1.446  1.00 21.60 ? 23  ILE C CA    1 
ATOM   1209 C C     . ILE E 3 23 ? -2.296  7.819   2.320  1.00 20.32 ? 23  ILE C C     1 
ATOM   1210 O O     . ILE E 3 23 ? -2.327  6.700   2.835  1.00 20.25 ? 23  ILE C O     1 
ATOM   1211 C CB    . ILE E 3 23 ? 0.037   8.773   2.344  1.00 21.97 ? 23  ILE C CB    1 
ATOM   1212 C CG1   . ILE E 3 23 ? -0.472  9.841   3.305  1.00 21.55 ? 23  ILE C CG1   1 
ATOM   1213 C CG2   . ILE E 3 23 ? 1.159   9.326   1.469  1.00 22.05 ? 23  ILE C CG2   1 
ATOM   1214 C CD1   . ILE E 3 23 ? 0.578   10.280  4.309  1.00 22.95 ? 23  ILE C CD1   1 
ATOM   1215 N N     . ILE E 3 24 ? -3.269  8.708   2.490  1.00 18.19 ? 24  ILE C N     1 
ATOM   1216 C CA    . ILE E 3 24 ? -4.460  8.374   3.259  1.00 17.21 ? 24  ILE C CA    1 
ATOM   1217 C C     . ILE E 3 24 ? -5.641  9.101   2.625  1.00 17.16 ? 24  ILE C C     1 
ATOM   1218 O O     . ILE E 3 24 ? -5.486  10.198  2.092  1.00 16.44 ? 24  ILE C O     1 
ATOM   1219 C CB    . ILE E 3 24 ? -4.328  8.770   4.753  1.00 16.21 ? 24  ILE C CB    1 
ATOM   1220 C CG1   . ILE E 3 24 ? -5.462  8.123   5.556  1.00 15.24 ? 24  ILE C CG1   1 
ATOM   1221 C CG2   . ILE E 3 24 ? -4.333  10.283  4.905  1.00 15.67 ? 24  ILE C CG2   1 
ATOM   1222 C CD1   . ILE E 3 24 ? -5.350  8.307   7.081  1.00 14.86 ? 24  ILE C CD1   1 
ATOM   1223 N N     . SER E 3 25 ? -6.815  8.487   2.673  1.00 16.53 ? 25  SER C N     1 
ATOM   1224 C CA    . SER E 3 25 ? -7.997  9.095   2.072  1.00 17.94 ? 25  SER C CA    1 
ATOM   1225 C C     . SER E 3 25 ? -9.291  8.566   2.658  1.00 16.96 ? 25  SER C C     1 
ATOM   1226 O O     . SER E 3 25 ? -9.367  7.401   3.056  1.00 17.20 ? 25  SER C O     1 
ATOM   1227 C CB    . SER E 3 25 ? -8.007  8.830   0.556  1.00 18.05 ? 25  SER C CB    1 
ATOM   1228 O OG    . SER E 3 25 ? -9.236  9.231   -0.035 1.00 19.61 ? 25  SER C OG    1 
ATOM   1229 N N     . TRP E 3 26 ? -10.303 9.428   2.727  1.00 17.37 ? 26  TRP C N     1 
ATOM   1230 C CA    . TRP E 3 26 ? -11.609 8.995   3.205  1.00 18.95 ? 26  TRP C CA    1 
ATOM   1231 C C     . TRP E 3 26 ? -12.133 8.132   2.061  1.00 20.43 ? 26  TRP C C     1 
ATOM   1232 O O     . TRP E 3 26 ? -11.839 8.407   0.892  1.00 21.51 ? 26  TRP C O     1 
ATOM   1233 C CB    . TRP E 3 26 ? -12.581 10.178  3.389  1.00 17.98 ? 26  TRP C CB    1 
ATOM   1234 C CG    . TRP E 3 26 ? -12.334 11.062  4.576  1.00 16.71 ? 26  TRP C CG    1 
ATOM   1235 C CD1   . TRP E 3 26 ? -11.903 12.356  4.552  1.00 17.53 ? 26  TRP C CD1   1 
ATOM   1236 C CD2   . TRP E 3 26 ? -12.487 10.716  5.962  1.00 17.07 ? 26  TRP C CD2   1 
ATOM   1237 N NE1   . TRP E 3 26 ? -11.775 12.837  5.833  1.00 17.97 ? 26  TRP C NE1   1 
ATOM   1238 C CE2   . TRP E 3 26 ? -12.127 11.853  6.718  1.00 16.78 ? 26  TRP C CE2   1 
ATOM   1239 C CE3   . TRP E 3 26 ? -12.891 9.556   6.636  1.00 17.25 ? 26  TRP C CE3   1 
ATOM   1240 C CZ2   . TRP E 3 26 ? -12.154 11.865  8.118  1.00 18.47 ? 26  TRP C CZ2   1 
ATOM   1241 C CZ3   . TRP E 3 26 ? -12.918 9.564   8.027  1.00 18.64 ? 26  TRP C CZ3   1 
ATOM   1242 C CH2   . TRP E 3 26 ? -12.551 10.715  8.755  1.00 19.21 ? 26  TRP C CH2   1 
ATOM   1243 N N     . THR E 3 27 ? -12.875 7.080   2.385  1.00 20.91 ? 27  THR C N     1 
ATOM   1244 C CA    . THR E 3 27 ? -13.467 6.238   1.352  1.00 22.12 ? 27  THR C CA    1 
ATOM   1245 C C     . THR E 3 27 ? -14.933 6.663   1.371  1.00 23.80 ? 27  THR C C     1 
ATOM   1246 O O     . THR E 3 27 ? -15.525 6.959   0.339  1.00 24.49 ? 27  THR C O     1 
ATOM   1247 C CB    . THR E 3 27 ? -13.312 4.736   1.671  1.00 20.55 ? 27  THR C CB    1 
ATOM   1248 O OG1   . THR E 3 27 ? -13.839 4.456   2.971  1.00 20.16 ? 27  THR C OG1   1 
ATOM   1249 C CG2   . THR E 3 27 ? -11.842 4.343   1.624  1.00 20.35 ? 27  THR C CG2   1 
ATOM   1250 N N     . SER E 3 28 ? -15.498 6.724   2.570  1.00 25.05 ? 28  SER C N     1 
ATOM   1251 C CA    . SER E 3 28 ? -16.863 7.188   2.758  1.00 26.30 ? 28  SER C CA    1 
ATOM   1252 C C     . SER E 3 28 ? -16.789 8.040   4.015  1.00 27.26 ? 28  SER C C     1 
ATOM   1253 O O     . SER E 3 28 ? -16.900 7.531   5.130  1.00 27.28 ? 28  SER C O     1 
ATOM   1254 C CB    . SER E 3 28 ? -17.829 6.020   2.958  1.00 25.07 ? 28  SER C CB    1 
ATOM   1255 O OG    . SER E 3 28 ? -19.147 6.500   3.164  1.00 26.26 ? 28  SER C OG    1 
ATOM   1256 N N     . ARG E 3 29 ? -16.566 9.338   3.835  1.00 28.90 ? 29  ARG C N     1 
ATOM   1257 C CA    . ARG E 3 29 ? -16.448 10.241  4.973  1.00 30.50 ? 29  ARG C CA    1 
ATOM   1258 C C     . ARG E 3 29 ? -17.711 10.268  5.821  1.00 31.09 ? 29  ARG C C     1 
ATOM   1259 O O     . ARG E 3 29 ? -17.633 10.325  7.050  1.00 30.52 ? 29  ARG C O     1 
ATOM   1260 C CB    . ARG E 3 29 ? -16.105 11.654  4.506  1.00 31.16 ? 29  ARG C CB    1 
ATOM   1261 C CG    . ARG E 3 29 ? -15.855 12.609  5.654  1.00 32.11 ? 29  ARG C CG    1 
ATOM   1262 C CD    . ARG E 3 29 ? -15.437 13.973  5.148  1.00 34.05 ? 29  ARG C CD    1 
ATOM   1263 N NE    . ARG E 3 29 ? -15.195 14.905  6.243  1.00 35.04 ? 29  ARG C NE    1 
ATOM   1264 C CZ    . ARG E 3 29 ? -14.794 16.159  6.076  1.00 36.00 ? 29  ARG C CZ    1 
ATOM   1265 N NH1   . ARG E 3 29 ? -14.587 16.629  4.854  1.00 36.18 ? 29  ARG C NH1   1 
ATOM   1266 N NH2   . ARG E 3 29 ? -14.608 16.946  7.129  1.00 37.04 ? 29  ARG C NH2   1 
ATOM   1267 N N     . ASP E 3 30 ? -18.871 10.230  5.166  1.00 32.17 ? 30  ASP C N     1 
ATOM   1268 C CA    . ASP E 3 30 ? -20.139 10.229  5.888  1.00 33.17 ? 30  ASP C CA    1 
ATOM   1269 C C     . ASP E 3 30 ? -20.089 9.130   6.955  1.00 31.97 ? 30  ASP C C     1 
ATOM   1270 O O     . ASP E 3 30 ? -20.519 9.333   8.092  1.00 32.52 ? 30  ASP C O     1 
ATOM   1271 C CB    . ASP E 3 30 ? -21.321 9.959   4.935  1.00 36.27 ? 30  ASP C CB    1 
ATOM   1272 C CG    . ASP E 3 30 ? -21.552 11.090  3.929  1.00 39.33 ? 30  ASP C CG    1 
ATOM   1273 O OD1   . ASP E 3 30 ? -21.290 12.262  4.270  1.00 41.09 ? 30  ASP C OD1   1 
ATOM   1274 O OD2   . ASP E 3 30 ? -22.019 10.805  2.801  1.00 40.69 ? 30  ASP C OD2   1 
ATOM   1275 N N     . GLY E 3 31 ? -19.547 7.972   6.582  1.00 29.35 ? 31  GLY C N     1 
ATOM   1276 C CA    . GLY E 3 31 ? -19.459 6.860   7.515  1.00 27.49 ? 31  GLY C CA    1 
ATOM   1277 C C     . GLY E 3 31 ? -18.182 6.768   8.340  1.00 25.83 ? 31  GLY C C     1 
ATOM   1278 O O     . GLY E 3 31 ? -17.998 5.803   9.081  1.00 25.50 ? 31  GLY C O     1 
ATOM   1279 N N     . GLY E 3 32 ? -17.301 7.758   8.210  1.00 24.07 ? 32  GLY C N     1 
ATOM   1280 C CA    . GLY E 3 32 ? -16.059 7.753   8.962  1.00 22.17 ? 32  GLY C CA    1 
ATOM   1281 C C     . GLY E 3 32 ? -15.082 6.688   8.496  1.00 21.26 ? 32  GLY C C     1 
ATOM   1282 O O     . GLY E 3 32 ? -14.152 6.323   9.214  1.00 21.17 ? 32  GLY C O     1 
ATOM   1283 N N     . GLU E 3 33 ? -15.291 6.192   7.282  1.00 20.56 ? 33  GLU C N     1 
ATOM   1284 C CA    . GLU E 3 33 ? -14.431 5.162   6.719  1.00 19.66 ? 33  GLU C CA    1 
ATOM   1285 C C     . GLU E 3 33 ? -13.311 5.778   5.883  1.00 19.15 ? 33  GLU C C     1 
ATOM   1286 O O     . GLU E 3 33 ? -13.539 6.696   5.092  1.00 18.48 ? 33  GLU C O     1 
ATOM   1287 C CB    . GLU E 3 33 ? -15.283 4.192   5.899  1.00 20.57 ? 33  GLU C CB    1 
ATOM   1288 C CG    . GLU E 3 33 ? -16.393 3.571   6.736  1.00 21.02 ? 33  GLU C CG    1 
ATOM   1289 C CD    . GLU E 3 33 ? -17.360 2.706   5.930  1.00 24.37 ? 33  GLU C CD    1 
ATOM   1290 O OE1   . GLU E 3 33 ? -17.144 2.527   4.712  1.00 23.54 ? 33  GLU C OE1   1 
ATOM   1291 O OE2   . GLU E 3 33 ? -18.336 2.203   6.530  1.00 24.09 ? 33  GLU C OE2   1 
ATOM   1292 N N     . PHE E 3 34 ? -12.098 5.268   6.079  1.00 18.06 ? 34  PHE C N     1 
ATOM   1293 C CA    . PHE E 3 34 ? -10.918 5.780   5.392  1.00 17.27 ? 34  PHE C CA    1 
ATOM   1294 C C     . PHE E 3 34 ? -9.969  4.660   5.014  1.00 18.16 ? 34  PHE C C     1 
ATOM   1295 O O     . PHE E 3 34 ? -9.994  3.579   5.608  1.00 19.30 ? 34  PHE C O     1 
ATOM   1296 C CB    . PHE E 3 34 ? -10.185 6.771   6.302  1.00 16.27 ? 34  PHE C CB    1 
ATOM   1297 C CG    . PHE E 3 34 ? -9.658  6.155   7.572  1.00 14.27 ? 34  PHE C CG    1 
ATOM   1298 C CD1   . PHE E 3 34 ? -10.501 5.942   8.657  1.00 14.37 ? 34  PHE C CD1   1 
ATOM   1299 C CD2   . PHE E 3 34 ? -8.327  5.762   7.676  1.00 13.83 ? 34  PHE C CD2   1 
ATOM   1300 C CE1   . PHE E 3 34 ? -10.029 5.342   9.833  1.00 15.10 ? 34  PHE C CE1   1 
ATOM   1301 C CE2   . PHE E 3 34 ? -7.843  5.162   8.848  1.00 14.39 ? 34  PHE C CE2   1 
ATOM   1302 C CZ    . PHE E 3 34 ? -8.699  4.954   9.929  1.00 13.54 ? 34  PHE C CZ    1 
ATOM   1303 N N     . LYS E 3 35 ? -9.121  4.927   4.030  1.00 18.57 ? 35  LYS C N     1 
ATOM   1304 C CA    . LYS E 3 35 ? -8.166  3.938   3.579  1.00 18.68 ? 35  LYS C CA    1 
ATOM   1305 C C     . LYS E 3 35 ? -6.735  4.427   3.696  1.00 18.67 ? 35  LYS C C     1 
ATOM   1306 O O     . LYS E 3 35 ? -6.434  5.576   3.375  1.00 18.05 ? 35  LYS C O     1 
ATOM   1307 C CB    . LYS E 3 35 ? -8.434  3.560   2.121  1.00 20.22 ? 35  LYS C CB    1 
ATOM   1308 C CG    . LYS E 3 35 ? -7.448  2.524   1.593  1.00 23.45 ? 35  LYS C CG    1 
ATOM   1309 C CD    . LYS E 3 35 ? -7.526  2.345   0.083  1.00 27.00 ? 35  LYS C CD    1 
ATOM   1310 C CE    . LYS E 3 35 ? -8.880  1.855   -0.366 1.00 28.17 ? 35  LYS C CE    1 
ATOM   1311 N NZ    . LYS E 3 35 ? -8.909  1.694   -1.853 1.00 31.68 ? 35  LYS C NZ    1 
ATOM   1312 N N     . LEU E 3 36 ? -5.850  3.551   4.162  1.00 18.32 ? 36  LEU C N     1 
ATOM   1313 C CA    . LEU E 3 36 ? -4.445  3.906   4.259  1.00 19.18 ? 36  LEU C CA    1 
ATOM   1314 C C     . LEU E 3 36 ? -3.883  3.552   2.887  1.00 20.26 ? 36  LEU C C     1 
ATOM   1315 O O     . LEU E 3 36 ? -3.430  2.424   2.657  1.00 20.98 ? 36  LEU C O     1 
ATOM   1316 C CB    . LEU E 3 36 ? -3.748  3.093   5.359  1.00 19.32 ? 36  LEU C CB    1 
ATOM   1317 C CG    . LEU E 3 36 ? -4.236  3.285   6.803  1.00 19.71 ? 36  LEU C CG    1 
ATOM   1318 C CD1   . LEU E 3 36 ? -3.313  2.526   7.743  1.00 20.34 ? 36  LEU C CD1   1 
ATOM   1319 C CD2   . LEU E 3 36 ? -4.242  4.764   7.176  1.00 18.32 ? 36  LEU C CD2   1 
ATOM   1320 N N     . VAL E 3 37 ? -3.945  4.518   1.973  1.00 20.19 ? 37  VAL C N     1 
ATOM   1321 C CA    . VAL E 3 37 ? -3.476  4.339   0.605  1.00 20.22 ? 37  VAL C CA    1 
ATOM   1322 C C     . VAL E 3 37 ? -2.019  3.900   0.544  1.00 20.38 ? 37  VAL C C     1 
ATOM   1323 O O     . VAL E 3 37 ? -1.659  3.031   -0.249 1.00 20.30 ? 37  VAL C O     1 
ATOM   1324 C CB    . VAL E 3 37 ? -3.680  5.633   -0.212 1.00 21.36 ? 37  VAL C CB    1 
ATOM   1325 C CG1   . VAL E 3 37 ? -3.168  5.448   -1.639 1.00 21.60 ? 37  VAL C CG1   1 
ATOM   1326 C CG2   . VAL E 3 37 ? -5.161  5.991   -0.225 1.00 21.04 ? 37  VAL C CG2   1 
ATOM   1327 N N     . ASP E 3 38 ? -1.180  4.512   1.370  1.00 20.16 ? 38  ASP C N     1 
ATOM   1328 C CA    . ASP E 3 38 ? 0.226   4.135   1.441  1.00 18.95 ? 38  ASP C CA    1 
ATOM   1329 C C     . ASP E 3 38 ? 0.455   3.859   2.925  1.00 18.70 ? 38  ASP C C     1 
ATOM   1330 O O     . ASP E 3 38 ? 0.936   4.712   3.678  1.00 18.42 ? 38  ASP C O     1 
ATOM   1331 C CB    . ASP E 3 38 ? 1.119   5.267   0.941  1.00 19.28 ? 38  ASP C CB    1 
ATOM   1332 C CG    . ASP E 3 38 ? 2.582   4.858   0.845  1.00 20.75 ? 38  ASP C CG    1 
ATOM   1333 O OD1   . ASP E 3 38 ? 2.972   3.830   1.442  1.00 19.80 ? 38  ASP C OD1   1 
ATOM   1334 O OD2   . ASP E 3 38 ? 3.347   5.574   0.176  1.00 21.46 ? 38  ASP C OD2   1 
ATOM   1335 N N     . ALA E 3 39 ? 0.082   2.651   3.327  1.00 16.64 ? 39  ALA C N     1 
ATOM   1336 C CA    . ALA E 3 39 ? 0.158   2.220   4.715  1.00 16.23 ? 39  ALA C CA    1 
ATOM   1337 C C     . ALA E 3 39 ? 1.508   2.383   5.400  1.00 15.66 ? 39  ALA C C     1 
ATOM   1338 O O     . ALA E 3 39 ? 1.574   2.821   6.550  1.00 14.86 ? 39  ALA C O     1 
ATOM   1339 C CB    . ALA E 3 39 ? -0.314  0.781   4.820  1.00 14.17 ? 39  ALA C CB    1 
ATOM   1340 N N     . GLU E 3 40 ? 2.580   2.030   4.703  1.00 16.61 ? 40  GLU C N     1 
ATOM   1341 C CA    . GLU E 3 40 ? 3.916   2.134   5.277  1.00 17.80 ? 40  GLU C CA    1 
ATOM   1342 C C     . GLU E 3 40 ? 4.337   3.592   5.455  1.00 17.02 ? 40  GLU C C     1 
ATOM   1343 O O     . GLU E 3 40 ? 5.082   3.920   6.378  1.00 16.30 ? 40  GLU C O     1 
ATOM   1344 C CB    . GLU E 3 40 ? 4.924   1.388   4.395  1.00 19.09 ? 40  GLU C CB    1 
ATOM   1345 C CG    . GLU E 3 40 ? 4.634   -0.106  4.237  1.00 19.90 ? 40  GLU C CG    1 
ATOM   1346 C CD    . GLU E 3 40 ? 4.725   -0.869  5.547  1.00 21.94 ? 40  GLU C CD    1 
ATOM   1347 O OE1   . GLU E 3 40 ? 5.280   -0.317  6.519  1.00 21.70 ? 40  GLU C OE1   1 
ATOM   1348 O OE2   . GLU E 3 40 ? 4.250   -2.023  5.606  1.00 22.52 ? 40  GLU C OE2   1 
ATOM   1349 N N     . GLU E 3 41 ? 3.862   4.473   4.579  1.00 17.02 ? 41  GLU C N     1 
ATOM   1350 C CA    . GLU E 3 41 ? 4.212   5.886   4.701  1.00 16.48 ? 41  GLU C CA    1 
ATOM   1351 C C     . GLU E 3 41 ? 3.445   6.484   5.880  1.00 15.95 ? 41  GLU C C     1 
ATOM   1352 O O     . GLU E 3 41 ? 3.994   7.268   6.651  1.00 15.79 ? 41  GLU C O     1 
ATOM   1353 C CB    . GLU E 3 41 ? 3.888   6.637   3.407  1.00 19.19 ? 41  GLU C CB    1 
ATOM   1354 C CG    . GLU E 3 41 ? 4.341   8.098   3.393  1.00 22.31 ? 41  GLU C CG    1 
ATOM   1355 C CD    . GLU E 3 41 ? 5.773   8.287   3.891  1.00 24.51 ? 41  GLU C CD    1 
ATOM   1356 O OE1   . GLU E 3 41 ? 6.611   7.381   3.687  1.00 23.96 ? 41  GLU C OE1   1 
ATOM   1357 O OE2   . GLU E 3 41 ? 6.059   9.351   4.480  1.00 26.68 ? 41  GLU C OE2   1 
ATOM   1358 N N     . VAL E 3 42 ? 2.177   6.113   6.024  1.00 13.82 ? 42  VAL C N     1 
ATOM   1359 C CA    . VAL E 3 42 ? 1.389   6.600   7.147  1.00 14.84 ? 42  VAL C CA    1 
ATOM   1360 C C     . VAL E 3 42 ? 2.054   6.125   8.438  1.00 14.46 ? 42  VAL C C     1 
ATOM   1361 O O     . VAL E 3 42 ? 2.102   6.857   9.426  1.00 15.61 ? 42  VAL C O     1 
ATOM   1362 C CB    . VAL E 3 42 ? -0.070  6.055   7.127  1.00 15.47 ? 42  VAL C CB    1 
ATOM   1363 C CG1   . VAL E 3 42 ? -0.782  6.423   8.430  1.00 13.96 ? 42  VAL C CG1   1 
ATOM   1364 C CG2   . VAL E 3 42 ? -0.831  6.634   5.937  1.00 13.83 ? 42  VAL C CG2   1 
ATOM   1365 N N     . ALA E 3 43 ? 2.568   4.897   8.424  1.00 14.24 ? 43  ALA C N     1 
ATOM   1366 C CA    . ALA E 3 43 ? 3.206   4.334   9.606  1.00 14.29 ? 43  ALA C CA    1 
ATOM   1367 C C     . ALA E 3 43 ? 4.519   5.050   9.919  1.00 14.32 ? 43  ALA C C     1 
ATOM   1368 O O     . ALA E 3 43 ? 4.801   5.339   11.078 1.00 14.54 ? 43  ALA C O     1 
ATOM   1369 C CB    . ALA E 3 43 ? 3.442   2.823   9.424  1.00 14.11 ? 43  ALA C CB    1 
ATOM   1370 N N     A ARG E 3 44 ? 5.307   5.335   8.882  0.50 14.54 ? 44  ARG C N     1 
ATOM   1371 N N     B ARG E 3 44 ? 5.329   5.324   8.898  0.50 14.85 ? 44  ARG C N     1 
ATOM   1372 C CA    A ARG E 3 44 ? 6.578   6.038   9.053  0.50 15.31 ? 44  ARG C CA    1 
ATOM   1373 C CA    B ARG E 3 44 ? 6.590   6.018   9.137  0.50 15.84 ? 44  ARG C CA    1 
ATOM   1374 C C     A ARG E 3 44 ? 6.310   7.336   9.799  0.50 15.60 ? 44  ARG C C     1 
ATOM   1375 C C     B ARG E 3 44 ? 6.301   7.345   9.830  0.50 15.95 ? 44  ARG C C     1 
ATOM   1376 O O     A ARG E 3 44 ? 6.922   7.618   10.828 0.50 16.11 ? 44  ARG C O     1 
ATOM   1377 O O     B ARG E 3 44 ? 6.901   7.659   10.857 0.50 16.42 ? 44  ARG C O     1 
ATOM   1378 C CB    A ARG E 3 44 ? 7.216   6.364   7.692  0.50 13.97 ? 44  ARG C CB    1 
ATOM   1379 C CB    B ARG E 3 44 ? 7.352   6.261   7.830  0.50 15.33 ? 44  ARG C CB    1 
ATOM   1380 C CG    A ARG E 3 44 ? 8.555   7.102   7.796  0.51 13.28 ? 44  ARG C CG    1 
ATOM   1381 C CG    B ARG E 3 44 ? 8.634   7.064   8.026  0.49 15.42 ? 44  ARG C CG    1 
ATOM   1382 C CD    A ARG E 3 44 ? 9.223   7.323   6.430  0.51 11.94 ? 44  ARG C CD    1 
ATOM   1383 C CD    B ARG E 3 44 ? 9.620   6.888   6.877  0.49 15.78 ? 44  ARG C CD    1 
ATOM   1384 N NE    A ARG E 3 44 ? 8.594   8.376   5.632  0.51 11.18 ? 44  ARG C NE    1 
ATOM   1385 N NE    B ARG E 3 44 ? 10.282  5.584   6.916  0.49 14.81 ? 44  ARG C NE    1 
ATOM   1386 C CZ    A ARG E 3 44 ? 8.715   9.680   5.871  0.51 9.04  ? 44  ARG C CZ    1 
ATOM   1387 C CZ    B ARG E 3 44 ? 11.244  5.208   6.077  0.49 14.41 ? 44  ARG C CZ    1 
ATOM   1388 N NH1   A ARG E 3 44 ? 9.445   10.108  6.885  0.51 10.48 ? 44  ARG C NH1   1 
ATOM   1389 N NH1   B ARG E 3 44 ? 11.661  6.037   5.127  0.49 12.75 ? 44  ARG C NH1   1 
ATOM   1390 N NH2   A ARG E 3 44 ? 8.105   10.559  5.094  0.51 9.35  ? 44  ARG C NH2   1 
ATOM   1391 N NH2   B ARG E 3 44 ? 11.796  4.006   6.194  0.49 12.94 ? 44  ARG C NH2   1 
ATOM   1392 N N     . LEU E 3 45 ? 5.374   8.116   9.269  1.00 15.75 ? 45  LEU C N     1 
ATOM   1393 C CA    . LEU E 3 45 ? 4.996   9.401   9.853  1.00 15.12 ? 45  LEU C CA    1 
ATOM   1394 C C     . LEU E 3 45 ? 4.502   9.253   11.296 1.00 14.74 ? 45  LEU C C     1 
ATOM   1395 O O     . LEU E 3 45 ? 4.834   10.080  12.152 1.00 14.21 ? 45  LEU C O     1 
ATOM   1396 C CB    . LEU E 3 45 ? 3.912   10.055  8.995  1.00 16.09 ? 45  LEU C CB    1 
ATOM   1397 C CG    . LEU E 3 45 ? 4.278   11.065  7.904  1.00 18.61 ? 45  LEU C CG    1 
ATOM   1398 C CD1   . LEU E 3 45 ? 5.758   11.066  7.584  1.00 16.73 ? 45  LEU C CD1   1 
ATOM   1399 C CD2   . LEU E 3 45 ? 3.428   10.776  6.684  1.00 17.70 ? 45  LEU C CD2   1 
ATOM   1400 N N     . TRP E 3 46 ? 3.712   8.211   11.567 1.00 13.70 ? 46  TRP C N     1 
ATOM   1401 C CA    . TRP E 3 46 ? 3.206   7.967   12.924 1.00 13.82 ? 46  TRP C CA    1 
ATOM   1402 C C     . TRP E 3 46 ? 4.396   7.757   13.858 1.00 13.70 ? 46  TRP C C     1 
ATOM   1403 O O     . TRP E 3 46 ? 4.442   8.314   14.943 1.00 15.12 ? 46  TRP C O     1 
ATOM   1404 C CB    . TRP E 3 46 ? 2.290   6.734   12.954 1.00 12.60 ? 46  TRP C CB    1 
ATOM   1405 C CG    . TRP E 3 46 ? 1.856   6.246   14.345 1.00 13.56 ? 46  TRP C CG    1 
ATOM   1406 C CD1   . TRP E 3 46 ? 1.846   4.945   14.781 1.00 12.43 ? 46  TRP C CD1   1 
ATOM   1407 C CD2   . TRP E 3 46 ? 1.359   7.033   15.446 1.00 13.30 ? 46  TRP C CD2   1 
ATOM   1408 N NE1   . TRP E 3 46 ? 1.379   4.874   16.066 1.00 13.39 ? 46  TRP C NE1   1 
ATOM   1409 C CE2   . TRP E 3 46 ? 1.072   6.137   16.503 1.00 12.93 ? 46  TRP C CE2   1 
ATOM   1410 C CE3   . TRP E 3 46 ? 1.129   8.407   15.642 1.00 13.40 ? 46  TRP C CE3   1 
ATOM   1411 C CZ2   . TRP E 3 46 ? 0.570   6.569   17.746 1.00 12.48 ? 46  TRP C CZ2   1 
ATOM   1412 C CZ3   . TRP E 3 46 ? 0.628   8.839   16.880 1.00 10.62 ? 46  TRP C CZ3   1 
ATOM   1413 C CH2   . TRP E 3 46 ? 0.355   7.919   17.914 1.00 13.62 ? 46  TRP C CH2   1 
ATOM   1414 N N     . GLY E 3 47 ? 5.362   6.955   13.428 1.00 14.58 ? 47  GLY C N     1 
ATOM   1415 C CA    . GLY E 3 47 ? 6.534   6.726   14.256 1.00 14.05 ? 47  GLY C CA    1 
ATOM   1416 C C     . GLY E 3 47 ? 7.294   8.015   14.520 1.00 14.83 ? 47  GLY C C     1 
ATOM   1417 O O     . GLY E 3 47 ? 7.783   8.240   15.628 1.00 14.93 ? 47  GLY C O     1 
ATOM   1418 N N     . LEU E 3 48 ? 7.379   8.881   13.513 1.00 15.83 ? 48  LEU C N     1 
ATOM   1419 C CA    . LEU E 3 48 ? 8.103   10.138  13.666 1.00 15.63 ? 48  LEU C CA    1 
ATOM   1420 C C     . LEU E 3 48 ? 7.445   11.093  14.661 1.00 15.44 ? 48  LEU C C     1 
ATOM   1421 O O     . LEU E 3 48 ? 8.099   11.997  15.176 1.00 16.06 ? 48  LEU C O     1 
ATOM   1422 C CB    . LEU E 3 48 ? 8.299   10.807  12.297 1.00 15.22 ? 48  LEU C CB    1 
ATOM   1423 C CG    . LEU E 3 48 ? 9.235   10.016  11.364 1.00 17.91 ? 48  LEU C CG    1 
ATOM   1424 C CD1   . LEU E 3 48 ? 9.221   10.593  9.941  1.00 16.84 ? 48  LEU C CD1   1 
ATOM   1425 C CD2   . LEU E 3 48 ? 10.648  10.059  11.926 1.00 15.75 ? 48  LEU C CD2   1 
ATOM   1426 N N     . ARG E 3 49 ? 6.160   10.900  14.944 1.00 15.40 ? 49  ARG C N     1 
ATOM   1427 C CA    . ARG E 3 49 ? 5.494   11.753  15.926 1.00 16.25 ? 49  ARG C CA    1 
ATOM   1428 C C     . ARG E 3 49 ? 6.108   11.440  17.294 1.00 16.59 ? 49  ARG C C     1 
ATOM   1429 O O     . ARG E 3 49 ? 6.036   12.249  18.220 1.00 16.23 ? 49  ARG C O     1 
ATOM   1430 C CB    . ARG E 3 49 ? 3.983   11.487  15.969 1.00 16.18 ? 49  ARG C CB    1 
ATOM   1431 C CG    . ARG E 3 49 ? 3.181   12.112  14.826 1.00 16.75 ? 49  ARG C CG    1 
ATOM   1432 C CD    . ARG E 3 49 ? 3.302   13.637  14.803 1.00 17.64 ? 49  ARG C CD    1 
ATOM   1433 N NE    . ARG E 3 49 ? 2.436   14.256  13.795 1.00 14.79 ? 49  ARG C NE    1 
ATOM   1434 C CZ    . ARG E 3 49 ? 1.179   14.634  14.011 1.00 15.49 ? 49  ARG C CZ    1 
ATOM   1435 N NH1   . ARG E 3 49 ? 0.621   14.465  15.204 1.00 13.20 ? 49  ARG C NH1   1 
ATOM   1436 N NH2   . ARG E 3 49 ? 0.479   15.199  13.031 1.00 13.71 ? 49  ARG C NH2   1 
ATOM   1437 N N     . LYS E 3 50 ? 6.701   10.252  17.414 1.00 16.63 ? 50  LYS C N     1 
ATOM   1438 C CA    . LYS E 3 50 ? 7.338   9.834   18.659 1.00 18.38 ? 50  LYS C CA    1 
ATOM   1439 C C     . LYS E 3 50 ? 8.856   9.750   18.498 1.00 19.73 ? 50  LYS C C     1 
ATOM   1440 O O     . LYS E 3 50 ? 9.538   9.053   19.250 1.00 20.23 ? 50  LYS C O     1 
ATOM   1441 C CB    . LYS E 3 50 ? 6.765   8.491   19.130 1.00 16.53 ? 50  LYS C CB    1 
ATOM   1442 C CG    . LYS E 3 50 ? 5.296   8.599   19.501 1.00 18.41 ? 50  LYS C CG    1 
ATOM   1443 C CD    . LYS E 3 50 ? 4.737   7.332   20.091 1.00 17.72 ? 50  LYS C CD    1 
ATOM   1444 C CE    . LYS E 3 50 ? 3.273   7.524   20.469 1.00 15.62 ? 50  LYS C CE    1 
ATOM   1445 N NZ    . LYS E 3 50 ? 2.672   6.231   20.902 1.00 15.03 ? 50  LYS C NZ    1 
ATOM   1446 N N     . ASN E 3 51 ? 9.372   10.453  17.496 1.00 20.56 ? 51  ASN C N     1 
ATOM   1447 C CA    . ASN E 3 51 ? 10.807  10.491  17.246 1.00 22.72 ? 51  ASN C CA    1 
ATOM   1448 C C     . ASN E 3 51 ? 11.427  9.126   16.944 1.00 22.82 ? 51  ASN C C     1 
ATOM   1449 O O     . ASN E 3 51 ? 12.551  8.838   17.363 1.00 23.24 ? 51  ASN C O     1 
ATOM   1450 C CB    . ASN E 3 51 ? 11.507  11.137  18.451 1.00 26.14 ? 51  ASN C CB    1 
ATOM   1451 C CG    . ASN E 3 51 ? 12.989  11.329  18.232 1.00 29.12 ? 51  ASN C CG    1 
ATOM   1452 O OD1   . ASN E 3 51 ? 13.412  11.849  17.201 1.00 32.94 ? 51  ASN C OD1   1 
ATOM   1453 N ND2   . ASN E 3 51 ? 13.790  10.919  19.209 1.00 32.08 ? 51  ASN C ND2   1 
ATOM   1454 N N     . LYS E 3 52 ? 10.693  8.282   16.229 1.00 21.45 ? 52  LYS C N     1 
ATOM   1455 C CA    . LYS E 3 52 ? 11.197  6.963   15.850 1.00 20.98 ? 52  LYS C CA    1 
ATOM   1456 C C     . LYS E 3 52 ? 11.078  6.847   14.331 1.00 20.14 ? 52  LYS C C     1 
ATOM   1457 O O     . LYS E 3 52 ? 10.085  7.286   13.749 1.00 18.29 ? 52  LYS C O     1 
ATOM   1458 C CB    . LYS E 3 52 ? 10.372  5.856   16.518 1.00 21.89 ? 52  LYS C CB    1 
ATOM   1459 C CG    . LYS E 3 52 ? 10.323  5.938   18.036 1.00 24.28 ? 52  LYS C CG    1 
ATOM   1460 C CD    . LYS E 3 52 ? 11.580  5.385   18.689 1.00 25.97 ? 52  LYS C CD    1 
ATOM   1461 C CE    . LYS E 3 52 ? 11.540  3.861   18.764 1.00 27.93 ? 52  LYS C CE    1 
ATOM   1462 N NZ    . LYS E 3 52 ? 10.461  3.379   19.687 1.00 28.56 ? 52  LYS C NZ    1 
ATOM   1463 N N     . THR E 3 53 ? 12.089  6.261   13.692 1.00 18.62 ? 53  THR C N     1 
ATOM   1464 C CA    . THR E 3 53 ? 12.083  6.099   12.242 1.00 17.04 ? 53  THR C CA    1 
ATOM   1465 C C     . THR E 3 53 ? 11.679  4.685   11.845 1.00 16.93 ? 53  THR C C     1 
ATOM   1466 O O     . THR E 3 53 ? 11.606  4.362   10.657 1.00 17.12 ? 53  THR C O     1 
ATOM   1467 C CB    . THR E 3 53 ? 13.479  6.322   11.650 1.00 17.98 ? 53  THR C CB    1 
ATOM   1468 O OG1   . THR E 3 53 ? 14.359  5.283   12.115 1.00 17.92 ? 53  THR C OG1   1 
ATOM   1469 C CG2   . THR E 3 53 ? 14.025  7.676   12.055 1.00 17.93 ? 53  THR C CG2   1 
ATOM   1470 N N     . ASN E 3 54 ? 11.403  3.840   12.827 1.00 16.90 ? 54  ASN C N     1 
ATOM   1471 C CA    . ASN E 3 54 ? 11.095  2.453   12.514 1.00 17.36 ? 54  ASN C CA    1 
ATOM   1472 C C     . ASN E 3 54 ? 9.661   1.947   12.667 1.00 16.05 ? 54  ASN C C     1 
ATOM   1473 O O     . ASN E 3 54 ? 9.461   0.749   12.845 1.00 15.61 ? 54  ASN C O     1 
ATOM   1474 C CB    . ASN E 3 54 ? 12.020  1.560   13.331 1.00 17.96 ? 54  ASN C CB    1 
ATOM   1475 C CG    . ASN E 3 54 ? 11.662  1.555   14.800 1.00 20.01 ? 54  ASN C CG    1 
ATOM   1476 O OD1   . ASN E 3 54 ? 11.056  2.505   15.306 1.00 19.21 ? 54  ASN C OD1   1 
ATOM   1477 N ND2   . ASN E 3 54 ? 12.039  0.491   15.496 1.00 19.33 ? 54  ASN C ND2   1 
ATOM   1478 N N     . MET E 3 55 ? 8.667   2.828   12.615 1.00 15.25 ? 55  MET C N     1 
ATOM   1479 C CA    . MET E 3 55 ? 7.287   2.360   12.728 1.00 16.00 ? 55  MET C CA    1 
ATOM   1480 C C     . MET E 3 55 ? 6.848   1.866   11.356 1.00 16.52 ? 55  MET C C     1 
ATOM   1481 O O     . MET E 3 55 ? 7.128   2.505   10.343 1.00 16.98 ? 55  MET C O     1 
ATOM   1482 C CB    . MET E 3 55 ? 6.366   3.490   13.203 1.00 15.61 ? 55  MET C CB    1 
ATOM   1483 C CG    . MET E 3 55 ? 4.865   3.164   13.196 1.00 15.86 ? 55  MET C CG    1 
ATOM   1484 S SD    . MET E 3 55 ? 4.343   1.772   14.221 1.00 16.65 ? 55  MET C SD    1 
ATOM   1485 C CE    . MET E 3 55 ? 5.012   2.255   15.826 1.00 12.65 ? 55  MET C CE    1 
ATOM   1486 N N     . ASN E 3 56 ? 6.191   0.712   11.316 1.00 16.76 ? 56  ASN C N     1 
ATOM   1487 C CA    . ASN E 3 56 ? 5.723   0.164   10.052 1.00 17.45 ? 56  ASN C CA    1 
ATOM   1488 C C     . ASN E 3 56 ? 4.246   -0.191  10.168 1.00 16.72 ? 56  ASN C C     1 
ATOM   1489 O O     . ASN E 3 56 ? 3.647   -0.057  11.237 1.00 15.26 ? 56  ASN C O     1 
ATOM   1490 C CB    . ASN E 3 56 ? 6.535   -1.076  9.654  1.00 18.65 ? 56  ASN C CB    1 
ATOM   1491 C CG    . ASN E 3 56 ? 6.547   -2.137  10.735 1.00 19.99 ? 56  ASN C CG    1 
ATOM   1492 O OD1   . ASN E 3 56 ? 5.573   -2.309  11.467 1.00 19.99 ? 56  ASN C OD1   1 
ATOM   1493 N ND2   . ASN E 3 56 ? 7.653   -2.868  10.831 1.00 20.53 ? 56  ASN C ND2   1 
ATOM   1494 N N     . TYR E 3 57 ? 3.657   -0.657  9.076  1.00 16.85 ? 57  TYR C N     1 
ATOM   1495 C CA    . TYR E 3 57 ? 2.238   -0.975  9.099  1.00 17.08 ? 57  TYR C CA    1 
ATOM   1496 C C     . TYR E 3 57 ? 1.881   -2.169  9.967  1.00 17.61 ? 57  TYR C C     1 
ATOM   1497 O O     . TYR E 3 57 ? 0.794   -2.214  10.541 1.00 17.12 ? 57  TYR C O     1 
ATOM   1498 C CB    . TYR E 3 57 ? 1.716   -1.175  7.677  1.00 16.81 ? 57  TYR C CB    1 
ATOM   1499 C CG    . TYR E 3 57 ? 0.236   -1.457  7.616  1.00 16.11 ? 57  TYR C CG    1 
ATOM   1500 C CD1   . TYR E 3 57 ? -0.689  -0.577  8.181  1.00 16.04 ? 57  TYR C CD1   1 
ATOM   1501 C CD2   . TYR E 3 57 ? -0.245  -2.603  6.995  1.00 16.70 ? 57  TYR C CD2   1 
ATOM   1502 C CE1   . TYR E 3 57 ? -2.064  -0.838  8.127  1.00 16.70 ? 57  TYR C CE1   1 
ATOM   1503 C CE2   . TYR E 3 57 ? -1.612  -2.874  6.933  1.00 16.74 ? 57  TYR C CE2   1 
ATOM   1504 C CZ    . TYR E 3 57 ? -2.517  -1.988  7.500  1.00 16.61 ? 57  TYR C CZ    1 
ATOM   1505 O OH    . TYR E 3 57 ? -3.872  -2.264  7.441  1.00 17.41 ? 57  TYR C OH    1 
ATOM   1506 N N     . ASP E 3 58 ? 2.780   -3.140  10.079 1.00 18.63 ? 58  ASP C N     1 
ATOM   1507 C CA    . ASP E 3 58 ? 2.484   -4.299  10.911 1.00 18.80 ? 58  ASP C CA    1 
ATOM   1508 C C     . ASP E 3 58 ? 2.220   -3.874  12.344 1.00 18.52 ? 58  ASP C C     1 
ATOM   1509 O O     . ASP E 3 58 ? 1.331   -4.406  13.009 1.00 19.02 ? 58  ASP C O     1 
ATOM   1510 C CB    . ASP E 3 58 ? 3.636   -5.309  10.904 1.00 22.13 ? 58  ASP C CB    1 
ATOM   1511 C CG    . ASP E 3 58 ? 3.510   -6.327  12.029 1.00 24.84 ? 58  ASP C CG    1 
ATOM   1512 O OD1   . ASP E 3 58 ? 2.783   -7.330  11.859 1.00 26.53 ? 58  ASP C OD1   1 
ATOM   1513 O OD2   . ASP E 3 58 ? 4.120   -6.116  13.102 1.00 28.53 ? 58  ASP C OD2   1 
ATOM   1514 N N     . LYS E 3 59 ? 2.997   -2.908  12.817 1.00 17.87 ? 59  LYS C N     1 
ATOM   1515 C CA    . LYS E 3 59 ? 2.851   -2.427  14.182 1.00 16.84 ? 59  LYS C CA    1 
ATOM   1516 C C     . LYS E 3 59 ? 1.713   -1.419  14.321 1.00 15.62 ? 59  LYS C C     1 
ATOM   1517 O O     . LYS E 3 59 ? 0.983   -1.437  15.312 1.00 16.65 ? 59  LYS C O     1 
ATOM   1518 C CB    . LYS E 3 59 ? 4.182   -1.832  14.662 1.00 17.38 ? 59  LYS C CB    1 
ATOM   1519 C CG    . LYS E 3 59 ? 5.282   -2.896  14.842 1.00 18.03 ? 59  LYS C CG    1 
ATOM   1520 C CD    . LYS E 3 59 ? 6.556   -2.325  15.469 1.00 17.82 ? 59  LYS C CD    1 
ATOM   1521 C CE    . LYS E 3 59 ? 7.259   -1.361  14.534 1.00 17.27 ? 59  LYS C CE    1 
ATOM   1522 N NZ    . LYS E 3 59 ? 8.542   -0.864  15.101 1.00 18.04 ? 59  LYS C NZ    1 
ATOM   1523 N N     . LEU E 3 60 ? 1.558   -0.542  13.335 1.00 14.82 ? 60  LEU C N     1 
ATOM   1524 C CA    . LEU E 3 60 ? 0.483   0.439   13.383 1.00 14.93 ? 60  LEU C CA    1 
ATOM   1525 C C     . LEU E 3 60 ? -0.853  -0.294  13.257 1.00 15.12 ? 60  LEU C C     1 
ATOM   1526 O O     . LEU E 3 60 ? -1.811  0.032   13.957 1.00 16.01 ? 60  LEU C O     1 
ATOM   1527 C CB    . LEU E 3 60 ? 0.636   1.480   12.258 1.00 13.28 ? 60  LEU C CB    1 
ATOM   1528 C CG    . LEU E 3 60 ? -0.447  2.570   12.186 1.00 12.98 ? 60  LEU C CG    1 
ATOM   1529 C CD1   . LEU E 3 60 ? 0.115   3.826   11.519 1.00 14.03 ? 60  LEU C CD1   1 
ATOM   1530 C CD2   . LEU E 3 60 ? -1.658  2.053   11.419 1.00 12.85 ? 60  LEU C CD2   1 
ATOM   1531 N N     . SER E 3 61 ? -0.921  -1.291  12.379 1.00 15.59 ? 61  SER C N     1 
ATOM   1532 C CA    . SER E 3 61 ? -2.167  -2.035  12.219 1.00 16.82 ? 61  SER C CA    1 
ATOM   1533 C C     . SER E 3 61 ? -2.537  -2.721  13.528 1.00 17.30 ? 61  SER C C     1 
ATOM   1534 O O     . SER E 3 61 ? -3.717  -2.820  13.863 1.00 18.26 ? 61  SER C O     1 
ATOM   1535 C CB    . SER E 3 61 ? -2.058  -3.078  11.094 1.00 18.70 ? 61  SER C CB    1 
ATOM   1536 O OG    . SER E 3 61 ? -1.151  -4.119  11.425 1.00 18.30 ? 61  SER C OG    1 
ATOM   1537 N N     . ARG E 3 62 ? -1.538  -3.195  14.272 1.00 16.60 ? 62  ARG C N     1 
ATOM   1538 C CA    . ARG E 3 62 ? -1.815  -3.857  15.549 1.00 16.46 ? 62  ARG C CA    1 
ATOM   1539 C C     . ARG E 3 62 ? -2.418  -2.856  16.516 1.00 15.12 ? 62  ARG C C     1 
ATOM   1540 O O     . ARG E 3 62 ? -3.311  -3.190  17.293 1.00 16.67 ? 62  ARG C O     1 
ATOM   1541 C CB    . ARG E 3 62 ? -0.545  -4.435  16.179 1.00 17.28 ? 62  ARG C CB    1 
ATOM   1542 C CG    . ARG E 3 62 ? -0.797  -5.085  17.545 1.00 18.63 ? 62  ARG C CG    1 
ATOM   1543 C CD    . ARG E 3 62 ? -1.501  -6.425  17.377 1.00 19.60 ? 62  ARG C CD    1 
ATOM   1544 N NE    . ARG E 3 62 ? -1.911  -7.057  18.633 1.00 19.39 ? 62  ARG C NE    1 
ATOM   1545 C CZ    . ARG E 3 62 ? -3.014  -6.750  19.310 1.00 19.75 ? 62  ARG C CZ    1 
ATOM   1546 N NH1   . ARG E 3 62 ? -3.830  -5.805  18.870 1.00 19.10 ? 62  ARG C NH1   1 
ATOM   1547 N NH2   . ARG E 3 62 ? -3.331  -7.425  20.405 1.00 18.06 ? 62  ARG C NH2   1 
ATOM   1548 N N     . ALA E 3 63 ? -1.898  -1.636  16.493 1.00 14.61 ? 63  ALA C N     1 
ATOM   1549 C CA    . ALA E 3 63 ? -2.419  -0.587  17.353 1.00 15.11 ? 63  ALA C CA    1 
ATOM   1550 C C     . ALA E 3 63 ? -3.891  -0.377  16.986 1.00 14.87 ? 63  ALA C C     1 
ATOM   1551 O O     . ALA E 3 63 ? -4.742  -0.235  17.862 1.00 14.72 ? 63  ALA C O     1 
ATOM   1552 C CB    . ALA E 3 63 ? -1.619  0.708   17.157 1.00 15.54 ? 63  ALA C CB    1 
ATOM   1553 N N     . LEU E 3 64 ? -4.196  -0.369  15.690 1.00 15.54 ? 64  LEU C N     1 
ATOM   1554 C CA    . LEU E 3 64 ? -5.586  -0.192  15.255 1.00 15.70 ? 64  LEU C CA    1 
ATOM   1555 C C     . LEU E 3 64 ? -6.444  -1.370  15.720 1.00 16.38 ? 64  LEU C C     1 
ATOM   1556 O O     . LEU E 3 64 ? -7.611  -1.195  16.068 1.00 15.64 ? 64  LEU C O     1 
ATOM   1557 C CB    . LEU E 3 64 ? -5.673  -0.054  13.728 1.00 14.66 ? 64  LEU C CB    1 
ATOM   1558 C CG    . LEU E 3 64 ? -5.065  1.218   13.115 1.00 14.56 ? 64  LEU C CG    1 
ATOM   1559 C CD1   . LEU E 3 64 ? -5.206  1.177   11.601 1.00 14.01 ? 64  LEU C CD1   1 
ATOM   1560 C CD2   . LEU E 3 64 ? -5.764  2.460   13.673 1.00 13.66 ? 64  LEU C CD2   1 
ATOM   1561 N N     . ARG E 3 65 ? -5.867  -2.571  15.733 1.00 16.79 ? 65  ARG C N     1 
ATOM   1562 C CA    . ARG E 3 65 ? -6.615  -3.744  16.176 1.00 18.17 ? 65  ARG C CA    1 
ATOM   1563 C C     . ARG E 3 65 ? -6.939  -3.613  17.661 1.00 18.38 ? 65  ARG C C     1 
ATOM   1564 O O     . ARG E 3 65 ? -7.997  -4.035  18.120 1.00 18.03 ? 65  ARG C O     1 
ATOM   1565 C CB    . ARG E 3 65 ? -5.828  -5.033  15.878 1.00 18.27 ? 65  ARG C CB    1 
ATOM   1566 C CG    . ARG E 3 65 ? -5.840  -5.393  14.380 1.00 17.91 ? 65  ARG C CG    1 
ATOM   1567 C CD    . ARG E 3 65 ? -5.359  -6.812  14.091 1.00 18.21 ? 65  ARG C CD    1 
ATOM   1568 N NE    . ARG E 3 65 ? -3.930  -7.015  14.316 1.00 18.08 ? 65  ARG C NE    1 
ATOM   1569 C CZ    . ARG E 3 65 ? -2.960  -6.586  13.513 1.00 19.24 ? 65  ARG C CZ    1 
ATOM   1570 N NH1   . ARG E 3 65 ? -3.244  -5.908  12.407 1.00 18.76 ? 65  ARG C NH1   1 
ATOM   1571 N NH2   . ARG E 3 65 ? -1.694  -6.851  13.812 1.00 19.91 ? 65  ARG C NH2   1 
ATOM   1572 N N     . TYR E 3 66 ? -6.024  -3.000  18.402 1.00 20.02 ? 66  TYR C N     1 
ATOM   1573 C CA    . TYR E 3 66 ? -6.203  -2.758  19.827 1.00 20.75 ? 66  TYR C CA    1 
ATOM   1574 C C     . TYR E 3 66 ? -7.427  -1.843  20.027 1.00 20.62 ? 66  TYR C C     1 
ATOM   1575 O O     . TYR E 3 66 ? -8.044  -1.848  21.086 1.00 18.83 ? 66  TYR C O     1 
ATOM   1576 C CB    . TYR E 3 66 ? -4.919  -2.114  20.372 1.00 25.47 ? 66  TYR C CB    1 
ATOM   1577 C CG    . TYR E 3 66 ? -5.096  -1.204  21.558 1.00 29.09 ? 66  TYR C CG    1 
ATOM   1578 C CD1   . TYR E 3 66 ? -5.144  -1.708  22.858 1.00 31.07 ? 66  TYR C CD1   1 
ATOM   1579 C CD2   . TYR E 3 66 ? -5.240  0.172   21.376 1.00 31.43 ? 66  TYR C CD2   1 
ATOM   1580 C CE1   . TYR E 3 66 ? -5.334  -0.861  23.948 1.00 32.30 ? 66  TYR C CE1   1 
ATOM   1581 C CE2   . TYR E 3 66 ? -5.432  1.023   22.453 1.00 32.42 ? 66  TYR C CE2   1 
ATOM   1582 C CZ    . TYR E 3 66 ? -5.480  0.505   23.733 1.00 32.82 ? 66  TYR C CZ    1 
ATOM   1583 O OH    . TYR E 3 66 ? -5.693  1.360   24.791 1.00 34.87 ? 66  TYR C OH    1 
ATOM   1584 N N     . TYR E 3 67 ? -7.774  -1.062  19.000 1.00 20.06 ? 67  TYR C N     1 
ATOM   1585 C CA    . TYR E 3 67 ? -8.931  -0.157  19.069 1.00 20.08 ? 67  TYR C CA    1 
ATOM   1586 C C     . TYR E 3 67 ? -10.278 -0.865  18.898 1.00 21.04 ? 67  TYR C C     1 
ATOM   1587 O O     . TYR E 3 67 ? -11.314 -0.331  19.287 1.00 19.31 ? 67  TYR C O     1 
ATOM   1588 C CB    . TYR E 3 67 ? -8.831  0.926   17.988 1.00 18.64 ? 67  TYR C CB    1 
ATOM   1589 C CG    . TYR E 3 67 ? -7.885  2.070   18.287 1.00 16.54 ? 67  TYR C CG    1 
ATOM   1590 C CD1   . TYR E 3 67 ? -7.692  2.530   19.592 1.00 17.91 ? 67  TYR C CD1   1 
ATOM   1591 C CD2   . TYR E 3 67 ? -7.234  2.739   17.252 1.00 17.81 ? 67  TYR C CD2   1 
ATOM   1592 C CE1   . TYR E 3 67 ? -6.878  3.635   19.855 1.00 18.89 ? 67  TYR C CE1   1 
ATOM   1593 C CE2   . TYR E 3 67 ? -6.423  3.842   17.498 1.00 17.93 ? 67  TYR C CE2   1 
ATOM   1594 C CZ    . TYR E 3 67 ? -6.251  4.285   18.798 1.00 18.79 ? 67  TYR C CZ    1 
ATOM   1595 O OH    . TYR E 3 67 ? -5.465  5.385   19.029 1.00 19.49 ? 67  TYR C OH    1 
ATOM   1596 N N     . TYR E 3 68 ? -10.266 -2.062  18.315 1.00 23.02 ? 68  TYR C N     1 
ATOM   1597 C CA    . TYR E 3 68 ? -11.510 -2.795  18.081 1.00 24.30 ? 68  TYR C CA    1 
ATOM   1598 C C     . TYR E 3 68 ? -12.371 -2.979  19.327 1.00 26.26 ? 68  TYR C C     1 
ATOM   1599 O O     . TYR E 3 68 ? -13.565 -2.671  19.310 1.00 25.52 ? 68  TYR C O     1 
ATOM   1600 C CB    . TYR E 3 68 ? -11.221 -4.168  17.464 1.00 23.02 ? 68  TYR C CB    1 
ATOM   1601 C CG    . TYR E 3 68 ? -10.532 -4.133  16.114 1.00 22.30 ? 68  TYR C CG    1 
ATOM   1602 C CD1   . TYR E 3 68 ? -10.325 -2.930  15.437 1.00 21.53 ? 68  TYR C CD1   1 
ATOM   1603 C CD2   . TYR E 3 68 ? -10.101 -5.313  15.507 1.00 22.34 ? 68  TYR C CD2   1 
ATOM   1604 C CE1   . TYR E 3 68 ? -9.707  -2.903  14.188 1.00 20.25 ? 68  TYR C CE1   1 
ATOM   1605 C CE2   . TYR E 3 68 ? -9.485  -5.296  14.263 1.00 21.38 ? 68  TYR C CE2   1 
ATOM   1606 C CZ    . TYR E 3 68 ? -9.290  -4.089  13.611 1.00 20.76 ? 68  TYR C CZ    1 
ATOM   1607 O OH    . TYR E 3 68 ? -8.674  -4.073  12.387 1.00 19.33 ? 68  TYR C OH    1 
ATOM   1608 N N     A ASP E 3 69 ? -11.766 -3.477  20.399 0.50 27.34 ? 69  ASP C N     1 
ATOM   1609 N N     B ASP E 3 69 ? -11.766 -3.488  20.399 0.50 27.33 ? 69  ASP C N     1 
ATOM   1610 C CA    A ASP E 3 69 ? -12.489 -3.712  21.643 0.50 29.02 ? 69  ASP C CA    1 
ATOM   1611 C CA    B ASP E 3 69 ? -12.483 -3.714  21.651 0.50 29.02 ? 69  ASP C CA    1 
ATOM   1612 C C     A ASP E 3 69 ? -12.807 -2.408  22.371 0.50 29.80 ? 69  ASP C C     1 
ATOM   1613 C C     B ASP E 3 69 ? -12.781 -2.414  22.394 0.50 29.78 ? 69  ASP C C     1 
ATOM   1614 O O     A ASP E 3 69 ? -13.635 -2.388  23.277 0.50 29.77 ? 69  ASP C O     1 
ATOM   1615 O O     B ASP E 3 69 ? -13.570 -2.403  23.335 0.50 29.71 ? 69  ASP C O     1 
ATOM   1616 C CB    A ASP E 3 69 ? -11.671 -4.627  22.558 0.50 30.18 ? 69  ASP C CB    1 
ATOM   1617 C CB    B ASP E 3 69 ? -11.688 -4.653  22.568 0.50 30.21 ? 69  ASP C CB    1 
ATOM   1618 C CG    A ASP E 3 69 ? -10.561 -3.890  23.275 0.43 31.11 ? 69  ASP C CG    1 
ATOM   1619 C CG    B ASP E 3 69 ? -11.731 -6.104  22.109 0.57 31.33 ? 69  ASP C CG    1 
ATOM   1620 O OD1   A ASP E 3 69 ? -10.879 -3.103  24.189 0.43 32.62 ? 69  ASP C OD1   1 
ATOM   1621 O OD1   B ASP E 3 69 ? -12.341 -6.393  21.057 0.57 32.08 ? 69  ASP C OD1   1 
ATOM   1622 O OD2   A ASP E 3 69 ? -9.377  -4.088  22.925 0.43 31.91 ? 69  ASP C OD2   1 
ATOM   1623 O OD2   B ASP E 3 69 ? -11.151 -6.961  22.806 0.57 32.66 ? 69  ASP C OD2   1 
ATOM   1624 N N     . LYS E 3 70 ? -12.143 -1.323  21.979 1.00 30.32 ? 70  LYS C N     1 
ATOM   1625 C CA    . LYS E 3 70 ? -12.378 -0.020  22.610 1.00 31.28 ? 70  LYS C CA    1 
ATOM   1626 C C     . LYS E 3 70 ? -13.492 0.728   21.878 1.00 30.90 ? 70  LYS C C     1 
ATOM   1627 O O     . LYS E 3 70 ? -13.873 1.833   22.260 1.00 30.37 ? 70  LYS C O     1 
ATOM   1628 C CB    . LYS E 3 70 ? -11.105 0.837   22.620 1.00 32.45 ? 70  LYS C CB    1 
ATOM   1629 C CG    . LYS E 3 70 ? -10.154 0.562   23.786 1.00 35.74 ? 70  LYS C CG    1 
ATOM   1630 C CD    . LYS E 3 70 ? -9.444  -0.776  23.641 1.00 39.29 ? 70  LYS C CD    1 
ATOM   1631 C CE    . LYS E 3 70 ? -8.568  -1.101  24.855 1.00 41.00 ? 70  LYS C CE    1 
ATOM   1632 N NZ    . LYS E 3 70 ? -9.348  -1.309  26.118 1.00 42.94 ? 70  LYS C NZ    1 
ATOM   1633 N N     . ASN E 3 71 ? -14.013 0.110   20.825 1.00 31.57 ? 71  ASN C N     1 
ATOM   1634 C CA    . ASN E 3 71 ? -15.081 0.704   20.030 1.00 31.47 ? 71  ASN C CA    1 
ATOM   1635 C C     . ASN E 3 71 ? -14.724 2.101   19.522 1.00 29.97 ? 71  ASN C C     1 
ATOM   1636 O O     . ASN E 3 71 ? -15.585 2.980   19.431 1.00 30.60 ? 71  ASN C O     1 
ATOM   1637 C CB    . ASN E 3 71 ? -16.371 0.761   20.849 1.00 34.47 ? 71  ASN C CB    1 
ATOM   1638 C CG    . ASN E 3 71 ? -16.744 -0.589  21.432 1.00 37.13 ? 71  ASN C CG    1 
ATOM   1639 O OD1   . ASN E 3 71 ? -16.713 -1.605  20.734 1.00 39.40 ? 71  ASN C OD1   1 
ATOM   1640 N ND2   . ASN E 3 71 ? -17.101 -0.607  22.715 1.00 38.01 ? 71  ASN C ND2   1 
ATOM   1641 N N     . ILE E 3 72 ? -13.447 2.299   19.206 1.00 27.46 ? 72  ILE C N     1 
ATOM   1642 C CA    . ILE E 3 72 ? -12.959 3.573   18.681 1.00 25.06 ? 72  ILE C CA    1 
ATOM   1643 C C     . ILE E 3 72 ? -12.871 3.438   17.163 1.00 24.38 ? 72  ILE C C     1 
ATOM   1644 O O     . ILE E 3 72 ? -13.351 4.289   16.417 1.00 24.52 ? 72  ILE C O     1 
ATOM   1645 C CB    . ILE E 3 72 ? -11.552 3.909   19.246 1.00 24.32 ? 72  ILE C CB    1 
ATOM   1646 C CG1   . ILE E 3 72 ? -11.667 4.305   20.718 1.00 23.35 ? 72  ILE C CG1   1 
ATOM   1647 C CG2   . ILE E 3 72 ? -10.903 5.026   18.428 1.00 22.61 ? 72  ILE C CG2   1 
ATOM   1648 C CD1   . ILE E 3 72 ? -10.337 4.507   21.400 1.00 23.86 ? 72  ILE C CD1   1 
ATOM   1649 N N     . ILE E 3 73 ? -12.247 2.356   16.720 1.00 24.02 ? 73  ILE C N     1 
ATOM   1650 C CA    . ILE E 3 73 ? -12.099 2.075   15.299 1.00 24.77 ? 73  ILE C CA    1 
ATOM   1651 C C     . ILE E 3 73 ? -12.387 0.607   15.036 1.00 25.45 ? 73  ILE C C     1 
ATOM   1652 O O     . ILE E 3 73 ? -12.134 -0.249  15.883 1.00 26.34 ? 73  ILE C O     1 
ATOM   1653 C CB    . ILE E 3 73 ? -10.665 2.403   14.786 1.00 24.49 ? 73  ILE C CB    1 
ATOM   1654 C CG1   . ILE E 3 73 ? -10.546 3.903   14.484 1.00 24.45 ? 73  ILE C CG1   1 
ATOM   1655 C CG2   . ILE E 3 73 ? -10.347 1.582   13.530 1.00 24.32 ? 73  ILE C CG2   1 
ATOM   1656 C CD1   . ILE E 3 73 ? -9.152  4.354   14.057 1.00 24.24 ? 73  ILE C CD1   1 
ATOM   1657 N N     . ARG E 3 74 ? -12.936 0.339   13.859 1.00 26.09 ? 74  ARG C N     1 
ATOM   1658 C CA    . ARG E 3 74 ? -13.252 -1.007  13.423 1.00 27.83 ? 74  ARG C CA    1 
ATOM   1659 C C     . ARG E 3 74 ? -12.747 -1.174  12.004 1.00 27.18 ? 74  ARG C C     1 
ATOM   1660 O O     . ARG E 3 74 ? -12.542 -0.196  11.280 1.00 26.35 ? 74  ARG C O     1 
ATOM   1661 C CB    . ARG E 3 74 ? -14.764 -1.257  13.450 1.00 30.17 ? 74  ARG C CB    1 
ATOM   1662 C CG    . ARG E 3 74 ? -15.223 -2.035  14.665 1.00 36.11 ? 74  ARG C CG    1 
ATOM   1663 C CD    . ARG E 3 74 ? -15.014 -1.236  15.935 1.00 39.89 ? 74  ARG C CD    1 
ATOM   1664 N NE    . ARG E 3 74 ? -15.208 -2.030  17.145 1.00 43.68 ? 74  ARG C NE    1 
ATOM   1665 C CZ    . ARG E 3 74 ? -16.259 -2.807  17.378 1.00 45.52 ? 74  ARG C CZ    1 
ATOM   1666 N NH1   . ARG E 3 74 ? -17.229 -2.914  16.479 1.00 47.59 ? 74  ARG C NH1   1 
ATOM   1667 N NH2   . ARG E 3 74 ? -16.351 -3.464  18.526 1.00 46.91 ? 74  ARG C NH2   1 
ATOM   1668 N N     . LYS E 3 75 ? -12.552 -2.423  11.614 1.00 25.93 ? 75  LYS C N     1 
ATOM   1669 C CA    . LYS E 3 75 ? -12.081 -2.740  10.281 1.00 26.29 ? 75  LYS C CA    1 
ATOM   1670 C C     . LYS E 3 75 ? -13.265 -2.763  9.330  1.00 26.72 ? 75  LYS C C     1 
ATOM   1671 O O     . LYS E 3 75 ? -14.382 -3.101  9.729  1.00 26.33 ? 75  LYS C O     1 
ATOM   1672 C CB    . LYS E 3 75 ? -11.417 -4.120  10.286 1.00 26.42 ? 75  LYS C CB    1 
ATOM   1673 C CG    . LYS E 3 75 ? -10.801 -4.538  8.951  1.00 26.16 ? 75  LYS C CG    1 
ATOM   1674 C CD    . LYS E 3 75 ? -9.545  -3.744  8.657  1.00 24.96 ? 75  LYS C CD    1 
ATOM   1675 C CE    . LYS E 3 75 ? -8.887  -4.215  7.371  1.00 24.14 ? 75  LYS C CE    1 
ATOM   1676 N NZ    . LYS E 3 75 ? -9.736  -3.919  6.190  1.00 24.00 ? 75  LYS C NZ    1 
ATOM   1677 N N     . VAL E 3 76 ? -13.028 -2.383  8.080  1.00 27.54 ? 76  VAL C N     1 
ATOM   1678 C CA    . VAL E 3 76 ? -14.072 -2.438  7.063  1.00 29.46 ? 76  VAL C CA    1 
ATOM   1679 C C     . VAL E 3 76 ? -13.740 -3.730  6.313  1.00 30.76 ? 76  VAL C C     1 
ATOM   1680 O O     . VAL E 3 76 ? -12.905 -3.746  5.413  1.00 30.93 ? 76  VAL C O     1 
ATOM   1681 C CB    . VAL E 3 76 ? -14.015 -1.217  6.108  1.00 30.47 ? 76  VAL C CB    1 
ATOM   1682 C CG1   . VAL E 3 76 ? -14.970 -1.418  4.928  1.00 29.98 ? 76  VAL C CG1   1 
ATOM   1683 C CG2   . VAL E 3 76 ? -14.404 0.051   6.874  1.00 28.36 ? 76  VAL C CG2   1 
ATOM   1684 N N     . SER E 3 77 ? -14.370 -4.824  6.726  1.00 32.71 ? 77  SER C N     1 
ATOM   1685 C CA    . SER E 3 77 ? -14.124 -6.130  6.123  1.00 34.04 ? 77  SER C CA    1 
ATOM   1686 C C     . SER E 3 77 ? -14.264 -6.193  4.610  1.00 33.60 ? 77  SER C C     1 
ATOM   1687 O O     . SER E 3 77 ? -15.190 -5.627  4.030  1.00 32.78 ? 77  SER C O     1 
ATOM   1688 C CB    . SER E 3 77 ? -15.038 -7.181  6.757  1.00 36.14 ? 77  SER C CB    1 
ATOM   1689 O OG    . SER E 3 77 ? -14.630 -7.464  8.083  1.00 39.96 ? 77  SER C OG    1 
ATOM   1690 N N     . GLY E 3 78 ? -13.325 -6.890  3.977  1.00 33.56 ? 78  GLY C N     1 
ATOM   1691 C CA    . GLY E 3 78 ? -13.372 -7.047  2.536  1.00 33.18 ? 78  GLY C CA    1 
ATOM   1692 C C     . GLY E 3 78 ? -12.664 -5.979  1.731  1.00 32.96 ? 78  GLY C C     1 
ATOM   1693 O O     . GLY E 3 78 ? -12.646 -6.043  0.503  1.00 33.69 ? 78  GLY C O     1 
ATOM   1694 N N     . GLN E 3 79 ? -12.093 -4.988  2.405  1.00 31.77 ? 79  GLN C N     1 
ATOM   1695 C CA    . GLN E 3 79 ? -11.375 -3.930  1.705  1.00 30.74 ? 79  GLN C CA    1 
ATOM   1696 C C     . GLN E 3 79 ? -10.014 -3.734  2.356  1.00 29.93 ? 79  GLN C C     1 
ATOM   1697 O O     . GLN E 3 79 ? -9.915  -3.450  3.548  1.00 30.30 ? 79  GLN C O     1 
ATOM   1698 C CB    . GLN E 3 79 ? -12.177 -2.630  1.737  1.00 31.23 ? 79  GLN C CB    1 
ATOM   1699 C CG    . GLN E 3 79 ? -13.522 -2.725  1.028  1.00 32.22 ? 79  GLN C CG    1 
ATOM   1700 C CD    . GLN E 3 79 ? -14.148 -1.370  0.788  1.00 32.05 ? 79  GLN C CD    1 
ATOM   1701 O OE1   . GLN E 3 79 ? -13.544 -0.501  0.161  1.00 32.84 ? 79  GLN C OE1   1 
ATOM   1702 N NE2   . GLN E 3 79 ? -15.364 -1.183  1.281  1.00 32.57 ? 79  GLN C NE2   1 
ATOM   1703 N N     . LYS E 3 80 ? -8.963  -3.882  1.564  1.00 28.87 ? 80  LYS C N     1 
ATOM   1704 C CA    . LYS E 3 80 ? -7.621  -3.745  2.086  1.00 28.25 ? 80  LYS C CA    1 
ATOM   1705 C C     . LYS E 3 80 ? -7.266  -2.334  2.525  1.00 26.69 ? 80  LYS C C     1 
ATOM   1706 O O     . LYS E 3 80 ? -7.485  -1.358  1.798  1.00 24.15 ? 80  LYS C O     1 
ATOM   1707 C CB    . LYS E 3 80 ? -6.602  -4.238  1.059  1.00 31.34 ? 80  LYS C CB    1 
ATOM   1708 C CG    . LYS E 3 80 ? -6.764  -5.706  0.700  1.00 35.19 ? 80  LYS C CG    1 
ATOM   1709 C CD    . LYS E 3 80 ? -5.532  -6.269  -0.014 1.00 37.63 ? 80  LYS C CD    1 
ATOM   1710 C CE    . LYS E 3 80 ? -5.246  -5.568  -1.334 1.00 39.77 ? 80  LYS C CE    1 
ATOM   1711 N NZ    . LYS E 3 80 ? -4.748  -4.173  -1.156 1.00 41.91 ? 80  LYS C NZ    1 
ATOM   1712 N N     . PHE E 3 81 ? -6.720  -2.253  3.736  1.00 24.46 ? 81  PHE C N     1 
ATOM   1713 C CA    . PHE E 3 81 ? -6.281  -0.997  4.325  1.00 22.39 ? 81  PHE C CA    1 
ATOM   1714 C C     . PHE E 3 81 ? -7.395  -0.009  4.673  1.00 21.45 ? 81  PHE C C     1 
ATOM   1715 O O     . PHE E 3 81 ? -7.126  1.158   4.971  1.00 21.03 ? 81  PHE C O     1 
ATOM   1716 C CB    . PHE E 3 81 ? -5.266  -0.336  3.396  1.00 21.35 ? 81  PHE C CB    1 
ATOM   1717 C CG    . PHE E 3 81 ? -4.167  -1.262  2.944  1.00 22.12 ? 81  PHE C CG    1 
ATOM   1718 C CD1   . PHE E 3 81 ? -3.184  -1.680  3.831  1.00 22.55 ? 81  PHE C CD1   1 
ATOM   1719 C CD2   . PHE E 3 81 ? -4.114  -1.715  1.630  1.00 23.01 ? 81  PHE C CD2   1 
ATOM   1720 C CE1   . PHE E 3 81 ? -2.161  -2.532  3.420  1.00 22.78 ? 81  PHE C CE1   1 
ATOM   1721 C CE2   . PHE E 3 81 ? -3.094  -2.568  1.206  1.00 23.40 ? 81  PHE C CE2   1 
ATOM   1722 C CZ    . PHE E 3 81 ? -2.116  -2.976  2.106  1.00 22.81 ? 81  PHE C CZ    1 
ATOM   1723 N N     . VAL E 3 82 ? -8.641  -0.473  4.650  1.00 19.85 ? 82  VAL C N     1 
ATOM   1724 C CA    . VAL E 3 82 ? -9.762  0.399   4.976  1.00 18.98 ? 82  VAL C CA    1 
ATOM   1725 C C     . VAL E 3 82 ? -10.260 0.194   6.402  1.00 18.73 ? 82  VAL C C     1 
ATOM   1726 O O     . VAL E 3 82 ? -10.531 -0.931  6.822  1.00 19.02 ? 82  VAL C O     1 
ATOM   1727 C CB    . VAL E 3 82 ? -10.944 0.188   4.004  1.00 19.08 ? 82  VAL C CB    1 
ATOM   1728 C CG1   . VAL E 3 82 ? -12.064 1.183   4.323  1.00 18.06 ? 82  VAL C CG1   1 
ATOM   1729 C CG2   . VAL E 3 82 ? -10.465 0.365   2.558  1.00 18.07 ? 82  VAL C CG2   1 
ATOM   1730 N N     . TYR E 3 83 ? -10.370 1.295   7.141  1.00 17.72 ? 83  TYR C N     1 
ATOM   1731 C CA    . TYR E 3 83 ? -10.847 1.258   8.517  1.00 17.94 ? 83  TYR C CA    1 
ATOM   1732 C C     . TYR E 3 83 ? -12.007 2.230   8.707  1.00 16.65 ? 83  TYR C C     1 
ATOM   1733 O O     . TYR E 3 83 ? -12.352 2.982   7.793  1.00 16.74 ? 83  TYR C O     1 
ATOM   1734 C CB    . TYR E 3 83 ? -9.710  1.582   9.488  1.00 16.88 ? 83  TYR C CB    1 
ATOM   1735 C CG    . TYR E 3 83 ? -8.611  0.544   9.472  1.00 17.32 ? 83  TYR C CG    1 
ATOM   1736 C CD1   . TYR E 3 83 ? -7.634  0.549   8.480  1.00 16.61 ? 83  TYR C CD1   1 
ATOM   1737 C CD2   . TYR E 3 83 ? -8.557  -0.453  10.444 1.00 17.25 ? 83  TYR C CD2   1 
ATOM   1738 C CE1   . TYR E 3 83 ? -6.624  -0.415  8.457  1.00 18.21 ? 83  TYR C CE1   1 
ATOM   1739 C CE2   . TYR E 3 83 ? -7.555  -1.421  10.430 1.00 17.89 ? 83  TYR C CE2   1 
ATOM   1740 C CZ    . TYR E 3 83 ? -6.593  -1.394  9.434  1.00 18.06 ? 83  TYR C CZ    1 
ATOM   1741 O OH    . TYR E 3 83 ? -5.600  -2.342  9.409  1.00 18.35 ? 83  TYR C OH    1 
ATOM   1742 N N     . LYS E 3 84 ? -12.594 2.219   9.897  1.00 16.54 ? 84  LYS C N     1 
ATOM   1743 C CA    . LYS E 3 84 ? -13.754 3.058   10.180 1.00 17.40 ? 84  LYS C CA    1 
ATOM   1744 C C     . LYS E 3 84 ? -13.771 3.650   11.583 1.00 18.04 ? 84  LYS C C     1 
ATOM   1745 O O     . LYS E 3 84 ? -13.688 2.910   12.568 1.00 17.39 ? 84  LYS C O     1 
ATOM   1746 C CB    . LYS E 3 84 ? -15.025 2.217   9.980  1.00 16.55 ? 84  LYS C CB    1 
ATOM   1747 C CG    . LYS E 3 84 ? -16.355 2.897   10.333 1.00 17.73 ? 84  LYS C CG    1 
ATOM   1748 C CD    . LYS E 3 84 ? -17.517 1.890   10.218 1.00 17.46 ? 84  LYS C CD    1 
ATOM   1749 C CE    . LYS E 3 84 ? -18.888 2.557   10.327 1.00 17.82 ? 84  LYS C CE    1 
ATOM   1750 N NZ    . LYS E 3 84 ? -19.244 3.353   9.110  1.00 16.65 ? 84  LYS C NZ    1 
ATOM   1751 N N     . PHE E 3 85 ? -13.872 4.976   11.680 1.00 17.92 ? 85  PHE C N     1 
ATOM   1752 C CA    . PHE E 3 85 ? -13.964 5.610   12.993 1.00 20.64 ? 85  PHE C CA    1 
ATOM   1753 C C     . PHE E 3 85 ? -15.418 5.386   13.411 1.00 21.77 ? 85  PHE C C     1 
ATOM   1754 O O     . PHE E 3 85 ? -16.330 5.798   12.690 1.00 18.97 ? 85  PHE C O     1 
ATOM   1755 C CB    . PHE E 3 85 ? -13.710 7.120   12.921 1.00 21.10 ? 85  PHE C CB    1 
ATOM   1756 C CG    . PHE E 3 85 ? -12.283 7.504   12.635 1.00 22.40 ? 85  PHE C CG    1 
ATOM   1757 C CD1   . PHE E 3 85 ? -11.350 7.569   13.663 1.00 23.43 ? 85  PHE C CD1   1 
ATOM   1758 C CD2   . PHE E 3 85 ? -11.891 7.872   11.356 1.00 23.24 ? 85  PHE C CD2   1 
ATOM   1759 C CE1   . PHE E 3 85 ? -10.046 8.005   13.423 1.00 23.11 ? 85  PHE C CE1   1 
ATOM   1760 C CE2   . PHE E 3 85 ? -10.588 8.311   11.107 1.00 24.20 ? 85  PHE C CE2   1 
ATOM   1761 C CZ    . PHE E 3 85 ? -9.667  8.376   12.148 1.00 22.98 ? 85  PHE C CZ    1 
ATOM   1762 N N     . VAL E 3 86 ? -15.649 4.750   14.559 1.00 24.16 ? 86  VAL C N     1 
ATOM   1763 C CA    . VAL E 3 86 ? -17.026 4.501   14.981 1.00 27.36 ? 86  VAL C CA    1 
ATOM   1764 C C     . VAL E 3 86 ? -17.695 5.735   15.595 1.00 29.84 ? 86  VAL C C     1 
ATOM   1765 O O     . VAL E 3 86 ? -18.920 5.844   15.586 1.00 28.28 ? 86  VAL C O     1 
ATOM   1766 C CB    . VAL E 3 86 ? -17.132 3.288   15.958 1.00 26.76 ? 86  VAL C CB    1 
ATOM   1767 C CG1   . VAL E 3 86 ? -15.851 2.487   15.944 1.00 27.33 ? 86  VAL C CG1   1 
ATOM   1768 C CG2   . VAL E 3 86 ? -17.489 3.753   17.351 1.00 28.31 ? 86  VAL C CG2   1 
ATOM   1769 N N     . SER E 3 87 ? -16.901 6.653   16.138 1.00 33.42 ? 87  SER C N     1 
ATOM   1770 C CA    . SER E 3 87 ? -17.441 7.896   16.698 1.00 38.21 ? 87  SER C CA    1 
ATOM   1771 C C     . SER E 3 87 ? -17.174 9.013   15.697 1.00 42.37 ? 87  SER C C     1 
ATOM   1772 O O     . SER E 3 87 ? -16.024 9.397   15.485 1.00 43.44 ? 87  SER C O     1 
ATOM   1773 C CB    . SER E 3 87 ? -16.779 8.240   18.031 1.00 38.04 ? 87  SER C CB    1 
ATOM   1774 O OG    . SER E 3 87 ? -17.370 7.508   19.089 1.00 37.98 ? 87  SER C OG    1 
ATOM   1775 N N     . TYR E 3 88 ? -18.246 9.518   15.085 1.00 46.51 ? 88  TYR C N     1 
ATOM   1776 C CA    . TYR E 3 88 ? -18.192 10.579  14.075 1.00 49.98 ? 88  TYR C CA    1 
ATOM   1777 C C     . TYR E 3 88 ? -16.939 11.449  14.158 1.00 52.13 ? 88  TYR C C     1 
ATOM   1778 O O     . TYR E 3 88 ? -16.704 12.125  15.161 1.00 52.53 ? 88  TYR C O     1 
ATOM   1779 C CB    . TYR E 3 88 ? -19.454 11.445  14.175 1.00 51.63 ? 88  TYR C CB    1 
ATOM   1780 C CG    . TYR E 3 88 ? -19.737 12.299  12.957 1.00 53.75 ? 88  TYR C CG    1 
ATOM   1781 C CD1   . TYR E 3 88 ? -19.497 11.818  11.668 1.00 54.55 ? 88  TYR C CD1   1 
ATOM   1782 C CD2   . TYR E 3 88 ? -20.280 13.579  13.092 1.00 54.69 ? 88  TYR C CD2   1 
ATOM   1783 C CE1   . TYR E 3 88 ? -19.790 12.593  10.541 1.00 55.81 ? 88  TYR C CE1   1 
ATOM   1784 C CE2   . TYR E 3 88 ? -20.577 14.359  11.976 1.00 55.59 ? 88  TYR C CE2   1 
ATOM   1785 C CZ    . TYR E 3 88 ? -20.330 13.862  10.705 1.00 56.12 ? 88  TYR C CZ    1 
ATOM   1786 O OH    . TYR E 3 88 ? -20.618 14.639  9.604  1.00 57.37 ? 88  TYR C OH    1 
ATOM   1787 N N     . PRO E 3 89 ? -16.115 11.428  13.095 1.00 54.01 ? 89  PRO C N     1 
ATOM   1788 C CA    . PRO E 3 89 ? -14.858 12.174  12.948 1.00 55.99 ? 89  PRO C CA    1 
ATOM   1789 C C     . PRO E 3 89 ? -14.974 13.693  13.084 1.00 57.93 ? 89  PRO C C     1 
ATOM   1790 O O     . PRO E 3 89 ? -14.910 14.417  12.089 1.00 58.41 ? 89  PRO C O     1 
ATOM   1791 C CB    . PRO E 3 89 ? -14.382 11.769  11.555 1.00 55.37 ? 89  PRO C CB    1 
ATOM   1792 C CG    . PRO E 3 89 ? -14.926 10.389  11.405 1.00 55.09 ? 89  PRO C CG    1 
ATOM   1793 C CD    . PRO E 3 89 ? -16.324 10.547  11.934 1.00 54.16 ? 89  PRO C CD    1 
ATOM   1794 N N     . GLU E 3 90 ? -15.127 14.172  14.314 1.00 59.92 ? 90  GLU C N     1 
ATOM   1795 C CA    . GLU E 3 90 ? -15.242 15.603  14.558 1.00 61.64 ? 90  GLU C CA    1 
ATOM   1796 C C     . GLU E 3 90 ? -13.967 16.136  15.210 1.00 62.40 ? 90  GLU C C     1 
ATOM   1797 O O     . GLU E 3 90 ? -14.080 16.828  16.246 1.00 62.90 ? 90  GLU C O     1 
ATOM   1798 C CB    . GLU E 3 90 ? -16.437 15.891  15.469 1.00 62.44 ? 90  GLU C CB    1 
ATOM   1799 C CG    . GLU E 3 90 ? -16.799 17.360  15.553 1.00 64.02 ? 90  GLU C CG    1 
ATOM   1800 C CD    . GLU E 3 90 ? -17.820 17.645  16.628 1.00 65.25 ? 90  GLU C CD    1 
ATOM   1801 O OE1   . GLU E 3 90 ? -18.839 16.924  16.679 1.00 65.94 ? 90  GLU C OE1   1 
ATOM   1802 O OE2   . GLU E 3 90 ? -17.606 18.592  17.419 1.00 65.32 ? 90  GLU C OE2   1 
ATOM   1803 N N     . VAL F 3 5  ? -0.068  20.886  21.604 1.00 29.13 ? 5   VAL F N     1 
ATOM   1804 C CA    . VAL F 3 5  ? 1.009   20.994  20.623 1.00 26.75 ? 5   VAL F CA    1 
ATOM   1805 C C     . VAL F 3 5  ? 1.346   22.461  20.384 1.00 24.99 ? 5   VAL F C     1 
ATOM   1806 O O     . VAL F 3 5  ? 0.451   23.298  20.313 1.00 26.05 ? 5   VAL F O     1 
ATOM   1807 C CB    . VAL F 3 5  ? 0.592   20.369  19.281 1.00 28.99 ? 5   VAL F CB    1 
ATOM   1808 C CG1   . VAL F 3 5  ? -0.648  21.086  18.743 1.00 29.75 ? 5   VAL F CG1   1 
ATOM   1809 C CG2   . VAL F 3 5  ? 1.742   20.452  18.276 1.00 27.60 ? 5   VAL F CG2   1 
ATOM   1810 N N     . THR F 3 6  ? 2.632   22.780  20.268 1.00 21.68 ? 6   THR F N     1 
ATOM   1811 C CA    . THR F 3 6  ? 3.024   24.162  20.026 1.00 19.36 ? 6   THR F CA    1 
ATOM   1812 C C     . THR F 3 6  ? 2.998   24.491  18.536 1.00 17.27 ? 6   THR F C     1 
ATOM   1813 O O     . THR F 3 6  ? 2.997   23.597  17.680 1.00 17.19 ? 6   THR F O     1 
ATOM   1814 C CB    . THR F 3 6  ? 4.440   24.463  20.571 1.00 18.57 ? 6   THR F CB    1 
ATOM   1815 O OG1   . THR F 3 6  ? 5.395   23.618  19.919 1.00 18.52 ? 6   THR F OG1   1 
ATOM   1816 C CG2   . THR F 3 6  ? 4.501   24.216  22.074 1.00 20.91 ? 6   THR F CG2   1 
ATOM   1817 N N     . LEU F 3 7  ? 2.977   25.785  18.238 1.00 16.04 ? 7   LEU F N     1 
ATOM   1818 C CA    . LEU F 3 7  ? 2.963   26.257  16.865 1.00 15.77 ? 7   LEU F CA    1 
ATOM   1819 C C     . LEU F 3 7  ? 4.210   25.752  16.149 1.00 14.88 ? 7   LEU F C     1 
ATOM   1820 O O     . LEU F 3 7  ? 4.117   25.225  15.051 1.00 14.16 ? 7   LEU F O     1 
ATOM   1821 C CB    . LEU F 3 7  ? 2.956   27.789  16.822 1.00 16.43 ? 7   LEU F CB    1 
ATOM   1822 C CG    . LEU F 3 7  ? 2.346   28.515  15.612 1.00 17.76 ? 7   LEU F CG    1 
ATOM   1823 C CD1   . LEU F 3 7  ? 2.983   29.888  15.508 1.00 17.44 ? 7   LEU F CD1   1 
ATOM   1824 C CD2   . LEU F 3 7  ? 2.551   27.751  14.321 1.00 16.44 ? 7   LEU F CD2   1 
ATOM   1825 N N     . TRP F 3 8  ? 5.380   25.900  16.766 1.00 15.82 ? 8   TRP F N     1 
ATOM   1826 C CA    . TRP F 3 8  ? 6.594   25.455  16.092 1.00 17.10 ? 8   TRP F CA    1 
ATOM   1827 C C     . TRP F 3 8  ? 6.613   23.947  15.842 1.00 17.23 ? 8   TRP F C     1 
ATOM   1828 O O     . TRP F 3 8  ? 7.086   23.498  14.798 1.00 17.08 ? 8   TRP F O     1 
ATOM   1829 C CB    . TRP F 3 8  ? 7.855   25.903  16.848 1.00 18.41 ? 8   TRP F CB    1 
ATOM   1830 C CG    . TRP F 3 8  ? 8.039   25.335  18.224 1.00 20.06 ? 8   TRP F CG    1 
ATOM   1831 C CD1   . TRP F 3 8  ? 7.710   25.934  19.408 1.00 19.28 ? 8   TRP F CD1   1 
ATOM   1832 C CD2   . TRP F 3 8  ? 8.633   24.076  18.562 1.00 19.57 ? 8   TRP F CD2   1 
ATOM   1833 N NE1   . TRP F 3 8  ? 8.065   25.127  20.462 1.00 19.77 ? 8   TRP F NE1   1 
ATOM   1834 C CE2   . TRP F 3 8  ? 8.632   23.980  19.974 1.00 20.38 ? 8   TRP F CE2   1 
ATOM   1835 C CE3   . TRP F 3 8  ? 9.166   23.018  17.810 1.00 20.95 ? 8   TRP F CE3   1 
ATOM   1836 C CZ2   . TRP F 3 8  ? 9.148   22.866  20.653 1.00 20.61 ? 8   TRP F CZ2   1 
ATOM   1837 C CZ3   . TRP F 3 8  ? 9.682   21.907  18.486 1.00 20.33 ? 8   TRP F CZ3   1 
ATOM   1838 C CH2   . TRP F 3 8  ? 9.666   21.841  19.894 1.00 20.79 ? 8   TRP F CH2   1 
ATOM   1839 N N     . GLN F 3 9  ? 6.080   23.167  16.775 1.00 17.18 ? 9   GLN F N     1 
ATOM   1840 C CA    . GLN F 3 9  ? 6.036   21.718  16.595 1.00 18.44 ? 9   GLN F CA    1 
ATOM   1841 C C     . GLN F 3 9  ? 5.113   21.390  15.433 1.00 17.49 ? 9   GLN F C     1 
ATOM   1842 O O     . GLN F 3 9  ? 5.421   20.530  14.610 1.00 17.77 ? 9   GLN F O     1 
ATOM   1843 C CB    . GLN F 3 9  ? 5.514   21.020  17.852 1.00 22.14 ? 9   GLN F CB    1 
ATOM   1844 C CG    . GLN F 3 9  ? 6.436   21.114  19.050 1.00 27.64 ? 9   GLN F CG    1 
ATOM   1845 C CD    . GLN F 3 9  ? 5.851   20.449  20.286 1.00 30.73 ? 9   GLN F CD    1 
ATOM   1846 O OE1   . GLN F 3 9  ? 4.827   20.886  20.821 1.00 31.62 ? 9   GLN F OE1   1 
ATOM   1847 N NE2   . GLN F 3 9  ? 6.499   19.382  20.743 1.00 32.70 ? 9   GLN F NE2   1 
ATOM   1848 N N     . PHE F 3 10 ? 3.976   22.080  15.384 1.00 16.07 ? 10  PHE F N     1 
ATOM   1849 C CA    . PHE F 3 10 ? 2.989   21.885  14.329 1.00 15.29 ? 10  PHE F CA    1 
ATOM   1850 C C     . PHE F 3 10 ? 3.610   22.173  12.972 1.00 14.85 ? 10  PHE F C     1 
ATOM   1851 O O     . PHE F 3 10 ? 3.447   21.401  12.030 1.00 15.22 ? 10  PHE F O     1 
ATOM   1852 C CB    . PHE F 3 10 ? 1.788   22.816  14.549 1.00 14.21 ? 10  PHE F CB    1 
ATOM   1853 C CG    . PHE F 3 10 ? 0.867   22.910  13.368 1.00 14.99 ? 10  PHE F CG    1 
ATOM   1854 C CD1   . PHE F 3 10 ? 0.118   21.808  12.959 1.00 15.98 ? 10  PHE F CD1   1 
ATOM   1855 C CD2   . PHE F 3 10 ? 0.733   24.106  12.672 1.00 16.39 ? 10  PHE F CD2   1 
ATOM   1856 C CE1   . PHE F 3 10 ? -0.754  21.895  11.874 1.00 16.29 ? 10  PHE F CE1   1 
ATOM   1857 C CE2   . PHE F 3 10 ? -0.141  24.206  11.579 1.00 16.53 ? 10  PHE F CE2   1 
ATOM   1858 C CZ    . PHE F 3 10 ? -0.884  23.101  11.183 1.00 16.74 ? 10  PHE F CZ    1 
ATOM   1859 N N     . LEU F 3 11 ? 4.316   23.293  12.868 1.00 14.30 ? 11  LEU F N     1 
ATOM   1860 C CA    . LEU F 3 11 ? 4.955   23.654  11.612 1.00 14.95 ? 11  LEU F CA    1 
ATOM   1861 C C     . LEU F 3 11 ? 5.923   22.542  11.181 1.00 15.10 ? 11  LEU F C     1 
ATOM   1862 O O     . LEU F 3 11 ? 5.973   22.165  10.001 1.00 14.48 ? 11  LEU F O     1 
ATOM   1863 C CB    . LEU F 3 11 ? 5.697   24.982  11.772 1.00 15.66 ? 11  LEU F CB    1 
ATOM   1864 C CG    . LEU F 3 11 ? 5.094   26.287  11.223 1.00 18.64 ? 11  LEU F CG    1 
ATOM   1865 C CD1   . LEU F 3 11 ? 3.590   26.187  11.013 1.00 15.78 ? 11  LEU F CD1   1 
ATOM   1866 C CD2   . LEU F 3 11 ? 5.457   27.414  12.176 1.00 16.35 ? 11  LEU F CD2   1 
ATOM   1867 N N     . LEU F 3 12 ? 6.684   22.027  12.142 1.00 12.74 ? 12  LEU F N     1 
ATOM   1868 C CA    . LEU F 3 12 ? 7.639   20.956  11.877 1.00 15.22 ? 12  LEU F CA    1 
ATOM   1869 C C     . LEU F 3 12 ? 6.891   19.718  11.364 1.00 14.48 ? 12  LEU F C     1 
ATOM   1870 O O     . LEU F 3 12 ? 7.347   19.041  10.441 1.00 14.13 ? 12  LEU F O     1 
ATOM   1871 C CB    . LEU F 3 12 ? 8.417   20.637  13.159 1.00 17.24 ? 12  LEU F CB    1 
ATOM   1872 C CG    . LEU F 3 12 ? 9.938   20.841  13.213 1.00 20.77 ? 12  LEU F CG    1 
ATOM   1873 C CD1   . LEU F 3 12 ? 10.409  21.848  12.181 1.00 19.05 ? 12  LEU F CD1   1 
ATOM   1874 C CD2   . LEU F 3 12 ? 10.327  21.274  14.622 1.00 20.35 ? 12  LEU F CD2   1 
ATOM   1875 N N     . GLN F 3 13 ? 5.735   19.433  11.957 1.00 13.19 ? 13  GLN F N     1 
ATOM   1876 C CA    . GLN F 3 13 ? 4.925   18.297  11.524 1.00 14.75 ? 13  GLN F CA    1 
ATOM   1877 C C     . GLN F 3 13 ? 4.444   18.469  10.078 1.00 15.29 ? 13  GLN F C     1 
ATOM   1878 O O     . GLN F 3 13 ? 4.542   17.541  9.275  1.00 15.58 ? 13  GLN F O     1 
ATOM   1879 C CB    . GLN F 3 13 ? 3.739   18.104  12.478 1.00 13.23 ? 13  GLN F CB    1 
ATOM   1880 C CG    . GLN F 3 13 ? 4.196   17.571  13.833 1.00 16.29 ? 13  GLN F CG    1 
ATOM   1881 C CD    . GLN F 3 13 ? 3.098   17.460  14.876 1.00 17.30 ? 13  GLN F CD    1 
ATOM   1882 O OE1   . GLN F 3 13 ? 3.370   17.100  16.027 1.00 18.89 ? 13  GLN F OE1   1 
ATOM   1883 N NE2   . GLN F 3 13 ? 1.862   17.771  14.493 1.00 15.89 ? 13  GLN F NE2   1 
ATOM   1884 N N     . LEU F 3 14 ? 3.939   19.655  9.744  1.00 15.85 ? 14  LEU F N     1 
ATOM   1885 C CA    . LEU F 3 14 ? 3.465   19.923  8.382  1.00 16.16 ? 14  LEU F CA    1 
ATOM   1886 C C     . LEU F 3 14 ? 4.567   19.744  7.352  1.00 16.30 ? 14  LEU F C     1 
ATOM   1887 O O     . LEU F 3 14 ? 4.354   19.147  6.297  1.00 15.80 ? 14  LEU F O     1 
ATOM   1888 C CB    . LEU F 3 14 ? 2.934   21.353  8.252  1.00 18.54 ? 14  LEU F CB    1 
ATOM   1889 C CG    . LEU F 3 14 ? 1.495   21.644  8.652  1.00 19.71 ? 14  LEU F CG    1 
ATOM   1890 C CD1   . LEU F 3 14 ? 1.145   23.071  8.192  1.00 19.12 ? 14  LEU F CD1   1 
ATOM   1891 C CD2   . LEU F 3 14 ? 0.560   20.621  7.999  1.00 18.55 ? 14  LEU F CD2   1 
ATOM   1892 N N     . LEU F 3 15 ? 5.740   20.284  7.655  1.00 15.52 ? 15  LEU F N     1 
ATOM   1893 C CA    . LEU F 3 15 ? 6.882   20.191  6.757  1.00 17.86 ? 15  LEU F CA    1 
ATOM   1894 C C     . LEU F 3 15 ? 7.307   18.748  6.544  1.00 19.19 ? 15  LEU F C     1 
ATOM   1895 O O     . LEU F 3 15 ? 7.736   18.363  5.457  1.00 19.31 ? 15  LEU F O     1 
ATOM   1896 C CB    . LEU F 3 15 ? 8.059   20.995  7.322  1.00 16.44 ? 15  LEU F CB    1 
ATOM   1897 C CG    . LEU F 3 15 ? 7.950   22.507  7.101  1.00 16.35 ? 15  LEU F CG    1 
ATOM   1898 C CD1   . LEU F 3 15 ? 8.817   23.249  8.101  1.00 15.35 ? 15  LEU F CD1   1 
ATOM   1899 C CD2   . LEU F 3 15 ? 8.344   22.831  5.668  1.00 15.40 ? 15  LEU F CD2   1 
ATOM   1900 N N     . ARG F 3 16 ? 7.174   17.950  7.589  1.00 19.68 ? 16  ARG F N     1 
ATOM   1901 C CA    . ARG F 3 16 ? 7.561   16.552  7.531  1.00 21.50 ? 16  ARG F CA    1 
ATOM   1902 C C     . ARG F 3 16 ? 6.476   15.697  6.876  1.00 22.14 ? 16  ARG F C     1 
ATOM   1903 O O     . ARG F 3 16 ? 6.771   14.793  6.097  1.00 20.28 ? 16  ARG F O     1 
ATOM   1904 C CB    . ARG F 3 16 ? 7.841   16.072  8.962  1.00 22.71 ? 16  ARG F CB    1 
ATOM   1905 C CG    . ARG F 3 16 ? 8.394   14.674  9.101  1.00 26.27 ? 16  ARG F CG    1 
ATOM   1906 C CD    . ARG F 3 16 ? 8.861   14.437  10.530 1.00 26.31 ? 16  ARG F CD    1 
ATOM   1907 N NE    . ARG F 3 16 ? 7.753   14.360  11.477 1.00 27.51 ? 16  ARG F NE    1 
ATOM   1908 C CZ    . ARG F 3 16 ? 7.690   15.044  12.617 1.00 28.97 ? 16  ARG F CZ    1 
ATOM   1909 N NH1   . ARG F 3 16 ? 8.673   15.869  12.956 1.00 28.40 ? 16  ARG F NH1   1 
ATOM   1910 N NH2   . ARG F 3 16 ? 6.649   14.891  13.427 1.00 27.76 ? 16  ARG F NH2   1 
ATOM   1911 N N     . GLU F 3 17 ? 5.218   16.027  7.160  1.00 22.40 ? 17  GLU F N     1 
ATOM   1912 C CA    . GLU F 3 17 ? 4.089   15.255  6.666  1.00 23.27 ? 17  GLU F CA    1 
ATOM   1913 C C     . GLU F 3 17 ? 3.463   15.582  5.313  1.00 24.96 ? 17  GLU F C     1 
ATOM   1914 O O     . GLU F 3 17 ? 2.885   14.699  4.684  1.00 24.69 ? 17  GLU F O     1 
ATOM   1915 C CB    . GLU F 3 17 ? 3.015   15.220  7.761  1.00 22.77 ? 17  GLU F CB    1 
ATOM   1916 C CG    . GLU F 3 17 ? 3.440   14.321  8.927  1.00 22.39 ? 17  GLU F CG    1 
ATOM   1917 C CD    . GLU F 3 17 ? 2.752   14.627  10.252 1.00 20.98 ? 17  GLU F CD    1 
ATOM   1918 O OE1   . GLU F 3 17 ? 1.657   15.227  10.260 1.00 19.06 ? 17  GLU F OE1   1 
ATOM   1919 O OE2   . GLU F 3 17 ? 3.314   14.239  11.300 1.00 20.52 ? 17  GLU F OE2   1 
ATOM   1920 N N     . GLN F 3 18 ? 3.570   16.826  4.859  1.00 26.39 ? 18  GLN F N     1 
ATOM   1921 C CA    . GLN F 3 18 ? 3.007   17.205  3.562  1.00 28.20 ? 18  GLN F CA    1 
ATOM   1922 C C     . GLN F 3 18 ? 3.724   16.436  2.451  1.00 29.39 ? 18  GLN F C     1 
ATOM   1923 O O     . GLN F 3 18 ? 4.936   16.225  2.514  1.00 29.41 ? 18  GLN F O     1 
ATOM   1924 C CB    . GLN F 3 18 ? 3.170   18.714  3.327  1.00 28.75 ? 18  GLN F CB    1 
ATOM   1925 C CG    . GLN F 3 18 ? 2.276   19.592  4.198  1.00 29.08 ? 18  GLN F CG    1 
ATOM   1926 C CD    . GLN F 3 18 ? 0.839   19.634  3.710  1.00 30.23 ? 18  GLN F CD    1 
ATOM   1927 O OE1   . GLN F 3 18 ? 0.537   20.241  2.679  1.00 29.84 ? 18  GLN F OE1   1 
ATOM   1928 N NE2   . GLN F 3 18 ? -0.053  18.984  4.446  1.00 29.87 ? 18  GLN F NE2   1 
ATOM   1929 N N     . GLY F 3 19 ? 2.984   16.009  1.436  1.00 30.09 ? 19  GLY F N     1 
ATOM   1930 C CA    . GLY F 3 19 ? 3.620   15.278  0.350  1.00 32.32 ? 19  GLY F CA    1 
ATOM   1931 C C     . GLY F 3 19 ? 4.244   16.207  -0.682 1.00 33.32 ? 19  GLY F C     1 
ATOM   1932 O O     . GLY F 3 19 ? 4.984   15.772  -1.568 1.00 33.65 ? 19  GLY F O     1 
ATOM   1933 N N     . ASN F 3 20 ? 3.955   17.499  -0.557 1.00 32.77 ? 20  ASN F N     1 
ATOM   1934 C CA    . ASN F 3 20 ? 4.456   18.494  -1.495 1.00 32.35 ? 20  ASN F CA    1 
ATOM   1935 C C     . ASN F 3 20 ? 4.614   19.850  -0.813 1.00 31.73 ? 20  ASN F C     1 
ATOM   1936 O O     . ASN F 3 20 ? 4.475   19.964  0.407  1.00 30.48 ? 20  ASN F O     1 
ATOM   1937 C CB    . ASN F 3 20 ? 3.479   18.630  -2.656 1.00 33.00 ? 20  ASN F CB    1 
ATOM   1938 C CG    . ASN F 3 20 ? 2.056   18.843  -2.181 1.00 34.41 ? 20  ASN F CG    1 
ATOM   1939 O OD1   . ASN F 3 20 ? 1.213   17.953  -2.294 1.00 35.24 ? 20  ASN F OD1   1 
ATOM   1940 N ND2   . ASN F 3 20 ? 1.787   20.021  -1.622 1.00 34.05 ? 20  ASN F ND2   1 
ATOM   1941 N N     . GLY F 3 21 ? 4.885   20.876  -1.615 1.00 30.54 ? 21  GLY F N     1 
ATOM   1942 C CA    . GLY F 3 21 ? 5.070   22.208  -1.072 1.00 29.90 ? 21  GLY F CA    1 
ATOM   1943 C C     . GLY F 3 21 ? 3.994   23.196  -1.466 1.00 29.37 ? 21  GLY F C     1 
ATOM   1944 O O     . GLY F 3 21 ? 4.264   24.384  -1.604 1.00 29.39 ? 21  GLY F O     1 
ATOM   1945 N N     . HIS F 3 22 ? 2.770   22.714  -1.641 1.00 28.83 ? 22  HIS F N     1 
ATOM   1946 C CA    . HIS F 3 22 ? 1.669   23.586  -2.015 1.00 28.37 ? 22  HIS F CA    1 
ATOM   1947 C C     . HIS F 3 22 ? 1.247   24.557  -0.905 1.00 26.05 ? 22  HIS F C     1 
ATOM   1948 O O     . HIS F 3 22 ? 0.723   25.625  -1.208 1.00 26.19 ? 22  HIS F O     1 
ATOM   1949 C CB    . HIS F 3 22 ? 0.469   22.752  -2.480 1.00 30.99 ? 22  HIS F CB    1 
ATOM   1950 C CG    . HIS F 3 22 ? 0.678   22.079  -3.804 1.00 35.22 ? 22  HIS F CG    1 
ATOM   1951 N ND1   . HIS F 3 22 ? -0.216  21.167  -4.325 1.00 36.37 ? 22  HIS F ND1   1 
ATOM   1952 C CD2   . HIS F 3 22 ? 1.679   22.185  -4.710 1.00 36.15 ? 22  HIS F CD2   1 
ATOM   1953 C CE1   . HIS F 3 22 ? 0.229   20.737  -5.493 1.00 37.55 ? 22  HIS F CE1   1 
ATOM   1954 N NE2   . HIS F 3 22 ? 1.377   21.340  -5.750 1.00 37.85 ? 22  HIS F NE2   1 
ATOM   1955 N N     . ILE F 3 23 ? 1.448   24.207  0.367  1.00 23.19 ? 23  ILE F N     1 
ATOM   1956 C CA    . ILE F 3 23 ? 1.081   25.143  1.433  1.00 21.61 ? 23  ILE F CA    1 
ATOM   1957 C C     . ILE F 3 23 ? 2.269   25.561  2.309  1.00 20.55 ? 23  ILE F C     1 
ATOM   1958 O O     . ILE F 3 23 ? 2.303   26.684  2.823  1.00 20.11 ? 23  ILE F O     1 
ATOM   1959 C CB    . ILE F 3 23 ? -0.065  24.607  2.332  1.00 22.45 ? 23  ILE F CB    1 
ATOM   1960 C CG1   . ILE F 3 23 ? 0.447   23.543  3.295  1.00 22.47 ? 23  ILE F CG1   1 
ATOM   1961 C CG2   . ILE F 3 23 ? -1.185  24.045  1.456  1.00 22.57 ? 23  ILE F CG2   1 
ATOM   1962 C CD1   . ILE F 3 23 ? -0.597  23.118  4.309  1.00 22.78 ? 23  ILE F CD1   1 
ATOM   1963 N N     . ILE F 3 24 ? 3.237   24.666  2.485  1.00 18.11 ? 24  ILE F N     1 
ATOM   1964 C CA    . ILE F 3 24 ? 4.430   24.995  3.256  1.00 18.11 ? 24  ILE F CA    1 
ATOM   1965 C C     . ILE F 3 24 ? 5.612   24.269  2.625  1.00 17.79 ? 24  ILE F C     1 
ATOM   1966 O O     . ILE F 3 24 ? 5.456   23.175  2.089  1.00 17.57 ? 24  ILE F O     1 
ATOM   1967 C CB    . ILE F 3 24 ? 4.292   24.604  4.753  1.00 16.75 ? 24  ILE F CB    1 
ATOM   1968 C CG1   . ILE F 3 24 ? 5.433   25.241  5.554  1.00 16.26 ? 24  ILE F CG1   1 
ATOM   1969 C CG2   . ILE F 3 24 ? 4.287   23.089  4.912  1.00 17.78 ? 24  ILE F CG2   1 
ATOM   1970 C CD1   . ILE F 3 24 ? 5.312   25.071  7.080  1.00 15.27 ? 24  ILE F CD1   1 
ATOM   1971 N N     . SER F 3 25 ? 6.787   24.884  2.674  1.00 17.10 ? 25  SER F N     1 
ATOM   1972 C CA    . SER F 3 25 ? 7.970   24.278  2.073  1.00 17.71 ? 25  SER F CA    1 
ATOM   1973 C C     . SER F 3 25 ? 9.264   24.811  2.666  1.00 17.45 ? 25  SER F C     1 
ATOM   1974 O O     . SER F 3 25 ? 9.331   25.973  3.074  1.00 18.00 ? 25  SER F O     1 
ATOM   1975 C CB    . SER F 3 25 ? 7.985   24.553  0.560  1.00 17.99 ? 25  SER F CB    1 
ATOM   1976 O OG    . SER F 3 25 ? 9.217   24.157  -0.027 1.00 18.38 ? 25  SER F OG    1 
ATOM   1977 N N     . TRP F 3 26 ? 10.282  23.956  2.727  1.00 17.24 ? 26  TRP F N     1 
ATOM   1978 C CA    . TRP F 3 26 ? 11.585  24.388  3.206  1.00 19.03 ? 26  TRP F CA    1 
ATOM   1979 C C     . TRP F 3 26 ? 12.106  25.251  2.059  1.00 20.52 ? 26  TRP F C     1 
ATOM   1980 O O     . TRP F 3 26 ? 11.810  24.978  0.887  1.00 21.35 ? 26  TRP F O     1 
ATOM   1981 C CB    . TRP F 3 26 ? 12.559  23.207  3.388  1.00 17.78 ? 26  TRP F CB    1 
ATOM   1982 C CG    . TRP F 3 26 ? 12.308  22.316  4.578  1.00 16.70 ? 26  TRP F CG    1 
ATOM   1983 C CD1   . TRP F 3 26 ? 11.872  21.024  4.552  1.00 17.01 ? 26  TRP F CD1   1 
ATOM   1984 C CD2   . TRP F 3 26 ? 12.463  22.658  5.964  1.00 16.57 ? 26  TRP F CD2   1 
ATOM   1985 N NE1   . TRP F 3 26 ? 11.741  20.540  5.833  1.00 16.82 ? 26  TRP F NE1   1 
ATOM   1986 C CE2   . TRP F 3 26 ? 12.097  21.522  6.718  1.00 16.52 ? 26  TRP F CE2   1 
ATOM   1987 C CE3   . TRP F 3 26 ? 12.872  23.816  6.640  1.00 16.21 ? 26  TRP F CE3   1 
ATOM   1988 C CZ2   . TRP F 3 26 ? 12.128  21.507  8.118  1.00 17.83 ? 26  TRP F CZ2   1 
ATOM   1989 C CZ3   . TRP F 3 26 ? 12.901  23.805  8.030  1.00 17.59 ? 26  TRP F CZ3   1 
ATOM   1990 C CH2   . TRP F 3 26 ? 12.528  22.654  8.755  1.00 18.20 ? 26  TRP F CH2   1 
ATOM   1991 N N     . THR F 3 27 ? 12.851  26.299  2.386  1.00 21.35 ? 27  THR F N     1 
ATOM   1992 C CA    . THR F 3 27 ? 13.447  27.141  1.357  1.00 22.46 ? 27  THR F CA    1 
ATOM   1993 C C     . THR F 3 27 ? 14.910  26.722  1.379  1.00 23.56 ? 27  THR F C     1 
ATOM   1994 O O     . THR F 3 27 ? 15.507  26.440  0.346  1.00 24.42 ? 27  THR F O     1 
ATOM   1995 C CB    . THR F 3 27 ? 13.289  28.637  1.680  1.00 21.46 ? 27  THR F CB    1 
ATOM   1996 O OG1   . THR F 3 27 ? 13.812  28.909  2.982  1.00 22.01 ? 27  THR F OG1   1 
ATOM   1997 C CG2   . THR F 3 27 ? 11.816  29.025  1.630  1.00 20.95 ? 27  THR F CG2   1 
ATOM   1998 N N     . SER F 3 28 ? 15.471  26.656  2.580  1.00 24.61 ? 28  SER F N     1 
ATOM   1999 C CA    . SER F 3 28 ? 16.840  26.195  2.771  1.00 25.90 ? 28  SER F CA    1 
ATOM   2000 C C     . SER F 3 28 ? 16.768  25.339  4.025  1.00 26.81 ? 28  SER F C     1 
ATOM   2001 O O     . SER F 3 28 ? 16.851  25.847  5.143  1.00 26.77 ? 28  SER F O     1 
ATOM   2002 C CB    . SER F 3 28 ? 17.803  27.364  2.978  1.00 26.00 ? 28  SER F CB    1 
ATOM   2003 O OG    . SER F 3 28 ? 19.122  26.884  3.180  1.00 27.64 ? 28  SER F OG    1 
ATOM   2004 N N     . ARG F 3 29 ? 16.594  24.037  3.835  1.00 27.63 ? 29  ARG F N     1 
ATOM   2005 C CA    . ARG F 3 29 ? 16.467  23.123  4.961  1.00 29.13 ? 29  ARG F CA    1 
ATOM   2006 C C     . ARG F 3 29 ? 17.634  23.047  5.944  1.00 29.48 ? 29  ARG F C     1 
ATOM   2007 O O     . ARG F 3 29 ? 17.414  23.111  7.152  1.00 28.97 ? 29  ARG F O     1 
ATOM   2008 C CB    . ARG F 3 29 ? 16.136  21.721  4.464  1.00 29.79 ? 29  ARG F CB    1 
ATOM   2009 C CG    . ARG F 3 29 ? 15.856  20.739  5.590  1.00 30.59 ? 29  ARG F CG    1 
ATOM   2010 C CD    . ARG F 3 29 ? 15.516  19.379  5.019  1.00 32.43 ? 29  ARG F CD    1 
ATOM   2011 N NE    . ARG F 3 29 ? 15.161  18.416  6.053  1.00 32.62 ? 29  ARG F NE    1 
ATOM   2012 C CZ    . ARG F 3 29 ? 14.808  17.162  5.802  1.00 32.97 ? 29  ARG F CZ    1 
ATOM   2013 N NH1   . ARG F 3 29 ? 14.764  16.726  4.550  1.00 32.18 ? 29  ARG F NH1   1 
ATOM   2014 N NH2   . ARG F 3 29 ? 14.510  16.344  6.802  1.00 33.82 ? 29  ARG F NH2   1 
ATOM   2015 N N     . ASP F 3 30 ? 18.869  22.894  5.471  1.00 30.58 ? 30  ASP F N     1 
ATOM   2016 C CA    . ASP F 3 30 ? 19.955  22.820  6.439  1.00 31.73 ? 30  ASP F CA    1 
ATOM   2017 C C     . ASP F 3 30 ? 20.009  24.097  7.274  1.00 31.19 ? 30  ASP F C     1 
ATOM   2018 O O     . ASP F 3 30 ? 20.509  24.090  8.402  1.00 31.23 ? 30  ASP F O     1 
ATOM   2019 C CB    . ASP F 3 30 ? 21.313  22.529  5.772  1.00 34.83 ? 30  ASP F CB    1 
ATOM   2020 C CG    . ASP F 3 30 ? 21.427  23.086  4.370  1.00 37.99 ? 30  ASP F CG    1 
ATOM   2021 O OD1   . ASP F 3 30 ? 21.402  24.325  4.210  1.00 38.99 ? 30  ASP F OD1   1 
ATOM   2022 O OD2   . ASP F 3 30 ? 21.555  22.271  3.426  1.00 39.52 ? 30  ASP F OD2   1 
ATOM   2023 N N     . GLY F 3 31 ? 19.459  25.181  6.727  1.00 28.88 ? 31  GLY F N     1 
ATOM   2024 C CA    . GLY F 3 31 ? 19.422  26.443  7.444  1.00 26.85 ? 31  GLY F CA    1 
ATOM   2025 C C     . GLY F 3 31 ? 18.175  26.574  8.314  1.00 25.40 ? 31  GLY F C     1 
ATOM   2026 O O     . GLY F 3 31 ? 18.040  27.533  9.076  1.00 24.54 ? 31  GLY F O     1 
ATOM   2027 N N     . GLY F 3 32 ? 17.265  25.607  8.200  1.00 22.94 ? 32  GLY F N     1 
ATOM   2028 C CA    . GLY F 3 32 ? 16.036  25.627  8.973  1.00 21.15 ? 32  GLY F CA    1 
ATOM   2029 C C     . GLY F 3 32 ? 15.053  26.689  8.502  1.00 20.60 ? 32  GLY F C     1 
ATOM   2030 O O     . GLY F 3 32 ? 14.119  27.047  9.217  1.00 20.60 ? 32  GLY F O     1 
ATOM   2031 N N     . GLU F 3 33 ? 15.261  27.189  7.290  1.00 20.03 ? 33  GLU F N     1 
ATOM   2032 C CA    . GLU F 3 33 ? 14.402  28.220  6.719  1.00 19.15 ? 33  GLU F CA    1 
ATOM   2033 C C     . GLU F 3 33 ? 13.284  27.603  5.879  1.00 18.31 ? 33  GLU F C     1 
ATOM   2034 O O     . GLU F 3 33 ? 13.514  26.686  5.086  1.00 16.69 ? 33  GLU F O     1 
ATOM   2035 C CB    . GLU F 3 33 ? 15.257  29.186  5.899  1.00 19.63 ? 33  GLU F CB    1 
ATOM   2036 C CG    . GLU F 3 33 ? 16.367  29.808  6.740  1.00 21.00 ? 33  GLU F CG    1 
ATOM   2037 C CD    . GLU F 3 33 ? 17.332  30.673  5.942  1.00 23.92 ? 33  GLU F CD    1 
ATOM   2038 O OE1   . GLU F 3 33 ? 17.127  30.849  4.719  1.00 22.63 ? 33  GLU F OE1   1 
ATOM   2039 O OE2   . GLU F 3 33 ? 18.301  31.181  6.552  1.00 24.05 ? 33  GLU F OE2   1 
ATOM   2040 N N     . PHE F 3 34 ? 12.072  28.110  6.077  1.00 17.85 ? 34  PHE F N     1 
ATOM   2041 C CA    . PHE F 3 34 ? 10.890  27.595  5.392  1.00 17.62 ? 34  PHE F CA    1 
ATOM   2042 C C     . PHE F 3 34 ? 9.940   28.718  5.016  1.00 18.59 ? 34  PHE F C     1 
ATOM   2043 O O     . PHE F 3 34 ? 9.964   29.796  5.613  1.00 19.49 ? 34  PHE F O     1 
ATOM   2044 C CB    . PHE F 3 34 ? 10.157  26.606  6.302  1.00 16.24 ? 34  PHE F CB    1 
ATOM   2045 C CG    . PHE F 3 34 ? 9.636   27.223  7.573  1.00 14.52 ? 34  PHE F CG    1 
ATOM   2046 C CD1   . PHE F 3 34 ? 10.481  27.430  8.660  1.00 14.58 ? 34  PHE F CD1   1 
ATOM   2047 C CD2   . PHE F 3 34 ? 8.306   27.618  7.678  1.00 14.52 ? 34  PHE F CD2   1 
ATOM   2048 C CE1   . PHE F 3 34 ? 10.011  28.025  9.837  1.00 14.54 ? 34  PHE F CE1   1 
ATOM   2049 C CE2   . PHE F 3 34 ? 7.821   28.211  8.851  1.00 14.72 ? 34  PHE F CE2   1 
ATOM   2050 C CZ    . PHE F 3 34 ? 8.675   28.415  9.934  1.00 13.62 ? 34  PHE F CZ    1 
ATOM   2051 N N     . LYS F 3 35 ? 9.089   28.449  4.034  1.00 19.03 ? 35  LYS F N     1 
ATOM   2052 C CA    . LYS F 3 35 ? 8.135   29.439  3.579  1.00 19.11 ? 35  LYS F CA    1 
ATOM   2053 C C     . LYS F 3 35 ? 6.704   28.949  3.689  1.00 18.79 ? 35  LYS F C     1 
ATOM   2054 O O     . LYS F 3 35 ? 6.407   27.801  3.357  1.00 18.57 ? 35  LYS F O     1 
ATOM   2055 C CB    . LYS F 3 35 ? 8.407   29.816  2.122  1.00 20.68 ? 35  LYS F CB    1 
ATOM   2056 C CG    . LYS F 3 35 ? 7.415   30.849  1.593  1.00 23.85 ? 35  LYS F CG    1 
ATOM   2057 C CD    . LYS F 3 35 ? 7.497   31.032  0.082  1.00 26.74 ? 35  LYS F CD    1 
ATOM   2058 C CE    . LYS F 3 35 ? 8.854   31.522  -0.362 1.00 28.25 ? 35  LYS F CE    1 
ATOM   2059 N NZ    . LYS F 3 35 ? 8.889   31.682  -1.846 1.00 31.51 ? 35  LYS F NZ    1 
ATOM   2060 N N     . LEU F 3 36 ? 5.818   29.817  4.164  1.00 18.17 ? 36  LEU F N     1 
ATOM   2061 C CA    . LEU F 3 36 ? 4.414   29.464  4.256  1.00 19.24 ? 36  LEU F CA    1 
ATOM   2062 C C     . LEU F 3 36 ? 3.850   29.817  2.881  1.00 20.54 ? 36  LEU F C     1 
ATOM   2063 O O     . LEU F 3 36 ? 3.389   30.943  2.647  1.00 20.46 ? 36  LEU F O     1 
ATOM   2064 C CB    . LEU F 3 36 ? 3.718   30.276  5.357  1.00 19.56 ? 36  LEU F CB    1 
ATOM   2065 C CG    . LEU F 3 36 ? 4.206   30.089  6.802  1.00 19.85 ? 36  LEU F CG    1 
ATOM   2066 C CD1   . LEU F 3 36 ? 3.272   30.840  7.733  1.00 20.26 ? 36  LEU F CD1   1 
ATOM   2067 C CD2   . LEU F 3 36 ? 4.228   28.611  7.182  1.00 18.76 ? 36  LEU F CD2   1 
ATOM   2068 N N     . VAL F 3 37 ? 3.922   28.851  1.968  1.00 20.47 ? 37  VAL F N     1 
ATOM   2069 C CA    . VAL F 3 37 ? 3.454   29.033  0.597  1.00 20.51 ? 37  VAL F CA    1 
ATOM   2070 C C     . VAL F 3 37 ? 1.998   29.478  0.541  1.00 20.43 ? 37  VAL F C     1 
ATOM   2071 O O     . VAL F 3 37 ? 1.645   30.356  -0.244 1.00 20.15 ? 37  VAL F O     1 
ATOM   2072 C CB    . VAL F 3 37 ? 3.654   27.742  -0.213 1.00 21.39 ? 37  VAL F CB    1 
ATOM   2073 C CG1   . VAL F 3 37 ? 3.149   27.928  -1.643 1.00 22.07 ? 37  VAL F CG1   1 
ATOM   2074 C CG2   . VAL F 3 37 ? 5.137   27.380  -0.214 1.00 21.11 ? 37  VAL F CG2   1 
ATOM   2075 N N     . ASP F 3 38 ? 1.155   28.863  1.364  1.00 19.74 ? 38  ASP F N     1 
ATOM   2076 C CA    . ASP F 3 38 ? -0.249  29.239  1.439  1.00 18.73 ? 38  ASP F CA    1 
ATOM   2077 C C     . ASP F 3 38 ? -0.484  29.516  2.920  1.00 18.43 ? 38  ASP F C     1 
ATOM   2078 O O     . ASP F 3 38 ? -0.978  28.670  3.672  1.00 18.87 ? 38  ASP F O     1 
ATOM   2079 C CB    . ASP F 3 38 ? -1.142  28.108  0.937  1.00 19.91 ? 38  ASP F CB    1 
ATOM   2080 C CG    . ASP F 3 38 ? -2.605  28.516  0.843  1.00 20.62 ? 38  ASP F CG    1 
ATOM   2081 O OD1   . ASP F 3 38 ? -2.992  29.543  1.438  1.00 19.49 ? 38  ASP F OD1   1 
ATOM   2082 O OD2   . ASP F 3 38 ? -3.370  27.799  0.174  1.00 21.47 ? 38  ASP F OD2   1 
ATOM   2083 N N     . ALA F 3 39 ? -0.104  30.721  3.322  1.00 17.30 ? 39  ALA F N     1 
ATOM   2084 C CA    . ALA F 3 39 ? -0.185  31.158  4.706  1.00 16.52 ? 39  ALA F CA    1 
ATOM   2085 C C     . ALA F 3 39 ? -1.534  30.995  5.389  1.00 16.13 ? 39  ALA F C     1 
ATOM   2086 O O     . ALA F 3 39 ? -1.599  30.558  6.540  1.00 13.81 ? 39  ALA F O     1 
ATOM   2087 C CB    . ALA F 3 39 ? 0.277   32.594  4.805  1.00 14.87 ? 39  ALA F CB    1 
ATOM   2088 N N     . GLU F 3 40 ? -2.609  31.346  4.689  1.00 16.90 ? 40  GLU F N     1 
ATOM   2089 C CA    . GLU F 3 40 ? -3.942  31.239  5.265  1.00 17.11 ? 40  GLU F CA    1 
ATOM   2090 C C     . GLU F 3 40 ? -4.363  29.783  5.447  1.00 15.99 ? 40  GLU F C     1 
ATOM   2091 O O     . GLU F 3 40 ? -5.110  29.462  6.367  1.00 15.92 ? 40  GLU F O     1 
ATOM   2092 C CB    . GLU F 3 40 ? -4.957  31.982  4.386  1.00 19.25 ? 40  GLU F CB    1 
ATOM   2093 C CG    . GLU F 3 40 ? -4.672  33.485  4.233  1.00 19.54 ? 40  GLU F CG    1 
ATOM   2094 C CD    . GLU F 3 40 ? -4.760  34.241  5.545  1.00 21.42 ? 40  GLU F CD    1 
ATOM   2095 O OE1   . GLU F 3 40 ? -5.307  33.680  6.515  1.00 20.38 ? 40  GLU F OE1   1 
ATOM   2096 O OE2   . GLU F 3 40 ? -4.289  35.402  5.607  1.00 22.87 ? 40  GLU F OE2   1 
ATOM   2097 N N     . GLU F 3 41 ? -3.887  28.899  4.576  1.00 15.88 ? 41  GLU F N     1 
ATOM   2098 C CA    . GLU F 3 41 ? -4.237  27.487  4.697  1.00 16.17 ? 41  GLU F CA    1 
ATOM   2099 C C     . GLU F 3 41 ? -3.468  26.889  5.874  1.00 15.43 ? 41  GLU F C     1 
ATOM   2100 O O     . GLU F 3 41 ? -4.012  26.100  6.639  1.00 15.46 ? 41  GLU F O     1 
ATOM   2101 C CB    . GLU F 3 41 ? -3.916  26.736  3.400  1.00 18.38 ? 41  GLU F CB    1 
ATOM   2102 C CG    . GLU F 3 41 ? -4.370  25.279  3.380  1.00 22.51 ? 41  GLU F CG    1 
ATOM   2103 C CD    . GLU F 3 41 ? -5.797  25.088  3.890  1.00 24.79 ? 41  GLU F CD    1 
ATOM   2104 O OE1   . GLU F 3 41 ? -6.636  25.996  3.697  1.00 24.39 ? 41  GLU F OE1   1 
ATOM   2105 O OE2   . GLU F 3 41 ? -6.079  24.022  4.480  1.00 26.64 ? 41  GLU F OE2   1 
ATOM   2106 N N     . VAL F 3 42 ? -2.202  27.270  6.023  1.00 14.09 ? 42  VAL F N     1 
ATOM   2107 C CA    . VAL F 3 42 ? -1.418  26.777  7.146  1.00 14.71 ? 42  VAL F CA    1 
ATOM   2108 C C     . VAL F 3 42 ? -2.079  27.257  8.434  1.00 14.30 ? 42  VAL F C     1 
ATOM   2109 O O     . VAL F 3 42 ? -2.135  26.531  9.422  1.00 15.67 ? 42  VAL F O     1 
ATOM   2110 C CB    . VAL F 3 42 ? 0.045   27.308  7.126  1.00 14.95 ? 42  VAL F CB    1 
ATOM   2111 C CG1   . VAL F 3 42 ? 0.753   26.935  8.431  1.00 13.54 ? 42  VAL F CG1   1 
ATOM   2112 C CG2   . VAL F 3 42 ? 0.802   26.721  5.944  1.00 14.18 ? 42  VAL F CG2   1 
ATOM   2113 N N     . ALA F 3 43 ? -2.584  28.489  8.419  1.00 14.35 ? 43  ALA F N     1 
ATOM   2114 C CA    . ALA F 3 43 ? -3.222  29.045  9.604  1.00 13.88 ? 43  ALA F CA    1 
ATOM   2115 C C     . ALA F 3 43 ? -4.529  28.331  9.920  1.00 14.09 ? 43  ALA F C     1 
ATOM   2116 O O     . ALA F 3 43 ? -4.812  28.047  11.081 1.00 14.18 ? 43  ALA F O     1 
ATOM   2117 C CB    . ALA F 3 43 ? -3.470  30.549  9.429  1.00 14.12 ? 43  ALA F CB    1 
ATOM   2118 N N     A ARG F 3 44 ? -5.313  28.041  8.884  0.50 14.21 ? 44  ARG F N     1 
ATOM   2119 N N     B ARG F 3 44 ? -5.334  28.050  8.900  0.50 14.45 ? 44  ARG F N     1 
ATOM   2120 C CA    A ARG F 3 44 ? -6.586  27.347  9.064  0.50 14.79 ? 44  ARG F CA    1 
ATOM   2121 C CA    B ARG F 3 44 ? -6.599  27.364  9.145  0.50 15.18 ? 44  ARG F CA    1 
ATOM   2122 C C     A ARG F 3 44 ? -6.325  26.043  9.803  0.50 14.52 ? 44  ARG F C     1 
ATOM   2123 C C     B ARG F 3 44 ? -6.322  26.031  9.829  0.50 14.79 ? 44  ARG F C     1 
ATOM   2124 O O     A ARG F 3 44 ? -6.940  25.762  10.831 0.50 14.60 ? 44  ARG F O     1 
ATOM   2125 O O     B ARG F 3 44 ? -6.933  25.714  10.849 0.50 14.86 ? 44  ARG F O     1 
ATOM   2126 C CB    A ARG F 3 44 ? -7.237  27.040  7.708  0.50 13.86 ? 44  ARG F CB    1 
ATOM   2127 C CB    B ARG F 3 44 ? -7.375  27.136  7.841  0.50 14.88 ? 44  ARG F CB    1 
ATOM   2128 C CG    A ARG F 3 44 ? -8.574  26.302  7.814  0.50 14.20 ? 44  ARG F CG    1 
ATOM   2129 C CG    B ARG F 3 44 ? -8.635  26.299  8.035  0.50 15.81 ? 44  ARG F CG    1 
ATOM   2130 C CD    A ARG F 3 44 ? -9.221  26.071  6.444  0.50 13.11 ? 44  ARG F CD    1 
ATOM   2131 C CD    B ARG F 3 44 ? -9.628  26.462  6.890  0.50 16.55 ? 44  ARG F CD    1 
ATOM   2132 N NE    A ARG F 3 44 ? -8.575  25.015  5.667  0.50 13.02 ? 44  ARG F NE    1 
ATOM   2133 N NE    B ARG F 3 44 ? -10.292 27.765  6.929  0.50 15.82 ? 44  ARG F NE    1 
ATOM   2134 C CZ    A ARG F 3 44 ? -8.698  23.714  5.919  0.50 11.41 ? 44  ARG F CZ    1 
ATOM   2135 C CZ    B ARG F 3 44 ? -11.259 28.139  6.096  0.50 16.17 ? 44  ARG F CZ    1 
ATOM   2136 N NH1   A ARG F 3 44 ? -9.444  23.299  6.928  0.50 12.72 ? 44  ARG F NH1   1 
ATOM   2137 N NH1   B ARG F 3 44 ? -11.684 27.311  5.148  0.50 14.96 ? 44  ARG F NH1   1 
ATOM   2138 N NH2   A ARG F 3 44 ? -8.082  22.826  5.160  0.50 11.68 ? 44  ARG F NH2   1 
ATOM   2139 N NH2   B ARG F 3 44 ? -11.810 29.340  6.219  0.50 15.03 ? 44  ARG F NH2   1 
ATOM   2140 N N     . LEU F 3 45 ? -5.395  25.259  9.268  1.00 14.67 ? 45  LEU F N     1 
ATOM   2141 C CA    . LEU F 3 45 ? -5.024  23.969  9.846  1.00 14.68 ? 45  LEU F CA    1 
ATOM   2142 C C     . LEU F 3 45 ? -4.533  24.111  11.292 1.00 14.13 ? 45  LEU F C     1 
ATOM   2143 O O     . LEU F 3 45 ? -4.865  23.285  12.144 1.00 13.76 ? 45  LEU F O     1 
ATOM   2144 C CB    . LEU F 3 45 ? -3.939  23.315  8.990  1.00 15.88 ? 45  LEU F CB    1 
ATOM   2145 C CG    . LEU F 3 45 ? -4.307  22.308  7.894  1.00 18.95 ? 45  LEU F CG    1 
ATOM   2146 C CD1   . LEU F 3 45 ? -5.793  22.311  7.579  1.00 15.76 ? 45  LEU F CD1   1 
ATOM   2147 C CD2   . LEU F 3 45 ? -3.459  22.604  6.674  1.00 16.73 ? 45  LEU F CD2   1 
ATOM   2148 N N     . TRP F 3 46 ? -3.750  25.155  11.567 1.00 14.08 ? 46  TRP F N     1 
ATOM   2149 C CA    . TRP F 3 46 ? -3.242  25.397  12.925 1.00 14.06 ? 46  TRP F CA    1 
ATOM   2150 C C     . TRP F 3 46 ? -4.434  25.603  13.854 1.00 14.08 ? 46  TRP F C     1 
ATOM   2151 O O     . TRP F 3 46 ? -4.489  25.036  14.937 1.00 15.11 ? 46  TRP F O     1 
ATOM   2152 C CB    . TRP F 3 46 ? -2.330  26.637  12.950 1.00 12.52 ? 46  TRP F CB    1 
ATOM   2153 C CG    . TRP F 3 46 ? -1.892  27.126  14.338 1.00 13.66 ? 46  TRP F CG    1 
ATOM   2154 C CD1   . TRP F 3 46 ? -1.875  28.427  14.772 1.00 12.32 ? 46  TRP F CD1   1 
ATOM   2155 C CD2   . TRP F 3 46 ? -1.396  26.337  15.439 1.00 12.86 ? 46  TRP F CD2   1 
ATOM   2156 N NE1   . TRP F 3 46 ? -1.407  28.497  16.059 1.00 13.76 ? 46  TRP F NE1   1 
ATOM   2157 C CE2   . TRP F 3 46 ? -1.107  27.234  16.498 1.00 13.18 ? 46  TRP F CE2   1 
ATOM   2158 C CE3   . TRP F 3 46 ? -1.172  24.965  15.634 1.00 13.03 ? 46  TRP F CE3   1 
ATOM   2159 C CZ2   . TRP F 3 46 ? -0.603  26.802  17.740 1.00 12.82 ? 46  TRP F CZ2   1 
ATOM   2160 C CZ3   . TRP F 3 46 ? -0.669  24.530  16.877 1.00 12.16 ? 46  TRP F CZ3   1 
ATOM   2161 C CH2   . TRP F 3 46 ? -0.393  25.450  17.911 1.00 13.25 ? 46  TRP F CH2   1 
ATOM   2162 N N     . GLY F 3 47 ? -5.394  26.415  13.427 1.00 15.03 ? 47  GLY F N     1 
ATOM   2163 C CA    . GLY F 3 47 ? -6.564  26.641  14.256 1.00 13.18 ? 47  GLY F CA    1 
ATOM   2164 C C     . GLY F 3 47 ? -7.327  25.353  14.516 1.00 14.26 ? 47  GLY F C     1 
ATOM   2165 O O     . GLY F 3 47 ? -7.824  25.132  15.621 1.00 14.73 ? 47  GLY F O     1 
ATOM   2166 N N     . LEU F 3 48 ? -7.414  24.488  13.507 1.00 15.11 ? 48  LEU F N     1 
ATOM   2167 C CA    . LEU F 3 48 ? -8.139  23.234  13.658 1.00 15.46 ? 48  LEU F CA    1 
ATOM   2168 C C     . LEU F 3 48 ? -7.476  22.280  14.657 1.00 15.65 ? 48  LEU F C     1 
ATOM   2169 O O     . LEU F 3 48 ? -8.128  21.378  15.181 1.00 15.35 ? 48  LEU F O     1 
ATOM   2170 C CB    . LEU F 3 48 ? -8.332  22.561  12.288 1.00 15.05 ? 48  LEU F CB    1 
ATOM   2171 C CG    . LEU F 3 48 ? -9.263  23.352  11.349 1.00 18.01 ? 48  LEU F CG    1 
ATOM   2172 C CD1   . LEU F 3 48 ? -9.237  22.770  9.931  1.00 17.32 ? 48  LEU F CD1   1 
ATOM   2173 C CD2   . LEU F 3 48 ? -10.684 23.328  11.904 1.00 15.44 ? 48  LEU F CD2   1 
ATOM   2174 N N     . ARG F 3 49 ? -6.187  22.467  14.928 1.00 15.45 ? 49  ARG F N     1 
ATOM   2175 C CA    . ARG F 3 49 ? -5.524  21.612  15.911 1.00 16.40 ? 49  ARG F CA    1 
ATOM   2176 C C     . ARG F 3 49 ? -6.143  21.923  17.278 1.00 16.39 ? 49  ARG F C     1 
ATOM   2177 O O     . ARG F 3 49 ? -6.084  21.107  18.200 1.00 16.37 ? 49  ARG F O     1 
ATOM   2178 C CB    . ARG F 3 49 ? -4.013  21.880  15.954 1.00 16.36 ? 49  ARG F CB    1 
ATOM   2179 C CG    . ARG F 3 49 ? -3.219  21.258  14.807 1.00 16.90 ? 49  ARG F CG    1 
ATOM   2180 C CD    . ARG F 3 49 ? -3.337  19.732  14.792 1.00 16.91 ? 49  ARG F CD    1 
ATOM   2181 N NE    . ARG F 3 49 ? -2.472  19.117  13.788 1.00 15.30 ? 49  ARG F NE    1 
ATOM   2182 C CZ    . ARG F 3 49 ? -1.216  18.732  14.001 1.00 15.59 ? 49  ARG F CZ    1 
ATOM   2183 N NH1   . ARG F 3 49 ? -0.653  18.890  15.197 1.00 14.44 ? 49  ARG F NH1   1 
ATOM   2184 N NH2   . ARG F 3 49 ? -0.520  18.186  13.013 1.00 12.46 ? 49  ARG F NH2   1 
ATOM   2185 N N     . LYS F 3 50 ? -6.731  23.114  17.400 1.00 15.81 ? 50  LYS F N     1 
ATOM   2186 C CA    . LYS F 3 50 ? -7.372  23.529  18.642 1.00 17.25 ? 50  LYS F CA    1 
ATOM   2187 C C     . LYS F 3 50 ? -8.891  23.610  18.483 1.00 18.74 ? 50  LYS F C     1 
ATOM   2188 O O     . LYS F 3 50 ? -9.577  24.293  19.242 1.00 19.09 ? 50  LYS F O     1 
ATOM   2189 C CB    . LYS F 3 50 ? -6.799  24.869  19.117 1.00 15.56 ? 50  LYS F CB    1 
ATOM   2190 C CG    . LYS F 3 50 ? -5.326  24.762  19.475 1.00 17.32 ? 50  LYS F CG    1 
ATOM   2191 C CD    . LYS F 3 50 ? -4.770  26.024  20.090 1.00 17.37 ? 50  LYS F CD    1 
ATOM   2192 C CE    . LYS F 3 50 ? -3.301  25.843  20.453 1.00 15.82 ? 50  LYS F CE    1 
ATOM   2193 N NZ    . LYS F 3 50 ? -2.706  27.132  20.908 1.00 13.11 ? 50  LYS F NZ    1 
ATOM   2194 N N     . ASN F 3 51 ? -9.405  22.912  17.478 1.00 20.18 ? 51  ASN F N     1 
ATOM   2195 C CA    . ASN F 3 51 ? -10.840 22.872  17.230 1.00 22.71 ? 51  ASN F CA    1 
ATOM   2196 C C     . ASN F 3 51 ? -11.462 24.237  16.927 1.00 22.69 ? 51  ASN F C     1 
ATOM   2197 O O     . ASN F 3 51 ? -12.587 24.521  17.341 1.00 22.88 ? 51  ASN F O     1 
ATOM   2198 C CB    . ASN F 3 51 ? -11.538 22.230  18.437 1.00 26.22 ? 51  ASN F CB    1 
ATOM   2199 C CG    . ASN F 3 51 ? -13.020 22.029  18.219 1.00 29.50 ? 51  ASN F CG    1 
ATOM   2200 O OD1   . ASN F 3 51 ? -13.438 21.511  17.185 1.00 33.32 ? 51  ASN F OD1   1 
ATOM   2201 N ND2   . ASN F 3 51 ? -13.824 22.427  19.197 1.00 31.96 ? 51  ASN F ND2   1 
ATOM   2202 N N     . LYS F 3 52 ? -10.729 25.082  16.210 1.00 21.66 ? 52  LYS F N     1 
ATOM   2203 C CA    . LYS F 3 52 ? -11.231 26.403  15.834 1.00 20.67 ? 52  LYS F CA    1 
ATOM   2204 C C     . LYS F 3 52 ? -11.105 26.521  14.316 1.00 19.80 ? 52  LYS F C     1 
ATOM   2205 O O     . LYS F 3 52 ? -10.101 26.094  13.740 1.00 16.67 ? 52  LYS F O     1 
ATOM   2206 C CB    . LYS F 3 52 ? -10.407 27.507  16.505 1.00 21.94 ? 52  LYS F CB    1 
ATOM   2207 C CG    . LYS F 3 52 ? -10.363 27.426  18.030 1.00 24.98 ? 52  LYS F CG    1 
ATOM   2208 C CD    . LYS F 3 52 ? -11.616 27.983  18.680 1.00 26.27 ? 52  LYS F CD    1 
ATOM   2209 C CE    . LYS F 3 52 ? -11.569 29.507  18.749 1.00 28.67 ? 52  LYS F CE    1 
ATOM   2210 N NZ    . LYS F 3 52 ? -10.490 29.990  19.676 1.00 29.23 ? 52  LYS F NZ    1 
ATOM   2211 N N     . THR F 3 53 ? -12.117 27.104  13.676 1.00 18.44 ? 53  THR F N     1 
ATOM   2212 C CA    . THR F 3 53 ? -12.113 27.271  12.225 1.00 17.26 ? 53  THR F CA    1 
ATOM   2213 C C     . THR F 3 53 ? -11.703 28.680  11.827 1.00 17.13 ? 53  THR F C     1 
ATOM   2214 O O     . THR F 3 53 ? -11.602 28.994  10.640 1.00 17.34 ? 53  THR F O     1 
ATOM   2215 C CB    . THR F 3 53 ? -13.512 27.042  11.633 1.00 18.23 ? 53  THR F CB    1 
ATOM   2216 O OG1   . THR F 3 53 ? -14.395 28.080  12.086 1.00 18.57 ? 53  THR F OG1   1 
ATOM   2217 C CG2   . THR F 3 53 ? -14.064 25.691  12.057 1.00 18.38 ? 53  THR F CG2   1 
ATOM   2218 N N     . ASN F 3 54 ? -11.449 29.529  12.810 1.00 17.61 ? 54  ASN F N     1 
ATOM   2219 C CA    . ASN F 3 54 ? -11.128 30.916  12.505 1.00 17.83 ? 54  ASN F CA    1 
ATOM   2220 C C     . ASN F 3 54 ? -9.693  31.418  12.661 1.00 16.77 ? 54  ASN F C     1 
ATOM   2221 O O     . ASN F 3 54 ? -9.488  32.619  12.841 1.00 15.52 ? 54  ASN F O     1 
ATOM   2222 C CB    . ASN F 3 54 ? -12.051 31.812  13.322 1.00 18.08 ? 54  ASN F CB    1 
ATOM   2223 C CG    . ASN F 3 54 ? -11.697 31.810  14.789 1.00 20.15 ? 54  ASN F CG    1 
ATOM   2224 O OD1   . ASN F 3 54 ? -11.107 30.850  15.296 1.00 19.91 ? 54  ASN F OD1   1 
ATOM   2225 N ND2   . ASN F 3 54 ? -12.061 32.879  15.486 1.00 18.59 ? 54  ASN F ND2   1 
ATOM   2226 N N     . MET F 3 55 ? -8.701  30.535  12.597 1.00 15.59 ? 55  MET F N     1 
ATOM   2227 C CA    . MET F 3 55 ? -7.322  31.004  12.716 1.00 16.71 ? 55  MET F CA    1 
ATOM   2228 C C     . MET F 3 55 ? -6.874  31.503  11.349 1.00 17.26 ? 55  MET F C     1 
ATOM   2229 O O     . MET F 3 55 ? -7.130  30.857  10.333 1.00 17.80 ? 55  MET F O     1 
ATOM   2230 C CB    . MET F 3 55 ? -6.399  29.875  13.196 1.00 16.39 ? 55  MET F CB    1 
ATOM   2231 C CG    . MET F 3 55 ? -4.895  30.202  13.183 1.00 16.02 ? 55  MET F CG    1 
ATOM   2232 S SD    . MET F 3 55 ? -4.372  31.599  14.212 1.00 16.98 ? 55  MET F SD    1 
ATOM   2233 C CE    . MET F 3 55 ? -5.026  31.112  15.810 1.00 13.10 ? 55  MET F CE    1 
ATOM   2234 N N     . ASN F 3 56 ? -6.228  32.662  11.314 1.00 17.21 ? 56  ASN F N     1 
ATOM   2235 C CA    . ASN F 3 56 ? -5.757  33.207  10.051 1.00 17.83 ? 56  ASN F CA    1 
ATOM   2236 C C     . ASN F 3 56 ? -4.276  33.562  10.162 1.00 17.16 ? 56  ASN F C     1 
ATOM   2237 O O     . ASN F 3 56 ? -3.673  33.429  11.229 1.00 15.99 ? 56  ASN F O     1 
ATOM   2238 C CB    . ASN F 3 56 ? -6.567  34.447  9.649  1.00 18.84 ? 56  ASN F CB    1 
ATOM   2239 C CG    . ASN F 3 56 ? -6.580  35.511  10.730 1.00 20.49 ? 56  ASN F CG    1 
ATOM   2240 O OD1   . ASN F 3 56 ? -5.605  35.684  11.462 1.00 20.28 ? 56  ASN F OD1   1 
ATOM   2241 N ND2   . ASN F 3 56 ? -7.687  36.245  10.824 1.00 20.42 ? 56  ASN F ND2   1 
ATOM   2242 N N     . TYR F 3 57 ? -3.693  34.030  9.069  1.00 16.38 ? 57  TYR F N     1 
ATOM   2243 C CA    . TYR F 3 57 ? -2.273  34.348  9.092  1.00 17.96 ? 57  TYR F CA    1 
ATOM   2244 C C     . TYR F 3 57 ? -1.909  35.541  9.957  1.00 18.54 ? 57  TYR F C     1 
ATOM   2245 O O     . TYR F 3 57 ? -0.811  35.593  10.513 1.00 18.02 ? 57  TYR F O     1 
ATOM   2246 C CB    . TYR F 3 57 ? -1.747  34.546  7.672  1.00 16.64 ? 57  TYR F CB    1 
ATOM   2247 C CG    . TYR F 3 57 ? -0.263  34.829  7.613  1.00 17.42 ? 57  TYR F CG    1 
ATOM   2248 C CD1   . TYR F 3 57 ? 0.662   33.948  8.175  1.00 16.47 ? 57  TYR F CD1   1 
ATOM   2249 C CD2   . TYR F 3 57 ? 0.217   35.976  6.996  1.00 16.54 ? 57  TYR F CD2   1 
ATOM   2250 C CE1   . TYR F 3 57 ? 2.037   34.211  8.124  1.00 17.05 ? 57  TYR F CE1   1 
ATOM   2251 C CE2   . TYR F 3 57 ? 1.586   36.248  6.937  1.00 17.39 ? 57  TYR F CE2   1 
ATOM   2252 C CZ    . TYR F 3 57 ? 2.491   35.360  7.501  1.00 17.15 ? 57  TYR F CZ    1 
ATOM   2253 O OH    . TYR F 3 57 ? 3.845   35.625  7.428  1.00 16.60 ? 57  TYR F OH    1 
ATOM   2254 N N     . ASP F 3 58 ? -2.818  36.501  10.087 1.00 19.26 ? 58  ASP F N     1 
ATOM   2255 C CA    . ASP F 3 58 ? -2.518  37.665  10.910 1.00 19.69 ? 58  ASP F CA    1 
ATOM   2256 C C     . ASP F 3 58 ? -2.249  37.245  12.344 1.00 19.29 ? 58  ASP F C     1 
ATOM   2257 O O     . ASP F 3 58 ? -1.352  37.777  13.002 1.00 20.15 ? 58  ASP F O     1 
ATOM   2258 C CB    . ASP F 3 58 ? -3.668  38.675  10.904 1.00 22.17 ? 58  ASP F CB    1 
ATOM   2259 C CG    . ASP F 3 58 ? -3.539  39.696  12.025 1.00 24.55 ? 58  ASP F CG    1 
ATOM   2260 O OD1   . ASP F 3 58 ? -2.809  40.690  11.851 1.00 26.50 ? 58  ASP F OD1   1 
ATOM   2261 O OD2   . ASP F 3 58 ? -4.147  39.494  13.099 1.00 28.89 ? 58  ASP F OD2   1 
ATOM   2262 N N     . LYS F 3 59 ? -3.033  36.288  12.825 1.00 17.83 ? 59  LYS F N     1 
ATOM   2263 C CA    . LYS F 3 59 ? -2.889  35.802  14.186 1.00 17.19 ? 59  LYS F CA    1 
ATOM   2264 C C     . LYS F 3 59 ? -1.751  34.794  14.323 1.00 16.12 ? 59  LYS F C     1 
ATOM   2265 O O     . LYS F 3 59 ? -1.023  34.815  15.311 1.00 18.37 ? 59  LYS F O     1 
ATOM   2266 C CB    . LYS F 3 59 ? -4.217  35.203  14.662 1.00 17.46 ? 59  LYS F CB    1 
ATOM   2267 C CG    . LYS F 3 59 ? -5.320  36.261  14.827 1.00 17.87 ? 59  LYS F CG    1 
ATOM   2268 C CD    . LYS F 3 59 ? -6.587  35.694  15.459 1.00 17.81 ? 59  LYS F CD    1 
ATOM   2269 C CE    . LYS F 3 59 ? -7.296  34.726  14.529 1.00 17.65 ? 59  LYS F CE    1 
ATOM   2270 N NZ    . LYS F 3 59 ? -8.572  34.240  15.119 1.00 17.30 ? 59  LYS F NZ    1 
ATOM   2271 N N     . LEU F 3 60 ? -1.594  33.919  13.336 1.00 15.48 ? 60  LEU F N     1 
ATOM   2272 C CA    . LEU F 3 60 ? -0.520  32.935  13.379 1.00 15.41 ? 60  LEU F CA    1 
ATOM   2273 C C     . LEU F 3 60 ? 0.817   33.661  13.260 1.00 15.20 ? 60  LEU F C     1 
ATOM   2274 O O     . LEU F 3 60 ? 1.771   33.328  13.962 1.00 15.32 ? 60  LEU F O     1 
ATOM   2275 C CB    . LEU F 3 60 ? -0.669  31.899  12.246 1.00 13.24 ? 60  LEU F CB    1 
ATOM   2276 C CG    . LEU F 3 60 ? 0.411   30.806  12.180 1.00 13.87 ? 60  LEU F CG    1 
ATOM   2277 C CD1   . LEU F 3 60 ? -0.152  29.550  11.514 1.00 15.11 ? 60  LEU F CD1   1 
ATOM   2278 C CD2   . LEU F 3 60 ? 1.623   31.315  11.427 1.00 12.57 ? 60  LEU F CD2   1 
ATOM   2279 N N     . SER F 3 61 ? 0.890   34.657  12.380 1.00 15.75 ? 61  SER F N     1 
ATOM   2280 C CA    . SER F 3 61 ? 2.135   35.398  12.217 1.00 17.09 ? 61  SER F CA    1 
ATOM   2281 C C     . SER F 3 61 ? 2.507   36.090  13.526 1.00 17.80 ? 61  SER F C     1 
ATOM   2282 O O     . SER F 3 61 ? 3.687   36.191  13.859 1.00 19.52 ? 61  SER F O     1 
ATOM   2283 C CB    . SER F 3 61 ? 2.020   36.441  11.091 1.00 18.66 ? 61  SER F CB    1 
ATOM   2284 O OG    . SER F 3 61 ? 1.114   37.479  11.428 1.00 17.21 ? 61  SER F OG    1 
ATOM   2285 N N     . ARG F 3 62 ? 1.508   36.557  14.274 1.00 16.85 ? 62  ARG F N     1 
ATOM   2286 C CA    . ARG F 3 62 ? 1.782   37.223  15.548 1.00 17.18 ? 62  ARG F CA    1 
ATOM   2287 C C     . ARG F 3 62 ? 2.384   36.222  16.517 1.00 15.94 ? 62  ARG F C     1 
ATOM   2288 O O     . ARG F 3 62 ? 3.283   36.556  17.288 1.00 17.32 ? 62  ARG F O     1 
ATOM   2289 C CB    . ARG F 3 62 ? 0.510   37.806  16.172 1.00 16.97 ? 62  ARG F CB    1 
ATOM   2290 C CG    . ARG F 3 62 ? 0.754   38.462  17.539 1.00 19.40 ? 62  ARG F CG    1 
ATOM   2291 C CD    . ARG F 3 62 ? 1.477   39.791  17.368 1.00 19.99 ? 62  ARG F CD    1 
ATOM   2292 N NE    . ARG F 3 62 ? 1.881   40.430  18.622 1.00 20.60 ? 62  ARG F NE    1 
ATOM   2293 C CZ    . ARG F 3 62 ? 2.975   40.117  19.311 1.00 20.76 ? 62  ARG F CZ    1 
ATOM   2294 N NH1   . ARG F 3 62 ? 3.784   39.159  18.884 1.00 20.10 ? 62  ARG F NH1   1 
ATOM   2295 N NH2   . ARG F 3 62 ? 3.285   40.790  20.408 1.00 19.56 ? 62  ARG F NH2   1 
ATOM   2296 N N     . ALA F 3 63 ? 1.863   35.002  16.496 1.00 14.97 ? 63  ALA F N     1 
ATOM   2297 C CA    . ALA F 3 63 ? 2.384   33.954  17.354 1.00 14.63 ? 63  ALA F CA    1 
ATOM   2298 C C     . ALA F 3 63 ? 3.856   33.741  16.986 1.00 14.72 ? 63  ALA F C     1 
ATOM   2299 O O     . ALA F 3 63 ? 4.706   33.591  17.864 1.00 15.19 ? 63  ALA F O     1 
ATOM   2300 C CB    . ALA F 3 63 ? 1.585   32.662  17.161 1.00 15.11 ? 63  ALA F CB    1 
ATOM   2301 N N     . LEU F 3 64 ? 4.163   33.739  15.692 1.00 15.42 ? 64  LEU F N     1 
ATOM   2302 C CA    . LEU F 3 64 ? 5.551   33.560  15.259 1.00 15.52 ? 64  LEU F CA    1 
ATOM   2303 C C     . LEU F 3 64 ? 6.410   34.736  15.721 1.00 16.90 ? 64  LEU F C     1 
ATOM   2304 O O     . LEU F 3 64 ? 7.580   34.558  16.062 1.00 16.78 ? 64  LEU F O     1 
ATOM   2305 C CB    . LEU F 3 64 ? 5.639   33.419  13.735 1.00 15.25 ? 64  LEU F CB    1 
ATOM   2306 C CG    . LEU F 3 64 ? 5.028   32.152  13.122 1.00 14.34 ? 64  LEU F CG    1 
ATOM   2307 C CD1   . LEU F 3 64 ? 5.172   32.208  11.605 1.00 15.02 ? 64  LEU F CD1   1 
ATOM   2308 C CD2   . LEU F 3 64 ? 5.722   30.901  13.675 1.00 13.07 ? 64  LEU F CD2   1 
ATOM   2309 N N     . ARG F 3 65 ? 5.837   35.939  15.734 1.00 16.86 ? 65  ARG F N     1 
ATOM   2310 C CA    . ARG F 3 65 ? 6.586   37.112  16.178 1.00 18.05 ? 65  ARG F CA    1 
ATOM   2311 C C     . ARG F 3 65 ? 6.907   36.980  17.668 1.00 18.54 ? 65  ARG F C     1 
ATOM   2312 O O     . ARG F 3 65 ? 7.963   37.402  18.129 1.00 18.73 ? 65  ARG F O     1 
ATOM   2313 C CB    . ARG F 3 65 ? 5.801   38.403  15.878 1.00 17.85 ? 65  ARG F CB    1 
ATOM   2314 C CG    . ARG F 3 65 ? 5.803   38.757  14.379 1.00 17.22 ? 65  ARG F CG    1 
ATOM   2315 C CD    . ARG F 3 65 ? 5.318   40.184  14.084 1.00 18.87 ? 65  ARG F CD    1 
ATOM   2316 N NE    . ARG F 3 65 ? 3.887   40.385  14.318 1.00 18.30 ? 65  ARG F NE    1 
ATOM   2317 C CZ    . ARG F 3 65 ? 2.917   39.955  13.515 1.00 19.07 ? 65  ARG F CZ    1 
ATOM   2318 N NH1   . ARG F 3 65 ? 3.203   39.284  12.404 1.00 17.41 ? 65  ARG F NH1   1 
ATOM   2319 N NH2   . ARG F 3 65 ? 1.650   40.216  13.817 1.00 19.48 ? 65  ARG F NH2   1 
ATOM   2320 N N     . TYR F 3 66 ? 5.991   36.368  18.408 1.00 20.30 ? 66  TYR F N     1 
ATOM   2321 C CA    . TYR F 3 66 ? 6.169   36.126  19.833 1.00 21.62 ? 66  TYR F CA    1 
ATOM   2322 C C     . TYR F 3 66 ? 7.394   35.210  20.034 1.00 21.76 ? 66  TYR F C     1 
ATOM   2323 O O     . TYR F 3 66 ? 8.012   35.214  21.094 1.00 20.74 ? 66  TYR F O     1 
ATOM   2324 C CB    . TYR F 3 66 ? 4.884   35.483  20.375 1.00 25.95 ? 66  TYR F CB    1 
ATOM   2325 C CG    . TYR F 3 66 ? 5.057   34.571  21.560 1.00 29.28 ? 66  TYR F CG    1 
ATOM   2326 C CD1   . TYR F 3 66 ? 5.105   35.074  22.860 1.00 31.24 ? 66  TYR F CD1   1 
ATOM   2327 C CD2   . TYR F 3 66 ? 5.199   33.195  21.378 1.00 31.43 ? 66  TYR F CD2   1 
ATOM   2328 C CE1   . TYR F 3 66 ? 5.296   34.224  23.951 1.00 32.77 ? 66  TYR F CE1   1 
ATOM   2329 C CE2   . TYR F 3 66 ? 5.392   32.342  22.455 1.00 32.50 ? 66  TYR F CE2   1 
ATOM   2330 C CZ    . TYR F 3 66 ? 5.441   32.857  23.734 1.00 32.84 ? 66  TYR F CZ    1 
ATOM   2331 O OH    . TYR F 3 66 ? 5.655   32.002  24.791 1.00 34.41 ? 66  TYR F OH    1 
ATOM   2332 N N     . TYR F 3 67 ? 7.745   34.435  19.006 1.00 20.56 ? 67  TYR F N     1 
ATOM   2333 C CA    . TYR F 3 67 ? 8.896   33.529  19.072 1.00 20.62 ? 67  TYR F CA    1 
ATOM   2334 C C     . TYR F 3 67 ? 10.240  34.235  18.904 1.00 21.38 ? 67  TYR F C     1 
ATOM   2335 O O     . TYR F 3 67 ? 11.278  33.699  19.292 1.00 19.74 ? 67  TYR F O     1 
ATOM   2336 C CB    . TYR F 3 67 ? 8.794   32.447  17.988 1.00 19.48 ? 67  TYR F CB    1 
ATOM   2337 C CG    . TYR F 3 67 ? 7.848   31.303  18.288 1.00 17.88 ? 67  TYR F CG    1 
ATOM   2338 C CD1   . TYR F 3 67 ? 7.646   30.852  19.593 1.00 18.38 ? 67  TYR F CD1   1 
ATOM   2339 C CD2   . TYR F 3 67 ? 7.206   30.624  17.250 1.00 18.63 ? 67  TYR F CD2   1 
ATOM   2340 C CE1   . TYR F 3 67 ? 6.828   29.747  19.856 1.00 19.47 ? 67  TYR F CE1   1 
ATOM   2341 C CE2   . TYR F 3 67 ? 6.393   29.524  17.498 1.00 18.18 ? 67  TYR F CE2   1 
ATOM   2342 C CZ    . TYR F 3 67 ? 6.208   29.089  18.798 1.00 19.89 ? 67  TYR F CZ    1 
ATOM   2343 O OH    . TYR F 3 67 ? 5.414   27.990  19.033 1.00 21.30 ? 67  TYR F OH    1 
ATOM   2344 N N     . TYR F 3 68 ? 10.229  35.432  18.324 1.00 22.87 ? 68  TYR F N     1 
ATOM   2345 C CA    . TYR F 3 68 ? 11.473  36.162  18.090 1.00 24.30 ? 68  TYR F CA    1 
ATOM   2346 C C     . TYR F 3 68 ? 12.332  36.333  19.341 1.00 26.25 ? 68  TYR F C     1 
ATOM   2347 O O     . TYR F 3 68 ? 13.529  36.029  19.321 1.00 25.83 ? 68  TYR F O     1 
ATOM   2348 C CB    . TYR F 3 68 ? 11.187  37.536  17.474 1.00 23.33 ? 68  TYR F CB    1 
ATOM   2349 C CG    . TYR F 3 68 ? 10.500  37.503  16.121 1.00 23.19 ? 68  TYR F CG    1 
ATOM   2350 C CD1   . TYR F 3 68 ? 10.297  36.302  15.441 1.00 22.51 ? 68  TYR F CD1   1 
ATOM   2351 C CD2   . TYR F 3 68 ? 10.066  38.684  15.516 1.00 23.27 ? 68  TYR F CD2   1 
ATOM   2352 C CE1   . TYR F 3 68 ? 9.678   36.278  14.191 1.00 21.59 ? 68  TYR F CE1   1 
ATOM   2353 C CE2   . TYR F 3 68 ? 9.452   38.671  14.275 1.00 22.26 ? 68  TYR F CE2   1 
ATOM   2354 C CZ    . TYR F 3 68 ? 9.261   37.467  13.617 1.00 21.62 ? 68  TYR F CZ    1 
ATOM   2355 O OH    . TYR F 3 68 ? 8.654   37.464  12.387 1.00 19.24 ? 68  TYR F OH    1 
ATOM   2356 N N     A ASP F 3 69 ? 11.719  36.815  20.419 0.50 27.10 ? 69  ASP F N     1 
ATOM   2357 N N     B ASP F 3 69 ? 11.727  36.812  20.424 0.50 26.91 ? 69  ASP F N     1 
ATOM   2358 C CA    A ASP F 3 69 ? 12.421  37.031  21.682 0.50 28.76 ? 69  ASP F CA    1 
ATOM   2359 C CA    B ASP F 3 69 ? 12.467  37.024  21.663 0.50 28.44 ? 69  ASP F CA    1 
ATOM   2360 C C     A ASP F 3 69 ? 12.742  35.722  22.400 0.50 29.34 ? 69  ASP F C     1 
ATOM   2361 C C     B ASP F 3 69 ? 12.762  35.715  22.391 0.50 29.14 ? 69  ASP F C     1 
ATOM   2362 O O     A ASP F 3 69 ? 13.568  35.699  23.311 0.50 28.89 ? 69  ASP F O     1 
ATOM   2363 O O     B ASP F 3 69 ? 13.588  35.683  23.301 0.50 28.69 ? 69  ASP F O     1 
ATOM   2364 C CB    A ASP F 3 69 ? 11.583  37.918  22.613 0.50 30.06 ? 69  ASP F CB    1 
ATOM   2365 C CB    B ASP F 3 69 ? 11.700  37.973  22.591 0.50 29.35 ? 69  ASP F CB    1 
ATOM   2366 C CG    A ASP F 3 69 ? 11.590  39.380  22.200 0.64 31.01 ? 69  ASP F CG    1 
ATOM   2367 C CG    B ASP F 3 69 ? 10.481  37.327  23.213 0.36 29.91 ? 69  ASP F CG    1 
ATOM   2368 O OD1   A ASP F 3 69 ? 10.839  40.170  22.808 0.64 32.09 ? 69  ASP F OD1   1 
ATOM   2369 O OD1   B ASP F 3 69 ? 9.572   36.907  22.466 0.36 30.23 ? 69  ASP F OD1   1 
ATOM   2370 O OD2   A ASP F 3 69 ? 12.349  39.743  21.277 0.64 32.13 ? 69  ASP F OD2   1 
ATOM   2371 O OD2   B ASP F 3 69 ? 10.431  37.241  24.458 0.36 30.99 ? 69  ASP F OD2   1 
ATOM   2372 N N     . LYS F 3 70 ? 12.088  34.638  21.990 1.00 29.73 ? 70  LYS F N     1 
ATOM   2373 C CA    . LYS F 3 70 ? 12.310  33.328  22.609 1.00 30.03 ? 70  LYS F CA    1 
ATOM   2374 C C     . LYS F 3 70 ? 13.424  32.596  21.882 1.00 29.91 ? 70  LYS F C     1 
ATOM   2375 O O     . LYS F 3 70 ? 13.767  31.468  22.228 1.00 30.42 ? 70  LYS F O     1 
ATOM   2376 C CB    . LYS F 3 70 ? 11.047  32.466  22.558 1.00 30.56 ? 70  LYS F CB    1 
ATOM   2377 C CG    . LYS F 3 70 ? 9.815   33.092  23.183 1.00 32.86 ? 70  LYS F CG    1 
ATOM   2378 C CD    . LYS F 3 70 ? 9.994   33.341  24.665 1.00 35.48 ? 70  LYS F CD    1 
ATOM   2379 C CE    . LYS F 3 70 ? 8.746   33.984  25.258 1.00 37.11 ? 70  LYS F CE    1 
ATOM   2380 N NZ    . LYS F 3 70 ? 8.886   34.245  26.725 1.00 39.11 ? 70  LYS F NZ    1 
ATOM   2381 N N     . ASN F 3 71 ? 13.983  33.244  20.870 1.00 30.24 ? 71  ASN F N     1 
ATOM   2382 C CA    . ASN F 3 71 ? 15.053  32.652  20.080 1.00 30.61 ? 71  ASN F CA    1 
ATOM   2383 C C     . ASN F 3 71 ? 14.686  31.265  19.549 1.00 29.05 ? 71  ASN F C     1 
ATOM   2384 O O     . ASN F 3 71 ? 15.536  30.375  19.464 1.00 29.21 ? 71  ASN F O     1 
ATOM   2385 C CB    . ASN F 3 71 ? 16.335  32.572  20.914 1.00 34.30 ? 71  ASN F CB    1 
ATOM   2386 C CG    . ASN F 3 71 ? 16.763  33.926  21.443 1.00 36.71 ? 71  ASN F CG    1 
ATOM   2387 O OD1   . ASN F 3 71 ? 16.834  34.900  20.692 1.00 39.05 ? 71  ASN F OD1   1 
ATOM   2388 N ND2   . ASN F 3 71 ? 17.050  33.997  22.742 1.00 38.00 ? 71  ASN F ND2   1 
ATOM   2389 N N     . ILE F 3 72 ? 13.417  31.082  19.199 1.00 26.64 ? 72  ILE F N     1 
ATOM   2390 C CA    . ILE F 3 72 ? 12.943  29.810  18.659 1.00 24.34 ? 72  ILE F CA    1 
ATOM   2391 C C     . ILE F 3 72 ? 12.826  29.936  17.145 1.00 23.57 ? 72  ILE F C     1 
ATOM   2392 O O     . ILE F 3 72 ? 13.262  29.066  16.395 1.00 23.38 ? 72  ILE F O     1 
ATOM   2393 C CB    . ILE F 3 72 ? 11.558  29.438  19.235 1.00 23.67 ? 72  ILE F CB    1 
ATOM   2394 C CG1   . ILE F 3 72 ? 11.701  29.058  20.712 1.00 23.04 ? 72  ILE F CG1   1 
ATOM   2395 C CG2   . ILE F 3 72 ? 10.938  28.294  18.430 1.00 22.44 ? 72  ILE F CG2   1 
ATOM   2396 C CD1   . ILE F 3 72 ? 10.384  28.909  21.428 1.00 22.97 ? 72  ILE F CD1   1 
ATOM   2397 N N     . ILE F 3 73 ? 12.221  31.029  16.707 1.00 23.41 ? 73  ILE F N     1 
ATOM   2398 C CA    . ILE F 3 73 ? 12.055  31.296  15.289 1.00 24.36 ? 73  ILE F CA    1 
ATOM   2399 C C     . ILE F 3 73 ? 12.355  32.757  15.024 1.00 24.66 ? 73  ILE F C     1 
ATOM   2400 O O     . ILE F 3 73 ? 12.114  33.618  15.873 1.00 25.62 ? 73  ILE F O     1 
ATOM   2401 C CB    . ILE F 3 73 ? 10.612  30.962  14.803 1.00 24.05 ? 73  ILE F CB    1 
ATOM   2402 C CG1   . ILE F 3 73 ? 10.474  29.448  14.601 1.00 24.50 ? 73  ILE F CG1   1 
ATOM   2403 C CG2   . ILE F 3 73 ? 10.299  31.707  13.505 1.00 23.60 ? 73  ILE F CG2   1 
ATOM   2404 C CD1   . ILE F 3 73 ? 9.074   28.978  14.219 1.00 24.98 ? 73  ILE F CD1   1 
ATOM   2405 N N     . ARG F 3 74 ? 12.908  33.019  13.847 1.00 24.83 ? 74  ARG F N     1 
ATOM   2406 C CA    . ARG F 3 74 ? 13.239  34.364  13.424 1.00 26.37 ? 74  ARG F CA    1 
ATOM   2407 C C     . ARG F 3 74 ? 12.727  34.541  12.006 1.00 25.72 ? 74  ARG F C     1 
ATOM   2408 O O     . ARG F 3 74 ? 12.528  33.566  11.279 1.00 23.81 ? 74  ARG F O     1 
ATOM   2409 C CB    . ARG F 3 74 ? 14.754  34.586  13.448 1.00 27.90 ? 74  ARG F CB    1 
ATOM   2410 C CG    . ARG F 3 74 ? 15.367  34.461  14.825 1.00 33.28 ? 74  ARG F CG    1 
ATOM   2411 C CD    . ARG F 3 74 ? 14.551  35.246  15.843 1.00 37.81 ? 74  ARG F CD    1 
ATOM   2412 N NE    . ARG F 3 74 ? 15.242  35.380  17.118 1.00 41.30 ? 74  ARG F NE    1 
ATOM   2413 C CZ    . ARG F 3 74 ? 16.350  36.091  17.288 1.00 42.94 ? 74  ARG F CZ    1 
ATOM   2414 N NH1   . ARG F 3 74 ? 16.891  36.733  16.261 1.00 43.72 ? 74  ARG F NH1   1 
ATOM   2415 N NH2   . ARG F 3 74 ? 16.916  36.161  18.485 1.00 44.06 ? 74  ARG F NH2   1 
ATOM   2416 N N     . LYS F 3 75 ? 12.520  35.791  11.622 1.00 24.98 ? 75  LYS F N     1 
ATOM   2417 C CA    . LYS F 3 75 ? 12.049  36.110  10.291 1.00 25.66 ? 75  LYS F CA    1 
ATOM   2418 C C     . LYS F 3 75 ? 13.234  36.130  9.340  1.00 26.19 ? 75  LYS F C     1 
ATOM   2419 O O     . LYS F 3 75 ? 14.351  36.462  9.740  1.00 26.26 ? 75  LYS F O     1 
ATOM   2420 C CB    . LYS F 3 75 ? 11.392  37.493  10.291 1.00 25.70 ? 75  LYS F CB    1 
ATOM   2421 C CG    . LYS F 3 75 ? 10.779  37.910  8.954  1.00 24.91 ? 75  LYS F CG    1 
ATOM   2422 C CD    . LYS F 3 75 ? 9.519   37.119  8.665  1.00 24.13 ? 75  LYS F CD    1 
ATOM   2423 C CE    . LYS F 3 75 ? 8.861   37.584  7.377  1.00 23.07 ? 75  LYS F CE    1 
ATOM   2424 N NZ    . LYS F 3 75 ? 9.712   37.284  6.196  1.00 23.53 ? 75  LYS F NZ    1 
ATOM   2425 N N     . VAL F 3 76 ? 12.997  35.752  8.089  1.00 27.08 ? 76  VAL F N     1 
ATOM   2426 C CA    . VAL F 3 76 ? 14.041  35.809  7.072  1.00 29.18 ? 76  VAL F CA    1 
ATOM   2427 C C     . VAL F 3 76 ? 13.708  37.101  6.320  1.00 30.64 ? 76  VAL F C     1 
ATOM   2428 O O     . VAL F 3 76 ? 12.877  37.114  5.415  1.00 30.54 ? 76  VAL F O     1 
ATOM   2429 C CB    . VAL F 3 76 ? 13.986  34.589  6.115  1.00 29.92 ? 76  VAL F CB    1 
ATOM   2430 C CG1   . VAL F 3 76 ? 14.943  34.792  4.938  1.00 29.43 ? 76  VAL F CG1   1 
ATOM   2431 C CG2   . VAL F 3 76 ? 14.373  33.320  6.876  1.00 28.14 ? 76  VAL F CG2   1 
ATOM   2432 N N     . SER F 3 77 ? 14.335  38.197  6.737  1.00 32.96 ? 77  SER F N     1 
ATOM   2433 C CA    . SER F 3 77 ? 14.092  39.505  6.137  1.00 34.30 ? 77  SER F CA    1 
ATOM   2434 C C     . SER F 3 77 ? 14.233  39.571  4.622  1.00 33.90 ? 77  SER F C     1 
ATOM   2435 O O     . SER F 3 77 ? 15.161  39.008  4.041  1.00 33.13 ? 77  SER F O     1 
ATOM   2436 C CB    . SER F 3 77 ? 15.012  40.552  6.770  1.00 36.20 ? 77  SER F CB    1 
ATOM   2437 O OG    . SER F 3 77 ? 14.606  40.841  8.096  1.00 39.72 ? 77  SER F OG    1 
ATOM   2438 N N     . GLY F 3 78 ? 13.293  40.267  3.990  1.00 33.81 ? 78  GLY F N     1 
ATOM   2439 C CA    . GLY F 3 78 ? 13.339  40.426  2.548  1.00 33.82 ? 78  GLY F CA    1 
ATOM   2440 C C     . GLY F 3 78 ? 12.636  39.357  1.740  1.00 33.21 ? 78  GLY F C     1 
ATOM   2441 O O     . GLY F 3 78 ? 12.625  39.417  0.512  1.00 34.31 ? 78  GLY F O     1 
ATOM   2442 N N     . GLN F 3 79 ? 12.064  38.367  2.413  1.00 32.26 ? 79  GLN F N     1 
ATOM   2443 C CA    . GLN F 3 79 ? 11.348  37.310  1.713  1.00 31.05 ? 79  GLN F CA    1 
ATOM   2444 C C     . GLN F 3 79 ? 9.984   37.110  2.356  1.00 30.09 ? 79  GLN F C     1 
ATOM   2445 O O     . GLN F 3 79 ? 9.882   36.830  3.548  1.00 30.08 ? 79  GLN F O     1 
ATOM   2446 C CB    . GLN F 3 79 ? 12.151  36.008  1.744  1.00 31.54 ? 79  GLN F CB    1 
ATOM   2447 C CG    . GLN F 3 79 ? 13.497  36.103  1.037  1.00 32.68 ? 79  GLN F CG    1 
ATOM   2448 C CD    . GLN F 3 79 ? 14.125  34.748  0.802  1.00 32.66 ? 79  GLN F CD    1 
ATOM   2449 O OE1   . GLN F 3 79 ? 13.525  33.876  0.175  1.00 33.55 ? 79  GLN F OE1   1 
ATOM   2450 N NE2   . GLN F 3 79 ? 15.338  34.563  1.301  1.00 34.07 ? 79  GLN F NE2   1 
ATOM   2451 N N     . LYS F 3 80 ? 8.936   37.255  1.558  1.00 29.00 ? 80  LYS F N     1 
ATOM   2452 C CA    . LYS F 3 80 ? 7.579   37.111  2.055  1.00 28.38 ? 80  LYS F CA    1 
ATOM   2453 C C     . LYS F 3 80 ? 7.265   35.705  2.543  1.00 26.71 ? 80  LYS F C     1 
ATOM   2454 O O     . LYS F 3 80 ? 7.549   34.717  1.861  1.00 25.70 ? 80  LYS F O     1 
ATOM   2455 C CB    . LYS F 3 80 ? 6.561   37.481  0.968  1.00 31.14 ? 80  LYS F CB    1 
ATOM   2456 C CG    . LYS F 3 80 ? 6.587   38.931  0.493  1.00 34.57 ? 80  LYS F CG    1 
ATOM   2457 C CD    . LYS F 3 80 ? 5.363   39.227  -0.389 1.00 36.63 ? 80  LYS F CD    1 
ATOM   2458 C CE    . LYS F 3 80 ? 5.243   38.229  -1.545 1.00 38.83 ? 80  LYS F CE    1 
ATOM   2459 N NZ    . LYS F 3 80 ? 3.977   38.371  -2.332 1.00 40.00 ? 80  LYS F NZ    1 
ATOM   2460 N N     . PHE F 3 81 ? 6.679   35.634  3.733  1.00 24.21 ? 81  PHE F N     1 
ATOM   2461 C CA    . PHE F 3 81 ? 6.259   34.374  4.326  1.00 22.54 ? 81  PHE F CA    1 
ATOM   2462 C C     . PHE F 3 81 ? 7.375   33.386  4.678  1.00 21.08 ? 81  PHE F C     1 
ATOM   2463 O O     . PHE F 3 81 ? 7.108   32.220  4.982  1.00 20.74 ? 81  PHE F O     1 
ATOM   2464 C CB    . PHE F 3 81 ? 5.242   33.708  3.398  1.00 21.14 ? 81  PHE F CB    1 
ATOM   2465 C CG    . PHE F 3 81 ? 4.140   34.634  2.942  1.00 22.01 ? 81  PHE F CG    1 
ATOM   2466 C CD1   . PHE F 3 81 ? 3.155   35.050  3.829  1.00 21.87 ? 81  PHE F CD1   1 
ATOM   2467 C CD2   . PHE F 3 81 ? 4.093   35.092  1.628  1.00 22.00 ? 81  PHE F CD2   1 
ATOM   2468 C CE1   . PHE F 3 81 ? 2.134   35.904  3.418  1.00 23.08 ? 81  PHE F CE1   1 
ATOM   2469 C CE2   . PHE F 3 81 ? 3.072   35.950  1.202  1.00 23.29 ? 81  PHE F CE2   1 
ATOM   2470 C CZ    . PHE F 3 81 ? 2.091   36.356  2.101  1.00 22.95 ? 81  PHE F CZ    1 
ATOM   2471 N N     . VAL F 3 82 ? 8.618   33.847  4.650  1.00 19.40 ? 82  VAL F N     1 
ATOM   2472 C CA    . VAL F 3 82 ? 9.735   32.974  4.977  1.00 18.86 ? 82  VAL F CA    1 
ATOM   2473 C C     . VAL F 3 82 ? 10.229  33.182  6.405  1.00 19.27 ? 82  VAL F C     1 
ATOM   2474 O O     . VAL F 3 82 ? 10.497  34.309  6.825  1.00 19.65 ? 82  VAL F O     1 
ATOM   2475 C CB    . VAL F 3 82 ? 10.916  33.189  4.009  1.00 19.44 ? 82  VAL F CB    1 
ATOM   2476 C CG1   . VAL F 3 82 ? 12.039  32.195  4.332  1.00 17.69 ? 82  VAL F CG1   1 
ATOM   2477 C CG2   . VAL F 3 82 ? 10.439  33.020  2.563  1.00 17.29 ? 82  VAL F CG2   1 
ATOM   2478 N N     . TYR F 3 83 ? 10.341  32.082  7.144  1.00 18.30 ? 83  TYR F N     1 
ATOM   2479 C CA    . TYR F 3 83 ? 10.817  32.116  8.519  1.00 17.86 ? 83  TYR F CA    1 
ATOM   2480 C C     . TYR F 3 83 ? 11.974  31.143  8.708  1.00 16.81 ? 83  TYR F C     1 
ATOM   2481 O O     . TYR F 3 83 ? 12.317  30.391  7.795  1.00 14.97 ? 83  TYR F O     1 
ATOM   2482 C CB    . TYR F 3 83 ? 9.682   31.790  9.487  1.00 17.70 ? 83  TYR F CB    1 
ATOM   2483 C CG    . TYR F 3 83 ? 8.584   32.828  9.472  1.00 17.90 ? 83  TYR F CG    1 
ATOM   2484 C CD1   . TYR F 3 83 ? 7.605   32.822  8.481  1.00 17.69 ? 83  TYR F CD1   1 
ATOM   2485 C CD2   . TYR F 3 83 ? 8.532   33.823  10.444 1.00 16.93 ? 83  TYR F CD2   1 
ATOM   2486 C CE1   . TYR F 3 83 ? 6.588   33.786  8.464  1.00 18.81 ? 83  TYR F CE1   1 
ATOM   2487 C CE2   . TYR F 3 83 ? 7.528   34.790  10.437 1.00 17.69 ? 83  TYR F CE2   1 
ATOM   2488 C CZ    . TYR F 3 83 ? 6.561   34.764  9.445  1.00 18.13 ? 83  TYR F CZ    1 
ATOM   2489 O OH    . TYR F 3 83 ? 5.569   35.713  9.437  1.00 17.32 ? 83  TYR F OH    1 
ATOM   2490 N N     . LYS F 3 84 ? 12.560  31.154  9.900  1.00 17.11 ? 84  LYS F N     1 
ATOM   2491 C CA    . LYS F 3 84 ? 13.722  30.315  10.186 1.00 17.98 ? 84  LYS F CA    1 
ATOM   2492 C C     . LYS F 3 84 ? 13.739  29.723  11.589 1.00 18.29 ? 84  LYS F C     1 
ATOM   2493 O O     . LYS F 3 84 ? 13.659  30.463  12.572 1.00 17.44 ? 84  LYS F O     1 
ATOM   2494 C CB    . LYS F 3 84 ? 14.994  31.156  9.989  1.00 17.70 ? 84  LYS F CB    1 
ATOM   2495 C CG    . LYS F 3 84 ? 16.323  30.469  10.337 1.00 18.81 ? 84  LYS F CG    1 
ATOM   2496 C CD    . LYS F 3 84 ? 17.487  31.478  10.224 1.00 18.95 ? 84  LYS F CD    1 
ATOM   2497 C CE    . LYS F 3 84 ? 18.856  30.804  10.327 1.00 19.45 ? 84  LYS F CE    1 
ATOM   2498 N NZ    . LYS F 3 84 ? 19.203  30.024  9.098  1.00 18.46 ? 84  LYS F NZ    1 
ATOM   2499 N N     . PHE F 3 85 ? 13.835  28.398  11.685 1.00 18.21 ? 85  PHE F N     1 
ATOM   2500 C CA    . PHE F 3 85 ? 13.931  27.761  12.999 1.00 20.85 ? 85  PHE F CA    1 
ATOM   2501 C C     . PHE F 3 85 ? 15.385  27.990  13.422 1.00 22.08 ? 85  PHE F C     1 
ATOM   2502 O O     . PHE F 3 85 ? 16.300  27.595  12.699 1.00 19.00 ? 85  PHE F O     1 
ATOM   2503 C CB    . PHE F 3 85 ? 13.680  26.252  12.922 1.00 21.30 ? 85  PHE F CB    1 
ATOM   2504 C CG    . PHE F 3 85 ? 12.253  25.869  12.635 1.00 22.55 ? 85  PHE F CG    1 
ATOM   2505 C CD1   . PHE F 3 85 ? 11.318  25.812  13.660 1.00 23.56 ? 85  PHE F CD1   1 
ATOM   2506 C CD2   . PHE F 3 85 ? 11.863  25.492  11.356 1.00 23.51 ? 85  PHE F CD2   1 
ATOM   2507 C CE1   . PHE F 3 85 ? 10.013  25.375  13.418 1.00 22.97 ? 85  PHE F CE1   1 
ATOM   2508 C CE2   . PHE F 3 85 ? 10.560  25.052  11.106 1.00 24.19 ? 85  PHE F CE2   1 
ATOM   2509 C CZ    . PHE F 3 85 ? 9.637   24.995  12.145 1.00 23.10 ? 85  PHE F CZ    1 
ATOM   2510 N N     . VAL F 3 86 ? 15.612  28.624  14.573 1.00 24.38 ? 86  VAL F N     1 
ATOM   2511 C CA    . VAL F 3 86 ? 16.989  28.875  14.991 1.00 27.63 ? 86  VAL F CA    1 
ATOM   2512 C C     . VAL F 3 86 ? 17.656  27.636  15.597 1.00 30.10 ? 86  VAL F C     1 
ATOM   2513 O O     . VAL F 3 86 ? 18.881  27.515  15.573 1.00 29.27 ? 86  VAL F O     1 
ATOM   2514 C CB    . VAL F 3 86 ? 17.098  30.084  15.969 1.00 27.27 ? 86  VAL F CB    1 
ATOM   2515 C CG1   . VAL F 3 86 ? 15.816  30.888  15.953 1.00 27.60 ? 86  VAL F CG1   1 
ATOM   2516 C CG2   . VAL F 3 86 ? 17.448  29.619  17.364 1.00 28.72 ? 86  VAL F CG2   1 
ATOM   2517 N N     . SER F 3 87 ? 16.855  26.724  16.142 1.00 33.73 ? 87  SER F N     1 
ATOM   2518 C CA    . SER F 3 87 ? 17.388  25.480  16.694 1.00 38.29 ? 87  SER F CA    1 
ATOM   2519 C C     . SER F 3 87 ? 17.188  24.388  15.649 1.00 42.31 ? 87  SER F C     1 
ATOM   2520 O O     . SER F 3 87 ? 16.066  24.130  15.214 1.00 42.82 ? 87  SER F O     1 
ATOM   2521 C CB    . SER F 3 87 ? 16.671  25.089  17.987 1.00 38.75 ? 87  SER F CB    1 
ATOM   2522 O OG    . SER F 3 87 ? 17.082  25.913  19.064 1.00 39.10 ? 87  SER F OG    1 
ATOM   2523 N N     . TYR F 3 88 ? 18.293  23.768  15.248 1.00 46.39 ? 88  TYR F N     1 
ATOM   2524 C CA    . TYR F 3 88 ? 18.314  22.711  14.241 1.00 50.06 ? 88  TYR F CA    1 
ATOM   2525 C C     . TYR F 3 88 ? 17.163  21.710  14.326 1.00 52.24 ? 88  TYR F C     1 
ATOM   2526 O O     . TYR F 3 88 ? 16.953  21.071  15.359 1.00 52.78 ? 88  TYR F O     1 
ATOM   2527 C CB    . TYR F 3 88 ? 19.650  21.969  14.322 1.00 51.42 ? 88  TYR F CB    1 
ATOM   2528 C CG    . TYR F 3 88 ? 19.831  20.876  13.300 1.00 53.27 ? 88  TYR F CG    1 
ATOM   2529 C CD1   . TYR F 3 88 ? 19.726  21.143  11.936 1.00 53.93 ? 88  TYR F CD1   1 
ATOM   2530 C CD2   . TYR F 3 88 ? 20.132  19.574  13.696 1.00 53.96 ? 88  TYR F CD2   1 
ATOM   2531 C CE1   . TYR F 3 88 ? 19.916  20.135  10.989 1.00 55.03 ? 88  TYR F CE1   1 
ATOM   2532 C CE2   . TYR F 3 88 ? 20.324  18.563  12.762 1.00 54.86 ? 88  TYR F CE2   1 
ATOM   2533 C CZ    . TYR F 3 88 ? 20.216  18.847  11.411 1.00 55.17 ? 88  TYR F CZ    1 
ATOM   2534 O OH    . TYR F 3 88 ? 20.403  17.840  10.488 1.00 55.91 ? 88  TYR F OH    1 
ATOM   2535 N N     . PRO F 3 89 ? 16.395  21.574  13.233 1.00 54.47 ? 89  PRO F N     1 
ATOM   2536 C CA    . PRO F 3 89 ? 15.259  20.650  13.160 1.00 56.59 ? 89  PRO F CA    1 
ATOM   2537 C C     . PRO F 3 89 ? 15.647  19.256  12.644 1.00 58.62 ? 89  PRO F C     1 
ATOM   2538 O O     . PRO F 3 89 ? 16.695  18.718  13.006 1.00 58.88 ? 89  PRO F O     1 
ATOM   2539 C CB    . PRO F 3 89 ? 14.302  21.373  12.221 1.00 56.01 ? 89  PRO F CB    1 
ATOM   2540 C CG    . PRO F 3 89 ? 15.240  21.999  11.244 1.00 55.34 ? 89  PRO F CG    1 
ATOM   2541 C CD    . PRO F 3 89 ? 16.347  22.547  12.124 1.00 54.64 ? 89  PRO F CD    1 
ATOM   2542 N N     . GLU F 3 90 ? 14.802  18.688  11.786 1.00 60.89 ? 90  GLU F N     1 
ATOM   2543 C CA    . GLU F 3 90 ? 15.029  17.353  11.229 1.00 63.05 ? 90  GLU F CA    1 
ATOM   2544 C C     . GLU F 3 90 ? 15.247  16.340  12.344 1.00 63.36 ? 90  GLU F C     1 
ATOM   2545 O O     . GLU F 3 90 ? 16.168  15.509  12.208 1.00 63.56 ? 90  GLU F O     1 
ATOM   2546 C CB    . GLU F 3 90 ? 16.246  17.340  10.293 1.00 64.19 ? 90  GLU F CB    1 
ATOM   2547 C CG    . GLU F 3 90 ? 16.051  18.094  8.993  1.00 66.23 ? 90  GLU F CG    1 
ATOM   2548 C CD    . GLU F 3 90 ? 15.974  19.592  9.197  1.00 67.53 ? 90  GLU F CD    1 
ATOM   2549 O OE1   . GLU F 3 90 ? 16.989  20.190  9.617  1.00 68.26 ? 90  GLU F OE1   1 
ATOM   2550 O OE2   . GLU F 3 90 ? 14.899  20.172  8.940  1.00 68.36 ? 90  GLU F OE2   1 
HETATM 2551 O O     . HOH G 4 .  ? -6.840  -13.113 8.952  1.00 39.02 ? 14  HOH A O     1 
HETATM 2552 O O     . HOH G 4 .  ? -11.394 -8.412  8.866  1.00 26.51 ? 15  HOH A O     1 
HETATM 2553 O O     . HOH G 4 .  ? -11.904 -7.400  12.725 1.00 28.55 ? 16  HOH A O     1 
HETATM 2554 O O     . HOH G 4 .  ? 7.862   -7.341  24.069 1.00 37.56 ? 17  HOH A O     1 
HETATM 2555 O O     . HOH G 4 .  ? -3.550  -5.521  8.783  1.00 20.02 ? 18  HOH A O     1 
HETATM 2556 O O     . HOH G 4 .  ? 14.323  1.536   26.351 1.00 46.30 ? 19  HOH A O     1 
HETATM 2557 O O     . HOH G 4 .  ? -6.436  -15.928 27.965 1.00 49.05 ? 20  HOH A O     1 
HETATM 2558 O O     . HOH G 4 .  ? 4.624   -11.569 2.373  1.00 50.25 ? 21  HOH A O     1 
HETATM 2559 O O     . HOH G 4 .  ? -5.379  -4.957  10.807 1.00 16.90 ? 22  HOH A O     1 
HETATM 2560 O O     . HOH G 4 .  ? 6.952   14.355  28.360 1.00 36.81 ? 23  HOH A O     1 
HETATM 2561 O O     . HOH G 4 .  ? 7.066   -0.220  23.525 1.00 35.08 ? 24  HOH A O     1 
HETATM 2562 O O     . HOH G 4 .  ? 2.084   -5.989  -3.035 1.00 41.00 ? 25  HOH A O     1 
HETATM 2563 O O     . HOH G 4 .  ? -6.392  -10.834 4.889  1.00 27.13 ? 26  HOH A O     1 
HETATM 2564 O O     . HOH G 4 .  ? -12.455 -11.567 14.542 1.00 40.99 ? 27  HOH A O     1 
HETATM 2565 O O     . HOH G 4 .  ? -8.574  -15.135 21.845 1.00 41.41 ? 28  HOH A O     1 
HETATM 2566 O O     . HOH G 4 .  ? -4.694  -10.221 24.987 1.00 38.40 ? 29  HOH A O     1 
HETATM 2567 O O     . HOH G 4 .  ? 10.650  7.910   31.517 1.00 32.92 ? 30  HOH A O     1 
HETATM 2568 O O     . HOH G 4 .  ? 5.500   -11.838 23.555 1.00 45.62 ? 31  HOH A O     1 
HETATM 2569 O O     . HOH G 4 .  ? 13.054  9.621   25.480 1.00 51.13 ? 32  HOH A O     1 
HETATM 2570 O O     . HOH G 4 .  ? 7.949   -13.326 -3.138 1.00 54.92 ? 33  HOH A O     1 
HETATM 2571 O O     . HOH H 4 .  ? -8.784  -15.357 11.244 1.00 45.60 ? 14  HOH B O     1 
HETATM 2572 O O     . HOH H 4 .  ? -6.922  6.152   22.712 1.00 25.40 ? 15  HOH B O     1 
HETATM 2573 O O     . HOH H 4 .  ? 0.065   7.032   21.527 1.00 16.32 ? 16  HOH B O     1 
HETATM 2574 O O     . HOH H 4 .  ? 1.310   5.117   24.749 1.00 27.78 ? 17  HOH B O     1 
HETATM 2575 O O     . HOH H 4 .  ? 4.055   2.536   23.798 1.00 23.69 ? 18  HOH B O     1 
HETATM 2576 O O     . HOH H 4 .  ? 7.461   -3.100  23.423 1.00 24.08 ? 19  HOH B O     1 
HETATM 2577 O O     . HOH H 4 .  ? 7.686   -8.916  21.782 1.00 38.84 ? 20  HOH B O     1 
HETATM 2578 O O     . HOH H 4 .  ? 6.778   -12.573 21.241 1.00 46.73 ? 21  HOH B O     1 
HETATM 2579 O O     . HOH H 4 .  ? 12.314  0.160   18.480 1.00 29.16 ? 22  HOH B O     1 
HETATM 2580 O O     . HOH H 4 .  ? -2.273  -4.920  22.365 1.00 33.64 ? 23  HOH B O     1 
HETATM 2581 O O     . HOH H 4 .  ? 3.263   -11.622 11.226 1.00 36.27 ? 24  HOH B O     1 
HETATM 2582 O O     . HOH H 4 .  ? 8.344   2.944   16.176 1.00 22.21 ? 25  HOH B O     1 
HETATM 2583 O O     . HOH H 4 .  ? 12.882  -2.230  18.176 1.00 34.79 ? 26  HOH B O     1 
HETATM 2584 O O     . HOH H 4 .  ? 4.548   5.954   16.909 1.00 19.23 ? 27  HOH B O     1 
HETATM 2585 O O     . HOH H 4 .  ? -3.437  -3.727  26.110 1.00 31.36 ? 28  HOH B O     1 
HETATM 2586 O O     . HOH H 4 .  ? 0.528   -2.604  32.464 1.00 31.07 ? 29  HOH B O     1 
HETATM 2587 O O     . HOH H 4 .  ? 13.006  -3.209  20.850 1.00 56.32 ? 30  HOH B O     1 
HETATM 2588 O O     . HOH H 4 .  ? -3.019  -1.446  28.119 1.00 40.20 ? 31  HOH B O     1 
HETATM 2589 O O     . HOH H 4 .  ? -0.971  -2.402  29.595 1.00 36.21 ? 32  HOH B O     1 
HETATM 2590 O O     . HOH H 4 .  ? -2.271  6.668   33.230 1.00 40.88 ? 33  HOH B O     1 
HETATM 2591 O O     . HOH H 4 .  ? 3.176   -16.767 10.004 1.00 33.30 ? 34  HOH B O     1 
HETATM 2592 O O     . HOH H 4 .  ? -2.224  -25.309 14.629 1.00 45.97 ? 35  HOH B O     1 
HETATM 2593 O O     . HOH I 4 .  ? -7.777  40.775  24.154 1.00 36.25 ? 33  HOH D O     1 
HETATM 2594 O O     . HOH I 4 .  ? 3.512   38.800  8.777  1.00 19.47 ? 62  HOH D O     1 
HETATM 2595 O O     . HOH I 4 .  ? 6.373   44.138  4.849  1.00 30.97 ? 63  HOH D O     1 
HETATM 2596 O O     . HOH I 4 .  ? 11.938  40.816  12.739 1.00 34.59 ? 65  HOH D O     1 
HETATM 2597 O O     . HOH I 4 .  ? 6.333   48.988  27.991 1.00 47.94 ? 70  HOH D O     1 
HETATM 2598 O O     . HOH I 4 .  ? -14.846 31.840  26.461 1.00 49.75 ? 72  HOH D O     1 
HETATM 2599 O O     . HOH I 4 .  ? -12.965 25.172  28.805 1.00 60.06 ? 73  HOH D O     1 
HETATM 2600 O O     . HOH I 4 .  ? 11.367  41.814  9.071  1.00 28.09 ? 94  HOH D O     1 
HETATM 2601 O O     . HOH I 4 .  ? -7.765  30.529  23.278 1.00 51.38 ? 113 HOH D O     1 
HETATM 2602 O O     . HOH I 4 .  ? -7.032  33.543  23.484 1.00 39.99 ? 114 HOH D O     1 
HETATM 2603 O O     . HOH I 4 .  ? 5.439   38.325  10.770 1.00 16.94 ? 119 HOH D O     1 
HETATM 2604 O O     . HOH I 4 .  ? -10.805 25.361  31.366 1.00 30.52 ? 156 HOH D O     1 
HETATM 2605 O O     . HOH I 4 .  ? -7.002  18.924  28.211 1.00 40.02 ? 157 HOH D O     1 
HETATM 2606 O O     . HOH I 4 .  ? 4.652   43.603  25.248 1.00 41.93 ? 174 HOH D O     1 
HETATM 2607 O O     . HOH I 4 .  ? 2.452   41.306  23.920 1.00 40.47 ? 175 HOH D O     1 
HETATM 2608 O O     . HOH I 4 .  ? -5.608  45.169  23.641 1.00 40.37 ? 176 HOH D O     1 
HETATM 2609 O O     . HOH I 4 .  ? 6.816   46.464  8.838  1.00 38.61 ? 178 HOH D O     1 
HETATM 2610 O O     . HOH I 4 .  ? -2.974  43.745  -7.451 1.00 46.19 ? 179 HOH D O     1 
HETATM 2611 O O     . HOH I 4 .  ? -0.342  37.910  28.901 1.00 32.26 ? 184 HOH D O     1 
HETATM 2612 O O     . HOH I 4 .  ? -4.409  36.563  0.725  1.00 42.05 ? 222 HOH D O     1 
HETATM 2613 O O     . HOH I 4 .  ? -12.883 23.924  25.152 1.00 39.89 ? 224 HOH D O     1 
HETATM 2614 O O     . HOH J 4 .  ? 6.155   54.297  2.766  1.00 46.65 ? 14  HOH E O     1 
HETATM 2615 O O     . HOH J 4 .  ? -0.083  26.273  21.604 1.00 18.01 ? 15  HOH E O     1 
HETATM 2616 O O     . HOH J 4 .  ? -4.010  30.861  23.766 1.00 21.11 ? 16  HOH E O     1 
HETATM 2617 O O     . HOH J 4 .  ? -7.526  36.391  23.450 1.00 25.22 ? 17  HOH E O     1 
HETATM 2618 O O     . HOH J 4 .  ? -10.534 36.282  15.173 1.00 28.87 ? 18  HOH E O     1 
HETATM 2619 O O     . HOH J 4 .  ? -12.242 33.181  18.578 1.00 35.89 ? 19  HOH E O     1 
HETATM 2620 O O     . HOH J 4 .  ? 6.755   27.461  22.810 1.00 25.53 ? 20  HOH E O     1 
HETATM 2621 O O     . HOH J 4 .  ? 8.591   48.654  11.061 1.00 46.48 ? 21  HOH E O     1 
HETATM 2622 O O     . HOH J 4 .  ? -0.498  35.782  32.584 1.00 38.22 ? 22  HOH E O     1 
HETATM 2623 O O     . HOH J 4 .  ? 3.473   37.069  25.985 1.00 31.14 ? 23  HOH E O     1 
HETATM 2624 O O     . HOH J 4 .  ? 2.954   34.722  28.330 1.00 42.90 ? 24  HOH E O     1 
HETATM 2625 O O     . HOH J 4 .  ? -4.677  27.445  16.915 1.00 19.73 ? 25  HOH E O     1 
HETATM 2626 O O     . HOH J 4 .  ? -7.913  42.322  21.894 1.00 38.30 ? 26  HOH E O     1 
HETATM 2627 O O     . HOH J 4 .  ? -3.361  44.739  11.171 1.00 35.77 ? 27  HOH E O     1 
HETATM 2628 O O     . HOH J 4 .  ? -6.975  45.679  21.325 1.00 43.64 ? 28  HOH E O     1 
HETATM 2629 O O     . HOH J 4 .  ? -8.368  30.447  16.136 1.00 21.68 ? 29  HOH E O     1 
HETATM 2630 O O     . HOH J 4 .  ? -1.301  28.098  24.848 1.00 29.41 ? 30  HOH E O     1 
HETATM 2631 O O     . HOH J 4 .  ? 0.745   35.794  29.740 1.00 36.28 ? 31  HOH E O     1 
HETATM 2632 O O     . HOH J 4 .  ? -3.100  50.170  10.110 1.00 29.34 ? 32  HOH E O     1 
HETATM 2633 O O     . HOH J 4 .  ? 5.745   23.820  25.415 1.00 52.15 ? 33  HOH E O     1 
HETATM 2634 O O     . HOH J 4 .  ? -0.164  25.751  24.093 1.00 31.81 ? 34  HOH E O     1 
HETATM 2635 O O     . HOH J 4 .  ? 2.542   58.860  14.676 1.00 48.26 ? 35  HOH E O     1 
HETATM 2636 O O     . HOH K 4 .  ? -10.625 -7.106  6.089  1.00 24.69 ? 95  HOH C O     1 
HETATM 2637 O O     . HOH K 4 .  ? -7.699  -6.962  19.243 1.00 38.80 ? 96  HOH C O     1 
HETATM 2638 O O     . HOH K 4 .  ? 7.599   -6.764  14.893 1.00 36.95 ? 97  HOH C O     1 
HETATM 2639 O O     . HOH K 4 .  ? 7.656   -5.180  12.560 1.00 33.75 ? 98  HOH C O     1 
HETATM 2640 O O     . HOH K 4 .  ? 4.730   -3.567  7.776  1.00 15.74 ? 99  HOH C O     1 
HETATM 2641 O O     . HOH K 4 .  ? -0.119  -7.200  11.480 1.00 27.82 ? 100 HOH C O     1 
HETATM 2642 O O     . HOH K 4 .  ? 1.976   -0.206  17.529 1.00 11.40 ? 101 HOH C O     1 
HETATM 2643 O O     . HOH K 4 .  ? 7.049   4.829   17.794 1.00 12.50 ? 102 HOH C O     1 
HETATM 2644 O O     . HOH K 4 .  ? 8.787   5.821   11.762 1.00 10.34 ? 103 HOH C O     1 
HETATM 2645 O O     . HOH K 4 .  ? 1.823   14.751  18.047 1.00 23.12 ? 104 HOH C O     1 
HETATM 2646 O O     . HOH K 4 .  ? -1.238  16.028  18.387 1.00 50.33 ? 105 HOH C O     1 
HETATM 2647 O O     . HOH K 4 .  ? -8.868  20.287  5.758  1.00 36.25 ? 106 HOH C O     1 
HETATM 2648 O O     . HOH K 4 .  ? -10.072 14.733  9.768  1.00 24.38 ? 107 HOH C O     1 
HETATM 2649 O O     . HOH K 4 .  ? -6.244  17.376  16.151 1.00 20.04 ? 108 HOH C O     1 
HETATM 2650 O O     . HOH K 4 .  ? 13.331  -1.864  14.405 1.00 29.20 ? 109 HOH C O     1 
HETATM 2651 O O     . HOH K 4 .  ? 2.682   0.989   1.774  1.00 20.33 ? 110 HOH C O     1 
HETATM 2652 O O     . HOH K 4 .  ? -1.210  0.647   1.542  1.00 27.28 ? 111 HOH C O     1 
HETATM 2653 O O     . HOH K 4 .  ? 2.631   7.689   -1.524 1.00 43.03 ? 112 HOH C O     1 
HETATM 2654 O O     . HOH K 4 .  ? -2.568  11.622  1.489  1.00 17.76 ? 113 HOH C O     1 
HETATM 2655 O O     . HOH K 4 .  ? -9.619  12.473  1.588  1.00 29.96 ? 114 HOH C O     1 
HETATM 2656 O O     . HOH K 4 .  ? -15.092 2.104   2.831  1.00 22.08 ? 115 HOH C O     1 
HETATM 2657 O O     . HOH K 4 .  ? 8.708   13.057  5.483  1.00 39.14 ? 116 HOH C O     1 
HETATM 2658 O O     . HOH K 4 .  ? -8.059  -3.729  26.764 1.00 51.75 ? 117 HOH C O     1 
HETATM 2659 O O     . HOH K 4 .  ? -13.884 15.146  1.306  1.00 38.91 ? 118 HOH C O     1 
HETATM 2660 O O     . HOH K 4 .  ? -13.073 -4.959  13.367 1.00 27.09 ? 119 HOH C O     1 
HETATM 2661 O O     . HOH K 4 .  ? -20.259 7.484   0.837  1.00 35.64 ? 120 HOH C O     1 
HETATM 2662 O O     . HOH K 4 .  ? 7.782   4.678   20.459 1.00 29.85 ? 121 HOH C O     1 
HETATM 2663 O O     . HOH K 4 .  ? 3.504   5.156   23.259 1.00 30.01 ? 122 HOH C O     1 
HETATM 2664 O O     . HOH K 4 .  ? 10.513  -2.731  15.231 1.00 37.85 ? 123 HOH C O     1 
HETATM 2665 O O     . HOH K 4 .  ? -10.232 15.966  19.892 1.00 42.61 ? 124 HOH C O     1 
HETATM 2666 O O     . HOH K 4 .  ? -12.770 8.584   19.382 1.00 37.13 ? 125 HOH C O     1 
HETATM 2667 O O     . HOH K 4 .  ? -6.117  2.449   -3.160 1.00 37.31 ? 126 HOH C O     1 
HETATM 2668 O O     . HOH K 4 .  ? -9.491  -5.000  20.501 1.00 40.26 ? 127 HOH C O     1 
HETATM 2669 O O     . HOH K 4 .  ? -0.834  -6.008  8.861  1.00 16.69 ? 128 HOH C O     1 
HETATM 2670 O O     . HOH K 4 .  ? 2.697   -9.310  10.074 1.00 35.41 ? 129 HOH C O     1 
HETATM 2671 O O     . HOH K 4 .  ? 2.461   -6.050  15.034 1.00 19.30 ? 130 HOH C O     1 
HETATM 2672 O O     . HOH K 4 .  ? 8.373   -3.386  7.527  1.00 46.40 ? 131 HOH C O     1 
HETATM 2673 O O     . HOH K 4 .  ? 5.191   0.152   0.715  1.00 42.79 ? 132 HOH C O     1 
HETATM 2674 O O     . HOH K 4 .  ? 5.845   3.644   1.377  1.00 29.80 ? 133 HOH C O     1 
HETATM 2675 O O     . HOH K 4 .  ? -0.324  0.497   -1.138 1.00 51.68 ? 134 HOH C O     1 
HETATM 2676 O O     . HOH K 4 .  ? -4.035  20.479  2.894  1.00 37.48 ? 135 HOH C O     1 
HETATM 2677 O O     . HOH K 4 .  ? -14.407 19.259  2.820  1.00 49.12 ? 136 HOH C O     1 
HETATM 2678 O O     . HOH K 4 .  ? -14.456 12.175  17.262 1.00 39.58 ? 137 HOH C O     1 
HETATM 2679 O O     . HOH K 4 .  ? -13.345 11.051  22.487 1.00 38.56 ? 138 HOH C O     1 
HETATM 2680 O O     . HOH K 4 .  ? -8.376  8.561   23.363 1.00 46.38 ? 139 HOH C O     1 
HETATM 2681 O O     . HOH K 4 .  ? -7.223  3.409   24.556 1.00 48.66 ? 140 HOH C O     1 
HETATM 2682 O O     . HOH K 4 .  ? -18.255 0.104   4.392  1.00 33.56 ? 141 HOH C O     1 
HETATM 2683 O O     . HOH K 4 .  ? 9.435   3.665   9.000  1.00 32.43 ? 142 HOH C O     1 
HETATM 2684 O O     . HOH K 4 .  ? 7.028   2.206   7.464  1.00 42.35 ? 143 HOH C O     1 
HETATM 2685 O O     . HOH K 4 .  ? -14.195 6.629   17.085 1.00 32.11 ? 144 HOH C O     1 
HETATM 2686 O O     . HOH K 4 .  ? -18.962 13.883  3.224  1.00 55.84 ? 145 HOH C O     1 
HETATM 2687 O O     . HOH K 4 .  ? -18.672 19.638  19.997 1.00 39.51 ? 146 HOH C O     1 
HETATM 2688 O O     . HOH K 4 .  ? -18.880 21.140  17.405 1.00 48.25 ? 147 HOH C O     1 
HETATM 2689 O O     . HOH K 4 .  ? 4.986   14.771  18.378 1.00 38.14 ? 148 HOH C O     1 
HETATM 2690 O O     . HOH K 4 .  ? 6.108   15.342  21.054 1.00 53.36 ? 149 HOH C O     1 
HETATM 2691 O O     . HOH K 4 .  ? 0.016   13.743  -8.222 1.00 44.94 ? 150 HOH C O     1 
HETATM 2692 O O     . HOH K 4 .  ? -7.740  20.113  1.508  1.00 38.79 ? 151 HOH C O     1 
HETATM 2693 O O     . HOH K 4 .  ? 0.798   -6.590  6.968  1.00 29.55 ? 152 HOH C O     1 
HETATM 2694 O O     . HOH K 4 .  ? -5.445  20.503  11.695 1.00 13.18 ? 153 HOH C O     1 
HETATM 2695 O O     . HOH K 4 .  ? -17.998 -7.325  -1.639 1.00 54.08 ? 154 HOH C O     1 
HETATM 2696 O O     . HOH K 4 .  ? 2.070   -2.841  4.124  1.00 31.29 ? 155 HOH C O     1 
HETATM 2697 O O     . HOH K 4 .  ? 8.575   3.374   5.663  1.00 48.92 ? 156 HOH C O     1 
HETATM 2698 O O     . HOH K 4 .  ? 7.460   4.909   3.509  1.00 35.80 ? 157 HOH C O     1 
HETATM 2699 O O     . HOH K 4 .  ? 11.240  2.029   8.542  1.00 43.33 ? 158 HOH C O     1 
HETATM 2700 O O     . HOH K 4 .  ? -11.252 15.635  7.347  1.00 27.84 ? 159 HOH C O     1 
HETATM 2701 O O     . HOH K 4 .  ? -16.517 10.507  1.152  1.00 44.42 ? 160 HOH C O     1 
HETATM 2702 O O     . HOH K 4 .  ? -11.822 -4.815  -1.839 1.00 41.76 ? 161 HOH C O     1 
HETATM 2703 O O     . HOH K 4 .  ? -3.198  1.299   -2.027 1.00 50.63 ? 162 HOH C O     1 
HETATM 2704 O O     . HOH K 4 .  ? 0.987   -0.925  1.889  1.00 34.14 ? 163 HOH C O     1 
HETATM 2705 O O     . HOH K 4 .  ? -5.951  9.510   25.191 1.00 51.78 ? 164 HOH C O     1 
HETATM 2706 O O     . HOH K 4 .  ? -12.500 8.612   22.159 1.00 47.09 ? 165 HOH C O     1 
HETATM 2707 O O     . HOH K 4 .  ? 8.703   14.884  16.726 1.00 50.61 ? 166 HOH C O     1 
HETATM 2708 O O     . HOH K 4 .  ? -25.522 13.049  1.454  1.00 40.94 ? 167 HOH C O     1 
HETATM 2709 O O     . HOH L 4 .  ? 10.093  18.763  9.838  1.00 27.96 ? 95  HOH F O     1 
HETATM 2710 O O     . HOH L 4 .  ? 6.269   15.970  16.213 1.00 22.21 ? 96  HOH F O     1 
HETATM 2711 O O     . HOH L 4 .  ? 1.090   17.359  18.434 1.00 41.31 ? 97  HOH F O     1 
HETATM 2712 O O     . HOH L 4 .  ? -1.827  18.695  18.016 1.00 20.41 ? 98  HOH F O     1 
HETATM 2713 O O     . HOH L 4 .  ? -7.726  40.020  14.919 1.00 42.50 ? 99  HOH F O     1 
HETATM 2714 O O     . HOH L 4 .  ? -7.563  38.542  12.701 1.00 29.59 ? 100 HOH F O     1 
HETATM 2715 O O     . HOH L 4 .  ? -7.766  28.662  20.523 1.00 31.06 ? 101 HOH F O     1 
HETATM 2716 O O     . HOH L 4 .  ? -7.092  28.482  17.840 1.00 13.90 ? 102 HOH F O     1 
HETATM 2717 O O     . HOH L 4 .  ? 22.207  16.322  11.909 1.00 41.02 ? 103 HOH F O     1 
HETATM 2718 O O     . HOH L 4 .  ? -1.950  33.545  17.515 1.00 15.80 ? 104 HOH F O     1 
HETATM 2719 O O     . HOH L 4 .  ? -2.450  39.419  14.965 1.00 16.82 ? 105 HOH F O     1 
HETATM 2720 O O     . HOH L 4 .  ? 0.039   40.425  11.466 1.00 31.35 ? 106 HOH F O     1 
HETATM 2721 O O     . HOH L 4 .  ? 0.725   39.363  8.959  1.00 20.99 ? 107 HOH F O     1 
HETATM 2722 O O     . HOH L 4 .  ? 10.521  40.326  6.020  1.00 23.00 ? 108 HOH F O     1 
HETATM 2723 O O     . HOH L 4 .  ? -13.460 35.347  14.492 1.00 26.69 ? 109 HOH F O     1 
HETATM 2724 O O     . HOH L 4 .  ? 7.537   40.309  19.112 1.00 35.02 ? 110 HOH F O     1 
HETATM 2725 O O     . HOH L 4 .  ? 2.359   38.500  22.433 1.00 31.41 ? 111 HOH F O     1 
HETATM 2726 O O     . HOH L 4 .  ? 7.155   41.651  -1.256 1.00 56.48 ? 112 HOH F O     1 
HETATM 2727 O O     . HOH L 4 .  ? -8.983  36.026  7.134  1.00 47.59 ? 113 HOH F O     1 
HETATM 2728 O O     . HOH L 4 .  ? -4.719  36.920  7.761  1.00 15.75 ? 114 HOH F O     1 
HETATM 2729 O O     . HOH L 4 .  ? -2.737  32.353  1.824  1.00 20.57 ? 115 HOH F O     1 
HETATM 2730 O O     . HOH L 4 .  ? 1.202   32.802  1.528  1.00 26.08 ? 116 HOH F O     1 
HETATM 2731 O O     . HOH L 4 .  ? -2.676  25.821  -1.477 1.00 40.25 ? 117 HOH F O     1 
HETATM 2732 O O     . HOH L 4 .  ? 2.540   21.806  1.423  1.00 16.12 ? 118 HOH F O     1 
HETATM 2733 O O     . HOH L 4 .  ? -11.256 31.324  8.356  1.00 44.18 ? 119 HOH F O     1 
HETATM 2734 O O     . HOH L 4 .  ? 20.672  32.389  6.356  1.00 49.16 ? 120 HOH F O     1 
HETATM 2735 O O     . HOH L 4 .  ? -5.516  33.029  0.855  1.00 30.13 ? 121 HOH F O     1 
HETATM 2736 O O     . HOH L 4 .  ? -0.723  29.680  -2.618 1.00 49.71 ? 122 HOH F O     1 
HETATM 2737 O O     . HOH L 4 .  ? 6.078   30.926  -3.113 1.00 37.78 ? 123 HOH F O     1 
HETATM 2738 O O     . HOH L 4 .  ? 15.026  31.228  2.881  1.00 19.66 ? 124 HOH F O     1 
HETATM 2739 O O     . HOH L 4 .  ? 12.832  38.318  13.427 1.00 24.86 ? 125 HOH F O     1 
HETATM 2740 O O     . HOH L 4 .  ? 9.495   38.388  20.350 1.00 32.04 ? 126 HOH F O     1 
HETATM 2741 O O     . HOH L 4 .  ? 12.808  24.716  19.464 1.00 37.58 ? 127 HOH F O     1 
HETATM 2742 O O     . HOH L 4 .  ? 13.992  26.553  17.131 1.00 39.45 ? 128 HOH F O     1 
HETATM 2743 O O     . HOH L 4 .  ? 11.100  17.273  12.100 1.00 40.70 ? 129 HOH F O     1 
HETATM 2744 O O     . HOH L 4 .  ? 0.001   16.578  1.423  1.00 27.15 ? 130 HOH F O     1 
HETATM 2745 O O     . HOH L 4 .  ? -3.526  28.270  23.171 1.00 29.56 ? 131 HOH F O     1 
HETATM 2746 O O     . HOH L 4 .  ? 19.966  36.187  20.552 1.00 52.71 ? 132 HOH F O     1 
HETATM 2747 O O     . HOH L 4 .  ? -0.909  40.029  6.900  1.00 28.47 ? 133 HOH F O     1 
HETATM 2748 O O     . HOH L 4 .  ? -4.832  18.768  18.321 1.00 33.20 ? 134 HOH F O     1 
HETATM 2749 O O     . HOH L 4 .  ? -8.696  18.473  16.708 1.00 46.75 ? 135 HOH F O     1 
HETATM 2750 O O     . HOH L 4 .  ? 5.730   33.011  27.199 1.00 56.71 ? 136 HOH F O     1 
HETATM 2751 O O     . HOH L 4 .  ? -5.056  24.978  24.052 1.00 38.09 ? 137 HOH F O     1 
HETATM 2752 O O     . HOH L 4 .  ? 4.217   12.836  2.855  1.00 47.88 ? 138 HOH F O     1 
HETATM 2753 O O     . HOH L 4 .  ? 5.950   20.372  -4.020 1.00 40.64 ? 139 HOH F O     1 
HETATM 2754 O O     . HOH L 4 .  ? 13.092  22.328  22.543 1.00 43.22 ? 140 HOH F O     1 
HETATM 2755 O O     . HOH L 4 .  ? -9.392  29.672  9.067  1.00 25.64 ? 141 HOH F O     1 
HETATM 2756 O O     . HOH L 4 .  ? 18.982  23.156  1.860  1.00 45.37 ? 142 HOH F O     1 
HETATM 2757 O O     . HOH L 4 .  ? 20.296  35.694  18.085 1.00 38.21 ? 143 HOH F O     1 
HETATM 2758 O O     . HOH L 4 .  ? -2.619  42.614  10.038 1.00 39.51 ? 144 HOH F O     1 
HETATM 2759 O O     . HOH L 4 .  ? -7.772  33.578  2.281  1.00 44.96 ? 145 HOH F O     1 
HETATM 2760 O O     . HOH L 4 .  ? -5.974  29.609  1.453  1.00 33.53 ? 146 HOH F O     1 
HETATM 2761 O O     . HOH L 4 .  ? -7.319  31.316  7.289  1.00 44.01 ? 147 HOH F O     1 
HETATM 2762 O O     . HOH L 4 .  ? 0.212   32.758  -1.063 1.00 39.70 ? 148 HOH F O     1 
HETATM 2763 O O     . HOH L 4 .  ? 20.116  26.069  0.820  1.00 38.72 ? 149 HOH F O     1 
HETATM 2764 O O     . HOH L 4 .  ? -0.058  19.638  -8.161 1.00 48.04 ? 150 HOH F O     1 
HETATM 2765 O O     . HOH L 4 .  ? 2.874   18.330  -7.030 1.00 40.56 ? 151 HOH F O     1 
HETATM 2766 O O     . HOH L 4 .  ? 5.406   12.786  11.642 1.00 13.19 ? 152 HOH F O     1 
HETATM 2767 O O     . HOH L 4 .  ? 16.589  22.807  1.354  1.00 40.18 ? 153 HOH F O     1 
HETATM 2768 O O     . HOH L 4 .  ? -1.933  36.223  4.166  1.00 26.64 ? 154 HOH F O     1 
HETATM 2769 O O     . HOH L 4 .  ? 11.204  17.695  7.267  1.00 29.50 ? 155 HOH F O     1 
HETATM 2770 O O     . HOH L 4 .  ? 9.565   20.839  1.669  1.00 29.14 ? 156 HOH F O     1 
HETATM 2771 O O     . HOH L 4 .  ? 11.853  38.250  -1.954 1.00 42.75 ? 157 HOH F O     1 
HETATM 2772 O O     . HOH L 4 .  ? 7.836   18.099  23.142 1.00 45.66 ? 158 HOH F O     1 
HETATM 2773 O O     . HOH L 4 .  ? -8.780  27.549  11.830 1.00 11.19 ? 159 HOH F O     1 
HETATM 2774 O O     . HOH L 4 .  ? -7.528  28.641  3.748  1.00 31.77 ? 160 HOH F O     1 
HETATM 2775 O O     . HOH L 4 .  ? 0.216   16.832  6.337  1.00 42.13 ? 161 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DT  1  1  1  DT  T   A . n 
A 1 2  DG  2  2  2  DG  G   A . n 
A 1 3  DA  3  3  3  DA  A   A . n 
A 1 4  DC  4  4  4  DC  C   A . n 
A 1 5  DC  5  5  5  DC  C   A . n 
A 1 6  DG  6  6  6  DG  G   A . n 
A 1 7  DG  7  7  7  DG  G   A . n 
A 1 8  DA  8  8  8  DA  A   A . n 
A 1 9  DA  9  9  9  DA  A   A . n 
A 1 10 DG  10 10 10 DG  G   A . n 
A 1 11 DT  11 11 11 DT  T   A . n 
A 1 12 DG  12 12 12 DG  G   A . n 
A 1 13 DT  13 13 13 DT  T   A . n 
B 2 1  DA  1  1  1  DA  A   B . n 
B 2 2  DC  2  2  2  DC  C   B . n 
B 2 3  DA  3  3  3  DA  A   B . n 
B 2 4  DC  4  4  4  DC  C   B . n 
B 2 5  DT  5  5  5  DT  T   B . n 
B 2 6  DT  6  6  6  DT  T   B . n 
B 2 7  DC  7  7  7  DC  C   B . n 
B 2 8  DC  8  8  8  DC  C   B . n 
B 2 9  DG  9  9  9  DG  G   B . n 
B 2 10 DG  10 10 10 DG  G   B . n 
B 2 11 DT  11 11 11 DT  T   B . n 
B 2 12 DC  12 12 12 DC  C   B . n 
B 2 13 DA  13 13 13 DA  A   B . n 
C 1 1  DT  1  1  1  DT  T   D . n 
C 1 2  DG  2  2  2  DG  G   D . n 
C 1 3  DA  3  3  3  DA  A   D . n 
C 1 4  DC  4  4  4  DC  C   D . n 
C 1 5  DC  5  5  5  DC  C   D . n 
C 1 6  DG  6  6  6  DG  G   D . n 
C 1 7  DG  7  7  7  DG  G   D . n 
C 1 8  DA  8  8  8  DA  A   D . n 
C 1 9  DA  9  9  9  DA  A   D . n 
C 1 10 DG  10 10 10 DG  G   D . n 
C 1 11 DT  11 11 11 DT  T   D . n 
C 1 12 DG  12 12 12 DG  G   D . n 
C 1 13 DT  13 13 13 DT  T   D . n 
D 2 1  DA  1  1  1  DA  A   E . n 
D 2 2  DC  2  2  2  DC  C   E . n 
D 2 3  DA  3  3  3  DA  A   E . n 
D 2 4  DC  4  4  4  DC  C   E . n 
D 2 5  DT  5  5  5  DT  T   E . n 
D 2 6  DT  6  6  6  DT  T   E . n 
D 2 7  DC  7  7  7  DC  C   E . n 
D 2 8  DC  8  8  8  DC  C   E . n 
D 2 9  DG  9  9  9  DG  G   E . n 
D 2 10 DG  10 10 10 DG  G   E . n 
D 2 11 DT  11 11 11 DT  T   E . n 
D 2 12 DC  12 12 12 DC  C   E . n 
D 2 13 DA  13 13 13 DA  A   E . n 
E 3 1  MET 1  1  ?  ?   ?   C . n 
E 3 2  ASP 2  2  ?  ?   ?   C . n 
E 3 3  PRO 3  3  ?  ?   ?   C . n 
E 3 4  SER 4  4  ?  ?   ?   C . n 
E 3 5  VAL 5  5  5  VAL VAL C . n 
E 3 6  THR 6  6  6  THR THR C . n 
E 3 7  LEU 7  7  7  LEU LEU C . n 
E 3 8  TRP 8  8  8  TRP TRP C . n 
E 3 9  GLN 9  9  9  GLN GLN C . n 
E 3 10 PHE 10 10 10 PHE PHE C . n 
E 3 11 LEU 11 11 11 LEU LEU C . n 
E 3 12 LEU 12 12 12 LEU LEU C . n 
E 3 13 GLN 13 13 13 GLN GLN C . n 
E 3 14 LEU 14 14 14 LEU LEU C . n 
E 3 15 LEU 15 15 15 LEU LEU C . n 
E 3 16 ARG 16 16 16 ARG ARG C . n 
E 3 17 GLU 17 17 17 GLU GLU C . n 
E 3 18 GLN 18 18 18 GLN GLN C . n 
E 3 19 GLY 19 19 19 GLY GLY C . n 
E 3 20 ASN 20 20 20 ASN ASN C . n 
E 3 21 GLY 21 21 21 GLY GLY C . n 
E 3 22 HIS 22 22 22 HIS HIS C . n 
E 3 23 ILE 23 23 23 ILE ILE C . n 
E 3 24 ILE 24 24 24 ILE ILE C . n 
E 3 25 SER 25 25 25 SER SER C . n 
E 3 26 TRP 26 26 26 TRP TRP C . n 
E 3 27 THR 27 27 27 THR THR C . n 
E 3 28 SER 28 28 28 SER SER C . n 
E 3 29 ARG 29 29 29 ARG ARG C . n 
E 3 30 ASP 30 30 30 ASP ASP C . n 
E 3 31 GLY 31 31 31 GLY GLY C . n 
E 3 32 GLY 32 32 32 GLY GLY C . n 
E 3 33 GLU 33 33 33 GLU GLU C . n 
E 3 34 PHE 34 34 34 PHE PHE C . n 
E 3 35 LYS 35 35 35 LYS LYS C . n 
E 3 36 LEU 36 36 36 LEU LEU C . n 
E 3 37 VAL 37 37 37 VAL VAL C . n 
E 3 38 ASP 38 38 38 ASP ASP C . n 
E 3 39 ALA 39 39 39 ALA ALA C . n 
E 3 40 GLU 40 40 40 GLU GLU C . n 
E 3 41 GLU 41 41 41 GLU GLU C . n 
E 3 42 VAL 42 42 42 VAL VAL C . n 
E 3 43 ALA 43 43 43 ALA ALA C . n 
E 3 44 ARG 44 44 44 ARG ARG C . n 
E 3 45 LEU 45 45 45 LEU LEU C . n 
E 3 46 TRP 46 46 46 TRP TRP C . n 
E 3 47 GLY 47 47 47 GLY GLY C . n 
E 3 48 LEU 48 48 48 LEU LEU C . n 
E 3 49 ARG 49 49 49 ARG ARG C . n 
E 3 50 LYS 50 50 50 LYS LYS C . n 
E 3 51 ASN 51 51 51 ASN ASN C . n 
E 3 52 LYS 52 52 52 LYS LYS C . n 
E 3 53 THR 53 53 53 THR THR C . n 
E 3 54 ASN 54 54 54 ASN ASN C . n 
E 3 55 MET 55 55 55 MET MET C . n 
E 3 56 ASN 56 56 56 ASN ASN C . n 
E 3 57 TYR 57 57 57 TYR TYR C . n 
E 3 58 ASP 58 58 58 ASP ASP C . n 
E 3 59 LYS 59 59 59 LYS LYS C . n 
E 3 60 LEU 60 60 60 LEU LEU C . n 
E 3 61 SER 61 61 61 SER SER C . n 
E 3 62 ARG 62 62 62 ARG ARG C . n 
E 3 63 ALA 63 63 63 ALA ALA C . n 
E 3 64 LEU 64 64 64 LEU LEU C . n 
E 3 65 ARG 65 65 65 ARG ARG C . n 
E 3 66 TYR 66 66 66 TYR TYR C . n 
E 3 67 TYR 67 67 67 TYR TYR C . n 
E 3 68 TYR 68 68 68 TYR TYR C . n 
E 3 69 ASP 69 69 69 ASP ASP C . n 
E 3 70 LYS 70 70 70 LYS LYS C . n 
E 3 71 ASN 71 71 71 ASN ASN C . n 
E 3 72 ILE 72 72 72 ILE ILE C . n 
E 3 73 ILE 73 73 73 ILE ILE C . n 
E 3 74 ARG 74 74 74 ARG ARG C . n 
E 3 75 LYS 75 75 75 LYS LYS C . n 
E 3 76 VAL 76 76 76 VAL VAL C . n 
E 3 77 SER 77 77 77 SER SER C . n 
E 3 78 GLY 78 78 78 GLY GLY C . n 
E 3 79 GLN 79 79 79 GLN GLN C . n 
E 3 80 LYS 80 80 80 LYS LYS C . n 
E 3 81 PHE 81 81 81 PHE PHE C . n 
E 3 82 VAL 82 82 82 VAL VAL C . n 
E 3 83 TYR 83 83 83 TYR TYR C . n 
E 3 84 LYS 84 84 84 LYS LYS C . n 
E 3 85 PHE 85 85 85 PHE PHE C . n 
E 3 86 VAL 86 86 86 VAL VAL C . n 
E 3 87 SER 87 87 87 SER SER C . n 
E 3 88 TYR 88 88 88 TYR TYR C . n 
E 3 89 PRO 89 89 89 PRO PRO C . n 
E 3 90 GLU 90 90 90 GLU GLU C . n 
E 3 91 VAL 91 91 ?  ?   ?   C . n 
E 3 92 ALA 92 92 ?  ?   ?   C . n 
E 3 93 GLY 93 93 ?  ?   ?   C . n 
E 3 94 CYS 94 94 ?  ?   ?   C . n 
F 3 1  MET 1  1  ?  ?   ?   F . n 
F 3 2  ASP 2  2  ?  ?   ?   F . n 
F 3 3  PRO 3  3  ?  ?   ?   F . n 
F 3 4  SER 4  4  ?  ?   ?   F . n 
F 3 5  VAL 5  5  5  VAL VAL F . n 
F 3 6  THR 6  6  6  THR THR F . n 
F 3 7  LEU 7  7  7  LEU LEU F . n 
F 3 8  TRP 8  8  8  TRP TRP F . n 
F 3 9  GLN 9  9  9  GLN GLN F . n 
F 3 10 PHE 10 10 10 PHE PHE F . n 
F 3 11 LEU 11 11 11 LEU LEU F . n 
F 3 12 LEU 12 12 12 LEU LEU F . n 
F 3 13 GLN 13 13 13 GLN GLN F . n 
F 3 14 LEU 14 14 14 LEU LEU F . n 
F 3 15 LEU 15 15 15 LEU LEU F . n 
F 3 16 ARG 16 16 16 ARG ARG F . n 
F 3 17 GLU 17 17 17 GLU GLU F . n 
F 3 18 GLN 18 18 18 GLN GLN F . n 
F 3 19 GLY 19 19 19 GLY GLY F . n 
F 3 20 ASN 20 20 20 ASN ASN F . n 
F 3 21 GLY 21 21 21 GLY GLY F . n 
F 3 22 HIS 22 22 22 HIS HIS F . n 
F 3 23 ILE 23 23 23 ILE ILE F . n 
F 3 24 ILE 24 24 24 ILE ILE F . n 
F 3 25 SER 25 25 25 SER SER F . n 
F 3 26 TRP 26 26 26 TRP TRP F . n 
F 3 27 THR 27 27 27 THR THR F . n 
F 3 28 SER 28 28 28 SER SER F . n 
F 3 29 ARG 29 29 29 ARG ARG F . n 
F 3 30 ASP 30 30 30 ASP ASP F . n 
F 3 31 GLY 31 31 31 GLY GLY F . n 
F 3 32 GLY 32 32 32 GLY GLY F . n 
F 3 33 GLU 33 33 33 GLU GLU F . n 
F 3 34 PHE 34 34 34 PHE PHE F . n 
F 3 35 LYS 35 35 35 LYS LYS F . n 
F 3 36 LEU 36 36 36 LEU LEU F . n 
F 3 37 VAL 37 37 37 VAL VAL F . n 
F 3 38 ASP 38 38 38 ASP ASP F . n 
F 3 39 ALA 39 39 39 ALA ALA F . n 
F 3 40 GLU 40 40 40 GLU GLU F . n 
F 3 41 GLU 41 41 41 GLU GLU F . n 
F 3 42 VAL 42 42 42 VAL VAL F . n 
F 3 43 ALA 43 43 43 ALA ALA F . n 
F 3 44 ARG 44 44 44 ARG ARG F . n 
F 3 45 LEU 45 45 45 LEU LEU F . n 
F 3 46 TRP 46 46 46 TRP TRP F . n 
F 3 47 GLY 47 47 47 GLY GLY F . n 
F 3 48 LEU 48 48 48 LEU LEU F . n 
F 3 49 ARG 49 49 49 ARG ARG F . n 
F 3 50 LYS 50 50 50 LYS LYS F . n 
F 3 51 ASN 51 51 51 ASN ASN F . n 
F 3 52 LYS 52 52 52 LYS LYS F . n 
F 3 53 THR 53 53 53 THR THR F . n 
F 3 54 ASN 54 54 54 ASN ASN F . n 
F 3 55 MET 55 55 55 MET MET F . n 
F 3 56 ASN 56 56 56 ASN ASN F . n 
F 3 57 TYR 57 57 57 TYR TYR F . n 
F 3 58 ASP 58 58 58 ASP ASP F . n 
F 3 59 LYS 59 59 59 LYS LYS F . n 
F 3 60 LEU 60 60 60 LEU LEU F . n 
F 3 61 SER 61 61 61 SER SER F . n 
F 3 62 ARG 62 62 62 ARG ARG F . n 
F 3 63 ALA 63 63 63 ALA ALA F . n 
F 3 64 LEU 64 64 64 LEU LEU F . n 
F 3 65 ARG 65 65 65 ARG ARG F . n 
F 3 66 TYR 66 66 66 TYR TYR F . n 
F 3 67 TYR 67 67 67 TYR TYR F . n 
F 3 68 TYR 68 68 68 TYR TYR F . n 
F 3 69 ASP 69 69 69 ASP ASP F . n 
F 3 70 LYS 70 70 70 LYS LYS F . n 
F 3 71 ASN 71 71 71 ASN ASN F . n 
F 3 72 ILE 72 72 72 ILE ILE F . n 
F 3 73 ILE 73 73 73 ILE ILE F . n 
F 3 74 ARG 74 74 74 ARG ARG F . n 
F 3 75 LYS 75 75 75 LYS LYS F . n 
F 3 76 VAL 76 76 76 VAL VAL F . n 
F 3 77 SER 77 77 77 SER SER F . n 
F 3 78 GLY 78 78 78 GLY GLY F . n 
F 3 79 GLN 79 79 79 GLN GLN F . n 
F 3 80 LYS 80 80 80 LYS LYS F . n 
F 3 81 PHE 81 81 81 PHE PHE F . n 
F 3 82 VAL 82 82 82 VAL VAL F . n 
F 3 83 TYR 83 83 83 TYR TYR F . n 
F 3 84 LYS 84 84 84 LYS LYS F . n 
F 3 85 PHE 85 85 85 PHE PHE F . n 
F 3 86 VAL 86 86 86 VAL VAL F . n 
F 3 87 SER 87 87 87 SER SER F . n 
F 3 88 TYR 88 88 88 TYR TYR F . n 
F 3 89 PRO 89 89 89 PRO PRO F . n 
F 3 90 GLU 90 90 90 GLU GLU F . n 
F 3 91 VAL 91 91 ?  ?   ?   F . n 
F 3 92 ALA 92 92 ?  ?   ?   F . n 
F 3 93 GLY 93 93 ?  ?   ?   F . n 
F 3 94 CYS 94 94 ?  ?   ?   F . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-04-17 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
CNS       refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR C 88 ? ? -23.26 117.21  
2 1 PRO C 89 ? ? -57.61 75.54   
3 1 PRO F 89 ? ? -90.43 -138.62 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DT B 5 ? ? 0.073 'SIDE CHAIN' 
2 1 DT E 5 ? ? 0.073 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 C MET 1  ? E MET 1  
2  1 Y 1 C ASP 2  ? E ASP 2  
3  1 Y 1 C PRO 3  ? E PRO 3  
4  1 Y 1 C SER 4  ? E SER 4  
5  1 Y 1 C VAL 91 ? E VAL 91 
6  1 Y 1 C ALA 92 ? E ALA 92 
7  1 Y 1 C GLY 93 ? E GLY 93 
8  1 Y 1 C CYS 94 ? E CYS 94 
9  1 Y 1 F MET 1  ? F MET 1  
10 1 Y 1 F ASP 2  ? F ASP 2  
11 1 Y 1 F PRO 3  ? F PRO 3  
12 1 Y 1 F SER 4  ? F SER 4  
13 1 Y 1 F VAL 91 ? F VAL 91 
14 1 Y 1 F ALA 92 ? F ALA 92 
15 1 Y 1 F GLY 93 ? F GLY 93 
16 1 Y 1 F CYS 94 ? F CYS 94 
# 
_ndb_struct_conf_na.entry_id   1DUX 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 13 1_555 -0.238 -0.384 -0.360 10.560  -7.867  1.083  1  A_DT1:DA13_B A 1  ? B 13 ? 20 1 
1 A DG 2  1_555 B DC 12 1_555 -0.498 -0.075 0.083  5.386   -9.500  4.661  2  A_DG2:DC12_B A 2  ? B 12 ? 19 1 
1 A DA 3  1_555 B DT 11 1_555 0.285  -0.021 0.114  9.796   -11.473 -3.176 3  A_DA3:DT11_B A 3  ? B 11 ? 20 1 
1 A DC 4  1_555 B DG 10 1_555 0.088  -0.065 -0.287 3.678   -12.560 1.305  4  A_DC4:DG10_B A 4  ? B 10 ? 19 1 
1 A DC 5  1_555 B DG 9  1_555 0.159  0.012  0.269  -16.211 -7.008  0.508  5  A_DC5:DG9_B  A 5  ? B 9  ? 19 1 
1 A DG 6  1_555 B DC 8  1_555 -0.687 0.030  -0.480 0.730   2.849   4.701  6  A_DG6:DC8_B  A 6  ? B 8  ? 19 1 
1 A DG 7  1_555 B DC 7  1_555 -0.400 -0.158 0.152  6.182   -5.839  3.514  7  A_DG7:DC7_B  A 7  ? B 7  ? 19 1 
1 A DA 8  1_555 B DT 6  1_555 0.146  0.061  -0.055 10.830  -11.404 5.319  8  A_DA8:DT6_B  A 8  ? B 6  ? 20 1 
1 A DA 9  1_555 B DT 5  1_555 0.086  -0.071 0.075  10.401  -19.607 5.024  9  A_DA9:DT5_B  A 9  ? B 5  ? 20 1 
1 A DG 10 1_555 B DC 4  1_555 -0.377 -0.022 -0.019 -7.049  -13.158 0.484  10 A_DG10:DC4_B A 10 ? B 4  ? 19 1 
1 A DT 11 1_555 B DA 3  1_555 -0.317 -0.016 0.149  -5.595  -9.808  2.506  11 A_DT11:DA3_B A 11 ? B 3  ? 20 1 
1 A DG 12 1_555 B DC 2  1_555 -0.025 0.048  0.126  4.547   -3.535  4.692  12 A_DG12:DC2_B A 12 ? B 2  ? 19 1 
1 A DT 13 1_555 B DA 1  1_555 0.045  0.019  -0.043 19.144  -6.349  7.484  13 A_DT13:DA1_B A 13 ? B 1  ? 20 1 
1 C DT 1  1_555 D DA 13 1_555 -0.218 -0.375 -0.354 10.522  -7.947  1.125  14 D_DT1:DA13_E D 1  ? E 13 ? 20 1 
1 C DG 2  1_555 D DC 12 1_555 -0.485 -0.082 0.089  5.329   -9.776  4.616  15 D_DG2:DC12_E D 2  ? E 12 ? 19 1 
1 C DA 3  1_555 D DT 11 1_555 0.299  -0.032 0.121  9.624   -11.548 -3.152 16 D_DA3:DT11_E D 3  ? E 11 ? 20 1 
1 C DC 4  1_555 D DG 10 1_555 0.091  -0.078 -0.277 3.745   -12.557 1.440  17 D_DC4:DG10_E D 4  ? E 10 ? 19 1 
1 C DC 5  1_555 D DG 9  1_555 0.150  0.003  0.268  -16.158 -6.946  0.537  18 D_DC5:DG9_E  D 5  ? E 9  ? 19 1 
1 C DG 6  1_555 D DC 8  1_555 -0.688 0.033  -0.472 0.595   2.907   4.751  19 D_DG6:DC8_E  D 6  ? E 8  ? 19 1 
1 C DG 7  1_555 D DC 7  1_555 -0.405 -0.162 0.179  6.128   -5.789  3.391  20 D_DG7:DC7_E  D 7  ? E 7  ? 19 1 
1 C DA 8  1_555 D DT 6  1_555 0.146  0.065  -0.051 10.874  -11.414 5.325  21 D_DA8:DT6_E  D 8  ? E 6  ? 20 1 
1 C DA 9  1_555 D DT 5  1_555 0.084  -0.063 0.093  10.245  -19.730 5.168  22 D_DA9:DT5_E  D 9  ? E 5  ? 20 1 
1 C DG 10 1_555 D DC 4  1_555 -0.382 -0.023 -0.034 -7.471  -13.467 0.669  23 D_DG10:DC4_E D 10 ? E 4  ? 19 1 
1 C DT 11 1_555 D DA 3  1_555 -0.305 -0.018 0.141  -5.325  -9.802  2.587  24 D_DT11:DA3_E D 11 ? E 3  ? 20 1 
1 C DG 12 1_555 D DC 2  1_555 -0.031 0.048  0.146  4.558   -3.596  4.724  25 D_DG12:DC2_E D 12 ? E 2  ? 19 1 
1 C DT 13 1_555 D DA 1  1_555 0.036  0.022  -0.038 19.072  -6.543  7.567  26 D_DT13:DA1_E D 13 ? E 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 13 1_555 A DG 2  1_555 B DC 12 1_555 -0.075 1.068  3.493 -4.821 6.876  34.250 0.638  -0.665 3.611 11.464 
8.037  35.234 1  AA_DT1DG2:DC12DA13_BB A 1  ? B 13 ? A 2  ? B 12 ? 
1 A DG 2  1_555 B DC 12 1_555 A DA 3  1_555 B DT 11 1_555 -0.485 0.342  3.152 -1.467 0.243  41.527 0.457  0.534  3.169 0.342  
2.068  41.552 2  AA_DG2DA3:DT11DC12_BB A 2  ? B 12 ? A 3  ? B 11 ? 
1 A DA 3  1_555 B DT 11 1_555 A DC 4  1_555 B DG 10 1_555 0.798  -0.972 3.410 3.722  2.652  33.629 -2.109 -0.745 3.392 4.558  
-6.396 33.929 3  AA_DA3DC4:DG10DT11_BB A 3  ? B 11 ? A 4  ? B 10 ? 
1 A DC 4  1_555 B DG 10 1_555 A DC 5  1_555 B DG 9  1_555 -0.176 -0.903 3.679 -3.782 10.476 32.270 -3.352 -0.354 3.237 18.185 
6.566  34.090 4  AA_DC4DC5:DG9DG10_BB  A 4  ? B 10 ? A 5  ? B 9  ? 
1 A DC 5  1_555 B DG 9  1_555 A DG 6  1_555 B DC 8  1_555 0.721  0.822  3.109 5.240  3.361  30.886 0.898  -0.368 3.253 6.231  
-9.715 31.492 5  AA_DC5DG6:DC8DG9_BB   A 5  ? B 9  ? A 6  ? B 8  ? 
1 A DG 6  1_555 B DC 8  1_555 A DG 7  1_555 B DC 7  1_555 -1.541 0.090  3.130 -7.052 5.247  30.063 -0.839 1.505  3.364 9.854  
13.243 31.293 6  AA_DG6DG7:DC7DC8_BB   A 6  ? B 8  ? A 7  ? B 7  ? 
1 A DG 7  1_555 B DC 7  1_555 A DA 8  1_555 B DT 6  1_555 -0.027 -0.192 3.246 0.604  8.354  31.619 -1.767 0.151  3.095 15.004 
-1.085 32.682 7  AA_DG7DA8:DT6DC7_BB   A 7  ? B 7  ? A 8  ? B 6  ? 
1 A DA 8  1_555 B DT 6  1_555 A DA 9  1_555 B DT 5  1_555 -0.222 0.004  3.194 0.272  5.449  33.744 -0.835 0.420  3.154 9.312  
-0.464 34.170 8  AA_DA8DA9:DT5DT6_BB   A 8  ? B 6  ? A 9  ? B 5  ? 
1 A DA 9  1_555 B DT 5  1_555 A DG 10 1_555 B DC 4  1_555 -0.010 -0.676 3.624 -4.308 5.932  39.023 -1.752 -0.535 3.470 8.786  
6.380  39.679 9  AA_DA9DG10:DC4DT5_BB  A 9  ? B 5  ? A 10 ? B 4  ? 
1 A DG 10 1_555 B DC 4  1_555 A DT 11 1_555 B DA 3  1_555 -1.235 -0.759 3.227 -2.545 -0.424 28.415 -1.444 1.923  3.333 -0.861 
5.172  28.529 10 AA_DG10DT11:DA3DC4_BB A 10 ? B 4  ? A 11 ? B 3  ? 
1 A DT 11 1_555 B DA 3  1_555 A DG 12 1_555 B DC 2  1_555 -0.088 0.605  3.115 -2.343 6.749  33.193 -0.015 -0.215 3.172 11.646 
4.044  33.932 11 AA_DT11DG12:DC2DA3_BB A 11 ? B 3  ? A 12 ? B 2  ? 
1 A DG 12 1_555 B DC 2  1_555 A DT 13 1_555 B DA 1  1_555 -0.252 -0.293 2.962 0.022  3.022  27.359 -1.283 0.535  2.913 6.364  
-0.046 27.523 12 AA_DG12DT13:DA1DC2_BB A 12 ? B 2  ? A 13 ? B 1  ? 
1 C DT 1  1_555 D DA 13 1_555 C DG 2  1_555 D DC 12 1_555 -0.077 1.073  3.499 -4.732 6.879  34.228 0.644  -0.650 3.618 11.477 
7.895  35.202 13 DD_DT1DG2:DC12DA13_EE D 1  ? E 13 ? D 2  ? E 12 ? 
1 C DG 2  1_555 D DC 12 1_555 C DA 3  1_555 D DT 11 1_555 -0.479 0.345  3.149 -1.504 0.241  41.629 0.461  0.520  3.166 0.339  
2.115  41.655 14 DD_DG2DA3:DT11DC12_EE D 2  ? E 12 ? D 3  ? E 11 ? 
1 C DA 3  1_555 D DT 11 1_555 C DC 4  1_555 D DG 10 1_555 0.808  -0.971 3.402 3.830  2.633  33.534 -2.111 -0.744 3.387 4.536  
-6.599 33.846 15 DD_DA3DC4:DG10DT11_EE D 3  ? E 11 ? D 4  ? E 10 ? 
1 C DC 4  1_555 D DG 10 1_555 C DC 5  1_555 D DG 9  1_555 -0.173 -0.897 3.679 -3.706 10.575 32.261 -3.357 -0.346 3.233 18.354 
6.432  34.102 16 DD_DC4DC5:DG9DG10_EE  D 4  ? E 10 ? D 5  ? E 9  ? 
1 C DC 5  1_555 D DG 9  1_555 C DG 6  1_555 D DC 8  1_555 0.718  0.824  3.114 5.128  3.540  30.937 0.868  -0.382 3.260 6.553  
-9.494 31.543 17 DD_DC5DG6:DC8DG9_EE   D 5  ? E 9  ? D 6  ? E 8  ? 
1 C DG 6  1_555 D DC 8  1_555 C DG 7  1_555 D DC 7  1_555 -1.547 0.084  3.127 -7.162 5.084  29.998 -0.821 1.496  3.367 9.566  
13.477 31.229 18 DD_DG6DG7:DC7DC8_EE   D 6  ? E 8  ? D 7  ? E 7  ? 
1 C DG 7  1_555 D DC 7  1_555 C DA 8  1_555 D DT 6  1_555 -0.025 -0.196 3.247 0.735  8.412  31.691 -1.775 0.170  3.094 15.072 
-1.316 32.769 19 DD_DG7DA8:DT6DC7_EE   D 7  ? E 7  ? D 8  ? E 6  ? 
1 C DA 8  1_555 D DT 6  1_555 C DA 9  1_555 D DT 5  1_555 -0.226 0.003  3.197 0.167  5.571  33.682 -0.859 0.412  3.156 9.532  
-0.286 34.127 20 DD_DA8DA9:DT5DT6_EE   D 8  ? E 6  ? D 9  ? E 5  ? 
1 C DA 9  1_555 D DT 5  1_555 C DG 10 1_555 D DC 4  1_555 -0.018 -0.665 3.633 -4.184 6.015  38.983 -1.752 -0.509 3.480 8.917  
6.203  39.639 21 DD_DA9DG10:DC4DT5_EE  D 9  ? E 5  ? D 10 ? E 4  ? 
1 C DG 10 1_555 D DC 4  1_555 C DT 11 1_555 D DA 3  1_555 -1.246 -0.742 3.203 -2.628 -0.441 28.509 -1.401 1.925  3.313 -0.892 
5.323  28.631 22 DD_DG10DT11:DA3DC4_EE D 10 ? E 4  ? D 11 ? E 3  ? 
1 C DT 11 1_555 D DA 3  1_555 C DG 12 1_555 D DC 2  1_555 -0.086 0.606  3.122 -2.620 6.710  33.113 -0.012 -0.263 3.178 11.603 
4.531  33.866 23 DD_DT11DG12:DC2DA3_EE D 11 ? E 3  ? D 12 ? E 2  ? 
1 C DG 12 1_555 D DC 2  1_555 C DT 13 1_555 D DA 1  1_555 -0.248 -0.291 2.968 0.136  2.994  27.348 -1.275 0.553  2.918 6.309  
-0.288 27.508 24 DD_DG12DT13:DA1DC2_EE D 12 ? E 2  ? D 13 ? E 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1  14  2   HOH HOH A . 
G 4 HOH 2  15  4   HOH HOH A . 
G 4 HOH 3  16  6   HOH HOH A . 
G 4 HOH 4  17  13  HOH HOH A . 
G 4 HOH 5  18  19  HOH HOH A . 
G 4 HOH 6  19  44  HOH HOH A . 
G 4 HOH 7  20  55  HOH HOH A . 
G 4 HOH 8  21  81  HOH HOH A . 
G 4 HOH 9  22  83  HOH HOH A . 
G 4 HOH 10 23  98  HOH HOH A . 
G 4 HOH 11 24  105 HOH HOH A . 
G 4 HOH 12 25  109 HOH HOH A . 
G 4 HOH 13 26  127 HOH HOH A . 
G 4 HOH 14 27  150 HOH HOH A . 
G 4 HOH 15 28  151 HOH HOH A . 
G 4 HOH 16 29  152 HOH HOH A . 
G 4 HOH 17 30  166 HOH HOH A . 
G 4 HOH 18 31  186 HOH HOH A . 
G 4 HOH 19 32  195 HOH HOH A . 
G 4 HOH 20 33  219 HOH HOH A . 
H 4 HOH 1  14  3   HOH HOH B . 
H 4 HOH 2  15  8   HOH HOH B . 
H 4 HOH 3  16  9   HOH HOH B . 
H 4 HOH 4  17  10  HOH HOH B . 
H 4 HOH 5  18  11  HOH HOH B . 
H 4 HOH 6  19  12  HOH HOH B . 
H 4 HOH 7  20  14  HOH HOH B . 
H 4 HOH 8  21  15  HOH HOH B . 
H 4 HOH 9  22  45  HOH HOH B . 
H 4 HOH 10 23  54  HOH HOH B . 
H 4 HOH 11 24  82  HOH HOH B . 
H 4 HOH 12 25  102 HOH HOH B . 
H 4 HOH 13 26  106 HOH HOH B . 
H 4 HOH 14 27  108 HOH HOH B . 
H 4 HOH 15 28  122 HOH HOH B . 
H 4 HOH 16 29  123 HOH HOH B . 
H 4 HOH 17 30  126 HOH HOH B . 
H 4 HOH 18 31  143 HOH HOH B . 
H 4 HOH 19 32  144 HOH HOH B . 
H 4 HOH 20 33  145 HOH HOH B . 
H 4 HOH 21 34  190 HOH HOH B . 
H 4 HOH 22 35  218 HOH HOH B . 
I 4 HOH 1  33  33  HOH HOH D . 
I 4 HOH 2  62  62  HOH HOH D . 
I 4 HOH 3  63  63  HOH HOH D . 
I 4 HOH 4  65  65  HOH HOH D . 
I 4 HOH 5  70  70  HOH HOH D . 
I 4 HOH 6  72  72  HOH HOH D . 
I 4 HOH 7  73  73  HOH HOH D . 
I 4 HOH 8  94  94  HOH HOH D . 
I 4 HOH 9  113 113 HOH HOH D . 
I 4 HOH 10 114 114 HOH HOH D . 
I 4 HOH 11 119 119 HOH HOH D . 
I 4 HOH 12 156 156 HOH HOH D . 
I 4 HOH 13 157 157 HOH HOH D . 
I 4 HOH 14 174 174 HOH HOH D . 
I 4 HOH 15 175 175 HOH HOH D . 
I 4 HOH 16 176 176 HOH HOH D . 
I 4 HOH 17 178 178 HOH HOH D . 
I 4 HOH 18 179 179 HOH HOH D . 
I 4 HOH 19 184 184 HOH HOH D . 
I 4 HOH 20 222 222 HOH HOH D . 
I 4 HOH 21 224 224 HOH HOH D . 
J 4 HOH 1  14  1   HOH HOH E . 
J 4 HOH 2  15  30  HOH HOH E . 
J 4 HOH 3  16  31  HOH HOH E . 
J 4 HOH 4  17  32  HOH HOH E . 
J 4 HOH 5  18  36  HOH HOH E . 
J 4 HOH 6  19  37  HOH HOH E . 
J 4 HOH 7  20  57  HOH HOH E . 
J 4 HOH 8  21  64  HOH HOH E . 
J 4 HOH 9  22  91  HOH HOH E . 
J 4 HOH 10 23  96  HOH HOH E . 
J 4 HOH 11 24  97  HOH HOH E . 
J 4 HOH 12 25  111 HOH HOH E . 
J 4 HOH 13 26  116 HOH HOH E . 
J 4 HOH 14 27  117 HOH HOH E . 
J 4 HOH 15 28  149 HOH HOH E . 
J 4 HOH 16 29  160 HOH HOH E . 
J 4 HOH 17 30  168 HOH HOH E . 
J 4 HOH 18 31  185 HOH HOH E . 
J 4 HOH 19 32  189 HOH HOH E . 
J 4 HOH 20 33  215 HOH HOH E . 
J 4 HOH 21 34  216 HOH HOH E . 
J 4 HOH 22 35  223 HOH HOH E . 
K 4 HOH 1  95  5   HOH HOH C . 
K 4 HOH 2  96  7   HOH HOH C . 
K 4 HOH 3  97  16  HOH HOH C . 
K 4 HOH 4  98  17  HOH HOH C . 
K 4 HOH 5  99  18  HOH HOH C . 
K 4 HOH 6  100 20  HOH HOH C . 
K 4 HOH 7  101 21  HOH HOH C . 
K 4 HOH 8  102 22  HOH HOH C . 
K 4 HOH 9  103 23  HOH HOH C . 
K 4 HOH 10 104 26  HOH HOH C . 
K 4 HOH 11 105 27  HOH HOH C . 
K 4 HOH 12 106 40  HOH HOH C . 
K 4 HOH 13 107 41  HOH HOH C . 
K 4 HOH 14 108 43  HOH HOH C . 
K 4 HOH 15 109 46  HOH HOH C . 
K 4 HOH 16 110 47  HOH HOH C . 
K 4 HOH 17 111 48  HOH HOH C . 
K 4 HOH 18 112 49  HOH HOH C . 
K 4 HOH 19 113 50  HOH HOH C . 
K 4 HOH 20 114 51  HOH HOH C . 
K 4 HOH 21 115 52  HOH HOH C . 
K 4 HOH 22 116 53  HOH HOH C . 
K 4 HOH 23 117 56  HOH HOH C . 
K 4 HOH 24 118 80  HOH HOH C . 
K 4 HOH 25 119 84  HOH HOH C . 
K 4 HOH 26 120 85  HOH HOH C . 
K 4 HOH 27 121 103 HOH HOH C . 
K 4 HOH 28 122 104 HOH HOH C . 
K 4 HOH 29 123 107 HOH HOH C . 
K 4 HOH 30 124 120 HOH HOH C . 
K 4 HOH 31 125 121 HOH HOH C . 
K 4 HOH 32 126 124 HOH HOH C . 
K 4 HOH 33 127 125 HOH HOH C . 
K 4 HOH 34 128 128 HOH HOH C . 
K 4 HOH 35 129 129 HOH HOH C . 
K 4 HOH 36 130 130 HOH HOH C . 
K 4 HOH 37 131 131 HOH HOH C . 
K 4 HOH 38 132 132 HOH HOH C . 
K 4 HOH 39 133 133 HOH HOH C . 
K 4 HOH 40 134 134 HOH HOH C . 
K 4 HOH 41 135 137 HOH HOH C . 
K 4 HOH 42 136 138 HOH HOH C . 
K 4 HOH 43 137 139 HOH HOH C . 
K 4 HOH 44 138 140 HOH HOH C . 
K 4 HOH 45 139 141 HOH HOH C . 
K 4 HOH 46 140 142 HOH HOH C . 
K 4 HOH 47 141 146 HOH HOH C . 
K 4 HOH 48 142 147 HOH HOH C . 
K 4 HOH 49 143 148 HOH HOH C . 
K 4 HOH 50 144 153 HOH HOH C . 
K 4 HOH 51 145 155 HOH HOH C . 
K 4 HOH 52 146 158 HOH HOH C . 
K 4 HOH 53 147 159 HOH HOH C . 
K 4 HOH 54 148 162 HOH HOH C . 
K 4 HOH 55 149 163 HOH HOH C . 
K 4 HOH 56 150 165 HOH HOH C . 
K 4 HOH 57 151 172 HOH HOH C . 
K 4 HOH 58 152 191 HOH HOH C . 
K 4 HOH 59 153 193 HOH HOH C . 
K 4 HOH 60 154 196 HOH HOH C . 
K 4 HOH 61 155 197 HOH HOH C . 
K 4 HOH 62 156 198 HOH HOH C . 
K 4 HOH 63 157 199 HOH HOH C . 
K 4 HOH 64 158 200 HOH HOH C . 
K 4 HOH 65 159 203 HOH HOH C . 
K 4 HOH 66 160 204 HOH HOH C . 
K 4 HOH 67 161 205 HOH HOH C . 
K 4 HOH 68 162 206 HOH HOH C . 
K 4 HOH 69 163 207 HOH HOH C . 
K 4 HOH 70 164 208 HOH HOH C . 
K 4 HOH 71 165 209 HOH HOH C . 
K 4 HOH 72 166 210 HOH HOH C . 
K 4 HOH 73 167 213 HOH HOH C . 
L 4 HOH 1  95  24  HOH HOH F . 
L 4 HOH 2  96  25  HOH HOH F . 
L 4 HOH 3  97  28  HOH HOH F . 
L 4 HOH 4  98  29  HOH HOH F . 
L 4 HOH 5  99  34  HOH HOH F . 
L 4 HOH 6  100 35  HOH HOH F . 
L 4 HOH 7  101 38  HOH HOH F . 
L 4 HOH 8  102 39  HOH HOH F . 
L 4 HOH 9  103 42  HOH HOH F . 
L 4 HOH 10 104 58  HOH HOH F . 
L 4 HOH 11 105 59  HOH HOH F . 
L 4 HOH 12 106 60  HOH HOH F . 
L 4 HOH 13 107 61  HOH HOH F . 
L 4 HOH 14 108 66  HOH HOH F . 
L 4 HOH 15 109 67  HOH HOH F . 
L 4 HOH 16 110 68  HOH HOH F . 
L 4 HOH 17 111 69  HOH HOH F . 
L 4 HOH 18 112 71  HOH HOH F . 
L 4 HOH 19 113 74  HOH HOH F . 
L 4 HOH 20 114 75  HOH HOH F . 
L 4 HOH 21 115 76  HOH HOH F . 
L 4 HOH 22 116 77  HOH HOH F . 
L 4 HOH 23 117 78  HOH HOH F . 
L 4 HOH 24 118 79  HOH HOH F . 
L 4 HOH 25 119 86  HOH HOH F . 
L 4 HOH 26 120 87  HOH HOH F . 
L 4 HOH 27 121 88  HOH HOH F . 
L 4 HOH 28 122 89  HOH HOH F . 
L 4 HOH 29 123 90  HOH HOH F . 
L 4 HOH 30 124 92  HOH HOH F . 
L 4 HOH 31 125 93  HOH HOH F . 
L 4 HOH 32 126 95  HOH HOH F . 
L 4 HOH 33 127 99  HOH HOH F . 
L 4 HOH 34 128 100 HOH HOH F . 
L 4 HOH 35 129 101 HOH HOH F . 
L 4 HOH 36 130 110 HOH HOH F . 
L 4 HOH 37 131 112 HOH HOH F . 
L 4 HOH 38 132 115 HOH HOH F . 
L 4 HOH 39 133 118 HOH HOH F . 
L 4 HOH 40 134 135 HOH HOH F . 
L 4 HOH 41 135 136 HOH HOH F . 
L 4 HOH 42 136 154 HOH HOH F . 
L 4 HOH 43 137 161 HOH HOH F . 
L 4 HOH 44 138 164 HOH HOH F . 
L 4 HOH 45 139 167 HOH HOH F . 
L 4 HOH 46 140 169 HOH HOH F . 
L 4 HOH 47 141 170 HOH HOH F . 
L 4 HOH 48 142 171 HOH HOH F . 
L 4 HOH 49 143 173 HOH HOH F . 
L 4 HOH 50 144 177 HOH HOH F . 
L 4 HOH 51 145 180 HOH HOH F . 
L 4 HOH 52 146 181 HOH HOH F . 
L 4 HOH 53 147 182 HOH HOH F . 
L 4 HOH 54 148 183 HOH HOH F . 
L 4 HOH 55 149 187 HOH HOH F . 
L 4 HOH 56 150 188 HOH HOH F . 
L 4 HOH 57 151 192 HOH HOH F . 
L 4 HOH 58 152 194 HOH HOH F . 
L 4 HOH 59 153 201 HOH HOH F . 
L 4 HOH 60 154 202 HOH HOH F . 
L 4 HOH 61 155 211 HOH HOH F . 
L 4 HOH 62 156 212 HOH HOH F . 
L 4 HOH 63 157 214 HOH HOH F . 
L 4 HOH 64 158 217 HOH HOH F . 
L 4 HOH 65 159 220 HOH HOH F . 
L 4 HOH 66 160 221 HOH HOH F . 
L 4 HOH 67 161 225 HOH HOH F . 
#