data_1DX4
# 
_entry.id   1DX4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DX4         
WWPDB D_1290004405 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DX4 
_pdbx_database_status.recvd_initial_deposition_date   1999-12-20 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Silman, I.'    2 
'Sussman, J.L.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Three-dimensional structures of Drosophila melanogaster acetylcholinesterase and of its complexes with two potent inhibitors.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            9 
_citation.page_first                1063 
_citation.page_last                 1072 
_citation.year                      2000 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10892800 
_citation.pdbx_database_id_DOI      10.1110/ps.9.6.1063 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'        1 ? 
primary 'Kryger, G.'       2 ? 
primary 'Rosenberry, T.L.' 3 ? 
primary 'Mallender, W.D.'  4 ? 
primary 'Lewis, T.'        5 ? 
primary 'Fletcher, R.J.'   6 ? 
primary 'Guss, J.M.'       7 ? 
primary 'Silman, I.'       8 ? 
primary 'Sussman, J.L.'    9 ? 
# 
_cell.entry_id           1DX4 
_cell.length_a           95.810 
_cell.length_b           95.810 
_cell.length_c           162.030 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DX4 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 64956.562 1  3.1.1.7 ? ? ? 
2 branched    man 
;beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   1  ?       ? ? ? 
3 non-polymer syn 'SULFATE ION' 96.063    1  ?       ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1  ?       ? ? ? 
5 non-polymer syn '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 288.386   1  ?       ? ? ? 
6 water       nat water 18.015    91 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VIDRLVVQTSSGPVRGRSVTVQGREVHVYTGIPYAKPPVEDLRFRKPVPAEPWHGVLDATGLSATCVQERYEYFPGFSGE
EIWNPNTNVSEDCLYINVWAPAKARLRHGRGANGGEHPNGKQADTDHLIHNGNPQNTTNGLPILIWIYGGGFMTGSATLD
IYNADIMAAVGNVIVASFQYRVGAFGFLHLAPEMPSEFAEEAPGNVGLWDQALAIRWLKDNAHAFGGNPEWMTLFGESAG
SSSVNAQLMSPVTRGLVKRGMMQSGTMNAPWSHMTSEKAVEIGKALINDCNCNASMLKTNPAHVMSCMRSVDAKTISVQQ
WNSYSGILSFPSAPTIDGAFLPADPMTLMKTADLKDYDILMGNVRDEGTYFLLYDFIDYFDKDDATALPRDKYLEIMNNI
FGKATQAEREAIIFQYTSWEGNPGYQNQQQIGRAVGDHFFTCPTNEYAQALAERGASVHYYYFTHRTSTSLWGEWMGVLH
GDEIEYFFGQPLNNSLQYRPVERELGKRMLSAVIEFAKTGNPAQDGEEWPNFSKEDPVYYIFSTDDKIEKLARGPLAARC
SFWNDYLPKVRSWAGTCDGDSGSAS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   ILE n 
1 3   ASP n 
1 4   ARG n 
1 5   LEU n 
1 6   VAL n 
1 7   VAL n 
1 8   GLN n 
1 9   THR n 
1 10  SER n 
1 11  SER n 
1 12  GLY n 
1 13  PRO n 
1 14  VAL n 
1 15  ARG n 
1 16  GLY n 
1 17  ARG n 
1 18  SER n 
1 19  VAL n 
1 20  THR n 
1 21  VAL n 
1 22  GLN n 
1 23  GLY n 
1 24  ARG n 
1 25  GLU n 
1 26  VAL n 
1 27  HIS n 
1 28  VAL n 
1 29  TYR n 
1 30  THR n 
1 31  GLY n 
1 32  ILE n 
1 33  PRO n 
1 34  TYR n 
1 35  ALA n 
1 36  LYS n 
1 37  PRO n 
1 38  PRO n 
1 39  VAL n 
1 40  GLU n 
1 41  ASP n 
1 42  LEU n 
1 43  ARG n 
1 44  PHE n 
1 45  ARG n 
1 46  LYS n 
1 47  PRO n 
1 48  VAL n 
1 49  PRO n 
1 50  ALA n 
1 51  GLU n 
1 52  PRO n 
1 53  TRP n 
1 54  HIS n 
1 55  GLY n 
1 56  VAL n 
1 57  LEU n 
1 58  ASP n 
1 59  ALA n 
1 60  THR n 
1 61  GLY n 
1 62  LEU n 
1 63  SER n 
1 64  ALA n 
1 65  THR n 
1 66  CYS n 
1 67  VAL n 
1 68  GLN n 
1 69  GLU n 
1 70  ARG n 
1 71  TYR n 
1 72  GLU n 
1 73  TYR n 
1 74  PHE n 
1 75  PRO n 
1 76  GLY n 
1 77  PHE n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  GLU n 
1 82  ILE n 
1 83  TRP n 
1 84  ASN n 
1 85  PRO n 
1 86  ASN n 
1 87  THR n 
1 88  ASN n 
1 89  VAL n 
1 90  SER n 
1 91  GLU n 
1 92  ASP n 
1 93  CYS n 
1 94  LEU n 
1 95  TYR n 
1 96  ILE n 
1 97  ASN n 
1 98  VAL n 
1 99  TRP n 
1 100 ALA n 
1 101 PRO n 
1 102 ALA n 
1 103 LYS n 
1 104 ALA n 
1 105 ARG n 
1 106 LEU n 
1 107 ARG n 
1 108 HIS n 
1 109 GLY n 
1 110 ARG n 
1 111 GLY n 
1 112 ALA n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 GLU n 
1 117 HIS n 
1 118 PRO n 
1 119 ASN n 
1 120 GLY n 
1 121 LYS n 
1 122 GLN n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 ILE n 
1 130 HIS n 
1 131 ASN n 
1 132 GLY n 
1 133 ASN n 
1 134 PRO n 
1 135 GLN n 
1 136 ASN n 
1 137 THR n 
1 138 THR n 
1 139 ASN n 
1 140 GLY n 
1 141 LEU n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 ILE n 
1 146 TRP n 
1 147 ILE n 
1 148 TYR n 
1 149 GLY n 
1 150 GLY n 
1 151 GLY n 
1 152 PHE n 
1 153 MET n 
1 154 THR n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 LEU n 
1 160 ASP n 
1 161 ILE n 
1 162 TYR n 
1 163 ASN n 
1 164 ALA n 
1 165 ASP n 
1 166 ILE n 
1 167 MET n 
1 168 ALA n 
1 169 ALA n 
1 170 VAL n 
1 171 GLY n 
1 172 ASN n 
1 173 VAL n 
1 174 ILE n 
1 175 VAL n 
1 176 ALA n 
1 177 SER n 
1 178 PHE n 
1 179 GLN n 
1 180 TYR n 
1 181 ARG n 
1 182 VAL n 
1 183 GLY n 
1 184 ALA n 
1 185 PHE n 
1 186 GLY n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 LEU n 
1 191 ALA n 
1 192 PRO n 
1 193 GLU n 
1 194 MET n 
1 195 PRO n 
1 196 SER n 
1 197 GLU n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 GLU n 
1 202 ALA n 
1 203 PRO n 
1 204 GLY n 
1 205 ASN n 
1 206 VAL n 
1 207 GLY n 
1 208 LEU n 
1 209 TRP n 
1 210 ASP n 
1 211 GLN n 
1 212 ALA n 
1 213 LEU n 
1 214 ALA n 
1 215 ILE n 
1 216 ARG n 
1 217 TRP n 
1 218 LEU n 
1 219 LYS n 
1 220 ASP n 
1 221 ASN n 
1 222 ALA n 
1 223 HIS n 
1 224 ALA n 
1 225 PHE n 
1 226 GLY n 
1 227 GLY n 
1 228 ASN n 
1 229 PRO n 
1 230 GLU n 
1 231 TRP n 
1 232 MET n 
1 233 THR n 
1 234 LEU n 
1 235 PHE n 
1 236 GLY n 
1 237 GLU n 
1 238 SER n 
1 239 ALA n 
1 240 GLY n 
1 241 SER n 
1 242 SER n 
1 243 SER n 
1 244 VAL n 
1 245 ASN n 
1 246 ALA n 
1 247 GLN n 
1 248 LEU n 
1 249 MET n 
1 250 SER n 
1 251 PRO n 
1 252 VAL n 
1 253 THR n 
1 254 ARG n 
1 255 GLY n 
1 256 LEU n 
1 257 VAL n 
1 258 LYS n 
1 259 ARG n 
1 260 GLY n 
1 261 MET n 
1 262 MET n 
1 263 GLN n 
1 264 SER n 
1 265 GLY n 
1 266 THR n 
1 267 MET n 
1 268 ASN n 
1 269 ALA n 
1 270 PRO n 
1 271 TRP n 
1 272 SER n 
1 273 HIS n 
1 274 MET n 
1 275 THR n 
1 276 SER n 
1 277 GLU n 
1 278 LYS n 
1 279 ALA n 
1 280 VAL n 
1 281 GLU n 
1 282 ILE n 
1 283 GLY n 
1 284 LYS n 
1 285 ALA n 
1 286 LEU n 
1 287 ILE n 
1 288 ASN n 
1 289 ASP n 
1 290 CYS n 
1 291 ASN n 
1 292 CYS n 
1 293 ASN n 
1 294 ALA n 
1 295 SER n 
1 296 MET n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 ASN n 
1 301 PRO n 
1 302 ALA n 
1 303 HIS n 
1 304 VAL n 
1 305 MET n 
1 306 SER n 
1 307 CYS n 
1 308 MET n 
1 309 ARG n 
1 310 SER n 
1 311 VAL n 
1 312 ASP n 
1 313 ALA n 
1 314 LYS n 
1 315 THR n 
1 316 ILE n 
1 317 SER n 
1 318 VAL n 
1 319 GLN n 
1 320 GLN n 
1 321 TRP n 
1 322 ASN n 
1 323 SER n 
1 324 TYR n 
1 325 SER n 
1 326 GLY n 
1 327 ILE n 
1 328 LEU n 
1 329 SER n 
1 330 PHE n 
1 331 PRO n 
1 332 SER n 
1 333 ALA n 
1 334 PRO n 
1 335 THR n 
1 336 ILE n 
1 337 ASP n 
1 338 GLY n 
1 339 ALA n 
1 340 PHE n 
1 341 LEU n 
1 342 PRO n 
1 343 ALA n 
1 344 ASP n 
1 345 PRO n 
1 346 MET n 
1 347 THR n 
1 348 LEU n 
1 349 MET n 
1 350 LYS n 
1 351 THR n 
1 352 ALA n 
1 353 ASP n 
1 354 LEU n 
1 355 LYS n 
1 356 ASP n 
1 357 TYR n 
1 358 ASP n 
1 359 ILE n 
1 360 LEU n 
1 361 MET n 
1 362 GLY n 
1 363 ASN n 
1 364 VAL n 
1 365 ARG n 
1 366 ASP n 
1 367 GLU n 
1 368 GLY n 
1 369 THR n 
1 370 TYR n 
1 371 PHE n 
1 372 LEU n 
1 373 LEU n 
1 374 TYR n 
1 375 ASP n 
1 376 PHE n 
1 377 ILE n 
1 378 ASP n 
1 379 TYR n 
1 380 PHE n 
1 381 ASP n 
1 382 LYS n 
1 383 ASP n 
1 384 ASP n 
1 385 ALA n 
1 386 THR n 
1 387 ALA n 
1 388 LEU n 
1 389 PRO n 
1 390 ARG n 
1 391 ASP n 
1 392 LYS n 
1 393 TYR n 
1 394 LEU n 
1 395 GLU n 
1 396 ILE n 
1 397 MET n 
1 398 ASN n 
1 399 ASN n 
1 400 ILE n 
1 401 PHE n 
1 402 GLY n 
1 403 LYS n 
1 404 ALA n 
1 405 THR n 
1 406 GLN n 
1 407 ALA n 
1 408 GLU n 
1 409 ARG n 
1 410 GLU n 
1 411 ALA n 
1 412 ILE n 
1 413 ILE n 
1 414 PHE n 
1 415 GLN n 
1 416 TYR n 
1 417 THR n 
1 418 SER n 
1 419 TRP n 
1 420 GLU n 
1 421 GLY n 
1 422 ASN n 
1 423 PRO n 
1 424 GLY n 
1 425 TYR n 
1 426 GLN n 
1 427 ASN n 
1 428 GLN n 
1 429 GLN n 
1 430 GLN n 
1 431 ILE n 
1 432 GLY n 
1 433 ARG n 
1 434 ALA n 
1 435 VAL n 
1 436 GLY n 
1 437 ASP n 
1 438 HIS n 
1 439 PHE n 
1 440 PHE n 
1 441 THR n 
1 442 CYS n 
1 443 PRO n 
1 444 THR n 
1 445 ASN n 
1 446 GLU n 
1 447 TYR n 
1 448 ALA n 
1 449 GLN n 
1 450 ALA n 
1 451 LEU n 
1 452 ALA n 
1 453 GLU n 
1 454 ARG n 
1 455 GLY n 
1 456 ALA n 
1 457 SER n 
1 458 VAL n 
1 459 HIS n 
1 460 TYR n 
1 461 TYR n 
1 462 TYR n 
1 463 PHE n 
1 464 THR n 
1 465 HIS n 
1 466 ARG n 
1 467 THR n 
1 468 SER n 
1 469 THR n 
1 470 SER n 
1 471 LEU n 
1 472 TRP n 
1 473 GLY n 
1 474 GLU n 
1 475 TRP n 
1 476 MET n 
1 477 GLY n 
1 478 VAL n 
1 479 LEU n 
1 480 HIS n 
1 481 GLY n 
1 482 ASP n 
1 483 GLU n 
1 484 ILE n 
1 485 GLU n 
1 486 TYR n 
1 487 PHE n 
1 488 PHE n 
1 489 GLY n 
1 490 GLN n 
1 491 PRO n 
1 492 LEU n 
1 493 ASN n 
1 494 ASN n 
1 495 SER n 
1 496 LEU n 
1 497 GLN n 
1 498 TYR n 
1 499 ARG n 
1 500 PRO n 
1 501 VAL n 
1 502 GLU n 
1 503 ARG n 
1 504 GLU n 
1 505 LEU n 
1 506 GLY n 
1 507 LYS n 
1 508 ARG n 
1 509 MET n 
1 510 LEU n 
1 511 SER n 
1 512 ALA n 
1 513 VAL n 
1 514 ILE n 
1 515 GLU n 
1 516 PHE n 
1 517 ALA n 
1 518 LYS n 
1 519 THR n 
1 520 GLY n 
1 521 ASN n 
1 522 PRO n 
1 523 ALA n 
1 524 GLN n 
1 525 ASP n 
1 526 GLY n 
1 527 GLU n 
1 528 GLU n 
1 529 TRP n 
1 530 PRO n 
1 531 ASN n 
1 532 PHE n 
1 533 SER n 
1 534 LYS n 
1 535 GLU n 
1 536 ASP n 
1 537 PRO n 
1 538 VAL n 
1 539 TYR n 
1 540 TYR n 
1 541 ILE n 
1 542 PHE n 
1 543 SER n 
1 544 THR n 
1 545 ASP n 
1 546 ASP n 
1 547 LYS n 
1 548 ILE n 
1 549 GLU n 
1 550 LYS n 
1 551 LEU n 
1 552 ALA n 
1 553 ARG n 
1 554 GLY n 
1 555 PRO n 
1 556 LEU n 
1 557 ALA n 
1 558 ALA n 
1 559 ARG n 
1 560 CYS n 
1 561 SER n 
1 562 PHE n 
1 563 TRP n 
1 564 ASN n 
1 565 ASP n 
1 566 TYR n 
1 567 LEU n 
1 568 PRO n 
1 569 LYS n 
1 570 VAL n 
1 571 ARG n 
1 572 SER n 
1 573 TRP n 
1 574 ALA n 
1 575 GLY n 
1 576 THR n 
1 577 CYS n 
1 578 ASP n 
1 579 GLY n 
1 580 ASP n 
1 581 SER n 
1 582 GLY n 
1 583 SER n 
1 584 ALA n 
1 585 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'FRUIT FLY' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'FRUIT FLY' 
_entity_src_gen.pdbx_host_org_scientific_name      'DROSOPHILA MELANOGASTER' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 DMACHE 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'SCHNEIDER LINE 2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'SECRETED (EXTRACELLULAR)' 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'S2-SEC 1/3' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P07140 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DX4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 585 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07140 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  623 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       585 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
760 non-polymer                   . '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 9-N-PHENYLMETHYLAMINO-TACRINE 
'C20 H20 N2'     288.386 
ALA 'L-peptide linking'           y ALANINE                                              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                      ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                 'beta-D-mannose; D-mannose; mannose' 
'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                                ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                               ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                'alpha-D-mannose; D-mannose; mannose' 
'C6 H12 O6'      180.156 
MET 'L-peptide linking'           y METHIONINE                                           ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose             
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                   . 'SULFATE ION'                                        ? 'O4 S -2'        96.063  
THR 'L-peptide linking'           y THREONINE                                            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DX4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   57.03 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.60 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.60' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1DX4 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   21076 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.03800 
_reflns.pdbx_netI_over_sigmaI        24.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.79 
_reflns_shell.percent_possible_all   84.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.27400 
_reflns_shell.meanI_over_sigI_obs    3.200 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1DX4 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     20597 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30. 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    97.7 
_refine.ls_R_factor_obs                          0.220 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.220 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               50.8 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE FOLLOWING RESIDUES WERE ASSIGNED PARTIAL OCCUPANCY: THR 6 137, THR 138, NAG 992, 760 997 THE FOLLOWING RESIDUES HAVE ALTERNATE CONFORMATIONS: GLU 40, ARG 433, HIS 480, ARG 499.
;
_refine.pdbx_starting_model                      2ACE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4231 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         91 
_refine_hist.number_atoms_solvent             91 
_refine_hist.number_atoms_total               4413 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        30. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.463 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   40 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.72 
_refine_ls_shell.number_reflns_R_work             364 
_refine_ls_shell.R_factor_R_work                  0.353 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.358 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1DX4 
_struct.title                     
'ACHE FROM DROSOPHILA MELANOGASTER COMPLEX WITH TACRINE DERIVATIVE 9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DX4 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE, SERINE ESTERASE, SYNAPSE, MEMBRANE, NERVE, MUSCLE, NEUROTRANSMITTER DEGRADATION, GLYCOPROTEIN, GPI-ANCHOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 VAL A 39  ? ARG A 43  ? VAL A 39  ARG A 43  5 ? 5  
HELX_P HELX_P2  AA2 PHE A 77  ? ILE A 82  ? PHE A 77  ILE A 82  1 ? 6  
HELX_P HELX_P3  AA3 LEU A 159 ? ASN A 163 ? LEU A 159 ASN A 163 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 164 ? ASN A 172 ? ALA A 164 ASN A 172 1 ? 9  
HELX_P HELX_P5  AA5 GLY A 183 ? LEU A 188 ? GLY A 183 LEU A 188 1 ? 6  
HELX_P HELX_P6  AA6 LEU A 190 ? MET A 194 ? LEU A 190 MET A 194 5 ? 5  
HELX_P HELX_P7  AA7 PRO A 195 ? ALA A 199 ? PRO A 195 ALA A 199 5 ? 5  
HELX_P HELX_P8  AA8 ASN A 205 ? ASN A 221 ? ASN A 205 ASN A 221 1 ? 17 
HELX_P HELX_P9  AA9 ALA A 222 ? PHE A 225 ? ALA A 222 PHE A 225 5 ? 4  
HELX_P HELX_P10 AB1 SER A 238 ? SER A 250 ? SER A 238 SER A 250 1 ? 13 
HELX_P HELX_P11 AB2 ALA A 269 ? HIS A 273 ? ALA A 269 HIS A 273 5 ? 5  
HELX_P HELX_P12 AB3 THR A 275 ? CYS A 290 ? THR A 275 CYS A 290 1 ? 16 
HELX_P HELX_P13 AB4 ASN A 293 ? LYS A 298 ? ASN A 293 LYS A 298 5 ? 6  
HELX_P HELX_P14 AB5 ASN A 300 ? ARG A 309 ? ASN A 300 ARG A 309 1 ? 10 
HELX_P HELX_P15 AB6 ASP A 312 ? GLN A 320 ? ASP A 312 GLN A 320 1 ? 9  
HELX_P HELX_P16 AB7 TRP A 321 ? TYR A 324 ? TRP A 321 TYR A 324 5 ? 4  
HELX_P HELX_P17 AB8 LEU A 348 ? ALA A 352 ? LEU A 348 ALA A 352 5 ? 5  
HELX_P HELX_P18 AB9 ASP A 353 ? ASP A 356 ? ASP A 353 ASP A 356 5 ? 4  
HELX_P HELX_P19 AC1 GLY A 368 ? PHE A 376 ? GLY A 368 PHE A 376 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 389 ? PHE A 401 ? PRO A 389 PHE A 401 1 ? 13 
HELX_P HELX_P21 AC3 THR A 405 ? TYR A 416 ? THR A 405 TYR A 416 1 ? 12 
HELX_P HELX_P22 AC4 TYR A 425 ? PHE A 440 ? TYR A 425 PHE A 440 1 ? 16 
HELX_P HELX_P23 AC5 PHE A 440 ? ARG A 454 ? PHE A 440 ARG A 454 1 ? 15 
HELX_P HELX_P24 AC6 GLY A 473 ? GLY A 477 ? GLY A 473 GLY A 477 5 ? 5  
HELX_P HELX_P25 AC7 GLY A 481 ? PHE A 488 ? GLY A 481 PHE A 488 1 ? 8  
HELX_P HELX_P26 AC8 GLY A 489 ? ASN A 493 ? GLY A 489 ASN A 493 5 ? 5  
HELX_P HELX_P27 AC9 ARG A 499 ? GLY A 520 ? ARG A 499 GLY A 520 1 ? 22 
HELX_P HELX_P28 AD1 ARG A 553 ? ASP A 565 ? ARG A 553 ASP A 565 1 ? 13 
HELX_P HELX_P29 AD2 TYR A 566 ? SER A 572 ? TYR A 566 SER A 572 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 66  SG  ? ? ? 1_555 A CYS 93  SG ? ? A CYS 66  A CYS 93  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf2 disulf ?    ? A CYS 292 SG  ? ? ? 1_555 A CYS 307 SG ? ? A CYS 292 A CYS 307 1_555 ? ? ? ? ? ? ? 2.083 ? ?               
disulf3 disulf ?    ? A CYS 442 SG  ? ? ? 1_555 A CYS 560 SG ? ? A CYS 442 A CYS 560 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
covale1 covale one  ? A ASN 88  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 88  A NAG 602 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
covale2 covale one  ? A ASN 493 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 493 B NAG 1   1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
covale3 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.383 ? ?               
covale4 covale both ? B NAG .   O4  ? ? ? 1_555 B MAN .   C1 ? ? B NAG 2   B MAN 3   1_555 ? ? ? ? ? ? ? 1.392 ? ?               
covale5 covale both ? B MAN .   O3  ? ? ? 1_555 B BMA .   C1 ? ? B MAN 3   B BMA 4   1_555 ? ? ? ? ? ? ? 1.404 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? parallel      
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA2 4 5  ? parallel      
AA2 5 6  ? parallel      
AA2 6 7  ? parallel      
AA2 7 8  ? parallel      
AA2 8 9  ? parallel      
AA2 9 10 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 6   ? THR A 9   ? VAL A 6   THR A 9   
AA1 2  GLY A 12  ? ARG A 15  ? GLY A 12  ARG A 15  
AA1 3  LEU A 57  ? ASP A 58  ? LEU A 57  ASP A 58  
AA2 1  ARG A 17  ? VAL A 21  ? ARG A 17  VAL A 21  
AA2 2  ARG A 24  ? PRO A 33  ? ARG A 24  PRO A 33  
AA2 3  TYR A 95  ? PRO A 101 ? TYR A 95  PRO A 101 
AA2 4  ILE A 174 ? PHE A 178 ? ILE A 174 PHE A 178 
AA2 5  LEU A 141 ? ILE A 147 ? LEU A 141 ILE A 147 
AA2 6  GLY A 227 ? GLU A 237 ? GLY A 227 GLU A 237 
AA2 7  ARG A 259 ? GLN A 263 ? ARG A 259 GLN A 263 
AA2 8  ASP A 358 ? VAL A 364 ? ASP A 358 VAL A 364 
AA2 9  SER A 457 ? PHE A 463 ? SER A 457 PHE A 463 
AA2 10 TYR A 540 ? PHE A 542 ? TYR A 540 PHE A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N VAL A 7   ? N VAL A 7   O VAL A 14  ? O VAL A 14  
AA1 2 3  N ARG A 15  ? N ARG A 15  O LEU A 57  ? O LEU A 57  
AA2 1 2  N VAL A 19  ? N VAL A 19  O VAL A 26  ? O VAL A 26  
AA2 2 3  N ILE A 32  ? N ILE A 32  O ILE A 96  ? O ILE A 96  
AA2 3 4  N ASN A 97  ? N ASN A 97  O SER A 177 ? O SER A 177 
AA2 4 5  O ALA A 176 ? O ALA A 176 N TRP A 146 ? N TRP A 146 
AA2 5 6  N ILE A 143 ? N ILE A 143 O TRP A 231 ? O TRP A 231 
AA2 6 7  N LEU A 234 ? N LEU A 234 O MET A 261 ? O MET A 261 
AA2 7 8  N GLY A 260 ? N GLY A 260 O LEU A 360 ? O LEU A 360 
AA2 8 9  N ASN A 363 ? N ASN A 363 O PHE A 463 ? O PHE A 463 
AA2 9 10 N TYR A 462 ? N TYR A 462 O PHE A 542 ? O PHE A 542 
# 
_database_PDB_matrix.entry_id          1DX4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DX4 
_atom_sites.fract_transf_matrix[1][1]   0.010437 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010437 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006172 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 3   ? 26.942 44.240 -22.871 1.00 86.25  ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 3   ? 27.310 44.585 -21.466 1.00 85.96  ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 3   ? 26.574 43.729 -20.442 1.00 85.86  ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 3   ? 25.390 43.429 -20.603 1.00 85.44  ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 3   ? 27.000 46.056 -21.183 1.00 86.45  ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 3   ? 28.240 46.930 -21.169 1.00 86.54  ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 3   ? 29.220 46.565 -20.479 1.00 85.71  ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 3   ? 28.223 47.991 -21.835 1.00 85.25  ? 3   ASP A OD2 1 
ATOM   9    N N   . ARG A 1 4   ? 27.283 43.330 -19.391 1.00 85.91  ? 4   ARG A N   1 
ATOM   10   C CA  . ARG A 1 4   ? 26.670 42.536 -18.339 1.00 86.28  ? 4   ARG A CA  1 
ATOM   11   C C   . ARG A 1 4   ? 26.620 43.352 -17.057 1.00 84.34  ? 4   ARG A C   1 
ATOM   12   O O   . ARG A 1 4   ? 26.031 42.944 -16.049 1.00 83.95  ? 4   ARG A O   1 
ATOM   13   C CB  . ARG A 1 4   ? 27.430 41.225 -18.100 1.00 89.75  ? 4   ARG A CB  1 
ATOM   14   C CG  . ARG A 1 4   ? 26.817 40.358 -16.990 1.00 93.83  ? 4   ARG A CG  1 
ATOM   15   C CD  . ARG A 1 4   ? 25.317 40.094 -17.211 1.00 97.97  ? 4   ARG A CD  1 
ATOM   16   N NE  . ARG A 1 4   ? 24.626 41.273 -17.734 1.00 101.36 ? 4   ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 4   ? 23.315 41.488 -17.675 1.00 103.89 ? 4   ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 4   ? 22.509 40.600 -17.104 1.00 104.79 ? 4   ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 4   ? 22.810 42.600 -18.195 1.00 105.18 ? 4   ARG A NH2 1 
ATOM   20   N N   . LEU A 1 5   ? 27.253 44.516 -17.109 1.00 80.71  ? 5   LEU A N   1 
ATOM   21   C CA  . LEU A 1 5   ? 27.272 45.423 -15.980 1.00 77.10  ? 5   LEU A CA  1 
ATOM   22   C C   . LEU A 1 5   ? 26.176 46.452 -16.242 1.00 74.66  ? 5   LEU A C   1 
ATOM   23   O O   . LEU A 1 5   ? 26.263 47.600 -15.805 1.00 75.43  ? 5   LEU A O   1 
ATOM   24   C CB  . LEU A 1 5   ? 28.642 46.090 -15.881 1.00 76.46  ? 5   LEU A CB  1 
ATOM   25   C CG  . LEU A 1 5   ? 29.771 45.067 -15.749 1.00 75.74  ? 5   LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 5   ? 31.120 45.759 -15.813 1.00 75.89  ? 5   LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 5   ? 29.606 44.304 -14.445 1.00 75.51  ? 5   LEU A CD2 1 
ATOM   28   N N   . VAL A 1 6   ? 25.149 46.017 -16.970 1.00 70.33  ? 6   VAL A N   1 
ATOM   29   C CA  . VAL A 1 6   ? 24.016 46.861 -17.320 1.00 67.48  ? 6   VAL A CA  1 
ATOM   30   C C   . VAL A 1 6   ? 22.754 46.417 -16.596 1.00 67.11  ? 6   VAL A C   1 
ATOM   31   O O   . VAL A 1 6   ? 22.421 45.231 -16.579 1.00 66.76  ? 6   VAL A O   1 
ATOM   32   C CB  . VAL A 1 6   ? 23.750 46.839 -18.838 1.00 65.61  ? 6   VAL A CB  1 
ATOM   33   C CG1 . VAL A 1 6   ? 22.362 47.361 -19.134 1.00 65.95  ? 6   VAL A CG1 1 
ATOM   34   C CG2 . VAL A 1 6   ? 24.764 47.708 -19.546 1.00 65.60  ? 6   VAL A CG2 1 
ATOM   35   N N   . VAL A 1 7   ? 22.052 47.380 -16.004 1.00 65.85  ? 7   VAL A N   1 
ATOM   36   C CA  . VAL A 1 7   ? 20.828 47.093 -15.270 1.00 64.69  ? 7   VAL A CA  1 
ATOM   37   C C   . VAL A 1 7   ? 19.670 47.937 -15.791 1.00 64.03  ? 7   VAL A C   1 
ATOM   38   O O   . VAL A 1 7   ? 19.856 49.070 -16.237 1.00 62.46  ? 7   VAL A O   1 
ATOM   39   C CB  . VAL A 1 7   ? 21.009 47.359 -13.763 1.00 63.85  ? 7   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 7   ? 21.308 48.831 -13.536 1.00 66.29  ? 7   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 7   ? 19.769 46.930 -13.002 1.00 62.35  ? 7   VAL A CG2 1 
ATOM   42   N N   . GLN A 1 8   ? 18.473 47.363 -15.730 1.00 64.41  ? 8   GLN A N   1 
ATOM   43   C CA  . GLN A 1 8   ? 17.271 48.031 -16.201 1.00 65.18  ? 8   GLN A CA  1 
ATOM   44   C C   . GLN A 1 8   ? 16.518 48.714 -15.065 1.00 64.57  ? 8   GLN A C   1 
ATOM   45   O O   . GLN A 1 8   ? 15.760 48.074 -14.330 1.00 65.98  ? 8   GLN A O   1 
ATOM   46   C CB  . GLN A 1 8   ? 16.352 47.019 -16.904 1.00 64.73  ? 8   GLN A CB  1 
ATOM   47   C CG  . GLN A 1 8   ? 16.109 47.322 -18.381 1.00 66.67  ? 8   GLN A CG  1 
ATOM   48   C CD  . GLN A 1 8   ? 15.383 48.647 -18.602 1.00 68.47  ? 8   GLN A CD  1 
ATOM   49   O OE1 . GLN A 1 8   ? 14.225 48.811 -18.203 1.00 68.32  ? 8   GLN A OE1 1 
ATOM   50   N NE2 . GLN A 1 8   ? 16.065 49.601 -19.239 1.00 67.44  ? 8   GLN A NE2 1 
ATOM   51   N N   . THR A 1 9   ? 16.726 50.017 -14.920 1.00 62.72  ? 9   THR A N   1 
ATOM   52   C CA  . THR A 1 9   ? 16.045 50.758 -13.873 1.00 61.50  ? 9   THR A CA  1 
ATOM   53   C C   . THR A 1 9   ? 14.747 51.315 -14.424 1.00 60.42  ? 9   THR A C   1 
ATOM   54   O O   . THR A 1 9   ? 14.594 51.477 -15.632 1.00 59.53  ? 9   THR A O   1 
ATOM   55   C CB  . THR A 1 9   ? 16.880 51.930 -13.374 1.00 61.58  ? 9   THR A CB  1 
ATOM   56   O OG1 . THR A 1 9   ? 17.007 52.899 -14.423 1.00 61.84  ? 9   THR A OG1 1 
ATOM   57   C CG2 . THR A 1 9   ? 18.253 51.452 -12.948 1.00 61.01  ? 9   THR A CG2 1 
ATOM   58   N N   . SER A 1 10  ? 13.819 51.610 -13.523 1.00 60.06  ? 10  SER A N   1 
ATOM   59   C CA  . SER A 1 10  ? 12.520 52.150 -13.896 1.00 60.17  ? 10  SER A CA  1 
ATOM   60   C C   . SER A 1 10  ? 12.637 53.340 -14.839 1.00 59.01  ? 10  SER A C   1 
ATOM   61   O O   . SER A 1 10  ? 11.672 53.694 -15.504 1.00 57.48  ? 10  SER A O   1 
ATOM   62   C CB  . SER A 1 10  ? 11.758 52.587 -12.641 1.00 60.87  ? 10  SER A CB  1 
ATOM   63   O OG  . SER A 1 10  ? 12.386 53.702 -12.020 1.00 59.40  ? 10  SER A OG  1 
ATOM   64   N N   . SER A 1 11  ? 13.818 53.949 -14.888 1.00 59.80  ? 11  SER A N   1 
ATOM   65   C CA  . SER A 1 11  ? 14.049 55.118 -15.730 1.00 60.61  ? 11  SER A CA  1 
ATOM   66   C C   . SER A 1 11  ? 14.854 54.822 -16.989 1.00 62.22  ? 11  SER A C   1 
ATOM   67   O O   . SER A 1 11  ? 14.939 55.674 -17.879 1.00 62.37  ? 11  SER A O   1 
ATOM   68   C CB  . SER A 1 11  ? 14.764 56.201 -14.925 1.00 60.67  ? 11  SER A CB  1 
ATOM   69   O OG  . SER A 1 11  ? 14.101 56.448 -13.700 1.00 63.07  ? 11  SER A OG  1 
ATOM   70   N N   . GLY A 1 12  ? 15.454 53.629 -17.050 1.00 63.22  ? 12  GLY A N   1 
ATOM   71   C CA  . GLY A 1 12  ? 16.229 53.232 -18.215 1.00 63.60  ? 12  GLY A CA  1 
ATOM   72   C C   . GLY A 1 12  ? 17.412 52.310 -17.949 1.00 65.12  ? 12  GLY A C   1 
ATOM   73   O O   . GLY A 1 12  ? 17.546 51.779 -16.840 1.00 64.55  ? 12  GLY A O   1 
ATOM   74   N N   . PRO A 1 13  ? 18.284 52.094 -18.962 1.00 64.58  ? 13  PRO A N   1 
ATOM   75   C CA  . PRO A 1 13  ? 19.483 51.245 -18.930 1.00 62.30  ? 13  PRO A CA  1 
ATOM   76   C C   . PRO A 1 13  ? 20.670 51.935 -18.276 1.00 60.86  ? 13  PRO A C   1 
ATOM   77   O O   . PRO A 1 13  ? 20.957 53.094 -18.574 1.00 59.97  ? 13  PRO A O   1 
ATOM   78   C CB  . PRO A 1 13  ? 19.750 50.958 -20.410 1.00 62.51  ? 13  PRO A CB  1 
ATOM   79   C CG  . PRO A 1 13  ? 18.439 51.288 -21.094 1.00 63.14  ? 13  PRO A CG  1 
ATOM   80   C CD  . PRO A 1 13  ? 17.999 52.499 -20.345 1.00 64.37  ? 13  PRO A CD  1 
ATOM   81   N N   . VAL A 1 14  ? 21.361 51.211 -17.398 1.00 59.57  ? 14  VAL A N   1 
ATOM   82   C CA  . VAL A 1 14  ? 22.514 51.750 -16.691 1.00 59.41  ? 14  VAL A CA  1 
ATOM   83   C C   . VAL A 1 14  ? 23.663 50.752 -16.635 1.00 59.63  ? 14  VAL A C   1 
ATOM   84   O O   . VAL A 1 14  ? 23.446 49.575 -16.350 1.00 58.46  ? 14  VAL A O   1 
ATOM   85   C CB  . VAL A 1 14  ? 22.145 52.112 -15.243 1.00 60.90  ? 14  VAL A CB  1 
ATOM   86   C CG1 . VAL A 1 14  ? 23.382 52.554 -14.486 1.00 60.86  ? 14  VAL A CG1 1 
ATOM   87   C CG2 . VAL A 1 14  ? 21.091 53.207 -15.230 1.00 62.59  ? 14  VAL A CG2 1 
ATOM   88   N N   . ARG A 1 15  ? 24.882 51.223 -16.898 1.00 60.21  ? 15  ARG A N   1 
ATOM   89   C CA  . ARG A 1 15  ? 26.059 50.357 -16.840 1.00 62.55  ? 15  ARG A CA  1 
ATOM   90   C C   . ARG A 1 15  ? 27.142 50.927 -15.930 1.00 62.41  ? 15  ARG A C   1 
ATOM   91   O O   . ARG A 1 15  ? 27.621 52.038 -16.126 1.00 62.03  ? 15  ARG A O   1 
ATOM   92   C CB  . ARG A 1 15  ? 26.651 50.121 -18.233 1.00 64.14  ? 15  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 15  ? 27.125 51.381 -18.944 1.00 67.84  ? 15  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 15  ? 27.987 51.042 -20.160 1.00 68.25  ? 15  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 15  ? 29.414 51.040 -19.843 1.00 68.09  ? 15  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 15  ? 30.137 52.138 -19.624 1.00 68.65  ? 15  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 15  ? 29.570 53.338 -19.686 1.00 69.40  ? 15  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 15  ? 31.433 52.039 -19.352 1.00 67.74  ? 15  ARG A NH2 1 
ATOM   99   N N   . GLY A 1 16  ? 27.526 50.154 -14.928 1.00 63.40  ? 16  GLY A N   1 
ATOM   100  C CA  . GLY A 1 16  ? 28.551 50.617 -14.022 1.00 65.86  ? 16  GLY A CA  1 
ATOM   101  C C   . GLY A 1 16  ? 29.846 49.906 -14.332 1.00 67.62  ? 16  GLY A C   1 
ATOM   102  O O   . GLY A 1 16  ? 30.248 49.815 -15.492 1.00 69.37  ? 16  GLY A O   1 
ATOM   103  N N   . ARG A 1 17  ? 30.499 49.403 -13.292 1.00 67.21  ? 17  ARG A N   1 
ATOM   104  C CA  . ARG A 1 17  ? 31.748 48.683 -13.448 1.00 67.11  ? 17  ARG A CA  1 
ATOM   105  C C   . ARG A 1 17  ? 31.836 47.586 -12.398 1.00 67.24  ? 17  ARG A C   1 
ATOM   106  O O   . ARG A 1 17  ? 31.130 47.625 -11.392 1.00 67.82  ? 17  ARG A O   1 
ATOM   107  C CB  . ARG A 1 17  ? 32.929 49.643 -13.324 1.00 65.67  ? 17  ARG A CB  1 
ATOM   108  C CG  . ARG A 1 17  ? 32.853 50.569 -12.146 1.00 65.74  ? 17  ARG A CG  1 
ATOM   109  C CD  . ARG A 1 17  ? 34.104 51.423 -12.065 1.00 68.07  ? 17  ARG A CD  1 
ATOM   110  N NE  . ARG A 1 17  ? 33.919 52.557 -11.167 1.00 72.05  ? 17  ARG A NE  1 
ATOM   111  C CZ  . ARG A 1 17  ? 33.632 52.451 -9.873  1.00 72.92  ? 17  ARG A CZ  1 
ATOM   112  N NH1 . ARG A 1 17  ? 33.506 51.254 -9.317  1.00 73.38  ? 17  ARG A NH1 1 
ATOM   113  N NH2 . ARG A 1 17  ? 33.447 53.543 -9.139  1.00 72.85  ? 17  ARG A NH2 1 
ATOM   114  N N   . SER A 1 18  ? 32.693 46.599 -12.647 1.00 67.03  ? 18  SER A N   1 
ATOM   115  C CA  . SER A 1 18  ? 32.865 45.485 -11.723 1.00 65.61  ? 18  SER A CA  1 
ATOM   116  C C   . SER A 1 18  ? 34.100 45.675 -10.855 1.00 63.85  ? 18  SER A C   1 
ATOM   117  O O   . SER A 1 18  ? 35.135 46.161 -11.316 1.00 61.59  ? 18  SER A O   1 
ATOM   118  C CB  . SER A 1 18  ? 32.967 44.166 -12.494 1.00 67.08  ? 18  SER A CB  1 
ATOM   119  O OG  . SER A 1 18  ? 33.079 43.062 -11.614 1.00 68.38  ? 18  SER A OG  1 
ATOM   120  N N   . VAL A 1 19  ? 33.972 45.290 -9.589  1.00 63.04  ? 19  VAL A N   1 
ATOM   121  C CA  . VAL A 1 19  ? 35.059 45.414 -8.625  1.00 61.49  ? 19  VAL A CA  1 
ATOM   122  C C   . VAL A 1 19  ? 35.232 44.119 -7.847  1.00 60.33  ? 19  VAL A C   1 
ATOM   123  O O   . VAL A 1 19  ? 34.302 43.318 -7.724  1.00 59.65  ? 19  VAL A O   1 
ATOM   124  C CB  . VAL A 1 19  ? 34.795 46.561 -7.619  1.00 60.37  ? 19  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 19  ? 35.962 46.699 -6.665  1.00 60.55  ? 19  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 19  ? 34.583 47.863 -8.362  1.00 60.35  ? 19  VAL A CG2 1 
ATOM   127  N N   . THR A 1 20  ? 36.438 43.915 -7.335  1.00 59.04  ? 20  THR A N   1 
ATOM   128  C CA  . THR A 1 20  ? 36.746 42.730 -6.558  1.00 58.84  ? 20  THR A CA  1 
ATOM   129  C C   . THR A 1 20  ? 37.452 43.153 -5.279  1.00 57.89  ? 20  THR A C   1 
ATOM   130  O O   . THR A 1 20  ? 38.585 43.635 -5.307  1.00 57.72  ? 20  THR A O   1 
ATOM   131  C CB  . THR A 1 20  ? 37.642 41.754 -7.354  1.00 59.34  ? 20  THR A CB  1 
ATOM   132  O OG1 . THR A 1 20  ? 36.871 41.142 -8.395  1.00 60.62  ? 20  THR A OG1 1 
ATOM   133  C CG2 . THR A 1 20  ? 38.191 40.671 -6.450  1.00 59.28  ? 20  THR A CG2 1 
ATOM   134  N N   . VAL A 1 21  ? 36.756 42.997 -4.159  1.00 57.25  ? 21  VAL A N   1 
ATOM   135  C CA  . VAL A 1 21  ? 37.308 43.346 -2.856  1.00 56.75  ? 21  VAL A CA  1 
ATOM   136  C C   . VAL A 1 21  ? 37.053 42.174 -1.928  1.00 55.07  ? 21  VAL A C   1 
ATOM   137  O O   . VAL A 1 21  ? 36.022 41.504 -2.033  1.00 53.92  ? 21  VAL A O   1 
ATOM   138  C CB  . VAL A 1 21  ? 36.645 44.624 -2.275  1.00 58.50  ? 21  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 21  ? 36.828 45.783 -3.245  1.00 58.84  ? 21  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 21  ? 35.167 44.384 -2.010  1.00 57.30  ? 21  VAL A CG2 1 
ATOM   141  N N   . GLN A 1 22  ? 37.992 41.922 -1.024  1.00 54.17  ? 22  GLN A N   1 
ATOM   142  C CA  . GLN A 1 22  ? 37.855 40.803 -0.100  1.00 53.86  ? 22  GLN A CA  1 
ATOM   143  C C   . GLN A 1 22  ? 37.472 39.574 -0.927  1.00 55.08  ? 22  GLN A C   1 
ATOM   144  O O   . GLN A 1 22  ? 36.606 38.788 -0.529  1.00 54.12  ? 22  GLN A O   1 
ATOM   145  C CB  . GLN A 1 22  ? 36.769 41.097 0.944   1.00 52.37  ? 22  GLN A CB  1 
ATOM   146  C CG  . GLN A 1 22  ? 36.974 42.387 1.732   1.00 48.21  ? 22  GLN A CG  1 
ATOM   147  C CD  . GLN A 1 22  ? 38.142 42.312 2.700   1.00 48.36  ? 22  GLN A CD  1 
ATOM   148  O OE1 . GLN A 1 22  ? 38.185 41.437 3.565   1.00 46.86  ? 22  GLN A OE1 1 
ATOM   149  N NE2 . GLN A 1 22  ? 39.093 43.239 2.565   1.00 44.59  ? 22  GLN A NE2 1 
ATOM   150  N N   . GLY A 1 23  ? 38.121 39.431 -2.086  1.00 55.93  ? 23  GLY A N   1 
ATOM   151  C CA  . GLY A 1 23  ? 37.854 38.310 -2.971  1.00 56.92  ? 23  GLY A CA  1 
ATOM   152  C C   . GLY A 1 23  ? 36.376 38.105 -3.235  1.00 58.75  ? 23  GLY A C   1 
ATOM   153  O O   . GLY A 1 23  ? 35.857 36.995 -3.114  1.00 59.59  ? 23  GLY A O   1 
ATOM   154  N N   . ARG A 1 24  ? 35.695 39.184 -3.602  1.00 60.73  ? 24  ARG A N   1 
ATOM   155  C CA  . ARG A 1 24  ? 34.265 39.142 -3.873  1.00 60.47  ? 24  ARG A CA  1 
ATOM   156  C C   . ARG A 1 24  ? 33.975 40.165 -4.959  1.00 60.37  ? 24  ARG A C   1 
ATOM   157  O O   . ARG A 1 24  ? 34.451 41.299 -4.888  1.00 59.54  ? 24  ARG A O   1 
ATOM   158  C CB  . ARG A 1 24  ? 33.506 39.506 -2.603  1.00 62.31  ? 24  ARG A CB  1 
ATOM   159  C CG  . ARG A 1 24  ? 32.452 38.512 -2.168  1.00 66.95  ? 24  ARG A CG  1 
ATOM   160  C CD  . ARG A 1 24  ? 31.054 39.036 -2.470  1.00 72.90  ? 24  ARG A CD  1 
ATOM   161  N NE  . ARG A 1 24  ? 30.084 38.620 -1.459  1.00 76.03  ? 24  ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 24  ? 29.793 37.354 -1.177  1.00 77.17  ? 24  ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 24  ? 30.394 36.371 -1.830  1.00 78.46  ? 24  ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 24  ? 28.909 37.067 -0.234  1.00 77.43  ? 24  ARG A NH2 1 
ATOM   165  N N   . GLU A 1 25  ? 33.216 39.770 -5.976  1.00 60.27  ? 25  GLU A N   1 
ATOM   166  C CA  . GLU A 1 25  ? 32.893 40.713 -7.039  1.00 60.52  ? 25  GLU A CA  1 
ATOM   167  C C   . GLU A 1 25  ? 31.675 41.543 -6.647  1.00 59.15  ? 25  GLU A C   1 
ATOM   168  O O   . GLU A 1 25  ? 30.673 41.011 -6.156  1.00 59.55  ? 25  GLU A O   1 
ATOM   169  C CB  . GLU A 1 25  ? 32.610 39.998 -8.371  1.00 61.01  ? 25  GLU A CB  1 
ATOM   170  C CG  . GLU A 1 25  ? 32.278 40.990 -9.501  1.00 62.76  ? 25  GLU A CG  1 
ATOM   171  C CD  . GLU A 1 25  ? 32.044 40.347 -10.863 1.00 64.18  ? 25  GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 25  ? 31.129 39.500 -10.990 1.00 63.07  ? 25  GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 25  ? 32.777 40.707 -11.813 1.00 62.28  ? 25  GLU A OE2 1 
ATOM   174  N N   . VAL A 1 26  ? 31.774 42.851 -6.855  1.00 56.14  ? 26  VAL A N   1 
ATOM   175  C CA  . VAL A 1 26  ? 30.682 43.763 -6.545  1.00 54.77  ? 26  VAL A CA  1 
ATOM   176  C C   . VAL A 1 26  ? 30.508 44.707 -7.724  1.00 53.69  ? 26  VAL A C   1 
ATOM   177  O O   . VAL A 1 26  ? 31.493 45.235 -8.242  1.00 53.89  ? 26  VAL A O   1 
ATOM   178  C CB  . VAL A 1 26  ? 30.986 44.600 -5.281  1.00 54.40  ? 26  VAL A CB  1 
ATOM   179  C CG1 . VAL A 1 26  ? 29.902 45.645 -5.071  1.00 53.55  ? 26  VAL A CG1 1 
ATOM   180  C CG2 . VAL A 1 26  ? 31.083 43.696 -4.071  1.00 53.24  ? 26  VAL A CG2 1 
ATOM   181  N N   . HIS A 1 27  ? 29.267 44.905 -8.159  1.00 52.54  ? 27  HIS A N   1 
ATOM   182  C CA  . HIS A 1 27  ? 28.995 45.811 -9.274  1.00 53.56  ? 27  HIS A CA  1 
ATOM   183  C C   . HIS A 1 27  ? 28.678 47.191 -8.716  1.00 51.77  ? 27  HIS A C   1 
ATOM   184  O O   . HIS A 1 27  ? 27.767 47.346 -7.912  1.00 51.83  ? 27  HIS A O   1 
ATOM   185  C CB  . HIS A 1 27  ? 27.847 45.265 -10.123 1.00 55.80  ? 27  HIS A CB  1 
ATOM   186  C CG  . HIS A 1 27  ? 28.226 44.050 -10.917 1.00 59.49  ? 27  HIS A CG  1 
ATOM   187  N ND1 . HIS A 1 27  ? 27.297 43.237 -11.531 1.00 59.14  ? 27  HIS A ND1 1 
ATOM   188  C CD2 . HIS A 1 27  ? 29.440 43.520 -11.206 1.00 58.02  ? 27  HIS A CD2 1 
ATOM   189  C CE1 . HIS A 1 27  ? 27.922 42.259 -12.162 1.00 58.75  ? 27  HIS A CE1 1 
ATOM   190  N NE2 . HIS A 1 27  ? 29.222 42.409 -11.981 1.00 58.41  ? 27  HIS A NE2 1 
ATOM   191  N N   . VAL A 1 28  ? 29.446 48.186 -9.148  1.00 50.07  ? 28  VAL A N   1 
ATOM   192  C CA  . VAL A 1 28  ? 29.308 49.549 -8.655  1.00 49.12  ? 28  VAL A CA  1 
ATOM   193  C C   . VAL A 1 28  ? 28.749 50.572 -9.625  1.00 49.23  ? 28  VAL A C   1 
ATOM   194  O O   . VAL A 1 28  ? 29.400 50.920 -10.607 1.00 49.66  ? 28  VAL A O   1 
ATOM   195  C CB  . VAL A 1 28  ? 30.669 50.072 -8.177  1.00 49.08  ? 28  VAL A CB  1 
ATOM   196  C CG1 . VAL A 1 28  ? 30.547 51.514 -7.694  1.00 47.48  ? 28  VAL A CG1 1 
ATOM   197  C CG2 . VAL A 1 28  ? 31.196 49.169 -7.081  1.00 49.12  ? 28  VAL A CG2 1 
ATOM   198  N N   . TYR A 1 29  ? 27.562 51.085 -9.305  1.00 48.84  ? 29  TYR A N   1 
ATOM   199  C CA  . TYR A 1 29  ? 26.888 52.090 -10.124 1.00 46.25  ? 29  TYR A CA  1 
ATOM   200  C C   . TYR A 1 29  ? 26.866 53.441 -9.415  1.00 44.21  ? 29  TYR A C   1 
ATOM   201  O O   . TYR A 1 29  ? 26.171 53.612 -8.423  1.00 42.17  ? 29  TYR A O   1 
ATOM   202  C CB  . TYR A 1 29  ? 25.444 51.667 -10.412 1.00 47.88  ? 29  TYR A CB  1 
ATOM   203  C CG  . TYR A 1 29  ? 25.297 50.256 -10.931 1.00 49.96  ? 29  TYR A CG  1 
ATOM   204  C CD1 . TYR A 1 29  ? 25.536 49.167 -10.103 1.00 49.51  ? 29  TYR A CD1 1 
ATOM   205  C CD2 . TYR A 1 29  ? 24.933 50.010 -12.253 1.00 50.08  ? 29  TYR A CD2 1 
ATOM   206  C CE1 . TYR A 1 29  ? 25.420 47.870 -10.573 1.00 50.95  ? 29  TYR A CE1 1 
ATOM   207  C CE2 . TYR A 1 29  ? 24.816 48.711 -12.734 1.00 50.72  ? 29  TYR A CE2 1 
ATOM   208  C CZ  . TYR A 1 29  ? 25.061 47.647 -11.886 1.00 50.86  ? 29  TYR A CZ  1 
ATOM   209  O OH  . TYR A 1 29  ? 24.953 46.354 -12.341 1.00 53.30  ? 29  TYR A OH  1 
ATOM   210  N N   . THR A 1 30  ? 27.614 54.403 -9.942  1.00 45.46  ? 30  THR A N   1 
ATOM   211  C CA  . THR A 1 30  ? 27.672 55.744 -9.369  1.00 44.41  ? 30  THR A CA  1 
ATOM   212  C C   . THR A 1 30  ? 27.204 56.797 -10.387 1.00 44.05  ? 30  THR A C   1 
ATOM   213  O O   . THR A 1 30  ? 27.532 56.708 -11.571 1.00 43.91  ? 30  THR A O   1 
ATOM   214  C CB  . THR A 1 30  ? 29.108 56.074 -8.939  1.00 44.98  ? 30  THR A CB  1 
ATOM   215  O OG1 . THR A 1 30  ? 29.995 55.831 -10.038 1.00 49.91  ? 30  THR A OG1 1 
ATOM   216  C CG2 . THR A 1 30  ? 29.532 55.204 -7.773  1.00 43.20  ? 30  THR A CG2 1 
ATOM   217  N N   . GLY A 1 31  ? 26.431 57.783 -9.925  1.00 44.33  ? 31  GLY A N   1 
ATOM   218  C CA  . GLY A 1 31  ? 25.946 58.838 -10.810 1.00 41.26  ? 31  GLY A CA  1 
ATOM   219  C C   . GLY A 1 31  ? 24.613 58.627 -11.524 1.00 40.17  ? 31  GLY A C   1 
ATOM   220  O O   . GLY A 1 31  ? 24.410 59.169 -12.609 1.00 40.13  ? 31  GLY A O   1 
ATOM   221  N N   . ILE A 1 32  ? 23.709 57.840 -10.941 1.00 39.34  ? 32  ILE A N   1 
ATOM   222  C CA  . ILE A 1 32  ? 22.388 57.594 -11.536 1.00 38.59  ? 32  ILE A CA  1 
ATOM   223  C C   . ILE A 1 32  ? 21.456 58.737 -11.093 1.00 39.60  ? 32  ILE A C   1 
ATOM   224  O O   . ILE A 1 32  ? 21.242 58.939 -9.896  1.00 41.44  ? 32  ILE A O   1 
ATOM   225  C CB  . ILE A 1 32  ? 21.812 56.250 -11.046 1.00 37.78  ? 32  ILE A CB  1 
ATOM   226  C CG1 . ILE A 1 32  ? 22.732 55.103 -11.467 1.00 39.19  ? 32  ILE A CG1 1 
ATOM   227  C CG2 . ILE A 1 32  ? 20.429 56.039 -11.610 1.00 37.18  ? 32  ILE A CG2 1 
ATOM   228  C CD1 . ILE A 1 32  ? 22.272 53.735 -10.985 1.00 39.23  ? 32  ILE A CD1 1 
ATOM   229  N N   . PRO A 1 33  ? 20.886 59.498 -12.044 1.00 38.85  ? 33  PRO A N   1 
ATOM   230  C CA  . PRO A 1 33  ? 20.003 60.602 -11.652 1.00 37.78  ? 33  PRO A CA  1 
ATOM   231  C C   . PRO A 1 33  ? 18.667 60.129 -11.127 1.00 35.91  ? 33  PRO A C   1 
ATOM   232  O O   . PRO A 1 33  ? 18.066 59.223 -11.691 1.00 37.47  ? 33  PRO A O   1 
ATOM   233  C CB  . PRO A 1 33  ? 19.862 61.395 -12.940 1.00 38.39  ? 33  PRO A CB  1 
ATOM   234  C CG  . PRO A 1 33  ? 19.833 60.328 -13.947 1.00 37.60  ? 33  PRO A CG  1 
ATOM   235  C CD  . PRO A 1 33  ? 20.948 59.389 -13.512 1.00 39.29  ? 33  PRO A CD  1 
ATOM   236  N N   . TYR A 1 34  ? 18.200 60.733 -10.042 1.00 33.56  ? 34  TYR A N   1 
ATOM   237  C CA  . TYR A 1 34  ? 16.915 60.339 -9.486  1.00 31.71  ? 34  TYR A CA  1 
ATOM   238  C C   . TYR A 1 34  ? 15.986 61.542 -9.491  1.00 31.03  ? 34  TYR A C   1 
ATOM   239  O O   . TYR A 1 34  ? 14.918 61.509 -8.891  1.00 30.06  ? 34  TYR A O   1 
ATOM   240  C CB  . TYR A 1 34  ? 17.080 59.750 -8.065  1.00 32.09  ? 34  TYR A CB  1 
ATOM   241  C CG  . TYR A 1 34  ? 17.419 60.747 -6.971  1.00 32.62  ? 34  TYR A CG  1 
ATOM   242  C CD1 . TYR A 1 34  ? 16.417 61.486 -6.337  1.00 29.67  ? 34  TYR A CD1 1 
ATOM   243  C CD2 . TYR A 1 34  ? 18.741 60.974 -6.590  1.00 31.29  ? 34  TYR A CD2 1 
ATOM   244  C CE1 . TYR A 1 34  ? 16.720 62.420 -5.358  1.00 27.38  ? 34  TYR A CE1 1 
ATOM   245  C CE2 . TYR A 1 34  ? 19.050 61.916 -5.606  1.00 31.16  ? 34  TYR A CE2 1 
ATOM   246  C CZ  . TYR A 1 34  ? 18.032 62.632 -4.997  1.00 28.32  ? 34  TYR A CZ  1 
ATOM   247  O OH  . TYR A 1 34  ? 18.323 63.550 -4.016  1.00 27.75  ? 34  TYR A OH  1 
ATOM   248  N N   . ALA A 1 35  ? 16.386 62.599 -10.197 1.00 31.14  ? 35  ALA A N   1 
ATOM   249  C CA  . ALA A 1 35  ? 15.561 63.798 -10.265 1.00 33.79  ? 35  ALA A CA  1 
ATOM   250  C C   . ALA A 1 35  ? 16.036 64.780 -11.324 1.00 36.54  ? 35  ALA A C   1 
ATOM   251  O O   . ALA A 1 35  ? 17.207 64.753 -11.726 1.00 36.18  ? 35  ALA A O   1 
ATOM   252  C CB  . ALA A 1 35  ? 15.534 64.492 -8.901  1.00 35.44  ? 35  ALA A CB  1 
ATOM   253  N N   . LYS A 1 36  ? 15.122 65.645 -11.773 1.00 36.70  ? 36  LYS A N   1 
ATOM   254  C CA  . LYS A 1 36  ? 15.459 66.654 -12.770 1.00 37.12  ? 36  LYS A CA  1 
ATOM   255  C C   . LYS A 1 36  ? 16.423 67.621 -12.113 1.00 37.03  ? 36  LYS A C   1 
ATOM   256  O O   . LYS A 1 36  ? 16.185 68.079 -11.000 1.00 35.62  ? 36  LYS A O   1 
ATOM   257  C CB  . LYS A 1 36  ? 14.225 67.445 -13.210 1.00 39.00  ? 36  LYS A CB  1 
ATOM   258  C CG  . LYS A 1 36  ? 13.223 66.700 -14.078 1.00 43.88  ? 36  LYS A CG  1 
ATOM   259  C CD  . LYS A 1 36  ? 12.289 67.692 -14.796 1.00 45.03  ? 36  LYS A CD  1 
ATOM   260  C CE  . LYS A 1 36  ? 13.088 68.619 -15.727 1.00 47.04  ? 36  LYS A CE  1 
ATOM   261  N NZ  . LYS A 1 36  ? 12.258 69.621 -16.465 1.00 46.79  ? 36  LYS A NZ  1 
ATOM   262  N N   . PRO A 1 37  ? 17.527 67.946 -12.785 1.00 38.24  ? 37  PRO A N   1 
ATOM   263  C CA  . PRO A 1 37  ? 18.477 68.881 -12.180 1.00 40.81  ? 37  PRO A CA  1 
ATOM   264  C C   . PRO A 1 37  ? 17.724 70.098 -11.654 1.00 45.13  ? 37  PRO A C   1 
ATOM   265  O O   . PRO A 1 37  ? 17.205 70.886 -12.439 1.00 48.12  ? 37  PRO A O   1 
ATOM   266  C CB  . PRO A 1 37  ? 19.393 69.225 -13.344 1.00 38.41  ? 37  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 37  ? 19.428 67.941 -14.108 1.00 36.66  ? 37  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 37  ? 17.975 67.529 -14.122 1.00 36.53  ? 37  PRO A CD  1 
ATOM   269  N N   . PRO A 1 38  ? 17.649 70.263 -10.319 1.00 47.03  ? 38  PRO A N   1 
ATOM   270  C CA  . PRO A 1 38  ? 16.945 71.398 -9.695  1.00 47.37  ? 38  PRO A CA  1 
ATOM   271  C C   . PRO A 1 38  ? 17.663 72.709 -9.991  1.00 49.07  ? 38  PRO A C   1 
ATOM   272  O O   . PRO A 1 38  ? 18.207 73.359 -9.091  1.00 49.02  ? 38  PRO A O   1 
ATOM   273  C CB  . PRO A 1 38  ? 16.986 71.050 -8.218  1.00 46.63  ? 38  PRO A CB  1 
ATOM   274  C CG  . PRO A 1 38  ? 18.341 70.399 -8.091  1.00 47.06  ? 38  PRO A CG  1 
ATOM   275  C CD  . PRO A 1 38  ? 18.403 69.492 -9.312  1.00 45.63  ? 38  PRO A CD  1 
ATOM   276  N N   . VAL A 1 39  ? 17.645 73.093 -11.262 1.00 49.92  ? 39  VAL A N   1 
ATOM   277  C CA  . VAL A 1 39  ? 18.320 74.292 -11.720 1.00 50.27  ? 39  VAL A CA  1 
ATOM   278  C C   . VAL A 1 39  ? 17.355 75.337 -12.255 1.00 50.88  ? 39  VAL A C   1 
ATOM   279  O O   . VAL A 1 39  ? 16.228 75.022 -12.653 1.00 49.31  ? 39  VAL A O   1 
ATOM   280  C CB  . VAL A 1 39  ? 19.336 73.911 -12.803 1.00 49.94  ? 39  VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 39  ? 20.124 75.117 -13.261 1.00 52.93  ? 39  VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 39  ? 20.264 72.865 -12.248 1.00 50.66  ? 39  VAL A CG2 1 
ATOM   283  N N   . GLU A 1 40  ? 17.803 76.589 -12.255 1.00 51.44  ? 40  GLU A N   1 
ATOM   284  C CA  . GLU A 1 40  ? 16.993 77.693 -12.739 1.00 52.54  ? 40  GLU A CA  1 
ATOM   285  C C   . GLU A 1 40  ? 15.646 77.786 -12.033 1.00 52.13  ? 40  GLU A C   1 
ATOM   286  O O   . GLU A 1 40  ? 15.576 78.053 -10.836 1.00 52.15  ? 40  GLU A O   1 
ATOM   287  C CB  . GLU A 1 40  ? 16.770 77.553 -14.242 1.00 54.78  ? 40  GLU A CB  1 
ATOM   288  C CG  . GLU A 1 40  ? 17.970 77.930 -15.085 1.00 58.90  ? 40  GLU A CG  1 
ATOM   289  C CD  . GLU A 1 40  ? 17.721 77.723 -16.571 1.00 61.13  ? 40  GLU A CD  1 
ATOM   290  O OE1 . GLU A 1 40  ? 16.571 77.936 -17.020 1.00 62.53  ? 40  GLU A OE1 1 
ATOM   291  O OE2 . GLU A 1 40  ? 18.680 77.360 -17.289 1.00 62.42  ? 40  GLU A OE2 1 
ATOM   292  N N   . ASP A 1 41  ? 14.578 77.559 -12.789 1.00 51.62  ? 41  ASP A N   1 
ATOM   293  C CA  . ASP A 1 41  ? 13.228 77.632 -12.262 1.00 51.10  ? 41  ASP A CA  1 
ATOM   294  C C   . ASP A 1 41  ? 12.902 76.594 -11.195 1.00 50.28  ? 41  ASP A C   1 
ATOM   295  O O   . ASP A 1 41  ? 11.921 76.725 -10.453 1.00 49.16  ? 41  ASP A O   1 
ATOM   296  C CB  . ASP A 1 41  ? 12.243 77.513 -13.419 1.00 54.91  ? 41  ASP A CB  1 
ATOM   297  C CG  . ASP A 1 41  ? 10.813 77.479 -12.959 1.00 59.06  ? 41  ASP A CG  1 
ATOM   298  O OD1 . ASP A 1 41  ? 10.382 78.441 -12.279 1.00 60.15  ? 41  ASP A OD1 1 
ATOM   299  O OD2 . ASP A 1 41  ? 10.124 76.485 -13.280 1.00 63.06  ? 41  ASP A OD2 1 
ATOM   300  N N   . LEU A 1 42  ? 13.722 75.559 -11.109 1.00 48.51  ? 42  LEU A N   1 
ATOM   301  C CA  . LEU A 1 42  ? 13.472 74.524 -10.126 1.00 45.33  ? 42  LEU A CA  1 
ATOM   302  C C   . LEU A 1 42  ? 14.280 74.681 -8.835  1.00 45.31  ? 42  LEU A C   1 
ATOM   303  O O   . LEU A 1 42  ? 14.233 73.810 -7.968  1.00 47.60  ? 42  LEU A O   1 
ATOM   304  C CB  . LEU A 1 42  ? 13.714 73.152 -10.752 1.00 42.59  ? 42  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 42  ? 12.541 72.550 -11.523 1.00 37.48  ? 42  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 42  ? 12.979 71.268 -12.180 1.00 41.18  ? 42  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 42  ? 11.404 72.260 -10.582 1.00 37.33  ? 42  LEU A CD2 1 
ATOM   308  N N   . ARG A 1 43  ? 15.013 75.788 -8.708  1.00 43.48  ? 43  ARG A N   1 
ATOM   309  C CA  . ARG A 1 43  ? 15.797 76.056 -7.504  1.00 41.96  ? 43  ARG A CA  1 
ATOM   310  C C   . ARG A 1 43  ? 14.839 76.313 -6.333  1.00 41.25  ? 43  ARG A C   1 
ATOM   311  O O   . ARG A 1 43  ? 13.768 76.894 -6.519  1.00 41.37  ? 43  ARG A O   1 
ATOM   312  C CB  . ARG A 1 43  ? 16.694 77.278 -7.711  1.00 41.62  ? 43  ARG A CB  1 
ATOM   313  C CG  . ARG A 1 43  ? 17.366 77.772 -6.434  1.00 42.26  ? 43  ARG A CG  1 
ATOM   314  C CD  . ARG A 1 43  ? 18.140 79.062 -6.667  1.00 44.93  ? 43  ARG A CD  1 
ATOM   315  N NE  . ARG A 1 43  ? 19.393 78.850 -7.387  1.00 46.96  ? 43  ARG A NE  1 
ATOM   316  C CZ  . ARG A 1 43  ? 20.173 79.835 -7.831  1.00 48.88  ? 43  ARG A CZ  1 
ATOM   317  N NH1 . ARG A 1 43  ? 19.829 81.102 -7.637  1.00 46.46  ? 43  ARG A NH1 1 
ATOM   318  N NH2 . ARG A 1 43  ? 21.309 79.557 -8.458  1.00 49.66  ? 43  ARG A NH2 1 
ATOM   319  N N   . PHE A 1 44  ? 15.224 75.872 -5.136  1.00 40.37  ? 44  PHE A N   1 
ATOM   320  C CA  . PHE A 1 44  ? 14.406 76.048 -3.936  1.00 37.83  ? 44  PHE A CA  1 
ATOM   321  C C   . PHE A 1 44  ? 13.104 75.229 -3.945  1.00 37.64  ? 44  PHE A C   1 
ATOM   322  O O   . PHE A 1 44  ? 12.467 75.060 -2.910  1.00 37.16  ? 44  PHE A O   1 
ATOM   323  C CB  . PHE A 1 44  ? 14.059 77.531 -3.753  1.00 37.97  ? 44  PHE A CB  1 
ATOM   324  C CG  . PHE A 1 44  ? 15.259 78.444 -3.678  1.00 39.06  ? 44  PHE A CG  1 
ATOM   325  C CD1 . PHE A 1 44  ? 16.439 78.031 -3.087  1.00 40.37  ? 44  PHE A CD1 1 
ATOM   326  C CD2 . PHE A 1 44  ? 15.199 79.729 -4.195  1.00 39.57  ? 44  PHE A CD2 1 
ATOM   327  C CE1 . PHE A 1 44  ? 17.542 78.884 -3.014  1.00 40.32  ? 44  PHE A CE1 1 
ATOM   328  C CE2 . PHE A 1 44  ? 16.295 80.577 -4.125  1.00 40.83  ? 44  PHE A CE2 1 
ATOM   329  C CZ  . PHE A 1 44  ? 17.467 80.153 -3.533  1.00 39.47  ? 44  PHE A CZ  1 
ATOM   330  N N   . ARG A 1 45  ? 12.706 74.715 -5.103  1.00 37.94  ? 45  ARG A N   1 
ATOM   331  C CA  . ARG A 1 45  ? 11.454 73.965 -5.188  1.00 40.00  ? 45  ARG A CA  1 
ATOM   332  C C   . ARG A 1 45  ? 11.607 72.496 -4.848  1.00 40.89  ? 45  ARG A C   1 
ATOM   333  O O   . ARG A 1 45  ? 12.720 71.967 -4.832  1.00 44.02  ? 45  ARG A O   1 
ATOM   334  C CB  . ARG A 1 45  ? 10.862 74.089 -6.599  1.00 41.01  ? 45  ARG A CB  1 
ATOM   335  C CG  . ARG A 1 45  ? 10.449 75.502 -7.017  1.00 41.35  ? 45  ARG A CG  1 
ATOM   336  C CD  . ARG A 1 45  ? 9.808  75.466 -8.405  1.00 44.69  ? 45  ARG A CD  1 
ATOM   337  N NE  . ARG A 1 45  ? 9.578  76.795 -8.968  1.00 47.92  ? 45  ARG A NE  1 
ATOM   338  C CZ  . ARG A 1 45  ? 8.587  77.612 -8.614  1.00 47.62  ? 45  ARG A CZ  1 
ATOM   339  N NH1 . ARG A 1 45  ? 7.698  77.253 -7.693  1.00 46.89  ? 45  ARG A NH1 1 
ATOM   340  N NH2 . ARG A 1 45  ? 8.504  78.808 -9.172  1.00 47.32  ? 45  ARG A NH2 1 
ATOM   341  N N   . LYS A 1 46  ? 10.490 71.833 -4.570  1.00 39.63  ? 46  LYS A N   1 
ATOM   342  C CA  . LYS A 1 46  ? 10.541 70.405 -4.282  1.00 40.69  ? 46  LYS A CA  1 
ATOM   343  C C   . LYS A 1 46  ? 11.133 69.740 -5.525  1.00 41.74  ? 46  LYS A C   1 
ATOM   344  O O   . LYS A 1 46  ? 11.042 70.283 -6.619  1.00 42.60  ? 46  LYS A O   1 
ATOM   345  C CB  . LYS A 1 46  ? 9.141  69.864 -4.003  1.00 37.71  ? 46  LYS A CB  1 
ATOM   346  C CG  . LYS A 1 46  ? 8.574  70.378 -2.706  1.00 39.01  ? 46  LYS A CG  1 
ATOM   347  C CD  . LYS A 1 46  ? 7.186  69.834 -2.432  1.00 40.34  ? 46  LYS A CD  1 
ATOM   348  C CE  . LYS A 1 46  ? 6.652  70.409 -1.125  1.00 42.17  ? 46  LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 46  ? 5.216  70.091 -0.863  1.00 44.28  ? 46  LYS A NZ  1 
ATOM   350  N N   . PRO A 1 47  ? 11.758 68.564 -5.373  1.00 42.50  ? 47  PRO A N   1 
ATOM   351  C CA  . PRO A 1 47  ? 12.345 67.898 -6.535  1.00 41.61  ? 47  PRO A CA  1 
ATOM   352  C C   . PRO A 1 47  ? 11.316 67.173 -7.397  1.00 42.51  ? 47  PRO A C   1 
ATOM   353  O O   . PRO A 1 47  ? 10.257 66.787 -6.905  1.00 43.37  ? 47  PRO A O   1 
ATOM   354  C CB  . PRO A 1 47  ? 13.335 66.939 -5.892  1.00 40.23  ? 47  PRO A CB  1 
ATOM   355  C CG  . PRO A 1 47  ? 12.575 66.479 -4.695  1.00 40.79  ? 47  PRO A CG  1 
ATOM   356  C CD  . PRO A 1 47  ? 12.019 67.788 -4.145  1.00 42.31  ? 47  PRO A CD  1 
ATOM   357  N N   . VAL A 1 48  ? 11.623 67.002 -8.683  1.00 42.65  ? 48  VAL A N   1 
ATOM   358  C CA  . VAL A 1 48  ? 10.731 66.280 -9.593  1.00 43.56  ? 48  VAL A CA  1 
ATOM   359  C C   . VAL A 1 48  ? 11.449 65.072 -10.195 1.00 43.49  ? 48  VAL A C   1 
ATOM   360  O O   . VAL A 1 48  ? 12.619 65.155 -10.579 1.00 43.93  ? 48  VAL A O   1 
ATOM   361  C CB  . VAL A 1 48  ? 10.233 67.160 -10.761 1.00 43.22  ? 48  VAL A CB  1 
ATOM   362  C CG1 . VAL A 1 48  ? 9.349  68.271 -10.238 1.00 44.42  ? 48  VAL A CG1 1 
ATOM   363  C CG2 . VAL A 1 48  ? 11.405 67.732 -11.510 1.00 43.33  ? 48  VAL A CG2 1 
ATOM   364  N N   . PRO A 1 49  ? 10.758 63.926 -10.269 1.00 43.03  ? 49  PRO A N   1 
ATOM   365  C CA  . PRO A 1 49  ? 11.334 62.703 -10.830 1.00 43.34  ? 49  PRO A CA  1 
ATOM   366  C C   . PRO A 1 49  ? 12.043 63.024 -12.131 1.00 46.07  ? 49  PRO A C   1 
ATOM   367  O O   . PRO A 1 49  ? 11.542 63.808 -12.932 1.00 46.66  ? 49  PRO A O   1 
ATOM   368  C CB  . PRO A 1 49  ? 10.113 61.828 -11.038 1.00 41.67  ? 49  PRO A CB  1 
ATOM   369  C CG  . PRO A 1 49  ? 9.272  62.192 -9.861  1.00 41.15  ? 49  PRO A CG  1 
ATOM   370  C CD  . PRO A 1 49  ? 9.375  63.695 -9.820  1.00 41.68  ? 49  PRO A CD  1 
ATOM   371  N N   . ALA A 1 50  ? 13.212 62.430 -12.339 1.00 50.28  ? 50  ALA A N   1 
ATOM   372  C CA  . ALA A 1 50  ? 13.984 62.678 -13.552 1.00 54.14  ? 50  ALA A CA  1 
ATOM   373  C C   . ALA A 1 50  ? 13.322 62.066 -14.779 1.00 56.92  ? 50  ALA A C   1 
ATOM   374  O O   . ALA A 1 50  ? 12.569 61.093 -14.677 1.00 55.73  ? 50  ALA A O   1 
ATOM   375  C CB  . ALA A 1 50  ? 15.398 62.128 -13.397 1.00 53.35  ? 50  ALA A CB  1 
ATOM   376  N N   . GLU A 1 51  ? 13.604 62.643 -15.942 1.00 60.18  ? 51  GLU A N   1 
ATOM   377  C CA  . GLU A 1 51  ? 13.040 62.142 -17.190 1.00 64.03  ? 51  GLU A CA  1 
ATOM   378  C C   . GLU A 1 51  ? 13.746 60.857 -17.632 1.00 65.54  ? 51  GLU A C   1 
ATOM   379  O O   . GLU A 1 51  ? 14.973 60.819 -17.709 1.00 65.00  ? 51  GLU A O   1 
ATOM   380  C CB  . GLU A 1 51  ? 13.182 63.205 -18.271 1.00 66.08  ? 51  GLU A CB  1 
ATOM   381  C CG  . GLU A 1 51  ? 12.285 64.410 -18.078 1.00 71.06  ? 51  GLU A CG  1 
ATOM   382  C CD  . GLU A 1 51  ? 12.588 65.511 -19.076 1.00 74.46  ? 51  GLU A CD  1 
ATOM   383  O OE1 . GLU A 1 51  ? 12.650 65.216 -20.291 1.00 76.72  ? 51  GLU A OE1 1 
ATOM   384  O OE2 . GLU A 1 51  ? 12.765 66.672 -18.646 1.00 77.21  ? 51  GLU A OE2 1 
ATOM   385  N N   . PRO A 1 52  ? 12.971 59.794 -17.931 1.00 67.31  ? 52  PRO A N   1 
ATOM   386  C CA  . PRO A 1 52  ? 13.496 58.499 -18.367 1.00 69.21  ? 52  PRO A CA  1 
ATOM   387  C C   . PRO A 1 52  ? 14.420 58.693 -19.559 1.00 70.88  ? 52  PRO A C   1 
ATOM   388  O O   . PRO A 1 52  ? 14.239 59.602 -20.361 1.00 69.38  ? 52  PRO A O   1 
ATOM   389  C CB  . PRO A 1 52  ? 12.233 57.685 -18.676 1.00 68.67  ? 52  PRO A CB  1 
ATOM   390  C CG  . PRO A 1 52  ? 11.260 58.730 -19.068 1.00 68.92  ? 52  PRO A CG  1 
ATOM   391  C CD  . PRO A 1 52  ? 11.511 59.814 -18.057 1.00 68.58  ? 52  PRO A CD  1 
ATOM   392  N N   . TRP A 1 53  ? 15.437 57.850 -19.625 1.00 74.97  ? 53  TRP A N   1 
ATOM   393  C CA  . TRP A 1 53  ? 16.455 57.939 -20.663 1.00 79.80  ? 53  TRP A CA  1 
ATOM   394  C C   . TRP A 1 53  ? 16.537 56.911 -21.810 1.00 81.69  ? 53  TRP A C   1 
ATOM   395  O O   . TRP A 1 53  ? 15.833 55.905 -21.827 1.00 81.55  ? 53  TRP A O   1 
ATOM   396  C CB  . TRP A 1 53  ? 17.792 58.002 -19.956 1.00 81.76  ? 53  TRP A CB  1 
ATOM   397  C CG  . TRP A 1 53  ? 17.861 57.028 -18.777 1.00 83.89  ? 53  TRP A CG  1 
ATOM   398  C CD1 . TRP A 1 53  ? 17.853 55.671 -18.847 1.00 83.54  ? 53  TRP A CD1 1 
ATOM   399  C CD2 . TRP A 1 53  ? 17.887 57.352 -17.370 1.00 84.64  ? 53  TRP A CD2 1 
ATOM   400  N NE1 . TRP A 1 53  ? 17.867 55.124 -17.584 1.00 85.90  ? 53  TRP A NE1 1 
ATOM   401  C CE2 . TRP A 1 53  ? 17.884 56.131 -16.657 1.00 86.24  ? 53  TRP A CE2 1 
ATOM   402  C CE3 . TRP A 1 53  ? 17.908 58.548 -16.651 1.00 84.41  ? 53  TRP A CE3 1 
ATOM   403  C CZ2 . TRP A 1 53  ? 17.900 56.075 -15.247 1.00 86.01  ? 53  TRP A CZ2 1 
ATOM   404  C CZ3 . TRP A 1 53  ? 17.925 58.493 -15.260 1.00 85.02  ? 53  TRP A CZ3 1 
ATOM   405  C CH2 . TRP A 1 53  ? 17.919 57.266 -14.572 1.00 85.32  ? 53  TRP A CH2 1 
ATOM   406  N N   . HIS A 1 54  ? 17.407 57.187 -22.780 1.00 84.56  ? 54  HIS A N   1 
ATOM   407  C CA  . HIS A 1 54  ? 17.610 56.284 -23.906 1.00 86.77  ? 54  HIS A CA  1 
ATOM   408  C C   . HIS A 1 54  ? 19.010 55.680 -23.815 1.00 85.60  ? 54  HIS A C   1 
ATOM   409  O O   . HIS A 1 54  ? 19.973 56.322 -23.371 1.00 87.09  ? 54  HIS A O   1 
ATOM   410  C CB  . HIS A 1 54  ? 17.437 57.020 -25.241 1.00 92.02  ? 54  HIS A CB  1 
ATOM   411  C CG  . HIS A 1 54  ? 18.378 58.173 -25.427 1.00 97.75  ? 54  HIS A CG  1 
ATOM   412  N ND1 . HIS A 1 54  ? 18.088 59.451 -24.993 1.00 99.46  ? 54  HIS A ND1 1 
ATOM   413  C CD2 . HIS A 1 54  ? 19.606 58.239 -25.998 1.00 99.94  ? 54  HIS A CD2 1 
ATOM   414  C CE1 . HIS A 1 54  ? 19.096 60.254 -25.296 1.00 100.49 ? 54  HIS A CE1 1 
ATOM   415  N NE2 . HIS A 1 54  ? 20.030 59.545 -25.907 1.00 101.39 ? 54  HIS A NE2 1 
ATOM   416  N N   . GLY A 1 55  ? 19.116 54.426 -24.217 1.00 82.96  ? 55  GLY A N   1 
ATOM   417  C CA  . GLY A 1 55  ? 20.409 53.780 -24.173 1.00 79.98  ? 55  GLY A CA  1 
ATOM   418  C C   . GLY A 1 55  ? 20.856 53.496 -22.751 1.00 78.16  ? 55  GLY A C   1 
ATOM   419  O O   . GLY A 1 55  ? 20.057 53.583 -21.816 1.00 79.09  ? 55  GLY A O   1 
ATOM   420  N N   . VAL A 1 56  ? 22.132 53.150 -22.595 1.00 75.33  ? 56  VAL A N   1 
ATOM   421  C CA  . VAL A 1 56  ? 22.706 52.833 -21.294 1.00 70.17  ? 56  VAL A CA  1 
ATOM   422  C C   . VAL A 1 56  ? 23.342 54.098 -20.756 1.00 67.05  ? 56  VAL A C   1 
ATOM   423  O O   . VAL A 1 56  ? 24.005 54.830 -21.497 1.00 64.43  ? 56  VAL A O   1 
ATOM   424  C CB  . VAL A 1 56  ? 23.802 51.750 -21.400 1.00 70.62  ? 56  VAL A CB  1 
ATOM   425  C CG1 . VAL A 1 56  ? 23.218 50.469 -21.958 1.00 70.01  ? 56  VAL A CG1 1 
ATOM   426  C CG2 . VAL A 1 56  ? 24.945 52.249 -22.289 1.00 70.64  ? 56  VAL A CG2 1 
ATOM   427  N N   . LEU A 1 57  ? 23.130 54.346 -19.466 1.00 64.19  ? 57  LEU A N   1 
ATOM   428  C CA  . LEU A 1 57  ? 23.677 55.523 -18.813 1.00 61.04  ? 57  LEU A CA  1 
ATOM   429  C C   . LEU A 1 57  ? 25.023 55.178 -18.192 1.00 58.87  ? 57  LEU A C   1 
ATOM   430  O O   . LEU A 1 57  ? 25.166 54.145 -17.543 1.00 57.39  ? 57  LEU A O   1 
ATOM   431  C CB  . LEU A 1 57  ? 22.706 56.031 -17.748 1.00 59.91  ? 57  LEU A CB  1 
ATOM   432  C CG  . LEU A 1 57  ? 23.067 57.364 -17.117 1.00 57.76  ? 57  LEU A CG  1 
ATOM   433  C CD1 . LEU A 1 57  ? 21.855 58.263 -17.129 1.00 57.43  ? 57  LEU A CD1 1 
ATOM   434  C CD2 . LEU A 1 57  ? 23.571 57.139 -15.705 1.00 57.29  ? 57  LEU A CD2 1 
ATOM   435  N N   . ASP A 1 58  ? 26.012 56.039 -18.410 1.00 57.89  ? 58  ASP A N   1 
ATOM   436  C CA  . ASP A 1 58  ? 27.348 55.811 -17.885 1.00 58.71  ? 58  ASP A CA  1 
ATOM   437  C C   . ASP A 1 58  ? 27.390 55.974 -16.375 1.00 60.14  ? 58  ASP A C   1 
ATOM   438  O O   . ASP A 1 58  ? 27.496 57.090 -15.866 1.00 62.18  ? 58  ASP A O   1 
ATOM   439  C CB  . ASP A 1 58  ? 28.338 56.785 -18.514 1.00 58.76  ? 58  ASP A CB  1 
ATOM   440  C CG  . ASP A 1 58  ? 29.770 56.446 -18.168 1.00 60.78  ? 58  ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 58  ? 29.985 55.328 -17.646 1.00 60.63  ? 58  ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 58  ? 30.676 57.274 -18.413 1.00 61.21  ? 58  ASP A OD2 1 
ATOM   443  N N   . ALA A 1 59  ? 27.327 54.861 -15.658 1.00 58.79  ? 59  ALA A N   1 
ATOM   444  C CA  . ALA A 1 59  ? 27.356 54.910 -14.209 1.00 58.53  ? 59  ALA A CA  1 
ATOM   445  C C   . ALA A 1 59  ? 28.696 54.438 -13.651 1.00 58.45  ? 59  ALA A C   1 
ATOM   446  O O   . ALA A 1 59  ? 28.743 53.519 -12.829 1.00 58.69  ? 59  ALA A O   1 
ATOM   447  C CB  . ALA A 1 59  ? 26.234 54.064 -13.647 1.00 59.73  ? 59  ALA A CB  1 
ATOM   448  N N   . THR A 1 60  ? 29.782 55.068 -14.087 1.00 56.17  ? 60  THR A N   1 
ATOM   449  C CA  . THR A 1 60  ? 31.101 54.682 -13.609 1.00 55.04  ? 60  THR A CA  1 
ATOM   450  C C   . THR A 1 60  ? 31.850 55.876 -13.034 1.00 55.05  ? 60  THR A C   1 
ATOM   451  O O   . THR A 1 60  ? 32.836 55.715 -12.315 1.00 56.31  ? 60  THR A O   1 
ATOM   452  C CB  . THR A 1 60  ? 31.948 54.038 -14.737 1.00 55.12  ? 60  THR A CB  1 
ATOM   453  O OG1 . THR A 1 60  ? 32.388 55.049 -15.651 1.00 54.34  ? 60  THR A OG1 1 
ATOM   454  C CG2 . THR A 1 60  ? 31.122 52.990 -15.491 1.00 51.70  ? 60  THR A CG2 1 
ATOM   455  N N   . GLY A 1 61  ? 31.378 57.075 -13.348 1.00 53.90  ? 61  GLY A N   1 
ATOM   456  C CA  . GLY A 1 61  ? 32.016 58.265 -12.825 1.00 51.19  ? 61  GLY A CA  1 
ATOM   457  C C   . GLY A 1 61  ? 31.300 58.731 -11.571 1.00 51.01  ? 61  GLY A C   1 
ATOM   458  O O   . GLY A 1 61  ? 30.156 58.350 -11.323 1.00 49.70  ? 61  GLY A O   1 
ATOM   459  N N   . LEU A 1 62  ? 31.981 59.543 -10.769 1.00 51.22  ? 62  LEU A N   1 
ATOM   460  C CA  . LEU A 1 62  ? 31.395 60.086 -9.549  1.00 50.42  ? 62  LEU A CA  1 
ATOM   461  C C   . LEU A 1 62  ? 30.564 61.313 -9.907  1.00 49.56  ? 62  LEU A C   1 
ATOM   462  O O   . LEU A 1 62  ? 31.016 62.181 -10.657 1.00 47.86  ? 62  LEU A O   1 
ATOM   463  C CB  . LEU A 1 62  ? 32.488 60.501 -8.561  1.00 51.05  ? 62  LEU A CB  1 
ATOM   464  C CG  . LEU A 1 62  ? 33.314 59.416 -7.862  1.00 52.15  ? 62  LEU A CG  1 
ATOM   465  C CD1 . LEU A 1 62  ? 34.332 60.085 -6.929  1.00 49.25  ? 62  LEU A CD1 1 
ATOM   466  C CD2 . LEU A 1 62  ? 32.390 58.476 -7.077  1.00 51.08  ? 62  LEU A CD2 1 
ATOM   467  N N   . SER A 1 63  ? 29.352 61.386 -9.369  1.00 48.66  ? 63  SER A N   1 
ATOM   468  C CA  . SER A 1 63  ? 28.475 62.519 -9.638  1.00 46.64  ? 63  SER A CA  1 
ATOM   469  C C   . SER A 1 63  ? 29.079 63.767 -9.018  1.00 44.96  ? 63  SER A C   1 
ATOM   470  O O   . SER A 1 63  ? 30.058 63.686 -8.281  1.00 44.76  ? 63  SER A O   1 
ATOM   471  C CB  . SER A 1 63  ? 27.094 62.276 -9.031  1.00 47.58  ? 63  SER A CB  1 
ATOM   472  O OG  . SER A 1 63  ? 27.148 62.348 -7.617  1.00 49.16  ? 63  SER A OG  1 
ATOM   473  N N   . ALA A 1 64  ? 28.495 64.921 -9.316  1.00 44.05  ? 64  ALA A N   1 
ATOM   474  C CA  . ALA A 1 64  ? 28.984 66.175 -8.761  1.00 43.90  ? 64  ALA A CA  1 
ATOM   475  C C   . ALA A 1 64  ? 28.505 66.237 -7.316  1.00 44.10  ? 64  ALA A C   1 
ATOM   476  O O   . ALA A 1 64  ? 27.733 65.375 -6.891  1.00 45.19  ? 64  ALA A O   1 
ATOM   477  C CB  . ALA A 1 64  ? 28.420 67.342 -9.550  1.00 41.94  ? 64  ALA A CB  1 
ATOM   478  N N   . THR A 1 65  ? 28.972 67.224 -6.554  1.00 42.81  ? 65  THR A N   1 
ATOM   479  C CA  . THR A 1 65  ? 28.517 67.377 -5.175  1.00 43.91  ? 65  THR A CA  1 
ATOM   480  C C   . THR A 1 65  ? 27.726 68.691 -5.105  1.00 43.91  ? 65  THR A C   1 
ATOM   481  O O   . THR A 1 65  ? 28.094 69.674 -5.744  1.00 45.19  ? 65  THR A O   1 
ATOM   482  C CB  . THR A 1 65  ? 29.690 67.421 -4.158  1.00 44.69  ? 65  THR A CB  1 
ATOM   483  O OG1 . THR A 1 65  ? 30.078 68.778 -3.928  1.00 46.64  ? 65  THR A OG1 1 
ATOM   484  C CG2 . THR A 1 65  ? 30.887 66.639 -4.672  1.00 42.57  ? 65  THR A CG2 1 
ATOM   485  N N   . CYS A 1 66  ? 26.639 68.707 -4.339  1.00 42.18  ? 66  CYS A N   1 
ATOM   486  C CA  . CYS A 1 66  ? 25.802 69.892 -4.239  1.00 41.76  ? 66  CYS A CA  1 
ATOM   487  C C   . CYS A 1 66  ? 26.567 71.140 -3.798  1.00 43.55  ? 66  CYS A C   1 
ATOM   488  O O   . CYS A 1 66  ? 27.556 71.046 -3.077  1.00 43.92  ? 66  CYS A O   1 
ATOM   489  C CB  . CYS A 1 66  ? 24.628 69.613 -3.308  1.00 40.09  ? 66  CYS A CB  1 
ATOM   490  S SG  . CYS A 1 66  ? 23.521 68.267 -3.868  1.00 43.73  ? 66  CYS A SG  1 
ATOM   491  N N   . VAL A 1 67  ? 26.105 72.305 -4.253  1.00 44.10  ? 67  VAL A N   1 
ATOM   492  C CA  . VAL A 1 67  ? 26.748 73.580 -3.944  1.00 44.13  ? 67  VAL A CA  1 
ATOM   493  C C   . VAL A 1 67  ? 27.010 73.772 -2.458  1.00 45.52  ? 67  VAL A C   1 
ATOM   494  O O   . VAL A 1 67  ? 26.116 73.588 -1.636  1.00 45.35  ? 67  VAL A O   1 
ATOM   495  C CB  . VAL A 1 67  ? 25.904 74.763 -4.468  1.00 44.09  ? 67  VAL A CB  1 
ATOM   496  C CG1 . VAL A 1 67  ? 26.587 76.086 -4.145  1.00 43.37  ? 67  VAL A CG1 1 
ATOM   497  C CG2 . VAL A 1 67  ? 25.710 74.624 -5.960  1.00 41.85  ? 67  VAL A CG2 1 
ATOM   498  N N   . GLN A 1 68  ? 28.242 74.158 -2.128  1.00 48.02  ? 68  GLN A N   1 
ATOM   499  C CA  . GLN A 1 68  ? 28.663 74.371 -0.743  1.00 50.99  ? 68  GLN A CA  1 
ATOM   500  C C   . GLN A 1 68  ? 30.082 74.927 -0.694  1.00 53.48  ? 68  GLN A C   1 
ATOM   501  O O   . GLN A 1 68  ? 30.819 74.845 -1.676  1.00 56.10  ? 68  GLN A O   1 
ATOM   502  C CB  . GLN A 1 68  ? 28.626 73.048 0.026   1.00 49.68  ? 68  GLN A CB  1 
ATOM   503  C CG  . GLN A 1 68  ? 29.476 71.959 -0.607  1.00 48.82  ? 68  GLN A CG  1 
ATOM   504  C CD  . GLN A 1 68  ? 29.366 70.632 0.117   1.00 49.79  ? 68  GLN A CD  1 
ATOM   505  O OE1 . GLN A 1 68  ? 29.830 70.488 1.245   1.00 49.81  ? 68  GLN A OE1 1 
ATOM   506  N NE2 . GLN A 1 68  ? 28.745 69.653 -0.531  1.00 49.50  ? 68  GLN A NE2 1 
ATOM   507  N N   . GLU A 1 69  ? 30.462 75.481 0.455   1.00 55.60  ? 69  GLU A N   1 
ATOM   508  C CA  . GLU A 1 69  ? 31.800 76.043 0.639   1.00 57.55  ? 69  GLU A CA  1 
ATOM   509  C C   . GLU A 1 69  ? 32.731 75.070 1.360   1.00 57.82  ? 69  GLU A C   1 
ATOM   510  O O   . GLU A 1 69  ? 32.289 74.195 2.107   1.00 56.82  ? 69  GLU A O   1 
ATOM   511  C CB  . GLU A 1 69  ? 31.723 77.351 1.431   1.00 59.95  ? 69  GLU A CB  1 
ATOM   512  C CG  . GLU A 1 69  ? 30.901 78.434 0.753   1.00 64.78  ? 69  GLU A CG  1 
ATOM   513  C CD  . GLU A 1 69  ? 31.492 78.883 -0.574  1.00 68.39  ? 69  GLU A CD  1 
ATOM   514  O OE1 . GLU A 1 69  ? 32.736 78.884 -0.717  1.00 70.82  ? 69  GLU A OE1 1 
ATOM   515  O OE2 . GLU A 1 69  ? 30.706 79.248 -1.474  1.00 69.88  ? 69  GLU A OE2 1 
ATOM   516  N N   . ARG A 1 70  ? 34.027 75.233 1.134   1.00 58.59  ? 70  ARG A N   1 
ATOM   517  C CA  . ARG A 1 70  ? 35.012 74.369 1.759   1.00 60.51  ? 70  ARG A CA  1 
ATOM   518  C C   . ARG A 1 70  ? 35.495 74.999 3.057   1.00 61.64  ? 70  ARG A C   1 
ATOM   519  O O   . ARG A 1 70  ? 35.453 76.215 3.220   1.00 61.05  ? 70  ARG A O   1 
ATOM   520  C CB  . ARG A 1 70  ? 36.221 74.186 0.837   1.00 61.08  ? 70  ARG A CB  1 
ATOM   521  C CG  . ARG A 1 70  ? 35.902 73.898 -0.620  1.00 62.18  ? 70  ARG A CG  1 
ATOM   522  C CD  . ARG A 1 70  ? 37.187 73.830 -1.437  1.00 62.51  ? 70  ARG A CD  1 
ATOM   523  N NE  . ARG A 1 70  ? 37.994 72.668 -1.080  1.00 64.72  ? 70  ARG A NE  1 
ATOM   524  C CZ  . ARG A 1 70  ? 37.757 71.432 -1.514  1.00 66.14  ? 70  ARG A CZ  1 
ATOM   525  N NH1 . ARG A 1 70  ? 36.736 71.196 -2.330  1.00 66.17  ? 70  ARG A NH1 1 
ATOM   526  N NH2 . ARG A 1 70  ? 38.532 70.428 -1.125  1.00 66.71  ? 70  ARG A NH2 1 
ATOM   527  N N   . TYR A 1 71  ? 35.939 74.167 3.991   1.00 63.53  ? 71  TYR A N   1 
ATOM   528  C CA  . TYR A 1 71  ? 36.486 74.682 5.238   1.00 65.34  ? 71  TYR A CA  1 
ATOM   529  C C   . TYR A 1 71  ? 37.996 74.693 5.038   1.00 66.58  ? 71  TYR A C   1 
ATOM   530  O O   . TYR A 1 71  ? 38.626 73.639 4.904   1.00 65.50  ? 71  TYR A O   1 
ATOM   531  C CB  . TYR A 1 71  ? 36.115 73.795 6.437   1.00 66.34  ? 71  TYR A CB  1 
ATOM   532  C CG  . TYR A 1 71  ? 34.699 74.000 6.932   1.00 65.96  ? 71  TYR A CG  1 
ATOM   533  C CD1 . TYR A 1 71  ? 33.624 73.393 6.293   1.00 65.34  ? 71  TYR A CD1 1 
ATOM   534  C CD2 . TYR A 1 71  ? 34.434 74.849 8.009   1.00 66.57  ? 71  TYR A CD2 1 
ATOM   535  C CE1 . TYR A 1 71  ? 32.326 73.629 6.707   1.00 65.99  ? 71  TYR A CE1 1 
ATOM   536  C CE2 . TYR A 1 71  ? 33.134 75.091 8.433   1.00 65.52  ? 71  TYR A CE2 1 
ATOM   537  C CZ  . TYR A 1 71  ? 32.087 74.480 7.779   1.00 65.76  ? 71  TYR A CZ  1 
ATOM   538  O OH  . TYR A 1 71  ? 30.800 74.716 8.199   1.00 66.05  ? 71  TYR A OH  1 
ATOM   539  N N   . GLU A 1 72  ? 38.562 75.895 4.990   1.00 68.22  ? 72  GLU A N   1 
ATOM   540  C CA  . GLU A 1 72  ? 39.994 76.070 4.789   1.00 68.80  ? 72  GLU A CA  1 
ATOM   541  C C   . GLU A 1 72  ? 40.633 76.686 6.032   1.00 68.48  ? 72  GLU A C   1 
ATOM   542  O O   . GLU A 1 72  ? 41.537 77.514 5.927   1.00 69.44  ? 72  GLU A O   1 
ATOM   543  C CB  . GLU A 1 72  ? 40.234 76.972 3.570   1.00 70.26  ? 72  GLU A CB  1 
ATOM   544  C CG  . GLU A 1 72  ? 39.528 76.502 2.294   1.00 71.17  ? 72  GLU A CG  1 
ATOM   545  C CD  . GLU A 1 72  ? 40.180 75.276 1.671   1.00 72.39  ? 72  GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 72  ? 40.782 74.480 2.421   1.00 74.00  ? 72  GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 72  ? 40.080 75.102 0.436   1.00 72.91  ? 72  GLU A OE2 1 
ATOM   548  N N   . TYR A 1 73  ? 40.160 76.282 7.208   1.00 67.46  ? 73  TYR A N   1 
ATOM   549  C CA  . TYR A 1 73  ? 40.703 76.800 8.455   1.00 66.99  ? 73  TYR A CA  1 
ATOM   550  C C   . TYR A 1 73  ? 42.149 76.387 8.641   1.00 66.45  ? 73  TYR A C   1 
ATOM   551  O O   . TYR A 1 73  ? 42.931 77.103 9.258   1.00 66.38  ? 73  TYR A O   1 
ATOM   552  C CB  . TYR A 1 73  ? 39.884 76.312 9.649   1.00 68.33  ? 73  TYR A CB  1 
ATOM   553  C CG  . TYR A 1 73  ? 38.627 77.114 9.905   1.00 69.92  ? 73  TYR A CG  1 
ATOM   554  C CD1 . TYR A 1 73  ? 37.597 77.154 8.965   1.00 71.30  ? 73  TYR A CD1 1 
ATOM   555  C CD2 . TYR A 1 73  ? 38.467 77.840 11.089  1.00 69.91  ? 73  TYR A CD2 1 
ATOM   556  C CE1 . TYR A 1 73  ? 36.434 77.901 9.195   1.00 71.57  ? 73  TYR A CE1 1 
ATOM   557  C CE2 . TYR A 1 73  ? 37.309 78.590 11.328  1.00 70.20  ? 73  TYR A CE2 1 
ATOM   558  C CZ  . TYR A 1 73  ? 36.300 78.616 10.375  1.00 70.11  ? 73  TYR A CZ  1 
ATOM   559  O OH  . TYR A 1 73  ? 35.169 79.367 10.586  1.00 69.50  ? 73  TYR A OH  1 
ATOM   560  N N   . PHE A 1 74  ? 42.494 75.222 8.110   1.00 66.12  ? 74  PHE A N   1 
ATOM   561  C CA  . PHE A 1 74  ? 43.852 74.728 8.214   1.00 65.66  ? 74  PHE A CA  1 
ATOM   562  C C   . PHE A 1 74  ? 44.335 74.425 6.826   1.00 66.59  ? 74  PHE A C   1 
ATOM   563  O O   . PHE A 1 74  ? 44.450 73.256 6.431   1.00 66.35  ? 74  PHE A O   1 
ATOM   564  C CB  . PHE A 1 74  ? 43.895 73.481 9.088   1.00 65.58  ? 74  PHE A CB  1 
ATOM   565  C CG  . PHE A 1 74  ? 43.333 73.701 10.447  1.00 65.92  ? 74  PHE A CG  1 
ATOM   566  C CD1 . PHE A 1 74  ? 41.959 73.746 10.641  1.00 66.93  ? 74  PHE A CD1 1 
ATOM   567  C CD2 . PHE A 1 74  ? 44.167 73.890 11.532  1.00 64.69  ? 74  PHE A CD2 1 
ATOM   568  C CE1 . PHE A 1 74  ? 41.424 73.977 11.907  1.00 66.82  ? 74  PHE A CE1 1 
ATOM   569  C CE2 . PHE A 1 74  ? 43.638 74.122 12.799  1.00 66.41  ? 74  PHE A CE2 1 
ATOM   570  C CZ  . PHE A 1 74  ? 42.264 74.166 12.987  1.00 67.04  ? 74  PHE A CZ  1 
ATOM   571  N N   . PRO A 1 75  ? 44.625 75.485 6.056   1.00 68.02  ? 75  PRO A N   1 
ATOM   572  C CA  . PRO A 1 75  ? 45.089 75.248 4.698   1.00 68.81  ? 75  PRO A CA  1 
ATOM   573  C C   . PRO A 1 75  ? 46.178 74.181 4.621   1.00 70.31  ? 75  PRO A C   1 
ATOM   574  O O   . PRO A 1 75  ? 47.157 74.192 5.375   1.00 71.56  ? 75  PRO A O   1 
ATOM   575  C CB  . PRO A 1 75  ? 45.577 76.601 4.217   1.00 68.20  ? 75  PRO A CB  1 
ATOM   576  C CG  . PRO A 1 75  ? 45.162 77.584 5.204   1.00 68.13  ? 75  PRO A CG  1 
ATOM   577  C CD  . PRO A 1 75  ? 44.686 76.897 6.443   1.00 69.07  ? 75  PRO A CD  1 
ATOM   578  N N   . GLY A 1 76  ? 45.966 73.227 3.714   1.00 70.52  ? 76  GLY A N   1 
ATOM   579  C CA  . GLY A 1 76  ? 46.910 72.150 3.496   1.00 70.91  ? 76  GLY A CA  1 
ATOM   580  C C   . GLY A 1 76  ? 46.840 71.013 4.483   1.00 71.85  ? 76  GLY A C   1 
ATOM   581  O O   . GLY A 1 76  ? 47.586 70.028 4.350   1.00 73.36  ? 76  GLY A O   1 
ATOM   582  N N   . PHE A 1 77  ? 45.957 71.111 5.467   1.00 71.52  ? 77  PHE A N   1 
ATOM   583  C CA  . PHE A 1 77  ? 45.875 70.033 6.421   1.00 71.10  ? 77  PHE A CA  1 
ATOM   584  C C   . PHE A 1 77  ? 45.070 68.967 5.755   1.00 70.01  ? 77  PHE A C   1 
ATOM   585  O O   . PHE A 1 77  ? 44.073 69.259 5.099   1.00 69.90  ? 77  PHE A O   1 
ATOM   586  C CB  . PHE A 1 77  ? 45.167 70.475 7.697   1.00 72.06  ? 77  PHE A CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 45.286 69.476 8.820   1.00 73.99  ? 77  PHE A CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 45.399 68.110 8.588   1.00 75.00  ? 77  PHE A CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 45.338 69.889 10.101  1.00 75.96  ? 77  PHE A CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 45.564 67.204 9.652   1.00 75.85  ? 77  PHE A CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 45.507 68.981 11.144  1.00 77.33  ? 77  PHE A CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 45.616 67.656 10.917  1.00 76.75  ? 77  PHE A CZ  1 
ATOM   593  N N   . SER A 1 78  ? 45.465 67.713 5.952   1.00 68.72  ? 78  SER A N   1 
ATOM   594  C CA  . SER A 1 78  ? 44.731 66.635 5.347   1.00 67.94  ? 78  SER A CA  1 
ATOM   595  C C   . SER A 1 78  ? 43.463 66.383 6.159   1.00 67.37  ? 78  SER A C   1 
ATOM   596  O O   . SER A 1 78  ? 42.387 66.189 5.600   1.00 68.47  ? 78  SER A O   1 
ATOM   597  C CB  . SER A 1 78  ? 45.593 65.377 5.332   1.00 68.07  ? 78  SER A CB  1 
ATOM   598  O OG  . SER A 1 78  ? 44.732 64.277 5.185   1.00 68.81  ? 78  SER A OG  1 
ATOM   599  N N   . GLY A 1 79  ? 43.593 66.439 7.482   1.00 64.81  ? 79  GLY A N   1 
ATOM   600  C CA  . GLY A 1 79  ? 42.456 66.219 8.362   1.00 62.52  ? 79  GLY A CA  1 
ATOM   601  C C   . GLY A 1 79  ? 41.172 66.933 7.986   1.00 60.44  ? 79  GLY A C   1 
ATOM   602  O O   . GLY A 1 79  ? 40.096 66.336 7.986   1.00 59.01  ? 79  GLY A O   1 
ATOM   603  N N   . GLU A 1 80  ? 41.295 68.215 7.670   1.00 59.33  ? 80  GLU A N   1 
ATOM   604  C CA  . GLU A 1 80  ? 40.154 69.035 7.294   1.00 58.74  ? 80  GLU A CA  1 
ATOM   605  C C   . GLU A 1 80  ? 39.667 68.793 5.871   1.00 59.31  ? 80  GLU A C   1 
ATOM   606  O O   . GLU A 1 80  ? 38.467 68.855 5.597   1.00 58.98  ? 80  GLU A O   1 
ATOM   607  C CB  . GLU A 1 80  ? 40.508 70.511 7.454   1.00 57.02  ? 80  GLU A CB  1 
ATOM   608  C CG  . GLU A 1 80  ? 39.515 71.463 6.826   1.00 55.98  ? 80  GLU A CG  1 
ATOM   609  C CD  . GLU A 1 80  ? 39.896 72.906 7.053   1.00 57.28  ? 80  GLU A CD  1 
ATOM   610  O OE1 . GLU A 1 80  ? 41.025 73.278 6.678   1.00 59.40  ? 80  GLU A OE1 1 
ATOM   611  O OE2 . GLU A 1 80  ? 39.074 73.670 7.604   1.00 56.30  ? 80  GLU A OE2 1 
ATOM   612  N N   . GLU A 1 81  ? 40.601 68.512 4.971   1.00 60.37  ? 81  GLU A N   1 
ATOM   613  C CA  . GLU A 1 81  ? 40.273 68.302 3.566   1.00 61.15  ? 81  GLU A CA  1 
ATOM   614  C C   . GLU A 1 81  ? 39.519 67.031 3.193   1.00 58.77  ? 81  GLU A C   1 
ATOM   615  O O   . GLU A 1 81  ? 38.704 67.052 2.269   1.00 57.70  ? 81  GLU A O   1 
ATOM   616  C CB  . GLU A 1 81  ? 41.543 68.396 2.719   1.00 64.31  ? 81  GLU A CB  1 
ATOM   617  C CG  . GLU A 1 81  ? 42.022 69.811 2.498   1.00 69.89  ? 81  GLU A CG  1 
ATOM   618  C CD  . GLU A 1 81  ? 40.974 70.671 1.819   1.00 73.40  ? 81  GLU A CD  1 
ATOM   619  O OE1 . GLU A 1 81  ? 40.509 70.286 0.726   1.00 74.88  ? 81  GLU A OE1 1 
ATOM   620  O OE2 . GLU A 1 81  ? 40.616 71.732 2.374   1.00 77.58  ? 81  GLU A OE2 1 
ATOM   621  N N   . ILE A 1 82  ? 39.787 65.927 3.884   1.00 55.75  ? 82  ILE A N   1 
ATOM   622  C CA  . ILE A 1 82  ? 39.100 64.681 3.560   1.00 53.67  ? 82  ILE A CA  1 
ATOM   623  C C   . ILE A 1 82  ? 37.592 64.841 3.659   1.00 52.37  ? 82  ILE A C   1 
ATOM   624  O O   . ILE A 1 82  ? 36.839 63.959 3.244   1.00 52.32  ? 82  ILE A O   1 
ATOM   625  C CB  . ILE A 1 82  ? 39.507 63.527 4.494   1.00 54.15  ? 82  ILE A CB  1 
ATOM   626  C CG1 . ILE A 1 82  ? 39.291 63.940 5.951   1.00 55.58  ? 82  ILE A CG1 1 
ATOM   627  C CG2 . ILE A 1 82  ? 40.939 63.125 4.227   1.00 53.59  ? 82  ILE A CG2 1 
ATOM   628  C CD1 . ILE A 1 82  ? 39.301 62.784 6.929   1.00 57.23  ? 82  ILE A CD1 1 
ATOM   629  N N   . TRP A 1 83  ? 37.154 65.968 4.209   1.00 50.23  ? 83  TRP A N   1 
ATOM   630  C CA  . TRP A 1 83  ? 35.736 66.213 4.362   1.00 48.95  ? 83  TRP A CA  1 
ATOM   631  C C   . TRP A 1 83  ? 35.184 67.282 3.425   1.00 48.40  ? 83  TRP A C   1 
ATOM   632  O O   . TRP A 1 83  ? 33.987 67.539 3.427   1.00 49.18  ? 83  TRP A O   1 
ATOM   633  C CB  . TRP A 1 83  ? 35.429 66.574 5.817   1.00 50.04  ? 83  TRP A CB  1 
ATOM   634  C CG  . TRP A 1 83  ? 35.772 65.478 6.806   1.00 49.67  ? 83  TRP A CG  1 
ATOM   635  C CD1 . TRP A 1 83  ? 36.873 65.416 7.615   1.00 50.92  ? 83  TRP A CD1 1 
ATOM   636  C CD2 . TRP A 1 83  ? 35.027 64.279 7.057   1.00 48.74  ? 83  TRP A CD2 1 
ATOM   637  N NE1 . TRP A 1 83  ? 36.861 64.254 8.352   1.00 48.58  ? 83  TRP A NE1 1 
ATOM   638  C CE2 . TRP A 1 83  ? 35.742 63.536 8.027   1.00 48.75  ? 83  TRP A CE2 1 
ATOM   639  C CE3 . TRP A 1 83  ? 33.829 63.757 6.555   1.00 48.96  ? 83  TRP A CE3 1 
ATOM   640  C CZ2 . TRP A 1 83  ? 35.295 62.300 8.504   1.00 47.59  ? 83  TRP A CZ2 1 
ATOM   641  C CZ3 . TRP A 1 83  ? 33.386 62.527 7.028   1.00 48.47  ? 83  TRP A CZ3 1 
ATOM   642  C CH2 . TRP A 1 83  ? 34.120 61.813 7.994   1.00 48.40  ? 83  TRP A CH2 1 
ATOM   643  N N   . ASN A 1 84  ? 36.051 67.910 2.633   1.00 48.14  ? 84  ASN A N   1 
ATOM   644  C CA  . ASN A 1 84  ? 35.611 68.930 1.678   1.00 46.94  ? 84  ASN A CA  1 
ATOM   645  C C   . ASN A 1 84  ? 35.183 68.271 0.359   1.00 46.43  ? 84  ASN A C   1 
ATOM   646  O O   . ASN A 1 84  ? 35.512 67.112 0.097   1.00 45.66  ? 84  ASN A O   1 
ATOM   647  C CB  . ASN A 1 84  ? 36.727 69.941 1.407   1.00 47.51  ? 84  ASN A CB  1 
ATOM   648  C CG  . ASN A 1 84  ? 36.879 70.966 2.521   1.00 48.16  ? 84  ASN A CG  1 
ATOM   649  O OD1 . ASN A 1 84  ? 35.899 71.521 3.018   1.00 45.49  ? 84  ASN A OD1 1 
ATOM   650  N ND2 . ASN A 1 84  ? 38.117 71.237 2.900   1.00 49.51  ? 84  ASN A ND2 1 
ATOM   651  N N   . PRO A 1 85  ? 34.435 68.998 -0.485  1.00 45.45  ? 85  PRO A N   1 
ATOM   652  C CA  . PRO A 1 85  ? 34.004 68.408 -1.749  1.00 47.18  ? 85  PRO A CA  1 
ATOM   653  C C   . PRO A 1 85  ? 35.067 67.555 -2.456  1.00 48.45  ? 85  PRO A C   1 
ATOM   654  O O   . PRO A 1 85  ? 36.250 67.892 -2.505  1.00 45.95  ? 85  PRO A O   1 
ATOM   655  C CB  . PRO A 1 85  ? 33.555 69.627 -2.555  1.00 46.38  ? 85  PRO A CB  1 
ATOM   656  C CG  . PRO A 1 85  ? 32.919 70.461 -1.511  1.00 44.84  ? 85  PRO A CG  1 
ATOM   657  C CD  . PRO A 1 85  ? 33.916 70.372 -0.355  1.00 45.42  ? 85  PRO A CD  1 
ATOM   658  N N   . ASN A 1 86  ? 34.603 66.438 -3.002  1.00 51.04  ? 86  ASN A N   1 
ATOM   659  C CA  . ASN A 1 86  ? 35.440 65.478 -3.697  1.00 50.27  ? 86  ASN A CA  1 
ATOM   660  C C   . ASN A 1 86  ? 35.414 65.717 -5.201  1.00 50.24  ? 86  ASN A C   1 
ATOM   661  O O   . ASN A 1 86  ? 36.405 65.516 -5.884  1.00 50.25  ? 86  ASN A O   1 
ATOM   662  C CB  . ASN A 1 86  ? 34.923 64.075 -3.388  1.00 51.09  ? 86  ASN A CB  1 
ATOM   663  C CG  . ASN A 1 86  ? 35.999 63.041 -3.460  1.00 51.79  ? 86  ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 86  ? 37.090 63.234 -2.922  1.00 52.83  ? 86  ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 86  ? 35.705 61.922 -4.112  1.00 53.69  ? 86  ASN A ND2 1 
ATOM   666  N N   . THR A 1 87  ? 34.267 66.141 -5.714  1.00 50.76  ? 87  THR A N   1 
ATOM   667  C CA  . THR A 1 87  ? 34.112 66.394 -7.138  1.00 49.58  ? 87  THR A CA  1 
ATOM   668  C C   . THR A 1 87  ? 33.603 67.813 -7.353  1.00 50.35  ? 87  THR A C   1 
ATOM   669  O O   . THR A 1 87  ? 33.328 68.533 -6.394  1.00 49.91  ? 87  THR A O   1 
ATOM   670  C CB  . THR A 1 87  ? 33.122 65.390 -7.759  1.00 49.00  ? 87  THR A CB  1 
ATOM   671  O OG1 . THR A 1 87  ? 31.830 65.551 -7.163  1.00 47.92  ? 87  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 87  ? 33.595 63.964 -7.511  1.00 47.31  ? 87  THR A CG2 1 
ATOM   673  N N   . ASN A 1 88  ? 33.491 68.222 -8.609  1.00 52.20  ? 88  ASN A N   1 
ATOM   674  C CA  . ASN A 1 88  ? 33.013 69.563 -8.912  1.00 54.15  ? 88  ASN A CA  1 
ATOM   675  C C   . ASN A 1 88  ? 31.667 69.795 -8.238  1.00 52.62  ? 88  ASN A C   1 
ATOM   676  O O   . ASN A 1 88  ? 30.853 68.875 -8.118  1.00 52.70  ? 88  ASN A O   1 
ATOM   677  C CB  . ASN A 1 88  ? 32.859 69.757 -10.428 1.00 60.35  ? 88  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 88  ? 34.181 70.056 -11.133 1.00 66.76  ? 88  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 88  ? 35.223 70.250 -10.491 1.00 67.79  ? 88  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 88  ? 34.130 70.105 -12.465 1.00 71.18  ? 88  ASN A ND2 1 
ATOM   681  N N   . VAL A 1 89  ? 31.433 71.029 -7.807  1.00 50.21  ? 89  VAL A N   1 
ATOM   682  C CA  . VAL A 1 89  ? 30.181 71.377 -7.150  1.00 48.27  ? 89  VAL A CA  1 
ATOM   683  C C   . VAL A 1 89  ? 29.246 72.147 -8.082  1.00 49.12  ? 89  VAL A C   1 
ATOM   684  O O   . VAL A 1 89  ? 29.644 73.150 -8.679  1.00 50.69  ? 89  VAL A O   1 
ATOM   685  C CB  . VAL A 1 89  ? 30.434 72.236 -5.880  1.00 44.64  ? 89  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 89  ? 31.499 71.594 -5.040  1.00 45.14  ? 89  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 89  ? 30.853 73.630 -6.251  1.00 41.84  ? 89  VAL A CG2 1 
ATOM   688  N N   . SER A 1 90  ? 28.010 71.671 -8.219  1.00 48.12  ? 90  SER A N   1 
ATOM   689  C CA  . SER A 1 90  ? 27.017 72.353 -9.052  1.00 47.35  ? 90  SER A CA  1 
ATOM   690  C C   . SER A 1 90  ? 25.631 72.111 -8.471  1.00 46.63  ? 90  SER A C   1 
ATOM   691  O O   . SER A 1 90  ? 25.443 71.213 -7.648  1.00 46.00  ? 90  SER A O   1 
ATOM   692  C CB  . SER A 1 90  ? 27.039 71.823 -10.483 1.00 47.21  ? 90  SER A CB  1 
ATOM   693  O OG  . SER A 1 90  ? 26.335 70.591 -10.573 1.00 50.88  ? 90  SER A OG  1 
ATOM   694  N N   . GLU A 1 91  ? 24.657 72.906 -8.899  1.00 44.53  ? 91  GLU A N   1 
ATOM   695  C CA  . GLU A 1 91  ? 23.308 72.717 -8.407  1.00 44.46  ? 91  GLU A CA  1 
ATOM   696  C C   . GLU A 1 91  ? 22.750 71.413 -8.960  1.00 43.44  ? 91  GLU A C   1 
ATOM   697  O O   . GLU A 1 91  ? 21.801 70.856 -8.409  1.00 42.75  ? 91  GLU A O   1 
ATOM   698  C CB  . GLU A 1 91  ? 22.414 73.881 -8.813  1.00 44.13  ? 91  GLU A CB  1 
ATOM   699  C CG  . GLU A 1 91  ? 22.862 75.196 -8.254  1.00 47.52  ? 91  GLU A CG  1 
ATOM   700  C CD  . GLU A 1 91  ? 21.759 76.230 -8.285  1.00 52.36  ? 91  GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 91  ? 20.859 76.170 -7.415  1.00 51.05  ? 91  GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 91  ? 21.788 77.096 -9.189  1.00 54.85  ? 91  GLU A OE2 1 
ATOM   703  N N   . ASP A 1 92  ? 23.346 70.938 -10.052 1.00 42.67  ? 92  ASP A N   1 
ATOM   704  C CA  . ASP A 1 92  ? 22.941 69.688 -10.692 1.00 42.09  ? 92  ASP A CA  1 
ATOM   705  C C   . ASP A 1 92  ? 23.731 68.613 -9.958  1.00 42.32  ? 92  ASP A C   1 
ATOM   706  O O   . ASP A 1 92  ? 24.829 68.255 -10.384 1.00 43.76  ? 92  ASP A O   1 
ATOM   707  C CB  . ASP A 1 92  ? 23.329 69.711 -12.176 1.00 40.10  ? 92  ASP A CB  1 
ATOM   708  C CG  . ASP A 1 92  ? 22.814 68.504 -12.947 1.00 39.96  ? 92  ASP A CG  1 
ATOM   709  O OD1 . ASP A 1 92  ? 22.314 67.538 -12.330 1.00 38.77  ? 92  ASP A OD1 1 
ATOM   710  O OD2 . ASP A 1 92  ? 22.917 68.520 -14.190 1.00 39.82  ? 92  ASP A OD2 1 
ATOM   711  N N   . CYS A 1 93  ? 23.166 68.104 -8.860  1.00 42.10  ? 93  CYS A N   1 
ATOM   712  C CA  . CYS A 1 93  ? 23.840 67.107 -8.020  1.00 42.19  ? 93  CYS A CA  1 
ATOM   713  C C   . CYS A 1 93  ? 22.973 65.936 -7.559  1.00 42.51  ? 93  CYS A C   1 
ATOM   714  O O   . CYS A 1 93  ? 23.472 65.017 -6.903  1.00 44.41  ? 93  CYS A O   1 
ATOM   715  C CB  . CYS A 1 93  ? 24.428 67.800 -6.774  1.00 39.86  ? 93  CYS A CB  1 
ATOM   716  S SG  . CYS A 1 93  ? 23.176 68.719 -5.814  1.00 39.43  ? 93  CYS A SG  1 
ATOM   717  N N   . LEU A 1 94  ? 21.688 65.953 -7.894  1.00 40.45  ? 94  LEU A N   1 
ATOM   718  C CA  . LEU A 1 94  ? 20.802 64.884 -7.454  1.00 39.48  ? 94  LEU A CA  1 
ATOM   719  C C   . LEU A 1 94  ? 21.068 63.543 -8.129  1.00 39.49  ? 94  LEU A C   1 
ATOM   720  O O   . LEU A 1 94  ? 20.422 63.204 -9.109  1.00 41.57  ? 94  LEU A O   1 
ATOM   721  C CB  . LEU A 1 94  ? 19.347 65.310 -7.653  1.00 39.55  ? 94  LEU A CB  1 
ATOM   722  C CG  . LEU A 1 94  ? 19.015 66.671 -7.016  1.00 39.47  ? 94  LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 94  ? 17.525 66.929 -7.057  1.00 38.44  ? 94  LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 94  ? 19.484 66.691 -5.580  1.00 39.13  ? 94  LEU A CD2 1 
ATOM   725  N N   . TYR A 1 95  ? 22.028 62.784 -7.603  1.00 40.38  ? 95  TYR A N   1 
ATOM   726  C CA  . TYR A 1 95  ? 22.364 61.471 -8.164  1.00 39.95  ? 95  TYR A CA  1 
ATOM   727  C C   . TYR A 1 95  ? 22.486 60.368 -7.112  1.00 40.18  ? 95  TYR A C   1 
ATOM   728  O O   . TYR A 1 95  ? 22.813 60.631 -5.955  1.00 40.85  ? 95  TYR A O   1 
ATOM   729  C CB  . TYR A 1 95  ? 23.662 61.543 -8.959  1.00 38.94  ? 95  TYR A CB  1 
ATOM   730  C CG  . TYR A 1 95  ? 23.627 62.527 -10.099 1.00 41.06  ? 95  TYR A CG  1 
ATOM   731  C CD1 . TYR A 1 95  ? 23.193 62.127 -11.365 1.00 42.68  ? 95  TYR A CD1 1 
ATOM   732  C CD2 . TYR A 1 95  ? 23.997 63.869 -9.915  1.00 40.49  ? 95  TYR A CD2 1 
ATOM   733  C CE1 . TYR A 1 95  ? 23.121 63.033 -12.428 1.00 43.17  ? 95  TYR A CE1 1 
ATOM   734  C CE2 . TYR A 1 95  ? 23.932 64.790 -10.971 1.00 41.47  ? 95  TYR A CE2 1 
ATOM   735  C CZ  . TYR A 1 95  ? 23.489 64.364 -12.226 1.00 42.89  ? 95  TYR A CZ  1 
ATOM   736  O OH  . TYR A 1 95  ? 23.387 65.265 -13.273 1.00 44.16  ? 95  TYR A OH  1 
ATOM   737  N N   . ILE A 1 96  ? 22.220 59.135 -7.526  1.00 40.80  ? 96  ILE A N   1 
ATOM   738  C CA  . ILE A 1 96  ? 22.297 57.970 -6.641  1.00 42.15  ? 96  ILE A CA  1 
ATOM   739  C C   . ILE A 1 96  ? 23.477 57.065 -6.985  1.00 42.37  ? 96  ILE A C   1 
ATOM   740  O O   . ILE A 1 96  ? 23.963 57.057 -8.115  1.00 43.95  ? 96  ILE A O   1 
ATOM   741  C CB  . ILE A 1 96  ? 20.991 57.125 -6.702  1.00 41.57  ? 96  ILE A CB  1 
ATOM   742  C CG1 . ILE A 1 96  ? 19.930 57.753 -5.800  1.00 42.95  ? 96  ILE A CG1 1 
ATOM   743  C CG2 . ILE A 1 96  ? 21.262 55.678 -6.288  1.00 38.94  ? 96  ILE A CG2 1 
ATOM   744  C CD1 . ILE A 1 96  ? 18.613 57.017 -5.806  1.00 45.85  ? 96  ILE A CD1 1 
ATOM   745  N N   . ASN A 1 97  ? 23.924 56.309 -5.988  1.00 41.38  ? 97  ASN A N   1 
ATOM   746  C CA  . ASN A 1 97  ? 25.021 55.366 -6.132  1.00 39.30  ? 97  ASN A CA  1 
ATOM   747  C C   . ASN A 1 97  ? 24.541 54.051 -5.507  1.00 40.96  ? 97  ASN A C   1 
ATOM   748  O O   . ASN A 1 97  ? 23.940 54.050 -4.428  1.00 40.51  ? 97  ASN A O   1 
ATOM   749  C CB  . ASN A 1 97  ? 26.253 55.860 -5.378  1.00 36.94  ? 97  ASN A CB  1 
ATOM   750  C CG  . ASN A 1 97  ? 26.610 57.293 -5.714  1.00 38.48  ? 97  ASN A CG  1 
ATOM   751  O OD1 . ASN A 1 97  ? 26.920 57.621 -6.861  1.00 38.65  ? 97  ASN A OD1 1 
ATOM   752  N ND2 . ASN A 1 97  ? 26.570 58.161 -4.707  1.00 38.88  ? 97  ASN A ND2 1 
ATOM   753  N N   . VAL A 1 98  ? 24.794 52.938 -6.186  1.00 40.44  ? 98  VAL A N   1 
ATOM   754  C CA  . VAL A 1 98  ? 24.394 51.643 -5.672  1.00 40.80  ? 98  VAL A CA  1 
ATOM   755  C C   . VAL A 1 98  ? 25.525 50.624 -5.782  1.00 41.99  ? 98  VAL A C   1 
ATOM   756  O O   . VAL A 1 98  ? 26.160 50.493 -6.829  1.00 42.59  ? 98  VAL A O   1 
ATOM   757  C CB  . VAL A 1 98  ? 23.181 51.098 -6.430  1.00 40.58  ? 98  VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 98  ? 22.705 49.802 -5.773  1.00 39.82  ? 98  VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 98  ? 22.076 52.133 -6.450  1.00 38.79  ? 98  VAL A CG2 1 
ATOM   760  N N   . TRP A 1 99  ? 25.773 49.915 -4.685  1.00 42.95  ? 99  TRP A N   1 
ATOM   761  C CA  . TRP A 1 99  ? 26.804 48.879 -4.616  1.00 40.98  ? 99  TRP A CA  1 
ATOM   762  C C   . TRP A 1 99  ? 26.072 47.549 -4.513  1.00 42.27  ? 99  TRP A C   1 
ATOM   763  O O   . TRP A 1 99  ? 25.415 47.275 -3.510  1.00 41.60  ? 99  TRP A O   1 
ATOM   764  C CB  . TRP A 1 99  ? 27.680 49.084 -3.379  1.00 38.95  ? 99  TRP A CB  1 
ATOM   765  C CG  . TRP A 1 99  ? 28.727 50.161 -3.517  1.00 39.54  ? 99  TRP A CG  1 
ATOM   766  C CD1 . TRP A 1 99  ? 30.018 50.000 -3.935  1.00 40.19  ? 99  TRP A CD1 1 
ATOM   767  C CD2 . TRP A 1 99  ? 28.575 51.559 -3.226  1.00 41.49  ? 99  TRP A CD2 1 
ATOM   768  N NE1 . TRP A 1 99  ? 30.683 51.207 -3.919  1.00 40.89  ? 99  TRP A NE1 1 
ATOM   769  C CE2 . TRP A 1 99  ? 29.821 52.181 -3.489  1.00 41.42  ? 99  TRP A CE2 1 
ATOM   770  C CE3 . TRP A 1 99  ? 27.510 52.347 -2.769  1.00 39.76  ? 99  TRP A CE3 1 
ATOM   771  C CZ2 . TRP A 1 99  ? 30.029 53.552 -3.309  1.00 41.09  ? 99  TRP A CZ2 1 
ATOM   772  C CZ3 . TRP A 1 99  ? 27.722 53.716 -2.589  1.00 41.62  ? 99  TRP A CZ3 1 
ATOM   773  C CH2 . TRP A 1 99  ? 28.972 54.301 -2.860  1.00 39.34  ? 99  TRP A CH2 1 
ATOM   774  N N   . ALA A 1 100 ? 26.178 46.727 -5.551  1.00 45.09  ? 100 ALA A N   1 
ATOM   775  C CA  . ALA A 1 100 ? 25.495 45.437 -5.572  1.00 48.29  ? 100 ALA A CA  1 
ATOM   776  C C   . ALA A 1 100 ? 26.415 44.226 -5.742  1.00 50.76  ? 100 ALA A C   1 
ATOM   777  O O   . ALA A 1 100 ? 27.210 44.154 -6.685  1.00 51.10  ? 100 ALA A O   1 
ATOM   778  C CB  . ALA A 1 100 ? 24.435 45.438 -6.680  1.00 47.14  ? 100 ALA A CB  1 
ATOM   779  N N   . PRO A 1 101 ? 26.326 43.256 -4.820  1.00 53.97  ? 101 PRO A N   1 
ATOM   780  C CA  . PRO A 1 101 ? 27.182 42.075 -4.955  1.00 55.07  ? 101 PRO A CA  1 
ATOM   781  C C   . PRO A 1 101 ? 26.879 41.441 -6.312  1.00 55.21  ? 101 PRO A C   1 
ATOM   782  O O   . PRO A 1 101 ? 25.740 41.490 -6.777  1.00 55.03  ? 101 PRO A O   1 
ATOM   783  C CB  . PRO A 1 101 ? 26.736 41.194 -3.787  1.00 54.29  ? 101 PRO A CB  1 
ATOM   784  C CG  . PRO A 1 101 ? 26.372 42.199 -2.736  1.00 54.45  ? 101 PRO A CG  1 
ATOM   785  C CD  . PRO A 1 101 ? 25.585 43.223 -3.544  1.00 55.74  ? 101 PRO A CD  1 
ATOM   786  N N   . ALA A 1 102 ? 27.902 40.863 -6.939  1.00 56.44  ? 102 ALA A N   1 
ATOM   787  C CA  . ALA A 1 102 ? 27.765 40.223 -8.246  1.00 56.04  ? 102 ALA A CA  1 
ATOM   788  C C   . ALA A 1 102 ? 26.749 39.089 -8.226  1.00 55.29  ? 102 ALA A C   1 
ATOM   789  O O   . ALA A 1 102 ? 27.062 37.973 -7.800  1.00 55.84  ? 102 ALA A O   1 
ATOM   790  C CB  . ALA A 1 102 ? 29.103 39.705 -8.707  1.00 56.89  ? 102 ALA A CB  1 
ATOM   791  N N   . THR A 1 137 ? 13.989 35.914 5.146   0.80 88.64  ? 137 THR A N   1 
ATOM   792  C CA  . THR A 1 137 ? 13.168 36.590 4.149   0.80 88.43  ? 137 THR A CA  1 
ATOM   793  C C   . THR A 1 137 ? 13.690 36.239 2.767   0.80 88.51  ? 137 THR A C   1 
ATOM   794  O O   . THR A 1 137 ? 12.938 36.285 1.799   0.80 89.33  ? 137 THR A O   1 
ATOM   795  C CB  . THR A 1 137 ? 13.212 38.129 4.333   0.80 88.06  ? 137 THR A CB  1 
ATOM   796  O OG1 . THR A 1 137 ? 14.568 38.586 4.291   0.80 88.81  ? 137 THR A OG1 1 
ATOM   797  C CG2 . THR A 1 137 ? 12.585 38.530 5.659   0.80 87.87  ? 137 THR A CG2 1 
ATOM   798  N N   . THR A 1 138 ? 14.978 35.883 2.697   0.80 87.24  ? 138 THR A N   1 
ATOM   799  C CA  . THR A 1 138 ? 15.663 35.523 1.445   0.80 85.74  ? 138 THR A CA  1 
ATOM   800  C C   . THR A 1 138 ? 14.722 35.459 0.237   0.80 84.54  ? 138 THR A C   1 
ATOM   801  O O   . THR A 1 138 ? 13.897 34.554 0.133   0.80 84.98  ? 138 THR A O   1 
ATOM   802  C CB  . THR A 1 138 ? 16.362 34.171 1.586   0.80 86.05  ? 138 THR A CB  1 
ATOM   803  O OG1 . THR A 1 138 ? 15.381 33.132 1.699   0.80 86.79  ? 138 THR A OG1 1 
ATOM   804  C CG2 . THR A 1 138 ? 17.259 34.169 2.823   0.80 85.22  ? 138 THR A CG2 1 
ATOM   805  N N   . ASN A 1 139 ? 14.850 36.448 -0.648  1.00 81.94  ? 139 ASN A N   1 
ATOM   806  C CA  . ASN A 1 139 ? 14.058 36.587 -1.881  1.00 77.07  ? 139 ASN A CA  1 
ATOM   807  C C   . ASN A 1 139 ? 14.391 37.979 -2.404  1.00 73.21  ? 139 ASN A C   1 
ATOM   808  O O   . ASN A 1 139 ? 13.593 38.636 -3.071  1.00 71.21  ? 139 ASN A O   1 
ATOM   809  C CB  . ASN A 1 139 ? 12.543 36.459 -1.619  1.00 78.25  ? 139 ASN A CB  1 
ATOM   810  C CG  . ASN A 1 139 ? 11.953 37.677 -0.934  1.00 79.59  ? 139 ASN A CG  1 
ATOM   811  O OD1 . ASN A 1 139 ? 11.851 37.744 0.304   1.00 80.24  ? 139 ASN A OD1 1 
ATOM   812  N ND2 . ASN A 1 139 ? 11.560 38.650 -1.738  1.00 81.36  ? 139 ASN A ND2 1 
ATOM   813  N N   . GLY A 1 140 ? 15.611 38.397 -2.073  1.00 69.68  ? 140 GLY A N   1 
ATOM   814  C CA  . GLY A 1 140 ? 16.139 39.694 -2.440  1.00 64.91  ? 140 GLY A CA  1 
ATOM   815  C C   . GLY A 1 140 ? 17.117 40.064 -1.337  1.00 62.91  ? 140 GLY A C   1 
ATOM   816  O O   . GLY A 1 140 ? 16.787 39.909 -0.153  1.00 62.41  ? 140 GLY A O   1 
ATOM   817  N N   . LEU A 1 141 ? 18.322 40.513 -1.710  1.00 59.58  ? 141 LEU A N   1 
ATOM   818  C CA  . LEU A 1 141 ? 19.353 40.908 -0.742  1.00 56.11  ? 141 LEU A CA  1 
ATOM   819  C C   . LEU A 1 141 ? 18.925 42.095 0.134   1.00 54.20  ? 141 LEU A C   1 
ATOM   820  O O   . LEU A 1 141 ? 17.988 42.829 -0.193  1.00 54.32  ? 141 LEU A O   1 
ATOM   821  C CB  . LEU A 1 141 ? 20.663 41.251 -1.468  1.00 54.96  ? 141 LEU A CB  1 
ATOM   822  C CG  . LEU A 1 141 ? 21.447 40.079 -2.027  1.00 55.23  ? 141 LEU A CG  1 
ATOM   823  C CD1 . LEU A 1 141 ? 22.812 40.548 -2.506  1.00 52.97  ? 141 LEU A CD1 1 
ATOM   824  C CD2 . LEU A 1 141 ? 21.599 39.047 -0.933  1.00 54.43  ? 141 LEU A CD2 1 
ATOM   825  N N   . PRO A 1 142 ? 19.574 42.263 1.293   1.00 51.83  ? 142 PRO A N   1 
ATOM   826  C CA  . PRO A 1 142 ? 19.204 43.386 2.158   1.00 49.64  ? 142 PRO A CA  1 
ATOM   827  C C   . PRO A 1 142 ? 19.713 44.686 1.526   1.00 48.48  ? 142 PRO A C   1 
ATOM   828  O O   . PRO A 1 142 ? 20.742 44.682 0.832   1.00 46.54  ? 142 PRO A O   1 
ATOM   829  C CB  . PRO A 1 142 ? 19.923 43.058 3.468   1.00 50.36  ? 142 PRO A CB  1 
ATOM   830  C CG  . PRO A 1 142 ? 20.036 41.557 3.442   1.00 49.19  ? 142 PRO A CG  1 
ATOM   831  C CD  . PRO A 1 142 ? 20.431 41.306 2.014   1.00 49.85  ? 142 PRO A CD  1 
ATOM   832  N N   . ILE A 1 143 ? 19.008 45.792 1.760   1.00 46.06  ? 143 ILE A N   1 
ATOM   833  C CA  . ILE A 1 143 ? 19.416 47.085 1.191   1.00 44.00  ? 143 ILE A CA  1 
ATOM   834  C C   . ILE A 1 143 ? 19.670 48.141 2.265   1.00 40.82  ? 143 ILE A C   1 
ATOM   835  O O   . ILE A 1 143 ? 18.763 48.484 3.031   1.00 42.50  ? 143 ILE A O   1 
ATOM   836  C CB  . ILE A 1 143 ? 18.333 47.646 0.215   1.00 43.74  ? 143 ILE A CB  1 
ATOM   837  C CG1 . ILE A 1 143 ? 17.938 46.573 -0.801  1.00 42.80  ? 143 ILE A CG1 1 
ATOM   838  C CG2 . ILE A 1 143 ? 18.875 48.870 -0.524  1.00 40.82  ? 143 ILE A CG2 1 
ATOM   839  C CD1 . ILE A 1 143 ? 16.632 46.832 -1.500  1.00 43.36  ? 143 ILE A CD1 1 
ATOM   840  N N   . LEU A 1 144 ? 20.900 48.650 2.308   1.00 36.80  ? 144 LEU A N   1 
ATOM   841  C CA  . LEU A 1 144 ? 21.299 49.684 3.261   1.00 33.15  ? 144 LEU A CA  1 
ATOM   842  C C   . LEU A 1 144 ? 21.510 51.008 2.538   1.00 34.60  ? 144 LEU A C   1 
ATOM   843  O O   . LEU A 1 144 ? 22.295 51.089 1.585   1.00 30.73  ? 144 LEU A O   1 
ATOM   844  C CB  . LEU A 1 144 ? 22.594 49.305 3.975   1.00 31.70  ? 144 LEU A CB  1 
ATOM   845  C CG  . LEU A 1 144 ? 22.508 48.376 5.182   1.00 32.38  ? 144 LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 144 ? 21.973 47.032 4.746   1.00 38.15  ? 144 LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 144 ? 23.876 48.214 5.806   1.00 30.46  ? 144 LEU A CD2 1 
ATOM   848  N N   . ILE A 1 145 ? 20.811 52.043 3.004   1.00 34.30  ? 145 ILE A N   1 
ATOM   849  C CA  . ILE A 1 145 ? 20.902 53.368 2.409   1.00 32.80  ? 145 ILE A CA  1 
ATOM   850  C C   . ILE A 1 145 ? 21.591 54.358 3.342   1.00 31.45  ? 145 ILE A C   1 
ATOM   851  O O   . ILE A 1 145 ? 21.126 54.617 4.456   1.00 30.87  ? 145 ILE A O   1 
ATOM   852  C CB  . ILE A 1 145 ? 19.512 53.922 2.089   1.00 35.12  ? 145 ILE A CB  1 
ATOM   853  C CG1 . ILE A 1 145 ? 18.746 52.949 1.201   1.00 34.74  ? 145 ILE A CG1 1 
ATOM   854  C CG2 . ILE A 1 145 ? 19.638 55.280 1.401   1.00 34.73  ? 145 ILE A CG2 1 
ATOM   855  C CD1 . ILE A 1 145 ? 17.285 53.345 1.035   1.00 38.04  ? 145 ILE A CD1 1 
ATOM   856  N N   . TRP A 1 146 ? 22.684 54.937 2.862   1.00 30.16  ? 146 TRP A N   1 
ATOM   857  C CA  . TRP A 1 146 ? 23.458 55.899 3.641   1.00 28.53  ? 146 TRP A CA  1 
ATOM   858  C C   . TRP A 1 146 ? 23.156 57.373 3.346   1.00 28.27  ? 146 TRP A C   1 
ATOM   859  O O   . TRP A 1 146 ? 23.078 57.789 2.191   1.00 28.80  ? 146 TRP A O   1 
ATOM   860  C CB  . TRP A 1 146 ? 24.952 55.634 3.428   1.00 22.07  ? 146 TRP A CB  1 
ATOM   861  C CG  . TRP A 1 146 ? 25.843 56.703 3.955   1.00 19.98  ? 146 TRP A CG  1 
ATOM   862  C CD1 . TRP A 1 146 ? 26.444 57.710 3.238   1.00 20.27  ? 146 TRP A CD1 1 
ATOM   863  C CD2 . TRP A 1 146 ? 26.319 56.834 5.301   1.00 18.77  ? 146 TRP A CD2 1 
ATOM   864  N NE1 . TRP A 1 146 ? 27.281 58.447 4.056   1.00 16.64  ? 146 TRP A NE1 1 
ATOM   865  C CE2 . TRP A 1 146 ? 27.224 57.928 5.324   1.00 17.66  ? 146 TRP A CE2 1 
ATOM   866  C CE3 . TRP A 1 146 ? 26.075 56.130 6.490   1.00 16.13  ? 146 TRP A CE3 1 
ATOM   867  C CZ2 . TRP A 1 146 ? 27.888 58.324 6.491   1.00 16.62  ? 146 TRP A CZ2 1 
ATOM   868  C CZ3 . TRP A 1 146 ? 26.732 56.525 7.649   1.00 14.25  ? 146 TRP A CZ3 1 
ATOM   869  C CH2 . TRP A 1 146 ? 27.631 57.612 7.641   1.00 15.27  ? 146 TRP A CH2 1 
ATOM   870  N N   . ILE A 1 147 ? 22.993 58.154 4.407   1.00 27.31  ? 147 ILE A N   1 
ATOM   871  C CA  . ILE A 1 147 ? 22.738 59.582 4.278   1.00 28.08  ? 147 ILE A CA  1 
ATOM   872  C C   . ILE A 1 147 ? 23.880 60.309 4.976   1.00 28.06  ? 147 ILE A C   1 
ATOM   873  O O   . ILE A 1 147 ? 23.991 60.238 6.186   1.00 29.35  ? 147 ILE A O   1 
ATOM   874  C CB  . ILE A 1 147 ? 21.420 59.973 4.967   1.00 28.80  ? 147 ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 147 ? 20.259 59.194 4.344   1.00 24.47  ? 147 ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 147 ? 21.206 61.488 4.868   1.00 24.13  ? 147 ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 147 ? 18.957 59.406 5.065   1.00 24.29  ? 147 ILE A CD1 1 
ATOM   878  N N   . TYR A 1 148 ? 24.725 61.006 4.226   1.00 27.82  ? 148 TYR A N   1 
ATOM   879  C CA  . TYR A 1 148 ? 25.854 61.707 4.830   1.00 27.27  ? 148 TYR A CA  1 
ATOM   880  C C   . TYR A 1 148 ? 25.408 62.877 5.665   1.00 27.05  ? 148 TYR A C   1 
ATOM   881  O O   . TYR A 1 148 ? 24.297 63.374 5.512   1.00 27.05  ? 148 TYR A O   1 
ATOM   882  C CB  . TYR A 1 148 ? 26.820 62.220 3.754   1.00 29.66  ? 148 TYR A CB  1 
ATOM   883  C CG  . TYR A 1 148 ? 26.192 63.195 2.780   1.00 29.93  ? 148 TYR A CG  1 
ATOM   884  C CD1 . TYR A 1 148 ? 25.984 64.526 3.125   1.00 30.37  ? 148 TYR A CD1 1 
ATOM   885  C CD2 . TYR A 1 148 ? 25.768 62.768 1.521   1.00 30.49  ? 148 TYR A CD2 1 
ATOM   886  C CE1 . TYR A 1 148 ? 25.365 65.411 2.234   1.00 31.23  ? 148 TYR A CE1 1 
ATOM   887  C CE2 . TYR A 1 148 ? 25.150 63.633 0.633   1.00 29.31  ? 148 TYR A CE2 1 
ATOM   888  C CZ  . TYR A 1 148 ? 24.947 64.951 0.989   1.00 31.52  ? 148 TYR A CZ  1 
ATOM   889  O OH  . TYR A 1 148 ? 24.299 65.787 0.100   1.00 29.61  ? 148 TYR A OH  1 
ATOM   890  N N   . GLY A 1 149 ? 26.311 63.321 6.531   1.00 27.76  ? 149 GLY A N   1 
ATOM   891  C CA  . GLY A 1 149 ? 26.054 64.458 7.398   1.00 25.45  ? 149 GLY A CA  1 
ATOM   892  C C   . GLY A 1 149 ? 26.871 65.670 6.977   1.00 26.74  ? 149 GLY A C   1 
ATOM   893  O O   . GLY A 1 149 ? 27.515 65.673 5.919   1.00 25.50  ? 149 GLY A O   1 
ATOM   894  N N   . GLY A 1 150 ? 26.855 66.705 7.812   1.00 29.14  ? 150 GLY A N   1 
ATOM   895  C CA  . GLY A 1 150 ? 27.578 67.924 7.490   1.00 29.61  ? 150 GLY A CA  1 
ATOM   896  C C   . GLY A 1 150 ? 26.812 69.189 7.826   1.00 29.24  ? 150 GLY A C   1 
ATOM   897  O O   . GLY A 1 150 ? 26.873 70.178 7.102   1.00 29.20  ? 150 GLY A O   1 
ATOM   898  N N   . GLY A 1 151 ? 26.083 69.150 8.934   1.00 27.37  ? 151 GLY A N   1 
ATOM   899  C CA  . GLY A 1 151 ? 25.335 70.304 9.382   1.00 28.22  ? 151 GLY A CA  1 
ATOM   900  C C   . GLY A 1 151 ? 24.288 70.841 8.434   1.00 29.70  ? 151 GLY A C   1 
ATOM   901  O O   . GLY A 1 151 ? 23.911 71.996 8.549   1.00 29.20  ? 151 GLY A O   1 
ATOM   902  N N   . PHE A 1 152 ? 23.797 70.000 7.529   1.00 32.73  ? 152 PHE A N   1 
ATOM   903  C CA  . PHE A 1 152 ? 22.795 70.410 6.559   1.00 32.43  ? 152 PHE A CA  1 
ATOM   904  C C   . PHE A 1 152 ? 23.332 71.575 5.720   1.00 34.18  ? 152 PHE A C   1 
ATOM   905  O O   . PHE A 1 152 ? 22.593 72.196 4.954   1.00 36.27  ? 152 PHE A O   1 
ATOM   906  C CB  . PHE A 1 152 ? 21.508 70.813 7.283   1.00 31.54  ? 152 PHE A CB  1 
ATOM   907  C CG  . PHE A 1 152 ? 20.824 69.671 8.000   1.00 31.81  ? 152 PHE A CG  1 
ATOM   908  C CD1 . PHE A 1 152 ? 20.140 68.686 7.290   1.00 31.60  ? 152 PHE A CD1 1 
ATOM   909  C CD2 . PHE A 1 152 ? 20.836 69.597 9.382   1.00 30.83  ? 152 PHE A CD2 1 
ATOM   910  C CE1 . PHE A 1 152 ? 19.475 67.650 7.951   1.00 26.68  ? 152 PHE A CE1 1 
ATOM   911  C CE2 . PHE A 1 152 ? 20.177 68.569 10.039  1.00 29.55  ? 152 PHE A CE2 1 
ATOM   912  C CZ  . PHE A 1 152 ? 19.492 67.594 9.315   1.00 28.57  ? 152 PHE A CZ  1 
ATOM   913  N N   . MET A 1 153 ? 24.626 71.849 5.856   1.00 33.10  ? 153 MET A N   1 
ATOM   914  C CA  . MET A 1 153 ? 25.282 72.931 5.138   1.00 33.90  ? 153 MET A CA  1 
ATOM   915  C C   . MET A 1 153 ? 26.230 72.361 4.099   1.00 34.44  ? 153 MET A C   1 
ATOM   916  O O   . MET A 1 153 ? 26.413 72.920 3.031   1.00 35.99  ? 153 MET A O   1 
ATOM   917  C CB  . MET A 1 153 ? 26.092 73.770 6.123   1.00 35.08  ? 153 MET A CB  1 
ATOM   918  C CG  . MET A 1 153 ? 25.267 74.608 7.093   1.00 37.46  ? 153 MET A CG  1 
ATOM   919  S SD  . MET A 1 153 ? 24.599 76.110 6.271   1.00 40.86  ? 153 MET A SD  1 
ATOM   920  C CE  . MET A 1 153 ? 22.917 75.836 6.509   1.00 40.26  ? 153 MET A CE  1 
ATOM   921  N N   . THR A 1 154 ? 26.830 71.226 4.431   1.00 36.86  ? 154 THR A N   1 
ATOM   922  C CA  . THR A 1 154 ? 27.809 70.573 3.575   1.00 34.95  ? 154 THR A CA  1 
ATOM   923  C C   . THR A 1 154 ? 27.604 69.067 3.565   1.00 34.43  ? 154 THR A C   1 
ATOM   924  O O   . THR A 1 154 ? 26.690 68.536 4.208   1.00 34.22  ? 154 THR A O   1 
ATOM   925  C CB  . THR A 1 154 ? 29.225 70.856 4.101   1.00 34.81  ? 154 THR A CB  1 
ATOM   926  O OG1 . THR A 1 154 ? 29.392 70.235 5.383   1.00 36.83  ? 154 THR A OG1 1 
ATOM   927  C CG2 . THR A 1 154 ? 29.457 72.355 4.252   1.00 31.21  ? 154 THR A CG2 1 
ATOM   928  N N   . GLY A 1 155 ? 28.490 68.378 2.853   1.00 34.70  ? 155 GLY A N   1 
ATOM   929  C CA  . GLY A 1 155 ? 28.420 66.930 2.778   1.00 36.32  ? 155 GLY A CA  1 
ATOM   930  C C   . GLY A 1 155 ? 28.303 66.392 1.366   1.00 35.42  ? 155 GLY A C   1 
ATOM   931  O O   . GLY A 1 155 ? 27.773 67.071 0.497   1.00 36.69  ? 155 GLY A O   1 
ATOM   932  N N   . SER A 1 156 ? 28.784 65.169 1.146   1.00 36.11  ? 156 SER A N   1 
ATOM   933  C CA  . SER A 1 156 ? 28.750 64.531 -0.170  1.00 36.46  ? 156 SER A CA  1 
ATOM   934  C C   . SER A 1 156 ? 28.849 63.020 -0.071  1.00 35.88  ? 156 SER A C   1 
ATOM   935  O O   . SER A 1 156 ? 29.591 62.499 0.745   1.00 37.44  ? 156 SER A O   1 
ATOM   936  C CB  . SER A 1 156 ? 29.911 65.030 -1.029  1.00 37.41  ? 156 SER A CB  1 
ATOM   937  O OG  . SER A 1 156 ? 30.071 64.220 -2.182  1.00 39.90  ? 156 SER A OG  1 
ATOM   938  N N   . ALA A 1 157 ? 28.119 62.316 -0.922  1.00 35.73  ? 157 ALA A N   1 
ATOM   939  C CA  . ALA A 1 157 ? 28.154 60.865 -0.903  1.00 37.59  ? 157 ALA A CA  1 
ATOM   940  C C   . ALA A 1 157 ? 29.345 60.350 -1.696  1.00 39.14  ? 157 ALA A C   1 
ATOM   941  O O   . ALA A 1 157 ? 29.532 59.140 -1.818  1.00 39.74  ? 157 ALA A O   1 
ATOM   942  C CB  . ALA A 1 157 ? 26.858 60.292 -1.481  1.00 34.63  ? 157 ALA A CB  1 
ATOM   943  N N   . THR A 1 158 ? 30.163 61.260 -2.218  1.00 39.15  ? 158 THR A N   1 
ATOM   944  C CA  . THR A 1 158 ? 31.306 60.841 -3.017  1.00 40.52  ? 158 THR A CA  1 
ATOM   945  C C   . THR A 1 158 ? 32.584 60.677 -2.219  1.00 41.39  ? 158 THR A C   1 
ATOM   946  O O   . THR A 1 158 ? 33.556 60.096 -2.714  1.00 42.81  ? 158 THR A O   1 
ATOM   947  C CB  . THR A 1 158 ? 31.594 61.826 -4.173  1.00 40.48  ? 158 THR A CB  1 
ATOM   948  O OG1 . THR A 1 158 ? 32.173 63.030 -3.649  1.00 40.48  ? 158 THR A OG1 1 
ATOM   949  C CG2 . THR A 1 158 ? 30.312 62.155 -4.923  1.00 39.03  ? 158 THR A CG2 1 
ATOM   950  N N   . LEU A 1 159 ? 32.596 61.180 -0.989  1.00 41.00  ? 159 LEU A N   1 
ATOM   951  C CA  . LEU A 1 159 ? 33.797 61.070 -0.165  1.00 40.14  ? 159 LEU A CA  1 
ATOM   952  C C   . LEU A 1 159 ? 34.265 59.626 -0.103  1.00 40.21  ? 159 LEU A C   1 
ATOM   953  O O   . LEU A 1 159 ? 33.444 58.707 -0.054  1.00 40.61  ? 159 LEU A O   1 
ATOM   954  C CB  . LEU A 1 159 ? 33.529 61.572 1.253   1.00 37.28  ? 159 LEU A CB  1 
ATOM   955  C CG  . LEU A 1 159 ? 32.861 62.938 1.394   1.00 34.87  ? 159 LEU A CG  1 
ATOM   956  C CD1 . LEU A 1 159 ? 32.994 63.391 2.836   1.00 27.95  ? 159 LEU A CD1 1 
ATOM   957  C CD2 . LEU A 1 159 ? 33.498 63.944 0.437   1.00 31.21  ? 159 LEU A CD2 1 
ATOM   958  N N   . ASP A 1 160 ? 35.583 59.438 -0.121  1.00 41.63  ? 160 ASP A N   1 
ATOM   959  C CA  . ASP A 1 160 ? 36.201 58.108 -0.049  1.00 41.86  ? 160 ASP A CA  1 
ATOM   960  C C   . ASP A 1 160 ? 35.712 57.321 1.159   1.00 41.19  ? 160 ASP A C   1 
ATOM   961  O O   . ASP A 1 160 ? 35.316 56.154 1.053   1.00 38.43  ? 160 ASP A O   1 
ATOM   962  C CB  . ASP A 1 160 ? 37.711 58.250 0.055   1.00 44.49  ? 160 ASP A CB  1 
ATOM   963  C CG  . ASP A 1 160 ? 38.365 58.491 -1.284  1.00 50.46  ? 160 ASP A CG  1 
ATOM   964  O OD1 . ASP A 1 160 ? 37.709 59.074 -2.185  1.00 51.55  ? 160 ASP A OD1 1 
ATOM   965  O OD2 . ASP A 1 160 ? 39.545 58.105 -1.427  1.00 51.67  ? 160 ASP A OD2 1 
ATOM   966  N N   . ILE A 1 161 ? 35.754 57.988 2.307   1.00 40.47  ? 161 ILE A N   1 
ATOM   967  C CA  . ILE A 1 161 ? 35.345 57.417 3.577   1.00 40.52  ? 161 ILE A CA  1 
ATOM   968  C C   . ILE A 1 161 ? 33.976 56.723 3.513   1.00 41.03  ? 161 ILE A C   1 
ATOM   969  O O   . ILE A 1 161 ? 33.695 55.823 4.312   1.00 40.02  ? 161 ILE A O   1 
ATOM   970  C CB  . ILE A 1 161 ? 35.334 58.520 4.651   1.00 41.73  ? 161 ILE A CB  1 
ATOM   971  C CG1 . ILE A 1 161 ? 35.403 57.902 6.042   1.00 42.60  ? 161 ILE A CG1 1 
ATOM   972  C CG2 . ILE A 1 161 ? 34.110 59.386 4.485   1.00 41.46  ? 161 ILE A CG2 1 
ATOM   973  C CD1 . ILE A 1 161 ? 36.669 57.111 6.282   1.00 45.78  ? 161 ILE A CD1 1 
ATOM   974  N N   . TYR A 1 162 ? 33.133 57.131 2.562   1.00 40.02  ? 162 TYR A N   1 
ATOM   975  C CA  . TYR A 1 162 ? 31.810 56.527 2.412   1.00 39.86  ? 162 TYR A CA  1 
ATOM   976  C C   . TYR A 1 162 ? 31.782 55.395 1.376   1.00 42.83  ? 162 TYR A C   1 
ATOM   977  O O   . TYR A 1 162 ? 30.716 54.837 1.079   1.00 42.46  ? 162 TYR A O   1 
ATOM   978  C CB  . TYR A 1 162 ? 30.759 57.582 2.031   1.00 36.43  ? 162 TYR A CB  1 
ATOM   979  C CG  . TYR A 1 162 ? 30.620 58.740 3.002   1.00 34.67  ? 162 TYR A CG  1 
ATOM   980  C CD1 . TYR A 1 162 ? 30.893 58.584 4.363   1.00 37.08  ? 162 TYR A CD1 1 
ATOM   981  C CD2 . TYR A 1 162 ? 30.215 59.992 2.559   1.00 34.00  ? 162 TYR A CD2 1 
ATOM   982  C CE1 . TYR A 1 162 ? 30.772 59.654 5.256   1.00 34.76  ? 162 TYR A CE1 1 
ATOM   983  C CE2 . TYR A 1 162 ? 30.088 61.060 3.438   1.00 33.96  ? 162 TYR A CE2 1 
ATOM   984  C CZ  . TYR A 1 162 ? 30.369 60.885 4.779   1.00 35.48  ? 162 TYR A CZ  1 
ATOM   985  O OH  . TYR A 1 162 ? 30.263 61.952 5.637   1.00 36.84  ? 162 TYR A OH  1 
ATOM   986  N N   . ASN A 1 163 ? 32.939 55.050 0.818   1.00 43.67  ? 163 ASN A N   1 
ATOM   987  C CA  . ASN A 1 163 ? 32.964 53.976 -0.159  1.00 43.97  ? 163 ASN A CA  1 
ATOM   988  C C   . ASN A 1 163 ? 32.410 52.711 0.486   1.00 43.81  ? 163 ASN A C   1 
ATOM   989  O O   . ASN A 1 163 ? 32.902 52.258 1.525   1.00 42.76  ? 163 ASN A O   1 
ATOM   990  C CB  . ASN A 1 163 ? 34.383 53.730 -0.655  1.00 47.02  ? 163 ASN A CB  1 
ATOM   991  C CG  . ASN A 1 163 ? 34.485 52.487 -1.504  1.00 48.24  ? 163 ASN A CG  1 
ATOM   992  O OD1 . ASN A 1 163 ? 33.739 52.313 -2.468  1.00 49.81  ? 163 ASN A OD1 1 
ATOM   993  N ND2 . ASN A 1 163 ? 35.412 51.608 -1.149  1.00 53.75  ? 163 ASN A ND2 1 
ATOM   994  N N   . ALA A 1 164 ? 31.379 52.150 -0.136  1.00 43.47  ? 164 ALA A N   1 
ATOM   995  C CA  . ALA A 1 164 ? 30.730 50.947 0.375   1.00 42.20  ? 164 ALA A CA  1 
ATOM   996  C C   . ALA A 1 164 ? 31.184 49.657 -0.294  1.00 42.77  ? 164 ALA A C   1 
ATOM   997  O O   . ALA A 1 164 ? 30.453 48.659 -0.258  1.00 42.83  ? 164 ALA A O   1 
ATOM   998  C CB  . ALA A 1 164 ? 29.220 51.079 0.236   1.00 40.49  ? 164 ALA A CB  1 
ATOM   999  N N   . ASP A 1 165 ? 32.365 49.664 -0.916  1.00 42.40  ? 165 ASP A N   1 
ATOM   1000 C CA  . ASP A 1 165 ? 32.864 48.449 -1.563  1.00 41.33  ? 165 ASP A CA  1 
ATOM   1001 C C   . ASP A 1 165 ? 32.958 47.337 -0.528  1.00 40.36  ? 165 ASP A C   1 
ATOM   1002 O O   . ASP A 1 165 ? 32.254 46.320 -0.611  1.00 37.14  ? 165 ASP A O   1 
ATOM   1003 C CB  . ASP A 1 165 ? 34.247 48.677 -2.162  1.00 42.91  ? 165 ASP A CB  1 
ATOM   1004 C CG  . ASP A 1 165 ? 34.204 49.467 -3.451  1.00 47.07  ? 165 ASP A CG  1 
ATOM   1005 O OD1 . ASP A 1 165 ? 33.092 49.728 -3.958  1.00 49.53  ? 165 ASP A OD1 1 
ATOM   1006 O OD2 . ASP A 1 165 ? 35.287 49.825 -3.959  1.00 46.46  ? 165 ASP A OD2 1 
ATOM   1007 N N   . ILE A 1 166 ? 33.823 47.550 0.462   1.00 39.20  ? 166 ILE A N   1 
ATOM   1008 C CA  . ILE A 1 166 ? 34.026 46.560 1.513   1.00 38.18  ? 166 ILE A CA  1 
ATOM   1009 C C   . ILE A 1 166 ? 32.732 46.109 2.163   1.00 37.72  ? 166 ILE A C   1 
ATOM   1010 O O   . ILE A 1 166 ? 32.508 44.914 2.316   1.00 39.51  ? 166 ILE A O   1 
ATOM   1011 C CB  . ILE A 1 166 ? 34.996 47.083 2.608   1.00 37.13  ? 166 ILE A CB  1 
ATOM   1012 C CG1 . ILE A 1 166 ? 36.393 47.255 2.002   1.00 34.21  ? 166 ILE A CG1 1 
ATOM   1013 C CG2 . ILE A 1 166 ? 35.028 46.114 3.804   1.00 31.39  ? 166 ILE A CG2 1 
ATOM   1014 C CD1 . ILE A 1 166 ? 37.294 48.208 2.756   1.00 34.99  ? 166 ILE A CD1 1 
ATOM   1015 N N   . MET A 1 167 ? 31.873 47.054 2.527   1.00 36.27  ? 167 MET A N   1 
ATOM   1016 C CA  . MET A 1 167 ? 30.626 46.700 3.181   1.00 35.89  ? 167 MET A CA  1 
ATOM   1017 C C   . MET A 1 167 ? 29.760 45.787 2.327   1.00 36.60  ? 167 MET A C   1 
ATOM   1018 O O   . MET A 1 167 ? 29.290 44.751 2.798   1.00 36.68  ? 167 MET A O   1 
ATOM   1019 C CB  . MET A 1 167 ? 29.839 47.958 3.553   1.00 36.92  ? 167 MET A CB  1 
ATOM   1020 C CG  . MET A 1 167 ? 28.540 47.673 4.330   1.00 38.72  ? 167 MET A CG  1 
ATOM   1021 S SD  . MET A 1 167 ? 27.569 49.142 4.763   1.00 38.14  ? 167 MET A SD  1 
ATOM   1022 C CE  . MET A 1 167 ? 28.242 49.532 6.421   1.00 32.04  ? 167 MET A CE  1 
ATOM   1023 N N   . ALA A 1 168 ? 29.541 46.168 1.075   1.00 36.85  ? 168 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 168 ? 28.718 45.350 0.191   1.00 38.11  ? 168 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 168 ? 29.282 43.934 0.109   1.00 39.19  ? 168 ALA A C   1 
ATOM   1026 O O   . ALA A 1 168 ? 28.587 42.958 0.396   1.00 39.31  ? 168 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 168 ? 28.660 45.968 -1.202  1.00 35.95  ? 168 ALA A CB  1 
ATOM   1028 N N   . ALA A 1 169 ? 30.552 43.837 -0.273  1.00 40.30  ? 169 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 169 ? 31.241 42.555 -0.427  1.00 40.56  ? 169 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 169 ? 31.249 41.682 0.821   1.00 41.37  ? 169 ALA A C   1 
ATOM   1031 O O   . ALA A 1 169 ? 30.638 40.611 0.839   1.00 41.65  ? 169 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 169 ? 32.661 42.799 -0.879  1.00 39.50  ? 169 ALA A CB  1 
ATOM   1033 N N   . VAL A 1 170 ? 31.960 42.144 1.850   1.00 41.19  ? 170 VAL A N   1 
ATOM   1034 C CA  . VAL A 1 170 ? 32.091 41.434 3.124   1.00 40.27  ? 170 VAL A CA  1 
ATOM   1035 C C   . VAL A 1 170 ? 30.771 41.083 3.797   1.00 41.40  ? 170 VAL A C   1 
ATOM   1036 O O   . VAL A 1 170 ? 30.644 40.009 4.378   1.00 40.52  ? 170 VAL A O   1 
ATOM   1037 C CB  . VAL A 1 170 ? 32.906 42.256 4.135   1.00 39.81  ? 170 VAL A CB  1 
ATOM   1038 C CG1 . VAL A 1 170 ? 33.049 41.490 5.438   1.00 39.14  ? 170 VAL A CG1 1 
ATOM   1039 C CG2 . VAL A 1 170 ? 34.261 42.588 3.560   1.00 42.52  ? 170 VAL A CG2 1 
ATOM   1040 N N   . GLY A 1 171 ? 29.808 42.004 3.742   1.00 42.74  ? 171 GLY A N   1 
ATOM   1041 C CA  . GLY A 1 171 ? 28.512 41.775 4.356   1.00 45.19  ? 171 GLY A CA  1 
ATOM   1042 C C   . GLY A 1 171 ? 27.558 41.099 3.389   1.00 47.05  ? 171 GLY A C   1 
ATOM   1043 O O   . GLY A 1 171 ? 26.552 40.480 3.780   1.00 47.10  ? 171 GLY A O   1 
ATOM   1044 N N   . ASN A 1 172 ? 27.890 41.211 2.109   1.00 47.32  ? 172 ASN A N   1 
ATOM   1045 C CA  . ASN A 1 172 ? 27.080 40.626 1.048   1.00 47.75  ? 172 ASN A CA  1 
ATOM   1046 C C   . ASN A 1 172 ? 25.698 41.250 1.099   1.00 45.41  ? 172 ASN A C   1 
ATOM   1047 O O   . ASN A 1 172 ? 24.704 40.575 1.359   1.00 44.04  ? 172 ASN A O   1 
ATOM   1048 C CB  . ASN A 1 172 ? 26.957 39.107 1.217   1.00 48.32  ? 172 ASN A CB  1 
ATOM   1049 C CG  . ASN A 1 172 ? 26.330 38.449 0.010   1.00 49.98  ? 172 ASN A CG  1 
ATOM   1050 O OD1 . ASN A 1 172 ? 25.649 37.420 0.120   1.00 50.12  ? 172 ASN A OD1 1 
ATOM   1051 N ND2 . ASN A 1 172 ? 26.561 39.039 -1.162  1.00 50.40  ? 172 ASN A ND2 1 
ATOM   1052 N N   . VAL A 1 173 ? 25.647 42.553 0.859   1.00 44.75  ? 173 VAL A N   1 
ATOM   1053 C CA  . VAL A 1 173 ? 24.389 43.276 0.872   1.00 43.73  ? 173 VAL A CA  1 
ATOM   1054 C C   . VAL A 1 173 ? 24.447 44.434 -0.095  1.00 43.01  ? 173 VAL A C   1 
ATOM   1055 O O   . VAL A 1 173 ? 25.519 44.822 -0.551  1.00 42.92  ? 173 VAL A O   1 
ATOM   1056 C CB  . VAL A 1 173 ? 24.083 43.864 2.258   1.00 42.83  ? 173 VAL A CB  1 
ATOM   1057 C CG1 . VAL A 1 173 ? 23.746 42.756 3.253   1.00 43.17  ? 173 VAL A CG1 1 
ATOM   1058 C CG2 . VAL A 1 173 ? 25.273 44.669 2.729   1.00 41.34  ? 173 VAL A CG2 1 
ATOM   1059 N N   . ILE A 1 174 ? 23.277 44.982 -0.401  1.00 43.54  ? 174 ILE A N   1 
ATOM   1060 C CA  . ILE A 1 174 ? 23.178 46.129 -1.281  1.00 41.88  ? 174 ILE A CA  1 
ATOM   1061 C C   . ILE A 1 174 ? 23.360 47.335 -0.375  1.00 40.61  ? 174 ILE A C   1 
ATOM   1062 O O   . ILE A 1 174 ? 22.836 47.347 0.738   1.00 39.92  ? 174 ILE A O   1 
ATOM   1063 C CB  . ILE A 1 174 ? 21.790 46.224 -1.923  1.00 42.89  ? 174 ILE A CB  1 
ATOM   1064 C CG1 . ILE A 1 174 ? 21.561 45.029 -2.849  1.00 44.41  ? 174 ILE A CG1 1 
ATOM   1065 C CG2 . ILE A 1 174 ? 21.657 47.541 -2.665  1.00 40.61  ? 174 ILE A CG2 1 
ATOM   1066 C CD1 . ILE A 1 174 ? 22.473 45.000 -4.046  1.00 47.15  ? 174 ILE A CD1 1 
ATOM   1067 N N   . VAL A 1 175 ? 24.122 48.320 -0.850  1.00 39.19  ? 175 VAL A N   1 
ATOM   1068 C CA  . VAL A 1 175 ? 24.379 49.571 -0.132  1.00 35.76  ? 175 VAL A CA  1 
ATOM   1069 C C   . VAL A 1 175 ? 24.271 50.740 -1.125  1.00 35.85  ? 175 VAL A C   1 
ATOM   1070 O O   . VAL A 1 175 ? 24.987 50.783 -2.129  1.00 37.20  ? 175 VAL A O   1 
ATOM   1071 C CB  . VAL A 1 175 ? 25.805 49.622 0.478   1.00 33.29  ? 175 VAL A CB  1 
ATOM   1072 C CG1 . VAL A 1 175 ? 26.049 50.988 1.085   1.00 32.58  ? 175 VAL A CG1 1 
ATOM   1073 C CG2 . VAL A 1 175 ? 25.976 48.560 1.532   1.00 31.88  ? 175 VAL A CG2 1 
ATOM   1074 N N   . ALA A 1 176 ? 23.383 51.691 -0.860  1.00 33.84  ? 176 ALA A N   1 
ATOM   1075 C CA  . ALA A 1 176 ? 23.253 52.829 -1.757  1.00 31.47  ? 176 ALA A CA  1 
ATOM   1076 C C   . ALA A 1 176 ? 23.476 54.146 -1.020  1.00 32.19  ? 176 ALA A C   1 
ATOM   1077 O O   . ALA A 1 176 ? 23.320 54.215 0.196   1.00 34.50  ? 176 ALA A O   1 
ATOM   1078 C CB  . ALA A 1 176 ? 21.896 52.814 -2.401  1.00 25.43  ? 176 ALA A CB  1 
ATOM   1079 N N   . SER A 1 177 ? 23.870 55.183 -1.758  1.00 33.09  ? 177 SER A N   1 
ATOM   1080 C CA  . SER A 1 177 ? 24.093 56.518 -1.194  1.00 32.91  ? 177 SER A CA  1 
ATOM   1081 C C   . SER A 1 177 ? 23.632 57.512 -2.237  1.00 33.17  ? 177 SER A C   1 
ATOM   1082 O O   . SER A 1 177 ? 23.380 57.125 -3.376  1.00 35.54  ? 177 SER A O   1 
ATOM   1083 C CB  . SER A 1 177 ? 25.570 56.756 -0.877  1.00 30.46  ? 177 SER A CB  1 
ATOM   1084 O OG  . SER A 1 177 ? 26.362 56.555 -2.022  1.00 30.98  ? 177 SER A OG  1 
ATOM   1085 N N   . PHE A 1 178 ? 23.517 58.786 -1.863  1.00 33.16  ? 178 PHE A N   1 
ATOM   1086 C CA  . PHE A 1 178 ? 23.047 59.806 -2.806  1.00 31.04  ? 178 PHE A CA  1 
ATOM   1087 C C   . PHE A 1 178 ? 23.258 61.219 -2.291  1.00 30.22  ? 178 PHE A C   1 
ATOM   1088 O O   . PHE A 1 178 ? 23.471 61.429 -1.103  1.00 32.37  ? 178 PHE A O   1 
ATOM   1089 C CB  . PHE A 1 178 ? 21.555 59.602 -3.071  1.00 28.36  ? 178 PHE A CB  1 
ATOM   1090 C CG  . PHE A 1 178 ? 20.710 59.707 -1.833  1.00 29.40  ? 178 PHE A CG  1 
ATOM   1091 C CD1 . PHE A 1 178 ? 20.315 60.954 -1.341  1.00 30.91  ? 178 PHE A CD1 1 
ATOM   1092 C CD2 . PHE A 1 178 ? 20.382 58.571 -1.105  1.00 30.46  ? 178 PHE A CD2 1 
ATOM   1093 C CE1 . PHE A 1 178 ? 19.621 61.063 -0.145  1.00 28.67  ? 178 PHE A CE1 1 
ATOM   1094 C CE2 . PHE A 1 178 ? 19.688 58.672 0.096   1.00 30.55  ? 178 PHE A CE2 1 
ATOM   1095 C CZ  . PHE A 1 178 ? 19.310 59.919 0.576   1.00 30.10  ? 178 PHE A CZ  1 
ATOM   1096 N N   . GLN A 1 179 ? 23.200 62.190 -3.189  1.00 29.54  ? 179 GLN A N   1 
ATOM   1097 C CA  . GLN A 1 179 ? 23.328 63.584 -2.783  1.00 31.31  ? 179 GLN A CA  1 
ATOM   1098 C C   . GLN A 1 179 ? 21.929 64.158 -2.540  1.00 29.03  ? 179 GLN A C   1 
ATOM   1099 O O   . GLN A 1 179 ? 20.972 63.785 -3.214  1.00 25.79  ? 179 GLN A O   1 
ATOM   1100 C CB  . GLN A 1 179 ? 23.991 64.421 -3.887  1.00 34.26  ? 179 GLN A CB  1 
ATOM   1101 C CG  . GLN A 1 179 ? 25.338 63.914 -4.364  1.00 34.16  ? 179 GLN A CG  1 
ATOM   1102 C CD  . GLN A 1 179 ? 26.400 64.078 -3.319  1.00 33.35  ? 179 GLN A CD  1 
ATOM   1103 O OE1 . GLN A 1 179 ? 27.485 64.592 -3.595  1.00 33.90  ? 179 GLN A OE1 1 
ATOM   1104 N NE2 . GLN A 1 179 ? 26.099 63.647 -2.104  1.00 31.84  ? 179 GLN A NE2 1 
ATOM   1105 N N   . TYR A 1 180 ? 21.823 65.047 -1.557  1.00 30.69  ? 180 TYR A N   1 
ATOM   1106 C CA  . TYR A 1 180 ? 20.578 65.755 -1.255  1.00 27.84  ? 180 TYR A CA  1 
ATOM   1107 C C   . TYR A 1 180 ? 21.001 67.211 -1.046  1.00 28.78  ? 180 TYR A C   1 
ATOM   1108 O O   . TYR A 1 180 ? 22.083 67.486 -0.527  1.00 28.15  ? 180 TYR A O   1 
ATOM   1109 C CB  . TYR A 1 180 ? 19.883 65.201 -0.012  1.00 25.15  ? 180 TYR A CB  1 
ATOM   1110 C CG  . TYR A 1 180 ? 20.646 65.350 1.278   1.00 26.66  ? 180 TYR A CG  1 
ATOM   1111 C CD1 . TYR A 1 180 ? 21.597 64.406 1.662   1.00 27.16  ? 180 TYR A CD1 1 
ATOM   1112 C CD2 . TYR A 1 180 ? 20.407 66.427 2.128   1.00 26.22  ? 180 TYR A CD2 1 
ATOM   1113 C CE1 . TYR A 1 180 ? 22.296 64.530 2.870   1.00 26.82  ? 180 TYR A CE1 1 
ATOM   1114 C CE2 . TYR A 1 180 ? 21.096 66.561 3.329   1.00 27.05  ? 180 TYR A CE2 1 
ATOM   1115 C CZ  . TYR A 1 180 ? 22.041 65.607 3.694   1.00 25.78  ? 180 TYR A CZ  1 
ATOM   1116 O OH  . TYR A 1 180 ? 22.736 65.736 4.870   1.00 21.00  ? 180 TYR A OH  1 
ATOM   1117 N N   . ARG A 1 181 ? 20.163 68.147 -1.469  1.00 31.08  ? 181 ARG A N   1 
ATOM   1118 C CA  . ARG A 1 181 ? 20.503 69.561 -1.346  1.00 31.22  ? 181 ARG A CA  1 
ATOM   1119 C C   . ARG A 1 181 ? 20.770 70.046 0.078   1.00 31.31  ? 181 ARG A C   1 
ATOM   1120 O O   . ARG A 1 181 ? 20.040 69.705 1.004   1.00 33.70  ? 181 ARG A O   1 
ATOM   1121 C CB  . ARG A 1 181 ? 19.407 70.402 -2.003  1.00 31.61  ? 181 ARG A CB  1 
ATOM   1122 C CG  . ARG A 1 181 ? 19.502 70.455 -3.527  1.00 31.21  ? 181 ARG A CG  1 
ATOM   1123 C CD  . ARG A 1 181 ? 18.306 71.166 -4.153  1.00 36.47  ? 181 ARG A CD  1 
ATOM   1124 N NE  . ARG A 1 181 ? 17.074 70.370 -4.068  1.00 39.71  ? 181 ARG A NE  1 
ATOM   1125 C CZ  . ARG A 1 181 ? 15.868 70.808 -4.428  1.00 39.91  ? 181 ARG A CZ  1 
ATOM   1126 N NH1 . ARG A 1 181 ? 15.722 72.043 -4.894  1.00 38.67  ? 181 ARG A NH1 1 
ATOM   1127 N NH2 . ARG A 1 181 ? 14.811 70.006 -4.343  1.00 40.65  ? 181 ARG A NH2 1 
ATOM   1128 N N   . VAL A 1 182 ? 21.837 70.827 0.243   1.00 32.27  ? 182 VAL A N   1 
ATOM   1129 C CA  . VAL A 1 182 ? 22.217 71.384 1.547   1.00 31.89  ? 182 VAL A CA  1 
ATOM   1130 C C   . VAL A 1 182 ? 22.263 72.910 1.470   1.00 33.41  ? 182 VAL A C   1 
ATOM   1131 O O   . VAL A 1 182 ? 22.307 73.485 0.382   1.00 33.77  ? 182 VAL A O   1 
ATOM   1132 C CB  . VAL A 1 182 ? 23.603 70.875 2.020   1.00 28.77  ? 182 VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 182 ? 23.531 69.401 2.354   1.00 26.74  ? 182 VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 182 ? 24.634 71.117 0.953   1.00 24.77  ? 182 VAL A CG2 1 
ATOM   1135 N N   . GLY A 1 183 ? 22.256 73.566 2.625   1.00 34.98  ? 183 GLY A N   1 
ATOM   1136 C CA  . GLY A 1 183 ? 22.273 75.019 2.639   1.00 36.07  ? 183 GLY A CA  1 
ATOM   1137 C C   . GLY A 1 183 ? 20.951 75.615 2.180   1.00 37.62  ? 183 GLY A C   1 
ATOM   1138 O O   . GLY A 1 183 ? 19.921 74.927 2.126   1.00 37.74  ? 183 GLY A O   1 
ATOM   1139 N N   . ALA A 1 184 ? 20.976 76.903 1.845   1.00 38.70  ? 184 ALA A N   1 
ATOM   1140 C CA  . ALA A 1 184 ? 19.778 77.605 1.389   1.00 37.85  ? 184 ALA A CA  1 
ATOM   1141 C C   . ALA A 1 184 ? 19.155 76.892 0.195   1.00 38.70  ? 184 ALA A C   1 
ATOM   1142 O O   . ALA A 1 184 ? 17.956 77.001 -0.054  1.00 39.23  ? 184 ALA A O   1 
ATOM   1143 C CB  . ALA A 1 184 ? 20.123 79.021 1.014   1.00 36.87  ? 184 ALA A CB  1 
ATOM   1144 N N   . PHE A 1 185 ? 19.977 76.156 -0.543  1.00 38.39  ? 185 PHE A N   1 
ATOM   1145 C CA  . PHE A 1 185 ? 19.495 75.429 -1.708  1.00 38.68  ? 185 PHE A CA  1 
ATOM   1146 C C   . PHE A 1 185 ? 18.490 74.354 -1.299  1.00 39.31  ? 185 PHE A C   1 
ATOM   1147 O O   . PHE A 1 185 ? 17.520 74.092 -2.017  1.00 40.18  ? 185 PHE A O   1 
ATOM   1148 C CB  . PHE A 1 185 ? 20.672 74.791 -2.446  1.00 36.85  ? 185 PHE A CB  1 
ATOM   1149 C CG  . PHE A 1 185 ? 21.725 75.771 -2.854  1.00 37.52  ? 185 PHE A CG  1 
ATOM   1150 C CD1 . PHE A 1 185 ? 21.541 76.583 -3.962  1.00 38.01  ? 185 PHE A CD1 1 
ATOM   1151 C CD2 . PHE A 1 185 ? 22.906 75.893 -2.120  1.00 40.09  ? 185 PHE A CD2 1 
ATOM   1152 C CE1 . PHE A 1 185 ? 22.519 77.507 -4.340  1.00 39.57  ? 185 PHE A CE1 1 
ATOM   1153 C CE2 . PHE A 1 185 ? 23.895 76.818 -2.491  1.00 41.71  ? 185 PHE A CE2 1 
ATOM   1154 C CZ  . PHE A 1 185 ? 23.699 77.623 -3.603  1.00 40.13  ? 185 PHE A CZ  1 
ATOM   1155 N N   . GLY A 1 186 ? 18.714 73.742 -0.139  1.00 39.06  ? 186 GLY A N   1 
ATOM   1156 C CA  . GLY A 1 186 ? 17.816 72.700 0.315   1.00 36.47  ? 186 GLY A CA  1 
ATOM   1157 C C   . GLY A 1 186 ? 16.884 73.101 1.436   1.00 36.80  ? 186 GLY A C   1 
ATOM   1158 O O   . GLY A 1 186 ? 15.923 72.356 1.738   1.00 36.39  ? 186 GLY A O   1 
ATOM   1159 N N   . PHE A 1 187 ? 17.128 74.266 2.044   1.00 32.70  ? 187 PHE A N   1 
ATOM   1160 C CA  . PHE A 1 187 ? 16.287 74.673 3.164   1.00 32.69  ? 187 PHE A CA  1 
ATOM   1161 C C   . PHE A 1 187 ? 15.787 76.111 3.190   1.00 33.88  ? 187 PHE A C   1 
ATOM   1162 O O   . PHE A 1 187 ? 15.507 76.642 4.271   1.00 34.46  ? 187 PHE A O   1 
ATOM   1163 C CB  . PHE A 1 187 ? 17.001 74.347 4.495   1.00 28.18  ? 187 PHE A CB  1 
ATOM   1164 C CG  . PHE A 1 187 ? 17.298 72.881 4.669   1.00 26.95  ? 187 PHE A CG  1 
ATOM   1165 C CD1 . PHE A 1 187 ? 16.352 72.031 5.223   1.00 25.26  ? 187 PHE A CD1 1 
ATOM   1166 C CD2 . PHE A 1 187 ? 18.478 72.332 4.180   1.00 25.33  ? 187 PHE A CD2 1 
ATOM   1167 C CE1 . PHE A 1 187 ? 16.579 70.676 5.280   1.00 26.03  ? 187 PHE A CE1 1 
ATOM   1168 C CE2 . PHE A 1 187 ? 18.706 70.976 4.238   1.00 23.71  ? 187 PHE A CE2 1 
ATOM   1169 C CZ  . PHE A 1 187 ? 17.759 70.147 4.786   1.00 24.60  ? 187 PHE A CZ  1 
ATOM   1170 N N   . LEU A 1 188 ? 15.633 76.743 2.028   1.00 34.56  ? 188 LEU A N   1 
ATOM   1171 C CA  . LEU A 1 188 ? 15.152 78.120 1.997   1.00 34.19  ? 188 LEU A CA  1 
ATOM   1172 C C   . LEU A 1 188 ? 13.674 78.054 2.280   1.00 34.55  ? 188 LEU A C   1 
ATOM   1173 O O   . LEU A 1 188 ? 12.934 77.458 1.510   1.00 35.65  ? 188 LEU A O   1 
ATOM   1174 C CB  . LEU A 1 188 ? 15.406 78.770 0.630   1.00 35.40  ? 188 LEU A CB  1 
ATOM   1175 C CG  . LEU A 1 188 ? 14.760 80.133 0.447   1.00 36.54  ? 188 LEU A CG  1 
ATOM   1176 C CD1 . LEU A 1 188 ? 15.118 81.009 1.635   1.00 36.60  ? 188 LEU A CD1 1 
ATOM   1177 C CD2 . LEU A 1 188 ? 15.217 80.750 -0.881  1.00 37.05  ? 188 LEU A CD2 1 
ATOM   1178 N N   . HIS A 1 189 ? 13.261 78.662 3.392   1.00 36.00  ? 189 HIS A N   1 
ATOM   1179 C CA  . HIS A 1 189 ? 11.863 78.669 3.836   1.00 38.08  ? 189 HIS A CA  1 
ATOM   1180 C C   . HIS A 1 189 ? 11.278 80.092 3.817   1.00 40.35  ? 189 HIS A C   1 
ATOM   1181 O O   . HIS A 1 189 ? 11.707 80.942 4.597   1.00 44.37  ? 189 HIS A O   1 
ATOM   1182 C CB  . HIS A 1 189 ? 11.814 78.085 5.253   1.00 36.96  ? 189 HIS A CB  1 
ATOM   1183 C CG  . HIS A 1 189 ? 10.438 77.905 5.809   1.00 39.04  ? 189 HIS A CG  1 
ATOM   1184 N ND1 . HIS A 1 189 ? 9.536  76.999 5.291   1.00 39.14  ? 189 HIS A ND1 1 
ATOM   1185 C CD2 . HIS A 1 189 ? 9.827  78.470 6.882   1.00 39.69  ? 189 HIS A CD2 1 
ATOM   1186 C CE1 . HIS A 1 189 ? 8.433  77.011 6.024   1.00 37.27  ? 189 HIS A CE1 1 
ATOM   1187 N NE2 . HIS A 1 189 ? 8.583  77.894 6.996   1.00 34.50  ? 189 HIS A NE2 1 
ATOM   1188 N N   . LEU A 1 190 ? 10.318 80.343 2.920   1.00 40.25  ? 190 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 190 ? 9.683  81.652 2.794   1.00 40.26  ? 190 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 190 ? 8.173  81.533 2.589   1.00 40.82  ? 190 LEU A C   1 
ATOM   1191 O O   . LEU A 1 190 ? 7.468  82.533 2.563   1.00 42.87  ? 190 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 190 ? 10.307 82.413 1.624   1.00 39.15  ? 190 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 190 ? 11.830 82.488 1.600   1.00 40.63  ? 190 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 190 ? 12.298 82.966 0.235   1.00 37.63  ? 190 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 190 ? 12.315 83.398 2.711   1.00 38.38  ? 190 LEU A CD2 1 
ATOM   1196 N N   . ALA A 1 191 ? 7.682  80.306 2.460   1.00 42.42  ? 191 ALA A N   1 
ATOM   1197 C CA  . ALA A 1 191 ? 6.258  80.047 2.249   1.00 44.19  ? 191 ALA A CA  1 
ATOM   1198 C C   . ALA A 1 191 ? 5.324  80.917 3.087   1.00 46.61  ? 191 ALA A C   1 
ATOM   1199 O O   . ALA A 1 191 ? 4.363  81.477 2.570   1.00 48.89  ? 191 ALA A O   1 
ATOM   1200 C CB  . ALA A 1 191 ? 5.959  78.582 2.511   1.00 42.58  ? 191 ALA A CB  1 
ATOM   1201 N N   . PRO A 1 192 ? 5.594  81.037 4.394   1.00 47.64  ? 192 PRO A N   1 
ATOM   1202 C CA  . PRO A 1 192 ? 4.758  81.846 5.282   1.00 47.81  ? 192 PRO A CA  1 
ATOM   1203 C C   . PRO A 1 192 ? 4.627  83.337 4.897   1.00 49.91  ? 192 PRO A C   1 
ATOM   1204 O O   . PRO A 1 192 ? 3.582  83.945 5.117   1.00 49.65  ? 192 PRO A O   1 
ATOM   1205 C CB  . PRO A 1 192 ? 5.433  81.651 6.635   1.00 46.46  ? 192 PRO A CB  1 
ATOM   1206 C CG  . PRO A 1 192 ? 5.990  80.262 6.535   1.00 46.31  ? 192 PRO A CG  1 
ATOM   1207 C CD  . PRO A 1 192 ? 6.596  80.277 5.167   1.00 46.73  ? 192 PRO A CD  1 
ATOM   1208 N N   . GLU A 1 193 ? 5.687  83.917 4.337   1.00 51.15  ? 193 GLU A N   1 
ATOM   1209 C CA  . GLU A 1 193 ? 5.691  85.324 3.939   1.00 52.05  ? 193 GLU A CA  1 
ATOM   1210 C C   . GLU A 1 193 ? 4.932  85.605 2.658   1.00 52.10  ? 193 GLU A C   1 
ATOM   1211 O O   . GLU A 1 193 ? 4.739  86.763 2.308   1.00 53.68  ? 193 GLU A O   1 
ATOM   1212 C CB  . GLU A 1 193 ? 7.119  85.824 3.726   1.00 53.70  ? 193 GLU A CB  1 
ATOM   1213 C CG  . GLU A 1 193 ? 7.883  86.160 4.986   1.00 57.26  ? 193 GLU A CG  1 
ATOM   1214 C CD  . GLU A 1 193 ? 7.348  87.392 5.689   1.00 58.11  ? 193 GLU A CD  1 
ATOM   1215 O OE1 . GLU A 1 193 ? 7.261  88.470 5.053   1.00 55.66  ? 193 GLU A OE1 1 
ATOM   1216 O OE2 . GLU A 1 193 ? 7.024  87.276 6.888   1.00 59.93  ? 193 GLU A OE2 1 
ATOM   1217 N N   . MET A 1 194 ? 4.514  84.566 1.945   1.00 50.92  ? 194 MET A N   1 
ATOM   1218 C CA  . MET A 1 194 ? 3.814  84.777 0.682   1.00 49.52  ? 194 MET A CA  1 
ATOM   1219 C C   . MET A 1 194 ? 2.395  84.257 0.730   1.00 49.09  ? 194 MET A C   1 
ATOM   1220 O O   . MET A 1 194 ? 1.999  83.607 1.696   1.00 49.91  ? 194 MET A O   1 
ATOM   1221 C CB  . MET A 1 194 ? 4.565  84.071 -0.446  1.00 48.97  ? 194 MET A CB  1 
ATOM   1222 C CG  . MET A 1 194 ? 6.043  84.384 -0.485  1.00 49.91  ? 194 MET A CG  1 
ATOM   1223 S SD  . MET A 1 194 ? 6.916  83.377 -1.689  1.00 52.29  ? 194 MET A SD  1 
ATOM   1224 C CE  . MET A 1 194 ? 7.506  82.036 -0.638  1.00 55.14  ? 194 MET A CE  1 
ATOM   1225 N N   . PRO A 1 195 ? 1.598  84.554 -0.310  1.00 48.84  ? 195 PRO A N   1 
ATOM   1226 C CA  . PRO A 1 195 ? 0.209  84.080 -0.345  1.00 47.50  ? 195 PRO A CA  1 
ATOM   1227 C C   . PRO A 1 195 ? 0.172  82.620 -0.787  1.00 46.40  ? 195 PRO A C   1 
ATOM   1228 O O   . PRO A 1 195 ? 1.064  82.156 -1.497  1.00 46.32  ? 195 PRO A O   1 
ATOM   1229 C CB  . PRO A 1 195 ? -0.454 85.005 -1.370  1.00 47.40  ? 195 PRO A CB  1 
ATOM   1230 C CG  . PRO A 1 195 ? 0.409  86.235 -1.342  1.00 48.18  ? 195 PRO A CG  1 
ATOM   1231 C CD  . PRO A 1 195 ? 1.792  85.651 -1.274  1.00 49.38  ? 195 PRO A CD  1 
ATOM   1232 N N   . SER A 1 196 ? -0.874 81.914 -0.372  1.00 46.98  ? 196 SER A N   1 
ATOM   1233 C CA  . SER A 1 196 ? -1.075 80.501 -0.688  1.00 46.60  ? 196 SER A CA  1 
ATOM   1234 C C   . SER A 1 196 ? -0.731 80.144 -2.120  1.00 46.19  ? 196 SER A C   1 
ATOM   1235 O O   . SER A 1 196 ? -0.164 79.092 -2.396  1.00 47.10  ? 196 SER A O   1 
ATOM   1236 C CB  . SER A 1 196 ? -2.523 80.128 -0.411  1.00 47.84  ? 196 SER A CB  1 
ATOM   1237 O OG  . SER A 1 196 ? -2.880 80.541 0.897   1.00 52.52  ? 196 SER A OG  1 
ATOM   1238 N N   . GLU A 1 197 ? -1.089 81.027 -3.034  1.00 46.22  ? 197 GLU A N   1 
ATOM   1239 C CA  . GLU A 1 197 ? -0.815 80.810 -4.438  1.00 45.73  ? 197 GLU A CA  1 
ATOM   1240 C C   . GLU A 1 197 ? 0.635  80.386 -4.644  1.00 45.93  ? 197 GLU A C   1 
ATOM   1241 O O   . GLU A 1 197 ? 0.906  79.462 -5.409  1.00 46.97  ? 197 GLU A O   1 
ATOM   1242 C CB  . GLU A 1 197 ? -1.083 82.099 -5.214  1.00 46.68  ? 197 GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 197 ? -0.890 81.989 -6.711  1.00 51.21  ? 197 GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 197 ? -1.040 83.327 -7.422  1.00 54.26  ? 197 GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 197 ? -1.648 84.249 -6.822  1.00 57.88  ? 197 GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 197 ? -0.564 83.448 -8.578  1.00 51.30  ? 197 GLU A OE2 1 
ATOM   1247 N N   . PHE A 1 198 ? 1.557  81.053 -3.947  1.00 44.68  ? 198 PHE A N   1 
ATOM   1248 C CA  . PHE A 1 198 ? 2.992  80.794 -4.092  1.00 42.16  ? 198 PHE A CA  1 
ATOM   1249 C C   . PHE A 1 198 ? 3.610  79.856 -3.062  1.00 42.13  ? 198 PHE A C   1 
ATOM   1250 O O   . PHE A 1 198 ? 4.831  79.846 -2.887  1.00 41.91  ? 198 PHE A O   1 
ATOM   1251 C CB  . PHE A 1 198 ? 3.768  82.115 -4.066  1.00 39.92  ? 198 PHE A CB  1 
ATOM   1252 C CG  . PHE A 1 198 ? 3.213  83.171 -4.979  1.00 38.34  ? 198 PHE A CG  1 
ATOM   1253 C CD1 . PHE A 1 198 ? 2.081  83.893 -4.625  1.00 39.45  ? 198 PHE A CD1 1 
ATOM   1254 C CD2 . PHE A 1 198 ? 3.819  83.445 -6.198  1.00 40.40  ? 198 PHE A CD2 1 
ATOM   1255 C CE1 . PHE A 1 198 ? 1.560  84.872 -5.469  1.00 38.06  ? 198 PHE A CE1 1 
ATOM   1256 C CE2 . PHE A 1 198 ? 3.302  84.427 -7.051  1.00 40.18  ? 198 PHE A CE2 1 
ATOM   1257 C CZ  . PHE A 1 198 ? 2.171  85.138 -6.681  1.00 39.19  ? 198 PHE A CZ  1 
ATOM   1258 N N   . ALA A 1 199 ? 2.777  79.062 -2.399  1.00 40.82  ? 199 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 199 ? 3.244  78.133 -1.376  1.00 41.01  ? 199 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 199 ? 4.346  77.160 -1.817  1.00 42.02  ? 199 ALA A C   1 
ATOM   1261 O O   . ALA A 1 199 ? 5.255  76.835 -1.047  1.00 42.84  ? 199 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 199 ? 2.068  77.359 -0.833  1.00 39.25  ? 199 ALA A CB  1 
ATOM   1263 N N   . GLU A 1 200 ? 4.272  76.703 -3.057  1.00 42.39  ? 200 GLU A N   1 
ATOM   1264 C CA  . GLU A 1 200 ? 5.247  75.749 -3.576  1.00 42.45  ? 200 GLU A CA  1 
ATOM   1265 C C   . GLU A 1 200 ? 6.516  76.440 -4.089  1.00 42.19  ? 200 GLU A C   1 
ATOM   1266 O O   . GLU A 1 200 ? 7.367  75.811 -4.728  1.00 41.80  ? 200 GLU A O   1 
ATOM   1267 C CB  . GLU A 1 200 ? 4.594  74.937 -4.697  1.00 40.41  ? 200 GLU A CB  1 
ATOM   1268 C CG  . GLU A 1 200 ? 5.050  73.517 -4.754  1.00 45.76  ? 200 GLU A CG  1 
ATOM   1269 C CD  . GLU A 1 200 ? 4.867  72.805 -3.424  1.00 48.49  ? 200 GLU A CD  1 
ATOM   1270 O OE1 . GLU A 1 200 ? 3.722  72.456 -3.068  1.00 50.34  ? 200 GLU A OE1 1 
ATOM   1271 O OE2 . GLU A 1 200 ? 5.876  72.604 -2.722  1.00 49.28  ? 200 GLU A OE2 1 
ATOM   1272 N N   . GLU A 1 201 ? 6.643  77.730 -3.793  1.00 42.24  ? 201 GLU A N   1 
ATOM   1273 C CA  . GLU A 1 201 ? 7.794  78.515 -4.246  1.00 42.89  ? 201 GLU A CA  1 
ATOM   1274 C C   . GLU A 1 201 ? 9.072  78.237 -3.444  1.00 41.68  ? 201 GLU A C   1 
ATOM   1275 O O   . GLU A 1 201 ? 10.143 78.025 -4.009  1.00 43.28  ? 201 GLU A O   1 
ATOM   1276 C CB  . GLU A 1 201 ? 7.442  80.008 -4.202  1.00 43.64  ? 201 GLU A CB  1 
ATOM   1277 C CG  . GLU A 1 201 ? 8.308  80.885 -5.089  1.00 47.64  ? 201 GLU A CG  1 
ATOM   1278 C CD  . GLU A 1 201 ? 8.052  80.706 -6.564  1.00 48.94  ? 201 GLU A CD  1 
ATOM   1279 O OE1 . GLU A 1 201 ? 6.929  80.321 -6.975  1.00 49.52  ? 201 GLU A OE1 1 
ATOM   1280 O OE2 . GLU A 1 201 ? 8.986  80.970 -7.352  1.00 48.72  ? 201 GLU A OE2 1 
ATOM   1281 N N   . ALA A 1 202 ? 8.952  78.250 -2.121  1.00 41.27  ? 202 ALA A N   1 
ATOM   1282 C CA  . ALA A 1 202 ? 10.082 77.976 -1.231  1.00 39.24  ? 202 ALA A CA  1 
ATOM   1283 C C   . ALA A 1 202 ? 9.497  77.305 -0.002  1.00 38.59  ? 202 ALA A C   1 
ATOM   1284 O O   . ALA A 1 202 ? 9.541  77.871 1.095   1.00 39.89  ? 202 ALA A O   1 
ATOM   1285 C CB  . ALA A 1 202 ? 10.764 79.265 -0.838  1.00 37.25  ? 202 ALA A CB  1 
ATOM   1286 N N   . PRO A 1 203 ? 8.914  76.100 -0.177  1.00 37.61  ? 203 PRO A N   1 
ATOM   1287 C CA  . PRO A 1 203 ? 8.305  75.340 0.928   1.00 34.40  ? 203 PRO A CA  1 
ATOM   1288 C C   . PRO A 1 203 ? 9.285  75.089 2.073   1.00 33.53  ? 203 PRO A C   1 
ATOM   1289 O O   . PRO A 1 203 ? 8.931  75.123 3.252   1.00 33.25  ? 203 PRO A O   1 
ATOM   1290 C CB  . PRO A 1 203 ? 7.884  74.023 0.299   1.00 33.81  ? 203 PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 203 ? 8.303  74.053 -1.112  1.00 35.23  ? 203 PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 203 ? 9.021  75.317 -1.422  1.00 36.80  ? 203 PRO A CD  1 
ATOM   1293 N N   . GLY A 1 204 ? 10.537 74.821 1.708   1.00 32.24  ? 204 GLY A N   1 
ATOM   1294 C CA  . GLY A 1 204 ? 11.570 74.526 2.686   1.00 28.99  ? 204 GLY A CA  1 
ATOM   1295 C C   . GLY A 1 204 ? 11.691 73.028 2.836   1.00 27.53  ? 204 GLY A C   1 
ATOM   1296 O O   . GLY A 1 204 ? 10.857 72.285 2.336   1.00 28.08  ? 204 GLY A O   1 
ATOM   1297 N N   . ASN A 1 205 ? 12.732 72.587 3.531   1.00 28.39  ? 205 ASN A N   1 
ATOM   1298 C CA  . ASN A 1 205 ? 12.961 71.170 3.752   1.00 26.94  ? 205 ASN A CA  1 
ATOM   1299 C C   . ASN A 1 205 ? 13.051 70.412 2.423   1.00 28.26  ? 205 ASN A C   1 
ATOM   1300 O O   . ASN A 1 205 ? 12.888 69.195 2.409   1.00 30.29  ? 205 ASN A O   1 
ATOM   1301 C CB  . ASN A 1 205 ? 11.819 70.566 4.586   1.00 28.25  ? 205 ASN A CB  1 
ATOM   1302 C CG  . ASN A 1 205 ? 11.775 71.088 6.030   1.00 31.11  ? 205 ASN A CG  1 
ATOM   1303 O OD1 . ASN A 1 205 ? 12.765 71.051 6.776   1.00 32.02  ? 205 ASN A OD1 1 
ATOM   1304 N ND2 . ASN A 1 205 ? 10.605 71.549 6.431   1.00 34.32  ? 205 ASN A ND2 1 
ATOM   1305 N N   . VAL A 1 206 ? 13.316 71.095 1.309   1.00 27.08  ? 206 VAL A N   1 
ATOM   1306 C CA  . VAL A 1 206 ? 13.366 70.371 0.044   1.00 29.33  ? 206 VAL A CA  1 
ATOM   1307 C C   . VAL A 1 206 ? 14.540 69.385 0.028   1.00 30.78  ? 206 VAL A C   1 
ATOM   1308 O O   . VAL A 1 206 ? 14.569 68.415 -0.744  1.00 28.22  ? 206 VAL A O   1 
ATOM   1309 C CB  . VAL A 1 206 ? 13.406 71.333 -1.212  1.00 28.76  ? 206 VAL A CB  1 
ATOM   1310 C CG1 . VAL A 1 206 ? 12.105 72.101 -1.298  1.00 26.87  ? 206 VAL A CG1 1 
ATOM   1311 C CG2 . VAL A 1 206 ? 14.592 72.285 -1.159  1.00 25.59  ? 206 VAL A CG2 1 
ATOM   1312 N N   . GLY A 1 207 ? 15.497 69.629 0.910   1.00 31.46  ? 207 GLY A N   1 
ATOM   1313 C CA  . GLY A 1 207 ? 16.634 68.735 1.010   1.00 32.26  ? 207 GLY A CA  1 
ATOM   1314 C C   . GLY A 1 207 ? 16.151 67.414 1.562   1.00 30.76  ? 207 GLY A C   1 
ATOM   1315 O O   . GLY A 1 207 ? 16.696 66.366 1.218   1.00 33.63  ? 207 GLY A O   1 
ATOM   1316 N N   . LEU A 1 208 ? 15.142 67.464 2.431   1.00 27.77  ? 208 LEU A N   1 
ATOM   1317 C CA  . LEU A 1 208 ? 14.570 66.253 3.004   1.00 27.56  ? 208 LEU A CA  1 
ATOM   1318 C C   . LEU A 1 208 ? 13.696 65.586 1.932   1.00 28.93  ? 208 LEU A C   1 
ATOM   1319 O O   . LEU A 1 208 ? 13.617 64.363 1.869   1.00 31.31  ? 208 LEU A O   1 
ATOM   1320 C CB  . LEU A 1 208 ? 13.736 66.584 4.248   1.00 23.38  ? 208 LEU A CB  1 
ATOM   1321 C CG  . LEU A 1 208 ? 14.490 67.328 5.366   1.00 25.98  ? 208 LEU A CG  1 
ATOM   1322 C CD1 . LEU A 1 208 ? 13.561 67.577 6.541   1.00 19.72  ? 208 LEU A CD1 1 
ATOM   1323 C CD2 . LEU A 1 208 ? 15.720 66.509 5.817   1.00 22.39  ? 208 LEU A CD2 1 
ATOM   1324 N N   . TRP A 1 209 ? 13.049 66.379 1.081   1.00 28.01  ? 209 TRP A N   1 
ATOM   1325 C CA  . TRP A 1 209 ? 12.229 65.795 0.026   1.00 31.49  ? 209 TRP A CA  1 
ATOM   1326 C C   . TRP A 1 209 ? 13.137 65.056 -0.962  1.00 33.82  ? 209 TRP A C   1 
ATOM   1327 O O   . TRP A 1 209 ? 12.773 64.010 -1.500  1.00 33.38  ? 209 TRP A O   1 
ATOM   1328 C CB  . TRP A 1 209 ? 11.412 66.863 -0.710  1.00 31.33  ? 209 TRP A CB  1 
ATOM   1329 C CG  . TRP A 1 209 ? 10.284 67.458 0.115   1.00 33.00  ? 209 TRP A CG  1 
ATOM   1330 C CD1 . TRP A 1 209 ? 10.319 68.612 0.856   1.00 33.47  ? 209 TRP A CD1 1 
ATOM   1331 C CD2 . TRP A 1 209 ? 8.972  66.915 0.293   1.00 31.55  ? 209 TRP A CD2 1 
ATOM   1332 N NE1 . TRP A 1 209 ? 9.112  68.819 1.480   1.00 30.17  ? 209 TRP A NE1 1 
ATOM   1333 C CE2 . TRP A 1 209 ? 8.267  67.794 1.154   1.00 31.28  ? 209 TRP A CE2 1 
ATOM   1334 C CE3 . TRP A 1 209 ? 8.320  65.771 -0.191  1.00 33.27  ? 209 TRP A CE3 1 
ATOM   1335 C CZ2 . TRP A 1 209 ? 6.943  67.567 1.540   1.00 29.64  ? 209 TRP A CZ2 1 
ATOM   1336 C CZ3 . TRP A 1 209 ? 7.004  65.543 0.191   1.00 31.99  ? 209 TRP A CZ3 1 
ATOM   1337 C CH2 . TRP A 1 209 ? 6.328  66.444 1.053   1.00 31.89  ? 209 TRP A CH2 1 
ATOM   1338 N N   . ASP A 1 210 ? 14.320 65.607 -1.207  1.00 35.77  ? 210 ASP A N   1 
ATOM   1339 C CA  . ASP A 1 210 ? 15.277 64.949 -2.091  1.00 37.21  ? 210 ASP A CA  1 
ATOM   1340 C C   . ASP A 1 210 ? 15.549 63.545 -1.536  1.00 37.62  ? 210 ASP A C   1 
ATOM   1341 O O   . ASP A 1 210 ? 15.435 62.544 -2.252  1.00 37.45  ? 210 ASP A O   1 
ATOM   1342 C CB  . ASP A 1 210 ? 16.610 65.710 -2.138  1.00 34.92  ? 210 ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 210 ? 16.510 67.019 -2.865  1.00 33.87  ? 210 ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 210 ? 15.647 67.139 -3.756  1.00 32.19  ? 210 ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 210 ? 17.316 67.922 -2.557  1.00 35.66  ? 210 ASP A OD2 1 
ATOM   1346 N N   . GLN A 1 211 ? 15.914 63.487 -0.256  1.00 37.20  ? 211 GLN A N   1 
ATOM   1347 C CA  . GLN A 1 211 ? 16.218 62.221 0.396   1.00 37.78  ? 211 GLN A CA  1 
ATOM   1348 C C   . GLN A 1 211 ? 15.065 61.262 0.231   1.00 37.27  ? 211 GLN A C   1 
ATOM   1349 O O   . GLN A 1 211 ? 15.265 60.119 -0.137  1.00 40.83  ? 211 GLN A O   1 
ATOM   1350 C CB  . GLN A 1 211 ? 16.495 62.430 1.879   1.00 35.77  ? 211 GLN A CB  1 
ATOM   1351 C CG  . GLN A 1 211 ? 17.509 63.501 2.150   1.00 35.79  ? 211 GLN A CG  1 
ATOM   1352 C CD  . GLN A 1 211 ? 17.833 63.628 3.625   1.00 37.65  ? 211 GLN A CD  1 
ATOM   1353 O OE1 . GLN A 1 211 ? 17.066 63.188 4.484   1.00 36.20  ? 211 GLN A OE1 1 
ATOM   1354 N NE2 . GLN A 1 211 ? 18.969 64.247 3.929   1.00 36.75  ? 211 GLN A NE2 1 
ATOM   1355 N N   . ALA A 1 212 ? 13.858 61.738 0.498   1.00 36.17  ? 212 ALA A N   1 
ATOM   1356 C CA  . ALA A 1 212 ? 12.668 60.916 0.380   1.00 34.89  ? 212 ALA A CA  1 
ATOM   1357 C C   . ALA A 1 212 ? 12.506 60.344 -1.023  1.00 34.61  ? 212 ALA A C   1 
ATOM   1358 O O   . ALA A 1 212 ? 12.102 59.194 -1.179  1.00 35.55  ? 212 ALA A O   1 
ATOM   1359 C CB  . ALA A 1 212 ? 11.427 61.739 0.756   1.00 34.74  ? 212 ALA A CB  1 
ATOM   1360 N N   . LEU A 1 213 ? 12.812 61.145 -2.041  1.00 34.07  ? 213 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 213 ? 12.671 60.700 -3.424  1.00 33.20  ? 213 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 213 ? 13.692 59.625 -3.750  1.00 33.46  ? 213 LEU A C   1 
ATOM   1363 O O   . LEU A 1 213 ? 13.364 58.623 -4.380  1.00 33.64  ? 213 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 213 ? 12.839 61.873 -4.392  1.00 33.50  ? 213 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 213 ? 12.432 61.623 -5.853  1.00 33.30  ? 213 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 213 ? 10.909 61.503 -5.926  1.00 32.00  ? 213 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 213 ? 12.917 62.766 -6.756  1.00 29.57  ? 213 LEU A CD2 1 
ATOM   1368 N N   . ALA A 1 214 ? 14.930 59.840 -3.318  1.00 33.55  ? 214 ALA A N   1 
ATOM   1369 C CA  . ALA A 1 214 ? 16.009 58.882 -3.549  1.00 32.68  ? 214 ALA A CA  1 
ATOM   1370 C C   . ALA A 1 214 ? 15.652 57.536 -2.900  1.00 32.14  ? 214 ALA A C   1 
ATOM   1371 O O   . ALA A 1 214 ? 15.864 56.471 -3.482  1.00 32.00  ? 214 ALA A O   1 
ATOM   1372 C CB  . ALA A 1 214 ? 17.326 59.425 -2.966  1.00 29.46  ? 214 ALA A CB  1 
ATOM   1373 N N   . ILE A 1 215 ? 15.105 57.591 -1.692  1.00 31.57  ? 215 ILE A N   1 
ATOM   1374 C CA  . ILE A 1 215 ? 14.728 56.382 -0.984  1.00 33.75  ? 215 ILE A CA  1 
ATOM   1375 C C   . ILE A 1 215 ? 13.579 55.695 -1.715  1.00 37.07  ? 215 ILE A C   1 
ATOM   1376 O O   . ILE A 1 215 ? 13.514 54.470 -1.781  1.00 38.58  ? 215 ILE A O   1 
ATOM   1377 C CB  . ILE A 1 215 ? 14.315 56.688 0.479   1.00 30.54  ? 215 ILE A CB  1 
ATOM   1378 C CG1 . ILE A 1 215 ? 15.537 57.163 1.276   1.00 27.60  ? 215 ILE A CG1 1 
ATOM   1379 C CG2 . ILE A 1 215 ? 13.720 55.444 1.131   1.00 28.29  ? 215 ILE A CG2 1 
ATOM   1380 C CD1 . ILE A 1 215 ? 15.232 57.542 2.730   1.00 25.11  ? 215 ILE A CD1 1 
ATOM   1381 N N   . ARG A 1 216 ? 12.670 56.485 -2.272  1.00 41.28  ? 216 ARG A N   1 
ATOM   1382 C CA  . ARG A 1 216 ? 11.543 55.914 -3.003  1.00 43.59  ? 216 ARG A CA  1 
ATOM   1383 C C   . ARG A 1 216 ? 12.054 55.261 -4.273  1.00 42.01  ? 216 ARG A C   1 
ATOM   1384 O O   . ARG A 1 216 ? 11.609 54.183 -4.647  1.00 41.73  ? 216 ARG A O   1 
ATOM   1385 C CB  . ARG A 1 216 ? 10.518 56.987 -3.364  1.00 49.03  ? 216 ARG A CB  1 
ATOM   1386 C CG  . ARG A 1 216 ? 9.131  56.733 -2.790  1.00 58.29  ? 216 ARG A CG  1 
ATOM   1387 C CD  . ARG A 1 216 ? 8.182  57.900 -3.108  1.00 66.09  ? 216 ARG A CD  1 
ATOM   1388 N NE  . ARG A 1 216 ? 8.647  59.177 -2.543  1.00 73.43  ? 216 ARG A NE  1 
ATOM   1389 C CZ  . ARG A 1 216 ? 7.998  60.340 -2.656  1.00 76.04  ? 216 ARG A CZ  1 
ATOM   1390 N NH1 . ARG A 1 216 ? 6.844  60.395 -3.325  1.00 78.91  ? 216 ARG A NH1 1 
ATOM   1391 N NH2 . ARG A 1 216 ? 8.498  61.450 -2.104  1.00 74.99  ? 216 ARG A NH2 1 
ATOM   1392 N N   . TRP A 1 217 ? 13.004 55.922 -4.920  1.00 41.22  ? 217 TRP A N   1 
ATOM   1393 C CA  . TRP A 1 217 ? 13.576 55.422 -6.149  1.00 40.23  ? 217 TRP A CA  1 
ATOM   1394 C C   . TRP A 1 217 ? 14.200 54.076 -5.870  1.00 41.55  ? 217 TRP A C   1 
ATOM   1395 O O   . TRP A 1 217 ? 13.988 53.121 -6.614  1.00 42.59  ? 217 TRP A O   1 
ATOM   1396 C CB  . TRP A 1 217 ? 14.641 56.378 -6.664  1.00 39.24  ? 217 TRP A CB  1 
ATOM   1397 C CG  . TRP A 1 217 ? 15.139 56.032 -8.035  1.00 40.05  ? 217 TRP A CG  1 
ATOM   1398 C CD1 . TRP A 1 217 ? 14.649 56.487 -9.227  1.00 39.94  ? 217 TRP A CD1 1 
ATOM   1399 C CD2 . TRP A 1 217 ? 16.222 55.153 -8.357  1.00 40.52  ? 217 TRP A CD2 1 
ATOM   1400 N NE1 . TRP A 1 217 ? 15.362 55.949 -10.271 1.00 39.70  ? 217 TRP A NE1 1 
ATOM   1401 C CE2 . TRP A 1 217 ? 16.335 55.125 -9.767  1.00 40.61  ? 217 TRP A CE2 1 
ATOM   1402 C CE3 . TRP A 1 217 ? 17.113 54.386 -7.592  1.00 39.88  ? 217 TRP A CE3 1 
ATOM   1403 C CZ2 . TRP A 1 217 ? 17.306 54.356 -10.430 1.00 39.77  ? 217 TRP A CZ2 1 
ATOM   1404 C CZ3 . TRP A 1 217 ? 18.080 53.620 -8.255  1.00 38.60  ? 217 TRP A CZ3 1 
ATOM   1405 C CH2 . TRP A 1 217 ? 18.166 53.614 -9.657  1.00 38.06  ? 217 TRP A CH2 1 
ATOM   1406 N N   . LEU A 1 218 ? 14.971 54.002 -4.791  1.00 42.14  ? 218 LEU A N   1 
ATOM   1407 C CA  . LEU A 1 218 ? 15.632 52.764 -4.421  1.00 40.57  ? 218 LEU A CA  1 
ATOM   1408 C C   . LEU A 1 218 ? 14.601 51.691 -4.115  1.00 40.19  ? 218 LEU A C   1 
ATOM   1409 O O   . LEU A 1 218 ? 14.781 50.527 -4.459  1.00 41.01  ? 218 LEU A O   1 
ATOM   1410 C CB  . LEU A 1 218 ? 16.559 53.004 -3.226  1.00 37.03  ? 218 LEU A CB  1 
ATOM   1411 C CG  . LEU A 1 218 ? 17.844 53.734 -3.630  1.00 36.25  ? 218 LEU A CG  1 
ATOM   1412 C CD1 . LEU A 1 218 ? 18.510 54.378 -2.434  1.00 32.77  ? 218 LEU A CD1 1 
ATOM   1413 C CD2 . LEU A 1 218 ? 18.768 52.751 -4.312  1.00 32.17  ? 218 LEU A CD2 1 
ATOM   1414 N N   . LYS A 1 219 ? 13.506 52.074 -3.484  1.00 41.01  ? 219 LYS A N   1 
ATOM   1415 C CA  . LYS A 1 219 ? 12.489 51.093 -3.175  1.00 44.55  ? 219 LYS A CA  1 
ATOM   1416 C C   . LYS A 1 219 ? 11.898 50.542 -4.481  1.00 45.82  ? 219 LYS A C   1 
ATOM   1417 O O   . LYS A 1 219 ? 11.497 49.379 -4.553  1.00 45.54  ? 219 LYS A O   1 
ATOM   1418 C CB  . LYS A 1 219 ? 11.395 51.720 -2.305  1.00 46.32  ? 219 LYS A CB  1 
ATOM   1419 C CG  . LYS A 1 219 ? 10.385 50.706 -1.775  1.00 50.63  ? 219 LYS A CG  1 
ATOM   1420 C CD  . LYS A 1 219 ? 10.328 50.676 -0.252  1.00 54.41  ? 219 LYS A CD  1 
ATOM   1421 C CE  . LYS A 1 219 ? 9.351  49.602 0.241   1.00 56.72  ? 219 LYS A CE  1 
ATOM   1422 N NZ  . LYS A 1 219 ? 9.149  49.614 1.724   1.00 57.57  ? 219 LYS A NZ  1 
ATOM   1423 N N   . ASP A 1 220 ? 11.856 51.373 -5.517  1.00 46.13  ? 220 ASP A N   1 
ATOM   1424 C CA  . ASP A 1 220 ? 11.316 50.943 -6.799  1.00 47.44  ? 220 ASP A CA  1 
ATOM   1425 C C   . ASP A 1 220 ? 12.275 50.056 -7.574  1.00 48.08  ? 220 ASP A C   1 
ATOM   1426 O O   . ASP A 1 220 ? 11.843 49.183 -8.328  1.00 49.52  ? 220 ASP A O   1 
ATOM   1427 C CB  . ASP A 1 220 ? 10.966 52.137 -7.688  1.00 49.82  ? 220 ASP A CB  1 
ATOM   1428 C CG  . ASP A 1 220 ? 9.850  52.980 -7.126  1.00 52.61  ? 220 ASP A CG  1 
ATOM   1429 O OD1 . ASP A 1 220 ? 8.989  52.435 -6.401  1.00 55.02  ? 220 ASP A OD1 1 
ATOM   1430 O OD2 . ASP A 1 220 ? 9.829  54.191 -7.432  1.00 53.03  ? 220 ASP A OD2 1 
ATOM   1431 N N   . ASN A 1 221 ? 13.574 50.284 -7.410  1.00 46.83  ? 221 ASN A N   1 
ATOM   1432 C CA  . ASN A 1 221 ? 14.557 49.492 -8.131  1.00 46.55  ? 221 ASN A CA  1 
ATOM   1433 C C   . ASN A 1 221 ? 15.306 48.487 -7.284  1.00 46.82  ? 221 ASN A C   1 
ATOM   1434 O O   . ASN A 1 221 ? 16.373 48.004 -7.673  1.00 46.78  ? 221 ASN A O   1 
ATOM   1435 C CB  . ASN A 1 221 ? 15.539 50.408 -8.848  1.00 46.34  ? 221 ASN A CB  1 
ATOM   1436 C CG  . ASN A 1 221 ? 14.886 51.159 -9.982  1.00 50.46  ? 221 ASN A CG  1 
ATOM   1437 O OD1 . ASN A 1 221 ? 14.223 50.562 -10.838 1.00 51.59  ? 221 ASN A OD1 1 
ATOM   1438 N ND2 . ASN A 1 221 ? 15.062 52.473 -10.000 1.00 52.50  ? 221 ASN A ND2 1 
ATOM   1439 N N   . ALA A 1 222 ? 14.738 48.154 -6.131  1.00 47.34  ? 222 ALA A N   1 
ATOM   1440 C CA  . ALA A 1 222 ? 15.379 47.192 -5.250  1.00 49.26  ? 222 ALA A CA  1 
ATOM   1441 C C   . ALA A 1 222 ? 15.588 45.871 -5.992  1.00 50.15  ? 222 ALA A C   1 
ATOM   1442 O O   . ALA A 1 222 ? 16.713 45.393 -6.106  1.00 49.60  ? 222 ALA A O   1 
ATOM   1443 C CB  . ALA A 1 222 ? 14.538 46.975 -4.001  1.00 48.74  ? 222 ALA A CB  1 
ATOM   1444 N N   . HIS A 1 223 ? 14.509 45.289 -6.508  1.00 52.13  ? 223 HIS A N   1 
ATOM   1445 C CA  . HIS A 1 223 ? 14.616 44.026 -7.229  1.00 53.09  ? 223 HIS A CA  1 
ATOM   1446 C C   . HIS A 1 223 ? 15.556 44.127 -8.419  1.00 52.03  ? 223 HIS A C   1 
ATOM   1447 O O   . HIS A 1 223 ? 16.361 43.236 -8.659  1.00 52.34  ? 223 HIS A O   1 
ATOM   1448 C CB  . HIS A 1 223 ? 13.237 43.545 -7.689  1.00 57.22  ? 223 HIS A CB  1 
ATOM   1449 C CG  . HIS A 1 223 ? 12.509 42.731 -6.662  1.00 62.33  ? 223 HIS A CG  1 
ATOM   1450 N ND1 . HIS A 1 223 ? 13.049 41.595 -6.095  1.00 64.69  ? 223 HIS A ND1 1 
ATOM   1451 C CD2 . HIS A 1 223 ? 11.280 42.877 -6.110  1.00 65.32  ? 223 HIS A CD2 1 
ATOM   1452 C CE1 . HIS A 1 223 ? 12.186 41.076 -5.238  1.00 66.62  ? 223 HIS A CE1 1 
ATOM   1453 N NE2 . HIS A 1 223 ? 11.103 41.834 -5.229  1.00 66.60  ? 223 HIS A NE2 1 
ATOM   1454 N N   . ALA A 1 224 ? 15.466 45.224 -9.154  1.00 51.06  ? 224 ALA A N   1 
ATOM   1455 C CA  . ALA A 1 224 ? 16.313 45.418 -10.316 1.00 49.52  ? 224 ALA A CA  1 
ATOM   1456 C C   . ALA A 1 224 ? 17.799 45.252 -10.009 1.00 50.26  ? 224 ALA A C   1 
ATOM   1457 O O   . ALA A 1 224 ? 18.587 44.992 -10.915 1.00 51.43  ? 224 ALA A O   1 
ATOM   1458 C CB  . ALA A 1 224 ? 16.060 46.792 -10.914 1.00 49.14  ? 224 ALA A CB  1 
ATOM   1459 N N   . PHE A 1 225 ? 18.190 45.408 -8.746  1.00 49.59  ? 225 PHE A N   1 
ATOM   1460 C CA  . PHE A 1 225 ? 19.599 45.276 -8.374  1.00 47.40  ? 225 PHE A CA  1 
ATOM   1461 C C   . PHE A 1 225 ? 19.895 44.022 -7.542  1.00 47.95  ? 225 PHE A C   1 
ATOM   1462 O O   . PHE A 1 225 ? 21.034 43.803 -7.107  1.00 44.69  ? 225 PHE A O   1 
ATOM   1463 C CB  . PHE A 1 225 ? 20.069 46.515 -7.611  1.00 46.06  ? 225 PHE A CB  1 
ATOM   1464 C CG  . PHE A 1 225 ? 20.336 47.708 -8.485  1.00 45.68  ? 225 PHE A CG  1 
ATOM   1465 C CD1 . PHE A 1 225 ? 19.323 48.625 -8.778  1.00 45.96  ? 225 PHE A CD1 1 
ATOM   1466 C CD2 . PHE A 1 225 ? 21.605 47.918 -9.016  1.00 43.91  ? 225 PHE A CD2 1 
ATOM   1467 C CE1 . PHE A 1 225 ? 19.570 49.737 -9.587  1.00 43.27  ? 225 PHE A CE1 1 
ATOM   1468 C CE2 . PHE A 1 225 ? 21.866 49.021 -9.827  1.00 45.09  ? 225 PHE A CE2 1 
ATOM   1469 C CZ  . PHE A 1 225 ? 20.841 49.937 -10.113 1.00 45.63  ? 225 PHE A CZ  1 
ATOM   1470 N N   . GLY A 1 226 ? 18.869 43.199 -7.337  1.00 47.60  ? 226 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 226 ? 19.035 41.980 -6.563  1.00 48.21  ? 226 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 226 ? 18.631 42.189 -5.118  1.00 49.50  ? 226 GLY A C   1 
ATOM   1473 O O   . GLY A 1 226 ? 18.847 41.325 -4.256  1.00 49.21  ? 226 GLY A O   1 
ATOM   1474 N N   . GLY A 1 227 ? 18.030 43.347 -4.856  1.00 48.99  ? 227 GLY A N   1 
ATOM   1475 C CA  . GLY A 1 227 ? 17.612 43.677 -3.512  1.00 46.61  ? 227 GLY A CA  1 
ATOM   1476 C C   . GLY A 1 227 ? 16.158 43.384 -3.233  1.00 45.87  ? 227 GLY A C   1 
ATOM   1477 O O   . GLY A 1 227 ? 15.345 43.271 -4.137  1.00 44.85  ? 227 GLY A O   1 
ATOM   1478 N N   . ASN A 1 228 ? 15.838 43.261 -1.954  1.00 46.50  ? 228 ASN A N   1 
ATOM   1479 C CA  . ASN A 1 228 ? 14.480 42.993 -1.520  1.00 47.19  ? 228 ASN A CA  1 
ATOM   1480 C C   . ASN A 1 228 ? 13.916 44.271 -0.898  1.00 48.49  ? 228 ASN A C   1 
ATOM   1481 O O   . ASN A 1 228 ? 14.274 44.637 0.218   1.00 48.94  ? 228 ASN A O   1 
ATOM   1482 C CB  . ASN A 1 228 ? 14.487 41.869 -0.485  1.00 45.44  ? 228 ASN A CB  1 
ATOM   1483 C CG  . ASN A 1 228 ? 13.112 41.557 0.051   1.00 44.88  ? 228 ASN A CG  1 
ATOM   1484 O OD1 . ASN A 1 228 ? 12.199 42.380 -0.024  1.00 46.08  ? 228 ASN A OD1 1 
ATOM   1485 N ND2 . ASN A 1 228 ? 12.960 40.370 0.623   1.00 42.61  ? 228 ASN A ND2 1 
ATOM   1486 N N   . PRO A 1 229 ? 13.025 44.959 -1.619  1.00 50.17  ? 229 PRO A N   1 
ATOM   1487 C CA  . PRO A 1 229 ? 12.350 46.203 -1.235  1.00 51.98  ? 229 PRO A CA  1 
ATOM   1488 C C   . PRO A 1 229 ? 11.921 46.324 0.223   1.00 52.74  ? 229 PRO A C   1 
ATOM   1489 O O   . PRO A 1 229 ? 12.003 47.399 0.808   1.00 53.76  ? 229 PRO A O   1 
ATOM   1490 C CB  . PRO A 1 229 ? 11.155 46.235 -2.169  1.00 52.46  ? 229 PRO A CB  1 
ATOM   1491 C CG  . PRO A 1 229 ? 11.742 45.690 -3.422  1.00 53.40  ? 229 PRO A CG  1 
ATOM   1492 C CD  . PRO A 1 229 ? 12.565 44.512 -2.944  1.00 51.88  ? 229 PRO A CD  1 
ATOM   1493 N N   . GLU A 1 230 ? 11.461 45.228 0.808   1.00 54.74  ? 230 GLU A N   1 
ATOM   1494 C CA  . GLU A 1 230 ? 11.010 45.236 2.199   1.00 56.94  ? 230 GLU A CA  1 
ATOM   1495 C C   . GLU A 1 230 ? 12.126 45.049 3.229   1.00 54.70  ? 230 GLU A C   1 
ATOM   1496 O O   . GLU A 1 230 ? 11.893 45.131 4.435   1.00 51.81  ? 230 GLU A O   1 
ATOM   1497 C CB  . GLU A 1 230 ? 9.962  44.141 2.400   1.00 62.06  ? 230 GLU A CB  1 
ATOM   1498 C CG  . GLU A 1 230 ? 8.645  44.384 1.684   1.00 67.38  ? 230 GLU A CG  1 
ATOM   1499 C CD  . GLU A 1 230 ? 7.488  44.448 2.655   1.00 71.72  ? 230 GLU A CD  1 
ATOM   1500 O OE1 . GLU A 1 230 ? 7.314  43.490 3.447   1.00 74.26  ? 230 GLU A OE1 1 
ATOM   1501 O OE2 . GLU A 1 230 ? 6.757  45.460 2.628   1.00 74.93  ? 230 GLU A OE2 1 
ATOM   1502 N N   . TRP A 1 231 ? 13.336 44.801 2.747   1.00 53.03  ? 231 TRP A N   1 
ATOM   1503 C CA  . TRP A 1 231 ? 14.474 44.576 3.617   1.00 51.54  ? 231 TRP A CA  1 
ATOM   1504 C C   . TRP A 1 231 ? 15.443 45.771 3.583   1.00 50.64  ? 231 TRP A C   1 
ATOM   1505 O O   . TRP A 1 231 ? 16.641 45.612 3.335   1.00 51.07  ? 231 TRP A O   1 
ATOM   1506 C CB  . TRP A 1 231 ? 15.174 43.298 3.158   1.00 53.16  ? 231 TRP A CB  1 
ATOM   1507 C CG  . TRP A 1 231 ? 15.797 42.491 4.254   1.00 56.17  ? 231 TRP A CG  1 
ATOM   1508 C CD1 . TRP A 1 231 ? 15.855 42.804 5.587   1.00 57.44  ? 231 TRP A CD1 1 
ATOM   1509 C CD2 . TRP A 1 231 ? 16.487 41.251 4.104   1.00 56.11  ? 231 TRP A CD2 1 
ATOM   1510 N NE1 . TRP A 1 231 ? 16.547 41.830 6.273   1.00 56.50  ? 231 TRP A NE1 1 
ATOM   1511 C CE2 . TRP A 1 231 ? 16.945 40.867 5.385   1.00 55.90  ? 231 TRP A CE2 1 
ATOM   1512 C CE3 . TRP A 1 231 ? 16.764 40.423 3.010   1.00 56.50  ? 231 TRP A CE3 1 
ATOM   1513 C CZ2 . TRP A 1 231 ? 17.667 39.695 5.599   1.00 57.33  ? 231 TRP A CZ2 1 
ATOM   1514 C CZ3 . TRP A 1 231 ? 17.485 39.253 3.223   1.00 57.25  ? 231 TRP A CZ3 1 
ATOM   1515 C CH2 . TRP A 1 231 ? 17.927 38.901 4.508   1.00 57.78  ? 231 TRP A CH2 1 
ATOM   1516 N N   . MET A 1 232 ? 14.921 46.968 3.839   1.00 47.77  ? 232 MET A N   1 
ATOM   1517 C CA  . MET A 1 232 ? 15.736 48.179 3.821   1.00 44.87  ? 232 MET A CA  1 
ATOM   1518 C C   . MET A 1 232 ? 15.981 48.770 5.197   1.00 42.96  ? 232 MET A C   1 
ATOM   1519 O O   . MET A 1 232 ? 15.114 48.743 6.066   1.00 43.52  ? 232 MET A O   1 
ATOM   1520 C CB  . MET A 1 232 ? 15.070 49.258 2.968   1.00 45.74  ? 232 MET A CB  1 
ATOM   1521 C CG  . MET A 1 232 ? 14.949 48.937 1.496   1.00 50.11  ? 232 MET A CG  1 
ATOM   1522 S SD  . MET A 1 232 ? 14.275 50.302 0.520   1.00 52.83  ? 232 MET A SD  1 
ATOM   1523 C CE  . MET A 1 232 ? 14.326 51.651 1.718   1.00 44.88  ? 232 MET A CE  1 
ATOM   1524 N N   . THR A 1 233 ? 17.175 49.304 5.399   1.00 39.47  ? 233 THR A N   1 
ATOM   1525 C CA  . THR A 1 233 ? 17.486 49.952 6.660   1.00 39.47  ? 233 THR A CA  1 
ATOM   1526 C C   . THR A 1 233 ? 18.262 51.222 6.317   1.00 38.84  ? 233 THR A C   1 
ATOM   1527 O O   . THR A 1 233 ? 19.106 51.233 5.416   1.00 39.64  ? 233 THR A O   1 
ATOM   1528 C CB  . THR A 1 233 ? 18.315 49.035 7.660   1.00 39.34  ? 233 THR A CB  1 
ATOM   1529 O OG1 . THR A 1 233 ? 19.664 49.504 7.767   1.00 39.85  ? 233 THR A OG1 1 
ATOM   1530 C CG2 . THR A 1 233 ? 18.319 47.601 7.213   1.00 35.19  ? 233 THR A CG2 1 
ATOM   1531 N N   . LEU A 1 234 ? 17.935 52.302 7.012   1.00 36.50  ? 234 LEU A N   1 
ATOM   1532 C CA  . LEU A 1 234 ? 18.592 53.574 6.787   1.00 35.87  ? 234 LEU A CA  1 
ATOM   1533 C C   . LEU A 1 234 ? 19.686 53.789 7.828   1.00 33.57  ? 234 LEU A C   1 
ATOM   1534 O O   . LEU A 1 234 ? 19.556 53.357 8.980   1.00 32.60  ? 234 LEU A O   1 
ATOM   1535 C CB  . LEU A 1 234 ? 17.575 54.716 6.906   1.00 38.29  ? 234 LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 234 ? 16.394 54.813 5.933   1.00 41.38  ? 234 LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 234 ? 15.385 55.827 6.469   1.00 41.19  ? 234 LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 234 ? 16.884 55.232 4.555   1.00 41.60  ? 234 LEU A CD2 1 
ATOM   1539 N N   . PHE A 1 235 ? 20.774 54.430 7.421   1.00 28.85  ? 235 PHE A N   1 
ATOM   1540 C CA  . PHE A 1 235 ? 21.819 54.753 8.376   1.00 30.78  ? 235 PHE A CA  1 
ATOM   1541 C C   . PHE A 1 235 ? 22.530 56.011 7.974   1.00 29.31  ? 235 PHE A C   1 
ATOM   1542 O O   . PHE A 1 235 ? 22.643 56.341 6.791   1.00 30.47  ? 235 PHE A O   1 
ATOM   1543 C CB  . PHE A 1 235 ? 22.827 53.608 8.599   1.00 31.37  ? 235 PHE A CB  1 
ATOM   1544 C CG  . PHE A 1 235 ? 23.662 53.250 7.402   1.00 31.14  ? 235 PHE A CG  1 
ATOM   1545 C CD1 . PHE A 1 235 ? 23.071 52.860 6.204   1.00 31.58  ? 235 PHE A CD1 1 
ATOM   1546 C CD2 . PHE A 1 235 ? 25.048 53.194 7.512   1.00 31.39  ? 235 PHE A CD2 1 
ATOM   1547 C CE1 . PHE A 1 235 ? 23.845 52.413 5.141   1.00 31.47  ? 235 PHE A CE1 1 
ATOM   1548 C CE2 . PHE A 1 235 ? 25.838 52.746 6.448   1.00 31.68  ? 235 PHE A CE2 1 
ATOM   1549 C CZ  . PHE A 1 235 ? 25.235 52.355 5.266   1.00 31.80  ? 235 PHE A CZ  1 
ATOM   1550 N N   . GLY A 1 236 ? 22.969 56.732 8.987   1.00 26.27  ? 236 GLY A N   1 
ATOM   1551 C CA  . GLY A 1 236 ? 23.666 57.971 8.760   1.00 26.75  ? 236 GLY A CA  1 
ATOM   1552 C C   . GLY A 1 236 ? 24.303 58.440 10.049  1.00 27.68  ? 236 GLY A C   1 
ATOM   1553 O O   . GLY A 1 236 ? 24.078 57.887 11.146  1.00 24.59  ? 236 GLY A O   1 
ATOM   1554 N N   . GLU A 1 237 ? 25.110 59.478 9.918   1.00 27.75  ? 237 GLU A N   1 
ATOM   1555 C CA  . GLU A 1 237 ? 25.794 60.019 11.070  1.00 30.01  ? 237 GLU A CA  1 
ATOM   1556 C C   . GLU A 1 237 ? 25.621 61.525 11.041  1.00 30.58  ? 237 GLU A C   1 
ATOM   1557 O O   . GLU A 1 237 ? 25.501 62.103 9.963   1.00 31.33  ? 237 GLU A O   1 
ATOM   1558 C CB  . GLU A 1 237 ? 27.269 59.629 10.981  1.00 26.95  ? 237 GLU A CB  1 
ATOM   1559 C CG  . GLU A 1 237 ? 28.152 60.117 12.113  1.00 28.57  ? 237 GLU A CG  1 
ATOM   1560 C CD  . GLU A 1 237 ? 28.755 61.476 11.829  1.00 28.94  ? 237 GLU A CD  1 
ATOM   1561 O OE1 . GLU A 1 237 ? 28.890 61.830 10.634  1.00 30.30  ? 237 GLU A OE1 1 
ATOM   1562 O OE2 . GLU A 1 237 ? 29.104 62.182 12.794  1.00 26.44  ? 237 GLU A OE2 1 
ATOM   1563 N N   . SER A 1 238 ? 25.537 62.167 12.200  1.00 29.62  ? 238 SER A N   1 
ATOM   1564 C CA  . SER A 1 238 ? 25.458 63.614 12.159  1.00 31.92  ? 238 SER A CA  1 
ATOM   1565 C C   . SER A 1 238 ? 24.098 64.007 11.565  1.00 30.67  ? 238 SER A C   1 
ATOM   1566 O O   . SER A 1 238 ? 23.093 63.363 11.819  1.00 31.65  ? 238 SER A O   1 
ATOM   1567 C CB  . SER A 1 238 ? 26.599 64.075 11.244  1.00 36.26  ? 238 SER A CB  1 
ATOM   1568 O OG  . SER A 1 238 ? 27.248 65.255 11.654  1.00 37.73  ? 238 SER A OG  1 
ATOM   1569 N N   . ALA A 1 239 ? 24.074 65.069 10.772  1.00 30.29  ? 239 ALA A N   1 
ATOM   1570 C CA  . ALA A 1 239 ? 22.847 65.506 10.123  1.00 29.64  ? 239 ALA A CA  1 
ATOM   1571 C C   . ALA A 1 239 ? 22.274 64.327 9.314   1.00 30.32  ? 239 ALA A C   1 
ATOM   1572 O O   . ALA A 1 239 ? 21.055 64.208 9.152   1.00 29.01  ? 239 ALA A O   1 
ATOM   1573 C CB  . ALA A 1 239 ? 23.143 66.687 9.214   1.00 28.82  ? 239 ALA A CB  1 
ATOM   1574 N N   . GLY A 1 240 ? 23.159 63.459 8.812   1.00 29.34  ? 240 GLY A N   1 
ATOM   1575 C CA  . GLY A 1 240 ? 22.710 62.293 8.067   1.00 29.13  ? 240 GLY A CA  1 
ATOM   1576 C C   . GLY A 1 240 ? 21.918 61.380 8.995   1.00 30.49  ? 240 GLY A C   1 
ATOM   1577 O O   . GLY A 1 240 ? 20.975 60.705 8.587   1.00 30.69  ? 240 GLY A O   1 
ATOM   1578 N N   . SER A 1 241 ? 22.308 61.367 10.263  1.00 29.87  ? 241 SER A N   1 
ATOM   1579 C CA  . SER A 1 241 ? 21.637 60.560 11.257  1.00 29.47  ? 241 SER A CA  1 
ATOM   1580 C C   . SER A 1 241 ? 20.301 61.216 11.555  1.00 30.98  ? 241 SER A C   1 
ATOM   1581 O O   . SER A 1 241 ? 19.267 60.553 11.565  1.00 33.14  ? 241 SER A O   1 
ATOM   1582 C CB  . SER A 1 241 ? 22.489 60.481 12.517  1.00 30.10  ? 241 SER A CB  1 
ATOM   1583 O OG  . SER A 1 241 ? 21.860 59.711 13.516  1.00 32.07  ? 241 SER A OG  1 
ATOM   1584 N N   . SER A 1 242 ? 20.309 62.522 11.799  1.00 31.17  ? 242 SER A N   1 
ATOM   1585 C CA  . SER A 1 242 ? 19.055 63.232 12.065  1.00 29.88  ? 242 SER A CA  1 
ATOM   1586 C C   . SER A 1 242 ? 18.082 62.972 10.917  1.00 27.75  ? 242 SER A C   1 
ATOM   1587 O O   . SER A 1 242 ? 16.885 62.821 11.127  1.00 25.36  ? 242 SER A O   1 
ATOM   1588 C CB  . SER A 1 242 ? 19.297 64.738 12.179  1.00 29.04  ? 242 SER A CB  1 
ATOM   1589 O OG  . SER A 1 242 ? 19.928 65.059 13.400  1.00 33.90  ? 242 SER A OG  1 
ATOM   1590 N N   . SER A 1 243 ? 18.615 62.921 9.700   1.00 26.82  ? 243 SER A N   1 
ATOM   1591 C CA  . SER A 1 243 ? 17.800 62.689 8.521   1.00 27.99  ? 243 SER A CA  1 
ATOM   1592 C C   . SER A 1 243 ? 17.136 61.316 8.576   1.00 30.40  ? 243 SER A C   1 
ATOM   1593 O O   . SER A 1 243 ? 15.940 61.183 8.289   1.00 31.17  ? 243 SER A O   1 
ATOM   1594 C CB  . SER A 1 243 ? 18.657 62.813 7.265   1.00 28.20  ? 243 SER A CB  1 
ATOM   1595 O OG  . SER A 1 243 ? 19.210 64.118 7.161   1.00 31.24  ? 243 SER A OG  1 
ATOM   1596 N N   . VAL A 1 244 ? 17.913 60.296 8.936   1.00 29.45  ? 244 VAL A N   1 
ATOM   1597 C CA  . VAL A 1 244 ? 17.386 58.944 9.048   1.00 28.16  ? 244 VAL A CA  1 
ATOM   1598 C C   . VAL A 1 244 ? 16.202 59.053 10.010  1.00 29.04  ? 244 VAL A C   1 
ATOM   1599 O O   . VAL A 1 244 ? 15.153 58.450 9.802   1.00 30.26  ? 244 VAL A O   1 
ATOM   1600 C CB  . VAL A 1 244 ? 18.458 57.959 9.634   1.00 28.49  ? 244 VAL A CB  1 
ATOM   1601 C CG1 . VAL A 1 244 ? 17.848 56.580 9.878   1.00 26.94  ? 244 VAL A CG1 1 
ATOM   1602 C CG2 . VAL A 1 244 ? 19.635 57.854 8.698   1.00 25.15  ? 244 VAL A CG2 1 
ATOM   1603 N N   . ASN A 1 245 ? 16.382 59.843 11.061  1.00 29.65  ? 245 ASN A N   1 
ATOM   1604 C CA  . ASN A 1 245 ? 15.342 60.063 12.059  1.00 30.82  ? 245 ASN A CA  1 
ATOM   1605 C C   . ASN A 1 245 ? 14.118 60.675 11.370  1.00 31.29  ? 245 ASN A C   1 
ATOM   1606 O O   . ASN A 1 245 ? 12.993 60.190 11.507  1.00 31.97  ? 245 ASN A O   1 
ATOM   1607 C CB  . ASN A 1 245 ? 15.876 61.014 13.128  1.00 30.67  ? 245 ASN A CB  1 
ATOM   1608 C CG  . ASN A 1 245 ? 14.948 61.171 14.300  1.00 30.55  ? 245 ASN A CG  1 
ATOM   1609 O OD1 . ASN A 1 245 ? 15.274 61.874 15.254  1.00 31.83  ? 245 ASN A OD1 1 
ATOM   1610 N ND2 . ASN A 1 245 ? 13.786 60.525 14.244  1.00 28.95  ? 245 ASN A ND2 1 
ATOM   1611 N N   . ALA A 1 246 ? 14.351 61.737 10.613  1.00 31.64  ? 246 ALA A N   1 
ATOM   1612 C CA  . ALA A 1 246 ? 13.276 62.419 9.912   1.00 33.69  ? 246 ALA A CA  1 
ATOM   1613 C C   . ALA A 1 246 ? 12.554 61.505 8.922   1.00 36.13  ? 246 ALA A C   1 
ATOM   1614 O O   . ALA A 1 246 ? 11.326 61.500 8.852   1.00 38.76  ? 246 ALA A O   1 
ATOM   1615 C CB  . ALA A 1 246 ? 13.826 63.633 9.194   1.00 30.20  ? 246 ALA A CB  1 
ATOM   1616 N N   . GLN A 1 247 ? 13.305 60.720 8.159   1.00 37.16  ? 247 GLN A N   1 
ATOM   1617 C CA  . GLN A 1 247 ? 12.671 59.843 7.186   1.00 36.61  ? 247 GLN A CA  1 
ATOM   1618 C C   . GLN A 1 247 ? 11.868 58.718 7.828   1.00 37.51  ? 247 GLN A C   1 
ATOM   1619 O O   . GLN A 1 247 ? 10.883 58.276 7.257   1.00 38.73  ? 247 GLN A O   1 
ATOM   1620 C CB  . GLN A 1 247 ? 13.711 59.250 6.241   1.00 37.05  ? 247 GLN A CB  1 
ATOM   1621 C CG  . GLN A 1 247 ? 14.563 60.268 5.490   1.00 40.10  ? 247 GLN A CG  1 
ATOM   1622 C CD  . GLN A 1 247 ? 13.779 61.098 4.492   1.00 41.55  ? 247 GLN A CD  1 
ATOM   1623 O OE1 . GLN A 1 247 ? 12.766 60.656 3.956   1.00 44.93  ? 247 GLN A OE1 1 
ATOM   1624 N NE2 . GLN A 1 247 ? 14.262 62.302 4.219   1.00 41.52  ? 247 GLN A NE2 1 
ATOM   1625 N N   . LEU A 1 248 ? 12.270 58.251 9.007   1.00 39.41  ? 248 LEU A N   1 
ATOM   1626 C CA  . LEU A 1 248 ? 11.542 57.164 9.652   1.00 40.03  ? 248 LEU A CA  1 
ATOM   1627 C C   . LEU A 1 248 ? 10.265 57.665 10.294  1.00 43.71  ? 248 LEU A C   1 
ATOM   1628 O O   . LEU A 1 248 ? 9.261  56.948 10.301  1.00 46.38  ? 248 LEU A O   1 
ATOM   1629 C CB  . LEU A 1 248 ? 12.383 56.481 10.735  1.00 38.30  ? 248 LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 248 ? 13.638 55.679 10.408  1.00 39.82  ? 248 LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 248 ? 14.074 54.895 11.636  1.00 38.92  ? 248 LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 248 ? 13.344 54.720 9.290   1.00 40.96  ? 248 LEU A CD2 1 
ATOM   1633 N N   . MET A 1 249 ? 10.295 58.896 10.807  1.00 44.55  ? 249 MET A N   1 
ATOM   1634 C CA  . MET A 1 249 ? 9.132  59.463 11.484  1.00 44.91  ? 249 MET A CA  1 
ATOM   1635 C C   . MET A 1 249 ? 8.243  60.442 10.672  1.00 44.12  ? 249 MET A C   1 
ATOM   1636 O O   . MET A 1 249 ? 7.109  60.705 11.062  1.00 43.14  ? 249 MET A O   1 
ATOM   1637 C CB  . MET A 1 249 ? 9.575  60.128 12.796  1.00 46.20  ? 249 MET A CB  1 
ATOM   1638 C CG  . MET A 1 249 ? 10.286 59.172 13.782  1.00 48.59  ? 249 MET A CG  1 
ATOM   1639 S SD  . MET A 1 249 ? 9.268  57.790 14.290  1.00 54.16  ? 249 MET A SD  1 
ATOM   1640 C CE  . MET A 1 249 ? 10.415 56.840 15.284  1.00 51.96  ? 249 MET A CE  1 
ATOM   1641 N N   . SER A 1 250 ? 8.720  60.971 9.549   1.00 42.85  ? 250 SER A N   1 
ATOM   1642 C CA  . SER A 1 250 ? 7.906  61.897 8.771   1.00 41.51  ? 250 SER A CA  1 
ATOM   1643 C C   . SER A 1 250 ? 6.561  61.253 8.393   1.00 41.41  ? 250 SER A C   1 
ATOM   1644 O O   . SER A 1 250 ? 6.463  60.061 8.274   1.00 42.08  ? 250 SER A O   1 
ATOM   1645 C CB  . SER A 1 250 ? 8.665  62.299 7.497   1.00 41.52  ? 250 SER A CB  1 
ATOM   1646 O OG  . SER A 1 250 ? 8.045  63.397 6.850   1.00 40.42  ? 250 SER A OG  1 
ATOM   1647 N N   . PRO A 1 251 ? 5.481  62.042 8.302   1.00 40.66  ? 251 PRO A N   1 
ATOM   1648 C CA  . PRO A 1 251 ? 4.143  61.567 7.920   1.00 38.76  ? 251 PRO A CA  1 
ATOM   1649 C C   . PRO A 1 251 ? 4.278  61.117 6.476   1.00 39.90  ? 251 PRO A C   1 
ATOM   1650 O O   . PRO A 1 251 ? 3.910  60.018 6.085   1.00 43.21  ? 251 PRO A O   1 
ATOM   1651 C CB  . PRO A 1 251 ? 3.327  62.830 7.911   1.00 38.26  ? 251 PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 251 ? 3.873  63.593 9.024   1.00 38.01  ? 251 PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 251 ? 5.345  63.206 9.195   1.00 39.23  ? 251 PRO A CD  1 
ATOM   1654 N N   . VAL A 1 252 ? 4.792  62.057 5.696   1.00 39.78  ? 252 VAL A N   1 
ATOM   1655 C CA  . VAL A 1 252 ? 5.045  61.945 4.278   1.00 42.30  ? 252 VAL A CA  1 
ATOM   1656 C C   . VAL A 1 252 ? 5.738  60.648 3.879   1.00 45.64  ? 252 VAL A C   1 
ATOM   1657 O O   . VAL A 1 252 ? 5.531  60.155 2.773   1.00 46.24  ? 252 VAL A O   1 
ATOM   1658 C CB  . VAL A 1 252 ? 5.917  63.129 3.836   1.00 40.55  ? 252 VAL A CB  1 
ATOM   1659 C CG1 . VAL A 1 252 ? 6.030  63.154 2.352   1.00 40.66  ? 252 VAL A CG1 1 
ATOM   1660 C CG2 . VAL A 1 252 ? 5.350  64.444 4.373   1.00 38.60  ? 252 VAL A CG2 1 
ATOM   1661 N N   . THR A 1 253 ? 6.552  60.088 4.770   1.00 47.24  ? 253 THR A N   1 
ATOM   1662 C CA  . THR A 1 253 ? 7.298  58.872 4.456   1.00 47.99  ? 253 THR A CA  1 
ATOM   1663 C C   . THR A 1 253 ? 7.031  57.715 5.399   1.00 50.82  ? 253 THR A C   1 
ATOM   1664 O O   . THR A 1 253 ? 7.245  56.561 5.029   1.00 50.65  ? 253 THR A O   1 
ATOM   1665 C CB  . THR A 1 253 ? 8.798  59.162 4.467   1.00 46.37  ? 253 THR A CB  1 
ATOM   1666 O OG1 . THR A 1 253 ? 9.164  59.705 5.740   1.00 44.41  ? 253 THR A OG1 1 
ATOM   1667 C CG2 . THR A 1 253 ? 9.158  60.165 3.367   1.00 45.89  ? 253 THR A CG2 1 
ATOM   1668 N N   . ARG A 1 254 ? 6.578  58.029 6.613   1.00 52.56  ? 254 ARG A N   1 
ATOM   1669 C CA  . ARG A 1 254 ? 6.272  57.020 7.632   1.00 55.87  ? 254 ARG A CA  1 
ATOM   1670 C C   . ARG A 1 254 ? 5.734  55.730 6.996   1.00 57.24  ? 254 ARG A C   1 
ATOM   1671 O O   . ARG A 1 254 ? 4.728  55.743 6.269   1.00 55.65  ? 254 ARG A O   1 
ATOM   1672 C CB  . ARG A 1 254 ? 5.243  57.582 8.623   1.00 58.28  ? 254 ARG A CB  1 
ATOM   1673 C CG  . ARG A 1 254 ? 5.291  56.982 10.012  1.00 62.66  ? 254 ARG A CG  1 
ATOM   1674 C CD  . ARG A 1 254 ? 4.319  57.684 10.955  1.00 68.07  ? 254 ARG A CD  1 
ATOM   1675 N NE  . ARG A 1 254 ? 4.685  57.464 12.357  1.00 75.56  ? 254 ARG A NE  1 
ATOM   1676 C CZ  . ARG A 1 254 ? 5.182  58.404 13.167  1.00 80.48  ? 254 ARG A CZ  1 
ATOM   1677 N NH1 . ARG A 1 254 ? 5.355  59.649 12.719  1.00 82.78  ? 254 ARG A NH1 1 
ATOM   1678 N NH2 . ARG A 1 254 ? 5.494  58.109 14.433  1.00 83.15  ? 254 ARG A NH2 1 
ATOM   1679 N N   . GLY A 1 255 ? 6.418  54.619 7.273   1.00 58.15  ? 255 GLY A N   1 
ATOM   1680 C CA  . GLY A 1 255 ? 6.010  53.331 6.734   1.00 57.76  ? 255 GLY A CA  1 
ATOM   1681 C C   . GLY A 1 255 ? 7.076  52.662 5.891   1.00 58.07  ? 255 GLY A C   1 
ATOM   1682 O O   . GLY A 1 255 ? 7.460  51.522 6.148   1.00 59.34  ? 255 GLY A O   1 
ATOM   1683 N N   . LEU A 1 256 ? 7.544  53.379 4.873   1.00 57.25  ? 256 LEU A N   1 
ATOM   1684 C CA  . LEU A 1 256 ? 8.564  52.881 3.962   1.00 56.14  ? 256 LEU A CA  1 
ATOM   1685 C C   . LEU A 1 256 ? 9.717  52.107 4.630   1.00 55.64  ? 256 LEU A C   1 
ATOM   1686 O O   . LEU A 1 256 ? 10.108 51.040 4.139   1.00 57.42  ? 256 LEU A O   1 
ATOM   1687 C CB  . LEU A 1 256 ? 9.127  54.043 3.127   1.00 56.80  ? 256 LEU A CB  1 
ATOM   1688 C CG  . LEU A 1 256 ? 8.355  54.430 1.866   1.00 59.31  ? 256 LEU A CG  1 
ATOM   1689 C CD1 . LEU A 1 256 ? 7.037  55.066 2.254   1.00 59.37  ? 256 LEU A CD1 1 
ATOM   1690 C CD2 . LEU A 1 256 ? 9.183  55.383 1.018   1.00 59.43  ? 256 LEU A CD2 1 
ATOM   1691 N N   . VAL A 1 257 ? 10.251 52.629 5.737   1.00 51.46  ? 257 VAL A N   1 
ATOM   1692 C CA  . VAL A 1 257 ? 11.356 51.981 6.431   1.00 46.17  ? 257 VAL A CA  1 
ATOM   1693 C C   . VAL A 1 257 ? 11.147 52.032 7.946   1.00 44.73  ? 257 VAL A C   1 
ATOM   1694 O O   . VAL A 1 257 ? 10.733 53.054 8.485   1.00 44.29  ? 257 VAL A O   1 
ATOM   1695 C CB  . VAL A 1 257 ? 12.693 52.665 6.089   1.00 45.46  ? 257 VAL A CB  1 
ATOM   1696 C CG1 . VAL A 1 257 ? 13.831 51.696 6.313   1.00 45.13  ? 257 VAL A CG1 1 
ATOM   1697 C CG2 . VAL A 1 257 ? 12.684 53.176 4.653   1.00 41.64  ? 257 VAL A CG2 1 
ATOM   1698 N N   . LYS A 1 258 ? 11.435 50.926 8.626   1.00 43.99  ? 258 LYS A N   1 
ATOM   1699 C CA  . LYS A 1 258 ? 11.260 50.839 10.078  1.00 45.02  ? 258 LYS A CA  1 
ATOM   1700 C C   . LYS A 1 258 ? 12.505 50.310 10.782  1.00 44.24  ? 258 LYS A C   1 
ATOM   1701 O O   . LYS A 1 258 ? 12.432 49.818 11.912  1.00 43.93  ? 258 LYS A O   1 
ATOM   1702 C CB  . LYS A 1 258 ? 10.091 49.916 10.420  1.00 47.10  ? 258 LYS A CB  1 
ATOM   1703 C CG  . LYS A 1 258 ? 8.751  50.364 9.889   1.00 52.46  ? 258 LYS A CG  1 
ATOM   1704 C CD  . LYS A 1 258 ? 7.720  49.271 10.104  1.00 56.89  ? 258 LYS A CD  1 
ATOM   1705 C CE  . LYS A 1 258 ? 6.350  49.715 9.656   1.00 59.35  ? 258 LYS A CE  1 
ATOM   1706 N NZ  . LYS A 1 258 ? 6.408  50.165 8.247   1.00 64.88  ? 258 LYS A NZ  1 
ATOM   1707 N N   . ARG A 1 259 ? 13.640 50.394 10.102  1.00 41.79  ? 259 ARG A N   1 
ATOM   1708 C CA  . ARG A 1 259 ? 14.895 49.929 10.662  1.00 39.42  ? 259 ARG A CA  1 
ATOM   1709 C C   . ARG A 1 259 ? 15.961 50.965 10.325  1.00 37.11  ? 259 ARG A C   1 
ATOM   1710 O O   . ARG A 1 259 ? 16.191 51.262 9.147   1.00 35.48  ? 259 ARG A O   1 
ATOM   1711 C CB  . ARG A 1 259 ? 15.246 48.563 10.070  1.00 38.67  ? 259 ARG A CB  1 
ATOM   1712 C CG  . ARG A 1 259 ? 16.632 48.057 10.435  1.00 41.02  ? 259 ARG A CG  1 
ATOM   1713 C CD  . ARG A 1 259 ? 16.766 46.601 10.057  1.00 41.51  ? 259 ARG A CD  1 
ATOM   1714 N NE  . ARG A 1 259 ? 15.791 45.789 10.776  1.00 40.56  ? 259 ARG A NE  1 
ATOM   1715 C CZ  . ARG A 1 259 ? 15.497 44.528 10.482  1.00 39.77  ? 259 ARG A CZ  1 
ATOM   1716 N NH1 . ARG A 1 259 ? 16.092 43.906 9.473   1.00 39.51  ? 259 ARG A NH1 1 
ATOM   1717 N NH2 . ARG A 1 259 ? 14.609 43.884 11.211  1.00 40.86  ? 259 ARG A NH2 1 
ATOM   1718 N N   . GLY A 1 260 ? 16.601 51.522 11.355  1.00 34.00  ? 260 GLY A N   1 
ATOM   1719 C CA  . GLY A 1 260 ? 17.615 52.536 11.111  1.00 31.64  ? 260 GLY A CA  1 
ATOM   1720 C C   . GLY A 1 260 ? 18.703 52.701 12.154  1.00 30.54  ? 260 GLY A C   1 
ATOM   1721 O O   . GLY A 1 260 ? 18.515 52.410 13.341  1.00 28.99  ? 260 GLY A O   1 
ATOM   1722 N N   . MET A 1 261 ? 19.854 53.175 11.691  1.00 29.98  ? 261 MET A N   1 
ATOM   1723 C CA  . MET A 1 261 ? 20.997 53.396 12.559  1.00 31.61  ? 261 MET A CA  1 
ATOM   1724 C C   . MET A 1 261 ? 21.317 54.876 12.556  1.00 31.38  ? 261 MET A C   1 
ATOM   1725 O O   . MET A 1 261 ? 21.645 55.458 11.510  1.00 32.60  ? 261 MET A O   1 
ATOM   1726 C CB  . MET A 1 261 ? 22.209 52.585 12.069  1.00 29.94  ? 261 MET A CB  1 
ATOM   1727 C CG  . MET A 1 261 ? 23.520 52.901 12.778  1.00 25.70  ? 261 MET A CG  1 
ATOM   1728 S SD  . MET A 1 261 ? 24.954 52.024 12.065  1.00 29.37  ? 261 MET A SD  1 
ATOM   1729 C CE  . MET A 1 261 ? 25.992 51.900 13.483  1.00 27.71  ? 261 MET A CE  1 
ATOM   1730 N N   . MET A 1 262 ? 21.194 55.474 13.727  1.00 30.01  ? 262 MET A N   1 
ATOM   1731 C CA  . MET A 1 262 ? 21.485 56.892 13.891  1.00 29.50  ? 262 MET A CA  1 
ATOM   1732 C C   . MET A 1 262 ? 22.748 57.104 14.717  1.00 29.22  ? 262 MET A C   1 
ATOM   1733 O O   . MET A 1 262 ? 22.757 56.839 15.915  1.00 31.11  ? 262 MET A O   1 
ATOM   1734 C CB  . MET A 1 262 ? 20.297 57.611 14.534  1.00 30.21  ? 262 MET A CB  1 
ATOM   1735 C CG  . MET A 1 262 ? 19.014 57.537 13.722  1.00 30.98  ? 262 MET A CG  1 
ATOM   1736 S SD  . MET A 1 262 ? 17.720 58.613 14.366  1.00 35.92  ? 262 MET A SD  1 
ATOM   1737 C CE  . MET A 1 262 ? 17.298 57.764 15.887  1.00 28.92  ? 262 MET A CE  1 
ATOM   1738 N N   . GLN A 1 263 ? 23.800 57.550 14.047  1.00 29.94  ? 263 GLN A N   1 
ATOM   1739 C CA  . GLN A 1 263 ? 25.098 57.798 14.682  1.00 28.55  ? 263 GLN A CA  1 
ATOM   1740 C C   . GLN A 1 263 ? 25.234 59.274 15.060  1.00 30.60  ? 263 GLN A C   1 
ATOM   1741 O O   . GLN A 1 263 ? 25.314 60.153 14.194  1.00 34.24  ? 263 GLN A O   1 
ATOM   1742 C CB  . GLN A 1 263 ? 26.239 57.428 13.719  1.00 26.76  ? 263 GLN A CB  1 
ATOM   1743 C CG  . GLN A 1 263 ? 26.144 56.016 13.125  1.00 26.78  ? 263 GLN A CG  1 
ATOM   1744 C CD  . GLN A 1 263 ? 27.207 55.715 12.051  1.00 25.31  ? 263 GLN A CD  1 
ATOM   1745 O OE1 . GLN A 1 263 ? 27.113 54.697 11.361  1.00 20.38  ? 263 GLN A OE1 1 
ATOM   1746 N NE2 . GLN A 1 263 ? 28.216 56.588 11.922  1.00 19.89  ? 263 GLN A NE2 1 
ATOM   1747 N N   . SER A 1 264 ? 25.284 59.542 16.355  1.00 30.28  ? 264 SER A N   1 
ATOM   1748 C CA  . SER A 1 264 ? 25.422 60.907 16.843  1.00 32.25  ? 264 SER A CA  1 
ATOM   1749 C C   . SER A 1 264 ? 24.545 61.932 16.123  1.00 33.48  ? 264 SER A C   1 
ATOM   1750 O O   . SER A 1 264 ? 25.038 62.953 15.641  1.00 35.49  ? 264 SER A O   1 
ATOM   1751 C CB  . SER A 1 264 ? 26.880 61.342 16.742  1.00 30.36  ? 264 SER A CB  1 
ATOM   1752 O OG  . SER A 1 264 ? 27.715 60.432 17.443  1.00 31.85  ? 264 SER A OG  1 
ATOM   1753 N N   . GLY A 1 265 ? 23.243 61.684 16.067  1.00 33.47  ? 265 GLY A N   1 
ATOM   1754 C CA  . GLY A 1 265 ? 22.361 62.624 15.403  1.00 33.31  ? 265 GLY A CA  1 
ATOM   1755 C C   . GLY A 1 265 ? 20.896 62.278 15.570  1.00 35.79  ? 265 GLY A C   1 
ATOM   1756 O O   . GLY A 1 265 ? 20.418 61.263 15.057  1.00 37.43  ? 265 GLY A O   1 
ATOM   1757 N N   . THR A 1 266 ? 20.178 63.131 16.293  1.00 35.01  ? 266 THR A N   1 
ATOM   1758 C CA  . THR A 1 266 ? 18.749 62.948 16.529  1.00 35.51  ? 266 THR A CA  1 
ATOM   1759 C C   . THR A 1 266 ? 18.047 64.291 16.385  1.00 35.36  ? 266 THR A C   1 
ATOM   1760 O O   . THR A 1 266 ? 18.575 65.309 16.831  1.00 35.88  ? 266 THR A O   1 
ATOM   1761 C CB  . THR A 1 266 ? 18.480 62.391 17.942  1.00 35.65  ? 266 THR A CB  1 
ATOM   1762 O OG1 . THR A 1 266 ? 19.227 63.139 18.914  1.00 39.73  ? 266 THR A OG1 1 
ATOM   1763 C CG2 . THR A 1 266 ? 18.856 60.918 18.012  1.00 32.92  ? 266 THR A CG2 1 
ATOM   1764 N N   . MET A 1 267 ? 16.861 64.283 15.772  1.00 36.13  ? 267 MET A N   1 
ATOM   1765 C CA  . MET A 1 267 ? 16.042 65.493 15.548  1.00 36.43  ? 267 MET A CA  1 
ATOM   1766 C C   . MET A 1 267 ? 15.804 66.401 16.778  1.00 35.42  ? 267 MET A C   1 
ATOM   1767 O O   . MET A 1 267 ? 15.700 67.623 16.645  1.00 36.58  ? 267 MET A O   1 
ATOM   1768 C CB  . MET A 1 267 ? 14.675 65.096 14.977  1.00 39.22  ? 267 MET A CB  1 
ATOM   1769 C CG  . MET A 1 267 ? 14.694 64.545 13.569  1.00 41.31  ? 267 MET A CG  1 
ATOM   1770 S SD  . MET A 1 267 ? 15.094 65.833 12.384  1.00 45.01  ? 267 MET A SD  1 
ATOM   1771 C CE  . MET A 1 267 ? 13.573 66.730 12.375  1.00 43.90  ? 267 MET A CE  1 
ATOM   1772 N N   . ASN A 1 268 ? 15.687 65.814 17.963  1.00 31.56  ? 268 ASN A N   1 
ATOM   1773 C CA  . ASN A 1 268 ? 15.479 66.606 19.163  1.00 30.34  ? 268 ASN A CA  1 
ATOM   1774 C C   . ASN A 1 268 ? 16.714 67.445 19.511  1.00 29.73  ? 268 ASN A C   1 
ATOM   1775 O O   . ASN A 1 268 ? 16.624 68.403 20.274  1.00 30.08  ? 268 ASN A O   1 
ATOM   1776 C CB  . ASN A 1 268 ? 15.098 65.698 20.337  1.00 30.21  ? 268 ASN A CB  1 
ATOM   1777 C CG  . ASN A 1 268 ? 16.223 64.758 20.758  1.00 32.65  ? 268 ASN A CG  1 
ATOM   1778 O OD1 . ASN A 1 268 ? 16.933 64.189 19.919  1.00 37.10  ? 268 ASN A OD1 1 
ATOM   1779 N ND2 . ASN A 1 268 ? 16.377 64.574 22.067  1.00 30.98  ? 268 ASN A ND2 1 
ATOM   1780 N N   . ALA A 1 269 ? 17.864 67.085 18.955  1.00 29.67  ? 269 ALA A N   1 
ATOM   1781 C CA  . ALA A 1 269 ? 19.093 67.836 19.206  1.00 31.31  ? 269 ALA A CA  1 
ATOM   1782 C C   . ALA A 1 269 ? 18.868 69.306 18.820  1.00 31.95  ? 269 ALA A C   1 
ATOM   1783 O O   . ALA A 1 269 ? 18.171 69.602 17.853  1.00 30.56  ? 269 ALA A O   1 
ATOM   1784 C CB  . ALA A 1 269 ? 20.264 67.235 18.387  1.00 28.05  ? 269 ALA A CB  1 
ATOM   1785 N N   . PRO A 1 270 ? 19.457 70.247 19.571  1.00 33.74  ? 270 PRO A N   1 
ATOM   1786 C CA  . PRO A 1 270 ? 19.292 71.676 19.272  1.00 35.22  ? 270 PRO A CA  1 
ATOM   1787 C C   . PRO A 1 270 ? 19.656 72.130 17.856  1.00 34.33  ? 270 PRO A C   1 
ATOM   1788 O O   . PRO A 1 270 ? 18.968 72.956 17.267  1.00 36.69  ? 270 PRO A O   1 
ATOM   1789 C CB  . PRO A 1 270 ? 20.144 72.358 20.345  1.00 34.31  ? 270 PRO A CB  1 
ATOM   1790 C CG  . PRO A 1 270 ? 21.147 71.305 20.725  1.00 36.54  ? 270 PRO A CG  1 
ATOM   1791 C CD  . PRO A 1 270 ? 20.320 70.054 20.747  1.00 34.87  ? 270 PRO A CD  1 
ATOM   1792 N N   . TRP A 1 271 ? 20.726 71.591 17.300  1.00 33.97  ? 271 TRP A N   1 
ATOM   1793 C CA  . TRP A 1 271 ? 21.148 71.979 15.956  1.00 34.45  ? 271 TRP A CA  1 
ATOM   1794 C C   . TRP A 1 271 ? 20.372 71.312 14.819  1.00 34.67  ? 271 TRP A C   1 
ATOM   1795 O O   . TRP A 1 271 ? 20.569 71.653 13.659  1.00 34.88  ? 271 TRP A O   1 
ATOM   1796 C CB  . TRP A 1 271 ? 22.624 71.633 15.767  1.00 36.10  ? 271 TRP A CB  1 
ATOM   1797 C CG  . TRP A 1 271 ? 22.936 70.176 16.090  1.00 36.55  ? 271 TRP A CG  1 
ATOM   1798 C CD1 . TRP A 1 271 ? 23.371 69.675 17.283  1.00 37.14  ? 271 TRP A CD1 1 
ATOM   1799 C CD2 . TRP A 1 271 ? 22.787 69.053 15.220  1.00 36.15  ? 271 TRP A CD2 1 
ATOM   1800 N NE1 . TRP A 1 271 ? 23.500 68.313 17.210  1.00 35.62  ? 271 TRP A NE1 1 
ATOM   1801 C CE2 . TRP A 1 271 ? 23.146 67.905 15.954  1.00 35.68  ? 271 TRP A CE2 1 
ATOM   1802 C CE3 . TRP A 1 271 ? 22.376 68.902 13.891  1.00 37.39  ? 271 TRP A CE3 1 
ATOM   1803 C CZ2 . TRP A 1 271 ? 23.114 66.628 15.402  1.00 36.97  ? 271 TRP A CZ2 1 
ATOM   1804 C CZ3 . TRP A 1 271 ? 22.344 67.626 13.344  1.00 36.67  ? 271 TRP A CZ3 1 
ATOM   1805 C CH2 . TRP A 1 271 ? 22.709 66.509 14.098  1.00 36.47  ? 271 TRP A CH2 1 
ATOM   1806 N N   . SER A 1 272 ? 19.494 70.371 15.148  1.00 36.30  ? 272 SER A N   1 
ATOM   1807 C CA  . SER A 1 272 ? 18.768 69.610 14.142  1.00 35.08  ? 272 SER A CA  1 
ATOM   1808 C C   . SER A 1 272 ? 17.342 70.031 13.795  1.00 37.33  ? 272 SER A C   1 
ATOM   1809 O O   . SER A 1 272 ? 16.694 69.397 12.964  1.00 38.75  ? 272 SER A O   1 
ATOM   1810 C CB  . SER A 1 272 ? 18.787 68.138 14.548  1.00 34.46  ? 272 SER A CB  1 
ATOM   1811 O OG  . SER A 1 272 ? 18.211 67.326 13.552  1.00 41.48  ? 272 SER A OG  1 
ATOM   1812 N N   . HIS A 1 273 ? 16.821 71.073 14.428  1.00 38.66  ? 273 HIS A N   1 
ATOM   1813 C CA  . HIS A 1 273 ? 15.477 71.522 14.080  1.00 39.52  ? 273 HIS A CA  1 
ATOM   1814 C C   . HIS A 1 273 ? 15.418 73.024 14.205  1.00 40.56  ? 273 HIS A C   1 
ATOM   1815 O O   . HIS A 1 273 ? 16.302 73.633 14.807  1.00 40.27  ? 273 HIS A O   1 
ATOM   1816 C CB  . HIS A 1 273 ? 14.408 70.866 14.957  1.00 38.33  ? 273 HIS A CB  1 
ATOM   1817 C CG  . HIS A 1 273 ? 14.570 71.140 16.410  1.00 39.84  ? 273 HIS A CG  1 
ATOM   1818 N ND1 . HIS A 1 273 ? 15.538 70.529 17.175  1.00 41.74  ? 273 HIS A ND1 1 
ATOM   1819 C CD2 . HIS A 1 273 ? 13.906 71.978 17.238  1.00 41.21  ? 273 HIS A CD2 1 
ATOM   1820 C CE1 . HIS A 1 273 ? 15.464 70.981 18.415  1.00 41.83  ? 273 HIS A CE1 1 
ATOM   1821 N NE2 . HIS A 1 273 ? 14.482 71.861 18.480  1.00 40.77  ? 273 HIS A NE2 1 
ATOM   1822 N N   . MET A 1 274 ? 14.386 73.622 13.621  1.00 42.61  ? 274 MET A N   1 
ATOM   1823 C CA  . MET A 1 274 ? 14.231 75.073 13.634  1.00 43.88  ? 274 MET A CA  1 
ATOM   1824 C C   . MET A 1 274 ? 12.782 75.490 13.376  1.00 45.03  ? 274 MET A C   1 
ATOM   1825 O O   . MET A 1 274 ? 12.091 74.895 12.540  1.00 47.27  ? 274 MET A O   1 
ATOM   1826 C CB  . MET A 1 274 ? 15.145 75.671 12.566  1.00 42.88  ? 274 MET A CB  1 
ATOM   1827 C CG  . MET A 1 274 ? 15.088 77.171 12.437  1.00 44.05  ? 274 MET A CG  1 
ATOM   1828 S SD  . MET A 1 274 ? 16.139 77.744 11.082  1.00 45.75  ? 274 MET A SD  1 
ATOM   1829 C CE  . MET A 1 274 ? 17.683 78.092 11.940  1.00 42.54  ? 274 MET A CE  1 
ATOM   1830 N N   . THR A 1 275 ? 12.322 76.509 14.099  1.00 45.42  ? 275 THR A N   1 
ATOM   1831 C CA  . THR A 1 275 ? 10.954 77.009 13.941  1.00 44.03  ? 275 THR A CA  1 
ATOM   1832 C C   . THR A 1 275 ? 10.741 77.579 12.553  1.00 43.14  ? 275 THR A C   1 
ATOM   1833 O O   . THR A 1 275 ? 11.696 77.870 11.837  1.00 40.10  ? 275 THR A O   1 
ATOM   1834 C CB  . THR A 1 275 ? 10.644 78.151 14.910  1.00 43.09  ? 275 THR A CB  1 
ATOM   1835 O OG1 . THR A 1 275 ? 11.644 79.177 14.771  1.00 43.95  ? 275 THR A OG1 1 
ATOM   1836 C CG2 . THR A 1 275 ? 10.597 77.645 16.325  1.00 38.60  ? 275 THR A CG2 1 
ATOM   1837 N N   . SER A 1 276 ? 9.479  77.760 12.186  1.00 44.86  ? 276 SER A N   1 
ATOM   1838 C CA  . SER A 1 276 ? 9.170  78.334 10.887  1.00 45.17  ? 276 SER A CA  1 
ATOM   1839 C C   . SER A 1 276 ? 9.610  79.789 10.924  1.00 45.26  ? 276 SER A C   1 
ATOM   1840 O O   . SER A 1 276 ? 10.185 80.294 9.962   1.00 44.14  ? 276 SER A O   1 
ATOM   1841 C CB  . SER A 1 276 ? 7.671  78.256 10.600  1.00 43.07  ? 276 SER A CB  1 
ATOM   1842 O OG  . SER A 1 276 ? 7.375  78.849 9.350   1.00 43.07  ? 276 SER A OG  1 
ATOM   1843 N N   . GLU A 1 277 ? 9.354  80.441 12.058  1.00 47.35  ? 277 GLU A N   1 
ATOM   1844 C CA  . GLU A 1 277 ? 9.697  81.846 12.259  1.00 48.84  ? 277 GLU A CA  1 
ATOM   1845 C C   . GLU A 1 277 ? 11.165 82.134 12.040  1.00 48.06  ? 277 GLU A C   1 
ATOM   1846 O O   . GLU A 1 277 ? 11.531 82.980 11.225  1.00 47.35  ? 277 GLU A O   1 
ATOM   1847 C CB  . GLU A 1 277 ? 9.319  82.299 13.674  1.00 54.58  ? 277 GLU A CB  1 
ATOM   1848 C CG  . GLU A 1 277 ? 7.818  82.418 13.961  1.00 61.14  ? 277 GLU A CG  1 
ATOM   1849 C CD  . GLU A 1 277 ? 7.108  81.072 14.034  1.00 64.27  ? 277 GLU A CD  1 
ATOM   1850 O OE1 . GLU A 1 277 ? 7.446  80.255 14.922  1.00 66.34  ? 277 GLU A OE1 1 
ATOM   1851 O OE2 . GLU A 1 277 ? 6.207  80.838 13.201  1.00 66.96  ? 277 GLU A OE2 1 
ATOM   1852 N N   . LYS A 1 278 ? 12.012 81.436 12.783  1.00 49.62  ? 278 LYS A N   1 
ATOM   1853 C CA  . LYS A 1 278 ? 13.447 81.641 12.665  1.00 50.45  ? 278 LYS A CA  1 
ATOM   1854 C C   . LYS A 1 278 ? 13.923 81.424 11.227  1.00 48.54  ? 278 LYS A C   1 
ATOM   1855 O O   . LYS A 1 278 ? 14.804 82.138 10.747  1.00 49.42  ? 278 LYS A O   1 
ATOM   1856 C CB  . LYS A 1 278 ? 14.190 80.707 13.632  1.00 52.73  ? 278 LYS A CB  1 
ATOM   1857 C CG  . LYS A 1 278 ? 15.715 80.842 13.615  1.00 55.03  ? 278 LYS A CG  1 
ATOM   1858 C CD  . LYS A 1 278 ? 16.185 82.240 14.007  1.00 57.73  ? 278 LYS A CD  1 
ATOM   1859 C CE  . LYS A 1 278 ? 17.701 82.368 13.864  1.00 61.21  ? 278 LYS A CE  1 
ATOM   1860 N NZ  . LYS A 1 278 ? 18.203 83.760 14.086  1.00 63.13  ? 278 LYS A NZ  1 
ATOM   1861 N N   . ALA A 1 279 ? 13.329 80.449 10.542  1.00 45.94  ? 279 ALA A N   1 
ATOM   1862 C CA  . ALA A 1 279 ? 13.693 80.147 9.159   1.00 45.13  ? 279 ALA A CA  1 
ATOM   1863 C C   . ALA A 1 279 ? 13.292 81.270 8.196   1.00 44.38  ? 279 ALA A C   1 
ATOM   1864 O O   . ALA A 1 279 ? 14.025 81.571 7.246   1.00 44.10  ? 279 ALA A O   1 
ATOM   1865 C CB  . ALA A 1 279 ? 13.057 78.820 8.720   1.00 44.20  ? 279 ALA A CB  1 
ATOM   1866 N N   . VAL A 1 280 ? 12.131 81.880 8.424   1.00 42.19  ? 280 VAL A N   1 
ATOM   1867 C CA  . VAL A 1 280 ? 11.702 82.969 7.559   1.00 43.94  ? 280 VAL A CA  1 
ATOM   1868 C C   . VAL A 1 280 ? 12.650 84.138 7.747   1.00 44.24  ? 280 VAL A C   1 
ATOM   1869 O O   . VAL A 1 280 ? 13.009 84.813 6.792   1.00 42.80  ? 280 VAL A O   1 
ATOM   1870 C CB  . VAL A 1 280 ? 10.280 83.455 7.883   1.00 44.77  ? 280 VAL A CB  1 
ATOM   1871 C CG1 . VAL A 1 280 ? 10.005 84.755 7.134   1.00 41.89  ? 280 VAL A CG1 1 
ATOM   1872 C CG2 . VAL A 1 280 ? 9.259  82.390 7.497   1.00 42.76  ? 280 VAL A CG2 1 
ATOM   1873 N N   . GLU A 1 281 ? 13.045 84.373 8.993   1.00 45.69  ? 281 GLU A N   1 
ATOM   1874 C CA  . GLU A 1 281 ? 13.966 85.450 9.306   1.00 46.54  ? 281 GLU A CA  1 
ATOM   1875 C C   . GLU A 1 281 ? 15.257 85.208 8.561   1.00 44.92  ? 281 GLU A C   1 
ATOM   1876 O O   . GLU A 1 281 ? 15.683 86.039 7.763   1.00 46.65  ? 281 GLU A O   1 
ATOM   1877 C CB  . GLU A 1 281 ? 14.231 85.503 10.809  1.00 51.81  ? 281 GLU A CB  1 
ATOM   1878 C CG  . GLU A 1 281 ? 13.302 86.453 11.570  1.00 60.19  ? 281 GLU A CG  1 
ATOM   1879 C CD  . GLU A 1 281 ? 12.781 85.872 12.888  1.00 64.83  ? 281 GLU A CD  1 
ATOM   1880 O OE1 . GLU A 1 281 ? 13.489 85.040 13.497  1.00 67.17  ? 281 GLU A OE1 1 
ATOM   1881 O OE2 . GLU A 1 281 ? 11.669 86.258 13.322  1.00 65.54  ? 281 GLU A OE2 1 
ATOM   1882 N N   . ILE A 1 282 ? 15.872 84.060 8.814   1.00 42.57  ? 282 ILE A N   1 
ATOM   1883 C CA  . ILE A 1 282 ? 17.122 83.705 8.151   1.00 43.13  ? 282 ILE A CA  1 
ATOM   1884 C C   . ILE A 1 282 ? 16.962 83.753 6.632   1.00 43.38  ? 282 ILE A C   1 
ATOM   1885 O O   . ILE A 1 282 ? 17.863 84.194 5.914   1.00 41.65  ? 282 ILE A O   1 
ATOM   1886 C CB  . ILE A 1 282 ? 17.586 82.298 8.593   1.00 43.17  ? 282 ILE A CB  1 
ATOM   1887 C CG1 . ILE A 1 282 ? 17.982 82.348 10.071  1.00 41.60  ? 282 ILE A CG1 1 
ATOM   1888 C CG2 . ILE A 1 282 ? 18.745 81.822 7.724   1.00 42.12  ? 282 ILE A CG2 1 
ATOM   1889 C CD1 . ILE A 1 282 ? 18.366 81.031 10.658  1.00 41.09  ? 282 ILE A CD1 1 
ATOM   1890 N N   . GLY A 1 283 ? 15.803 83.304 6.154   1.00 44.12  ? 283 GLY A N   1 
ATOM   1891 C CA  . GLY A 1 283 ? 15.528 83.322 4.729   1.00 45.37  ? 283 GLY A CA  1 
ATOM   1892 C C   . GLY A 1 283 ? 15.565 84.728 4.153   1.00 45.47  ? 283 GLY A C   1 
ATOM   1893 O O   . GLY A 1 283 ? 16.239 84.964 3.155   1.00 43.86  ? 283 GLY A O   1 
ATOM   1894 N N   . LYS A 1 284 ? 14.843 85.656 4.784   1.00 46.11  ? 284 LYS A N   1 
ATOM   1895 C CA  . LYS A 1 284 ? 14.799 87.052 4.339   1.00 47.95  ? 284 LYS A CA  1 
ATOM   1896 C C   . LYS A 1 284 ? 16.191 87.673 4.309   1.00 50.00  ? 284 LYS A C   1 
ATOM   1897 O O   . LYS A 1 284 ? 16.546 88.402 3.367   1.00 50.69  ? 284 LYS A O   1 
ATOM   1898 C CB  . LYS A 1 284 ? 13.930 87.894 5.266   1.00 46.06  ? 284 LYS A CB  1 
ATOM   1899 C CG  . LYS A 1 284 ? 12.452 87.731 5.093   1.00 47.75  ? 284 LYS A CG  1 
ATOM   1900 C CD  . LYS A 1 284 ? 11.754 88.697 6.022   1.00 53.88  ? 284 LYS A CD  1 
ATOM   1901 C CE  . LYS A 1 284 ? 10.241 88.654 5.878   1.00 58.58  ? 284 LYS A CE  1 
ATOM   1902 N NZ  . LYS A 1 284 ? 9.551  89.507 6.906   1.00 60.07  ? 284 LYS A NZ  1 
ATOM   1903 N N   . ALA A 1 285 ? 16.968 87.404 5.356   1.00 48.72  ? 285 ALA A N   1 
ATOM   1904 C CA  . ALA A 1 285 ? 18.320 87.934 5.439   1.00 48.33  ? 285 ALA A CA  1 
ATOM   1905 C C   . ALA A 1 285 ? 19.056 87.553 4.156   1.00 48.35  ? 285 ALA A C   1 
ATOM   1906 O O   . ALA A 1 285 ? 19.602 88.413 3.465   1.00 47.66  ? 285 ALA A O   1 
ATOM   1907 C CB  . ALA A 1 285 ? 19.034 87.366 6.662   1.00 47.85  ? 285 ALA A CB  1 
ATOM   1908 N N   . LEU A 1 286 ? 19.051 86.262 3.836   1.00 48.52  ? 286 LEU A N   1 
ATOM   1909 C CA  . LEU A 1 286 ? 19.704 85.771 2.624   1.00 48.71  ? 286 LEU A CA  1 
ATOM   1910 C C   . LEU A 1 286 ? 19.229 86.578 1.416   1.00 48.23  ? 286 LEU A C   1 
ATOM   1911 O O   . LEU A 1 286 ? 20.029 86.983 0.572   1.00 46.65  ? 286 LEU A O   1 
ATOM   1912 C CB  . LEU A 1 286 ? 19.380 84.287 2.423   1.00 46.68  ? 286 LEU A CB  1 
ATOM   1913 C CG  . LEU A 1 286 ? 19.768 83.645 1.091   1.00 46.64  ? 286 LEU A CG  1 
ATOM   1914 C CD1 . LEU A 1 286 ? 21.276 83.734 0.862   1.00 46.74  ? 286 LEU A CD1 1 
ATOM   1915 C CD2 . LEU A 1 286 ? 19.303 82.199 1.098   1.00 44.94  ? 286 LEU A CD2 1 
ATOM   1916 N N   . ILE A 1 287 ? 17.922 86.812 1.349   1.00 48.36  ? 287 ILE A N   1 
ATOM   1917 C CA  . ILE A 1 287 ? 17.327 87.582 0.268   1.00 49.51  ? 287 ILE A CA  1 
ATOM   1918 C C   . ILE A 1 287 ? 18.048 88.920 0.127   1.00 50.11  ? 287 ILE A C   1 
ATOM   1919 O O   . ILE A 1 287 ? 18.681 89.190 -0.890  1.00 49.78  ? 287 ILE A O   1 
ATOM   1920 C CB  . ILE A 1 287 ? 15.840 87.867 0.541   1.00 50.34  ? 287 ILE A CB  1 
ATOM   1921 C CG1 . ILE A 1 287 ? 15.063 86.555 0.718   1.00 49.47  ? 287 ILE A CG1 1 
ATOM   1922 C CG2 . ILE A 1 287 ? 15.257 88.669 -0.603  1.00 50.82  ? 287 ILE A CG2 1 
ATOM   1923 C CD1 . ILE A 1 287 ? 14.924 85.735 -0.544  1.00 44.15  ? 287 ILE A CD1 1 
ATOM   1924 N N   . ASN A 1 288 ? 17.961 89.753 1.159   1.00 52.31  ? 288 ASN A N   1 
ATOM   1925 C CA  . ASN A 1 288 ? 18.608 91.057 1.122   1.00 54.24  ? 288 ASN A CA  1 
ATOM   1926 C C   . ASN A 1 288 ? 20.099 90.946 0.868   1.00 56.56  ? 288 ASN A C   1 
ATOM   1927 O O   . ASN A 1 288 ? 20.652 91.714 0.093   1.00 58.31  ? 288 ASN A O   1 
ATOM   1928 C CB  . ASN A 1 288 ? 18.346 91.821 2.415   1.00 53.35  ? 288 ASN A CB  1 
ATOM   1929 C CG  . ASN A 1 288 ? 16.910 92.279 2.532   1.00 53.39  ? 288 ASN A CG  1 
ATOM   1930 O OD1 . ASN A 1 288 ? 16.387 92.953 1.645   1.00 54.74  ? 288 ASN A OD1 1 
ATOM   1931 N ND2 . ASN A 1 288 ? 16.262 91.917 3.631   1.00 54.67  ? 288 ASN A ND2 1 
ATOM   1932 N N   . ASP A 1 289 ? 20.752 89.989 1.519   1.00 60.33  ? 289 ASP A N   1 
ATOM   1933 C CA  . ASP A 1 289 ? 22.188 89.789 1.323   1.00 63.89  ? 289 ASP A CA  1 
ATOM   1934 C C   . ASP A 1 289 ? 22.542 89.486 -0.158  1.00 66.29  ? 289 ASP A C   1 
ATOM   1935 O O   . ASP A 1 289 ? 23.700 89.622 -0.556  1.00 66.21  ? 289 ASP A O   1 
ATOM   1936 C CB  . ASP A 1 289 ? 22.694 88.639 2.216   1.00 65.69  ? 289 ASP A CB  1 
ATOM   1937 C CG  . ASP A 1 289 ? 22.689 88.992 3.722   1.00 67.09  ? 289 ASP A CG  1 
ATOM   1938 O OD1 . ASP A 1 289 ? 21.665 89.462 4.250   1.00 68.83  ? 289 ASP A OD1 1 
ATOM   1939 O OD2 . ASP A 1 289 ? 23.714 88.774 4.398   1.00 67.55  ? 289 ASP A OD2 1 
ATOM   1940 N N   . CYS A 1 290 ? 21.550 89.097 -0.967  1.00 69.00  ? 290 CYS A N   1 
ATOM   1941 C CA  . CYS A 1 290 ? 21.759 88.750 -2.392  1.00 70.56  ? 290 CYS A CA  1 
ATOM   1942 C C   . CYS A 1 290 ? 21.327 89.825 -3.401  1.00 72.83  ? 290 CYS A C   1 
ATOM   1943 O O   . CYS A 1 290 ? 21.369 89.612 -4.627  1.00 73.75  ? 290 CYS A O   1 
ATOM   1944 C CB  . CYS A 1 290 ? 21.011 87.458 -2.709  1.00 69.98  ? 290 CYS A CB  1 
ATOM   1945 S SG  . CYS A 1 290 ? 21.615 86.018 -1.844  1.00 66.68  ? 290 CYS A SG  1 
ATOM   1946 N N   . ASN A 1 291 ? 20.888 90.956 -2.853  1.00 74.19  ? 291 ASN A N   1 
ATOM   1947 C CA  . ASN A 1 291 ? 20.433 92.115 -3.604  1.00 76.54  ? 291 ASN A CA  1 
ATOM   1948 C C   . ASN A 1 291 ? 18.924 92.276 -3.693  1.00 76.41  ? 291 ASN A C   1 
ATOM   1949 O O   . ASN A 1 291 ? 18.429 93.393 -3.611  1.00 77.77  ? 291 ASN A O   1 
ATOM   1950 C CB  . ASN A 1 291 ? 21.115 92.176 -4.985  1.00 79.78  ? 291 ASN A CB  1 
ATOM   1951 C CG  . ASN A 1 291 ? 22.622 92.430 -4.858  1.00 83.78  ? 291 ASN A CG  1 
ATOM   1952 O OD1 . ASN A 1 291 ? 23.075 92.943 -3.823  1.00 83.54  ? 291 ASN A OD1 1 
ATOM   1953 N ND2 . ASN A 1 291 ? 23.400 92.081 -5.898  1.00 84.67  ? 291 ASN A ND2 1 
ATOM   1954 N N   . CYS A 1 292 ? 18.190 91.176 -3.805  1.00 74.41  ? 292 CYS A N   1 
ATOM   1955 C CA  . CYS A 1 292 ? 16.736 91.242 -3.869  1.00 73.42  ? 292 CYS A CA  1 
ATOM   1956 C C   . CYS A 1 292 ? 16.207 91.822 -2.564  1.00 74.37  ? 292 CYS A C   1 
ATOM   1957 O O   . CYS A 1 292 ? 16.644 91.434 -1.481  1.00 76.56  ? 292 CYS A O   1 
ATOM   1958 C CB  . CYS A 1 292 ? 16.183 89.856 -4.042  1.00 71.13  ? 292 CYS A CB  1 
ATOM   1959 S SG  . CYS A 1 292 ? 17.270 88.776 -5.039  1.00 69.24  ? 292 CYS A SG  1 
ATOM   1960 N N   . ASN A 1 293 ? 15.256 92.742 -2.649  1.00 75.12  ? 293 ASN A N   1 
ATOM   1961 C CA  . ASN A 1 293 ? 14.746 93.336 -1.426  1.00 77.11  ? 293 ASN A CA  1 
ATOM   1962 C C   . ASN A 1 293 ? 13.630 92.498 -0.835  1.00 75.74  ? 293 ASN A C   1 
ATOM   1963 O O   . ASN A 1 293 ? 12.514 92.442 -1.341  1.00 74.40  ? 293 ASN A O   1 
ATOM   1964 C CB  . ASN A 1 293 ? 14.322 94.783 -1.668  1.00 80.58  ? 293 ASN A CB  1 
ATOM   1965 C CG  . ASN A 1 293 ? 15.480 95.643 -2.141  1.00 84.42  ? 293 ASN A CG  1 
ATOM   1966 O OD1 . ASN A 1 293 ? 16.596 95.530 -1.623  1.00 86.47  ? 293 ASN A OD1 1 
ATOM   1967 N ND2 . ASN A 1 293 ? 15.226 96.506 -3.126  1.00 84.59  ? 293 ASN A ND2 1 
ATOM   1968 N N   . ALA A 1 294 ? 13.994 91.826 0.248   1.00 74.99  ? 294 ALA A N   1 
ATOM   1969 C CA  . ALA A 1 294 ? 13.132 90.932 0.970   1.00 75.15  ? 294 ALA A CA  1 
ATOM   1970 C C   . ALA A 1 294 ? 11.824 91.594 1.344   1.00 75.62  ? 294 ALA A C   1 
ATOM   1971 O O   . ALA A 1 294 ? 10.831 90.914 1.582   1.00 76.16  ? 294 ALA A O   1 
ATOM   1972 C CB  . ALA A 1 294 ? 13.857 90.434 2.205   1.00 74.73  ? 294 ALA A CB  1 
ATOM   1973 N N   . SER A 1 295 ? 11.808 92.921 1.390   1.00 75.62  ? 295 SER A N   1 
ATOM   1974 C CA  . SER A 1 295 ? 10.586 93.629 1.761   1.00 74.42  ? 295 SER A CA  1 
ATOM   1975 C C   . SER A 1 295 ? 9.441  93.434 0.768   1.00 74.37  ? 295 SER A C   1 
ATOM   1976 O O   . SER A 1 295 ? 8.267  93.500 1.145   1.00 73.62  ? 295 SER A O   1 
ATOM   1977 C CB  . SER A 1 295 ? 10.859 95.125 1.927   1.00 73.84  ? 295 SER A CB  1 
ATOM   1978 O OG  . SER A 1 295 ? 11.298 95.705 0.714   1.00 73.45  ? 295 SER A OG  1 
ATOM   1979 N N   . MET A 1 296 ? 9.779  93.196 -0.496  1.00 73.91  ? 296 MET A N   1 
ATOM   1980 C CA  . MET A 1 296 ? 8.767  93.003 -1.525  1.00 74.97  ? 296 MET A CA  1 
ATOM   1981 C C   . MET A 1 296 ? 8.147  91.611 -1.556  1.00 74.77  ? 296 MET A C   1 
ATOM   1982 O O   . MET A 1 296 ? 7.258  91.347 -2.364  1.00 74.76  ? 296 MET A O   1 
ATOM   1983 C CB  . MET A 1 296 ? 9.346  93.334 -2.900  1.00 76.06  ? 296 MET A CB  1 
ATOM   1984 C CG  . MET A 1 296 ? 9.571  94.826 -3.125  1.00 78.49  ? 296 MET A CG  1 
ATOM   1985 S SD  . MET A 1 296 ? 10.119 95.234 -4.797  1.00 80.78  ? 296 MET A SD  1 
ATOM   1986 C CE  . MET A 1 296 ? 8.571  95.106 -5.697  1.00 80.87  ? 296 MET A CE  1 
ATOM   1987 N N   . LEU A 1 297 ? 8.602  90.729 -0.670  1.00 74.41  ? 297 LEU A N   1 
ATOM   1988 C CA  . LEU A 1 297 ? 8.084  89.366 -0.612  1.00 73.38  ? 297 LEU A CA  1 
ATOM   1989 C C   . LEU A 1 297 ? 6.569  89.288 -0.568  1.00 73.70  ? 297 LEU A C   1 
ATOM   1990 O O   . LEU A 1 297 ? 5.973  88.455 -1.243  1.00 73.26  ? 297 LEU A O   1 
ATOM   1991 C CB  . LEU A 1 297 ? 8.646  88.628 0.604   1.00 72.08  ? 297 LEU A CB  1 
ATOM   1992 C CG  . LEU A 1 297 ? 9.811  87.668 0.352   1.00 70.83  ? 297 LEU A CG  1 
ATOM   1993 C CD1 . LEU A 1 297 ? 10.256 87.059 1.663   1.00 70.69  ? 297 LEU A CD1 1 
ATOM   1994 C CD2 . LEU A 1 297 ? 9.384  86.582 -0.619  1.00 69.99  ? 297 LEU A CD2 1 
ATOM   1995 N N   . LYS A 1 298 ? 5.949  90.150 0.232   1.00 75.30  ? 298 LYS A N   1 
ATOM   1996 C CA  . LYS A 1 298 ? 4.495  90.161 0.373   1.00 75.64  ? 298 LYS A CA  1 
ATOM   1997 C C   . LYS A 1 298 ? 3.744  90.753 -0.818  1.00 75.55  ? 298 LYS A C   1 
ATOM   1998 O O   . LYS A 1 298 ? 2.767  90.172 -1.296  1.00 75.05  ? 298 LYS A O   1 
ATOM   1999 C CB  . LYS A 1 298 ? 4.105  90.908 1.655   1.00 75.30  ? 298 LYS A CB  1 
ATOM   2000 C CG  . LYS A 1 298 ? 4.235  90.084 2.933   1.00 73.72  ? 298 LYS A CG  1 
ATOM   2001 C CD  . LYS A 1 298 ? 2.927  89.374 3.295   1.00 74.17  ? 298 LYS A CD  1 
ATOM   2002 C CE  . LYS A 1 298 ? 2.401  88.492 2.161   1.00 74.99  ? 298 LYS A CE  1 
ATOM   2003 N NZ  . LYS A 1 298 ? 1.174  87.733 2.536   1.00 74.18  ? 298 LYS A NZ  1 
ATOM   2004 N N   . THR A 1 299 ? 4.205  91.906 -1.294  1.00 75.77  ? 299 THR A N   1 
ATOM   2005 C CA  . THR A 1 299 ? 3.571  92.585 -2.417  1.00 76.26  ? 299 THR A CA  1 
ATOM   2006 C C   . THR A 1 299 ? 3.805  91.866 -3.741  1.00 75.82  ? 299 THR A C   1 
ATOM   2007 O O   . THR A 1 299 ? 2.858  91.434 -4.391  1.00 75.27  ? 299 THR A O   1 
ATOM   2008 C CB  . THR A 1 299 ? 4.078  94.039 -2.541  1.00 77.09  ? 299 THR A CB  1 
ATOM   2009 O OG1 . THR A 1 299 ? 5.476  94.041 -2.860  1.00 77.31  ? 299 THR A OG1 1 
ATOM   2010 C CG2 . THR A 1 299 ? 3.865  94.783 -1.230  1.00 77.43  ? 299 THR A CG2 1 
ATOM   2011 N N   . ASN A 1 300 ? 5.070  91.745 -4.133  1.00 75.81  ? 300 ASN A N   1 
ATOM   2012 C CA  . ASN A 1 300 ? 5.439  91.079 -5.379  1.00 74.97  ? 300 ASN A CA  1 
ATOM   2013 C C   . ASN A 1 300 ? 6.305  89.847 -5.151  1.00 72.46  ? 300 ASN A C   1 
ATOM   2014 O O   . ASN A 1 300 ? 7.510  89.876 -5.394  1.00 70.93  ? 300 ASN A O   1 
ATOM   2015 C CB  . ASN A 1 300 ? 6.186  92.044 -6.299  1.00 77.85  ? 300 ASN A CB  1 
ATOM   2016 C CG  . ASN A 1 300 ? 5.254  92.871 -7.149  1.00 79.72  ? 300 ASN A CG  1 
ATOM   2017 O OD1 . ASN A 1 300 ? 4.515  92.337 -7.975  1.00 81.58  ? 300 ASN A OD1 1 
ATOM   2018 N ND2 . ASN A 1 300 ? 5.280  94.182 -6.953  1.00 81.62  ? 300 ASN A ND2 1 
ATOM   2019 N N   . PRO A 1 301 ? 5.694  88.744 -4.689  1.00 71.22  ? 301 PRO A N   1 
ATOM   2020 C CA  . PRO A 1 301 ? 6.421  87.498 -4.431  1.00 69.50  ? 301 PRO A CA  1 
ATOM   2021 C C   . PRO A 1 301 ? 7.210  87.046 -5.649  1.00 68.52  ? 301 PRO A C   1 
ATOM   2022 O O   . PRO A 1 301 ? 8.431  86.946 -5.609  1.00 67.62  ? 301 PRO A O   1 
ATOM   2023 C CB  . PRO A 1 301 ? 5.307  86.516 -4.082  1.00 69.09  ? 301 PRO A CB  1 
ATOM   2024 C CG  . PRO A 1 301 ? 4.274  87.388 -3.445  1.00 70.24  ? 301 PRO A CG  1 
ATOM   2025 C CD  . PRO A 1 301 ? 4.266  88.592 -4.357  1.00 71.13  ? 301 PRO A CD  1 
ATOM   2026 N N   . ALA A 1 302 ? 6.494  86.784 -6.734  1.00 67.99  ? 302 ALA A N   1 
ATOM   2027 C CA  . ALA A 1 302 ? 7.099  86.321 -7.973  1.00 67.43  ? 302 ALA A CA  1 
ATOM   2028 C C   . ALA A 1 302 ? 8.363  87.070 -8.387  1.00 67.41  ? 302 ALA A C   1 
ATOM   2029 O O   . ALA A 1 302 ? 9.276  86.478 -8.965  1.00 68.83  ? 302 ALA A O   1 
ATOM   2030 C CB  . ALA A 1 302 ? 6.072  86.380 -9.096  1.00 66.84  ? 302 ALA A CB  1 
ATOM   2031 N N   . HIS A 1 303 ? 8.428  88.360 -8.080  1.00 66.79  ? 303 HIS A N   1 
ATOM   2032 C CA  . HIS A 1 303 ? 9.578  89.161 -8.476  1.00 65.60  ? 303 HIS A CA  1 
ATOM   2033 C C   . HIS A 1 303 ? 10.872 88.883 -7.721  1.00 63.82  ? 303 HIS A C   1 
ATOM   2034 O O   . HIS A 1 303 ? 11.920 88.686 -8.340  1.00 62.46  ? 303 HIS A O   1 
ATOM   2035 C CB  . HIS A 1 303 ? 9.239  90.650 -8.379  1.00 69.15  ? 303 HIS A CB  1 
ATOM   2036 C CG  . HIS A 1 303 ? 10.163 91.524 -9.168  1.00 73.42  ? 303 HIS A CG  1 
ATOM   2037 N ND1 . HIS A 1 303 ? 11.484 91.716 -8.823  1.00 75.64  ? 303 HIS A ND1 1 
ATOM   2038 C CD2 . HIS A 1 303 ? 9.972  92.211 -10.320 1.00 74.19  ? 303 HIS A CD2 1 
ATOM   2039 C CE1 . HIS A 1 303 ? 12.068 92.480 -9.730  1.00 75.86  ? 303 HIS A CE1 1 
ATOM   2040 N NE2 . HIS A 1 303 ? 11.172 92.793 -10.649 1.00 75.88  ? 303 HIS A NE2 1 
ATOM   2041 N N   . VAL A 1 304 ? 10.812 88.875 -6.392  1.00 61.56  ? 304 VAL A N   1 
ATOM   2042 C CA  . VAL A 1 304 ? 12.011 88.629 -5.594  1.00 59.96  ? 304 VAL A CA  1 
ATOM   2043 C C   . VAL A 1 304 ? 12.508 87.201 -5.813  1.00 58.60  ? 304 VAL A C   1 
ATOM   2044 O O   . VAL A 1 304 ? 13.707 86.943 -5.831  1.00 57.52  ? 304 VAL A O   1 
ATOM   2045 C CB  . VAL A 1 304 ? 11.754 88.883 -4.077  1.00 60.02  ? 304 VAL A CB  1 
ATOM   2046 C CG1 . VAL A 1 304 ? 10.940 90.157 -3.896  1.00 61.04  ? 304 VAL A CG1 1 
ATOM   2047 C CG2 . VAL A 1 304 ? 11.040 87.713 -3.448  1.00 61.36  ? 304 VAL A CG2 1 
ATOM   2048 N N   . MET A 1 305 ? 11.577 86.274 -5.995  1.00 58.26  ? 305 MET A N   1 
ATOM   2049 C CA  . MET A 1 305 ? 11.938 84.889 -6.234  1.00 57.76  ? 305 MET A CA  1 
ATOM   2050 C C   . MET A 1 305 ? 12.655 84.805 -7.564  1.00 57.78  ? 305 MET A C   1 
ATOM   2051 O O   . MET A 1 305 ? 13.641 84.085 -7.703  1.00 57.68  ? 305 MET A O   1 
ATOM   2052 C CB  . MET A 1 305 ? 10.693 84.005 -6.253  1.00 57.23  ? 305 MET A CB  1 
ATOM   2053 C CG  . MET A 1 305 ? 10.084 83.779 -4.875  1.00 55.85  ? 305 MET A CG  1 
ATOM   2054 S SD  . MET A 1 305 ? 11.281 83.121 -3.690  1.00 54.57  ? 305 MET A SD  1 
ATOM   2055 C CE  . MET A 1 305 ? 11.686 81.553 -4.473  1.00 54.01  ? 305 MET A CE  1 
ATOM   2056 N N   . SER A 1 306 ? 12.150 85.543 -8.546  1.00 58.39  ? 306 SER A N   1 
ATOM   2057 C CA  . SER A 1 306 ? 12.770 85.568 -9.864  1.00 59.57  ? 306 SER A CA  1 
ATOM   2058 C C   . SER A 1 306 ? 14.190 86.119 -9.735  1.00 58.82  ? 306 SER A C   1 
ATOM   2059 O O   . SER A 1 306 ? 15.087 85.749 -10.493 1.00 58.58  ? 306 SER A O   1 
ATOM   2060 C CB  . SER A 1 306 ? 11.960 86.446 -10.820 1.00 60.84  ? 306 SER A CB  1 
ATOM   2061 O OG  . SER A 1 306 ? 12.651 86.626 -12.046 1.00 62.12  ? 306 SER A OG  1 
ATOM   2062 N N   . CYS A 1 307 ? 14.379 87.010 -8.766  1.00 58.66  ? 307 CYS A N   1 
ATOM   2063 C CA  . CYS A 1 307 ? 15.679 87.611 -8.511  1.00 58.95  ? 307 CYS A CA  1 
ATOM   2064 C C   . CYS A 1 307 ? 16.586 86.555 -7.899  1.00 58.22  ? 307 CYS A C   1 
ATOM   2065 O O   . CYS A 1 307 ? 17.722 86.368 -8.345  1.00 57.32  ? 307 CYS A O   1 
ATOM   2066 C CB  . CYS A 1 307 ? 15.515 88.776 -7.550  1.00 61.77  ? 307 CYS A CB  1 
ATOM   2067 S SG  . CYS A 1 307 ? 17.064 89.551 -6.961  1.00 66.45  ? 307 CYS A SG  1 
ATOM   2068 N N   . MET A 1 308 ? 16.063 85.864 -6.884  1.00 56.15  ? 308 MET A N   1 
ATOM   2069 C CA  . MET A 1 308 ? 16.802 84.821 -6.183  1.00 53.63  ? 308 MET A CA  1 
ATOM   2070 C C   . MET A 1 308 ? 17.213 83.669 -7.086  1.00 53.25  ? 308 MET A C   1 
ATOM   2071 O O   . MET A 1 308 ? 18.247 83.044 -6.864  1.00 55.01  ? 308 MET A O   1 
ATOM   2072 C CB  . MET A 1 308 ? 15.986 84.277 -5.012  1.00 52.35  ? 308 MET A CB  1 
ATOM   2073 C CG  . MET A 1 308 ? 15.769 85.253 -3.868  1.00 51.21  ? 308 MET A CG  1 
ATOM   2074 S SD  . MET A 1 308 ? 17.263 85.903 -3.075  1.00 50.01  ? 308 MET A SD  1 
ATOM   2075 C CE  . MET A 1 308 ? 18.461 84.684 -3.445  1.00 51.02  ? 308 MET A CE  1 
ATOM   2076 N N   . ARG A 1 309 ? 16.409 83.372 -8.097  1.00 52.20  ? 309 ARG A N   1 
ATOM   2077 C CA  . ARG A 1 309 ? 16.758 82.298 -9.007  1.00 52.43  ? 309 ARG A CA  1 
ATOM   2078 C C   . ARG A 1 309 ? 17.672 82.848 -10.080 1.00 54.32  ? 309 ARG A C   1 
ATOM   2079 O O   . ARG A 1 309 ? 18.000 82.153 -11.033 1.00 56.08  ? 309 ARG A O   1 
ATOM   2080 C CB  . ARG A 1 309 ? 15.516 81.708 -9.658  1.00 50.32  ? 309 ARG A CB  1 
ATOM   2081 C CG  . ARG A 1 309 ? 14.616 80.991 -8.699  1.00 49.97  ? 309 ARG A CG  1 
ATOM   2082 C CD  . ARG A 1 309 ? 13.795 79.941 -9.418  1.00 50.91  ? 309 ARG A CD  1 
ATOM   2083 N NE  . ARG A 1 309 ? 12.934 79.219 -8.492  1.00 51.91  ? 309 ARG A NE  1 
ATOM   2084 C CZ  . ARG A 1 309 ? 11.851 79.745 -7.935  1.00 52.16  ? 309 ARG A CZ  1 
ATOM   2085 N NH1 . ARG A 1 309 ? 11.511 80.991 -8.228  1.00 51.99  ? 309 ARG A NH1 1 
ATOM   2086 N NH2 . ARG A 1 309 ? 11.124 79.038 -7.077  1.00 53.76  ? 309 ARG A NH2 1 
ATOM   2087 N N   . SER A 1 310 ? 18.093 84.098 -9.917  1.00 56.65  ? 310 SER A N   1 
ATOM   2088 C CA  . SER A 1 310 ? 18.969 84.737 -10.894 1.00 58.53  ? 310 SER A CA  1 
ATOM   2089 C C   . SER A 1 310 ? 20.401 84.911 -10.396 1.00 58.74  ? 310 SER A C   1 
ATOM   2090 O O   . SER A 1 310 ? 21.345 84.864 -11.185 1.00 59.00  ? 310 SER A O   1 
ATOM   2091 C CB  . SER A 1 310 ? 18.389 86.090 -11.296 1.00 59.81  ? 310 SER A CB  1 
ATOM   2092 O OG  . SER A 1 310 ? 17.086 85.921 -11.827 1.00 62.65  ? 310 SER A OG  1 
ATOM   2093 N N   . VAL A 1 311 ? 20.566 85.112 -9.092  1.00 57.49  ? 311 VAL A N   1 
ATOM   2094 C CA  . VAL A 1 311 ? 21.901 85.278 -8.541  1.00 57.85  ? 311 VAL A CA  1 
ATOM   2095 C C   . VAL A 1 311 ? 22.671 83.967 -8.681  1.00 58.58  ? 311 VAL A C   1 
ATOM   2096 O O   . VAL A 1 311 ? 22.076 82.890 -8.662  1.00 58.76  ? 311 VAL A O   1 
ATOM   2097 C CB  . VAL A 1 311 ? 21.834 85.726 -7.062  1.00 56.76  ? 311 VAL A CB  1 
ATOM   2098 C CG1 . VAL A 1 311 ? 20.457 85.450 -6.505  1.00 55.22  ? 311 VAL A CG1 1 
ATOM   2099 C CG2 . VAL A 1 311 ? 22.901 85.017 -6.246  1.00 57.48  ? 311 VAL A CG2 1 
ATOM   2100 N N   . ASP A 1 312 ? 23.990 84.066 -8.843  1.00 59.60  ? 312 ASP A N   1 
ATOM   2101 C CA  . ASP A 1 312 ? 24.851 82.887 -8.995  1.00 58.72  ? 312 ASP A CA  1 
ATOM   2102 C C   . ASP A 1 312 ? 24.863 82.015 -7.751  1.00 56.15  ? 312 ASP A C   1 
ATOM   2103 O O   . ASP A 1 312 ? 24.889 82.518 -6.626  1.00 54.83  ? 312 ASP A O   1 
ATOM   2104 C CB  . ASP A 1 312 ? 26.298 83.304 -9.300  1.00 62.55  ? 312 ASP A CB  1 
ATOM   2105 C CG  . ASP A 1 312 ? 26.461 83.913 -10.680 1.00 64.63  ? 312 ASP A CG  1 
ATOM   2106 O OD1 . ASP A 1 312 ? 25.845 84.970 -10.944 1.00 68.16  ? 312 ASP A OD1 1 
ATOM   2107 O OD2 . ASP A 1 312 ? 27.207 83.334 -11.500 1.00 64.96  ? 312 ASP A OD2 1 
ATOM   2108 N N   . ALA A 1 313 ? 24.868 80.705 -7.963  1.00 54.16  ? 313 ALA A N   1 
ATOM   2109 C CA  . ALA A 1 313 ? 24.890 79.754 -6.859  1.00 54.11  ? 313 ALA A CA  1 
ATOM   2110 C C   . ALA A 1 313 ? 25.972 80.117 -5.848  1.00 53.88  ? 313 ALA A C   1 
ATOM   2111 O O   . ALA A 1 313 ? 25.744 80.052 -4.641  1.00 53.89  ? 313 ALA A O   1 
ATOM   2112 C CB  . ALA A 1 313 ? 25.125 78.350 -7.387  1.00 52.24  ? 313 ALA A CB  1 
ATOM   2113 N N   . LYS A 1 314 ? 27.144 80.509 -6.340  1.00 53.79  ? 314 LYS A N   1 
ATOM   2114 C CA  . LYS A 1 314 ? 28.248 80.877 -5.460  1.00 54.25  ? 314 LYS A CA  1 
ATOM   2115 C C   . LYS A 1 314 ? 27.902 82.036 -4.524  1.00 53.38  ? 314 LYS A C   1 
ATOM   2116 O O   . LYS A 1 314 ? 28.372 82.080 -3.388  1.00 53.82  ? 314 LYS A O   1 
ATOM   2117 C CB  . LYS A 1 314 ? 29.489 81.228 -6.285  1.00 55.78  ? 314 LYS A CB  1 
ATOM   2118 C CG  . LYS A 1 314 ? 30.741 80.449 -5.874  1.00 58.78  ? 314 LYS A CG  1 
ATOM   2119 C CD  . LYS A 1 314 ? 31.241 80.874 -4.502  1.00 61.05  ? 314 LYS A CD  1 
ATOM   2120 C CE  . LYS A 1 314 ? 32.173 79.830 -3.885  1.00 63.03  ? 314 LYS A CE  1 
ATOM   2121 N NZ  . LYS A 1 314 ? 33.420 79.591 -4.657  1.00 65.94  ? 314 LYS A NZ  1 
ATOM   2122 N N   . THR A 1 315 ? 27.081 82.970 -4.994  1.00 52.36  ? 315 THR A N   1 
ATOM   2123 C CA  . THR A 1 315 ? 26.691 84.115 -4.172  1.00 51.69  ? 315 THR A CA  1 
ATOM   2124 C C   . THR A 1 315 ? 25.871 83.615 -2.987  1.00 49.68  ? 315 THR A C   1 
ATOM   2125 O O   . THR A 1 315 ? 26.144 83.965 -1.837  1.00 48.87  ? 315 THR A O   1 
ATOM   2126 C CB  . THR A 1 315 ? 25.859 85.140 -4.991  1.00 53.42  ? 315 THR A CB  1 
ATOM   2127 O OG1 . THR A 1 315 ? 26.634 85.594 -6.107  1.00 57.41  ? 315 THR A OG1 1 
ATOM   2128 C CG2 . THR A 1 315 ? 25.474 86.342 -4.138  1.00 50.81  ? 315 THR A CG2 1 
ATOM   2129 N N   . ILE A 1 316 ? 24.871 82.789 -3.280  1.00 46.76  ? 316 ILE A N   1 
ATOM   2130 C CA  . ILE A 1 316 ? 24.014 82.213 -2.253  1.00 43.03  ? 316 ILE A CA  1 
ATOM   2131 C C   . ILE A 1 316 ? 24.877 81.355 -1.332  1.00 42.73  ? 316 ILE A C   1 
ATOM   2132 O O   . ILE A 1 316 ? 24.780 81.428 -0.106  1.00 40.28  ? 316 ILE A O   1 
ATOM   2133 C CB  . ILE A 1 316 ? 22.931 81.316 -2.882  1.00 41.08  ? 316 ILE A CB  1 
ATOM   2134 C CG1 . ILE A 1 316 ? 21.960 82.164 -3.700  1.00 37.00  ? 316 ILE A CG1 1 
ATOM   2135 C CG2 . ILE A 1 316 ? 22.212 80.528 -1.796  1.00 39.44  ? 316 ILE A CG2 1 
ATOM   2136 C CD1 . ILE A 1 316 ? 21.034 81.334 -4.560  1.00 38.12  ? 316 ILE A CD1 1 
ATOM   2137 N N   . SER A 1 317 ? 25.727 80.545 -1.945  1.00 42.21  ? 317 SER A N   1 
ATOM   2138 C CA  . SER A 1 317 ? 26.606 79.671 -1.207  1.00 44.50  ? 317 SER A CA  1 
ATOM   2139 C C   . SER A 1 317 ? 27.341 80.419 -0.100  1.00 45.62  ? 317 SER A C   1 
ATOM   2140 O O   . SER A 1 317 ? 27.463 79.913 1.020   1.00 47.25  ? 317 SER A O   1 
ATOM   2141 C CB  . SER A 1 317 ? 27.608 79.034 -2.159  1.00 46.22  ? 317 SER A CB  1 
ATOM   2142 O OG  . SER A 1 317 ? 28.382 78.061 -1.485  1.00 53.04  ? 317 SER A OG  1 
ATOM   2143 N N   . VAL A 1 318 ? 27.820 81.624 -0.407  1.00 45.39  ? 318 VAL A N   1 
ATOM   2144 C CA  . VAL A 1 318 ? 28.548 82.422 0.574   1.00 44.47  ? 318 VAL A CA  1 
ATOM   2145 C C   . VAL A 1 318 ? 27.657 83.254 1.502   1.00 45.68  ? 318 VAL A C   1 
ATOM   2146 O O   . VAL A 1 318 ? 27.742 83.130 2.725   1.00 45.90  ? 318 VAL A O   1 
ATOM   2147 C CB  . VAL A 1 318 ? 29.557 83.366 -0.114  1.00 44.05  ? 318 VAL A CB  1 
ATOM   2148 C CG1 . VAL A 1 318 ? 30.209 84.269 0.921   1.00 43.60  ? 318 VAL A CG1 1 
ATOM   2149 C CG2 . VAL A 1 318 ? 30.626 82.556 -0.832  1.00 39.99  ? 318 VAL A CG2 1 
ATOM   2150 N N   . GLN A 1 319 ? 26.800 84.090 0.927   1.00 45.32  ? 319 GLN A N   1 
ATOM   2151 C CA  . GLN A 1 319 ? 25.922 84.949 1.720   1.00 46.00  ? 319 GLN A CA  1 
ATOM   2152 C C   . GLN A 1 319 ? 25.044 84.248 2.749   1.00 46.87  ? 319 GLN A C   1 
ATOM   2153 O O   . GLN A 1 319 ? 24.611 84.874 3.718   1.00 47.67  ? 319 GLN A O   1 
ATOM   2154 C CB  . GLN A 1 319 ? 25.034 85.793 0.798   1.00 45.86  ? 319 GLN A CB  1 
ATOM   2155 C CG  . GLN A 1 319 ? 25.829 86.658 -0.159  1.00 46.41  ? 319 GLN A CG  1 
ATOM   2156 C CD  . GLN A 1 319 ? 26.871 87.498 0.565   1.00 46.64  ? 319 GLN A CD  1 
ATOM   2157 O OE1 . GLN A 1 319 ? 27.944 87.783 0.028   1.00 44.33  ? 319 GLN A OE1 1 
ATOM   2158 N NE2 . GLN A 1 319 ? 26.555 87.898 1.788   1.00 45.23  ? 319 GLN A NE2 1 
ATOM   2159 N N   . GLN A 1 320 ? 24.763 82.964 2.549   1.00 46.51  ? 320 GLN A N   1 
ATOM   2160 C CA  . GLN A 1 320 ? 23.915 82.249 3.498   1.00 46.11  ? 320 GLN A CA  1 
ATOM   2161 C C   . GLN A 1 320 ? 24.615 82.150 4.855   1.00 47.42  ? 320 GLN A C   1 
ATOM   2162 O O   . GLN A 1 320 ? 23.974 82.191 5.908   1.00 46.68  ? 320 GLN A O   1 
ATOM   2163 C CB  . GLN A 1 320 ? 23.586 80.844 2.982   1.00 42.47  ? 320 GLN A CB  1 
ATOM   2164 C CG  . GLN A 1 320 ? 24.729 79.848 3.093   1.00 38.92  ? 320 GLN A CG  1 
ATOM   2165 C CD  . GLN A 1 320 ? 24.321 78.465 2.636   1.00 36.28  ? 320 GLN A CD  1 
ATOM   2166 O OE1 . GLN A 1 320 ? 23.233 78.000 2.956   1.00 36.25  ? 320 GLN A OE1 1 
ATOM   2167 N NE2 . GLN A 1 320 ? 25.194 77.798 1.896   1.00 32.83  ? 320 GLN A NE2 1 
ATOM   2168 N N   . TRP A 1 321 ? 25.937 82.038 4.821   1.00 48.89  ? 321 TRP A N   1 
ATOM   2169 C CA  . TRP A 1 321 ? 26.717 81.921 6.040   1.00 50.27  ? 321 TRP A CA  1 
ATOM   2170 C C   . TRP A 1 321 ? 26.705 83.123 6.966   1.00 51.16  ? 321 TRP A C   1 
ATOM   2171 O O   . TRP A 1 321 ? 27.087 83.008 8.121   1.00 51.28  ? 321 TRP A O   1 
ATOM   2172 C CB  . TRP A 1 321 ? 28.159 81.564 5.706   1.00 51.70  ? 321 TRP A CB  1 
ATOM   2173 C CG  . TRP A 1 321 ? 28.324 80.120 5.411   1.00 53.24  ? 321 TRP A CG  1 
ATOM   2174 C CD1 . TRP A 1 321 ? 28.490 79.544 4.187   1.00 53.15  ? 321 TRP A CD1 1 
ATOM   2175 C CD2 . TRP A 1 321 ? 28.294 79.052 6.362   1.00 53.98  ? 321 TRP A CD2 1 
ATOM   2176 N NE1 . TRP A 1 321 ? 28.565 78.180 4.316   1.00 56.41  ? 321 TRP A NE1 1 
ATOM   2177 C CE2 . TRP A 1 321 ? 28.447 77.850 5.642   1.00 55.64  ? 321 TRP A CE2 1 
ATOM   2178 C CE3 . TRP A 1 321 ? 28.150 78.995 7.754   1.00 53.87  ? 321 TRP A CE3 1 
ATOM   2179 C CZ2 . TRP A 1 321 ? 28.461 76.600 6.266   1.00 56.19  ? 321 TRP A CZ2 1 
ATOM   2180 C CZ3 . TRP A 1 321 ? 28.164 77.757 8.373   1.00 55.28  ? 321 TRP A CZ3 1 
ATOM   2181 C CH2 . TRP A 1 321 ? 28.319 76.574 7.628   1.00 56.66  ? 321 TRP A CH2 1 
ATOM   2182 N N   . ASN A 1 322 ? 26.271 84.277 6.480   1.00 52.70  ? 322 ASN A N   1 
ATOM   2183 C CA  . ASN A 1 322 ? 26.238 85.445 7.345   1.00 54.72  ? 322 ASN A CA  1 
ATOM   2184 C C   . ASN A 1 322 ? 25.356 85.161 8.547   1.00 55.45  ? 322 ASN A C   1 
ATOM   2185 O O   . ASN A 1 322 ? 25.580 85.697 9.626   1.00 56.73  ? 322 ASN A O   1 
ATOM   2186 C CB  . ASN A 1 322 ? 25.718 86.675 6.593   1.00 54.88  ? 322 ASN A CB  1 
ATOM   2187 C CG  . ASN A 1 322 ? 26.641 87.102 5.469   1.00 56.55  ? 322 ASN A CG  1 
ATOM   2188 O OD1 . ASN A 1 322 ? 27.863 87.127 5.630   1.00 56.40  ? 322 ASN A OD1 1 
ATOM   2189 N ND2 . ASN A 1 322 ? 26.062 87.448 4.326   1.00 56.43  ? 322 ASN A ND2 1 
ATOM   2190 N N   . SER A 1 323 ? 24.365 84.297 8.359   1.00 58.16  ? 323 SER A N   1 
ATOM   2191 C CA  . SER A 1 323 ? 23.440 83.947 9.431   1.00 61.22  ? 323 SER A CA  1 
ATOM   2192 C C   . SER A 1 323 ? 23.992 82.937 10.429  1.00 63.21  ? 323 SER A C   1 
ATOM   2193 O O   . SER A 1 323 ? 23.236 82.378 11.222  1.00 63.79  ? 323 SER A O   1 
ATOM   2194 C CB  . SER A 1 323 ? 22.132 83.414 8.847   1.00 60.62  ? 323 SER A CB  1 
ATOM   2195 O OG  . SER A 1 323 ? 21.406 84.444 8.204   1.00 62.01  ? 323 SER A OG  1 
ATOM   2196 N N   . TYR A 1 324 ? 25.300 82.698 10.393  1.00 65.30  ? 324 TYR A N   1 
ATOM   2197 C CA  . TYR A 1 324 ? 25.919 81.761 11.329  1.00 68.69  ? 324 TYR A CA  1 
ATOM   2198 C C   . TYR A 1 324 ? 26.288 82.512 12.615  1.00 69.64  ? 324 TYR A C   1 
ATOM   2199 O O   . TYR A 1 324 ? 27.367 83.100 12.710  1.00 69.54  ? 324 TYR A O   1 
ATOM   2200 C CB  . TYR A 1 324 ? 27.174 81.147 10.712  1.00 70.50  ? 324 TYR A CB  1 
ATOM   2201 C CG  . TYR A 1 324 ? 27.803 80.085 11.576  1.00 72.73  ? 324 TYR A CG  1 
ATOM   2202 C CD1 . TYR A 1 324 ? 27.251 78.808 11.656  1.00 72.99  ? 324 TYR A CD1 1 
ATOM   2203 C CD2 . TYR A 1 324 ? 28.933 80.365 12.340  1.00 74.64  ? 324 TYR A CD2 1 
ATOM   2204 C CE1 . TYR A 1 324 ? 27.811 77.833 12.479  1.00 74.98  ? 324 TYR A CE1 1 
ATOM   2205 C CE2 . TYR A 1 324 ? 29.502 79.401 13.168  1.00 76.14  ? 324 TYR A CE2 1 
ATOM   2206 C CZ  . TYR A 1 324 ? 28.939 78.136 13.234  1.00 75.88  ? 324 TYR A CZ  1 
ATOM   2207 O OH  . TYR A 1 324 ? 29.512 77.183 14.050  1.00 76.74  ? 324 TYR A OH  1 
ATOM   2208 N N   . SER A 1 325 ? 25.390 82.476 13.598  1.00 70.13  ? 325 SER A N   1 
ATOM   2209 C CA  . SER A 1 325 ? 25.574 83.181 14.870  1.00 70.83  ? 325 SER A CA  1 
ATOM   2210 C C   . SER A 1 325 ? 26.519 82.518 15.866  1.00 70.31  ? 325 SER A C   1 
ATOM   2211 O O   . SER A 1 325 ? 27.686 82.895 15.987  1.00 70.26  ? 325 SER A O   1 
ATOM   2212 C CB  . SER A 1 325 ? 24.215 83.382 15.542  1.00 71.50  ? 325 SER A CB  1 
ATOM   2213 O OG  . SER A 1 325 ? 23.606 82.131 15.821  1.00 72.46  ? 325 SER A OG  1 
ATOM   2214 N N   . GLY A 1 326 ? 25.996 81.542 16.600  1.00 69.27  ? 326 GLY A N   1 
ATOM   2215 C CA  . GLY A 1 326 ? 26.812 80.848 17.576  1.00 66.84  ? 326 GLY A CA  1 
ATOM   2216 C C   . GLY A 1 326 ? 27.299 79.494 17.104  1.00 64.12  ? 326 GLY A C   1 
ATOM   2217 O O   . GLY A 1 326 ? 27.066 79.095 15.958  1.00 64.06  ? 326 GLY A O   1 
ATOM   2218 N N   . ILE A 1 327 ? 27.977 78.793 18.011  1.00 60.40  ? 327 ILE A N   1 
ATOM   2219 C CA  . ILE A 1 327 ? 28.542 77.468 17.752  1.00 56.98  ? 327 ILE A CA  1 
ATOM   2220 C C   . ILE A 1 327 ? 27.421 76.419 17.661  1.00 56.66  ? 327 ILE A C   1 
ATOM   2221 O O   . ILE A 1 327 ? 26.511 76.388 18.498  1.00 56.28  ? 327 ILE A O   1 
ATOM   2222 C CB  . ILE A 1 327 ? 29.517 77.079 18.886  1.00 55.70  ? 327 ILE A CB  1 
ATOM   2223 C CG1 . ILE A 1 327 ? 30.084 75.673 18.677  1.00 54.86  ? 327 ILE A CG1 1 
ATOM   2224 C CG2 . ILE A 1 327 ? 28.808 77.114 20.219  1.00 56.31  ? 327 ILE A CG2 1 
ATOM   2225 C CD1 . ILE A 1 327 ? 31.019 75.227 19.783  1.00 51.11  ? 327 ILE A CD1 1 
ATOM   2226 N N   . LEU A 1 328 ? 27.498 75.564 16.637  1.00 53.64  ? 328 LEU A N   1 
ATOM   2227 C CA  . LEU A 1 328 ? 26.518 74.504 16.388  1.00 50.25  ? 328 LEU A CA  1 
ATOM   2228 C C   . LEU A 1 328 ? 25.102 75.029 16.179  1.00 49.08  ? 328 LEU A C   1 
ATOM   2229 O O   . LEU A 1 328 ? 24.138 74.438 16.656  1.00 48.27  ? 328 LEU A O   1 
ATOM   2230 C CB  . LEU A 1 328 ? 26.543 73.468 17.524  1.00 47.75  ? 328 LEU A CB  1 
ATOM   2231 C CG  . LEU A 1 328 ? 27.664 72.451 17.465  1.00 47.55  ? 328 LEU A CG  1 
ATOM   2232 C CD1 . LEU A 1 328 ? 27.638 71.580 18.691  1.00 48.40  ? 328 LEU A CD1 1 
ATOM   2233 C CD2 . LEU A 1 328 ? 27.480 71.624 16.222  1.00 48.47  ? 328 LEU A CD2 1 
ATOM   2234 N N   . SER A 1 329 ? 24.997 76.131 15.439  1.00 47.94  ? 329 SER A N   1 
ATOM   2235 C CA  . SER A 1 329 ? 23.712 76.753 15.124  1.00 47.81  ? 329 SER A CA  1 
ATOM   2236 C C   . SER A 1 329 ? 23.785 77.300 13.712  1.00 47.68  ? 329 SER A C   1 
ATOM   2237 O O   . SER A 1 329 ? 23.994 78.493 13.499  1.00 49.02  ? 329 SER A O   1 
ATOM   2238 C CB  . SER A 1 329 ? 23.418 77.882 16.107  1.00 46.74  ? 329 SER A CB  1 
ATOM   2239 O OG  . SER A 1 329 ? 22.061 78.265 16.026  1.00 41.51  ? 329 SER A OG  1 
ATOM   2240 N N   . PHE A 1 330 ? 23.606 76.392 12.757  1.00 46.00  ? 330 PHE A N   1 
ATOM   2241 C CA  . PHE A 1 330 ? 23.685 76.709 11.344  1.00 44.69  ? 330 PHE A CA  1 
ATOM   2242 C C   . PHE A 1 330 ? 22.403 77.312 10.766  1.00 43.67  ? 330 PHE A C   1 
ATOM   2243 O O   . PHE A 1 330 ? 21.310 77.117 11.308  1.00 44.43  ? 330 PHE A O   1 
ATOM   2244 C CB  . PHE A 1 330 ? 24.083 75.458 10.568  1.00 45.76  ? 330 PHE A CB  1 
ATOM   2245 C CG  . PHE A 1 330 ? 25.303 74.771 11.123  1.00 44.43  ? 330 PHE A CG  1 
ATOM   2246 C CD1 . PHE A 1 330 ? 25.197 73.877 12.181  1.00 43.95  ? 330 PHE A CD1 1 
ATOM   2247 C CD2 . PHE A 1 330 ? 26.558 75.051 10.615  1.00 44.84  ? 330 PHE A CD2 1 
ATOM   2248 C CE1 . PHE A 1 330 ? 26.319 73.280 12.719  1.00 45.47  ? 330 PHE A CE1 1 
ATOM   2249 C CE2 . PHE A 1 330 ? 27.688 74.459 11.149  1.00 46.37  ? 330 PHE A CE2 1 
ATOM   2250 C CZ  . PHE A 1 330 ? 27.569 73.570 12.206  1.00 46.01  ? 330 PHE A CZ  1 
ATOM   2251 N N   . PRO A 1 331 ? 22.529 78.085 9.675   1.00 43.27  ? 331 PRO A N   1 
ATOM   2252 C CA  . PRO A 1 331 ? 21.411 78.749 8.985   1.00 44.11  ? 331 PRO A CA  1 
ATOM   2253 C C   . PRO A 1 331 ? 20.288 77.778 8.532   1.00 44.94  ? 331 PRO A C   1 
ATOM   2254 O O   . PRO A 1 331 ? 19.088 78.099 8.618   1.00 45.49  ? 331 PRO A O   1 
ATOM   2255 C CB  . PRO A 1 331 ? 22.067 79.440 7.792   1.00 44.59  ? 331 PRO A CB  1 
ATOM   2256 C CG  . PRO A 1 331 ? 23.495 79.122 7.832   1.00 44.69  ? 331 PRO A CG  1 
ATOM   2257 C CD  . PRO A 1 331 ? 23.826 78.292 9.010   1.00 42.25  ? 331 PRO A CD  1 
ATOM   2258 N N   . SER A 1 332 ? 20.678 76.605 8.026   1.00 42.03  ? 332 SER A N   1 
ATOM   2259 C CA  . SER A 1 332 ? 19.722 75.604 7.554   1.00 39.33  ? 332 SER A CA  1 
ATOM   2260 C C   . SER A 1 332 ? 19.639 74.413 8.497   1.00 37.43  ? 332 SER A C   1 
ATOM   2261 O O   . SER A 1 332 ? 20.620 74.049 9.144   1.00 39.00  ? 332 SER A O   1 
ATOM   2262 C CB  . SER A 1 332 ? 20.136 75.116 6.165   1.00 40.00  ? 332 SER A CB  1 
ATOM   2263 O OG  . SER A 1 332 ? 20.255 76.196 5.246   1.00 41.66  ? 332 SER A OG  1 
ATOM   2264 N N   . ALA A 1 333 ? 18.453 73.814 8.549   1.00 34.83  ? 333 ALA A N   1 
ATOM   2265 C CA  . ALA A 1 333 ? 18.174 72.637 9.373   1.00 34.11  ? 333 ALA A CA  1 
ATOM   2266 C C   . ALA A 1 333 ? 16.732 72.199 9.151   1.00 32.71  ? 333 ALA A C   1 
ATOM   2267 O O   . ALA A 1 333 ? 15.937 72.958 8.593   1.00 32.82  ? 333 ALA A O   1 
ATOM   2268 C CB  . ALA A 1 333 ? 18.379 72.970 10.845  1.00 34.17  ? 333 ALA A CB  1 
ATOM   2269 N N   . PRO A 1 334 ? 16.374 70.967 9.561   1.00 32.02  ? 334 PRO A N   1 
ATOM   2270 C CA  . PRO A 1 334 ? 14.990 70.512 9.374   1.00 32.07  ? 334 PRO A CA  1 
ATOM   2271 C C   . PRO A 1 334 ? 14.055 71.540 10.010  1.00 32.51  ? 334 PRO A C   1 
ATOM   2272 O O   . PRO A 1 334 ? 14.140 71.819 11.209  1.00 32.76  ? 334 PRO A O   1 
ATOM   2273 C CB  . PRO A 1 334 ? 14.964 69.161 10.090  1.00 32.43  ? 334 PRO A CB  1 
ATOM   2274 C CG  . PRO A 1 334 ? 16.357 68.691 9.988   1.00 27.48  ? 334 PRO A CG  1 
ATOM   2275 C CD  . PRO A 1 334 ? 17.180 69.933 10.222  1.00 31.12  ? 334 PRO A CD  1 
ATOM   2276 N N   . THR A 1 335 ? 13.169 72.095 9.184   1.00 34.11  ? 335 THR A N   1 
ATOM   2277 C CA  . THR A 1 335 ? 12.216 73.130 9.591   1.00 32.63  ? 335 THR A CA  1 
ATOM   2278 C C   . THR A 1 335 ? 10.800 72.628 9.833   1.00 32.19  ? 335 THR A C   1 
ATOM   2279 O O   . THR A 1 335 ? 10.261 71.885 9.023   1.00 31.50  ? 335 THR A O   1 
ATOM   2280 C CB  . THR A 1 335 ? 12.144 74.196 8.508   1.00 31.96  ? 335 THR A CB  1 
ATOM   2281 O OG1 . THR A 1 335 ? 13.478 74.549 8.121   1.00 32.34  ? 335 THR A OG1 1 
ATOM   2282 C CG2 . THR A 1 335 ? 11.392 75.429 9.019   1.00 31.76  ? 335 THR A CG2 1 
ATOM   2283 N N   . ILE A 1 336 ? 10.204 73.048 10.947  1.00 34.61  ? 336 ILE A N   1 
ATOM   2284 C CA  . ILE A 1 336 ? 8.830  72.667 11.259  1.00 39.01  ? 336 ILE A CA  1 
ATOM   2285 C C   . ILE A 1 336 ? 7.920  73.404 10.254  1.00 40.07  ? 336 ILE A C   1 
ATOM   2286 O O   . ILE A 1 336 ? 7.745  74.614 10.351  1.00 41.25  ? 336 ILE A O   1 
ATOM   2287 C CB  . ILE A 1 336 ? 8.478  73.054 12.700  1.00 39.70  ? 336 ILE A CB  1 
ATOM   2288 C CG1 . ILE A 1 336 ? 9.358  72.288 13.690  1.00 38.63  ? 336 ILE A CG1 1 
ATOM   2289 C CG2 . ILE A 1 336 ? 7.026  72.704 12.990  1.00 41.24  ? 336 ILE A CG2 1 
ATOM   2290 C CD1 . ILE A 1 336 ? 9.018  72.564 15.106  1.00 40.74  ? 336 ILE A CD1 1 
ATOM   2291 N N   . ASP A 1 337 ? 7.371  72.659 9.289   1.00 39.41  ? 337 ASP A N   1 
ATOM   2292 C CA  . ASP A 1 337 ? 6.547  73.206 8.212   1.00 38.53  ? 337 ASP A CA  1 
ATOM   2293 C C   . ASP A 1 337 ? 5.158  72.592 8.135   1.00 39.06  ? 337 ASP A C   1 
ATOM   2294 O O   . ASP A 1 337 ? 4.465  72.770 7.144   1.00 38.61  ? 337 ASP A O   1 
ATOM   2295 C CB  . ASP A 1 337 ? 7.252  72.966 6.884   1.00 38.34  ? 337 ASP A CB  1 
ATOM   2296 C CG  . ASP A 1 337 ? 7.521  71.502 6.637   1.00 37.92  ? 337 ASP A CG  1 
ATOM   2297 O OD1 . ASP A 1 337 ? 7.283  70.668 7.545   1.00 34.27  ? 337 ASP A OD1 1 
ATOM   2298 O OD2 . ASP A 1 337 ? 7.981  71.151 5.526   1.00 37.38  ? 337 ASP A OD2 1 
ATOM   2299 N N   . GLY A 1 338 ? 4.758  71.855 9.168   1.00 41.58  ? 338 GLY A N   1 
ATOM   2300 C CA  . GLY A 1 338 ? 3.443  71.234 9.173   1.00 41.83  ? 338 GLY A CA  1 
ATOM   2301 C C   . GLY A 1 338 ? 3.248  70.425 7.915   1.00 43.73  ? 338 GLY A C   1 
ATOM   2302 O O   . GLY A 1 338 ? 2.127  70.183 7.510   1.00 45.72  ? 338 GLY A O   1 
ATOM   2303 N N   . ALA A 1 339 ? 4.358  70.007 7.307   1.00 45.81  ? 339 ALA A N   1 
ATOM   2304 C CA  . ALA A 1 339 ? 4.365  69.225 6.073   1.00 44.07  ? 339 ALA A CA  1 
ATOM   2305 C C   . ALA A 1 339 ? 5.185  67.975 6.317   1.00 43.57  ? 339 ALA A C   1 
ATOM   2306 O O   . ALA A 1 339 ? 4.645  66.942 6.680   1.00 45.94  ? 339 ALA A O   1 
ATOM   2307 C CB  . ALA A 1 339 ? 4.984  70.039 4.940   1.00 42.37  ? 339 ALA A CB  1 
ATOM   2308 N N   . PHE A 1 340 ? 6.497  68.076 6.121   1.00 44.08  ? 340 PHE A N   1 
ATOM   2309 C CA  . PHE A 1 340 ? 7.404  66.947 6.332   1.00 43.78  ? 340 PHE A CA  1 
ATOM   2310 C C   . PHE A 1 340 ? 7.600  66.785 7.838   1.00 44.78  ? 340 PHE A C   1 
ATOM   2311 O O   . PHE A 1 340 ? 7.664  65.669 8.349   1.00 42.49  ? 340 PHE A O   1 
ATOM   2312 C CB  . PHE A 1 340 ? 8.758  67.222 5.657   1.00 38.73  ? 340 PHE A CB  1 
ATOM   2313 C CG  . PHE A 1 340 ? 9.505  65.981 5.268   1.00 36.77  ? 340 PHE A CG  1 
ATOM   2314 C CD1 . PHE A 1 340 ? 9.178  65.303 4.095   1.00 36.47  ? 340 PHE A CD1 1 
ATOM   2315 C CD2 . PHE A 1 340 ? 10.492 65.448 6.094   1.00 32.54  ? 340 PHE A CD2 1 
ATOM   2316 C CE1 . PHE A 1 340 ? 9.826  64.100 3.750   1.00 33.73  ? 340 PHE A CE1 1 
ATOM   2317 C CE2 . PHE A 1 340 ? 11.141 64.252 5.757   1.00 30.87  ? 340 PHE A CE2 1 
ATOM   2318 C CZ  . PHE A 1 340 ? 10.807 63.576 4.583   1.00 30.81  ? 340 PHE A CZ  1 
ATOM   2319 N N   . LEU A 1 341 ? 7.708  67.931 8.514   1.00 48.74  ? 341 LEU A N   1 
ATOM   2320 C CA  . LEU A 1 341 ? 7.878  68.007 9.967   1.00 54.47  ? 341 LEU A CA  1 
ATOM   2321 C C   . LEU A 1 341 ? 6.653  68.707 10.564  1.00 57.95  ? 341 LEU A C   1 
ATOM   2322 O O   . LEU A 1 341 ? 6.693  69.908 10.862  1.00 58.30  ? 341 LEU A O   1 
ATOM   2323 C CB  . LEU A 1 341 ? 9.157  68.776 10.337  1.00 53.95  ? 341 LEU A CB  1 
ATOM   2324 C CG  . LEU A 1 341 ? 10.454 67.988 10.354  1.00 53.95  ? 341 LEU A CG  1 
ATOM   2325 C CD1 . LEU A 1 341 ? 10.893 67.707 8.938   1.00 52.76  ? 341 LEU A CD1 1 
ATOM   2326 C CD2 . LEU A 1 341 ? 11.503 68.789 11.092  1.00 53.43  ? 341 LEU A CD2 1 
ATOM   2327 N N   . PRO A 1 342 ? 5.540  67.963 10.732  1.00 61.86  ? 342 PRO A N   1 
ATOM   2328 C CA  . PRO A 1 342 ? 4.333  68.581 11.297  1.00 65.69  ? 342 PRO A CA  1 
ATOM   2329 C C   . PRO A 1 342 ? 4.580  69.318 12.620  1.00 69.05  ? 342 PRO A C   1 
ATOM   2330 O O   . PRO A 1 342 ? 4.410  70.536 12.690  1.00 70.57  ? 342 PRO A O   1 
ATOM   2331 C CB  . PRO A 1 342 ? 3.345  67.429 11.456  1.00 64.53  ? 342 PRO A CB  1 
ATOM   2332 C CG  . PRO A 1 342 ? 3.984  66.229 10.920  1.00 63.19  ? 342 PRO A CG  1 
ATOM   2333 C CD  . PRO A 1 342 ? 5.397  66.512 10.524  1.00 63.09  ? 342 PRO A CD  1 
ATOM   2334 N N   . ALA A 1 343 ? 4.970  68.605 13.671  1.00 73.08  ? 343 ALA A N   1 
ATOM   2335 C CA  . ALA A 1 343 ? 5.209  69.266 14.953  1.00 79.56  ? 343 ALA A CA  1 
ATOM   2336 C C   . ALA A 1 343 ? 6.684  69.205 15.371  1.00 84.95  ? 343 ALA A C   1 
ATOM   2337 O O   . ALA A 1 343 ? 7.573  69.007 14.532  1.00 86.17  ? 343 ALA A O   1 
ATOM   2338 C CB  . ALA A 1 343 ? 4.318  68.650 16.026  1.00 78.02  ? 343 ALA A CB  1 
ATOM   2339 N N   . ASP A 1 344 ? 6.933  69.383 16.669  1.00 90.28  ? 344 ASP A N   1 
ATOM   2340 C CA  . ASP A 1 344 ? 8.288  69.368 17.234  1.00 95.12  ? 344 ASP A CA  1 
ATOM   2341 C C   . ASP A 1 344 ? 8.749  67.934 17.503  1.00 98.29  ? 344 ASP A C   1 
ATOM   2342 O O   . ASP A 1 344 ? 7.983  67.123 18.015  1.00 99.44  ? 344 ASP A O   1 
ATOM   2343 C CB  . ASP A 1 344 ? 8.303  70.168 18.539  1.00 96.79  ? 344 ASP A CB  1 
ATOM   2344 C CG  . ASP A 1 344 ? 9.438  71.173 18.595  1.00 99.60  ? 344 ASP A CG  1 
ATOM   2345 O OD1 . ASP A 1 344 ? 10.586 70.771 18.905  1.00 101.38 ? 344 ASP A OD1 1 
ATOM   2346 O OD2 . ASP A 1 344 ? 9.178  72.368 18.320  1.00 100.17 ? 344 ASP A OD2 1 
ATOM   2347 N N   . PRO A 1 345 ? 10.014 67.610 17.175  1.00 100.71 ? 345 PRO A N   1 
ATOM   2348 C CA  . PRO A 1 345 ? 10.613 66.279 17.361  1.00 102.98 ? 345 PRO A CA  1 
ATOM   2349 C C   . PRO A 1 345 ? 10.294 65.487 18.645  1.00 105.00 ? 345 PRO A C   1 
ATOM   2350 O O   . PRO A 1 345 ? 10.657 64.306 18.752  1.00 106.04 ? 345 PRO A O   1 
ATOM   2351 C CB  . PRO A 1 345 ? 12.104 66.559 17.198  1.00 102.68 ? 345 PRO A CB  1 
ATOM   2352 C CG  . PRO A 1 345 ? 12.102 67.591 16.117  1.00 101.83 ? 345 PRO A CG  1 
ATOM   2353 C CD  . PRO A 1 345 ? 10.996 68.535 16.577  1.00 101.06 ? 345 PRO A CD  1 
ATOM   2354 N N   . MET A 1 346 ? 9.629  66.118 19.614  1.00 105.67 ? 346 MET A N   1 
ATOM   2355 C CA  . MET A 1 346 ? 9.262  65.429 20.857  1.00 105.85 ? 346 MET A CA  1 
ATOM   2356 C C   . MET A 1 346 ? 7.740  65.302 21.026  1.00 105.66 ? 346 MET A C   1 
ATOM   2357 O O   . MET A 1 346 ? 7.255  64.525 21.861  1.00 104.32 ? 346 MET A O   1 
ATOM   2358 C CB  . MET A 1 346 ? 9.868  66.150 22.071  1.00 106.11 ? 346 MET A CB  1 
ATOM   2359 C CG  . MET A 1 346 ? 11.405 66.093 22.141  1.00 106.55 ? 346 MET A CG  1 
ATOM   2360 S SD  . MET A 1 346 ? 12.116 64.401 21.925  1.00 107.40 ? 346 MET A SD  1 
ATOM   2361 C CE  . MET A 1 346 ? 11.849 63.663 23.524  1.00 105.61 ? 346 MET A CE  1 
ATOM   2362 N N   . THR A 1 347 ? 7.002  66.072 20.225  1.00 106.39 ? 347 THR A N   1 
ATOM   2363 C CA  . THR A 1 347 ? 5.540  66.071 20.240  1.00 105.73 ? 347 THR A CA  1 
ATOM   2364 C C   . THR A 1 347 ? 4.986  65.251 19.065  1.00 105.73 ? 347 THR A C   1 
ATOM   2365 O O   . THR A 1 347 ? 3.793  65.301 18.757  1.00 105.31 ? 347 THR A O   1 
ATOM   2366 C CB  . THR A 1 347 ? 4.980  67.526 20.187  1.00 105.16 ? 347 THR A CB  1 
ATOM   2367 O OG1 . THR A 1 347 ? 5.406  68.175 18.979  1.00 103.84 ? 347 THR A OG1 1 
ATOM   2368 C CG2 . THR A 1 347 ? 5.482  68.322 21.389  1.00 103.63 ? 347 THR A CG2 1 
ATOM   2369 N N   . LEU A 1 348 ? 5.878  64.492 18.430  1.00 105.87 ? 348 LEU A N   1 
ATOM   2370 C CA  . LEU A 1 348 ? 5.542  63.616 17.312  1.00 105.83 ? 348 LEU A CA  1 
ATOM   2371 C C   . LEU A 1 348 ? 5.629  62.198 17.869  1.00 105.75 ? 348 LEU A C   1 
ATOM   2372 O O   . LEU A 1 348 ? 4.898  61.309 17.446  1.00 104.87 ? 348 LEU A O   1 
ATOM   2373 C CB  . LEU A 1 348 ? 6.556  63.758 16.164  1.00 105.62 ? 348 LEU A CB  1 
ATOM   2374 C CG  . LEU A 1 348 ? 6.692  65.020 15.303  1.00 105.86 ? 348 LEU A CG  1 
ATOM   2375 C CD1 . LEU A 1 348 ? 6.343  66.219 16.121  1.00 106.00 ? 348 LEU A CD1 1 
ATOM   2376 C CD2 . LEU A 1 348 ? 8.122  65.122 14.759  1.00 105.51 ? 348 LEU A CD2 1 
ATOM   2377 N N   . MET A 1 349 ? 6.515  62.009 18.846  1.00 106.67 ? 349 MET A N   1 
ATOM   2378 C CA  . MET A 1 349 ? 6.728  60.701 19.484  1.00 107.51 ? 349 MET A CA  1 
ATOM   2379 C C   . MET A 1 349 ? 5.526  60.340 20.349  1.00 107.08 ? 349 MET A C   1 
ATOM   2380 O O   . MET A 1 349 ? 5.065  59.193 20.415  1.00 107.67 ? 349 MET A O   1 
ATOM   2381 C CB  . MET A 1 349 ? 7.986  60.742 20.353  1.00 108.65 ? 349 MET A CB  1 
ATOM   2382 C CG  . MET A 1 349 ? 8.580  59.367 20.645  1.00 109.98 ? 349 MET A CG  1 
ATOM   2383 S SD  . MET A 1 349 ? 8.588  58.363 19.117  1.00 111.04 ? 349 MET A SD  1 
ATOM   2384 C CE  . MET A 1 349 ? 6.897  57.736 19.078  1.00 108.84 ? 349 MET A CE  1 
ATOM   2385 N N   . LYS A 1 350 ? 5.085  61.371 21.052  1.00 105.92 ? 350 LYS A N   1 
ATOM   2386 C CA  . LYS A 1 350 ? 3.943  61.384 21.942  1.00 104.72 ? 350 LYS A CA  1 
ATOM   2387 C C   . LYS A 1 350 ? 2.892  60.289 21.768  1.00 104.44 ? 350 LYS A C   1 
ATOM   2388 O O   . LYS A 1 350 ? 2.367  59.771 22.754  1.00 104.93 ? 350 LYS A O   1 
ATOM   2389 C CB  . LYS A 1 350 ? 3.309  62.775 21.797  1.00 103.94 ? 350 LYS A CB  1 
ATOM   2390 C CG  . LYS A 1 350 ? 1.809  62.854 21.871  1.00 103.73 ? 350 LYS A CG  1 
ATOM   2391 C CD  . LYS A 1 350 ? 1.301  64.215 21.415  1.00 103.79 ? 350 LYS A CD  1 
ATOM   2392 C CE  . LYS A 1 350 ? -0.061 64.516 22.041  1.00 104.36 ? 350 LYS A CE  1 
ATOM   2393 N NZ  . LYS A 1 350 ? -0.666 65.777 21.524  1.00 103.56 ? 350 LYS A NZ  1 
ATOM   2394 N N   . THR A 1 351 ? 2.610  59.900 20.528  1.00 103.12 ? 351 THR A N   1 
ATOM   2395 C CA  . THR A 1 351 ? 1.537  58.938 20.315  1.00 101.18 ? 351 THR A CA  1 
ATOM   2396 C C   . THR A 1 351 ? 1.748  57.767 19.350  1.00 98.41  ? 351 THR A C   1 
ATOM   2397 O O   . THR A 1 351 ? 0.798  57.037 19.056  1.00 98.80  ? 351 THR A O   1 
ATOM   2398 C CB  . THR A 1 351 ? 0.270  59.719 19.880  1.00 102.48 ? 351 THR A CB  1 
ATOM   2399 O OG1 . THR A 1 351 ? 0.502  60.347 18.611  1.00 102.77 ? 351 THR A OG1 1 
ATOM   2400 C CG2 . THR A 1 351 ? -0.037 60.836 20.887  1.00 101.52 ? 351 THR A CG2 1 
ATOM   2401 N N   . ALA A 1 352 ? 2.971  57.574 18.862  1.00 94.23  ? 352 ALA A N   1 
ATOM   2402 C CA  . ALA A 1 352 ? 3.225  56.489 17.918  1.00 89.22  ? 352 ALA A CA  1 
ATOM   2403 C C   . ALA A 1 352 ? 3.658  55.218 18.624  1.00 84.88  ? 352 ALA A C   1 
ATOM   2404 O O   . ALA A 1 352 ? 4.284  55.275 19.683  1.00 84.26  ? 352 ALA A O   1 
ATOM   2405 C CB  . ALA A 1 352 ? 4.289  56.917 16.906  1.00 89.18  ? 352 ALA A CB  1 
ATOM   2406 N N   . ASP A 1 353 ? 3.318  54.063 18.060  1.00 80.19  ? 353 ASP A N   1 
ATOM   2407 C CA  . ASP A 1 353 ? 3.770  52.825 18.674  1.00 76.70  ? 353 ASP A CA  1 
ATOM   2408 C C   . ASP A 1 353 ? 4.790  52.194 17.746  1.00 73.47  ? 353 ASP A C   1 
ATOM   2409 O O   . ASP A 1 353 ? 4.454  51.607 16.717  1.00 71.74  ? 353 ASP A O   1 
ATOM   2410 C CB  . ASP A 1 353 ? 2.630  51.857 18.971  1.00 76.47  ? 353 ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 353 ? 2.806  51.181 20.317  1.00 76.04  ? 353 ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 353 ? 2.686  51.877 21.355  1.00 74.16  ? 353 ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 353 ? 3.087  49.962 20.335  1.00 76.68  ? 353 ASP A OD2 1 
ATOM   2414 N N   . LEU A 1 354 ? 6.050  52.342 18.130  1.00 70.58  ? 354 LEU A N   1 
ATOM   2415 C CA  . LEU A 1 354 ? 7.172  51.838 17.358  1.00 67.38  ? 354 LEU A CA  1 
ATOM   2416 C C   . LEU A 1 354 ? 7.446  50.360 17.616  1.00 65.90  ? 354 LEU A C   1 
ATOM   2417 O O   . LEU A 1 354 ? 8.589  49.919 17.597  1.00 66.82  ? 354 LEU A O   1 
ATOM   2418 C CB  . LEU A 1 354 ? 8.401  52.681 17.686  1.00 65.43  ? 354 LEU A CB  1 
ATOM   2419 C CG  . LEU A 1 354 ? 8.088  54.171 17.771  1.00 62.78  ? 354 LEU A CG  1 
ATOM   2420 C CD1 . LEU A 1 354 ? 9.290  54.920 18.279  1.00 61.64  ? 354 LEU A CD1 1 
ATOM   2421 C CD2 . LEU A 1 354 ? 7.655  54.674 16.406  1.00 63.44  ? 354 LEU A CD2 1 
ATOM   2422 N N   . LYS A 1 355 ? 6.389  49.597 17.854  1.00 64.57  ? 355 LYS A N   1 
ATOM   2423 C CA  . LYS A 1 355 ? 6.519  48.167 18.107  1.00 63.22  ? 355 LYS A CA  1 
ATOM   2424 C C   . LYS A 1 355 ? 7.279  47.457 16.988  1.00 61.08  ? 355 LYS A C   1 
ATOM   2425 O O   . LYS A 1 355 ? 8.025  46.517 17.247  1.00 61.35  ? 355 LYS A O   1 
ATOM   2426 C CB  . LYS A 1 355 ? 5.130  47.536 18.252  1.00 64.40  ? 355 LYS A CB  1 
ATOM   2427 C CG  . LYS A 1 355 ? 5.124  46.021 18.103  1.00 67.39  ? 355 LYS A CG  1 
ATOM   2428 C CD  . LYS A 1 355 ? 3.752  45.496 17.697  1.00 69.07  ? 355 LYS A CD  1 
ATOM   2429 C CE  . LYS A 1 355 ? 3.825  44.027 17.292  1.00 69.87  ? 355 LYS A CE  1 
ATOM   2430 N NZ  . LYS A 1 355 ? 2.502  43.497 16.861  1.00 70.48  ? 355 LYS A NZ  1 
ATOM   2431 N N   . ASP A 1 356 ? 7.092  47.910 15.750  1.00 58.35  ? 356 ASP A N   1 
ATOM   2432 C CA  . ASP A 1 356 ? 7.739  47.284 14.597  1.00 56.42  ? 356 ASP A CA  1 
ATOM   2433 C C   . ASP A 1 356 ? 9.078  47.893 14.178  1.00 53.32  ? 356 ASP A C   1 
ATOM   2434 O O   . ASP A 1 356 ? 9.662  47.473 13.178  1.00 51.45  ? 356 ASP A O   1 
ATOM   2435 C CB  . ASP A 1 356 ? 6.792  47.310 13.391  1.00 59.96  ? 356 ASP A CB  1 
ATOM   2436 C CG  . ASP A 1 356 ? 5.449  46.671 13.687  1.00 63.74  ? 356 ASP A CG  1 
ATOM   2437 O OD1 . ASP A 1 356 ? 5.425  45.480 14.065  1.00 65.78  ? 356 ASP A OD1 1 
ATOM   2438 O OD2 . ASP A 1 356 ? 4.413  47.358 13.542  1.00 67.13  ? 356 ASP A OD2 1 
ATOM   2439 N N   . TYR A 1 357 ? 9.570  48.868 14.937  1.00 49.87  ? 357 TYR A N   1 
ATOM   2440 C CA  . TYR A 1 357 ? 10.830 49.514 14.592  1.00 45.87  ? 357 TYR A CA  1 
ATOM   2441 C C   . TYR A 1 357 ? 12.076 48.998 15.301  1.00 43.60  ? 357 TYR A C   1 
ATOM   2442 O O   . TYR A 1 357 ? 12.059 48.686 16.489  1.00 40.68  ? 357 TYR A O   1 
ATOM   2443 C CB  . TYR A 1 357 ? 10.731 51.016 14.829  1.00 45.17  ? 357 TYR A CB  1 
ATOM   2444 C CG  . TYR A 1 357 ? 9.916  51.766 13.808  1.00 45.51  ? 357 TYR A CG  1 
ATOM   2445 C CD1 . TYR A 1 357 ? 8.584  51.452 13.588  1.00 46.67  ? 357 TYR A CD1 1 
ATOM   2446 C CD2 . TYR A 1 357 ? 10.467 52.828 13.099  1.00 45.69  ? 357 TYR A CD2 1 
ATOM   2447 C CE1 . TYR A 1 357 ? 7.813  52.185 12.687  1.00 48.78  ? 357 TYR A CE1 1 
ATOM   2448 C CE2 . TYR A 1 357 ? 9.710  53.567 12.200  1.00 48.16  ? 357 TYR A CE2 1 
ATOM   2449 C CZ  . TYR A 1 357 ? 8.382  53.243 11.998  1.00 49.42  ? 357 TYR A CZ  1 
ATOM   2450 O OH  . TYR A 1 357 ? 7.622  53.986 11.121  1.00 50.45  ? 357 TYR A OH  1 
ATOM   2451 N N   . ASP A 1 358 ? 13.163 48.927 14.538  1.00 43.33  ? 358 ASP A N   1 
ATOM   2452 C CA  . ASP A 1 358 ? 14.469 48.499 15.033  1.00 41.07  ? 358 ASP A CA  1 
ATOM   2453 C C   . ASP A 1 358 ? 15.442 49.662 14.886  1.00 38.70  ? 358 ASP A C   1 
ATOM   2454 O O   . ASP A 1 358 ? 15.718 50.128 13.770  1.00 38.14  ? 358 ASP A O   1 
ATOM   2455 C CB  . ASP A 1 358 ? 14.978 47.315 14.228  1.00 41.08  ? 358 ASP A CB  1 
ATOM   2456 C CG  . ASP A 1 358 ? 14.085 46.130 14.351  1.00 43.83  ? 358 ASP A CG  1 
ATOM   2457 O OD1 . ASP A 1 358 ? 13.986 45.593 15.472  1.00 44.76  ? 358 ASP A OD1 1 
ATOM   2458 O OD2 . ASP A 1 358 ? 13.474 45.741 13.336  1.00 47.99  ? 358 ASP A OD2 1 
ATOM   2459 N N   . ILE A 1 359 ? 15.959 50.132 16.012  1.00 34.84  ? 359 ILE A N   1 
ATOM   2460 C CA  . ILE A 1 359 ? 16.876 51.254 15.990  1.00 33.84  ? 359 ILE A CA  1 
ATOM   2461 C C   . ILE A 1 359 ? 18.229 50.915 16.592  1.00 32.76  ? 359 ILE A C   1 
ATOM   2462 O O   . ILE A 1 359 ? 18.303 50.306 17.658  1.00 31.22  ? 359 ILE A O   1 
ATOM   2463 C CB  . ILE A 1 359 ? 16.285 52.488 16.769  1.00 34.57  ? 359 ILE A CB  1 
ATOM   2464 C CG1 . ILE A 1 359 ? 15.345 53.314 15.878  1.00 33.41  ? 359 ILE A CG1 1 
ATOM   2465 C CG2 . ILE A 1 359 ? 17.409 53.418 17.205  1.00 37.73  ? 359 ILE A CG2 1 
ATOM   2466 C CD1 . ILE A 1 359 ? 14.148 52.585 15.362  1.00 32.26  ? 359 ILE A CD1 1 
ATOM   2467 N N   . LEU A 1 360 ? 19.293 51.299 15.885  1.00 31.79  ? 360 LEU A N   1 
ATOM   2468 C CA  . LEU A 1 360 ? 20.666 51.125 16.368  1.00 30.36  ? 360 LEU A CA  1 
ATOM   2469 C C   . LEU A 1 360 ? 21.231 52.542 16.438  1.00 28.77  ? 360 LEU A C   1 
ATOM   2470 O O   . LEU A 1 360 ? 21.292 53.227 15.419  1.00 29.64  ? 360 LEU A O   1 
ATOM   2471 C CB  . LEU A 1 360 ? 21.520 50.281 15.409  1.00 30.27  ? 360 LEU A CB  1 
ATOM   2472 C CG  . LEU A 1 360 ? 23.021 50.263 15.770  1.00 28.59  ? 360 LEU A CG  1 
ATOM   2473 C CD1 . LEU A 1 360 ? 23.224 49.659 17.140  1.00 26.98  ? 360 LEU A CD1 1 
ATOM   2474 C CD2 . LEU A 1 360 ? 23.802 49.481 14.746  1.00 27.40  ? 360 LEU A CD2 1 
ATOM   2475 N N   . MET A 1 361 ? 21.624 52.994 17.626  1.00 27.24  ? 361 MET A N   1 
ATOM   2476 C CA  . MET A 1 361 ? 22.148 54.347 17.760  1.00 27.00  ? 361 MET A CA  1 
ATOM   2477 C C   . MET A 1 361 ? 23.217 54.453 18.822  1.00 26.25  ? 361 MET A C   1 
ATOM   2478 O O   . MET A 1 361 ? 23.328 53.573 19.673  1.00 26.49  ? 361 MET A O   1 
ATOM   2479 C CB  . MET A 1 361 ? 21.010 55.326 18.073  1.00 29.82  ? 361 MET A CB  1 
ATOM   2480 C CG  . MET A 1 361 ? 20.279 55.072 19.392  1.00 32.00  ? 361 MET A CG  1 
ATOM   2481 S SD  . MET A 1 361 ? 18.599 55.801 19.371  1.00 37.41  ? 361 MET A SD  1 
ATOM   2482 C CE  . MET A 1 361 ? 18.950 57.592 19.536  1.00 31.93  ? 361 MET A CE  1 
ATOM   2483 N N   . GLY A 1 362 ? 23.993 55.538 18.768  1.00 23.60  ? 362 GLY A N   1 
ATOM   2484 C CA  . GLY A 1 362 ? 25.054 55.744 19.733  1.00 23.31  ? 362 GLY A CA  1 
ATOM   2485 C C   . GLY A 1 362 ? 25.792 57.063 19.571  1.00 27.49  ? 362 GLY A C   1 
ATOM   2486 O O   . GLY A 1 362 ? 25.363 57.942 18.819  1.00 27.73  ? 362 GLY A O   1 
ATOM   2487 N N   . ASN A 1 363 ? 26.928 57.180 20.260  1.00 27.68  ? 363 ASN A N   1 
ATOM   2488 C CA  . ASN A 1 363 ? 27.760 58.382 20.256  1.00 27.44  ? 363 ASN A CA  1 
ATOM   2489 C C   . ASN A 1 363 ? 29.258 58.043 20.309  1.00 27.49  ? 363 ASN A C   1 
ATOM   2490 O O   . ASN A 1 363 ? 29.625 56.890 20.523  1.00 29.80  ? 363 ASN A O   1 
ATOM   2491 C CB  . ASN A 1 363 ? 27.427 59.215 21.489  1.00 28.32  ? 363 ASN A CB  1 
ATOM   2492 C CG  . ASN A 1 363 ? 25.993 59.670 21.517  1.00 28.70  ? 363 ASN A CG  1 
ATOM   2493 O OD1 . ASN A 1 363 ? 25.624 60.607 20.818  1.00 32.40  ? 363 ASN A OD1 1 
ATOM   2494 N ND2 . ASN A 1 363 ? 25.174 59.012 22.322  1.00 25.96  ? 363 ASN A ND2 1 
ATOM   2495 N N   . VAL A 1 364 ? 30.117 59.045 20.106  1.00 25.95  ? 364 VAL A N   1 
ATOM   2496 C CA  . VAL A 1 364 ? 31.560 58.839 20.220  1.00 28.54  ? 364 VAL A CA  1 
ATOM   2497 C C   . VAL A 1 364 ? 31.974 59.529 21.524  1.00 30.19  ? 364 VAL A C   1 
ATOM   2498 O O   . VAL A 1 364 ? 31.263 60.398 22.032  1.00 32.30  ? 364 VAL A O   1 
ATOM   2499 C CB  . VAL A 1 364 ? 32.375 59.454 19.046  1.00 28.66  ? 364 VAL A CB  1 
ATOM   2500 C CG1 . VAL A 1 364 ? 31.960 58.820 17.727  1.00 26.26  ? 364 VAL A CG1 1 
ATOM   2501 C CG2 . VAL A 1 364 ? 32.210 60.964 19.022  1.00 29.00  ? 364 VAL A CG2 1 
ATOM   2502 N N   . ARG A 1 365 ? 33.121 59.156 22.068  1.00 32.39  ? 365 ARG A N   1 
ATOM   2503 C CA  . ARG A 1 365 ? 33.568 59.728 23.331  1.00 36.04  ? 365 ARG A CA  1 
ATOM   2504 C C   . ARG A 1 365 ? 33.697 61.249 23.418  1.00 35.82  ? 365 ARG A C   1 
ATOM   2505 O O   . ARG A 1 365 ? 33.408 61.830 24.466  1.00 36.60  ? 365 ARG A O   1 
ATOM   2506 C CB  . ARG A 1 365 ? 34.896 59.100 23.741  1.00 39.50  ? 365 ARG A CB  1 
ATOM   2507 C CG  . ARG A 1 365 ? 35.241 59.314 25.210  1.00 44.22  ? 365 ARG A CG  1 
ATOM   2508 C CD  . ARG A 1 365 ? 36.555 58.652 25.545  1.00 50.31  ? 365 ARG A CD  1 
ATOM   2509 N NE  . ARG A 1 365 ? 37.671 59.388 24.960  1.00 57.39  ? 365 ARG A NE  1 
ATOM   2510 C CZ  . ARG A 1 365 ? 38.911 58.919 24.887  1.00 58.20  ? 365 ARG A CZ  1 
ATOM   2511 N NH1 . ARG A 1 365 ? 39.184 57.708 25.357  1.00 59.34  ? 365 ARG A NH1 1 
ATOM   2512 N NH2 . ARG A 1 365 ? 39.876 59.666 24.363  1.00 58.06  ? 365 ARG A NH2 1 
ATOM   2513 N N   . ASP A 1 366 ? 34.116 61.894 22.334  1.00 34.99  ? 366 ASP A N   1 
ATOM   2514 C CA  . ASP A 1 366 ? 34.312 63.338 22.349  1.00 35.38  ? 366 ASP A CA  1 
ATOM   2515 C C   . ASP A 1 366 ? 33.651 64.094 21.182  1.00 36.03  ? 366 ASP A C   1 
ATOM   2516 O O   . ASP A 1 366 ? 34.317 64.662 20.320  1.00 34.92  ? 366 ASP A O   1 
ATOM   2517 C CB  . ASP A 1 366 ? 35.818 63.616 22.390  1.00 35.59  ? 366 ASP A CB  1 
ATOM   2518 C CG  . ASP A 1 366 ? 36.545 62.757 23.427  1.00 39.06  ? 366 ASP A CG  1 
ATOM   2519 O OD1 . ASP A 1 366 ? 36.435 63.054 24.637  1.00 38.75  ? 366 ASP A OD1 1 
ATOM   2520 O OD2 . ASP A 1 366 ? 37.220 61.773 23.036  1.00 39.45  ? 366 ASP A OD2 1 
ATOM   2521 N N   . GLU A 1 367 ? 32.326 64.122 21.183  1.00 36.83  ? 367 GLU A N   1 
ATOM   2522 C CA  . GLU A 1 367 ? 31.566 64.799 20.143  1.00 36.13  ? 367 GLU A CA  1 
ATOM   2523 C C   . GLU A 1 367 ? 31.897 66.289 20.008  1.00 37.42  ? 367 GLU A C   1 
ATOM   2524 O O   . GLU A 1 367 ? 32.063 66.804 18.904  1.00 39.35  ? 367 GLU A O   1 
ATOM   2525 C CB  . GLU A 1 367 ? 30.076 64.651 20.434  1.00 34.29  ? 367 GLU A CB  1 
ATOM   2526 C CG  . GLU A 1 367 ? 29.598 63.212 20.670  1.00 35.99  ? 367 GLU A CG  1 
ATOM   2527 C CD  . GLU A 1 367 ? 29.004 62.554 19.428  1.00 36.49  ? 367 GLU A CD  1 
ATOM   2528 O OE1 . GLU A 1 367 ? 29.130 63.133 18.338  1.00 32.07  ? 367 GLU A OE1 1 
ATOM   2529 O OE2 . GLU A 1 367 ? 28.406 61.457 19.543  1.00 33.53  ? 367 GLU A OE2 1 
ATOM   2530 N N   . GLY A 1 368 ? 32.005 66.976 21.136  1.00 37.90  ? 368 GLY A N   1 
ATOM   2531 C CA  . GLY A 1 368 ? 32.259 68.404 21.105  1.00 38.54  ? 368 GLY A CA  1 
ATOM   2532 C C   . GLY A 1 368 ? 33.622 68.981 20.776  1.00 39.74  ? 368 GLY A C   1 
ATOM   2533 O O   . GLY A 1 368 ? 33.693 70.126 20.332  1.00 42.29  ? 368 GLY A O   1 
ATOM   2534 N N   . THR A 1 369 ? 34.699 68.232 20.983  1.00 41.38  ? 369 THR A N   1 
ATOM   2535 C CA  . THR A 1 369 ? 36.045 68.754 20.721  1.00 42.49  ? 369 THR A CA  1 
ATOM   2536 C C   . THR A 1 369 ? 36.190 69.488 19.393  1.00 45.25  ? 369 THR A C   1 
ATOM   2537 O O   . THR A 1 369 ? 36.552 70.663 19.359  1.00 45.40  ? 369 THR A O   1 
ATOM   2538 C CB  . THR A 1 369 ? 37.112 67.638 20.781  1.00 41.56  ? 369 THR A CB  1 
ATOM   2539 O OG1 . THR A 1 369 ? 36.734 66.557 19.918  1.00 38.46  ? 369 THR A OG1 1 
ATOM   2540 C CG2 . THR A 1 369 ? 37.267 67.134 22.211  1.00 42.29  ? 369 THR A CG2 1 
ATOM   2541 N N   . TYR A 1 370 ? 35.908 68.790 18.299  1.00 49.30  ? 370 TYR A N   1 
ATOM   2542 C CA  . TYR A 1 370 ? 36.013 69.373 16.965  1.00 50.91  ? 370 TYR A CA  1 
ATOM   2543 C C   . TYR A 1 370 ? 35.391 70.759 16.911  1.00 49.36  ? 370 TYR A C   1 
ATOM   2544 O O   . TYR A 1 370 ? 36.069 71.744 16.612  1.00 51.20  ? 370 TYR A O   1 
ATOM   2545 C CB  . TYR A 1 370 ? 35.338 68.460 15.929  1.00 54.35  ? 370 TYR A CB  1 
ATOM   2546 C CG  . TYR A 1 370 ? 35.037 69.139 14.614  1.00 57.54  ? 370 TYR A CG  1 
ATOM   2547 C CD1 . TYR A 1 370 ? 36.063 69.601 13.796  1.00 60.70  ? 370 TYR A CD1 1 
ATOM   2548 C CD2 . TYR A 1 370 ? 33.721 69.370 14.211  1.00 59.95  ? 370 TYR A CD2 1 
ATOM   2549 C CE1 . TYR A 1 370 ? 35.786 70.288 12.608  1.00 61.99  ? 370 TYR A CE1 1 
ATOM   2550 C CE2 . TYR A 1 370 ? 33.432 70.053 13.029  1.00 60.10  ? 370 TYR A CE2 1 
ATOM   2551 C CZ  . TYR A 1 370 ? 34.470 70.513 12.229  1.00 62.31  ? 370 TYR A CZ  1 
ATOM   2552 O OH  . TYR A 1 370 ? 34.201 71.212 11.065  1.00 62.22  ? 370 TYR A OH  1 
ATOM   2553 N N   . PHE A 1 371 ? 34.101 70.831 17.211  1.00 46.45  ? 371 PHE A N   1 
ATOM   2554 C CA  . PHE A 1 371 ? 33.381 72.091 17.179  1.00 44.39  ? 371 PHE A CA  1 
ATOM   2555 C C   . PHE A 1 371 ? 33.945 73.164 18.105  1.00 44.42  ? 371 PHE A C   1 
ATOM   2556 O O   . PHE A 1 371 ? 33.923 74.348 17.768  1.00 44.20  ? 371 PHE A O   1 
ATOM   2557 C CB  . PHE A 1 371 ? 31.910 71.845 17.484  1.00 41.01  ? 371 PHE A CB  1 
ATOM   2558 C CG  . PHE A 1 371 ? 31.237 70.948 16.492  1.00 39.15  ? 371 PHE A CG  1 
ATOM   2559 C CD1 . PHE A 1 371 ? 30.830 71.441 15.259  1.00 39.15  ? 371 PHE A CD1 1 
ATOM   2560 C CD2 . PHE A 1 371 ? 31.022 69.608 16.774  1.00 38.11  ? 371 PHE A CD2 1 
ATOM   2561 C CE1 . PHE A 1 371 ? 30.218 70.611 14.325  1.00 37.70  ? 371 PHE A CE1 1 
ATOM   2562 C CE2 . PHE A 1 371 ? 30.409 68.772 15.841  1.00 36.72  ? 371 PHE A CE2 1 
ATOM   2563 C CZ  . PHE A 1 371 ? 30.007 69.277 14.618  1.00 35.61  ? 371 PHE A CZ  1 
ATOM   2564 N N   . LEU A 1 372 ? 34.444 72.765 19.270  1.00 44.72  ? 372 LEU A N   1 
ATOM   2565 C CA  . LEU A 1 372 ? 35.021 73.737 20.194  1.00 44.92  ? 372 LEU A CA  1 
ATOM   2566 C C   . LEU A 1 372 ? 36.244 74.367 19.530  1.00 46.64  ? 372 LEU A C   1 
ATOM   2567 O O   . LEU A 1 372 ? 36.414 75.589 19.554  1.00 48.73  ? 372 LEU A O   1 
ATOM   2568 C CB  . LEU A 1 372 ? 35.446 73.061 21.500  1.00 43.00  ? 372 LEU A CB  1 
ATOM   2569 C CG  . LEU A 1 372 ? 36.127 73.943 22.560  1.00 41.82  ? 372 LEU A CG  1 
ATOM   2570 C CD1 . LEU A 1 372 ? 35.117 74.915 23.167  1.00 37.99  ? 372 LEU A CD1 1 
ATOM   2571 C CD2 . LEU A 1 372 ? 36.725 73.062 23.645  1.00 39.44  ? 372 LEU A CD2 1 
ATOM   2572 N N   . LEU A 1 373 ? 37.095 73.534 18.935  1.00 45.58  ? 373 LEU A N   1 
ATOM   2573 C CA  . LEU A 1 373 ? 38.290 74.039 18.271  1.00 45.92  ? 373 LEU A CA  1 
ATOM   2574 C C   . LEU A 1 373 ? 37.949 75.117 17.245  1.00 46.68  ? 373 LEU A C   1 
ATOM   2575 O O   . LEU A 1 373 ? 38.541 76.193 17.249  1.00 46.22  ? 373 LEU A O   1 
ATOM   2576 C CB  . LEU A 1 373 ? 39.044 72.900 17.573  1.00 44.81  ? 373 LEU A CB  1 
ATOM   2577 C CG  . LEU A 1 373 ? 40.224 73.312 16.679  1.00 42.37  ? 373 LEU A CG  1 
ATOM   2578 C CD1 . LEU A 1 373 ? 41.260 74.054 17.505  1.00 43.96  ? 373 LEU A CD1 1 
ATOM   2579 C CD2 . LEU A 1 373 ? 40.852 72.092 16.036  1.00 42.66  ? 373 LEU A CD2 1 
ATOM   2580 N N   . TYR A 1 374 ? 36.983 74.826 16.381  1.00 47.56  ? 374 TYR A N   1 
ATOM   2581 C CA  . TYR A 1 374 ? 36.585 75.754 15.329  1.00 48.66  ? 374 TYR A CA  1 
ATOM   2582 C C   . TYR A 1 374 ? 35.921 77.065 15.725  1.00 50.40  ? 374 TYR A C   1 
ATOM   2583 O O   . TYR A 1 374 ? 36.165 78.081 15.085  1.00 52.20  ? 374 TYR A O   1 
ATOM   2584 C CB  . TYR A 1 374 ? 35.690 75.049 14.310  1.00 45.14  ? 374 TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 374 ? 36.439 74.390 13.178  1.00 44.97  ? 374 TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 374 ? 37.257 73.284 13.407  1.00 44.53  ? 374 TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 374 ? 36.321 74.864 11.868  1.00 44.61  ? 374 TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 374 ? 37.941 72.661 12.362  1.00 42.87  ? 374 TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 374 ? 37.000 74.249 10.816  1.00 44.77  ? 374 TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 374 ? 37.807 73.147 11.071  1.00 44.85  ? 374 TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 374 ? 38.476 72.524 10.038  1.00 47.35  ? 374 TYR A OH  1 
ATOM   2592 N N   . ASP A 1 375 ? 35.088 77.070 16.757  1.00 52.79  ? 375 ASP A N   1 
ATOM   2593 C CA  . ASP A 1 375 ? 34.421 78.316 17.130  1.00 56.95  ? 375 ASP A CA  1 
ATOM   2594 C C   . ASP A 1 375 ? 35.204 79.235 18.069  1.00 57.23  ? 375 ASP A C   1 
ATOM   2595 O O   . ASP A 1 375 ? 34.836 80.396 18.261  1.00 56.11  ? 375 ASP A O   1 
ATOM   2596 C CB  . ASP A 1 375 ? 33.042 78.017 17.724  1.00 60.05  ? 375 ASP A CB  1 
ATOM   2597 C CG  . ASP A 1 375 ? 32.061 77.492 16.683  1.00 63.90  ? 375 ASP A CG  1 
ATOM   2598 O OD1 . ASP A 1 375 ? 32.265 76.367 16.173  1.00 63.80  ? 375 ASP A OD1 1 
ATOM   2599 O OD2 . ASP A 1 375 ? 31.087 78.211 16.369  1.00 65.28  ? 375 ASP A OD2 1 
ATOM   2600 N N   . PHE A 1 376 ? 36.274 78.712 18.656  1.00 57.77  ? 376 PHE A N   1 
ATOM   2601 C CA  . PHE A 1 376 ? 37.105 79.487 19.570  1.00 58.82  ? 376 PHE A CA  1 
ATOM   2602 C C   . PHE A 1 376 ? 38.537 79.157 19.222  1.00 59.59  ? 376 PHE A C   1 
ATOM   2603 O O   . PHE A 1 376 ? 39.364 78.900 20.098  1.00 58.90  ? 376 PHE A O   1 
ATOM   2604 C CB  . PHE A 1 376 ? 36.807 79.102 21.020  1.00 58.97  ? 376 PHE A CB  1 
ATOM   2605 C CG  . PHE A 1 376 ? 35.371 79.295 21.405  1.00 61.31  ? 376 PHE A CG  1 
ATOM   2606 C CD1 . PHE A 1 376 ? 34.371 78.510 20.834  1.00 62.37  ? 376 PHE A CD1 1 
ATOM   2607 C CD2 . PHE A 1 376 ? 35.005 80.289 22.299  1.00 61.52  ? 376 PHE A CD2 1 
ATOM   2608 C CE1 . PHE A 1 376 ? 33.031 78.718 21.145  1.00 61.64  ? 376 PHE A CE1 1 
ATOM   2609 C CE2 . PHE A 1 376 ? 33.664 80.504 22.617  1.00 60.98  ? 376 PHE A CE2 1 
ATOM   2610 C CZ  . PHE A 1 376 ? 32.677 79.719 22.038  1.00 60.46  ? 376 PHE A CZ  1 
ATOM   2611 N N   . ILE A 1 377 ? 38.805 79.173 17.920  1.00 61.23  ? 377 ILE A N   1 
ATOM   2612 C CA  . ILE A 1 377 ? 40.114 78.850 17.373  1.00 62.90  ? 377 ILE A CA  1 
ATOM   2613 C C   . ILE A 1 377 ? 41.212 79.790 17.851  1.00 64.46  ? 377 ILE A C   1 
ATOM   2614 O O   . ILE A 1 377 ? 42.398 79.475 17.751  1.00 65.41  ? 377 ILE A O   1 
ATOM   2615 C CB  . ILE A 1 377 ? 40.065 78.845 15.835  1.00 61.47  ? 377 ILE A CB  1 
ATOM   2616 C CG1 . ILE A 1 377 ? 41.291 78.126 15.276  1.00 60.67  ? 377 ILE A CG1 1 
ATOM   2617 C CG2 . ILE A 1 377 ? 39.991 80.266 15.320  1.00 61.52  ? 377 ILE A CG2 1 
ATOM   2618 C CD1 . ILE A 1 377 ? 41.099 77.589 13.870  1.00 59.45  ? 377 ILE A CD1 1 
ATOM   2619 N N   . ASP A 1 378 ? 40.820 80.944 18.374  1.00 66.35  ? 378 ASP A N   1 
ATOM   2620 C CA  . ASP A 1 378 ? 41.794 81.897 18.884  1.00 67.59  ? 378 ASP A CA  1 
ATOM   2621 C C   . ASP A 1 378 ? 42.395 81.304 20.150  1.00 67.72  ? 378 ASP A C   1 
ATOM   2622 O O   . ASP A 1 378 ? 43.607 81.336 20.346  1.00 68.84  ? 378 ASP A O   1 
ATOM   2623 C CB  . ASP A 1 378 ? 41.116 83.222 19.218  1.00 69.82  ? 378 ASP A CB  1 
ATOM   2624 C CG  . ASP A 1 378 ? 40.316 83.774 18.056  1.00 71.80  ? 378 ASP A CG  1 
ATOM   2625 O OD1 . ASP A 1 378 ? 40.913 84.039 16.988  1.00 72.99  ? 378 ASP A OD1 1 
ATOM   2626 O OD2 . ASP A 1 378 ? 39.086 83.939 18.213  1.00 72.96  ? 378 ASP A OD2 1 
ATOM   2627 N N   . TYR A 1 379 ? 41.530 80.749 20.995  1.00 66.98  ? 379 TYR A N   1 
ATOM   2628 C CA  . TYR A 1 379 ? 41.940 80.141 22.257  1.00 65.87  ? 379 TYR A CA  1 
ATOM   2629 C C   . TYR A 1 379 ? 42.634 78.799 22.098  1.00 64.15  ? 379 TYR A C   1 
ATOM   2630 O O   . TYR A 1 379 ? 43.566 78.488 22.831  1.00 64.28  ? 379 TYR A O   1 
ATOM   2631 C CB  . TYR A 1 379 ? 40.730 79.897 23.157  1.00 68.09  ? 379 TYR A CB  1 
ATOM   2632 C CG  . TYR A 1 379 ? 39.851 81.095 23.418  1.00 71.81  ? 379 TYR A CG  1 
ATOM   2633 C CD1 . TYR A 1 379 ? 40.255 82.117 24.279  1.00 71.30  ? 379 TYR A CD1 1 
ATOM   2634 C CD2 . TYR A 1 379 ? 38.593 81.191 22.824  1.00 73.07  ? 379 TYR A CD2 1 
ATOM   2635 C CE1 . TYR A 1 379 ? 39.421 83.198 24.542  1.00 70.63  ? 379 TYR A CE1 1 
ATOM   2636 C CE2 . TYR A 1 379 ? 37.758 82.266 23.079  1.00 72.49  ? 379 TYR A CE2 1 
ATOM   2637 C CZ  . TYR A 1 379 ? 38.174 83.261 23.935  1.00 71.06  ? 379 TYR A CZ  1 
ATOM   2638 O OH  . TYR A 1 379 ? 37.326 84.313 24.168  1.00 71.87  ? 379 TYR A OH  1 
ATOM   2639 N N   . PHE A 1 380 ? 42.183 77.997 21.144  1.00 62.07  ? 380 PHE A N   1 
ATOM   2640 C CA  . PHE A 1 380 ? 42.755 76.671 21.005  1.00 60.24  ? 380 PHE A CA  1 
ATOM   2641 C C   . PHE A 1 380 ? 43.600 76.369 19.789  1.00 58.46  ? 380 PHE A C   1 
ATOM   2642 O O   . PHE A 1 380 ? 43.623 77.119 18.818  1.00 56.84  ? 380 PHE A O   1 
ATOM   2643 C CB  . PHE A 1 380 ? 41.635 75.646 21.131  1.00 59.31  ? 380 PHE A CB  1 
ATOM   2644 C CG  . PHE A 1 380 ? 40.711 75.926 22.273  1.00 60.01  ? 380 PHE A CG  1 
ATOM   2645 C CD1 . PHE A 1 380 ? 41.164 75.834 23.583  1.00 59.71  ? 380 PHE A CD1 1 
ATOM   2646 C CD2 . PHE A 1 380 ? 39.402 76.329 22.044  1.00 60.78  ? 380 PHE A CD2 1 
ATOM   2647 C CE1 . PHE A 1 380 ? 40.329 76.141 24.651  1.00 60.07  ? 380 PHE A CE1 1 
ATOM   2648 C CE2 . PHE A 1 380 ? 38.557 76.638 23.108  1.00 60.41  ? 380 PHE A CE2 1 
ATOM   2649 C CZ  . PHE A 1 380 ? 39.024 76.544 24.413  1.00 59.84  ? 380 PHE A CZ  1 
ATOM   2650 N N   . ASP A 1 381 ? 44.303 75.247 19.874  1.00 57.93  ? 381 ASP A N   1 
ATOM   2651 C CA  . ASP A 1 381 ? 45.171 74.803 18.810  1.00 58.78  ? 381 ASP A CA  1 
ATOM   2652 C C   . ASP A 1 381 ? 44.872 73.355 18.434  1.00 58.58  ? 381 ASP A C   1 
ATOM   2653 O O   . ASP A 1 381 ? 44.551 72.528 19.277  1.00 58.93  ? 381 ASP A O   1 
ATOM   2654 C CB  . ASP A 1 381 ? 46.631 74.975 19.231  1.00 59.33  ? 381 ASP A CB  1 
ATOM   2655 C CG  . ASP A 1 381 ? 47.597 74.646 18.115  1.00 60.92  ? 381 ASP A CG  1 
ATOM   2656 O OD1 . ASP A 1 381 ? 47.983 73.461 17.998  1.00 62.53  ? 381 ASP A OD1 1 
ATOM   2657 O OD2 . ASP A 1 381 ? 47.954 75.569 17.349  1.00 58.47  ? 381 ASP A OD2 1 
ATOM   2658 N N   . LYS A 1 382 ? 44.978 73.076 17.144  1.00 58.39  ? 382 LYS A N   1 
ATOM   2659 C CA  . LYS A 1 382 ? 44.708 71.771 16.581  1.00 58.16  ? 382 LYS A CA  1 
ATOM   2660 C C   . LYS A 1 382 ? 45.623 70.643 17.027  1.00 58.85  ? 382 LYS A C   1 
ATOM   2661 O O   . LYS A 1 382 ? 45.205 69.488 17.076  1.00 58.67  ? 382 LYS A O   1 
ATOM   2662 C CB  . LYS A 1 382 ? 44.760 71.884 15.070  1.00 57.97  ? 382 LYS A CB  1 
ATOM   2663 C CG  . LYS A 1 382 ? 44.919 70.582 14.364  1.00 60.40  ? 382 LYS A CG  1 
ATOM   2664 C CD  . LYS A 1 382 ? 45.154 70.894 12.937  1.00 59.68  ? 382 LYS A CD  1 
ATOM   2665 C CE  . LYS A 1 382 ? 46.478 71.597 12.677  1.00 58.38  ? 382 LYS A CE  1 
ATOM   2666 N NZ  . LYS A 1 382 ? 46.687 71.893 11.225  1.00 59.74  ? 382 LYS A NZ  1 
ATOM   2667 N N   . ASP A 1 383 ? 46.870 70.964 17.346  1.00 60.13  ? 383 ASP A N   1 
ATOM   2668 C CA  . ASP A 1 383 ? 47.816 69.929 17.741  1.00 61.66  ? 383 ASP A CA  1 
ATOM   2669 C C   . ASP A 1 383 ? 48.090 69.783 19.223  1.00 61.98  ? 383 ASP A C   1 
ATOM   2670 O O   . ASP A 1 383 ? 48.255 68.663 19.713  1.00 61.79  ? 383 ASP A O   1 
ATOM   2671 C CB  . ASP A 1 383 ? 49.145 70.133 17.026  1.00 63.52  ? 383 ASP A CB  1 
ATOM   2672 C CG  . ASP A 1 383 ? 49.129 69.610 15.611  1.00 65.85  ? 383 ASP A CG  1 
ATOM   2673 O OD1 . ASP A 1 383 ? 48.330 70.110 14.798  1.00 68.27  ? 383 ASP A OD1 1 
ATOM   2674 O OD2 . ASP A 1 383 ? 49.921 68.694 15.309  1.00 68.34  ? 383 ASP A OD2 1 
ATOM   2675 N N   . ASP A 1 384 ? 48.156 70.903 19.937  1.00 61.15  ? 384 ASP A N   1 
ATOM   2676 C CA  . ASP A 1 384 ? 48.446 70.853 21.368  1.00 59.91  ? 384 ASP A CA  1 
ATOM   2677 C C   . ASP A 1 384 ? 47.271 71.246 22.237  1.00 57.79  ? 384 ASP A C   1 
ATOM   2678 O O   . ASP A 1 384 ? 46.370 71.958 21.805  1.00 57.76  ? 384 ASP A O   1 
ATOM   2679 C CB  . ASP A 1 384 ? 49.628 71.767 21.719  1.00 61.27  ? 384 ASP A CB  1 
ATOM   2680 C CG  . ASP A 1 384 ? 50.868 71.457 20.913  1.00 62.93  ? 384 ASP A CG  1 
ATOM   2681 O OD1 . ASP A 1 384 ? 51.226 70.261 20.805  1.00 64.61  ? 384 ASP A OD1 1 
ATOM   2682 O OD2 . ASP A 1 384 ? 51.488 72.414 20.398  1.00 63.27  ? 384 ASP A OD2 1 
ATOM   2683 N N   . ALA A 1 385 ? 47.291 70.769 23.473  1.00 55.49  ? 385 ALA A N   1 
ATOM   2684 C CA  . ALA A 1 385 ? 46.249 71.100 24.419  1.00 54.69  ? 385 ALA A CA  1 
ATOM   2685 C C   . ALA A 1 385 ? 46.648 72.479 24.922  1.00 55.47  ? 385 ALA A C   1 
ATOM   2686 O O   . ALA A 1 385 ? 47.826 72.837 24.876  1.00 57.51  ? 385 ALA A O   1 
ATOM   2687 C CB  . ALA A 1 385 ? 46.243 70.099 25.558  1.00 51.96  ? 385 ALA A CB  1 
ATOM   2688 N N   . THR A 1 386 ? 45.685 73.266 25.381  1.00 53.87  ? 386 THR A N   1 
ATOM   2689 C CA  . THR A 1 386 ? 46.021 74.581 25.889  1.00 54.21  ? 386 THR A CA  1 
ATOM   2690 C C   . THR A 1 386 ? 45.598 74.731 27.351  1.00 55.78  ? 386 THR A C   1 
ATOM   2691 O O   . THR A 1 386 ? 44.499 74.332 27.737  1.00 55.06  ? 386 THR A O   1 
ATOM   2692 C CB  . THR A 1 386 ? 45.348 75.693 25.073  1.00 54.40  ? 386 THR A CB  1 
ATOM   2693 O OG1 . THR A 1 386 ? 43.979 75.816 25.470  1.00 52.87  ? 386 THR A OG1 1 
ATOM   2694 C CG2 . THR A 1 386 ? 45.429 75.389 23.595  1.00 53.30  ? 386 THR A CG2 1 
ATOM   2695 N N   . ALA A 1 387 ? 46.483 75.298 28.165  1.00 56.03  ? 387 ALA A N   1 
ATOM   2696 C CA  . ALA A 1 387 ? 46.174 75.515 29.566  1.00 56.69  ? 387 ALA A CA  1 
ATOM   2697 C C   . ALA A 1 387 ? 45.226 76.715 29.642  1.00 58.36  ? 387 ALA A C   1 
ATOM   2698 O O   . ALA A 1 387 ? 45.635 77.861 29.443  1.00 59.00  ? 387 ALA A O   1 
ATOM   2699 C CB  . ALA A 1 387 ? 47.448 75.782 30.344  1.00 56.49  ? 387 ALA A CB  1 
ATOM   2700 N N   . LEU A 1 388 ? 43.956 76.441 29.926  1.00 58.94  ? 388 LEU A N   1 
ATOM   2701 C CA  . LEU A 1 388 ? 42.939 77.485 29.990  1.00 60.11  ? 388 LEU A CA  1 
ATOM   2702 C C   . LEU A 1 388 ? 42.712 78.048 31.397  1.00 61.66  ? 388 LEU A C   1 
ATOM   2703 O O   . LEU A 1 388 ? 42.367 77.309 32.320  1.00 62.36  ? 388 LEU A O   1 
ATOM   2704 C CB  . LEU A 1 388 ? 41.619 76.933 29.443  1.00 59.83  ? 388 LEU A CB  1 
ATOM   2705 C CG  . LEU A 1 388 ? 40.522 77.918 29.036  1.00 59.19  ? 388 LEU A CG  1 
ATOM   2706 C CD1 . LEU A 1 388 ? 40.967 78.707 27.816  1.00 58.35  ? 388 LEU A CD1 1 
ATOM   2707 C CD2 . LEU A 1 388 ? 39.255 77.155 28.717  1.00 58.22  ? 388 LEU A CD2 1 
ATOM   2708 N N   . PRO A 1 389 ? 42.899 79.372 31.572  1.00 61.85  ? 389 PRO A N   1 
ATOM   2709 C CA  . PRO A 1 389 ? 42.720 80.071 32.850  1.00 61.76  ? 389 PRO A CA  1 
ATOM   2710 C C   . PRO A 1 389 ? 41.260 80.039 33.299  1.00 62.69  ? 389 PRO A C   1 
ATOM   2711 O O   . PRO A 1 389 ? 40.362 79.833 32.487  1.00 63.46  ? 389 PRO A O   1 
ATOM   2712 C CB  . PRO A 1 389 ? 43.181 81.487 32.534  1.00 61.18  ? 389 PRO A CB  1 
ATOM   2713 C CG  . PRO A 1 389 ? 44.164 81.287 31.440  1.00 62.24  ? 389 PRO A CG  1 
ATOM   2714 C CD  . PRO A 1 389 ? 43.465 80.286 30.570  1.00 62.45  ? 389 PRO A CD  1 
ATOM   2715 N N   . ARG A 1 390 ? 41.023 80.260 34.588  1.00 62.97  ? 390 ARG A N   1 
ATOM   2716 C CA  . ARG A 1 390 ? 39.667 80.233 35.125  1.00 63.22  ? 390 ARG A CA  1 
ATOM   2717 C C   . ARG A 1 390 ? 38.771 81.291 34.475  1.00 63.97  ? 390 ARG A C   1 
ATOM   2718 O O   . ARG A 1 390 ? 37.593 81.050 34.215  1.00 65.03  ? 390 ARG A O   1 
ATOM   2719 C CB  . ARG A 1 390 ? 39.704 80.440 36.642  1.00 62.70  ? 390 ARG A CB  1 
ATOM   2720 C CG  . ARG A 1 390 ? 38.641 79.673 37.402  1.00 62.92  ? 390 ARG A CG  1 
ATOM   2721 C CD  . ARG A 1 390 ? 37.233 80.060 36.967  1.00 65.00  ? 390 ARG A CD  1 
ATOM   2722 N NE  . ARG A 1 390 ? 36.309 78.923 37.009  1.00 66.70  ? 390 ARG A NE  1 
ATOM   2723 C CZ  . ARG A 1 390 ? 35.295 78.804 37.860  1.00 66.15  ? 390 ARG A CZ  1 
ATOM   2724 N NH1 . ARG A 1 390 ? 35.062 79.757 38.754  1.00 66.97  ? 390 ARG A NH1 1 
ATOM   2725 N NH2 . ARG A 1 390 ? 34.512 77.734 37.814  1.00 65.30  ? 390 ARG A NH2 1 
ATOM   2726 N N   . ASP A 1 391 ? 39.331 82.463 34.213  1.00 64.22  ? 391 ASP A N   1 
ATOM   2727 C CA  . ASP A 1 391 ? 38.572 83.542 33.599  1.00 64.83  ? 391 ASP A CA  1 
ATOM   2728 C C   . ASP A 1 391 ? 38.180 83.157 32.184  1.00 63.56  ? 391 ASP A C   1 
ATOM   2729 O O   . ASP A 1 391 ? 37.074 83.459 31.744  1.00 63.44  ? 391 ASP A O   1 
ATOM   2730 C CB  . ASP A 1 391 ? 39.411 84.820 33.577  1.00 69.06  ? 391 ASP A CB  1 
ATOM   2731 C CG  . ASP A 1 391 ? 40.689 84.666 32.766  1.00 73.06  ? 391 ASP A CG  1 
ATOM   2732 O OD1 . ASP A 1 391 ? 41.172 83.520 32.629  1.00 75.49  ? 391 ASP A OD1 1 
ATOM   2733 O OD2 . ASP A 1 391 ? 41.219 85.690 32.279  1.00 74.92  ? 391 ASP A OD2 1 
ATOM   2734 N N   . LYS A 1 392 ? 39.097 82.494 31.479  1.00 62.68  ? 392 LYS A N   1 
ATOM   2735 C CA  . LYS A 1 392 ? 38.874 82.043 30.101  1.00 62.41  ? 392 LYS A CA  1 
ATOM   2736 C C   . LYS A 1 392 ? 37.776 80.982 30.046  1.00 60.35  ? 392 LYS A C   1 
ATOM   2737 O O   . LYS A 1 392 ? 36.872 81.044 29.209  1.00 60.54  ? 392 LYS A O   1 
ATOM   2738 C CB  . LYS A 1 392 ? 40.165 81.460 29.514  1.00 63.37  ? 392 LYS A CB  1 
ATOM   2739 C CG  . LYS A 1 392 ? 41.221 82.482 29.132  1.00 63.99  ? 392 LYS A CG  1 
ATOM   2740 C CD  . LYS A 1 392 ? 40.818 83.250 27.886  1.00 65.72  ? 392 LYS A CD  1 
ATOM   2741 C CE  . LYS A 1 392 ? 41.934 84.178 27.425  1.00 65.82  ? 392 LYS A CE  1 
ATOM   2742 N NZ  . LYS A 1 392 ? 42.273 85.181 28.471  1.00 65.63  ? 392 LYS A NZ  1 
ATOM   2743 N N   . TYR A 1 393 ? 37.874 80.000 30.934  1.00 57.52  ? 393 TYR A N   1 
ATOM   2744 C CA  . TYR A 1 393 ? 36.888 78.938 31.008  1.00 55.09  ? 393 TYR A CA  1 
ATOM   2745 C C   . TYR A 1 393 ? 35.498 79.563 31.160  1.00 54.44  ? 393 TYR A C   1 
ATOM   2746 O O   . TYR A 1 393 ? 34.571 79.210 30.436  1.00 55.39  ? 393 TYR A O   1 
ATOM   2747 C CB  . TYR A 1 393 ? 37.201 78.015 32.196  1.00 54.09  ? 393 TYR A CB  1 
ATOM   2748 C CG  . TYR A 1 393 ? 36.056 77.107 32.602  1.00 52.89  ? 393 TYR A CG  1 
ATOM   2749 C CD1 . TYR A 1 393 ? 35.803 75.910 31.930  1.00 51.45  ? 393 TYR A CD1 1 
ATOM   2750 C CD2 . TYR A 1 393 ? 35.193 77.475 33.636  1.00 52.62  ? 393 TYR A CD2 1 
ATOM   2751 C CE1 . TYR A 1 393 ? 34.714 75.108 32.277  1.00 49.64  ? 393 TYR A CE1 1 
ATOM   2752 C CE2 . TYR A 1 393 ? 34.107 76.681 33.988  1.00 51.65  ? 393 TYR A CE2 1 
ATOM   2753 C CZ  . TYR A 1 393 ? 33.871 75.504 33.307  1.00 49.89  ? 393 TYR A CZ  1 
ATOM   2754 O OH  . TYR A 1 393 ? 32.784 74.742 33.660  1.00 49.42  ? 393 TYR A OH  1 
ATOM   2755 N N   . LEU A 1 394 ? 35.355 80.502 32.089  1.00 53.64  ? 394 LEU A N   1 
ATOM   2756 C CA  . LEU A 1 394 ? 34.065 81.153 32.310  1.00 52.63  ? 394 LEU A CA  1 
ATOM   2757 C C   . LEU A 1 394 ? 33.657 81.977 31.095  1.00 54.11  ? 394 LEU A C   1 
ATOM   2758 O O   . LEU A 1 394 ? 32.497 81.985 30.677  1.00 54.29  ? 394 LEU A O   1 
ATOM   2759 C CB  . LEU A 1 394 ? 34.141 82.053 33.540  1.00 47.60  ? 394 LEU A CB  1 
ATOM   2760 C CG  . LEU A 1 394 ? 34.275 81.304 34.861  1.00 48.36  ? 394 LEU A CG  1 
ATOM   2761 C CD1 . LEU A 1 394 ? 34.641 82.258 35.974  1.00 46.06  ? 394 LEU A CD1 1 
ATOM   2762 C CD2 . LEU A 1 394 ? 32.964 80.595 35.168  1.00 48.59  ? 394 LEU A CD2 1 
ATOM   2763 N N   . GLU A 1 395 ? 34.633 82.671 30.531  1.00 55.50  ? 395 GLU A N   1 
ATOM   2764 C CA  . GLU A 1 395 ? 34.407 83.518 29.375  1.00 56.01  ? 395 GLU A CA  1 
ATOM   2765 C C   . GLU A 1 395 ? 33.789 82.692 28.257  1.00 54.79  ? 395 GLU A C   1 
ATOM   2766 O O   . GLU A 1 395 ? 32.764 83.071 27.686  1.00 55.84  ? 395 GLU A O   1 
ATOM   2767 C CB  . GLU A 1 395 ? 35.739 84.101 28.925  1.00 58.10  ? 395 GLU A CB  1 
ATOM   2768 C CG  . GLU A 1 395 ? 35.648 85.250 27.955  1.00 62.22  ? 395 GLU A CG  1 
ATOM   2769 C CD  . GLU A 1 395 ? 36.975 85.480 27.261  1.00 65.14  ? 395 GLU A CD  1 
ATOM   2770 O OE1 . GLU A 1 395 ? 37.376 84.604 26.467  1.00 66.02  ? 395 GLU A OE1 1 
ATOM   2771 O OE2 . GLU A 1 395 ? 37.627 86.515 27.517  1.00 66.97  ? 395 GLU A OE2 1 
ATOM   2772 N N   . ILE A 1 396 ? 34.416 81.556 27.962  1.00 52.63  ? 396 ILE A N   1 
ATOM   2773 C CA  . ILE A 1 396 ? 33.948 80.655 26.914  1.00 50.55  ? 396 ILE A CA  1 
ATOM   2774 C C   . ILE A 1 396 ? 32.617 80.002 27.245  1.00 49.58  ? 396 ILE A C   1 
ATOM   2775 O O   . ILE A 1 396 ? 31.699 80.017 26.431  1.00 49.98  ? 396 ILE A O   1 
ATOM   2776 C CB  . ILE A 1 396 ? 34.985 79.557 26.629  1.00 49.66  ? 396 ILE A CB  1 
ATOM   2777 C CG1 . ILE A 1 396 ? 36.150 80.155 25.839  1.00 49.44  ? 396 ILE A CG1 1 
ATOM   2778 C CG2 . ILE A 1 396 ? 34.338 78.411 25.880  1.00 48.40  ? 396 ILE A CG2 1 
ATOM   2779 C CD1 . ILE A 1 396 ? 37.281 79.201 25.591  1.00 51.11  ? 396 ILE A CD1 1 
ATOM   2780 N N   . MET A 1 397 ? 32.511 79.427 28.436  1.00 49.01  ? 397 MET A N   1 
ATOM   2781 C CA  . MET A 1 397 ? 31.272 78.782 28.841  1.00 48.66  ? 397 MET A CA  1 
ATOM   2782 C C   . MET A 1 397 ? 30.100 79.733 28.681  1.00 49.43  ? 397 MET A C   1 
ATOM   2783 O O   . MET A 1 397 ? 29.122 79.410 28.010  1.00 50.50  ? 397 MET A O   1 
ATOM   2784 C CB  . MET A 1 397 ? 31.339 78.323 30.303  1.00 46.08  ? 397 MET A CB  1 
ATOM   2785 C CG  . MET A 1 397 ? 32.215 77.116 30.559  1.00 43.49  ? 397 MET A CG  1 
ATOM   2786 S SD  . MET A 1 397 ? 31.755 75.676 29.587  1.00 41.96  ? 397 MET A SD  1 
ATOM   2787 C CE  . MET A 1 397 ? 30.388 75.022 30.535  1.00 37.80  ? 397 MET A CE  1 
ATOM   2788 N N   . ASN A 1 398 ? 30.202 80.907 29.299  1.00 50.50  ? 398 ASN A N   1 
ATOM   2789 C CA  . ASN A 1 398 ? 29.128 81.895 29.245  1.00 51.46  ? 398 ASN A CA  1 
ATOM   2790 C C   . ASN A 1 398 ? 28.766 82.247 27.823  1.00 51.40  ? 398 ASN A C   1 
ATOM   2791 O O   . ASN A 1 398 ? 27.660 82.722 27.555  1.00 51.14  ? 398 ASN A O   1 
ATOM   2792 C CB  . ASN A 1 398 ? 29.514 83.157 30.017  1.00 52.13  ? 398 ASN A CB  1 
ATOM   2793 C CG  . ASN A 1 398 ? 29.421 82.968 31.516  1.00 52.30  ? 398 ASN A CG  1 
ATOM   2794 O OD1 . ASN A 1 398 ? 28.353 82.644 32.049  1.00 51.63  ? 398 ASN A OD1 1 
ATOM   2795 N ND2 . ASN A 1 398 ? 30.540 83.166 32.207  1.00 52.34  ? 398 ASN A ND2 1 
ATOM   2796 N N   . ASN A 1 399 ? 29.700 82.011 26.909  1.00 51.53  ? 399 ASN A N   1 
ATOM   2797 C CA  . ASN A 1 399 ? 29.457 82.276 25.497  1.00 52.49  ? 399 ASN A CA  1 
ATOM   2798 C C   . ASN A 1 399 ? 28.566 81.172 24.923  1.00 51.41  ? 399 ASN A C   1 
ATOM   2799 O O   . ASN A 1 399 ? 27.428 81.419 24.513  1.00 51.33  ? 399 ASN A O   1 
ATOM   2800 C CB  . ASN A 1 399 ? 30.780 82.321 24.729  1.00 54.35  ? 399 ASN A CB  1 
ATOM   2801 C CG  . ASN A 1 399 ? 30.584 82.524 23.227  1.00 57.48  ? 399 ASN A CG  1 
ATOM   2802 O OD1 . ASN A 1 399 ? 31.553 82.677 22.481  1.00 57.65  ? 399 ASN A OD1 1 
ATOM   2803 N ND2 . ASN A 1 399 ? 29.328 82.522 22.780  1.00 57.78  ? 399 ASN A ND2 1 
ATOM   2804 N N   . ILE A 1 400 ? 29.099 79.957 24.907  1.00 48.70  ? 400 ILE A N   1 
ATOM   2805 C CA  . ILE A 1 400 ? 28.382 78.805 24.389  1.00 48.16  ? 400 ILE A CA  1 
ATOM   2806 C C   . ILE A 1 400 ? 26.940 78.690 24.894  1.00 48.96  ? 400 ILE A C   1 
ATOM   2807 O O   . ILE A 1 400 ? 26.020 78.440 24.111  1.00 48.29  ? 400 ILE A O   1 
ATOM   2808 C CB  . ILE A 1 400 ? 29.142 77.504 24.721  1.00 46.09  ? 400 ILE A CB  1 
ATOM   2809 C CG1 . ILE A 1 400 ? 30.521 77.534 24.069  1.00 43.35  ? 400 ILE A CG1 1 
ATOM   2810 C CG2 . ILE A 1 400 ? 28.373 76.305 24.221  1.00 45.28  ? 400 ILE A CG2 1 
ATOM   2811 C CD1 . ILE A 1 400 ? 31.388 76.362 24.431  1.00 41.72  ? 400 ILE A CD1 1 
ATOM   2812 N N   . PHE A 1 401 ? 26.733 78.884 26.192  1.00 49.69  ? 401 PHE A N   1 
ATOM   2813 C CA  . PHE A 1 401 ? 25.387 78.768 26.750  1.00 51.49  ? 401 PHE A CA  1 
ATOM   2814 C C   . PHE A 1 401 ? 24.764 80.104 27.128  1.00 54.21  ? 401 PHE A C   1 
ATOM   2815 O O   . PHE A 1 401 ? 23.818 80.154 27.921  1.00 52.95  ? 401 PHE A O   1 
ATOM   2816 C CB  . PHE A 1 401 ? 25.393 77.849 27.972  1.00 47.90  ? 401 PHE A CB  1 
ATOM   2817 C CG  . PHE A 1 401 ? 26.063 76.535 27.731  1.00 47.16  ? 401 PHE A CG  1 
ATOM   2818 C CD1 . PHE A 1 401 ? 27.448 76.421 27.809  1.00 47.03  ? 401 PHE A CD1 1 
ATOM   2819 C CD2 . PHE A 1 401 ? 25.322 75.416 27.378  1.00 47.04  ? 401 PHE A CD2 1 
ATOM   2820 C CE1 . PHE A 1 401 ? 28.087 75.216 27.539  1.00 45.71  ? 401 PHE A CE1 1 
ATOM   2821 C CE2 . PHE A 1 401 ? 25.955 74.203 27.103  1.00 46.72  ? 401 PHE A CE2 1 
ATOM   2822 C CZ  . PHE A 1 401 ? 27.340 74.107 27.184  1.00 45.38  ? 401 PHE A CZ  1 
ATOM   2823 N N   . GLY A 1 402 ? 25.291 81.183 26.556  1.00 57.27  ? 402 GLY A N   1 
ATOM   2824 C CA  . GLY A 1 402 ? 24.758 82.504 26.844  1.00 61.30  ? 402 GLY A CA  1 
ATOM   2825 C C   . GLY A 1 402 ? 23.281 82.660 26.503  1.00 63.26  ? 402 GLY A C   1 
ATOM   2826 O O   . GLY A 1 402 ? 22.632 83.606 26.951  1.00 63.57  ? 402 GLY A O   1 
ATOM   2827 N N   . LYS A 1 403 ? 22.747 81.731 25.712  1.00 65.47  ? 403 LYS A N   1 
ATOM   2828 C CA  . LYS A 1 403 ? 21.343 81.782 25.314  1.00 66.57  ? 403 LYS A CA  1 
ATOM   2829 C C   . LYS A 1 403 ? 20.456 81.271 26.442  1.00 66.15  ? 403 LYS A C   1 
ATOM   2830 O O   . LYS A 1 403 ? 19.258 81.547 26.478  1.00 66.36  ? 403 LYS A O   1 
ATOM   2831 C CB  . LYS A 1 403 ? 21.115 80.946 24.042  1.00 68.23  ? 403 LYS A CB  1 
ATOM   2832 C CG  . LYS A 1 403 ? 20.637 79.507 24.274  1.00 71.75  ? 403 LYS A CG  1 
ATOM   2833 C CD  . LYS A 1 403 ? 21.644 78.636 25.036  1.00 73.84  ? 403 LYS A CD  1 
ATOM   2834 C CE  . LYS A 1 403 ? 21.043 77.250 25.336  1.00 75.08  ? 403 LYS A CE  1 
ATOM   2835 N NZ  . LYS A 1 403 ? 21.919 76.351 26.152  1.00 72.79  ? 403 LYS A NZ  1 
ATOM   2836 N N   . ALA A 1 404 ? 21.052 80.527 27.367  1.00 65.49  ? 404 ALA A N   1 
ATOM   2837 C CA  . ALA A 1 404 ? 20.304 79.978 28.489  1.00 64.82  ? 404 ALA A CA  1 
ATOM   2838 C C   . ALA A 1 404 ? 20.257 80.980 29.637  1.00 63.64  ? 404 ALA A C   1 
ATOM   2839 O O   . ALA A 1 404 ? 21.129 81.848 29.743  1.00 62.07  ? 404 ALA A O   1 
ATOM   2840 C CB  . ALA A 1 404 ? 20.946 78.682 28.949  1.00 64.63  ? 404 ALA A CB  1 
ATOM   2841 N N   . THR A 1 405 ? 19.241 80.860 30.489  1.00 62.58  ? 405 THR A N   1 
ATOM   2842 C CA  . THR A 1 405 ? 19.103 81.763 31.626  1.00 63.21  ? 405 THR A CA  1 
ATOM   2843 C C   . THR A 1 405 ? 20.416 81.724 32.393  1.00 64.47  ? 405 THR A C   1 
ATOM   2844 O O   . THR A 1 405 ? 21.242 80.844 32.160  1.00 65.79  ? 405 THR A O   1 
ATOM   2845 C CB  . THR A 1 405 ? 17.970 81.327 32.578  1.00 62.79  ? 405 THR A CB  1 
ATOM   2846 O OG1 . THR A 1 405 ? 18.399 80.202 33.347  1.00 63.68  ? 405 THR A OG1 1 
ATOM   2847 C CG2 . THR A 1 405 ? 16.729 80.941 31.797  1.00 62.85  ? 405 THR A CG2 1 
ATOM   2848 N N   . GLN A 1 406 ? 20.627 82.666 33.304  1.00 64.70  ? 406 GLN A N   1 
ATOM   2849 C CA  . GLN A 1 406 ? 21.873 82.663 34.050  1.00 64.94  ? 406 GLN A CA  1 
ATOM   2850 C C   . GLN A 1 406 ? 21.849 81.572 35.113  1.00 63.69  ? 406 GLN A C   1 
ATOM   2851 O O   . GLN A 1 406 ? 22.894 81.019 35.457  1.00 62.42  ? 406 GLN A O   1 
ATOM   2852 C CB  . GLN A 1 406 ? 22.120 84.019 34.699  1.00 67.89  ? 406 GLN A CB  1 
ATOM   2853 C CG  . GLN A 1 406 ? 23.486 84.127 35.353  1.00 72.25  ? 406 GLN A CG  1 
ATOM   2854 C CD  . GLN A 1 406 ? 23.725 85.485 35.988  1.00 75.27  ? 406 GLN A CD  1 
ATOM   2855 O OE1 . GLN A 1 406 ? 23.834 86.502 35.294  1.00 76.28  ? 406 GLN A OE1 1 
ATOM   2856 N NE2 . GLN A 1 406 ? 23.802 85.510 37.316  1.00 76.28  ? 406 GLN A NE2 1 
ATOM   2857 N N   . ALA A 1 407 ? 20.657 81.265 35.623  1.00 61.51  ? 407 ALA A N   1 
ATOM   2858 C CA  . ALA A 1 407 ? 20.500 80.226 36.639  1.00 59.30  ? 407 ALA A CA  1 
ATOM   2859 C C   . ALA A 1 407 ? 21.062 78.904 36.121  1.00 58.76  ? 407 ALA A C   1 
ATOM   2860 O O   . ALA A 1 407 ? 21.836 78.243 36.809  1.00 58.41  ? 407 ALA A O   1 
ATOM   2861 C CB  . ALA A 1 407 ? 19.038 80.063 37.004  1.00 58.07  ? 407 ALA A CB  1 
ATOM   2862 N N   . GLU A 1 408 ? 20.680 78.515 34.911  1.00 57.86  ? 408 GLU A N   1 
ATOM   2863 C CA  . GLU A 1 408 ? 21.201 77.280 34.354  1.00 57.87  ? 408 GLU A CA  1 
ATOM   2864 C C   . GLU A 1 408 ? 22.635 77.488 33.881  1.00 56.47  ? 408 GLU A C   1 
ATOM   2865 O O   . GLU A 1 408 ? 23.475 76.602 34.020  1.00 56.15  ? 408 GLU A O   1 
ATOM   2866 C CB  . GLU A 1 408 ? 20.310 76.783 33.218  1.00 58.24  ? 408 GLU A CB  1 
ATOM   2867 C CG  . GLU A 1 408 ? 19.812 77.850 32.271  1.00 62.10  ? 408 GLU A CG  1 
ATOM   2868 C CD  . GLU A 1 408 ? 18.595 77.383 31.473  1.00 63.21  ? 408 GLU A CD  1 
ATOM   2869 O OE1 . GLU A 1 408 ? 18.687 76.318 30.824  1.00 65.14  ? 408 GLU A OE1 1 
ATOM   2870 O OE2 . GLU A 1 408 ? 17.553 78.075 31.497  1.00 61.08  ? 408 GLU A OE2 1 
ATOM   2871 N N   . ARG A 1 409 ? 22.920 78.672 33.353  1.00 55.80  ? 409 ARG A N   1 
ATOM   2872 C CA  . ARG A 1 409 ? 24.268 78.991 32.889  1.00 55.97  ? 409 ARG A CA  1 
ATOM   2873 C C   . ARG A 1 409 ? 25.268 78.762 34.018  1.00 55.64  ? 409 ARG A C   1 
ATOM   2874 O O   . ARG A 1 409 ? 26.409 78.380 33.776  1.00 56.38  ? 409 ARG A O   1 
ATOM   2875 C CB  . ARG A 1 409 ? 24.344 80.445 32.436  1.00 56.81  ? 409 ARG A CB  1 
ATOM   2876 C CG  . ARG A 1 409 ? 25.537 80.762 31.548  1.00 59.30  ? 409 ARG A CG  1 
ATOM   2877 C CD  . ARG A 1 409 ? 25.539 82.243 31.206  1.00 61.19  ? 409 ARG A CD  1 
ATOM   2878 N NE  . ARG A 1 409 ? 24.192 82.701 30.880  1.00 61.40  ? 409 ARG A NE  1 
ATOM   2879 C CZ  . ARG A 1 409 ? 23.673 83.850 31.297  1.00 62.42  ? 409 ARG A CZ  1 
ATOM   2880 N NH1 . ARG A 1 409 ? 24.391 84.670 32.060  1.00 62.65  ? 409 ARG A NH1 1 
ATOM   2881 N NH2 . ARG A 1 409 ? 22.427 84.168 30.970  1.00 60.46  ? 409 ARG A NH2 1 
ATOM   2882 N N   . GLU A 1 410 ? 24.837 79.007 35.252  1.00 56.61  ? 410 GLU A N   1 
ATOM   2883 C CA  . GLU A 1 410 ? 25.694 78.805 36.421  1.00 55.72  ? 410 GLU A CA  1 
ATOM   2884 C C   . GLU A 1 410 ? 25.696 77.324 36.797  1.00 53.18  ? 410 GLU A C   1 
ATOM   2885 O O   . GLU A 1 410 ? 26.746 76.774 37.124  1.00 53.74  ? 410 GLU A O   1 
ATOM   2886 C CB  . GLU A 1 410 ? 25.210 79.640 37.623  1.00 56.26  ? 410 GLU A CB  1 
ATOM   2887 C CG  . GLU A 1 410 ? 25.269 81.157 37.424  1.00 56.59  ? 410 GLU A CG  1 
ATOM   2888 C CD  . GLU A 1 410 ? 24.714 81.937 38.620  1.00 59.20  ? 410 GLU A CD  1 
ATOM   2889 O OE1 . GLU A 1 410 ? 23.652 81.550 39.156  1.00 59.42  ? 410 GLU A OE1 1 
ATOM   2890 O OE2 . GLU A 1 410 ? 25.330 82.949 39.022  1.00 59.64  ? 410 GLU A OE2 1 
ATOM   2891 N N   . ALA A 1 411 ? 24.526 76.687 36.746  1.00 49.98  ? 411 ALA A N   1 
ATOM   2892 C CA  . ALA A 1 411 ? 24.414 75.265 37.071  1.00 49.11  ? 411 ALA A CA  1 
ATOM   2893 C C   . ALA A 1 411 ? 25.322 74.456 36.146  1.00 50.43  ? 411 ALA A C   1 
ATOM   2894 O O   . ALA A 1 411 ? 25.958 73.481 36.558  1.00 51.33  ? 411 ALA A O   1 
ATOM   2895 C CB  . ALA A 1 411 ? 22.985 74.801 36.911  1.00 45.84  ? 411 ALA A CB  1 
ATOM   2896 N N   . ILE A 1 412 ? 25.380 74.876 34.888  1.00 48.92  ? 412 ILE A N   1 
ATOM   2897 C CA  . ILE A 1 412 ? 26.198 74.197 33.911  1.00 47.64  ? 412 ILE A CA  1 
ATOM   2898 C C   . ILE A 1 412 ? 27.651 74.404 34.268  1.00 48.86  ? 412 ILE A C   1 
ATOM   2899 O O   . ILE A 1 412 ? 28.410 73.438 34.401  1.00 50.13  ? 412 ILE A O   1 
ATOM   2900 C CB  . ILE A 1 412 ? 25.945 74.745 32.495  1.00 47.20  ? 412 ILE A CB  1 
ATOM   2901 C CG1 . ILE A 1 412 ? 24.469 74.556 32.123  1.00 45.46  ? 412 ILE A CG1 1 
ATOM   2902 C CG2 . ILE A 1 412 ? 26.842 74.018 31.493  1.00 46.56  ? 412 ILE A CG2 1 
ATOM   2903 C CD1 . ILE A 1 412 ? 24.054 75.238 30.846  1.00 42.74  ? 412 ILE A CD1 1 
ATOM   2904 N N   . ILE A 1 413 ? 28.039 75.665 34.426  1.00 47.83  ? 413 ILE A N   1 
ATOM   2905 C CA  . ILE A 1 413 ? 29.417 75.982 34.766  1.00 46.76  ? 413 ILE A CA  1 
ATOM   2906 C C   . ILE A 1 413 ? 29.901 75.190 35.974  1.00 46.39  ? 413 ILE A C   1 
ATOM   2907 O O   . ILE A 1 413 ? 31.018 74.682 35.975  1.00 46.84  ? 413 ILE A O   1 
ATOM   2908 C CB  . ILE A 1 413 ? 29.600 77.485 35.037  1.00 46.43  ? 413 ILE A CB  1 
ATOM   2909 C CG1 . ILE A 1 413 ? 29.415 78.260 33.730  1.00 45.04  ? 413 ILE A CG1 1 
ATOM   2910 C CG2 . ILE A 1 413 ? 30.983 77.748 35.616  1.00 44.48  ? 413 ILE A CG2 1 
ATOM   2911 C CD1 . ILE A 1 413 ? 29.848 79.700 33.803  1.00 47.55  ? 413 ILE A CD1 1 
ATOM   2912 N N   . PHE A 1 414 ? 29.057 75.071 36.995  1.00 45.22  ? 414 PHE A N   1 
ATOM   2913 C CA  . PHE A 1 414 ? 29.437 74.332 38.195  1.00 42.92  ? 414 PHE A CA  1 
ATOM   2914 C C   . PHE A 1 414 ? 29.621 72.853 37.888  1.00 42.24  ? 414 PHE A C   1 
ATOM   2915 O O   . PHE A 1 414 ? 30.626 72.255 38.273  1.00 42.39  ? 414 PHE A O   1 
ATOM   2916 C CB  . PHE A 1 414 ? 28.377 74.480 39.295  1.00 40.77  ? 414 PHE A CB  1 
ATOM   2917 C CG  . PHE A 1 414 ? 28.824 73.951 40.633  1.00 37.18  ? 414 PHE A CG  1 
ATOM   2918 C CD1 . PHE A 1 414 ? 29.825 74.603 41.353  1.00 36.52  ? 414 PHE A CD1 1 
ATOM   2919 C CD2 . PHE A 1 414 ? 28.288 72.774 41.147  1.00 35.05  ? 414 PHE A CD2 1 
ATOM   2920 C CE1 . PHE A 1 414 ? 30.291 74.084 42.570  1.00 34.68  ? 414 PHE A CE1 1 
ATOM   2921 C CE2 . PHE A 1 414 ? 28.747 72.247 42.361  1.00 34.61  ? 414 PHE A CE2 1 
ATOM   2922 C CZ  . PHE A 1 414 ? 29.751 72.906 43.071  1.00 33.91  ? 414 PHE A CZ  1 
ATOM   2923 N N   . GLN A 1 415 ? 28.641 72.272 37.205  1.00 41.27  ? 415 GLN A N   1 
ATOM   2924 C CA  . GLN A 1 415 ? 28.675 70.861 36.844  1.00 42.92  ? 415 GLN A CA  1 
ATOM   2925 C C   . GLN A 1 415 ? 29.920 70.502 36.021  1.00 45.46  ? 415 GLN A C   1 
ATOM   2926 O O   . GLN A 1 415 ? 30.353 69.350 36.013  1.00 45.81  ? 415 GLN A O   1 
ATOM   2927 C CB  . GLN A 1 415 ? 27.410 70.502 36.064  1.00 41.64  ? 415 GLN A CB  1 
ATOM   2928 C CG  . GLN A 1 415 ? 27.415 69.121 35.434  1.00 39.07  ? 415 GLN A CG  1 
ATOM   2929 C CD  . GLN A 1 415 ? 26.947 68.043 36.375  1.00 38.97  ? 415 GLN A CD  1 
ATOM   2930 O OE1 . GLN A 1 415 ? 26.863 66.874 35.999  1.00 38.91  ? 415 GLN A OE1 1 
ATOM   2931 N NE2 . GLN A 1 415 ? 26.628 68.425 37.606  1.00 37.24  ? 415 GLN A NE2 1 
ATOM   2932 N N   . TYR A 1 416 ? 30.502 71.489 35.344  1.00 48.21  ? 416 TYR A N   1 
ATOM   2933 C CA  . TYR A 1 416 ? 31.691 71.254 34.524  1.00 49.32  ? 416 TYR A CA  1 
ATOM   2934 C C   . TYR A 1 416 ? 32.979 71.943 34.975  1.00 52.52  ? 416 TYR A C   1 
ATOM   2935 O O   . TYR A 1 416 ? 33.818 72.287 34.138  1.00 54.73  ? 416 TYR A O   1 
ATOM   2936 C CB  . TYR A 1 416 ? 31.405 71.627 33.067  1.00 45.72  ? 416 TYR A CB  1 
ATOM   2937 C CG  . TYR A 1 416 ? 30.532 70.619 32.366  1.00 44.82  ? 416 TYR A CG  1 
ATOM   2938 C CD1 . TYR A 1 416 ? 29.144 70.710 32.433  1.00 43.41  ? 416 TYR A CD1 1 
ATOM   2939 C CD2 . TYR A 1 416 ? 31.090 69.541 31.682  1.00 43.27  ? 416 TYR A CD2 1 
ATOM   2940 C CE1 . TYR A 1 416 ? 28.331 69.754 31.846  1.00 42.52  ? 416 TYR A CE1 1 
ATOM   2941 C CE2 . TYR A 1 416 ? 30.281 68.572 31.086  1.00 42.31  ? 416 TYR A CE2 1 
ATOM   2942 C CZ  . TYR A 1 416 ? 28.899 68.685 31.178  1.00 42.73  ? 416 TYR A CZ  1 
ATOM   2943 O OH  . TYR A 1 416 ? 28.076 67.713 30.647  1.00 42.94  ? 416 TYR A OH  1 
ATOM   2944 N N   . THR A 1 417 ? 33.139 72.156 36.280  1.00 54.17  ? 417 THR A N   1 
ATOM   2945 C CA  . THR A 1 417 ? 34.368 72.760 36.799  1.00 58.01  ? 417 THR A CA  1 
ATOM   2946 C C   . THR A 1 417 ? 35.195 71.587 37.300  1.00 61.46  ? 417 THR A C   1 
ATOM   2947 O O   . THR A 1 417 ? 34.639 70.596 37.769  1.00 61.59  ? 417 THR A O   1 
ATOM   2948 C CB  . THR A 1 417 ? 34.116 73.684 38.001  1.00 56.67  ? 417 THR A CB  1 
ATOM   2949 O OG1 . THR A 1 417 ? 33.393 72.960 39.000  1.00 59.77  ? 417 THR A OG1 1 
ATOM   2950 C CG2 . THR A 1 417 ? 33.329 74.916 37.597  1.00 57.08  ? 417 THR A CG2 1 
ATOM   2951 N N   . SER A 1 418 ? 36.513 71.686 37.208  1.00 65.77  ? 418 SER A N   1 
ATOM   2952 C CA  . SER A 1 418 ? 37.362 70.599 37.670  1.00 71.24  ? 418 SER A CA  1 
ATOM   2953 C C   . SER A 1 418 ? 38.223 71.061 38.834  1.00 75.15  ? 418 SER A C   1 
ATOM   2954 O O   . SER A 1 418 ? 38.679 72.202 38.862  1.00 75.75  ? 418 SER A O   1 
ATOM   2955 C CB  . SER A 1 418 ? 38.249 70.105 36.527  1.00 72.73  ? 418 SER A CB  1 
ATOM   2956 O OG  . SER A 1 418 ? 38.976 71.181 35.950  1.00 73.17  ? 418 SER A OG  1 
ATOM   2957 N N   . TRP A 1 419 ? 38.432 70.168 39.797  1.00 79.67  ? 419 TRP A N   1 
ATOM   2958 C CA  . TRP A 1 419 ? 39.240 70.466 40.978  1.00 85.00  ? 419 TRP A CA  1 
ATOM   2959 C C   . TRP A 1 419 ? 40.422 69.504 41.041  1.00 89.74  ? 419 TRP A C   1 
ATOM   2960 O O   . TRP A 1 419 ? 41.557 69.907 41.291  1.00 91.53  ? 419 TRP A O   1 
ATOM   2961 C CB  . TRP A 1 419 ? 38.402 70.309 42.252  1.00 81.91  ? 419 TRP A CB  1 
ATOM   2962 C CG  . TRP A 1 419 ? 37.284 71.299 42.375  1.00 79.02  ? 419 TRP A CG  1 
ATOM   2963 C CD1 . TRP A 1 419 ? 37.379 72.605 42.768  1.00 77.19  ? 419 TRP A CD1 1 
ATOM   2964 C CD2 . TRP A 1 419 ? 35.904 71.071 42.070  1.00 76.85  ? 419 TRP A CD2 1 
ATOM   2965 N NE1 . TRP A 1 419 ? 36.142 73.203 42.725  1.00 75.69  ? 419 TRP A NE1 1 
ATOM   2966 C CE2 . TRP A 1 419 ? 35.220 72.286 42.298  1.00 75.90  ? 419 TRP A CE2 1 
ATOM   2967 C CE3 . TRP A 1 419 ? 35.179 69.958 41.623  1.00 75.54  ? 419 TRP A CE3 1 
ATOM   2968 C CZ2 . TRP A 1 419 ? 33.845 72.419 42.094  1.00 75.18  ? 419 TRP A CZ2 1 
ATOM   2969 C CZ3 . TRP A 1 419 ? 33.809 70.091 41.420  1.00 75.41  ? 419 TRP A CZ3 1 
ATOM   2970 C CH2 . TRP A 1 419 ? 33.158 71.314 41.655  1.00 75.44  ? 419 TRP A CH2 1 
ATOM   2971 N N   . GLU A 1 420 ? 40.133 68.228 40.812  1.00 95.50  ? 420 GLU A N   1 
ATOM   2972 C CA  . GLU A 1 420 ? 41.137 67.173 40.850  1.00 101.13 ? 420 GLU A CA  1 
ATOM   2973 C C   . GLU A 1 420 ? 42.271 67.393 39.855  1.00 103.46 ? 420 GLU A C   1 
ATOM   2974 O O   . GLU A 1 420 ? 42.080 67.298 38.638  1.00 104.07 ? 420 GLU A O   1 
ATOM   2975 C CB  . GLU A 1 420 ? 40.479 65.818 40.572  1.00 103.46 ? 420 GLU A CB  1 
ATOM   2976 C CG  . GLU A 1 420 ? 39.505 65.353 41.661  1.00 106.05 ? 420 GLU A CG  1 
ATOM   2977 C CD  . GLU A 1 420 ? 40.200 65.099 43.015  1.00 108.33 ? 420 GLU A CD  1 
ATOM   2978 O OE1 . GLU A 1 420 ? 41.104 64.214 43.064  1.00 107.78 ? 420 GLU A OE1 1 
ATOM   2979 O OE2 . GLU A 1 420 ? 39.844 65.788 44.016  1.00 106.56 ? 420 GLU A OE2 1 
ATOM   2980 N N   . GLY A 1 421 ? 43.455 67.677 40.383  1.00 106.32 ? 421 GLY A N   1 
ATOM   2981 C CA  . GLY A 1 421 ? 44.594 67.907 39.523  1.00 108.25 ? 421 GLY A CA  1 
ATOM   2982 C C   . GLY A 1 421 ? 44.740 69.386 39.202  1.00 108.90 ? 421 GLY A C   1 
ATOM   2983 O O   . GLY A 1 421 ? 44.553 70.235 40.074  1.00 109.30 ? 421 GLY A O   1 
ATOM   2984 N N   . ASN A 1 422 ? 45.060 69.668 37.944  1.00 108.77 ? 422 ASN A N   1 
ATOM   2985 C CA  . ASN A 1 422 ? 45.261 71.054 37.473  1.00 108.34 ? 422 ASN A CA  1 
ATOM   2986 C C   . ASN A 1 422 ? 44.151 71.575 36.547  1.00 106.73 ? 422 ASN A C   1 
ATOM   2987 O O   . ASN A 1 422 ? 43.263 70.848 36.096  1.00 106.93 ? 422 ASN A O   1 
ATOM   2988 C CB  . ASN A 1 422 ? 46.601 71.168 36.746  1.00 108.65 ? 422 ASN A CB  1 
ATOM   2989 C CG  . ASN A 1 422 ? 47.790 70.714 37.572  1.00 109.66 ? 422 ASN A CG  1 
ATOM   2990 O OD1 . ASN A 1 422 ? 47.885 71.042 38.753  1.00 110.70 ? 422 ASN A OD1 1 
ATOM   2991 N ND2 . ASN A 1 422 ? 48.690 69.962 36.937  1.00 109.16 ? 422 ASN A ND2 1 
ATOM   2992 N N   . PRO A 1 423 ? 44.257 72.886 36.311  1.00 105.25 ? 423 PRO A N   1 
ATOM   2993 C CA  . PRO A 1 423 ? 43.344 73.621 35.340  1.00 102.70 ? 423 PRO A CA  1 
ATOM   2994 C C   . PRO A 1 423 ? 43.578 73.284 33.904  1.00 99.40  ? 423 PRO A C   1 
ATOM   2995 O O   . PRO A 1 423 ? 42.927 72.498 33.235  1.00 100.12 ? 423 PRO A O   1 
ATOM   2996 C CB  . PRO A 1 423 ? 43.631 75.079 35.586  1.00 104.18 ? 423 PRO A CB  1 
ATOM   2997 C CG  . PRO A 1 423 ? 43.782 75.109 37.064  1.00 105.04 ? 423 PRO A CG  1 
ATOM   2998 C CD  . PRO A 1 423 ? 44.156 73.718 37.531  1.00 105.18 ? 423 PRO A CD  1 
ATOM   2999 N N   . GLY A 1 424 ? 44.624 74.008 33.476  1.00 95.80  ? 424 GLY A N   1 
ATOM   3000 C CA  . GLY A 1 424 ? 45.265 74.057 32.186  1.00 90.27  ? 424 GLY A CA  1 
ATOM   3001 C C   . GLY A 1 424 ? 45.466 72.679 31.582  1.00 85.50  ? 424 GLY A C   1 
ATOM   3002 O O   . GLY A 1 424 ? 46.472 71.981 31.809  1.00 85.82  ? 424 GLY A O   1 
ATOM   3003 N N   . TYR A 1 425 ? 44.459 72.329 30.804  1.00 79.34  ? 425 TYR A N   1 
ATOM   3004 C CA  . TYR A 1 425 ? 44.306 71.061 30.107  1.00 73.48  ? 425 TYR A CA  1 
ATOM   3005 C C   . TYR A 1 425 ? 42.947 70.487 30.527  1.00 71.03  ? 425 TYR A C   1 
ATOM   3006 O O   . TYR A 1 425 ? 42.200 69.978 29.678  1.00 71.38  ? 425 TYR A O   1 
ATOM   3007 C CB  . TYR A 1 425 ? 45.403 70.042 30.386  1.00 70.41  ? 425 TYR A CB  1 
ATOM   3008 C CG  . TYR A 1 425 ? 46.748 70.366 29.781  1.00 68.31  ? 425 TYR A CG  1 
ATOM   3009 C CD1 . TYR A 1 425 ? 46.961 71.591 29.126  1.00 67.35  ? 425 TYR A CD1 1 
ATOM   3010 C CD2 . TYR A 1 425 ? 47.821 69.479 29.891  1.00 66.16  ? 425 TYR A CD2 1 
ATOM   3011 C CE1 . TYR A 1 425 ? 48.207 71.929 28.606  1.00 64.57  ? 425 TYR A CE1 1 
ATOM   3012 C CE2 . TYR A 1 425 ? 49.070 69.801 29.375  1.00 64.09  ? 425 TYR A CE2 1 
ATOM   3013 C CZ  . TYR A 1 425 ? 49.257 71.026 28.736  1.00 64.38  ? 425 TYR A CZ  1 
ATOM   3014 O OH  . TYR A 1 425 ? 50.490 71.364 28.239  1.00 61.30  ? 425 TYR A OH  1 
ATOM   3015 N N   . GLN A 1 426 ? 42.642 70.558 31.825  1.00 67.47  ? 426 GLN A N   1 
ATOM   3016 C CA  . GLN A 1 426 ? 41.363 70.052 32.306  1.00 64.43  ? 426 GLN A CA  1 
ATOM   3017 C C   . GLN A 1 426 ? 40.186 70.965 31.994  1.00 61.34  ? 426 GLN A C   1 
ATOM   3018 O O   . GLN A 1 426 ? 39.112 70.483 31.659  1.00 60.49  ? 426 GLN A O   1 
ATOM   3019 C CB  . GLN A 1 426 ? 41.405 69.778 33.813  1.00 65.56  ? 426 GLN A CB  1 
ATOM   3020 C CG  . GLN A 1 426 ? 40.795 68.449 34.194  1.00 67.97  ? 426 GLN A CG  1 
ATOM   3021 C CD  . GLN A 1 426 ? 41.439 67.318 33.450  1.00 69.82  ? 426 GLN A CD  1 
ATOM   3022 O OE1 . GLN A 1 426 ? 42.660 67.354 33.168  1.00 70.03  ? 426 GLN A OE1 1 
ATOM   3023 N NE2 . GLN A 1 426 ? 40.633 66.301 33.132  1.00 69.82  ? 426 GLN A NE2 1 
ATOM   3024 N N   . ASN A 1 427 ? 40.371 72.275 32.114  1.00 58.48  ? 427 ASN A N   1 
ATOM   3025 C CA  . ASN A 1 427 ? 39.286 73.196 31.817  1.00 56.00  ? 427 ASN A CA  1 
ATOM   3026 C C   . ASN A 1 427 ? 38.842 73.029 30.377  1.00 54.39  ? 427 ASN A C   1 
ATOM   3027 O O   . ASN A 1 427 ? 37.653 73.061 30.084  1.00 54.21  ? 427 ASN A O   1 
ATOM   3028 C CB  . ASN A 1 427 ? 39.716 74.646 32.046  1.00 56.65  ? 427 ASN A CB  1 
ATOM   3029 C CG  . ASN A 1 427 ? 39.575 75.079 33.495  1.00 56.67  ? 427 ASN A CG  1 
ATOM   3030 O OD1 . ASN A 1 427 ? 38.600 74.737 34.179  1.00 53.73  ? 427 ASN A OD1 1 
ATOM   3031 N ND2 . ASN A 1 427 ? 40.546 75.853 33.967  1.00 56.01  ? 427 ASN A ND2 1 
ATOM   3032 N N   . GLN A 1 428 ? 39.809 72.846 29.483  1.00 52.81  ? 428 GLN A N   1 
ATOM   3033 C CA  . GLN A 1 428 ? 39.529 72.671 28.063  1.00 50.72  ? 428 GLN A CA  1 
ATOM   3034 C C   . GLN A 1 428 ? 38.741 71.379 27.841  1.00 50.49  ? 428 GLN A C   1 
ATOM   3035 O O   . GLN A 1 428 ? 37.741 71.349 27.118  1.00 50.92  ? 428 GLN A O   1 
ATOM   3036 C CB  . GLN A 1 428 ? 40.848 72.635 27.278  1.00 49.05  ? 428 GLN A CB  1 
ATOM   3037 C CG  . GLN A 1 428 ? 40.709 72.383 25.781  1.00 47.90  ? 428 GLN A CG  1 
ATOM   3038 C CD  . GLN A 1 428 ? 42.052 72.378 25.055  1.00 48.14  ? 428 GLN A CD  1 
ATOM   3039 O OE1 . GLN A 1 428 ? 42.982 71.679 25.448  1.00 46.73  ? 428 GLN A OE1 1 
ATOM   3040 N NE2 . GLN A 1 428 ? 42.149 73.153 23.983  1.00 46.85  ? 428 GLN A NE2 1 
ATOM   3041 N N   . GLN A 1 429 ? 39.196 70.311 28.476  1.00 49.11  ? 429 GLN A N   1 
ATOM   3042 C CA  . GLN A 1 429 ? 38.539 69.025 28.357  1.00 47.90  ? 429 GLN A CA  1 
ATOM   3043 C C   . GLN A 1 429 ? 37.097 69.121 28.830  1.00 47.33  ? 429 GLN A C   1 
ATOM   3044 O O   . GLN A 1 429 ? 36.192 68.548 28.218  1.00 47.09  ? 429 GLN A O   1 
ATOM   3045 C CB  . GLN A 1 429 ? 39.302 67.988 29.182  1.00 48.79  ? 429 GLN A CB  1 
ATOM   3046 C CG  . GLN A 1 429 ? 40.037 66.941 28.353  1.00 50.59  ? 429 GLN A CG  1 
ATOM   3047 C CD  . GLN A 1 429 ? 40.566 67.488 27.047  1.00 51.88  ? 429 GLN A CD  1 
ATOM   3048 O OE1 . GLN A 1 429 ? 41.038 68.615 26.981  1.00 54.43  ? 429 GLN A OE1 1 
ATOM   3049 N NE2 . GLN A 1 429 ? 40.502 66.679 26.001  1.00 53.06  ? 429 GLN A NE2 1 
ATOM   3050 N N   . GLN A 1 430 ? 36.891 69.862 29.914  1.00 46.35  ? 430 GLN A N   1 
ATOM   3051 C CA  . GLN A 1 430 ? 35.567 70.040 30.492  1.00 46.48  ? 430 GLN A CA  1 
ATOM   3052 C C   . GLN A 1 430 ? 34.609 70.806 29.585  1.00 46.82  ? 430 GLN A C   1 
ATOM   3053 O O   . GLN A 1 430 ? 33.418 70.482 29.520  1.00 48.35  ? 430 GLN A O   1 
ATOM   3054 C CB  . GLN A 1 430 ? 35.673 70.749 31.845  1.00 48.16  ? 430 GLN A CB  1 
ATOM   3055 C CG  . GLN A 1 430 ? 36.127 69.865 33.005  1.00 49.33  ? 430 GLN A CG  1 
ATOM   3056 C CD  . GLN A 1 430 ? 35.102 68.809 33.374  1.00 50.35  ? 430 GLN A CD  1 
ATOM   3057 O OE1 . GLN A 1 430 ? 35.259 67.633 33.050  1.00 52.74  ? 430 GLN A OE1 1 
ATOM   3058 N NE2 . GLN A 1 430 ? 34.041 69.227 34.048  1.00 49.19  ? 430 GLN A NE2 1 
ATOM   3059 N N   . ILE A 1 431 ? 35.111 71.826 28.895  1.00 44.46  ? 431 ILE A N   1 
ATOM   3060 C CA  . ILE A 1 431 ? 34.252 72.595 28.000  1.00 41.71  ? 431 ILE A CA  1 
ATOM   3061 C C   . ILE A 1 431 ? 33.909 71.712 26.818  1.00 40.62  ? 431 ILE A C   1 
ATOM   3062 O O   . ILE A 1 431 ? 32.834 71.829 26.241  1.00 39.09  ? 431 ILE A O   1 
ATOM   3063 C CB  . ILE A 1 431 ? 34.934 73.892 27.503  1.00 39.91  ? 431 ILE A CB  1 
ATOM   3064 C CG1 . ILE A 1 431 ? 35.192 74.825 28.693  1.00 37.90  ? 431 ILE A CG1 1 
ATOM   3065 C CG2 . ILE A 1 431 ? 34.046 74.584 26.475  1.00 36.43  ? 431 ILE A CG2 1 
ATOM   3066 C CD1 . ILE A 1 431 ? 35.859 76.123 28.332  1.00 35.35  ? 431 ILE A CD1 1 
ATOM   3067 N N   . GLY A 1 432 ? 34.834 70.823 26.470  1.00 40.17  ? 432 GLY A N   1 
ATOM   3068 C CA  . GLY A 1 432 ? 34.601 69.908 25.371  1.00 40.86  ? 432 GLY A CA  1 
ATOM   3069 C C   . GLY A 1 432 ? 33.480 68.948 25.727  1.00 41.62  ? 432 GLY A C   1 
ATOM   3070 O O   . GLY A 1 432 ? 32.586 68.709 24.923  1.00 41.31  ? 432 GLY A O   1 
ATOM   3071 N N   . ARG A 1 433 ? 33.530 68.397 26.937  1.00 41.90  ? 433 ARG A N   1 
ATOM   3072 C CA  . ARG A 1 433 ? 32.507 67.465 27.396  1.00 42.70  ? 433 ARG A CA  1 
ATOM   3073 C C   . ARG A 1 433 ? 31.133 68.130 27.394  1.00 41.37  ? 433 ARG A C   1 
ATOM   3074 O O   . ARG A 1 433 ? 30.160 67.549 26.922  1.00 42.11  ? 433 ARG A O   1 
ATOM   3075 C CB  . ARG A 1 433 ? 32.827 66.967 28.812  1.00 45.65  ? 433 ARG A CB  1 
ATOM   3076 C CG  . ARG A 1 433 ? 34.019 66.018 28.925  1.00 49.55  ? 433 ARG A CG  1 
ATOM   3077 C CD  . ARG A 1 433 ? 34.350 65.752 30.394  1.00 53.20  ? 433 ARG A CD  1 
ATOM   3078 N NE  . ARG A 1 433 ? 35.261 64.624 30.593  1.00 58.73  ? 433 ARG A NE  1 
ATOM   3079 C CZ  . ARG A 1 433 ? 36.507 64.557 30.127  1.00 61.56  ? 433 ARG A CZ  1 
ATOM   3080 N NH1 . ARG A 1 433 ? 37.016 65.559 29.420  1.00 62.40  ? 433 ARG A NH1 1 
ATOM   3081 N NH2 . ARG A 1 433 ? 37.251 63.484 30.372  1.00 62.60  ? 433 ARG A NH2 1 
ATOM   3082 N N   . ALA A 1 434 ? 31.058 69.348 27.920  1.00 38.40  ? 434 ALA A N   1 
ATOM   3083 C CA  . ALA A 1 434 ? 29.795 70.074 27.977  1.00 36.54  ? 434 ALA A CA  1 
ATOM   3084 C C   . ALA A 1 434 ? 29.186 70.295 26.597  1.00 36.79  ? 434 ALA A C   1 
ATOM   3085 O O   . ALA A 1 434 ? 27.966 70.283 26.453  1.00 38.65  ? 434 ALA A O   1 
ATOM   3086 C CB  . ALA A 1 434 ? 29.990 71.403 28.683  1.00 33.00  ? 434 ALA A CB  1 
ATOM   3087 N N   . VAL A 1 435 ? 30.034 70.494 25.585  1.00 35.57  ? 435 VAL A N   1 
ATOM   3088 C CA  . VAL A 1 435 ? 29.578 70.715 24.212  1.00 32.50  ? 435 VAL A CA  1 
ATOM   3089 C C   . VAL A 1 435 ? 28.946 69.449 23.658  1.00 33.18  ? 435 VAL A C   1 
ATOM   3090 O O   . VAL A 1 435 ? 27.777 69.447 23.262  1.00 35.18  ? 435 VAL A O   1 
ATOM   3091 C CB  . VAL A 1 435 ? 30.743 71.124 23.274  1.00 32.70  ? 435 VAL A CB  1 
ATOM   3092 C CG1 . VAL A 1 435 ? 30.270 71.166 21.823  1.00 28.94  ? 435 VAL A CG1 1 
ATOM   3093 C CG2 . VAL A 1 435 ? 31.266 72.489 23.665  1.00 34.43  ? 435 VAL A CG2 1 
ATOM   3094 N N   . GLY A 1 436 ? 29.725 68.376 23.627  1.00 31.13  ? 436 GLY A N   1 
ATOM   3095 C CA  . GLY A 1 436 ? 29.222 67.118 23.119  1.00 31.64  ? 436 GLY A CA  1 
ATOM   3096 C C   . GLY A 1 436 ? 28.023 66.617 23.894  1.00 31.78  ? 436 GLY A C   1 
ATOM   3097 O O   . GLY A 1 436 ? 27.035 66.166 23.304  1.00 30.16  ? 436 GLY A O   1 
ATOM   3098 N N   . ASP A 1 437 ? 28.110 66.701 25.217  1.00 32.33  ? 437 ASP A N   1 
ATOM   3099 C CA  . ASP A 1 437 ? 27.031 66.253 26.084  1.00 33.79  ? 437 ASP A CA  1 
ATOM   3100 C C   . ASP A 1 437 ? 25.729 66.980 25.774  1.00 34.14  ? 437 ASP A C   1 
ATOM   3101 O O   . ASP A 1 437 ? 24.688 66.351 25.583  1.00 34.46  ? 437 ASP A O   1 
ATOM   3102 C CB  . ASP A 1 437 ? 27.405 66.464 27.555  1.00 35.42  ? 437 ASP A CB  1 
ATOM   3103 C CG  . ASP A 1 437 ? 28.442 65.464 28.044  1.00 39.19  ? 437 ASP A CG  1 
ATOM   3104 O OD1 . ASP A 1 437 ? 28.834 64.578 27.252  1.00 41.10  ? 437 ASP A OD1 1 
ATOM   3105 O OD2 . ASP A 1 437 ? 28.864 65.555 29.221  1.00 39.87  ? 437 ASP A OD2 1 
ATOM   3106 N N   . HIS A 1 438 ? 25.782 68.304 25.719  1.00 32.86  ? 438 HIS A N   1 
ATOM   3107 C CA  . HIS A 1 438 ? 24.577 69.078 25.441  1.00 33.46  ? 438 HIS A CA  1 
ATOM   3108 C C   . HIS A 1 438 ? 24.049 68.917 24.005  1.00 34.29  ? 438 HIS A C   1 
ATOM   3109 O O   . HIS A 1 438 ? 22.862 68.637 23.794  1.00 35.57  ? 438 HIS A O   1 
ATOM   3110 C CB  . HIS A 1 438 ? 24.833 70.567 25.756  1.00 29.50  ? 438 HIS A CB  1 
ATOM   3111 C CG  . HIS A 1 438 ? 23.749 71.487 25.293  1.00 30.25  ? 438 HIS A CG  1 
ATOM   3112 N ND1 . HIS A 1 438 ? 22.435 71.343 25.676  1.00 33.74  ? 438 HIS A ND1 1 
ATOM   3113 C CD2 . HIS A 1 438 ? 23.787 72.578 24.489  1.00 32.48  ? 438 HIS A CD2 1 
ATOM   3114 C CE1 . HIS A 1 438 ? 21.710 72.306 25.131  1.00 31.14  ? 438 HIS A CE1 1 
ATOM   3115 N NE2 . HIS A 1 438 ? 22.506 73.070 24.408  1.00 31.49  ? 438 HIS A NE2 1 
ATOM   3116 N N   . PHE A 1 439 ? 24.936 69.065 23.025  1.00 33.62  ? 439 PHE A N   1 
ATOM   3117 C CA  . PHE A 1 439 ? 24.538 69.007 21.625  1.00 32.51  ? 439 PHE A CA  1 
ATOM   3118 C C   . PHE A 1 439 ? 24.412 67.665 20.960  1.00 31.32  ? 439 PHE A C   1 
ATOM   3119 O O   . PHE A 1 439 ? 23.775 67.577 19.901  1.00 29.45  ? 439 PHE A O   1 
ATOM   3120 C CB  . PHE A 1 439 ? 25.478 69.863 20.772  1.00 33.25  ? 439 PHE A CB  1 
ATOM   3121 C CG  . PHE A 1 439 ? 25.450 71.322 21.132  1.00 35.02  ? 439 PHE A CG  1 
ATOM   3122 C CD1 . PHE A 1 439 ? 24.514 72.172 20.556  1.00 33.63  ? 439 PHE A CD1 1 
ATOM   3123 C CD2 . PHE A 1 439 ? 26.354 71.851 22.041  1.00 35.66  ? 439 PHE A CD2 1 
ATOM   3124 C CE1 . PHE A 1 439 ? 24.473 73.522 20.866  1.00 33.66  ? 439 PHE A CE1 1 
ATOM   3125 C CE2 . PHE A 1 439 ? 26.322 73.213 22.358  1.00 38.02  ? 439 PHE A CE2 1 
ATOM   3126 C CZ  . PHE A 1 439 ? 25.373 74.051 21.762  1.00 36.41  ? 439 PHE A CZ  1 
ATOM   3127 N N   . PHE A 1 440 ? 25.008 66.620 21.537  1.00 31.15  ? 440 PHE A N   1 
ATOM   3128 C CA  . PHE A 1 440 ? 24.945 65.309 20.894  1.00 29.44  ? 440 PHE A CA  1 
ATOM   3129 C C   . PHE A 1 440 ? 24.559 64.121 21.772  1.00 29.69  ? 440 PHE A C   1 
ATOM   3130 O O   . PHE A 1 440 ? 23.447 63.628 21.684  1.00 30.62  ? 440 PHE A O   1 
ATOM   3131 C CB  . PHE A 1 440 ? 26.276 65.003 20.194  1.00 27.44  ? 440 PHE A CB  1 
ATOM   3132 C CG  . PHE A 1 440 ? 26.600 65.941 19.052  1.00 24.61  ? 440 PHE A CG  1 
ATOM   3133 C CD1 . PHE A 1 440 ? 26.083 65.706 17.781  1.00 24.78  ? 440 PHE A CD1 1 
ATOM   3134 C CD2 . PHE A 1 440 ? 27.444 67.039 19.239  1.00 24.45  ? 440 PHE A CD2 1 
ATOM   3135 C CE1 . PHE A 1 440 ? 26.403 66.539 16.709  1.00 25.04  ? 440 PHE A CE1 1 
ATOM   3136 C CE2 . PHE A 1 440 ? 27.779 67.891 18.172  1.00 24.32  ? 440 PHE A CE2 1 
ATOM   3137 C CZ  . PHE A 1 440 ? 27.257 67.638 16.897  1.00 26.59  ? 440 PHE A CZ  1 
ATOM   3138 N N   . THR A 1 441 ? 25.496 63.645 22.588  1.00 30.15  ? 441 THR A N   1 
ATOM   3139 C CA  . THR A 1 441 ? 25.288 62.488 23.442  1.00 30.10  ? 441 THR A CA  1 
ATOM   3140 C C   . THR A 1 441 ? 23.986 62.466 24.237  1.00 31.27  ? 441 THR A C   1 
ATOM   3141 O O   . THR A 1 441 ? 23.205 61.515 24.121  1.00 31.07  ? 441 THR A O   1 
ATOM   3142 C CB  . THR A 1 441 ? 26.480 62.304 24.397  1.00 30.76  ? 441 THR A CB  1 
ATOM   3143 O OG1 . THR A 1 441 ? 27.702 62.259 23.637  1.00 31.48  ? 441 THR A OG1 1 
ATOM   3144 C CG2 . THR A 1 441 ? 26.317 61.011 25.192  1.00 24.10  ? 441 THR A CG2 1 
ATOM   3145 N N   . CYS A 1 442 ? 23.742 63.493 25.047  1.00 31.62  ? 442 CYS A N   1 
ATOM   3146 C CA  . CYS A 1 442 ? 22.526 63.513 25.856  1.00 33.38  ? 442 CYS A CA  1 
ATOM   3147 C C   . CYS A 1 442 ? 21.247 63.551 25.043  1.00 35.36  ? 442 CYS A C   1 
ATOM   3148 O O   . CYS A 1 442 ? 20.280 62.813 25.369  1.00 36.99  ? 442 CYS A O   1 
ATOM   3149 C CB  . CYS A 1 442 ? 22.578 64.643 26.841  1.00 33.60  ? 442 CYS A CB  1 
ATOM   3150 S SG  . CYS A 1 442 ? 23.941 64.278 28.022  1.00 36.77  ? 442 CYS A SG  1 
ATOM   3151 N N   . PRO A 1 443 ? 21.206 64.389 23.975  1.00 34.25  ? 443 PRO A N   1 
ATOM   3152 C CA  . PRO A 1 443 ? 20.020 64.482 23.119  1.00 32.75  ? 443 PRO A CA  1 
ATOM   3153 C C   . PRO A 1 443 ? 19.671 63.103 22.520  1.00 32.59  ? 443 PRO A C   1 
ATOM   3154 O O   . PRO A 1 443 ? 18.500 62.706 22.465  1.00 32.29  ? 443 PRO A O   1 
ATOM   3155 C CB  . PRO A 1 443 ? 20.440 65.479 22.049  1.00 30.23  ? 443 PRO A CB  1 
ATOM   3156 C CG  . PRO A 1 443 ? 21.408 66.338 22.720  1.00 29.11  ? 443 PRO A CG  1 
ATOM   3157 C CD  . PRO A 1 443 ? 22.199 65.408 23.598  1.00 32.65  ? 443 PRO A CD  1 
ATOM   3158 N N   . THR A 1 444 ? 20.684 62.364 22.072  1.00 33.13  ? 444 THR A N   1 
ATOM   3159 C CA  . THR A 1 444 ? 20.429 61.048 21.485  1.00 36.54  ? 444 THR A CA  1 
ATOM   3160 C C   . THR A 1 444 ? 20.052 60.048 22.573  1.00 37.06  ? 444 THR A C   1 
ATOM   3161 O O   . THR A 1 444 ? 19.293 59.105 22.334  1.00 36.18  ? 444 THR A O   1 
ATOM   3162 C CB  . THR A 1 444 ? 21.655 60.498 20.688  1.00 37.06  ? 444 THR A CB  1 
ATOM   3163 O OG1 . THR A 1 444 ? 22.498 59.739 21.554  1.00 41.69  ? 444 THR A OG1 1 
ATOM   3164 C CG2 . THR A 1 444 ? 22.450 61.621 20.060  1.00 36.22  ? 444 THR A CG2 1 
ATOM   3165 N N   . ASN A 1 445 ? 20.577 60.257 23.773  1.00 37.70  ? 445 ASN A N   1 
ATOM   3166 C CA  . ASN A 1 445 ? 20.246 59.379 24.886  1.00 40.77  ? 445 ASN A CA  1 
ATOM   3167 C C   . ASN A 1 445 ? 18.751 59.561 25.176  1.00 41.18  ? 445 ASN A C   1 
ATOM   3168 O O   . ASN A 1 445 ? 18.003 58.587 25.285  1.00 41.81  ? 445 ASN A O   1 
ATOM   3169 C CB  . ASN A 1 445 ? 21.067 59.758 26.131  1.00 43.67  ? 445 ASN A CB  1 
ATOM   3170 C CG  . ASN A 1 445 ? 21.043 58.678 27.212  1.00 43.36  ? 445 ASN A CG  1 
ATOM   3171 O OD1 . ASN A 1 445 ? 21.699 57.642 27.089  1.00 44.73  ? 445 ASN A OD1 1 
ATOM   3172 N ND2 . ASN A 1 445 ? 20.282 58.918 28.271  1.00 44.91  ? 445 ASN A ND2 1 
ATOM   3173 N N   . GLU A 1 446 ? 18.317 60.814 25.283  1.00 40.20  ? 446 GLU A N   1 
ATOM   3174 C CA  . GLU A 1 446 ? 16.915 61.100 25.564  1.00 40.75  ? 446 GLU A CA  1 
ATOM   3175 C C   . GLU A 1 446 ? 15.951 60.464 24.559  1.00 37.87  ? 446 GLU A C   1 
ATOM   3176 O O   . GLU A 1 446 ? 14.925 59.894 24.935  1.00 32.97  ? 446 GLU A O   1 
ATOM   3177 C CB  . GLU A 1 446 ? 16.684 62.603 25.591  1.00 44.88  ? 446 GLU A CB  1 
ATOM   3178 C CG  . GLU A 1 446 ? 15.375 62.984 26.240  1.00 51.36  ? 446 GLU A CG  1 
ATOM   3179 C CD  . GLU A 1 446 ? 15.099 64.468 26.152  1.00 56.40  ? 446 GLU A CD  1 
ATOM   3180 O OE1 . GLU A 1 446 ? 15.784 65.156 25.353  1.00 59.12  ? 446 GLU A OE1 1 
ATOM   3181 O OE2 . GLU A 1 446 ? 14.193 64.941 26.878  1.00 57.77  ? 446 GLU A OE2 1 
ATOM   3182 N N   . TYR A 1 447 ? 16.283 60.566 23.279  1.00 37.20  ? 447 TYR A N   1 
ATOM   3183 C CA  . TYR A 1 447 ? 15.439 59.998 22.236  1.00 38.60  ? 447 TYR A CA  1 
ATOM   3184 C C   . TYR A 1 447 ? 15.497 58.458 22.283  1.00 39.94  ? 447 TYR A C   1 
ATOM   3185 O O   . TYR A 1 447 ? 14.531 57.762 21.934  1.00 39.13  ? 447 TYR A O   1 
ATOM   3186 C CB  . TYR A 1 447 ? 15.904 60.514 20.873  1.00 38.22  ? 447 TYR A CB  1 
ATOM   3187 C CG  . TYR A 1 447 ? 14.878 60.381 19.779  1.00 38.08  ? 447 TYR A CG  1 
ATOM   3188 C CD1 . TYR A 1 447 ? 13.599 60.899 19.942  1.00 39.02  ? 447 TYR A CD1 1 
ATOM   3189 C CD2 . TYR A 1 447 ? 15.185 59.741 18.573  1.00 37.33  ? 447 TYR A CD2 1 
ATOM   3190 C CE1 . TYR A 1 447 ? 12.645 60.785 18.930  1.00 39.22  ? 447 TYR A CE1 1 
ATOM   3191 C CE2 . TYR A 1 447 ? 14.242 59.621 17.556  1.00 35.79  ? 447 TYR A CE2 1 
ATOM   3192 C CZ  . TYR A 1 447 ? 12.977 60.143 17.741  1.00 37.64  ? 447 TYR A CZ  1 
ATOM   3193 O OH  . TYR A 1 447 ? 12.036 60.031 16.751  1.00 40.50  ? 447 TYR A OH  1 
ATOM   3194 N N   . ALA A 1 448 ? 16.640 57.931 22.714  1.00 39.33  ? 448 ALA A N   1 
ATOM   3195 C CA  . ALA A 1 448 ? 16.810 56.496 22.815  1.00 37.17  ? 448 ALA A CA  1 
ATOM   3196 C C   . ALA A 1 448 ? 15.789 56.019 23.846  1.00 37.95  ? 448 ALA A C   1 
ATOM   3197 O O   . ALA A 1 448 ? 15.036 55.078 23.600  1.00 37.13  ? 448 ALA A O   1 
ATOM   3198 C CB  . ALA A 1 448 ? 18.244 56.164 23.258  1.00 36.48  ? 448 ALA A CB  1 
ATOM   3199 N N   . GLN A 1 449 ? 15.756 56.683 24.999  1.00 38.09  ? 449 GLN A N   1 
ATOM   3200 C CA  . GLN A 1 449 ? 14.802 56.324 26.041  1.00 37.51  ? 449 GLN A CA  1 
ATOM   3201 C C   . GLN A 1 449 ? 13.374 56.495 25.533  1.00 37.15  ? 449 GLN A C   1 
ATOM   3202 O O   . GLN A 1 449 ? 12.544 55.609 25.722  1.00 38.74  ? 449 GLN A O   1 
ATOM   3203 C CB  . GLN A 1 449 ? 14.998 57.190 27.279  1.00 36.21  ? 449 GLN A CB  1 
ATOM   3204 C CG  . GLN A 1 449 ? 16.259 56.907 28.027  1.00 37.95  ? 449 GLN A CG  1 
ATOM   3205 C CD  . GLN A 1 449 ? 16.393 57.778 29.244  1.00 38.12  ? 449 GLN A CD  1 
ATOM   3206 O OE1 . GLN A 1 449 ? 17.394 58.476 29.414  1.00 39.77  ? 449 GLN A OE1 1 
ATOM   3207 N NE2 . GLN A 1 449 ? 15.379 57.757 30.099  1.00 40.75  ? 449 GLN A NE2 1 
ATOM   3208 N N   . ALA A 1 450 ? 13.088 57.630 24.895  1.00 35.67  ? 450 ALA A N   1 
ATOM   3209 C CA  . ALA A 1 450 ? 11.752 57.883 24.362  1.00 36.55  ? 450 ALA A CA  1 
ATOM   3210 C C   . ALA A 1 450 ? 11.332 56.816 23.341  1.00 39.77  ? 450 ALA A C   1 
ATOM   3211 O O   . ALA A 1 450 ? 10.197 56.332 23.376  1.00 41.48  ? 450 ALA A O   1 
ATOM   3212 C CB  . ALA A 1 450 ? 11.687 59.267 23.730  1.00 30.74  ? 450 ALA A CB  1 
ATOM   3213 N N   . LEU A 1 451 ? 12.240 56.444 22.437  1.00 40.77  ? 451 LEU A N   1 
ATOM   3214 C CA  . LEU A 1 451 ? 11.934 55.431 21.432  1.00 41.05  ? 451 LEU A CA  1 
ATOM   3215 C C   . LEU A 1 451 ? 11.576 54.105 22.095  1.00 41.77  ? 451 LEU A C   1 
ATOM   3216 O O   . LEU A 1 451 ? 10.577 53.478 21.747  1.00 41.26  ? 451 LEU A O   1 
ATOM   3217 C CB  . LEU A 1 451 ? 13.128 55.234 20.497  1.00 41.62  ? 451 LEU A CB  1 
ATOM   3218 C CG  . LEU A 1 451 ? 13.134 55.791 19.066  1.00 43.80  ? 451 LEU A CG  1 
ATOM   3219 C CD1 . LEU A 1 451 ? 12.104 56.877 18.875  1.00 45.61  ? 451 LEU A CD1 1 
ATOM   3220 C CD2 . LEU A 1 451 ? 14.534 56.338 18.768  1.00 45.31  ? 451 LEU A CD2 1 
ATOM   3221 N N   . ALA A 1 452 ? 12.398 53.678 23.050  1.00 42.49  ? 452 ALA A N   1 
ATOM   3222 C CA  . ALA A 1 452 ? 12.158 52.420 23.753  1.00 44.32  ? 452 ALA A CA  1 
ATOM   3223 C C   . ALA A 1 452 ? 10.787 52.438 24.429  1.00 46.35  ? 452 ALA A C   1 
ATOM   3224 O O   . ALA A 1 452 ? 10.040 51.459 24.363  1.00 47.18  ? 452 ALA A O   1 
ATOM   3225 C CB  . ALA A 1 452 ? 13.252 52.177 24.784  1.00 40.51  ? 452 ALA A CB  1 
ATOM   3226 N N   . GLU A 1 453 ? 10.456 53.558 25.067  1.00 48.01  ? 453 GLU A N   1 
ATOM   3227 C CA  . GLU A 1 453 ? 9.171  53.697 25.750  1.00 49.53  ? 453 GLU A CA  1 
ATOM   3228 C C   . GLU A 1 453 ? 8.020  53.542 24.764  1.00 49.10  ? 453 GLU A C   1 
ATOM   3229 O O   . GLU A 1 453 ? 6.972  53.010 25.105  1.00 49.13  ? 453 GLU A O   1 
ATOM   3230 C CB  . GLU A 1 453 ? 9.065  55.067 26.442  1.00 51.61  ? 453 GLU A CB  1 
ATOM   3231 C CG  . GLU A 1 453 ? 10.018 55.291 27.627  1.00 58.82  ? 453 GLU A CG  1 
ATOM   3232 C CD  . GLU A 1 453 ? 9.604  54.550 28.901  1.00 63.87  ? 453 GLU A CD  1 
ATOM   3233 O OE1 . GLU A 1 453 ? 9.564  53.298 28.887  1.00 66.51  ? 453 GLU A OE1 1 
ATOM   3234 O OE2 . GLU A 1 453 ? 9.322  55.223 29.921  1.00 64.17  ? 453 GLU A OE2 1 
ATOM   3235 N N   . ARG A 1 454 ? 8.219  54.013 23.540  1.00 49.12  ? 454 ARG A N   1 
ATOM   3236 C CA  . ARG A 1 454 ? 7.184  53.931 22.521  1.00 50.38  ? 454 ARG A CA  1 
ATOM   3237 C C   . ARG A 1 454 ? 7.152  52.550 21.875  1.00 49.20  ? 454 ARG A C   1 
ATOM   3238 O O   . ARG A 1 454 ? 6.443  52.331 20.891  1.00 47.88  ? 454 ARG A O   1 
ATOM   3239 C CB  . ARG A 1 454 ? 7.416  55.000 21.451  1.00 55.40  ? 454 ARG A CB  1 
ATOM   3240 C CG  . ARG A 1 454 ? 7.276  56.427 21.943  1.00 60.48  ? 454 ARG A CG  1 
ATOM   3241 C CD  . ARG A 1 454 ? 5.824  56.753 22.243  1.00 70.23  ? 454 ARG A CD  1 
ATOM   3242 N NE  . ARG A 1 454 ? 5.640  58.128 22.729  1.00 80.13  ? 454 ARG A NE  1 
ATOM   3243 C CZ  . ARG A 1 454 ? 6.175  58.624 23.854  1.00 85.32  ? 454 ARG A CZ  1 
ATOM   3244 N NH1 . ARG A 1 454 ? 6.941  57.844 24.641  1.00 85.85  ? 454 ARG A NH1 1 
ATOM   3245 N NH2 . ARG A 1 454 ? 5.938  59.905 24.195  1.00 86.12  ? 454 ARG A NH2 1 
ATOM   3246 N N   . GLY A 1 455 ? 7.948  51.629 22.412  1.00 48.23  ? 455 GLY A N   1 
ATOM   3247 C CA  . GLY A 1 455 ? 7.953  50.272 21.892  1.00 47.59  ? 455 GLY A CA  1 
ATOM   3248 C C   . GLY A 1 455 ? 9.004  49.785 20.906  1.00 47.43  ? 455 GLY A C   1 
ATOM   3249 O O   . GLY A 1 455 ? 9.026  48.589 20.586  1.00 47.01  ? 455 GLY A O   1 
ATOM   3250 N N   . ALA A 1 456 ? 9.878  50.663 20.420  1.00 45.06  ? 456 ALA A N   1 
ATOM   3251 C CA  . ALA A 1 456 ? 10.892 50.224 19.459  1.00 41.15  ? 456 ALA A CA  1 
ATOM   3252 C C   . ALA A 1 456 ? 11.979 49.368 20.096  1.00 38.85  ? 456 ALA A C   1 
ATOM   3253 O O   . ALA A 1 456 ? 12.233 49.452 21.289  1.00 37.87  ? 456 ALA A O   1 
ATOM   3254 C CB  . ALA A 1 456 ? 11.518 51.428 18.773  1.00 41.04  ? 456 ALA A CB  1 
ATOM   3255 N N   . SER A 1 457 ? 12.610 48.529 19.287  1.00 39.54  ? 457 SER A N   1 
ATOM   3256 C CA  . SER A 1 457 ? 13.699 47.680 19.758  1.00 40.02  ? 457 SER A CA  1 
ATOM   3257 C C   . SER A 1 457 ? 14.976 48.508 19.538  1.00 40.10  ? 457 SER A C   1 
ATOM   3258 O O   . SER A 1 457 ? 15.495 48.603 18.419  1.00 37.86  ? 457 SER A O   1 
ATOM   3259 C CB  . SER A 1 457 ? 13.731 46.386 18.944  1.00 39.00  ? 457 SER A CB  1 
ATOM   3260 O OG  . SER A 1 457 ? 14.925 45.659 19.158  1.00 41.73  ? 457 SER A OG  1 
ATOM   3261 N N   . VAL A 1 458 ? 15.455 49.116 20.620  1.00 39.22  ? 458 VAL A N   1 
ATOM   3262 C CA  . VAL A 1 458 ? 16.623 49.984 20.589  1.00 36.95  ? 458 VAL A CA  1 
ATOM   3263 C C   . VAL A 1 458 ? 17.916 49.375 21.129  1.00 37.06  ? 458 VAL A C   1 
ATOM   3264 O O   . VAL A 1 458 ? 17.938 48.764 22.197  1.00 37.42  ? 458 VAL A O   1 
ATOM   3265 C CB  . VAL A 1 458 ? 16.343 51.278 21.388  1.00 35.91  ? 458 VAL A CB  1 
ATOM   3266 C CG1 . VAL A 1 458 ? 17.588 52.156 21.422  1.00 36.28  ? 458 VAL A CG1 1 
ATOM   3267 C CG2 . VAL A 1 458 ? 15.167 52.030 20.768  1.00 38.01  ? 458 VAL A CG2 1 
ATOM   3268 N N   . HIS A 1 459 ? 18.991 49.550 20.370  1.00 35.27  ? 459 HIS A N   1 
ATOM   3269 C CA  . HIS A 1 459 ? 20.303 49.081 20.773  1.00 34.34  ? 459 HIS A CA  1 
ATOM   3270 C C   . HIS A 1 459 ? 21.229 50.283 20.719  1.00 34.38  ? 459 HIS A C   1 
ATOM   3271 O O   . HIS A 1 459 ? 21.331 50.969 19.696  1.00 33.60  ? 459 HIS A O   1 
ATOM   3272 C CB  . HIS A 1 459 ? 20.794 47.958 19.865  1.00 34.58  ? 459 HIS A CB  1 
ATOM   3273 C CG  . HIS A 1 459 ? 20.214 46.627 20.211  1.00 34.46  ? 459 HIS A CG  1 
ATOM   3274 N ND1 . HIS A 1 459 ? 19.035 46.165 19.669  1.00 34.29  ? 459 HIS A ND1 1 
ATOM   3275 C CD2 . HIS A 1 459 ? 20.614 45.688 21.100  1.00 35.96  ? 459 HIS A CD2 1 
ATOM   3276 C CE1 . HIS A 1 459 ? 18.734 44.998 20.207  1.00 34.56  ? 459 HIS A CE1 1 
ATOM   3277 N NE2 . HIS A 1 459 ? 19.675 44.686 21.080  1.00 37.42  ? 459 HIS A NE2 1 
ATOM   3278 N N   . TYR A 1 460 ? 21.894 50.529 21.840  1.00 32.56  ? 460 TYR A N   1 
ATOM   3279 C CA  . TYR A 1 460 ? 22.772 51.675 21.995  1.00 31.33  ? 460 TYR A CA  1 
ATOM   3280 C C   . TYR A 1 460 ? 24.246 51.265 22.074  1.00 30.48  ? 460 TYR A C   1 
ATOM   3281 O O   . TYR A 1 460 ? 24.556 50.196 22.603  1.00 29.48  ? 460 TYR A O   1 
ATOM   3282 C CB  . TYR A 1 460 ? 22.359 52.391 23.278  1.00 30.14  ? 460 TYR A CB  1 
ATOM   3283 C CG  . TYR A 1 460 ? 22.669 53.860 23.326  1.00 30.22  ? 460 TYR A CG  1 
ATOM   3284 C CD1 . TYR A 1 460 ? 23.968 54.312 23.556  1.00 28.46  ? 460 TYR A CD1 1 
ATOM   3285 C CD2 . TYR A 1 460 ? 21.642 54.808 23.222  1.00 30.92  ? 460 TYR A CD2 1 
ATOM   3286 C CE1 . TYR A 1 460 ? 24.230 55.673 23.691  1.00 29.61  ? 460 TYR A CE1 1 
ATOM   3287 C CE2 . TYR A 1 460 ? 21.894 56.169 23.363  1.00 27.17  ? 460 TYR A CE2 1 
ATOM   3288 C CZ  . TYR A 1 460 ? 23.182 56.588 23.599  1.00 28.16  ? 460 TYR A CZ  1 
ATOM   3289 O OH  . TYR A 1 460 ? 23.421 57.917 23.795  1.00 28.67  ? 460 TYR A OH  1 
ATOM   3290 N N   . TYR A 1 461 ? 25.144 52.111 21.559  1.00 28.06  ? 461 TYR A N   1 
ATOM   3291 C CA  . TYR A 1 461 ? 26.582 51.828 21.595  1.00 29.35  ? 461 TYR A CA  1 
ATOM   3292 C C   . TYR A 1 461 ? 27.371 53.086 21.931  1.00 31.35  ? 461 TYR A C   1 
ATOM   3293 O O   . TYR A 1 461 ? 26.884 54.198 21.751  1.00 30.89  ? 461 TYR A O   1 
ATOM   3294 C CB  . TYR A 1 461 ? 27.081 51.301 20.244  1.00 27.09  ? 461 TYR A CB  1 
ATOM   3295 C CG  . TYR A 1 461 ? 27.050 52.348 19.158  1.00 27.38  ? 461 TYR A CG  1 
ATOM   3296 C CD1 . TYR A 1 461 ? 27.971 53.406 19.153  1.00 23.66  ? 461 TYR A CD1 1 
ATOM   3297 C CD2 . TYR A 1 461 ? 26.055 52.333 18.177  1.00 24.91  ? 461 TYR A CD2 1 
ATOM   3298 C CE1 . TYR A 1 461 ? 27.890 54.427 18.208  1.00 22.19  ? 461 TYR A CE1 1 
ATOM   3299 C CE2 . TYR A 1 461 ? 25.972 53.351 17.220  1.00 23.00  ? 461 TYR A CE2 1 
ATOM   3300 C CZ  . TYR A 1 461 ? 26.889 54.393 17.248  1.00 21.06  ? 461 TYR A CZ  1 
ATOM   3301 O OH  . TYR A 1 461 ? 26.786 55.410 16.328  1.00 19.06  ? 461 TYR A OH  1 
ATOM   3302 N N   . TYR A 1 462 ? 28.601 52.907 22.400  1.00 32.79  ? 462 TYR A N   1 
ATOM   3303 C CA  . TYR A 1 462 ? 29.458 54.037 22.732  1.00 31.79  ? 462 TYR A CA  1 
ATOM   3304 C C   . TYR A 1 462 ? 30.830 53.752 22.115  1.00 31.53  ? 462 TYR A C   1 
ATOM   3305 O O   . TYR A 1 462 ? 31.456 52.743 22.443  1.00 34.43  ? 462 TYR A O   1 
ATOM   3306 C CB  . TYR A 1 462 ? 29.562 54.179 24.247  1.00 32.98  ? 462 TYR A CB  1 
ATOM   3307 C CG  . TYR A 1 462 ? 30.053 55.535 24.691  1.00 36.38  ? 462 TYR A CG  1 
ATOM   3308 C CD1 . TYR A 1 462 ? 29.401 56.694 24.278  1.00 35.27  ? 462 TYR A CD1 1 
ATOM   3309 C CD2 . TYR A 1 462 ? 31.156 55.664 25.532  1.00 35.78  ? 462 TYR A CD2 1 
ATOM   3310 C CE1 . TYR A 1 462 ? 29.826 57.936 24.686  1.00 36.91  ? 462 TYR A CE1 1 
ATOM   3311 C CE2 . TYR A 1 462 ? 31.595 56.916 25.948  1.00 38.51  ? 462 TYR A CE2 1 
ATOM   3312 C CZ  . TYR A 1 462 ? 30.924 58.047 25.520  1.00 39.06  ? 462 TYR A CZ  1 
ATOM   3313 O OH  . TYR A 1 462 ? 31.349 59.295 25.917  1.00 41.97  ? 462 TYR A OH  1 
ATOM   3314 N N   . PHE A 1 463 ? 31.280 54.621 21.212  1.00 28.45  ? 463 PHE A N   1 
ATOM   3315 C CA  . PHE A 1 463 ? 32.564 54.445 20.530  1.00 30.95  ? 463 PHE A CA  1 
ATOM   3316 C C   . PHE A 1 463 ? 33.674 55.224 21.238  1.00 33.56  ? 463 PHE A C   1 
ATOM   3317 O O   . PHE A 1 463 ? 33.707 56.450 21.192  1.00 32.03  ? 463 PHE A O   1 
ATOM   3318 C CB  . PHE A 1 463 ? 32.434 54.917 19.082  1.00 30.17  ? 463 PHE A CB  1 
ATOM   3319 C CG  . PHE A 1 463 ? 33.689 54.745 18.256  1.00 31.97  ? 463 PHE A CG  1 
ATOM   3320 C CD1 . PHE A 1 463 ? 34.122 53.480 17.869  1.00 32.79  ? 463 PHE A CD1 1 
ATOM   3321 C CD2 . PHE A 1 463 ? 34.419 55.855 17.835  1.00 31.61  ? 463 PHE A CD2 1 
ATOM   3322 C CE1 . PHE A 1 463 ? 35.259 53.319 17.071  1.00 29.44  ? 463 PHE A CE1 1 
ATOM   3323 C CE2 . PHE A 1 463 ? 35.556 55.705 17.039  1.00 30.98  ? 463 PHE A CE2 1 
ATOM   3324 C CZ  . PHE A 1 463 ? 35.973 54.433 16.659  1.00 31.25  ? 463 PHE A CZ  1 
ATOM   3325 N N   . THR A 1 464 ? 34.608 54.514 21.861  1.00 36.62  ? 464 THR A N   1 
ATOM   3326 C CA  . THR A 1 464 ? 35.661 55.190 22.609  1.00 41.20  ? 464 THR A CA  1 
ATOM   3327 C C   . THR A 1 464 ? 37.090 55.013 22.114  1.00 43.84  ? 464 THR A C   1 
ATOM   3328 O O   . THR A 1 464 ? 38.030 55.257 22.871  1.00 43.42  ? 464 THR A O   1 
ATOM   3329 C CB  . THR A 1 464 ? 35.632 54.755 24.096  1.00 39.86  ? 464 THR A CB  1 
ATOM   3330 O OG1 . THR A 1 464 ? 35.788 53.334 24.184  1.00 41.25  ? 464 THR A OG1 1 
ATOM   3331 C CG2 . THR A 1 464 ? 34.319 55.143 24.739  1.00 39.91  ? 464 THR A CG2 1 
ATOM   3332 N N   . HIS A 1 465 ? 37.268 54.618 20.857  1.00 46.92  ? 465 HIS A N   1 
ATOM   3333 C CA  . HIS A 1 465 ? 38.617 54.394 20.336  1.00 48.36  ? 465 HIS A CA  1 
ATOM   3334 C C   . HIS A 1 465 ? 39.224 55.422 19.390  1.00 48.44  ? 465 HIS A C   1 
ATOM   3335 O O   . HIS A 1 465 ? 38.684 55.673 18.311  1.00 48.81  ? 465 HIS A O   1 
ATOM   3336 C CB  . HIS A 1 465 ? 38.683 53.033 19.660  1.00 51.16  ? 465 HIS A CB  1 
ATOM   3337 C CG  . HIS A 1 465 ? 40.040 52.700 19.132  1.00 54.73  ? 465 HIS A CG  1 
ATOM   3338 N ND1 . HIS A 1 465 ? 40.462 53.070 17.875  1.00 56.46  ? 465 HIS A ND1 1 
ATOM   3339 C CD2 . HIS A 1 465 ? 41.088 52.072 19.713  1.00 55.67  ? 465 HIS A CD2 1 
ATOM   3340 C CE1 . HIS A 1 465 ? 41.711 52.680 17.702  1.00 56.70  ? 465 HIS A CE1 1 
ATOM   3341 N NE2 . HIS A 1 465 ? 42.115 52.073 18.802  1.00 55.85  ? 465 HIS A NE2 1 
ATOM   3342 N N   . ARG A 1 466 ? 40.362 55.997 19.786  1.00 48.65  ? 466 ARG A N   1 
ATOM   3343 C CA  . ARG A 1 466 ? 41.052 56.976 18.945  1.00 49.72  ? 466 ARG A CA  1 
ATOM   3344 C C   . ARG A 1 466 ? 41.928 56.221 17.961  1.00 50.50  ? 466 ARG A C   1 
ATOM   3345 O O   . ARG A 1 466 ? 42.856 55.516 18.370  1.00 49.21  ? 466 ARG A O   1 
ATOM   3346 C CB  . ARG A 1 466 ? 41.946 57.902 19.769  1.00 49.09  ? 466 ARG A CB  1 
ATOM   3347 C CG  . ARG A 1 466 ? 42.589 59.000 18.926  1.00 49.04  ? 466 ARG A CG  1 
ATOM   3348 C CD  . ARG A 1 466 ? 43.738 59.633 19.662  1.00 52.26  ? 466 ARG A CD  1 
ATOM   3349 N NE  . ARG A 1 466 ? 44.309 60.797 18.985  1.00 54.22  ? 466 ARG A NE  1 
ATOM   3350 C CZ  . ARG A 1 466 ? 43.670 61.949 18.797  1.00 56.61  ? 466 ARG A CZ  1 
ATOM   3351 N NH1 . ARG A 1 466 ? 42.422 62.112 19.218  1.00 57.39  ? 466 ARG A NH1 1 
ATOM   3352 N NH2 . ARG A 1 466 ? 44.295 62.958 18.216  1.00 57.22  ? 466 ARG A NH2 1 
ATOM   3353 N N   . THR A 1 467 ? 41.632 56.359 16.670  1.00 51.78  ? 467 THR A N   1 
ATOM   3354 C CA  . THR A 1 467 ? 42.415 55.674 15.645  1.00 52.04  ? 467 THR A CA  1 
ATOM   3355 C C   . THR A 1 467 ? 43.890 56.064 15.737  1.00 53.09  ? 467 THR A C   1 
ATOM   3356 O O   . THR A 1 467 ? 44.242 57.250 15.830  1.00 53.08  ? 467 THR A O   1 
ATOM   3357 C CB  . THR A 1 467 ? 41.910 55.992 14.236  1.00 51.06  ? 467 THR A CB  1 
ATOM   3358 O OG1 . THR A 1 467 ? 40.563 55.529 14.098  1.00 51.24  ? 467 THR A OG1 1 
ATOM   3359 C CG2 . THR A 1 467 ? 42.780 55.299 13.201  1.00 50.59  ? 467 THR A CG2 1 
ATOM   3360 N N   . SER A 1 468 ? 44.743 55.049 15.713  1.00 52.32  ? 468 SER A N   1 
ATOM   3361 C CA  . SER A 1 468 ? 46.181 55.232 15.813  1.00 53.65  ? 468 SER A CA  1 
ATOM   3362 C C   . SER A 1 468 ? 46.743 56.304 14.871  1.00 55.05  ? 468 SER A C   1 
ATOM   3363 O O   . SER A 1 468 ? 47.774 56.922 15.158  1.00 55.23  ? 468 SER A O   1 
ATOM   3364 C CB  . SER A 1 468 ? 46.864 53.908 15.519  1.00 53.91  ? 468 SER A CB  1 
ATOM   3365 O OG  . SER A 1 468 ? 46.585 53.523 14.184  1.00 54.38  ? 468 SER A OG  1 
ATOM   3366 N N   . THR A 1 469 ? 46.069 56.529 13.750  1.00 54.59  ? 469 THR A N   1 
ATOM   3367 C CA  . THR A 1 469 ? 46.554 57.495 12.783  1.00 54.52  ? 469 THR A CA  1 
ATOM   3368 C C   . THR A 1 469 ? 45.877 58.862 12.801  1.00 55.65  ? 469 THR A C   1 
ATOM   3369 O O   . THR A 1 469 ? 46.173 59.699 11.948  1.00 56.94  ? 469 THR A O   1 
ATOM   3370 C CB  . THR A 1 469 ? 46.456 56.922 11.361  1.00 54.73  ? 469 THR A CB  1 
ATOM   3371 O OG1 . THR A 1 469 ? 45.079 56.690 11.036  1.00 54.54  ? 469 THR A OG1 1 
ATOM   3372 C CG2 . THR A 1 469 ? 47.229 55.604 11.265  1.00 53.03  ? 469 THR A CG2 1 
ATOM   3373 N N   . SER A 1 470 ? 44.989 59.109 13.764  1.00 54.51  ? 470 SER A N   1 
ATOM   3374 C CA  . SER A 1 470 ? 44.304 60.400 13.817  1.00 51.94  ? 470 SER A CA  1 
ATOM   3375 C C   . SER A 1 470 ? 45.302 61.537 13.701  1.00 53.05  ? 470 SER A C   1 
ATOM   3376 O O   . SER A 1 470 ? 46.297 61.578 14.424  1.00 51.67  ? 470 SER A O   1 
ATOM   3377 C CB  . SER A 1 470 ? 43.516 60.559 15.115  1.00 51.22  ? 470 SER A CB  1 
ATOM   3378 O OG  . SER A 1 470 ? 42.859 61.818 15.148  1.00 47.37  ? 470 SER A OG  1 
ATOM   3379 N N   . LEU A 1 471 ? 45.023 62.460 12.785  1.00 54.32  ? 471 LEU A N   1 
ATOM   3380 C CA  . LEU A 1 471 ? 45.890 63.609 12.547  1.00 54.65  ? 471 LEU A CA  1 
ATOM   3381 C C   . LEU A 1 471 ? 45.504 64.848 13.343  1.00 54.22  ? 471 LEU A C   1 
ATOM   3382 O O   . LEU A 1 471 ? 45.947 65.950 13.030  1.00 56.30  ? 471 LEU A O   1 
ATOM   3383 C CB  . LEU A 1 471 ? 45.907 63.950 11.053  1.00 56.62  ? 471 LEU A CB  1 
ATOM   3384 C CG  . LEU A 1 471 ? 46.769 63.052 10.154  1.00 58.39  ? 471 LEU A CG  1 
ATOM   3385 C CD1 . LEU A 1 471 ? 46.576 63.456 8.688   1.00 56.82  ? 471 LEU A CD1 1 
ATOM   3386 C CD2 . LEU A 1 471 ? 48.247 63.158 10.581  1.00 54.75  ? 471 LEU A CD2 1 
ATOM   3387 N N   . TRP A 1 472 ? 44.682 64.679 14.371  1.00 52.88  ? 472 TRP A N   1 
ATOM   3388 C CA  . TRP A 1 472 ? 44.273 65.818 15.180  1.00 51.12  ? 472 TRP A CA  1 
ATOM   3389 C C   . TRP A 1 472 ? 44.965 65.741 16.525  1.00 50.59  ? 472 TRP A C   1 
ATOM   3390 O O   . TRP A 1 472 ? 45.523 64.704 16.868  1.00 49.17  ? 472 TRP A O   1 
ATOM   3391 C CB  . TRP A 1 472 ? 42.756 65.830 15.371  1.00 49.77  ? 472 TRP A CB  1 
ATOM   3392 C CG  . TRP A 1 472 ? 41.994 66.087 14.111  1.00 49.30  ? 472 TRP A CG  1 
ATOM   3393 C CD1 . TRP A 1 472 ? 41.522 65.157 13.229  1.00 49.47  ? 472 TRP A CD1 1 
ATOM   3394 C CD2 . TRP A 1 472 ? 41.639 67.366 13.576  1.00 49.51  ? 472 TRP A CD2 1 
ATOM   3395 N NE1 . TRP A 1 472 ? 40.895 65.780 12.174  1.00 47.89  ? 472 TRP A NE1 1 
ATOM   3396 C CE2 . TRP A 1 472 ? 40.953 67.136 12.363  1.00 49.19  ? 472 TRP A CE2 1 
ATOM   3397 C CE3 . TRP A 1 472 ? 41.838 68.689 14.005  1.00 49.96  ? 472 TRP A CE3 1 
ATOM   3398 C CZ2 . TRP A 1 472 ? 40.460 68.177 11.573  1.00 49.82  ? 472 TRP A CZ2 1 
ATOM   3399 C CZ3 . TRP A 1 472 ? 41.351 69.725 13.225  1.00 49.56  ? 472 TRP A CZ3 1 
ATOM   3400 C CH2 . TRP A 1 472 ? 40.667 69.462 12.016  1.00 51.69  ? 472 TRP A CH2 1 
ATOM   3401 N N   . GLY A 1 473 ? 44.939 66.838 17.276  1.00 52.06  ? 473 GLY A N   1 
ATOM   3402 C CA  . GLY A 1 473 ? 45.580 66.857 18.583  1.00 54.55  ? 473 GLY A CA  1 
ATOM   3403 C C   . GLY A 1 473 ? 45.060 65.761 19.498  1.00 55.23  ? 473 GLY A C   1 
ATOM   3404 O O   . GLY A 1 473 ? 43.890 65.390 19.410  1.00 57.24  ? 473 GLY A O   1 
ATOM   3405 N N   . GLU A 1 474 ? 45.912 65.231 20.372  1.00 54.72  ? 474 GLU A N   1 
ATOM   3406 C CA  . GLU A 1 474 ? 45.474 64.171 21.273  1.00 55.30  ? 474 GLU A CA  1 
ATOM   3407 C C   . GLU A 1 474 ? 44.384 64.661 22.223  1.00 52.03  ? 474 GLU A C   1 
ATOM   3408 O O   . GLU A 1 474 ? 43.594 63.872 22.738  1.00 50.32  ? 474 GLU A O   1 
ATOM   3409 C CB  . GLU A 1 474 ? 46.651 63.620 22.077  1.00 59.72  ? 474 GLU A CB  1 
ATOM   3410 C CG  . GLU A 1 474 ? 47.372 62.473 21.402  1.00 68.23  ? 474 GLU A CG  1 
ATOM   3411 C CD  . GLU A 1 474 ? 48.596 62.001 22.204  1.00 76.94  ? 474 GLU A CD  1 
ATOM   3412 O OE1 . GLU A 1 474 ? 49.539 62.824 22.437  1.00 80.50  ? 474 GLU A OE1 1 
ATOM   3413 O OE2 . GLU A 1 474 ? 48.610 60.800 22.594  1.00 81.79  ? 474 GLU A OE2 1 
ATOM   3414 N N   . TRP A 1 475 ? 44.339 65.965 22.452  1.00 49.93  ? 475 TRP A N   1 
ATOM   3415 C CA  . TRP A 1 475 ? 43.328 66.521 23.328  1.00 49.19  ? 475 TRP A CA  1 
ATOM   3416 C C   . TRP A 1 475 ? 41.915 66.383 22.780  1.00 47.04  ? 475 TRP A C   1 
ATOM   3417 O O   . TRP A 1 475 ? 40.962 66.286 23.544  1.00 47.62  ? 475 TRP A O   1 
ATOM   3418 C CB  . TRP A 1 475 ? 43.616 67.993 23.621  1.00 48.81  ? 475 TRP A CB  1 
ATOM   3419 C CG  . TRP A 1 475 ? 43.387 68.915 22.478  1.00 48.76  ? 475 TRP A CG  1 
ATOM   3420 C CD1 . TRP A 1 475 ? 44.230 69.149 21.428  1.00 49.20  ? 475 TRP A CD1 1 
ATOM   3421 C CD2 . TRP A 1 475 ? 42.227 69.738 22.259  1.00 48.90  ? 475 TRP A CD2 1 
ATOM   3422 N NE1 . TRP A 1 475 ? 43.667 70.071 20.570  1.00 50.30  ? 475 TRP A NE1 1 
ATOM   3423 C CE2 . TRP A 1 475 ? 42.441 70.450 21.059  1.00 49.22  ? 475 TRP A CE2 1 
ATOM   3424 C CE3 . TRP A 1 475 ? 41.028 69.942 22.963  1.00 48.06  ? 475 TRP A CE3 1 
ATOM   3425 C CZ2 . TRP A 1 475 ? 41.498 71.356 20.546  1.00 47.34  ? 475 TRP A CZ2 1 
ATOM   3426 C CZ3 . TRP A 1 475 ? 40.090 70.842 22.450  1.00 45.81  ? 475 TRP A CZ3 1 
ATOM   3427 C CH2 . TRP A 1 475 ? 40.333 71.536 21.256  1.00 45.74  ? 475 TRP A CH2 1 
ATOM   3428 N N   . MET A 1 476 ? 41.778 66.375 21.460  1.00 46.13  ? 476 MET A N   1 
ATOM   3429 C CA  . MET A 1 476 ? 40.475 66.253 20.817  1.00 46.43  ? 476 MET A CA  1 
ATOM   3430 C C   . MET A 1 476 ? 39.895 64.847 20.915  1.00 45.49  ? 476 MET A C   1 
ATOM   3431 O O   . MET A 1 476 ? 38.712 64.635 20.643  1.00 45.87  ? 476 MET A O   1 
ATOM   3432 C CB  . MET A 1 476 ? 40.592 66.684 19.357  1.00 47.52  ? 476 MET A CB  1 
ATOM   3433 C CG  . MET A 1 476 ? 40.925 68.167 19.181  1.00 47.66  ? 476 MET A CG  1 
ATOM   3434 S SD  . MET A 1 476 ? 41.293 68.653 17.442  1.00 49.22  ? 476 MET A SD  1 
ATOM   3435 C CE  . MET A 1 476 ? 39.653 69.335 16.936  1.00 50.27  ? 476 MET A CE  1 
ATOM   3436 N N   . GLY A 1 477 ? 40.730 63.893 21.329  1.00 43.99  ? 477 GLY A N   1 
ATOM   3437 C CA  . GLY A 1 477 ? 40.293 62.510 21.504  1.00 41.93  ? 477 GLY A CA  1 
ATOM   3438 C C   . GLY A 1 477 ? 39.520 61.868 20.368  1.00 40.99  ? 477 GLY A C   1 
ATOM   3439 O O   . GLY A 1 477 ? 39.758 62.189 19.214  1.00 41.83  ? 477 GLY A O   1 
ATOM   3440 N N   . VAL A 1 478 ? 38.620 60.940 20.708  1.00 39.46  ? 478 VAL A N   1 
ATOM   3441 C CA  . VAL A 1 478 ? 37.793 60.233 19.731  1.00 38.08  ? 478 VAL A CA  1 
ATOM   3442 C C   . VAL A 1 478 ? 36.754 61.234 19.252  1.00 39.93  ? 478 VAL A C   1 
ATOM   3443 O O   . VAL A 1 478 ? 35.779 61.482 19.948  1.00 41.04  ? 478 VAL A O   1 
ATOM   3444 C CB  . VAL A 1 478 ? 37.088 59.029 20.371  1.00 36.64  ? 478 VAL A CB  1 
ATOM   3445 C CG1 . VAL A 1 478 ? 36.417 58.190 19.308  1.00 36.45  ? 478 VAL A CG1 1 
ATOM   3446 C CG2 . VAL A 1 478 ? 38.071 58.188 21.161  1.00 37.02  ? 478 VAL A CG2 1 
ATOM   3447 N N   . LEU A 1 479 ? 36.954 61.810 18.069  1.00 40.98  ? 479 LEU A N   1 
ATOM   3448 C CA  . LEU A 1 479 ? 36.022 62.820 17.597  1.00 42.84  ? 479 LEU A CA  1 
ATOM   3449 C C   . LEU A 1 479 ? 34.974 62.480 16.563  1.00 44.02  ? 479 LEU A C   1 
ATOM   3450 O O   . LEU A 1 479 ? 35.078 61.508 15.826  1.00 44.41  ? 479 LEU A O   1 
ATOM   3451 C CB  . LEU A 1 479 ? 36.777 64.070 17.122  1.00 44.45  ? 479 LEU A CB  1 
ATOM   3452 C CG  . LEU A 1 479 ? 37.771 64.031 15.970  1.00 43.47  ? 479 LEU A CG  1 
ATOM   3453 C CD1 . LEU A 1 479 ? 38.131 65.451 15.584  1.00 42.87  ? 479 LEU A CD1 1 
ATOM   3454 C CD2 . LEU A 1 479 ? 39.013 63.285 16.384  1.00 46.70  ? 479 LEU A CD2 1 
ATOM   3455 N N   . HIS A 1 480 ? 33.944 63.317 16.546  1.00 44.86  ? 480 HIS A N   1 
ATOM   3456 C CA  . HIS A 1 480 ? 32.815 63.233 15.630  1.00 45.76  ? 480 HIS A CA  1 
ATOM   3457 C C   . HIS A 1 480 ? 33.227 62.662 14.272  1.00 44.67  ? 480 HIS A C   1 
ATOM   3458 O O   . HIS A 1 480 ? 34.070 63.238 13.589  1.00 45.31  ? 480 HIS A O   1 
ATOM   3459 C CB  . HIS A 1 480 ? 32.275 64.646 15.439  1.00 49.83  ? 480 HIS A CB  1 
ATOM   3460 C CG  . HIS A 1 480 ? 30.792 64.720 15.310  1.00 54.35  ? 480 HIS A CG  1 
ATOM   3461 N ND1 . HIS A 1 480 ? 30.160 64.980 14.114  1.00 55.92  ? 480 HIS A ND1 1 
ATOM   3462 C CD2 . HIS A 1 480 ? 29.814 64.602 16.238  1.00 56.31  ? 480 HIS A CD2 1 
ATOM   3463 C CE1 . HIS A 1 480 ? 28.855 65.020 14.313  1.00 57.85  ? 480 HIS A CE1 1 
ATOM   3464 N NE2 . HIS A 1 480 ? 28.618 64.794 15.593  1.00 57.72  ? 480 HIS A NE2 1 
ATOM   3465 N N   . GLY A 1 481 ? 32.637 61.539 13.877  1.00 43.62  ? 481 GLY A N   1 
ATOM   3466 C CA  . GLY A 1 481 ? 32.975 60.952 12.587  1.00 40.56  ? 481 GLY A CA  1 
ATOM   3467 C C   . GLY A 1 481 ? 34.068 59.889 12.540  1.00 40.24  ? 481 GLY A C   1 
ATOM   3468 O O   . GLY A 1 481 ? 34.279 59.247 11.495  1.00 37.95  ? 481 GLY A O   1 
ATOM   3469 N N   . ASP A 1 482 ? 34.782 59.703 13.652  1.00 40.18  ? 482 ASP A N   1 
ATOM   3470 C CA  . ASP A 1 482 ? 35.838 58.695 13.706  1.00 38.37  ? 482 ASP A CA  1 
ATOM   3471 C C   . ASP A 1 482 ? 35.215 57.320 13.578  1.00 36.16  ? 482 ASP A C   1 
ATOM   3472 O O   . ASP A 1 482 ? 35.816 56.420 13.013  1.00 40.45  ? 482 ASP A O   1 
ATOM   3473 C CB  . ASP A 1 482 ? 36.623 58.767 15.022  1.00 39.76  ? 482 ASP A CB  1 
ATOM   3474 C CG  . ASP A 1 482 ? 37.669 59.881 15.031  1.00 43.39  ? 482 ASP A CG  1 
ATOM   3475 O OD1 . ASP A 1 482 ? 37.901 60.521 13.975  1.00 43.09  ? 482 ASP A OD1 1 
ATOM   3476 O OD2 . ASP A 1 482 ? 38.267 60.106 16.104  1.00 41.51  ? 482 ASP A OD2 1 
ATOM   3477 N N   . GLU A 1 483 ? 33.998 57.158 14.075  1.00 32.84  ? 483 GLU A N   1 
ATOM   3478 C CA  . GLU A 1 483 ? 33.350 55.866 14.004  1.00 31.52  ? 483 GLU A CA  1 
ATOM   3479 C C   . GLU A 1 483 ? 32.920 55.470 12.588  1.00 30.68  ? 483 GLU A C   1 
ATOM   3480 O O   . GLU A 1 483 ? 32.846 54.291 12.271  1.00 32.44  ? 483 GLU A O   1 
ATOM   3481 C CB  . GLU A 1 483 ? 32.151 55.823 14.967  1.00 31.84  ? 483 GLU A CB  1 
ATOM   3482 C CG  . GLU A 1 483 ? 30.828 56.319 14.410  1.00 31.68  ? 483 GLU A CG  1 
ATOM   3483 C CD  . GLU A 1 483 ? 30.737 57.823 14.344  1.00 33.93  ? 483 GLU A CD  1 
ATOM   3484 O OE1 . GLU A 1 483 ? 31.768 58.474 14.074  1.00 33.23  ? 483 GLU A OE1 1 
ATOM   3485 O OE2 . GLU A 1 483 ? 29.623 58.351 14.546  1.00 35.63  ? 483 GLU A OE2 1 
ATOM   3486 N N   . ILE A 1 484 ? 32.661 56.442 11.724  1.00 29.09  ? 484 ILE A N   1 
ATOM   3487 C CA  . ILE A 1 484 ? 32.223 56.130 10.369  1.00 28.85  ? 484 ILE A CA  1 
ATOM   3488 C C   . ILE A 1 484 ? 33.114 55.116 9.649   1.00 29.36  ? 484 ILE A C   1 
ATOM   3489 O O   . ILE A 1 484 ? 32.623 54.095 9.182   1.00 28.03  ? 484 ILE A O   1 
ATOM   3490 C CB  . ILE A 1 484 ? 32.082 57.432 9.525   1.00 29.99  ? 484 ILE A CB  1 
ATOM   3491 C CG1 . ILE A 1 484 ? 30.973 58.305 10.119  1.00 28.63  ? 484 ILE A CG1 1 
ATOM   3492 C CG2 . ILE A 1 484 ? 31.745 57.107 8.075   1.00 27.33  ? 484 ILE A CG2 1 
ATOM   3493 C CD1 . ILE A 1 484 ? 30.810 59.646 9.423   1.00 31.90  ? 484 ILE A CD1 1 
ATOM   3494 N N   . GLU A 1 485 ? 34.411 55.385 9.551   1.00 33.94  ? 485 GLU A N   1 
ATOM   3495 C CA  . GLU A 1 485 ? 35.338 54.445 8.892   1.00 37.74  ? 485 GLU A CA  1 
ATOM   3496 C C   . GLU A 1 485 ? 35.092 53.002 9.339   1.00 37.80  ? 485 GLU A C   1 
ATOM   3497 O O   . GLU A 1 485 ? 34.918 52.105 8.514   1.00 40.51  ? 485 GLU A O   1 
ATOM   3498 C CB  . GLU A 1 485 ? 36.794 54.755 9.247   1.00 39.70  ? 485 GLU A CB  1 
ATOM   3499 C CG  . GLU A 1 485 ? 37.146 56.217 9.322   1.00 48.35  ? 485 GLU A CG  1 
ATOM   3500 C CD  . GLU A 1 485 ? 38.539 56.437 9.882   1.00 51.33  ? 485 GLU A CD  1 
ATOM   3501 O OE1 . GLU A 1 485 ? 39.243 55.429 10.150  1.00 49.74  ? 485 GLU A OE1 1 
ATOM   3502 O OE2 . GLU A 1 485 ? 38.922 57.621 10.053  1.00 54.42  ? 485 GLU A OE2 1 
ATOM   3503 N N   . TYR A 1 486 ? 35.102 52.790 10.654  1.00 35.24  ? 486 TYR A N   1 
ATOM   3504 C CA  . TYR A 1 486 ? 34.923 51.471 11.222  1.00 33.68  ? 486 TYR A CA  1 
ATOM   3505 C C   . TYR A 1 486 ? 33.625 50.777 10.867  1.00 35.54  ? 486 TYR A C   1 
ATOM   3506 O O   . TYR A 1 486 ? 33.614 49.580 10.573  1.00 35.31  ? 486 TYR A O   1 
ATOM   3507 C CB  . TYR A 1 486 ? 35.073 51.537 12.738  1.00 34.57  ? 486 TYR A CB  1 
ATOM   3508 C CG  . TYR A 1 486 ? 36.470 51.900 13.183  1.00 34.10  ? 486 TYR A CG  1 
ATOM   3509 C CD1 . TYR A 1 486 ? 36.920 53.221 13.132  1.00 33.08  ? 486 TYR A CD1 1 
ATOM   3510 C CD2 . TYR A 1 486 ? 37.349 50.921 13.637  1.00 33.46  ? 486 TYR A CD2 1 
ATOM   3511 C CE1 . TYR A 1 486 ? 38.210 53.556 13.526  1.00 32.42  ? 486 TYR A CE1 1 
ATOM   3512 C CE2 . TYR A 1 486 ? 38.644 51.248 14.031  1.00 34.35  ? 486 TYR A CE2 1 
ATOM   3513 C CZ  . TYR A 1 486 ? 39.066 52.567 13.971  1.00 32.79  ? 486 TYR A CZ  1 
ATOM   3514 O OH  . TYR A 1 486 ? 40.351 52.895 14.332  1.00 33.68  ? 486 TYR A OH  1 
ATOM   3515 N N   . PHE A 1 487 ? 32.523 51.515 10.904  1.00 36.85  ? 487 PHE A N   1 
ATOM   3516 C CA  . PHE A 1 487 ? 31.234 50.936 10.566  1.00 37.11  ? 487 PHE A CA  1 
ATOM   3517 C C   . PHE A 1 487 ? 31.195 50.583 9.083   1.00 37.09  ? 487 PHE A C   1 
ATOM   3518 O O   . PHE A 1 487 ? 30.465 49.685 8.669   1.00 36.46  ? 487 PHE A O   1 
ATOM   3519 C CB  . PHE A 1 487 ? 30.112 51.907 10.933  1.00 36.85  ? 487 PHE A CB  1 
ATOM   3520 C CG  . PHE A 1 487 ? 29.746 51.885 12.394  1.00 35.92  ? 487 PHE A CG  1 
ATOM   3521 C CD1 . PHE A 1 487 ? 29.764 50.694 13.111  1.00 37.49  ? 487 PHE A CD1 1 
ATOM   3522 C CD2 . PHE A 1 487 ? 29.358 53.048 13.044  1.00 35.28  ? 487 PHE A CD2 1 
ATOM   3523 C CE1 . PHE A 1 487 ? 29.400 50.662 14.451  1.00 36.70  ? 487 PHE A CE1 1 
ATOM   3524 C CE2 . PHE A 1 487 ? 28.994 53.028 14.380  1.00 35.47  ? 487 PHE A CE2 1 
ATOM   3525 C CZ  . PHE A 1 487 ? 29.015 51.830 15.087  1.00 37.32  ? 487 PHE A CZ  1 
ATOM   3526 N N   . PHE A 1 488 ? 31.984 51.287 8.281   1.00 38.47  ? 488 PHE A N   1 
ATOM   3527 C CA  . PHE A 1 488 ? 32.040 50.991 6.854   1.00 42.20  ? 488 PHE A CA  1 
ATOM   3528 C C   . PHE A 1 488 ? 33.047 49.873 6.617   1.00 43.32  ? 488 PHE A C   1 
ATOM   3529 O O   . PHE A 1 488 ? 33.187 49.379 5.499   1.00 44.94  ? 488 PHE A O   1 
ATOM   3530 C CB  . PHE A 1 488 ? 32.431 52.231 6.033   1.00 40.90  ? 488 PHE A CB  1 
ATOM   3531 C CG  . PHE A 1 488 ? 31.259 53.082 5.622   1.00 40.00  ? 488 PHE A CG  1 
ATOM   3532 C CD1 . PHE A 1 488 ? 30.565 52.804 4.454   1.00 37.79  ? 488 PHE A CD1 1 
ATOM   3533 C CD2 . PHE A 1 488 ? 30.827 54.146 6.421   1.00 42.65  ? 488 PHE A CD2 1 
ATOM   3534 C CE1 . PHE A 1 488 ? 29.452 53.572 4.082   1.00 40.40  ? 488 PHE A CE1 1 
ATOM   3535 C CE2 . PHE A 1 488 ? 29.708 54.925 6.056   1.00 40.80  ? 488 PHE A CE2 1 
ATOM   3536 C CZ  . PHE A 1 488 ? 29.023 54.635 4.886   1.00 38.84  ? 488 PHE A CZ  1 
ATOM   3537 N N   . GLY A 1 489 ? 33.744 49.482 7.681   1.00 45.25  ? 489 GLY A N   1 
ATOM   3538 C CA  . GLY A 1 489 ? 34.728 48.415 7.591   1.00 45.52  ? 489 GLY A CA  1 
ATOM   3539 C C   . GLY A 1 489 ? 35.983 48.761 6.805   1.00 46.17  ? 489 GLY A C   1 
ATOM   3540 O O   . GLY A 1 489 ? 36.604 47.881 6.204   1.00 44.81  ? 489 GLY A O   1 
ATOM   3541 N N   . GLN A 1 490 ? 36.371 50.033 6.811   1.00 46.41  ? 490 GLN A N   1 
ATOM   3542 C CA  . GLN A 1 490 ? 37.560 50.452 6.082   1.00 48.04  ? 490 GLN A CA  1 
ATOM   3543 C C   . GLN A 1 490 ? 38.844 49.875 6.686   1.00 49.17  ? 490 GLN A C   1 
ATOM   3544 O O   . GLN A 1 490 ? 39.858 49.767 6.006   1.00 51.40  ? 490 GLN A O   1 
ATOM   3545 C CB  . GLN A 1 490 ? 37.640 51.978 6.028   1.00 48.22  ? 490 GLN A CB  1 
ATOM   3546 C CG  . GLN A 1 490 ? 36.333 52.660 5.614   1.00 53.96  ? 490 GLN A CG  1 
ATOM   3547 C CD  . GLN A 1 490 ? 35.932 52.420 4.159   1.00 54.99  ? 490 GLN A CD  1 
ATOM   3548 O OE1 . GLN A 1 490 ? 35.901 51.285 3.678   1.00 55.08  ? 490 GLN A OE1 1 
ATOM   3549 N NE2 . GLN A 1 490 ? 35.603 53.500 3.459   1.00 56.57  ? 490 GLN A NE2 1 
ATOM   3550 N N   . PRO A 1 491 ? 38.831 49.519 7.979   1.00 48.92  ? 491 PRO A N   1 
ATOM   3551 C CA  . PRO A 1 491 ? 40.065 48.962 8.534   1.00 47.80  ? 491 PRO A CA  1 
ATOM   3552 C C   . PRO A 1 491 ? 40.379 47.573 7.978   1.00 47.79  ? 491 PRO A C   1 
ATOM   3553 O O   . PRO A 1 491 ? 41.436 47.011 8.260   1.00 47.65  ? 491 PRO A O   1 
ATOM   3554 C CB  . PRO A 1 491 ? 39.787 48.942 10.027  1.00 48.43  ? 491 PRO A CB  1 
ATOM   3555 C CG  . PRO A 1 491 ? 38.923 50.136 10.202  1.00 49.08  ? 491 PRO A CG  1 
ATOM   3556 C CD  . PRO A 1 491 ? 37.955 49.994 9.062   1.00 48.86  ? 491 PRO A CD  1 
ATOM   3557 N N   . LEU A 1 492 ? 39.454 47.012 7.205   1.00 46.78  ? 492 LEU A N   1 
ATOM   3558 C CA  . LEU A 1 492 ? 39.690 45.710 6.594   1.00 46.12  ? 492 LEU A CA  1 
ATOM   3559 C C   . LEU A 1 492 ? 40.519 45.932 5.330   1.00 48.28  ? 492 LEU A C   1 
ATOM   3560 O O   . LEU A 1 492 ? 41.010 44.983 4.722   1.00 50.94  ? 492 LEU A O   1 
ATOM   3561 C CB  . LEU A 1 492 ? 38.381 45.026 6.212   1.00 41.87  ? 492 LEU A CB  1 
ATOM   3562 C CG  . LEU A 1 492 ? 37.401 44.662 7.321   1.00 41.76  ? 492 LEU A CG  1 
ATOM   3563 C CD1 . LEU A 1 492 ? 36.311 43.782 6.748   1.00 44.03  ? 492 LEU A CD1 1 
ATOM   3564 C CD2 . LEU A 1 492 ? 38.107 43.931 8.420   1.00 43.21  ? 492 LEU A CD2 1 
ATOM   3565 N N   . ASN A 1 493 ? 40.669 47.195 4.942   1.00 48.09  ? 493 ASN A N   1 
ATOM   3566 C CA  . ASN A 1 493 ? 41.429 47.559 3.757   1.00 48.18  ? 493 ASN A CA  1 
ATOM   3567 C C   . ASN A 1 493 ? 42.914 47.537 4.079   1.00 47.67  ? 493 ASN A C   1 
ATOM   3568 O O   . ASN A 1 493 ? 43.442 48.467 4.681   1.00 46.74  ? 493 ASN A O   1 
ATOM   3569 C CB  . ASN A 1 493 ? 41.037 48.955 3.292   1.00 51.93  ? 493 ASN A CB  1 
ATOM   3570 C CG  . ASN A 1 493 ? 41.556 49.268 1.908   1.00 55.98  ? 493 ASN A CG  1 
ATOM   3571 O OD1 . ASN A 1 493 ? 42.593 48.747 1.506   1.00 55.81  ? 493 ASN A OD1 1 
ATOM   3572 N ND2 . ASN A 1 493 ? 40.844 50.128 1.183   1.00 59.44  ? 493 ASN A ND2 1 
ATOM   3573 N N   . ASN A 1 494 ? 43.587 46.472 3.667   1.00 48.23  ? 494 ASN A N   1 
ATOM   3574 C CA  . ASN A 1 494 ? 45.010 46.315 3.923   1.00 48.40  ? 494 ASN A CA  1 
ATOM   3575 C C   . ASN A 1 494 ? 45.898 47.406 3.363   1.00 50.54  ? 494 ASN A C   1 
ATOM   3576 O O   . ASN A 1 494 ? 47.008 47.605 3.856   1.00 51.71  ? 494 ASN A O   1 
ATOM   3577 C CB  . ASN A 1 494 ? 45.485 44.969 3.400   1.00 47.04  ? 494 ASN A CB  1 
ATOM   3578 C CG  . ASN A 1 494 ? 45.062 43.828 4.293   1.00 48.12  ? 494 ASN A CG  1 
ATOM   3579 O OD1 . ASN A 1 494 ? 44.272 42.966 3.899   1.00 47.23  ? 494 ASN A OD1 1 
ATOM   3580 N ND2 . ASN A 1 494 ? 45.585 43.817 5.515   1.00 46.99  ? 494 ASN A ND2 1 
ATOM   3581 N N   . SER A 1 495 ? 45.429 48.106 2.334   1.00 51.42  ? 495 SER A N   1 
ATOM   3582 C CA  . SER A 1 495 ? 46.222 49.177 1.747   1.00 51.48  ? 495 SER A CA  1 
ATOM   3583 C C   . SER A 1 495 ? 46.281 50.321 2.740   1.00 51.94  ? 495 SER A C   1 
ATOM   3584 O O   . SER A 1 495 ? 47.243 51.090 2.754   1.00 52.34  ? 495 SER A O   1 
ATOM   3585 C CB  . SER A 1 495 ? 45.607 49.652 0.431   1.00 51.80  ? 495 SER A CB  1 
ATOM   3586 O OG  . SER A 1 495 ? 45.614 48.616 -0.537  1.00 53.29  ? 495 SER A OG  1 
ATOM   3587 N N   . LEU A 1 496 ? 45.248 50.422 3.575   1.00 51.90  ? 496 LEU A N   1 
ATOM   3588 C CA  . LEU A 1 496 ? 45.179 51.468 4.596   1.00 53.03  ? 496 LEU A CA  1 
ATOM   3589 C C   . LEU A 1 496 ? 45.863 51.030 5.894   1.00 53.91  ? 496 LEU A C   1 
ATOM   3590 O O   . LEU A 1 496 ? 45.660 49.915 6.381   1.00 53.54  ? 496 LEU A O   1 
ATOM   3591 C CB  . LEU A 1 496 ? 43.726 51.841 4.882   1.00 52.17  ? 496 LEU A CB  1 
ATOM   3592 C CG  . LEU A 1 496 ? 42.989 52.565 3.761   1.00 52.42  ? 496 LEU A CG  1 
ATOM   3593 C CD1 . LEU A 1 496 ? 41.533 52.768 4.146   1.00 50.74  ? 496 LEU A CD1 1 
ATOM   3594 C CD2 . LEU A 1 496 ? 43.669 53.892 3.496   1.00 51.39  ? 496 LEU A CD2 1 
ATOM   3595 N N   . GLN A 1 497 ? 46.662 51.931 6.452   1.00 53.98  ? 497 GLN A N   1 
ATOM   3596 C CA  . GLN A 1 497 ? 47.418 51.672 7.669   1.00 54.89  ? 497 GLN A CA  1 
ATOM   3597 C C   . GLN A 1 497 ? 46.562 51.647 8.933   1.00 54.37  ? 497 GLN A C   1 
ATOM   3598 O O   . GLN A 1 497 ? 45.980 52.661 9.312   1.00 54.05  ? 497 GLN A O   1 
ATOM   3599 C CB  . GLN A 1 497 ? 48.494 52.746 7.811   1.00 56.94  ? 497 GLN A CB  1 
ATOM   3600 C CG  . GLN A 1 497 ? 49.567 52.460 8.831   1.00 59.89  ? 497 GLN A CG  1 
ATOM   3601 C CD  . GLN A 1 497 ? 50.433 53.679 9.088   1.00 63.79  ? 497 GLN A CD  1 
ATOM   3602 O OE1 . GLN A 1 497 ? 50.827 54.384 8.155   1.00 65.91  ? 497 GLN A OE1 1 
ATOM   3603 N NE2 . GLN A 1 497 ? 50.738 53.933 10.356  1.00 65.91  ? 497 GLN A NE2 1 
ATOM   3604 N N   . TYR A 1 498 ? 46.500 50.487 9.580   1.00 53.85  ? 498 TYR A N   1 
ATOM   3605 C CA  . TYR A 1 498 ? 45.744 50.306 10.823  1.00 53.66  ? 498 TYR A CA  1 
ATOM   3606 C C   . TYR A 1 498 ? 46.410 49.212 11.663  1.00 53.90  ? 498 TYR A C   1 
ATOM   3607 O O   . TYR A 1 498 ? 47.045 48.310 11.111  1.00 55.41  ? 498 TYR A O   1 
ATOM   3608 C CB  . TYR A 1 498 ? 44.306 49.858 10.538  1.00 52.86  ? 498 TYR A CB  1 
ATOM   3609 C CG  . TYR A 1 498 ? 43.344 50.925 10.064  1.00 52.44  ? 498 TYR A CG  1 
ATOM   3610 C CD1 . TYR A 1 498 ? 42.813 51.853 10.953  1.00 49.70  ? 498 TYR A CD1 1 
ATOM   3611 C CD2 . TYR A 1 498 ? 42.924 50.973 8.732   1.00 52.88  ? 498 TYR A CD2 1 
ATOM   3612 C CE1 . TYR A 1 498 ? 41.885 52.800 10.530  1.00 50.78  ? 498 TYR A CE1 1 
ATOM   3613 C CE2 . TYR A 1 498 ? 41.993 51.917 8.302   1.00 50.90  ? 498 TYR A CE2 1 
ATOM   3614 C CZ  . TYR A 1 498 ? 41.481 52.824 9.210   1.00 49.89  ? 498 TYR A CZ  1 
ATOM   3615 O OH  . TYR A 1 498 ? 40.562 53.757 8.810   1.00 49.92  ? 498 TYR A OH  1 
ATOM   3616 N N   . ARG A 1 499 ? 46.271 49.288 12.985  1.00 53.31  ? 499 ARG A N   1 
ATOM   3617 C CA  . ARG A 1 499 ? 46.848 48.272 13.858  1.00 53.90  ? 499 ARG A CA  1 
ATOM   3618 C C   . ARG A 1 499 ? 46.011 47.007 13.735  1.00 53.58  ? 499 ARG A C   1 
ATOM   3619 O O   . ARG A 1 499 ? 44.828 47.065 13.399  1.00 53.70  ? 499 ARG A O   1 
ATOM   3620 C CB  . ARG A 1 499 ? 46.852 48.731 15.320  1.00 56.28  ? 499 ARG A CB  1 
ATOM   3621 C CG  . ARG A 1 499 ? 47.859 49.816 15.656  1.00 59.01  ? 499 ARG A CG  1 
ATOM   3622 C CD  . ARG A 1 499 ? 48.046 49.913 17.161  1.00 63.10  ? 499 ARG A CD  1 
ATOM   3623 N NE  . ARG A 1 499 ? 46.837 50.364 17.848  1.00 68.37  ? 499 ARG A NE  1 
ATOM   3624 C CZ  . ARG A 1 499 ? 46.666 50.316 19.167  1.00 70.53  ? 499 ARG A CZ  1 
ATOM   3625 N NH1 . ARG A 1 499 ? 47.627 49.831 19.943  1.00 71.86  ? 499 ARG A NH1 1 
ATOM   3626 N NH2 . ARG A 1 499 ? 45.540 50.760 19.715  1.00 72.24  ? 499 ARG A NH2 1 
ATOM   3627 N N   . PRO A 1 500 ? 46.612 45.842 14.006  1.00 53.43  ? 500 PRO A N   1 
ATOM   3628 C CA  . PRO A 1 500 ? 45.861 44.588 13.907  1.00 52.83  ? 500 PRO A CA  1 
ATOM   3629 C C   . PRO A 1 500 ? 44.568 44.656 14.722  1.00 52.58  ? 500 PRO A C   1 
ATOM   3630 O O   . PRO A 1 500 ? 43.522 44.178 14.271  1.00 53.50  ? 500 PRO A O   1 
ATOM   3631 C CB  . PRO A 1 500 ? 46.847 43.549 14.447  1.00 51.96  ? 500 PRO A CB  1 
ATOM   3632 C CG  . PRO A 1 500 ? 48.175 44.124 14.075  1.00 53.06  ? 500 PRO A CG  1 
ATOM   3633 C CD  . PRO A 1 500 ? 48.007 45.594 14.410  1.00 53.60  ? 500 PRO A CD  1 
ATOM   3634 N N   . VAL A 1 501 ? 44.646 45.255 15.913  1.00 51.15  ? 501 VAL A N   1 
ATOM   3635 C CA  . VAL A 1 501 ? 43.480 45.383 16.787  1.00 50.35  ? 501 VAL A CA  1 
ATOM   3636 C C   . VAL A 1 501 ? 42.446 46.308 16.159  1.00 48.17  ? 501 VAL A C   1 
ATOM   3637 O O   . VAL A 1 501 ? 41.248 46.082 16.286  1.00 48.44  ? 501 VAL A O   1 
ATOM   3638 C CB  . VAL A 1 501 ? 43.849 45.940 18.199  1.00 50.56  ? 501 VAL A CB  1 
ATOM   3639 C CG1 . VAL A 1 501 ? 44.839 45.028 18.872  1.00 52.55  ? 501 VAL A CG1 1 
ATOM   3640 C CG2 . VAL A 1 501 ? 44.430 47.340 18.087  1.00 52.39  ? 501 VAL A CG2 1 
ATOM   3641 N N   . GLU A 1 502 ? 42.908 47.344 15.472  1.00 45.67  ? 502 GLU A N   1 
ATOM   3642 C CA  . GLU A 1 502 ? 41.990 48.269 14.839  1.00 43.89  ? 502 GLU A CA  1 
ATOM   3643 C C   . GLU A 1 502 ? 41.270 47.606 13.689  1.00 43.67  ? 502 GLU A C   1 
ATOM   3644 O O   . GLU A 1 502 ? 40.129 47.947 13.394  1.00 44.82  ? 502 GLU A O   1 
ATOM   3645 C CB  . GLU A 1 502 ? 42.732 49.519 14.378  1.00 40.99  ? 502 GLU A CB  1 
ATOM   3646 C CG  . GLU A 1 502 ? 43.245 50.308 15.558  1.00 42.88  ? 502 GLU A CG  1 
ATOM   3647 C CD  . GLU A 1 502 ? 43.963 51.556 15.162  1.00 43.37  ? 502 GLU A CD  1 
ATOM   3648 O OE1 . GLU A 1 502 ? 44.828 51.471 14.282  1.00 48.85  ? 502 GLU A OE1 1 
ATOM   3649 O OE2 . GLU A 1 502 ? 43.682 52.626 15.731  1.00 45.40  ? 502 GLU A OE2 1 
ATOM   3650 N N   . ARG A 1 503 ? 41.922 46.647 13.046  1.00 44.38  ? 503 ARG A N   1 
ATOM   3651 C CA  . ARG A 1 503 ? 41.281 45.945 11.945  1.00 47.22  ? 503 ARG A CA  1 
ATOM   3652 C C   . ARG A 1 503 ? 40.241 44.992 12.516  1.00 48.92  ? 503 ARG A C   1 
ATOM   3653 O O   . ARG A 1 503 ? 39.219 44.704 11.883  1.00 48.73  ? 503 ARG A O   1 
ATOM   3654 C CB  . ARG A 1 503 ? 42.305 45.164 11.124  1.00 47.08  ? 503 ARG A CB  1 
ATOM   3655 C CG  . ARG A 1 503 ? 43.299 46.043 10.389  1.00 49.71  ? 503 ARG A CG  1 
ATOM   3656 C CD  . ARG A 1 503 ? 44.122 45.248 9.384   1.00 49.80  ? 503 ARG A CD  1 
ATOM   3657 N NE  . ARG A 1 503 ? 45.257 46.024 8.898   1.00 50.59  ? 503 ARG A NE  1 
ATOM   3658 C CZ  . ARG A 1 503 ? 45.177 46.992 7.994   1.00 52.15  ? 503 ARG A CZ  1 
ATOM   3659 N NH1 . ARG A 1 503 ? 44.008 47.309 7.456   1.00 53.95  ? 503 ARG A NH1 1 
ATOM   3660 N NH2 . ARG A 1 503 ? 46.268 47.660 7.646   1.00 52.98  ? 503 ARG A NH2 1 
ATOM   3661 N N   . GLU A 1 504 ? 40.500 44.506 13.725  1.00 50.35  ? 504 GLU A N   1 
ATOM   3662 C CA  . GLU A 1 504 ? 39.574 43.592 14.371  1.00 50.27  ? 504 GLU A CA  1 
ATOM   3663 C C   . GLU A 1 504 ? 38.309 44.366 14.735  1.00 47.57  ? 504 GLU A C   1 
ATOM   3664 O O   . GLU A 1 504 ? 37.192 43.898 14.513  1.00 48.14  ? 504 GLU A O   1 
ATOM   3665 C CB  . GLU A 1 504 ? 40.213 42.991 15.625  1.00 53.38  ? 504 GLU A CB  1 
ATOM   3666 C CG  . GLU A 1 504 ? 40.096 41.469 15.718  1.00 60.62  ? 504 GLU A CG  1 
ATOM   3667 C CD  . GLU A 1 504 ? 38.665 40.987 15.936  1.00 65.72  ? 504 GLU A CD  1 
ATOM   3668 O OE1 . GLU A 1 504 ? 38.082 41.305 17.000  1.00 67.91  ? 504 GLU A OE1 1 
ATOM   3669 O OE2 . GLU A 1 504 ? 38.123 40.288 15.046  1.00 68.80  ? 504 GLU A OE2 1 
ATOM   3670 N N   . LEU A 1 505 ? 38.491 45.560 15.282  1.00 44.12  ? 505 LEU A N   1 
ATOM   3671 C CA  . LEU A 1 505 ? 37.362 46.387 15.672  1.00 42.56  ? 505 LEU A CA  1 
ATOM   3672 C C   . LEU A 1 505 ? 36.558 46.740 14.430  1.00 43.56  ? 505 LEU A C   1 
ATOM   3673 O O   . LEU A 1 505 ? 35.326 46.680 14.447  1.00 43.45  ? 505 LEU A O   1 
ATOM   3674 C CB  . LEU A 1 505 ? 37.843 47.664 16.377  1.00 38.20  ? 505 LEU A CB  1 
ATOM   3675 C CG  . LEU A 1 505 ? 36.769 48.574 16.986  1.00 32.89  ? 505 LEU A CG  1 
ATOM   3676 C CD1 . LEU A 1 505 ? 35.837 47.767 17.867  1.00 28.37  ? 505 LEU A CD1 1 
ATOM   3677 C CD2 . LEU A 1 505 ? 37.424 49.671 17.784  1.00 31.84  ? 505 LEU A CD2 1 
ATOM   3678 N N   . GLY A 1 506 ? 37.258 47.112 13.356  1.00 43.75  ? 506 GLY A N   1 
ATOM   3679 C CA  . GLY A 1 506 ? 36.581 47.443 12.113  1.00 40.93  ? 506 GLY A CA  1 
ATOM   3680 C C   . GLY A 1 506 ? 35.729 46.253 11.711  1.00 41.61  ? 506 GLY A C   1 
ATOM   3681 O O   . GLY A 1 506 ? 34.596 46.404 11.277  1.00 42.24  ? 506 GLY A O   1 
ATOM   3682 N N   . LYS A 1 507 ? 36.272 45.054 11.871  1.00 42.39  ? 507 LYS A N   1 
ATOM   3683 C CA  . LYS A 1 507 ? 35.539 43.847 11.521  1.00 44.19  ? 507 LYS A CA  1 
ATOM   3684 C C   . LYS A 1 507 ? 34.291 43.692 12.385  1.00 43.37  ? 507 LYS A C   1 
ATOM   3685 O O   . LYS A 1 507 ? 33.236 43.275 11.895  1.00 42.61  ? 507 LYS A O   1 
ATOM   3686 C CB  . LYS A 1 507 ? 36.425 42.610 11.692  1.00 46.25  ? 507 LYS A CB  1 
ATOM   3687 C CG  . LYS A 1 507 ? 35.749 41.313 11.253  1.00 48.60  ? 507 LYS A CG  1 
ATOM   3688 C CD  . LYS A 1 507 ? 36.472 40.095 11.803  1.00 53.98  ? 507 LYS A CD  1 
ATOM   3689 C CE  . LYS A 1 507 ? 35.639 38.831 11.629  1.00 55.80  ? 507 LYS A CE  1 
ATOM   3690 N NZ  . LYS A 1 507 ? 36.302 37.640 12.236  1.00 57.77  ? 507 LYS A NZ  1 
ATOM   3691 N N   . ARG A 1 508 ? 34.419 44.018 13.669  1.00 42.50  ? 508 ARG A N   1 
ATOM   3692 C CA  . ARG A 1 508 ? 33.298 43.919 14.605  1.00 41.98  ? 508 ARG A CA  1 
ATOM   3693 C C   . ARG A 1 508 ? 32.205 44.964 14.358  1.00 41.22  ? 508 ARG A C   1 
ATOM   3694 O O   . ARG A 1 508 ? 31.007 44.642 14.311  1.00 39.25  ? 508 ARG A O   1 
ATOM   3695 C CB  . ARG A 1 508 ? 33.785 44.076 16.045  1.00 42.36  ? 508 ARG A CB  1 
ATOM   3696 C CG  . ARG A 1 508 ? 34.424 42.856 16.653  1.00 44.30  ? 508 ARG A CG  1 
ATOM   3697 C CD  . ARG A 1 508 ? 34.473 43.022 18.168  1.00 47.62  ? 508 ARG A CD  1 
ATOM   3698 N NE  . ARG A 1 508 ? 35.352 44.119 18.559  1.00 50.72  ? 508 ARG A NE  1 
ATOM   3699 C CZ  . ARG A 1 508 ? 35.260 44.778 19.708  1.00 51.23  ? 508 ARG A CZ  1 
ATOM   3700 N NH1 . ARG A 1 508 ? 34.320 44.454 20.585  1.00 49.80  ? 508 ARG A NH1 1 
ATOM   3701 N NH2 . ARG A 1 508 ? 36.111 45.760 19.980  1.00 51.67  ? 508 ARG A NH2 1 
ATOM   3702 N N   . MET A 1 509 ? 32.630 46.217 14.211  1.00 39.54  ? 509 MET A N   1 
ATOM   3703 C CA  . MET A 1 509 ? 31.702 47.307 14.002  1.00 38.80  ? 509 MET A CA  1 
ATOM   3704 C C   . MET A 1 509 ? 30.989 47.177 12.666  1.00 40.49  ? 509 MET A C   1 
ATOM   3705 O O   . MET A 1 509 ? 29.821 47.576 12.537  1.00 42.31  ? 509 MET A O   1 
ATOM   3706 C CB  . MET A 1 509 ? 32.435 48.648 14.128  1.00 37.00  ? 509 MET A CB  1 
ATOM   3707 C CG  . MET A 1 509 ? 32.750 49.024 15.572  1.00 33.49  ? 509 MET A CG  1 
ATOM   3708 S SD  . MET A 1 509 ? 33.773 50.499 15.776  1.00 38.34  ? 509 MET A SD  1 
ATOM   3709 C CE  . MET A 1 509 ? 32.570 51.816 15.524  1.00 37.24  ? 509 MET A CE  1 
ATOM   3710 N N   . LEU A 1 510 ? 31.669 46.599 11.678  1.00 39.80  ? 510 LEU A N   1 
ATOM   3711 C CA  . LEU A 1 510 ? 31.060 46.420 10.362  1.00 39.17  ? 510 LEU A CA  1 
ATOM   3712 C C   . LEU A 1 510 ? 30.017 45.337 10.527  1.00 38.94  ? 510 LEU A C   1 
ATOM   3713 O O   . LEU A 1 510 ? 28.927 45.420 9.978   1.00 40.20  ? 510 LEU A O   1 
ATOM   3714 C CB  . LEU A 1 510 ? 32.107 45.988 9.325   1.00 39.15  ? 510 LEU A CB  1 
ATOM   3715 C CG  . LEU A 1 510 ? 31.796 45.870 7.815   1.00 39.36  ? 510 LEU A CG  1 
ATOM   3716 C CD1 . LEU A 1 510 ? 31.948 44.430 7.380   1.00 37.57  ? 510 LEU A CD1 1 
ATOM   3717 C CD2 . LEU A 1 510 ? 30.408 46.379 7.483   1.00 38.22  ? 510 LEU A CD2 1 
ATOM   3718 N N   . SER A 1 511 ? 30.353 44.329 11.318  1.00 38.75  ? 511 SER A N   1 
ATOM   3719 C CA  . SER A 1 511 ? 29.446 43.218 11.541  1.00 39.82  ? 511 SER A CA  1 
ATOM   3720 C C   . SER A 1 511 ? 28.220 43.633 12.327  1.00 37.96  ? 511 SER A C   1 
ATOM   3721 O O   . SER A 1 511 ? 27.135 43.088 12.131  1.00 37.26  ? 511 SER A O   1 
ATOM   3722 C CB  . SER A 1 511 ? 30.183 42.083 12.250  1.00 41.38  ? 511 SER A CB  1 
ATOM   3723 O OG  . SER A 1 511 ? 31.315 41.698 11.482  1.00 45.46  ? 511 SER A OG  1 
ATOM   3724 N N   . ALA A 1 512 ? 28.379 44.596 13.221  1.00 37.79  ? 512 ALA A N   1 
ATOM   3725 C CA  . ALA A 1 512 ? 27.226 45.054 13.984  1.00 38.51  ? 512 ALA A CA  1 
ATOM   3726 C C   . ALA A 1 512 ? 26.220 45.640 12.986  1.00 38.30  ? 512 ALA A C   1 
ATOM   3727 O O   . ALA A 1 512 ? 25.012 45.422 13.080  1.00 38.30  ? 512 ALA A O   1 
ATOM   3728 C CB  . ALA A 1 512 ? 27.650 46.111 15.000  1.00 37.89  ? 512 ALA A CB  1 
ATOM   3729 N N   . VAL A 1 513 ? 26.731 46.369 12.007  1.00 35.87  ? 513 VAL A N   1 
ATOM   3730 C CA  . VAL A 1 513 ? 25.858 46.970 11.030  1.00 34.84  ? 513 VAL A CA  1 
ATOM   3731 C C   . VAL A 1 513 ? 25.108 45.927 10.201  1.00 36.82  ? 513 VAL A C   1 
ATOM   3732 O O   . VAL A 1 513 ? 23.882 45.974 10.118  1.00 39.92  ? 513 VAL A O   1 
ATOM   3733 C CB  . VAL A 1 513 ? 26.651 47.913 10.098  1.00 32.16  ? 513 VAL A CB  1 
ATOM   3734 C CG1 . VAL A 1 513 ? 25.779 48.368 8.967   1.00 27.23  ? 513 VAL A CG1 1 
ATOM   3735 C CG2 . VAL A 1 513 ? 27.168 49.114 10.883  1.00 30.32  ? 513 VAL A CG2 1 
ATOM   3736 N N   . ILE A 1 514 ? 25.835 44.985 9.601   1.00 35.63  ? 514 ILE A N   1 
ATOM   3737 C CA  . ILE A 1 514 ? 25.227 43.964 8.748   1.00 33.86  ? 514 ILE A CA  1 
ATOM   3738 C C   . ILE A 1 514 ? 24.210 43.112 9.487   1.00 36.25  ? 514 ILE A C   1 
ATOM   3739 O O   . ILE A 1 514 ? 23.134 42.829 8.975   1.00 36.57  ? 514 ILE A O   1 
ATOM   3740 C CB  . ILE A 1 514 ? 26.281 43.029 8.166   1.00 32.94  ? 514 ILE A CB  1 
ATOM   3741 C CG1 . ILE A 1 514 ? 27.400 43.843 7.508   1.00 31.84  ? 514 ILE A CG1 1 
ATOM   3742 C CG2 . ILE A 1 514 ? 25.620 42.076 7.174   1.00 31.91  ? 514 ILE A CG2 1 
ATOM   3743 C CD1 . ILE A 1 514 ? 26.971 44.591 6.266   1.00 29.21  ? 514 ILE A CD1 1 
ATOM   3744 N N   . GLU A 1 515 ? 24.568 42.685 10.688  1.00 38.28  ? 515 GLU A N   1 
ATOM   3745 C CA  . GLU A 1 515 ? 23.673 41.882 11.493  1.00 40.00  ? 515 GLU A CA  1 
ATOM   3746 C C   . GLU A 1 515 ? 22.402 42.672 11.764  1.00 40.53  ? 515 GLU A C   1 
ATOM   3747 O O   . GLU A 1 515 ? 21.293 42.138 11.686  1.00 42.05  ? 515 GLU A O   1 
ATOM   3748 C CB  . GLU A 1 515 ? 24.336 41.517 12.824  1.00 43.75  ? 515 GLU A CB  1 
ATOM   3749 C CG  . GLU A 1 515 ? 25.051 40.193 12.815  1.00 46.07  ? 515 GLU A CG  1 
ATOM   3750 C CD  . GLU A 1 515 ? 24.207 39.123 12.165  1.00 50.45  ? 515 GLU A CD  1 
ATOM   3751 O OE1 . GLU A 1 515 ? 23.352 38.525 12.872  1.00 50.28  ? 515 GLU A OE1 1 
ATOM   3752 O OE2 . GLU A 1 515 ? 24.391 38.907 10.940  1.00 50.35  ? 515 GLU A OE2 1 
ATOM   3753 N N   . PHE A 1 516 ? 22.569 43.950 12.086  1.00 38.68  ? 516 PHE A N   1 
ATOM   3754 C CA  . PHE A 1 516 ? 21.428 44.800 12.381  1.00 36.63  ? 516 PHE A CA  1 
ATOM   3755 C C   . PHE A 1 516 ? 20.527 44.922 11.176  1.00 37.46  ? 516 PHE A C   1 
ATOM   3756 O O   . PHE A 1 516 ? 19.310 44.787 11.273  1.00 37.73  ? 516 PHE A O   1 
ATOM   3757 C CB  . PHE A 1 516 ? 21.881 46.188 12.788  1.00 33.06  ? 516 PHE A CB  1 
ATOM   3758 C CG  . PHE A 1 516 ? 20.758 47.146 12.959  1.00 30.09  ? 516 PHE A CG  1 
ATOM   3759 C CD1 . PHE A 1 516 ? 19.857 46.999 14.001  1.00 31.19  ? 516 PHE A CD1 1 
ATOM   3760 C CD2 . PHE A 1 516 ? 20.588 48.192 12.075  1.00 30.25  ? 516 PHE A CD2 1 
ATOM   3761 C CE1 . PHE A 1 516 ? 18.807 47.889 14.157  1.00 26.71  ? 516 PHE A CE1 1 
ATOM   3762 C CE2 . PHE A 1 516 ? 19.541 49.082 12.226  1.00 28.45  ? 516 PHE A CE2 1 
ATOM   3763 C CZ  . PHE A 1 516 ? 18.653 48.926 13.269  1.00 27.52  ? 516 PHE A CZ  1 
ATOM   3764 N N   . ALA A 1 517 ? 21.133 45.188 10.032  1.00 38.35  ? 517 ALA A N   1 
ATOM   3765 C CA  . ALA A 1 517 ? 20.369 45.340 8.812   1.00 39.91  ? 517 ALA A CA  1 
ATOM   3766 C C   . ALA A 1 517 ? 19.671 44.031 8.468   1.00 41.99  ? 517 ALA A C   1 
ATOM   3767 O O   . ALA A 1 517 ? 18.600 44.032 7.859   1.00 44.33  ? 517 ALA A O   1 
ATOM   3768 C CB  . ALA A 1 517 ? 21.290 45.769 7.670   1.00 37.41  ? 517 ALA A CB  1 
ATOM   3769 N N   . LYS A 1 518 ? 20.265 42.915 8.882   1.00 41.54  ? 518 LYS A N   1 
ATOM   3770 C CA  . LYS A 1 518 ? 19.709 41.609 8.575   1.00 40.38  ? 518 LYS A CA  1 
ATOM   3771 C C   . LYS A 1 518 ? 18.675 41.082 9.543   1.00 40.32  ? 518 LYS A C   1 
ATOM   3772 O O   . LYS A 1 518 ? 17.736 40.400 9.141   1.00 41.96  ? 518 LYS A O   1 
ATOM   3773 C CB  . LYS A 1 518 ? 20.836 40.581 8.444   1.00 39.00  ? 518 LYS A CB  1 
ATOM   3774 C CG  . LYS A 1 518 ? 21.583 40.669 7.128   1.00 38.23  ? 518 LYS A CG  1 
ATOM   3775 C CD  . LYS A 1 518 ? 22.720 39.656 7.031   1.00 37.50  ? 518 LYS A CD  1 
ATOM   3776 C CE  . LYS A 1 518 ? 23.398 39.740 5.674   1.00 39.26  ? 518 LYS A CE  1 
ATOM   3777 N NZ  . LYS A 1 518 ? 24.651 38.949 5.582   1.00 39.93  ? 518 LYS A NZ  1 
ATOM   3778 N N   . THR A 1 519 ? 18.829 41.406 10.815  1.00 40.60  ? 519 THR A N   1 
ATOM   3779 C CA  . THR A 1 519 ? 17.908 40.890 11.815  1.00 40.59  ? 519 THR A CA  1 
ATOM   3780 C C   . THR A 1 519 ? 17.326 41.952 12.721  1.00 43.10  ? 519 THR A C   1 
ATOM   3781 O O   . THR A 1 519 ? 16.579 41.632 13.643  1.00 44.83  ? 519 THR A O   1 
ATOM   3782 C CB  . THR A 1 519 ? 18.620 39.907 12.726  1.00 39.16  ? 519 THR A CB  1 
ATOM   3783 O OG1 . THR A 1 519 ? 19.291 40.642 13.755  1.00 40.41  ? 519 THR A OG1 1 
ATOM   3784 C CG2 . THR A 1 519 ? 19.662 39.107 11.945  1.00 35.82  ? 519 THR A CG2 1 
ATOM   3785 N N   . GLY A 1 520 ? 17.670 43.209 12.472  1.00 44.64  ? 520 GLY A N   1 
ATOM   3786 C CA  . GLY A 1 520 ? 17.181 44.274 13.325  1.00 45.44  ? 520 GLY A CA  1 
ATOM   3787 C C   . GLY A 1 520 ? 17.839 44.142 14.686  1.00 45.64  ? 520 GLY A C   1 
ATOM   3788 O O   . GLY A 1 520 ? 17.337 44.656 15.681  1.00 44.53  ? 520 GLY A O   1 
ATOM   3789 N N   . ASN A 1 521 ? 18.969 43.441 14.721  1.00 48.21  ? 521 ASN A N   1 
ATOM   3790 C CA  . ASN A 1 521 ? 19.708 43.219 15.961  1.00 50.75  ? 521 ASN A CA  1 
ATOM   3791 C C   . ASN A 1 521 ? 21.222 43.144 15.709  1.00 52.35  ? 521 ASN A C   1 
ATOM   3792 O O   . ASN A 1 521 ? 21.718 42.182 15.104  1.00 51.96  ? 521 ASN A O   1 
ATOM   3793 C CB  . ASN A 1 521 ? 19.231 41.930 16.617  1.00 51.72  ? 521 ASN A CB  1 
ATOM   3794 C CG  . ASN A 1 521 ? 19.611 41.850 18.071  1.00 54.94  ? 521 ASN A CG  1 
ATOM   3795 O OD1 . ASN A 1 521 ? 20.784 41.942 18.425  1.00 57.52  ? 521 ASN A OD1 1 
ATOM   3796 N ND2 . ASN A 1 521 ? 18.616 41.681 18.930  1.00 57.31  ? 521 ASN A ND2 1 
ATOM   3797 N N   . PRO A 1 522 ? 21.974 44.152 16.195  1.00 52.17  ? 522 PRO A N   1 
ATOM   3798 C CA  . PRO A 1 522 ? 23.428 44.263 16.050  1.00 53.14  ? 522 PRO A CA  1 
ATOM   3799 C C   . PRO A 1 522 ? 24.152 43.089 16.680  1.00 55.46  ? 522 PRO A C   1 
ATOM   3800 O O   . PRO A 1 522 ? 25.202 42.653 16.217  1.00 53.66  ? 522 PRO A O   1 
ATOM   3801 C CB  . PRO A 1 522 ? 23.735 45.567 16.771  1.00 52.14  ? 522 PRO A CB  1 
ATOM   3802 C CG  . PRO A 1 522 ? 22.761 45.529 17.902  1.00 50.75  ? 522 PRO A CG  1 
ATOM   3803 C CD  . PRO A 1 522 ? 21.488 45.112 17.205  1.00 51.51  ? 522 PRO A CD  1 
ATOM   3804 N N   . ALA A 1 523 ? 23.568 42.580 17.751  1.00 61.06  ? 523 ALA A N   1 
ATOM   3805 C CA  . ALA A 1 523 ? 24.153 41.472 18.478  1.00 66.87  ? 523 ALA A CA  1 
ATOM   3806 C C   . ALA A 1 523 ? 24.024 40.142 17.765  1.00 70.99  ? 523 ALA A C   1 
ATOM   3807 O O   . ALA A 1 523 ? 22.950 39.764 17.277  1.00 70.91  ? 523 ALA A O   1 
ATOM   3808 C CB  . ALA A 1 523 ? 23.528 41.371 19.876  1.00 65.96  ? 523 ALA A CB  1 
ATOM   3809 N N   . GLN A 1 524 ? 25.149 39.445 17.695  1.00 75.84  ? 524 GLN A N   1 
ATOM   3810 C CA  . GLN A 1 524 ? 25.192 38.115 17.114  1.00 80.78  ? 524 GLN A CA  1 
ATOM   3811 C C   . GLN A 1 524 ? 25.226 37.191 18.342  1.00 82.31  ? 524 GLN A C   1 
ATOM   3812 O O   . GLN A 1 524 ? 25.102 37.656 19.484  1.00 83.52  ? 524 GLN A O   1 
ATOM   3813 C CB  . GLN A 1 524 ? 26.451 37.937 16.243  1.00 82.36  ? 524 GLN A CB  1 
ATOM   3814 C CG  . GLN A 1 524 ? 27.501 39.030 16.405  1.00 84.44  ? 524 GLN A CG  1 
ATOM   3815 C CD  . GLN A 1 524 ? 28.094 39.053 17.793  1.00 85.45  ? 524 GLN A CD  1 
ATOM   3816 O OE1 . GLN A 1 524 ? 27.379 38.900 18.776  1.00 86.87  ? 524 GLN A OE1 1 
ATOM   3817 N NE2 . GLN A 1 524 ? 29.403 39.255 17.883  1.00 86.29  ? 524 GLN A NE2 1 
ATOM   3818 N N   . ASP A 1 525 ? 25.390 35.895 18.117  1.00 82.74  ? 525 ASP A N   1 
ATOM   3819 C CA  . ASP A 1 525 ? 25.432 34.928 19.212  1.00 81.91  ? 525 ASP A CA  1 
ATOM   3820 C C   . ASP A 1 525 ? 26.788 34.900 19.921  1.00 78.83  ? 525 ASP A C   1 
ATOM   3821 O O   . ASP A 1 525 ? 27.825 35.215 19.324  1.00 77.97  ? 525 ASP A O   1 
ATOM   3822 C CB  . ASP A 1 525 ? 25.121 33.546 18.659  1.00 85.70  ? 525 ASP A CB  1 
ATOM   3823 C CG  . ASP A 1 525 ? 25.894 33.260 17.394  1.00 89.37  ? 525 ASP A CG  1 
ATOM   3824 O OD1 . ASP A 1 525 ? 27.145 33.314 17.444  1.00 91.32  ? 525 ASP A OD1 1 
ATOM   3825 O OD2 . ASP A 1 525 ? 25.254 32.999 16.350  1.00 91.71  ? 525 ASP A OD2 1 
ATOM   3826 N N   . GLY A 1 526 ? 26.769 34.507 21.192  1.00 74.52  ? 526 GLY A N   1 
ATOM   3827 C CA  . GLY A 1 526 ? 27.993 34.444 21.964  1.00 70.71  ? 526 GLY A CA  1 
ATOM   3828 C C   . GLY A 1 526 ? 28.280 35.803 22.558  1.00 69.02  ? 526 GLY A C   1 
ATOM   3829 O O   . GLY A 1 526 ? 28.930 35.921 23.598  1.00 69.68  ? 526 GLY A O   1 
ATOM   3830 N N   . GLU A 1 527 ? 27.797 36.838 21.877  1.00 66.04  ? 527 GLU A N   1 
ATOM   3831 C CA  . GLU A 1 527 ? 27.973 38.206 22.333  1.00 62.57  ? 527 GLU A CA  1 
ATOM   3832 C C   . GLU A 1 527 ? 26.667 38.657 22.943  1.00 58.28  ? 527 GLU A C   1 
ATOM   3833 O O   . GLU A 1 527 ? 25.598 38.473 22.365  1.00 57.48  ? 527 GLU A O   1 
ATOM   3834 C CB  . GLU A 1 527 ? 28.333 39.133 21.174  1.00 64.74  ? 527 GLU A CB  1 
ATOM   3835 C CG  . GLU A 1 527 ? 28.184 40.616 21.491  1.00 69.19  ? 527 GLU A CG  1 
ATOM   3836 C CD  . GLU A 1 527 ? 28.047 41.486 20.241  1.00 71.07  ? 527 GLU A CD  1 
ATOM   3837 O OE1 . GLU A 1 527 ? 26.999 41.413 19.561  1.00 71.34  ? 527 GLU A OE1 1 
ATOM   3838 O OE2 . GLU A 1 527 ? 28.992 42.244 19.935  1.00 72.77  ? 527 GLU A OE2 1 
ATOM   3839 N N   . GLU A 1 528 ? 26.763 39.235 24.128  1.00 53.94  ? 528 GLU A N   1 
ATOM   3840 C CA  . GLU A 1 528 ? 25.593 39.728 24.814  1.00 50.29  ? 528 GLU A CA  1 
ATOM   3841 C C   . GLU A 1 528 ? 25.498 41.239 24.643  1.00 48.23  ? 528 GLU A C   1 
ATOM   3842 O O   . GLU A 1 528 ? 26.412 41.978 25.024  1.00 49.44  ? 528 GLU A O   1 
ATOM   3843 C CB  . GLU A 1 528 ? 25.670 39.389 26.304  1.00 50.90  ? 528 GLU A CB  1 
ATOM   3844 C CG  . GLU A 1 528 ? 24.961 38.106 26.699  1.00 53.04  ? 528 GLU A CG  1 
ATOM   3845 C CD  . GLU A 1 528 ? 23.475 38.135 26.388  1.00 53.63  ? 528 GLU A CD  1 
ATOM   3846 O OE1 . GLU A 1 528 ? 22.809 39.135 26.725  1.00 54.65  ? 528 GLU A OE1 1 
ATOM   3847 O OE2 . GLU A 1 528 ? 22.965 37.153 25.815  1.00 55.45  ? 528 GLU A OE2 1 
ATOM   3848 N N   . TRP A 1 529 ? 24.402 41.696 24.053  1.00 41.60  ? 529 TRP A N   1 
ATOM   3849 C CA  . TRP A 1 529 ? 24.189 43.117 23.876  1.00 38.57  ? 529 TRP A CA  1 
ATOM   3850 C C   . TRP A 1 529 ? 22.696 43.383 24.054  1.00 39.22  ? 529 TRP A C   1 
ATOM   3851 O O   . TRP A 1 529 ? 21.942 43.473 23.082  1.00 40.22  ? 529 TRP A O   1 
ATOM   3852 C CB  . TRP A 1 529 ? 24.668 43.561 22.495  1.00 35.59  ? 529 TRP A CB  1 
ATOM   3853 C CG  . TRP A 1 529 ? 24.611 45.052 22.275  1.00 33.92  ? 529 TRP A CG  1 
ATOM   3854 C CD1 . TRP A 1 529 ? 23.954 45.968 23.045  1.00 32.04  ? 529 TRP A CD1 1 
ATOM   3855 C CD2 . TRP A 1 529 ? 25.131 45.776 21.150  1.00 32.77  ? 529 TRP A CD2 1 
ATOM   3856 N NE1 . TRP A 1 529 ? 24.019 47.208 22.467  1.00 34.28  ? 529 TRP A NE1 1 
ATOM   3857 C CE2 . TRP A 1 529 ? 24.733 47.122 21.302  1.00 31.81  ? 529 TRP A CE2 1 
ATOM   3858 C CE3 . TRP A 1 529 ? 25.886 45.417 20.029  1.00 31.35  ? 529 TRP A CE3 1 
ATOM   3859 C CZ2 . TRP A 1 529 ? 25.065 48.108 20.381  1.00 30.47  ? 529 TRP A CZ2 1 
ATOM   3860 C CZ3 . TRP A 1 529 ? 26.219 46.396 19.114  1.00 32.77  ? 529 TRP A CZ3 1 
ATOM   3861 C CH2 . TRP A 1 529 ? 25.806 47.730 19.295  1.00 33.33  ? 529 TRP A CH2 1 
ATOM   3862 N N   . PRO A 1 530 ? 22.255 43.522 25.314  1.00 39.27  ? 530 PRO A N   1 
ATOM   3863 C CA  . PRO A 1 530 ? 20.875 43.774 25.744  1.00 39.22  ? 530 PRO A CA  1 
ATOM   3864 C C   . PRO A 1 530 ? 20.263 45.048 25.191  1.00 39.82  ? 530 PRO A C   1 
ATOM   3865 O O   . PRO A 1 530 ? 20.963 46.015 24.886  1.00 40.10  ? 530 PRO A O   1 
ATOM   3866 C CB  . PRO A 1 530 ? 20.987 43.841 27.266  1.00 37.81  ? 530 PRO A CB  1 
ATOM   3867 C CG  . PRO A 1 530 ? 22.206 43.076 27.572  1.00 38.00  ? 530 PRO A CG  1 
ATOM   3868 C CD  . PRO A 1 530 ? 23.146 43.491 26.483  1.00 40.03  ? 530 PRO A CD  1 
ATOM   3869 N N   . ASN A 1 531 ? 18.942 45.042 25.082  1.00 40.89  ? 531 ASN A N   1 
ATOM   3870 C CA  . ASN A 1 531 ? 18.214 46.201 24.591  1.00 40.34  ? 531 ASN A CA  1 
ATOM   3871 C C   . ASN A 1 531 ? 18.419 47.375 25.524  1.00 38.37  ? 531 ASN A C   1 
ATOM   3872 O O   . ASN A 1 531 ? 18.732 47.206 26.698  1.00 39.54  ? 531 ASN A O   1 
ATOM   3873 C CB  . ASN A 1 531 ? 16.724 45.887 24.500  1.00 39.91  ? 531 ASN A CB  1 
ATOM   3874 C CG  . ASN A 1 531 ? 16.311 45.459 23.115  1.00 42.89  ? 531 ASN A CG  1 
ATOM   3875 O OD1 . ASN A 1 531 ? 15.857 46.276 22.307  1.00 46.77  ? 531 ASN A OD1 1 
ATOM   3876 N ND2 . ASN A 1 531 ? 16.484 44.180 22.819  1.00 42.27  ? 531 ASN A ND2 1 
ATOM   3877 N N   . PHE A 1 532 ? 18.248 48.573 24.991  1.00 36.93  ? 532 PHE A N   1 
ATOM   3878 C CA  . PHE A 1 532 ? 18.387 49.773 25.793  1.00 35.80  ? 532 PHE A CA  1 
ATOM   3879 C C   . PHE A 1 532 ? 16.997 50.329 26.065  1.00 35.42  ? 532 PHE A C   1 
ATOM   3880 O O   . PHE A 1 532 ? 16.168 50.390 25.165  1.00 34.63  ? 532 PHE A O   1 
ATOM   3881 C CB  . PHE A 1 532 ? 19.241 50.813 25.051  1.00 32.57  ? 532 PHE A CB  1 
ATOM   3882 C CG  . PHE A 1 532 ? 19.222 52.180 25.680  1.00 29.09  ? 532 PHE A CG  1 
ATOM   3883 C CD1 . PHE A 1 532 ? 18.141 53.038 25.484  1.00 27.01  ? 532 PHE A CD1 1 
ATOM   3884 C CD2 . PHE A 1 532 ? 20.284 52.614 26.462  1.00 26.75  ? 532 PHE A CD2 1 
ATOM   3885 C CE1 . PHE A 1 532 ? 18.117 54.315 26.057  1.00 28.10  ? 532 PHE A CE1 1 
ATOM   3886 C CE2 . PHE A 1 532 ? 20.269 53.888 27.036  1.00 28.29  ? 532 PHE A CE2 1 
ATOM   3887 C CZ  . PHE A 1 532 ? 19.179 54.742 26.831  1.00 25.63  ? 532 PHE A CZ  1 
ATOM   3888 N N   . SER A 1 533 ? 16.747 50.720 27.311  1.00 37.09  ? 533 SER A N   1 
ATOM   3889 C CA  . SER A 1 533 ? 15.463 51.296 27.715  1.00 39.39  ? 533 SER A CA  1 
ATOM   3890 C C   . SER A 1 533 ? 15.764 52.208 28.892  1.00 41.36  ? 533 SER A C   1 
ATOM   3891 O O   . SER A 1 533 ? 16.844 52.120 29.477  1.00 39.97  ? 533 SER A O   1 
ATOM   3892 C CB  . SER A 1 533 ? 14.491 50.209 28.175  1.00 39.12  ? 533 SER A CB  1 
ATOM   3893 O OG  . SER A 1 533 ? 14.745 49.853 29.527  1.00 39.12  ? 533 SER A OG  1 
ATOM   3894 N N   . LYS A 1 534 ? 14.823 53.079 29.245  1.00 44.10  ? 534 LYS A N   1 
ATOM   3895 C CA  . LYS A 1 534 ? 15.035 53.977 30.376  1.00 46.62  ? 534 LYS A CA  1 
ATOM   3896 C C   . LYS A 1 534 ? 15.289 53.144 31.632  1.00 47.54  ? 534 LYS A C   1 
ATOM   3897 O O   . LYS A 1 534 ? 16.147 53.476 32.450  1.00 45.66  ? 534 LYS A O   1 
ATOM   3898 C CB  . LYS A 1 534 ? 13.807 54.862 30.598  1.00 48.56  ? 534 LYS A CB  1 
ATOM   3899 C CG  . LYS A 1 534 ? 13.938 55.780 31.805  1.00 51.73  ? 534 LYS A CG  1 
ATOM   3900 C CD  . LYS A 1 534 ? 12.591 56.340 32.275  1.00 55.28  ? 534 LYS A CD  1 
ATOM   3901 C CE  . LYS A 1 534 ? 12.151 57.576 31.497  1.00 56.81  ? 534 LYS A CE  1 
ATOM   3902 N NZ  . LYS A 1 534 ? 11.854 57.290 30.067  1.00 60.89  ? 534 LYS A NZ  1 
ATOM   3903 N N   . GLU A 1 535 ? 14.534 52.056 31.769  1.00 49.67  ? 535 GLU A N   1 
ATOM   3904 C CA  . GLU A 1 535 ? 14.640 51.157 32.922  1.00 51.97  ? 535 GLU A CA  1 
ATOM   3905 C C   . GLU A 1 535 ? 16.059 50.629 33.094  1.00 50.90  ? 535 GLU A C   1 
ATOM   3906 O O   . GLU A 1 535 ? 16.641 50.730 34.173  1.00 52.12  ? 535 GLU A O   1 
ATOM   3907 C CB  . GLU A 1 535 ? 13.662 49.980 32.769  1.00 54.84  ? 535 GLU A CB  1 
ATOM   3908 C CG  . GLU A 1 535 ? 12.180 50.391 32.669  1.00 60.06  ? 535 GLU A CG  1 
ATOM   3909 C CD  . GLU A 1 535 ? 11.895 51.316 31.488  1.00 62.26  ? 535 GLU A CD  1 
ATOM   3910 O OE1 . GLU A 1 535 ? 12.198 50.927 30.339  1.00 64.42  ? 535 GLU A OE1 1 
ATOM   3911 O OE2 . GLU A 1 535 ? 11.371 52.433 31.709  1.00 63.28  ? 535 GLU A OE2 1 
ATOM   3912 N N   . ASP A 1 536 ? 16.605 50.072 32.016  1.00 47.97  ? 536 ASP A N   1 
ATOM   3913 C CA  . ASP A 1 536 ? 17.953 49.520 32.004  1.00 44.19  ? 536 ASP A CA  1 
ATOM   3914 C C   . ASP A 1 536 ? 18.668 50.102 30.785  1.00 42.73  ? 536 ASP A C   1 
ATOM   3915 O O   . ASP A 1 536 ? 18.618 49.541 29.702  1.00 46.44  ? 536 ASP A O   1 
ATOM   3916 C CB  . ASP A 1 536 ? 17.858 47.994 31.915  1.00 41.45  ? 536 ASP A CB  1 
ATOM   3917 C CG  . ASP A 1 536 ? 19.202 47.326 31.784  1.00 39.50  ? 536 ASP A CG  1 
ATOM   3918 O OD1 . ASP A 1 536 ? 20.147 47.770 32.450  1.00 38.24  ? 536 ASP A OD1 1 
ATOM   3919 O OD2 . ASP A 1 536 ? 19.311 46.341 31.027  1.00 40.14  ? 536 ASP A OD2 1 
ATOM   3920 N N   . PRO A 1 537 ? 19.342 51.244 30.950  1.00 41.30  ? 537 PRO A N   1 
ATOM   3921 C CA  . PRO A 1 537 ? 20.049 51.885 29.838  1.00 40.55  ? 537 PRO A CA  1 
ATOM   3922 C C   . PRO A 1 537 ? 21.436 51.333 29.534  1.00 39.75  ? 537 PRO A C   1 
ATOM   3923 O O   . PRO A 1 537 ? 22.431 52.026 29.709  1.00 40.69  ? 537 PRO A O   1 
ATOM   3924 C CB  . PRO A 1 537 ? 20.107 53.341 30.281  1.00 40.37  ? 537 PRO A CB  1 
ATOM   3925 C CG  . PRO A 1 537 ? 20.371 53.196 31.752  1.00 40.50  ? 537 PRO A CG  1 
ATOM   3926 C CD  . PRO A 1 537 ? 19.422 52.071 32.168  1.00 41.27  ? 537 PRO A CD  1 
ATOM   3927 N N   . VAL A 1 538 ? 21.501 50.094 29.066  1.00 40.07  ? 538 VAL A N   1 
ATOM   3928 C CA  . VAL A 1 538 ? 22.779 49.475 28.745  1.00 38.94  ? 538 VAL A CA  1 
ATOM   3929 C C   . VAL A 1 538 ? 23.263 49.904 27.374  1.00 38.47  ? 538 VAL A C   1 
ATOM   3930 O O   . VAL A 1 538 ? 22.472 50.071 26.443  1.00 38.71  ? 538 VAL A O   1 
ATOM   3931 C CB  . VAL A 1 538 ? 22.687 47.933 28.660  1.00 40.24  ? 538 VAL A CB  1 
ATOM   3932 C CG1 . VAL A 1 538 ? 23.789 47.311 29.441  1.00 38.91  ? 538 VAL A CG1 1 
ATOM   3933 C CG2 . VAL A 1 538 ? 21.327 47.444 29.095  1.00 40.22  ? 538 VAL A CG2 1 
ATOM   3934 N N   . TYR A 1 539 ? 24.573 50.052 27.247  1.00 38.88  ? 539 TYR A N   1 
ATOM   3935 C CA  . TYR A 1 539 ? 25.179 50.391 25.966  1.00 37.62  ? 539 TYR A CA  1 
ATOM   3936 C C   . TYR A 1 539 ? 26.465 49.583 25.769  1.00 36.63  ? 539 TYR A C   1 
ATOM   3937 O O   . TYR A 1 539 ? 27.179 49.288 26.726  1.00 36.13  ? 539 TYR A O   1 
ATOM   3938 C CB  . TYR A 1 539 ? 25.455 51.892 25.876  1.00 35.63  ? 539 TYR A CB  1 
ATOM   3939 C CG  . TYR A 1 539 ? 26.272 52.484 27.008  1.00 34.99  ? 539 TYR A CG  1 
ATOM   3940 C CD1 . TYR A 1 539 ? 25.653 52.938 28.169  1.00 33.60  ? 539 TYR A CD1 1 
ATOM   3941 C CD2 . TYR A 1 539 ? 27.651 52.683 26.876  1.00 33.93  ? 539 TYR A CD2 1 
ATOM   3942 C CE1 . TYR A 1 539 ? 26.381 53.592 29.165  1.00 30.97  ? 539 TYR A CE1 1 
ATOM   3943 C CE2 . TYR A 1 539 ? 28.382 53.328 27.867  1.00 31.90  ? 539 TYR A CE2 1 
ATOM   3944 C CZ  . TYR A 1 539 ? 27.743 53.778 29.009  1.00 30.30  ? 539 TYR A CZ  1 
ATOM   3945 O OH  . TYR A 1 539 ? 28.478 54.375 30.009  1.00 29.93  ? 539 TYR A OH  1 
ATOM   3946 N N   . TYR A 1 540 ? 26.739 49.215 24.524  1.00 37.02  ? 540 TYR A N   1 
ATOM   3947 C CA  . TYR A 1 540 ? 27.926 48.440 24.173  1.00 35.88  ? 540 TYR A CA  1 
ATOM   3948 C C   . TYR A 1 540 ? 29.071 49.403 23.878  1.00 35.59  ? 540 TYR A C   1 
ATOM   3949 O O   . TYR A 1 540 ? 28.909 50.331 23.085  1.00 35.66  ? 540 TYR A O   1 
ATOM   3950 C CB  . TYR A 1 540 ? 27.619 47.606 22.935  1.00 37.90  ? 540 TYR A CB  1 
ATOM   3951 C CG  . TYR A 1 540 ? 28.638 46.545 22.617  1.00 39.87  ? 540 TYR A CG  1 
ATOM   3952 C CD1 . TYR A 1 540 ? 28.598 45.306 23.234  1.00 39.34  ? 540 TYR A CD1 1 
ATOM   3953 C CD2 . TYR A 1 540 ? 29.640 46.780 21.679  1.00 41.68  ? 540 TYR A CD2 1 
ATOM   3954 C CE1 . TYR A 1 540 ? 29.529 44.326 22.917  1.00 41.02  ? 540 TYR A CE1 1 
ATOM   3955 C CE2 . TYR A 1 540 ? 30.571 45.812 21.359  1.00 39.83  ? 540 TYR A CE2 1 
ATOM   3956 C CZ  . TYR A 1 540 ? 30.511 44.591 21.973  1.00 40.66  ? 540 TYR A CZ  1 
ATOM   3957 O OH  . TYR A 1 540 ? 31.417 43.622 21.614  1.00 44.27  ? 540 TYR A OH  1 
ATOM   3958 N N   . ILE A 1 541 ? 30.214 49.198 24.529  1.00 35.68  ? 541 ILE A N   1 
ATOM   3959 C CA  . ILE A 1 541 ? 31.393 50.054 24.334  1.00 35.89  ? 541 ILE A CA  1 
ATOM   3960 C C   . ILE A 1 541 ? 32.227 49.481 23.208  1.00 37.97  ? 541 ILE A C   1 
ATOM   3961 O O   . ILE A 1 541 ? 32.612 48.313 23.265  1.00 40.17  ? 541 ILE A O   1 
ATOM   3962 C CB  . ILE A 1 541 ? 32.344 50.068 25.562  1.00 35.28  ? 541 ILE A CB  1 
ATOM   3963 C CG1 . ILE A 1 541 ? 31.572 50.347 26.854  1.00 33.76  ? 541 ILE A CG1 1 
ATOM   3964 C CG2 . ILE A 1 541 ? 33.450 51.085 25.343  1.00 30.10  ? 541 ILE A CG2 1 
ATOM   3965 C CD1 . ILE A 1 541 ? 30.813 51.611 26.843  1.00 37.56  ? 541 ILE A CD1 1 
ATOM   3966 N N   . PHE A 1 542 ? 32.513 50.284 22.188  1.00 37.01  ? 542 PHE A N   1 
ATOM   3967 C CA  . PHE A 1 542 ? 33.350 49.811 21.091  1.00 37.02  ? 542 PHE A CA  1 
ATOM   3968 C C   . PHE A 1 542 ? 34.749 50.350 21.367  1.00 38.40  ? 542 PHE A C   1 
ATOM   3969 O O   . PHE A 1 542 ? 34.971 51.565 21.394  1.00 39.64  ? 542 PHE A O   1 
ATOM   3970 C CB  . PHE A 1 542 ? 32.809 50.308 19.749  1.00 35.60  ? 542 PHE A CB  1 
ATOM   3971 C CG  . PHE A 1 542 ? 31.760 49.405 19.145  1.00 32.70  ? 542 PHE A CG  1 
ATOM   3972 C CD1 . PHE A 1 542 ? 32.023 48.047 18.953  1.00 30.86  ? 542 PHE A CD1 1 
ATOM   3973 C CD2 . PHE A 1 542 ? 30.526 49.918 18.732  1.00 30.85  ? 542 PHE A CD2 1 
ATOM   3974 C CE1 . PHE A 1 542 ? 31.079 47.211 18.354  1.00 30.12  ? 542 PHE A CE1 1 
ATOM   3975 C CE2 . PHE A 1 542 ? 29.566 49.094 18.132  1.00 31.12  ? 542 PHE A CE2 1 
ATOM   3976 C CZ  . PHE A 1 542 ? 29.843 47.737 17.939  1.00 32.30  ? 542 PHE A CZ  1 
ATOM   3977 N N   . SER A 1 543 ? 35.686 49.435 21.590  1.00 38.72  ? 543 SER A N   1 
ATOM   3978 C CA  . SER A 1 543 ? 37.058 49.798 21.926  1.00 39.97  ? 543 SER A CA  1 
ATOM   3979 C C   . SER A 1 543 ? 38.052 48.685 21.554  1.00 40.01  ? 543 SER A C   1 
ATOM   3980 O O   . SER A 1 543 ? 37.652 47.551 21.299  1.00 36.26  ? 543 SER A O   1 
ATOM   3981 C CB  . SER A 1 543 ? 37.109 50.091 23.433  1.00 39.99  ? 543 SER A CB  1 
ATOM   3982 O OG  . SER A 1 543 ? 38.421 50.267 23.924  1.00 43.78  ? 543 SER A OG  1 
ATOM   3983 N N   . THR A 1 544 ? 39.343 49.015 21.500  1.00 42.41  ? 544 THR A N   1 
ATOM   3984 C CA  . THR A 1 544 ? 40.364 48.011 21.185  1.00 45.02  ? 544 THR A CA  1 
ATOM   3985 C C   . THR A 1 544 ? 40.877 47.383 22.472  1.00 45.77  ? 544 THR A C   1 
ATOM   3986 O O   . THR A 1 544 ? 41.387 46.267 22.466  1.00 46.14  ? 544 THR A O   1 
ATOM   3987 C CB  . THR A 1 544 ? 41.565 48.608 20.442  1.00 43.59  ? 544 THR A CB  1 
ATOM   3988 O OG1 . THR A 1 544 ? 42.010 49.788 21.119  1.00 43.28  ? 544 THR A OG1 1 
ATOM   3989 C CG2 . THR A 1 544 ? 41.195 48.920 19.009  1.00 44.01  ? 544 THR A CG2 1 
ATOM   3990 N N   . ASP A 1 545 ? 40.745 48.124 23.567  1.00 46.04  ? 545 ASP A N   1 
ATOM   3991 C CA  . ASP A 1 545 ? 41.160 47.661 24.881  1.00 45.92  ? 545 ASP A CA  1 
ATOM   3992 C C   . ASP A 1 545 ? 40.213 46.529 25.284  1.00 47.89  ? 545 ASP A C   1 
ATOM   3993 O O   . ASP A 1 545 ? 39.004 46.738 25.435  1.00 49.26  ? 545 ASP A O   1 
ATOM   3994 C CB  . ASP A 1 545 ? 41.055 48.805 25.884  1.00 43.84  ? 545 ASP A CB  1 
ATOM   3995 C CG  . ASP A 1 545 ? 41.724 48.490 27.197  1.00 45.31  ? 545 ASP A CG  1 
ATOM   3996 O OD1 . ASP A 1 545 ? 42.022 47.301 27.434  1.00 44.38  ? 545 ASP A OD1 1 
ATOM   3997 O OD2 . ASP A 1 545 ? 41.942 49.430 27.992  1.00 44.01  ? 545 ASP A OD2 1 
ATOM   3998 N N   . ASP A 1 546 ? 40.758 45.329 25.451  1.00 48.66  ? 546 ASP A N   1 
ATOM   3999 C CA  . ASP A 1 546 ? 39.937 44.183 25.814  1.00 49.82  ? 546 ASP A CA  1 
ATOM   4000 C C   . ASP A 1 546 ? 39.872 43.956 27.322  1.00 48.69  ? 546 ASP A C   1 
ATOM   4001 O O   . ASP A 1 546 ? 39.360 42.942 27.784  1.00 49.63  ? 546 ASP A O   1 
ATOM   4002 C CB  . ASP A 1 546 ? 40.450 42.926 25.098  1.00 50.83  ? 546 ASP A CB  1 
ATOM   4003 C CG  . ASP A 1 546 ? 41.839 42.509 25.553  1.00 53.73  ? 546 ASP A CG  1 
ATOM   4004 O OD1 . ASP A 1 546 ? 42.538 43.323 26.196  1.00 55.85  ? 546 ASP A OD1 1 
ATOM   4005 O OD2 . ASP A 1 546 ? 42.236 41.360 25.254  1.00 53.67  ? 546 ASP A OD2 1 
ATOM   4006 N N   . LYS A 1 547 ? 40.378 44.916 28.083  1.00 47.55  ? 547 LYS A N   1 
ATOM   4007 C CA  . LYS A 1 547 ? 40.370 44.827 29.535  1.00 47.60  ? 547 LYS A CA  1 
ATOM   4008 C C   . LYS A 1 547 ? 39.121 45.466 30.138  1.00 47.84  ? 547 LYS A C   1 
ATOM   4009 O O   . LYS A 1 547 ? 38.746 45.152 31.265  1.00 48.37  ? 547 LYS A O   1 
ATOM   4010 C CB  . LYS A 1 547 ? 41.601 45.523 30.113  1.00 49.97  ? 547 LYS A CB  1 
ATOM   4011 C CG  . LYS A 1 547 ? 42.937 44.862 29.816  1.00 51.73  ? 547 LYS A CG  1 
ATOM   4012 C CD  . LYS A 1 547 ? 44.084 45.825 30.106  1.00 54.55  ? 547 LYS A CD  1 
ATOM   4013 C CE  . LYS A 1 547 ? 43.965 46.436 31.496  1.00 59.07  ? 547 LYS A CE  1 
ATOM   4014 N NZ  . LYS A 1 547 ? 44.949 47.531 31.723  1.00 64.55  ? 547 LYS A NZ  1 
ATOM   4015 N N   . ILE A 1 548 ? 38.484 46.371 29.400  1.00 47.49  ? 548 ILE A N   1 
ATOM   4016 C CA  . ILE A 1 548 ? 37.290 47.039 29.905  1.00 46.70  ? 548 ILE A CA  1 
ATOM   4017 C C   . ILE A 1 548 ? 36.056 46.161 29.779  1.00 47.57  ? 548 ILE A C   1 
ATOM   4018 O O   . ILE A 1 548 ? 36.064 45.157 29.067  1.00 46.53  ? 548 ILE A O   1 
ATOM   4019 C CB  . ILE A 1 548 ? 37.036 48.386 29.176  1.00 45.89  ? 548 ILE A CB  1 
ATOM   4020 C CG1 . ILE A 1 548 ? 36.858 48.167 27.672  1.00 47.63  ? 548 ILE A CG1 1 
ATOM   4021 C CG2 . ILE A 1 548 ? 38.182 49.336 29.430  1.00 43.54  ? 548 ILE A CG2 1 
ATOM   4022 C CD1 . ILE A 1 548 ? 35.427 48.007 27.239  1.00 46.35  ? 548 ILE A CD1 1 
ATOM   4023 N N   . GLU A 1 549 ? 35.003 46.532 30.498  1.00 48.44  ? 549 GLU A N   1 
ATOM   4024 C CA  . GLU A 1 549 ? 33.751 45.787 30.449  1.00 50.15  ? 549 GLU A CA  1 
ATOM   4025 C C   . GLU A 1 549 ? 32.974 46.310 29.223  1.00 52.16  ? 549 GLU A C   1 
ATOM   4026 O O   . GLU A 1 549 ? 32.699 47.504 29.117  1.00 50.50  ? 549 GLU A O   1 
ATOM   4027 C CB  . GLU A 1 549 ? 32.947 46.024 31.740  1.00 49.02  ? 549 GLU A CB  1 
ATOM   4028 C CG  . GLU A 1 549 ? 31.686 45.169 31.914  1.00 48.48  ? 549 GLU A CG  1 
ATOM   4029 C CD  . GLU A 1 549 ? 31.994 43.698 32.154  1.00 49.85  ? 549 GLU A CD  1 
ATOM   4030 O OE1 . GLU A 1 549 ? 32.771 43.390 33.074  1.00 48.93  ? 549 GLU A OE1 1 
ATOM   4031 O OE2 . GLU A 1 549 ? 31.457 42.842 31.427  1.00 52.66  ? 549 GLU A OE2 1 
ATOM   4032 N N   . LYS A 1 550 ? 32.627 45.415 28.306  1.00 53.05  ? 550 LYS A N   1 
ATOM   4033 C CA  . LYS A 1 550 ? 31.930 45.772 27.098  1.00 54.41  ? 550 LYS A CA  1 
ATOM   4034 C C   . LYS A 1 550 ? 30.664 46.648 27.208  1.00 53.86  ? 550 LYS A C   1 
ATOM   4035 O O   . LYS A 1 550 ? 30.462 47.564 26.366  1.00 54.04  ? 550 LYS A O   1 
ATOM   4036 C CB  . LYS A 1 550 ? 31.662 44.516 26.259  1.00 56.70  ? 550 LYS A CB  1 
ATOM   4037 C CG  . LYS A 1 550 ? 32.861 43.512 26.186  1.00 60.19  ? 550 LYS A CG  1 
ATOM   4038 C CD  . LYS A 1 550 ? 33.723 43.686 24.951  1.00 59.53  ? 550 LYS A CD  1 
ATOM   4039 C CE  . LYS A 1 550 ? 34.712 42.536 24.826  1.00 61.81  ? 550 LYS A CE  1 
ATOM   4040 N NZ  . LYS A 1 550 ? 35.521 42.617 23.562  1.00 66.50  ? 550 LYS A NZ  1 
ATOM   4041 N N   . LEU A 1 551 ? 29.799 46.427 28.194  1.00 52.39  ? 551 LEU A N   1 
ATOM   4042 C CA  . LEU A 1 551 ? 28.630 47.291 28.291  1.00 54.35  ? 551 LEU A CA  1 
ATOM   4043 C C   . LEU A 1 551 ? 28.530 47.836 29.686  1.00 53.71  ? 551 LEU A C   1 
ATOM   4044 O O   . LEU A 1 551 ? 28.772 47.127 30.637  1.00 53.16  ? 551 LEU A O   1 
ATOM   4045 C CB  . LEU A 1 551 ? 27.313 46.546 27.882  1.00 56.30  ? 551 LEU A CB  1 
ATOM   4046 C CG  . LEU A 1 551 ? 27.182 45.080 28.251  1.00 53.05  ? 551 LEU A CG  1 
ATOM   4047 C CD1 . LEU A 1 551 ? 25.933 44.478 27.692  1.00 55.00  ? 551 LEU A CD1 1 
ATOM   4048 C CD2 . LEU A 1 551 ? 28.335 44.358 27.656  1.00 55.05  ? 551 LEU A CD2 1 
ATOM   4049 N N   . ALA A 1 552 ? 28.215 49.106 29.817  1.00 53.13  ? 552 ALA A N   1 
ATOM   4050 C CA  . ALA A 1 552 ? 28.086 49.665 31.150  1.00 56.80  ? 552 ALA A CA  1 
ATOM   4051 C C   . ALA A 1 552 ? 26.994 50.695 31.058  1.00 58.15  ? 552 ALA A C   1 
ATOM   4052 O O   . ALA A 1 552 ? 26.927 51.445 30.074  1.00 62.39  ? 552 ALA A O   1 
ATOM   4053 C CB  . ALA A 1 552 ? 29.375 50.309 31.625  1.00 58.86  ? 552 ALA A CB  1 
ATOM   4054 N N   . ARG A 1 553 ? 26.106 50.762 32.077  1.00 57.15  ? 553 ARG A N   1 
ATOM   4055 C CA  . ARG A 1 553 ? 24.994 51.735 32.004  1.00 55.04  ? 553 ARG A CA  1 
ATOM   4056 C C   . ARG A 1 553 ? 25.168 53.029 32.803  1.00 53.62  ? 553 ARG A C   1 
ATOM   4057 O O   . ARG A 1 553 ? 24.540 54.052 32.483  1.00 54.16  ? 553 ARG A O   1 
ATOM   4058 C CB  . ARG A 1 553 ? 23.702 51.015 32.437  1.00 54.32  ? 553 ARG A CB  1 
ATOM   4059 C CG  . ARG A 1 553 ? 23.830 49.497 32.557  1.00 56.82  ? 553 ARG A CG  1 
ATOM   4060 C CD  . ARG A 1 553 ? 22.488 48.809 32.810  1.00 60.91  ? 553 ARG A CD  1 
ATOM   4061 N NE  . ARG A 1 553 ? 22.574 47.342 32.914  1.00 65.52  ? 553 ARG A NE  1 
ATOM   4062 C CZ  . ARG A 1 553 ? 23.582 46.591 32.460  1.00 67.02  ? 553 ARG A CZ  1 
ATOM   4063 N NH1 . ARG A 1 553 ? 24.621 47.174 31.866  1.00 69.74  ? 553 ARG A NH1 1 
ATOM   4064 N NH2 . ARG A 1 553 ? 23.560 45.272 32.587  1.00 67.60  ? 553 ARG A NH2 1 
ATOM   4065 N N   . GLY A 1 554 ? 26.000 52.996 33.817  1.00 52.02  ? 554 GLY A N   1 
ATOM   4066 C CA  . GLY A 1 554 ? 26.178 54.100 34.793  1.00 49.75  ? 554 GLY A CA  1 
ATOM   4067 C C   . GLY A 1 554 ? 26.742 55.438 34.270  1.00 48.18  ? 554 GLY A C   1 
ATOM   4068 O O   . GLY A 1 554 ? 26.115 56.501 34.418  1.00 49.81  ? 554 GLY A O   1 
ATOM   4069 N N   . PRO A 1 555 ? 27.931 55.386 33.643  1.00 48.37  ? 555 PRO A N   1 
ATOM   4070 C CA  . PRO A 1 555 ? 28.604 56.633 33.158  1.00 48.15  ? 555 PRO A CA  1 
ATOM   4071 C C   . PRO A 1 555 ? 27.731 57.585 32.340  1.00 47.36  ? 555 PRO A C   1 
ATOM   4072 O O   . PRO A 1 555 ? 27.649 58.771 32.646  1.00 46.66  ? 555 PRO A O   1 
ATOM   4073 C CB  . PRO A 1 555 ? 29.862 56.079 32.518  1.00 47.90  ? 555 PRO A CB  1 
ATOM   4074 C CG  . PRO A 1 555 ? 30.212 54.981 33.467  1.00 47.86  ? 555 PRO A CG  1 
ATOM   4075 C CD  . PRO A 1 555 ? 28.954 54.493 34.131  1.00 49.24  ? 555 PRO A CD  1 
ATOM   4076 N N   . LEU A 1 556 ? 27.085 57.031 31.308  1.00 45.54  ? 556 LEU A N   1 
ATOM   4077 C CA  . LEU A 1 556 ? 26.256 57.869 30.470  1.00 45.93  ? 556 LEU A CA  1 
ATOM   4078 C C   . LEU A 1 556 ? 25.054 58.431 31.227  1.00 45.89  ? 556 LEU A C   1 
ATOM   4079 O O   . LEU A 1 556 ? 24.688 59.600 31.061  1.00 43.16  ? 556 LEU A O   1 
ATOM   4080 C CB  . LEU A 1 556 ? 25.769 57.096 29.239  1.00 45.80  ? 556 LEU A CB  1 
ATOM   4081 C CG  . LEU A 1 556 ? 26.696 57.175 28.025  1.00 49.07  ? 556 LEU A CG  1 
ATOM   4082 C CD1 . LEU A 1 556 ? 25.937 56.848 26.748  1.00 51.22  ? 556 LEU A CD1 1 
ATOM   4083 C CD2 . LEU A 1 556 ? 27.338 58.557 27.916  1.00 48.89  ? 556 LEU A CD2 1 
ATOM   4084 N N   . ALA A 1 557 ? 24.452 57.589 32.065  1.00 45.79  ? 557 ALA A N   1 
ATOM   4085 C CA  . ALA A 1 557 ? 23.293 57.977 32.858  1.00 44.81  ? 557 ALA A CA  1 
ATOM   4086 C C   . ALA A 1 557 ? 23.634 59.170 33.730  1.00 45.32  ? 557 ALA A C   1 
ATOM   4087 O O   . ALA A 1 557 ? 22.863 60.128 33.832  1.00 45.80  ? 557 ALA A O   1 
ATOM   4088 C CB  . ALA A 1 557 ? 22.844 56.815 33.720  1.00 43.32  ? 557 ALA A CB  1 
ATOM   4089 N N   . ALA A 1 558 ? 24.798 59.108 34.361  1.00 44.94  ? 558 ALA A N   1 
ATOM   4090 C CA  . ALA A 1 558 ? 25.237 60.193 35.220  1.00 45.68  ? 558 ALA A CA  1 
ATOM   4091 C C   . ALA A 1 558 ? 25.451 61.466 34.404  1.00 45.00  ? 558 ALA A C   1 
ATOM   4092 O O   . ALA A 1 558 ? 24.930 62.529 34.748  1.00 46.63  ? 558 ALA A O   1 
ATOM   4093 C CB  . ALA A 1 558 ? 26.524 59.798 35.935  1.00 48.39  ? 558 ALA A CB  1 
ATOM   4094 N N   . ARG A 1 559 ? 26.221 61.357 33.326  1.00 44.15  ? 559 ARG A N   1 
ATOM   4095 C CA  . ARG A 1 559 ? 26.490 62.503 32.460  1.00 43.59  ? 559 ARG A CA  1 
ATOM   4096 C C   . ARG A 1 559 ? 25.212 63.213 32.041  1.00 40.51  ? 559 ARG A C   1 
ATOM   4097 O O   . ARG A 1 559 ? 25.066 64.418 32.231  1.00 39.94  ? 559 ARG A O   1 
ATOM   4098 C CB  . ARG A 1 559 ? 27.196 62.075 31.167  1.00 47.94  ? 559 ARG A CB  1 
ATOM   4099 C CG  . ARG A 1 559 ? 28.681 61.776 31.248  1.00 54.51  ? 559 ARG A CG  1 
ATOM   4100 C CD  . ARG A 1 559 ? 29.316 62.103 29.899  1.00 60.20  ? 559 ARG A CD  1 
ATOM   4101 N NE  . ARG A 1 559 ? 30.721 61.718 29.799  1.00 65.86  ? 559 ARG A NE  1 
ATOM   4102 C CZ  . ARG A 1 559 ? 31.564 62.221 28.899  1.00 67.91  ? 559 ARG A CZ  1 
ATOM   4103 N NH1 . ARG A 1 559 ? 31.135 63.132 28.035  1.00 69.40  ? 559 ARG A NH1 1 
ATOM   4104 N NH2 . ARG A 1 559 ? 32.828 61.806 28.849  1.00 67.46  ? 559 ARG A NH2 1 
ATOM   4105 N N   . CYS A 1 560 ? 24.287 62.446 31.473  1.00 38.02  ? 560 CYS A N   1 
ATOM   4106 C CA  . CYS A 1 560 ? 23.054 63.008 30.962  1.00 36.73  ? 560 CYS A CA  1 
ATOM   4107 C C   . CYS A 1 560 ? 21.911 63.313 31.895  1.00 38.07  ? 560 CYS A C   1 
ATOM   4108 O O   . CYS A 1 560 ? 21.078 64.164 31.571  1.00 38.99  ? 560 CYS A O   1 
ATOM   4109 C CB  . CYS A 1 560 ? 22.566 62.162 29.803  1.00 35.35  ? 560 CYS A CB  1 
ATOM   4110 S SG  . CYS A 1 560 ? 23.743 62.271 28.411  1.00 33.58  ? 560 CYS A SG  1 
ATOM   4111 N N   . SER A 1 561 ? 21.857 62.655 33.049  1.00 38.39  ? 561 SER A N   1 
ATOM   4112 C CA  . SER A 1 561 ? 20.781 62.929 33.996  1.00 36.73  ? 561 SER A CA  1 
ATOM   4113 C C   . SER A 1 561 ? 20.788 64.420 34.294  1.00 35.52  ? 561 SER A C   1 
ATOM   4114 O O   . SER A 1 561 ? 19.750 65.003 34.595  1.00 32.94  ? 561 SER A O   1 
ATOM   4115 C CB  . SER A 1 561 ? 20.988 62.163 35.300  1.00 38.79  ? 561 SER A CB  1 
ATOM   4116 O OG  . SER A 1 561 ? 21.870 62.863 36.162  1.00 42.16  ? 561 SER A OG  1 
ATOM   4117 N N   . PHE A 1 562 ? 21.973 65.024 34.205  1.00 33.86  ? 562 PHE A N   1 
ATOM   4118 C CA  . PHE A 1 562 ? 22.137 66.443 34.455  1.00 33.68  ? 562 PHE A CA  1 
ATOM   4119 C C   . PHE A 1 562 ? 21.394 67.285 33.430  1.00 36.21  ? 562 PHE A C   1 
ATOM   4120 O O   . PHE A 1 562 ? 20.710 68.245 33.779  1.00 35.94  ? 562 PHE A O   1 
ATOM   4121 C CB  . PHE A 1 562 ? 23.606 66.815 34.413  1.00 35.05  ? 562 PHE A CB  1 
ATOM   4122 C CG  . PHE A 1 562 ? 23.854 68.297 34.413  1.00 39.57  ? 562 PHE A CG  1 
ATOM   4123 C CD1 . PHE A 1 562 ? 23.687 69.051 35.573  1.00 40.01  ? 562 PHE A CD1 1 
ATOM   4124 C CD2 . PHE A 1 562 ? 24.242 68.949 33.244  1.00 41.75  ? 562 PHE A CD2 1 
ATOM   4125 C CE1 . PHE A 1 562 ? 23.902 70.432 35.569  1.00 40.38  ? 562 PHE A CE1 1 
ATOM   4126 C CE2 . PHE A 1 562 ? 24.460 70.332 33.232  1.00 43.18  ? 562 PHE A CE2 1 
ATOM   4127 C CZ  . PHE A 1 562 ? 24.289 71.074 34.402  1.00 41.21  ? 562 PHE A CZ  1 
ATOM   4128 N N   . TRP A 1 563 ? 21.539 66.933 32.158  1.00 38.33  ? 563 TRP A N   1 
ATOM   4129 C CA  . TRP A 1 563 ? 20.886 67.689 31.101  1.00 36.77  ? 563 TRP A CA  1 
ATOM   4130 C C   . TRP A 1 563 ? 19.430 67.316 30.919  1.00 37.85  ? 563 TRP A C   1 
ATOM   4131 O O   . TRP A 1 563 ? 18.596 68.196 30.717  1.00 40.95  ? 563 TRP A O   1 
ATOM   4132 C CB  . TRP A 1 563 ? 21.611 67.495 29.770  1.00 33.42  ? 563 TRP A CB  1 
ATOM   4133 C CG  . TRP A 1 563 ? 23.004 68.015 29.734  1.00 32.04  ? 563 TRP A CG  1 
ATOM   4134 C CD1 . TRP A 1 563 ? 24.150 67.298 29.923  1.00 32.77  ? 563 TRP A CD1 1 
ATOM   4135 C CD2 . TRP A 1 563 ? 23.411 69.369 29.486  1.00 31.66  ? 563 TRP A CD2 1 
ATOM   4136 N NE1 . TRP A 1 563 ? 25.253 68.121 29.806  1.00 34.21  ? 563 TRP A NE1 1 
ATOM   4137 C CE2 . TRP A 1 563 ? 24.827 69.397 29.540  1.00 32.16  ? 563 TRP A CE2 1 
ATOM   4138 C CE3 . TRP A 1 563 ? 22.718 70.560 29.223  1.00 31.18  ? 563 TRP A CE3 1 
ATOM   4139 C CZ2 . TRP A 1 563 ? 25.564 70.573 29.342  1.00 30.09  ? 563 TRP A CZ2 1 
ATOM   4140 C CZ3 . TRP A 1 563 ? 23.451 71.735 29.024  1.00 32.00  ? 563 TRP A CZ3 1 
ATOM   4141 C CH2 . TRP A 1 563 ? 24.861 71.729 29.086  1.00 32.35  ? 563 TRP A CH2 1 
ATOM   4142 N N   . ASN A 1 564 ? 19.130 66.023 31.002  1.00 38.07  ? 564 ASN A N   1 
ATOM   4143 C CA  . ASN A 1 564 ? 17.778 65.521 30.794  1.00 39.78  ? 564 ASN A CA  1 
ATOM   4144 C C   . ASN A 1 564 ? 16.924 65.331 32.043  1.00 41.51  ? 564 ASN A C   1 
ATOM   4145 O O   . ASN A 1 564 ? 15.921 64.636 31.987  1.00 43.39  ? 564 ASN A O   1 
ATOM   4146 C CB  . ASN A 1 564 ? 17.823 64.172 30.058  1.00 39.72  ? 564 ASN A CB  1 
ATOM   4147 C CG  . ASN A 1 564 ? 18.699 64.204 28.823  1.00 39.80  ? 564 ASN A CG  1 
ATOM   4148 O OD1 . ASN A 1 564 ? 18.747 65.210 28.100  1.00 43.30  ? 564 ASN A OD1 1 
ATOM   4149 N ND2 . ASN A 1 564 ? 19.383 63.099 28.563  1.00 38.38  ? 564 ASN A ND2 1 
ATOM   4150 N N   . ASP A 1 565 ? 17.281 65.931 33.165  1.00 43.72  ? 565 ASP A N   1 
ATOM   4151 C CA  . ASP A 1 565 ? 16.477 65.750 34.376  1.00 46.27  ? 565 ASP A CA  1 
ATOM   4152 C C   . ASP A 1 565 ? 16.559 66.970 35.301  1.00 47.84  ? 565 ASP A C   1 
ATOM   4153 O O   . ASP A 1 565 ? 15.554 67.614 35.605  1.00 48.63  ? 565 ASP A O   1 
ATOM   4154 C CB  . ASP A 1 565 ? 16.940 64.508 35.155  1.00 47.21  ? 565 ASP A CB  1 
ATOM   4155 C CG  . ASP A 1 565 ? 16.704 63.221 34.407  1.00 51.76  ? 565 ASP A CG  1 
ATOM   4156 O OD1 . ASP A 1 565 ? 15.653 63.099 33.742  1.00 51.80  ? 565 ASP A OD1 1 
ATOM   4157 O OD2 . ASP A 1 565 ? 17.552 62.291 34.501  1.00 53.12  ? 565 ASP A OD2 1 
ATOM   4158 N N   . TYR A 1 566 ? 17.775 67.276 35.742  1.00 48.06  ? 566 TYR A N   1 
ATOM   4159 C CA  . TYR A 1 566 ? 18.017 68.387 36.639  1.00 47.79  ? 566 TYR A CA  1 
ATOM   4160 C C   . TYR A 1 566 ? 17.786 69.730 35.969  1.00 47.35  ? 566 TYR A C   1 
ATOM   4161 O O   . TYR A 1 566 ? 16.837 70.424 36.295  1.00 47.61  ? 566 TYR A O   1 
ATOM   4162 C CB  . TYR A 1 566 ? 19.448 68.328 37.161  1.00 45.73  ? 566 TYR A CB  1 
ATOM   4163 C CG  . TYR A 1 566 ? 19.740 69.381 38.186  1.00 46.46  ? 566 TYR A CG  1 
ATOM   4164 C CD1 . TYR A 1 566 ? 19.059 69.396 39.400  1.00 46.12  ? 566 TYR A CD1 1 
ATOM   4165 C CD2 . TYR A 1 566 ? 20.677 70.382 37.942  1.00 45.59  ? 566 TYR A CD2 1 
ATOM   4166 C CE1 . TYR A 1 566 ? 19.299 70.382 40.348  1.00 46.05  ? 566 TYR A CE1 1 
ATOM   4167 C CE2 . TYR A 1 566 ? 20.924 71.374 38.885  1.00 47.14  ? 566 TYR A CE2 1 
ATOM   4168 C CZ  . TYR A 1 566 ? 20.232 71.371 40.087  1.00 46.19  ? 566 TYR A CZ  1 
ATOM   4169 O OH  . TYR A 1 566 ? 20.474 72.363 41.005  1.00 47.52  ? 566 TYR A OH  1 
ATOM   4170 N N   . LEU A 1 567 ? 18.655 70.081 35.025  1.00 48.33  ? 567 LEU A N   1 
ATOM   4171 C CA  . LEU A 1 567 ? 18.589 71.356 34.327  1.00 49.61  ? 567 LEU A CA  1 
ATOM   4172 C C   . LEU A 1 567 ? 17.176 71.748 33.920  1.00 52.03  ? 567 LEU A C   1 
ATOM   4173 O O   . LEU A 1 567 ? 16.817 72.929 33.990  1.00 52.35  ? 567 LEU A O   1 
ATOM   4174 C CB  . LEU A 1 567 ? 19.510 71.338 33.109  1.00 47.99  ? 567 LEU A CB  1 
ATOM   4175 C CG  . LEU A 1 567 ? 20.180 72.662 32.801  1.00 48.03  ? 567 LEU A CG  1 
ATOM   4176 C CD1 . LEU A 1 567 ? 20.784 73.212 34.076  1.00 49.13  ? 567 LEU A CD1 1 
ATOM   4177 C CD2 . LEU A 1 567 ? 21.256 72.473 31.742  1.00 48.88  ? 567 LEU A CD2 1 
ATOM   4178 N N   . PRO A 1 568 ? 16.351 70.777 33.498  1.00 53.32  ? 568 PRO A N   1 
ATOM   4179 C CA  . PRO A 1 568 ? 14.976 71.118 33.104  1.00 53.71  ? 568 PRO A CA  1 
ATOM   4180 C C   . PRO A 1 568 ? 14.212 71.826 34.244  1.00 54.98  ? 568 PRO A C   1 
ATOM   4181 O O   . PRO A 1 568 ? 13.315 72.639 33.995  1.00 54.82  ? 568 PRO A O   1 
ATOM   4182 C CB  . PRO A 1 568 ? 14.344 69.780 32.743  1.00 53.22  ? 568 PRO A CB  1 
ATOM   4183 C CG  . PRO A 1 568 ? 15.380 68.749 32.914  1.00 56.09  ? 568 PRO A CG  1 
ATOM   4184 C CD  . PRO A 1 568 ? 16.663 69.347 33.355  1.00 53.69  ? 568 PRO A CD  1 
ATOM   4185 N N   . LYS A 1 569 ? 14.580 71.508 35.485  1.00 56.15  ? 569 LYS A N   1 
ATOM   4186 C CA  . LYS A 1 569 ? 13.954 72.078 36.676  1.00 57.41  ? 569 LYS A CA  1 
ATOM   4187 C C   . LYS A 1 569 ? 14.561 73.444 36.999  1.00 59.80  ? 569 LYS A C   1 
ATOM   4188 O O   . LYS A 1 569 ? 13.862 74.360 37.443  1.00 60.90  ? 569 LYS A O   1 
ATOM   4189 C CB  . LYS A 1 569 ? 14.143 71.128 37.862  1.00 56.56  ? 569 LYS A CB  1 
ATOM   4190 C CG  . LYS A 1 569 ? 13.644 69.717 37.597  1.00 55.86  ? 569 LYS A CG  1 
ATOM   4191 C CD  . LYS A 1 569 ? 13.924 68.776 38.764  1.00 56.87  ? 569 LYS A CD  1 
ATOM   4192 C CE  . LYS A 1 569 ? 13.465 67.359 38.421  1.00 59.94  ? 569 LYS A CE  1 
ATOM   4193 N NZ  . LYS A 1 569 ? 13.499 66.410 39.570  1.00 57.35  ? 569 LYS A NZ  1 
ATOM   4194 N N   . VAL A 1 570 ? 15.869 73.575 36.798  1.00 62.05  ? 570 VAL A N   1 
ATOM   4195 C CA  . VAL A 1 570 ? 16.545 74.843 37.050  1.00 63.01  ? 570 VAL A CA  1 
ATOM   4196 C C   . VAL A 1 570 ? 15.918 75.838 36.090  1.00 66.72  ? 570 VAL A C   1 
ATOM   4197 O O   . VAL A 1 570 ? 15.719 77.007 36.417  1.00 67.51  ? 570 VAL A O   1 
ATOM   4198 C CB  . VAL A 1 570 ? 18.045 74.737 36.754  1.00 59.87  ? 570 VAL A CB  1 
ATOM   4199 C CG1 . VAL A 1 570 ? 18.671 76.127 36.672  1.00 58.28  ? 570 VAL A CG1 1 
ATOM   4200 C CG2 . VAL A 1 570 ? 18.708 73.905 37.828  1.00 58.88  ? 570 VAL A CG2 1 
ATOM   4201 N N   . ARG A 1 571 ? 15.599 75.338 34.901  1.00 70.91  ? 571 ARG A N   1 
ATOM   4202 C CA  . ARG A 1 571 ? 14.988 76.128 33.845  1.00 73.51  ? 571 ARG A CA  1 
ATOM   4203 C C   . ARG A 1 571 ? 13.815 76.892 34.451  1.00 75.86  ? 571 ARG A C   1 
ATOM   4204 O O   . ARG A 1 571 ? 13.700 78.110 34.280  1.00 75.64  ? 571 ARG A O   1 
ATOM   4205 C CB  . ARG A 1 571 ? 14.505 75.196 32.730  1.00 74.50  ? 571 ARG A CB  1 
ATOM   4206 C CG  . ARG A 1 571 ? 14.622 75.779 31.336  1.00 75.85  ? 571 ARG A CG  1 
ATOM   4207 C CD  . ARG A 1 571 ? 14.217 74.771 30.261  1.00 78.16  ? 571 ARG A CD  1 
ATOM   4208 N NE  . ARG A 1 571 ? 15.027 73.547 30.256  1.00 79.34  ? 571 ARG A NE  1 
ATOM   4209 C CZ  . ARG A 1 571 ? 16.358 73.515 30.194  1.00 79.27  ? 571 ARG A CZ  1 
ATOM   4210 N NH1 . ARG A 1 571 ? 17.050 74.642 30.141  1.00 80.12  ? 571 ARG A NH1 1 
ATOM   4211 N NH2 . ARG A 1 571 ? 17.002 72.353 30.159  1.00 78.34  ? 571 ARG A NH2 1 
ATOM   4212 N N   . SER A 1 572 ? 12.960 76.162 35.166  1.00 78.37  ? 572 SER A N   1 
ATOM   4213 C CA  . SER A 1 572 ? 11.793 76.734 35.832  1.00 81.99  ? 572 SER A CA  1 
ATOM   4214 C C   . SER A 1 572 ? 12.145 77.967 36.669  1.00 84.83  ? 572 SER A C   1 
ATOM   4215 O O   . SER A 1 572 ? 12.512 77.845 37.845  1.00 85.47  ? 572 SER A O   1 
ATOM   4216 C CB  . SER A 1 572 ? 11.155 75.687 36.734  1.00 81.42  ? 572 SER A CB  1 
ATOM   4217 O OG  . SER A 1 572 ? 10.503 76.313 37.823  1.00 83.00  ? 572 SER A OG  1 
ATOM   4218 N N   . TRP A 1 573 ? 12.024 79.144 36.052  1.00 87.87  ? 573 TRP A N   1 
ATOM   4219 C CA  . TRP A 1 573 ? 12.331 80.427 36.697  1.00 91.67  ? 573 TRP A CA  1 
ATOM   4220 C C   . TRP A 1 573 ? 13.611 80.373 37.538  1.00 92.96  ? 573 TRP A C   1 
ATOM   4221 O O   . TRP A 1 573 ? 13.595 80.923 38.673  1.00 92.91  ? 573 TRP A O   1 
ATOM   4222 C CB  . TRP A 1 573 ? 11.167 80.869 37.593  1.00 94.27  ? 573 TRP A CB  1 
ATOM   4223 C CG  . TRP A 1 573 ? 9.867  81.085 36.861  1.00 99.03  ? 573 TRP A CG  1 
ATOM   4224 C CD1 . TRP A 1 573 ? 9.187  80.167 36.091  1.00 98.15  ? 573 TRP A CD1 1 
ATOM   4225 C CD2 . TRP A 1 573 ? 9.080  82.297 36.830  1.00 99.30  ? 573 TRP A CD2 1 
ATOM   4226 N NE1 . TRP A 1 573 ? 8.032  80.736 35.585  1.00 99.13  ? 573 TRP A NE1 1 
ATOM   4227 C CE2 . TRP A 1 573 ? 7.940  82.037 36.019  1.00 98.91  ? 573 TRP A CE2 1 
ATOM   4228 C CE3 . TRP A 1 573 ? 9.228  83.577 37.405  1.00 98.88  ? 573 TRP A CE3 1 
ATOM   4229 C CZ2 . TRP A 1 573 ? 6.946  83.018 35.767  1.00 98.15  ? 573 TRP A CZ2 1 
ATOM   4230 C CZ3 . TRP A 1 573 ? 8.238  84.554 37.153  1.00 98.63  ? 573 TRP A CZ3 1 
ATOM   4231 C CH2 . TRP A 1 573 ? 7.115  84.262 36.340  1.00 98.41  ? 573 TRP A CH2 1 
HETATM 4232 C C1  . NAG B 2 .   ? 41.389 50.673 -0.043  1.00 58.74  ? 1   NAG B C1  1 
HETATM 4233 C C2  . NAG B 2 .   ? 40.294 51.300 -0.889  1.00 60.35  ? 1   NAG B C2  1 
HETATM 4234 C C3  . NAG B 2 .   ? 40.918 51.689 -2.230  1.00 61.28  ? 1   NAG B C3  1 
HETATM 4235 C C4  . NAG B 2 .   ? 42.024 52.710 -1.962  1.00 63.84  ? 1   NAG B C4  1 
HETATM 4236 C C5  . NAG B 2 .   ? 43.033 52.142 -0.955  1.00 64.07  ? 1   NAG B C5  1 
HETATM 4237 C C6  . NAG B 2 .   ? 44.016 53.195 -0.509  1.00 64.11  ? 1   NAG B C6  1 
HETATM 4238 C C7  . NAG B 2 .   ? 39.338 49.137 -1.355  1.00 58.90  ? 1   NAG B C7  1 
HETATM 4239 C C8  . NAG B 2 .   ? 38.082 48.293 -1.489  1.00 58.51  ? 1   NAG B C8  1 
HETATM 4240 N N2  . NAG B 2 .   ? 39.157 50.413 -1.052  1.00 59.65  ? 1   NAG B N2  1 
HETATM 4241 O O3  . NAG B 2 .   ? 39.936 52.244 -3.094  1.00 59.52  ? 1   NAG B O3  1 
HETATM 4242 O O4  . NAG B 2 .   ? 42.707 53.034 -3.188  1.00 71.26  ? 1   NAG B O4  1 
HETATM 4243 O O5  . NAG B 2 .   ? 42.367 51.670 0.237   1.00 61.30  ? 1   NAG B O5  1 
HETATM 4244 O O6  . NAG B 2 .   ? 43.335 54.277 0.104   1.00 67.12  ? 1   NAG B O6  1 
HETATM 4245 O O7  . NAG B 2 .   ? 40.452 48.635 -1.525  1.00 60.76  ? 1   NAG B O7  1 
HETATM 4246 C C1  . NAG B 2 .   ? 42.288 54.176 -3.845  1.00 77.50  ? 2   NAG B C1  1 
HETATM 4247 C C2  . NAG B 2 .   ? 43.462 54.799 -4.594  1.00 80.56  ? 2   NAG B C2  1 
HETATM 4248 C C3  . NAG B 2 .   ? 42.974 56.032 -5.342  1.00 83.65  ? 2   NAG B C3  1 
HETATM 4249 C C4  . NAG B 2 .   ? 41.840 55.640 -6.298  1.00 85.92  ? 2   NAG B C4  1 
HETATM 4250 C C5  . NAG B 2 .   ? 40.728 54.914 -5.510  1.00 83.71  ? 2   NAG B C5  1 
HETATM 4251 C C6  . NAG B 2 .   ? 39.625 54.361 -6.394  1.00 82.96  ? 2   NAG B C6  1 
HETATM 4252 C C7  . NAG B 2 .   ? 45.548 54.337 -3.496  1.00 83.89  ? 2   NAG B C7  1 
HETATM 4253 C C8  . NAG B 2 .   ? 46.652 54.806 -2.558  1.00 83.55  ? 2   NAG B C8  1 
HETATM 4254 N N2  . NAG B 2 .   ? 44.519 55.159 -3.673  1.00 81.73  ? 2   NAG B N2  1 
HETATM 4255 O O3  . NAG B 2 .   ? 44.047 56.612 -6.068  1.00 83.12  ? 2   NAG B O3  1 
HETATM 4256 O O4  . NAG B 2 .   ? 41.309 56.830 -6.932  1.00 90.77  ? 2   NAG B O4  1 
HETATM 4257 O O5  . NAG B 2 .   ? 41.275 53.792 -4.781  1.00 80.85  ? 2   NAG B O5  1 
HETATM 4258 O O6  . NAG B 2 .   ? 39.893 53.018 -6.769  1.00 81.26  ? 2   NAG B O6  1 
HETATM 4259 O O7  . NAG B 2 .   ? 45.634 53.237 -4.051  1.00 85.40  ? 2   NAG B O7  1 
HETATM 4260 C C1  . MAN B 2 .   ? 41.463 56.964 -8.309  1.00 94.81  ? 3   MAN B C1  1 
HETATM 4261 C C2  . MAN B 2 .   ? 40.537 55.995 -9.049  1.00 97.98  ? 3   MAN B C2  1 
HETATM 4262 C C3  . MAN B 2 .   ? 40.598 56.265 -10.557 1.00 100.30 ? 3   MAN B C3  1 
HETATM 4263 C C4  . MAN B 2 .   ? 41.891 57.012 -10.925 1.00 99.71  ? 3   MAN B C4  1 
HETATM 4264 C C5  . MAN B 2 .   ? 43.098 56.578 -10.068 1.00 98.45  ? 3   MAN B C5  1 
HETATM 4265 C C6  . MAN B 2 .   ? 44.316 57.437 -10.350 1.00 98.89  ? 3   MAN B C6  1 
HETATM 4266 O O2  . MAN B 2 .   ? 39.203 56.159 -8.585  1.00 98.88  ? 3   MAN B O2  1 
HETATM 4267 O O3  . MAN B 2 .   ? 39.470 57.081 -10.940 1.00 103.12 ? 3   MAN B O3  1 
HETATM 4268 O O4  . MAN B 2 .   ? 42.186 56.793 -12.296 1.00 100.60 ? 3   MAN B O4  1 
HETATM 4269 O O5  . MAN B 2 .   ? 42.835 56.701 -8.642  1.00 96.40  ? 3   MAN B O5  1 
HETATM 4270 O O6  . MAN B 2 .   ? 44.058 58.807 -10.067 1.00 98.19  ? 3   MAN B O6  1 
HETATM 4271 C C1  . BMA B 2 .   ? 38.319 56.445 -11.431 1.00 104.08 ? 4   BMA B C1  1 
HETATM 4272 C C2  . BMA B 2 .   ? 37.115 57.394 -11.170 1.00 104.87 ? 4   BMA B C2  1 
HETATM 4273 C C3  . BMA B 2 .   ? 35.877 57.149 -12.050 1.00 105.32 ? 4   BMA B C3  1 
HETATM 4274 C C4  . BMA B 2 .   ? 36.283 56.864 -13.500 1.00 105.34 ? 4   BMA B C4  1 
HETATM 4275 C C5  . BMA B 2 .   ? 37.254 55.696 -13.484 1.00 104.26 ? 4   BMA B C5  1 
HETATM 4276 C C6  . BMA B 2 .   ? 37.623 55.203 -14.873 1.00 102.42 ? 4   BMA B C6  1 
HETATM 4277 O O2  . BMA B 2 .   ? 37.523 58.748 -11.304 1.00 105.40 ? 4   BMA B O2  1 
HETATM 4278 O O3  . BMA B 2 .   ? 35.042 58.298 -12.000 1.00 104.26 ? 4   BMA B O3  1 
HETATM 4279 O O4  . BMA B 2 .   ? 35.143 56.547 -14.291 1.00 106.31 ? 4   BMA B O4  1 
HETATM 4280 O O5  . BMA B 2 .   ? 38.463 56.110 -12.819 1.00 104.13 ? 4   BMA B O5  1 
HETATM 4281 O O6  . BMA B 2 .   ? 36.508 54.597 -15.516 1.00 99.30  ? 4   BMA B O6  1 
HETATM 4282 S S   . SO4 C 3 .   ? 26.729 67.596 12.128  1.00 71.69  ? 601 SO4 A S   1 
HETATM 4283 O O1  . SO4 C 3 .   ? 28.122 67.643 11.657  1.00 67.44  ? 601 SO4 A O1  1 
HETATM 4284 O O2  . SO4 C 3 .   ? 25.862 67.268 10.986  1.00 67.22  ? 601 SO4 A O2  1 
HETATM 4285 O O3  . SO4 C 3 .   ? 26.600 66.538 13.134  1.00 71.79  ? 601 SO4 A O3  1 
HETATM 4286 O O4  . SO4 C 3 .   ? 26.314 68.873 12.757  1.00 70.86  ? 601 SO4 A O4  1 
HETATM 4287 C C1  . NAG D 4 .   ? 34.894 69.157 -13.252 0.80 74.28  ? 602 NAG A C1  1 
HETATM 4288 C C2  . NAG D 4 .   ? 34.320 69.032 -14.674 0.80 75.50  ? 602 NAG A C2  1 
HETATM 4289 C C3  . NAG D 4 .   ? 35.385 69.409 -15.717 0.80 76.13  ? 602 NAG A C3  1 
HETATM 4290 C C4  . NAG D 4 .   ? 35.968 70.774 -15.356 0.80 76.36  ? 602 NAG A C4  1 
HETATM 4291 C C5  . NAG D 4 .   ? 36.617 70.735 -13.966 0.80 75.68  ? 602 NAG A C5  1 
HETATM 4292 C C6  . NAG D 4 .   ? 36.222 71.905 -13.075 0.80 76.17  ? 602 NAG A C6  1 
HETATM 4293 C C7  . NAG D 4 .   ? 32.536 67.430 -14.977 0.80 76.92  ? 602 NAG A C7  1 
HETATM 4294 C C8  . NAG D 4 .   ? 32.115 65.996 -15.248 0.80 75.72  ? 602 NAG A C8  1 
HETATM 4295 N N2  . NAG D 4 .   ? 33.843 67.677 -14.899 0.80 76.05  ? 602 NAG A N2  1 
HETATM 4296 O O3  . NAG D 4 .   ? 34.808 69.461 -17.017 0.80 76.21  ? 602 NAG A O3  1 
HETATM 4297 O O4  . NAG D 4 .   ? 36.934 71.157 -16.324 0.80 76.92  ? 602 NAG A O4  1 
HETATM 4298 O O5  . NAG D 4 .   ? 36.298 69.496 -13.266 0.80 75.57  ? 602 NAG A O5  1 
HETATM 4299 O O6  . NAG D 4 .   ? 36.912 73.092 -13.445 0.80 75.23  ? 602 NAG A O6  1 
HETATM 4300 O O7  . NAG D 4 .   ? 31.676 68.306 -14.844 0.80 77.21  ? 602 NAG A O7  1 
HETATM 4301 C C1  . 760 E 5 .   ? 31.146 64.518 9.727   0.80 51.05  ? 603 760 A C1  1 
HETATM 4302 C C2  . 760 E 5 .   ? 30.186 64.693 8.538   0.80 50.68  ? 603 760 A C2  1 
HETATM 4303 C C3  . 760 E 5 .   ? 29.824 65.993 8.563   0.80 52.88  ? 603 760 A C3  1 
HETATM 4304 C C4  . 760 E 5 .   ? 31.105 66.973 8.285   0.80 52.55  ? 603 760 A C4  1 
HETATM 4305 C C5  . 760 E 5 .   ? 33.626 67.631 8.331   0.80 50.54  ? 603 760 A C5  1 
HETATM 4306 C C6  . 760 E 5 .   ? 35.807 67.741 10.032  0.80 47.41  ? 603 760 A C6  1 
HETATM 4307 C C7  . 760 E 5 .   ? 36.877 67.391 11.000  0.80 48.59  ? 603 760 A C7  1 
HETATM 4308 C C8  . 760 E 5 .   ? 36.784 66.144 11.621  0.80 50.26  ? 603 760 A C8  1 
HETATM 4309 C C9  . 760 E 5 .   ? 35.682 65.288 11.341  0.80 50.02  ? 603 760 A C9  1 
HETATM 4310 N N10 . 760 E 5 .   ? 33.499 64.725 10.271  0.80 51.50  ? 603 760 A N10 1 
HETATM 4311 C C11 . 760 E 5 .   ? 32.623 65.261 9.637   0.80 51.95  ? 603 760 A C11 1 
HETATM 4312 C C12 . 760 E 5 .   ? 32.570 66.548 8.840   0.80 51.19  ? 603 760 A C12 1 
HETATM 4313 C C13 . 760 E 5 .   ? 34.592 67.038 9.560   0.80 49.76  ? 603 760 A C13 1 
HETATM 4314 C C14 . 760 E 5 .   ? 34.529 65.620 10.365  0.80 49.58  ? 603 760 A C14 1 
HETATM 4315 N N15 . 760 E 5 .   ? 33.596 69.070 8.278   0.80 52.38  ? 603 760 A N15 1 
HETATM 4316 C C17 . 760 E 5 .   ? 32.382 69.841 7.906   0.80 54.70  ? 603 760 A C17 1 
HETATM 4317 C C18 . 760 E 5 .   ? 31.200 70.300 8.892   0.80 54.87  ? 603 760 A C18 1 
HETATM 4318 C C19 . 760 E 5 .   ? 30.429 69.496 9.769   0.80 54.98  ? 603 760 A C19 1 
HETATM 4319 C C20 . 760 E 5 .   ? 29.437 70.047 10.489  0.80 54.94  ? 603 760 A C20 1 
HETATM 4320 C C21 . 760 E 5 .   ? 29.145 71.384 10.395  0.80 56.19  ? 603 760 A C21 1 
HETATM 4321 C C22 . 760 E 5 .   ? 29.893 72.201 9.556   0.80 55.52  ? 603 760 A C22 1 
HETATM 4322 C C23 . 760 E 5 .   ? 30.944 71.682 8.778   0.80 54.80  ? 603 760 A C23 1 
HETATM 4323 O O   . HOH F 6 .   ? 29.953 60.548 15.084  1.00 35.38  ? 701 HOH A O   1 
HETATM 4324 O O   . HOH F 6 .   ? 42.826 70.053 27.123  1.00 41.28  ? 702 HOH A O   1 
HETATM 4325 O O   . HOH F 6 .   ? 35.704 62.880 11.985  1.00 36.21  ? 703 HOH A O   1 
HETATM 4326 O O   . HOH F 6 .   ? 29.571 64.018 4.786   1.00 28.84  ? 704 HOH A O   1 
HETATM 4327 O O   . HOH F 6 .   ? 20.231 84.357 5.918   1.00 41.90  ? 705 HOH A O   1 
HETATM 4328 O O   . HOH F 6 .   ? 17.942 97.550 -1.706  1.00 50.53  ? 706 HOH A O   1 
HETATM 4329 O O   . HOH F 6 .   ? 23.419 54.588 30.380  1.00 38.93  ? 707 HOH A O   1 
HETATM 4330 O O   . HOH F 6 .   ? 22.503 40.282 23.395  1.00 39.49  ? 708 HOH A O   1 
HETATM 4331 O O   . HOH F 6 .   ? 14.928 48.863 23.619  1.00 37.96  ? 709 HOH A O   1 
HETATM 4332 O O   . HOH F 6 .   ? 12.452 75.474 0.050   1.00 35.87  ? 710 HOH A O   1 
HETATM 4333 O O   . HOH F 6 .   ? 19.717 64.799 -11.660 1.00 43.33  ? 711 HOH A O   1 
HETATM 4334 O O   . HOH F 6 .   ? 24.079 59.835 1.126   1.00 40.13  ? 712 HOH A O   1 
HETATM 4335 O O   . HOH F 6 .   ? 17.920 47.164 17.646  1.00 28.67  ? 713 HOH A O   1 
HETATM 4336 O O   . HOH F 6 .   ? 26.104 60.498 -5.519  1.00 31.40  ? 714 HOH A O   1 
HETATM 4337 O O   . HOH F 6 .   ? 28.624 57.106 -0.614  1.00 38.74  ? 715 HOH A O   1 
HETATM 4338 O O   . HOH F 6 .   ? 28.296 57.685 16.665  1.00 33.72  ? 716 HOH A O   1 
HETATM 4339 O O   . HOH F 6 .   ? 32.284 71.600 2.211   1.00 41.04  ? 717 HOH A O   1 
HETATM 4340 O O   . HOH F 6 .   ? 38.777 51.437 2.061   1.00 31.70  ? 718 HOH A O   1 
HETATM 4341 O O   . HOH F 6 .   ? 20.584 67.110 -10.437 1.00 30.37  ? 719 HOH A O   1 
HETATM 4342 O O   . HOH F 6 .   ? 26.420 70.188 39.520  1.00 26.51  ? 720 HOH A O   1 
HETATM 4343 O O   . HOH F 6 .   ? 8.248  73.143 -4.246  1.00 34.89  ? 721 HOH A O   1 
HETATM 4344 O O   . HOH F 6 .   ? 18.049 77.543 4.790   1.00 30.59  ? 722 HOH A O   1 
HETATM 4345 O O   . HOH F 6 .   ? 44.230 73.459 22.065  1.00 43.81  ? 723 HOH A O   1 
HETATM 4346 O O   . HOH F 6 .   ? 26.512 66.770 -1.801  1.00 22.47  ? 724 HOH A O   1 
HETATM 4347 O O   . HOH F 6 .   ? 17.798 45.448 5.767   1.00 29.16  ? 725 HOH A O   1 
HETATM 4348 O O   . HOH F 6 .   ? 22.928 40.337 29.095  1.00 28.70  ? 726 HOH A O   1 
HETATM 4349 O O   . HOH F 6 .   ? 31.485 41.483 23.196  1.00 44.98  ? 727 HOH A O   1 
HETATM 4350 O O   . HOH F 6 .   ? 13.447 74.668 5.446   1.00 39.42  ? 728 HOH A O   1 
HETATM 4351 O O   . HOH F 6 .   ? 28.536 61.961 7.712   1.00 26.52  ? 729 HOH A O   1 
HETATM 4352 O O   . HOH F 6 .   ? 30.155 63.882 24.985  1.00 29.13  ? 730 HOH A O   1 
HETATM 4353 O O   . HOH F 6 .   ? 24.818 67.852 6.070   1.00 22.61  ? 731 HOH A O   1 
HETATM 4354 O O   . HOH F 6 .   ? 14.157 68.654 -9.248  1.00 32.38  ? 732 HOH A O   1 
HETATM 4355 O O   . HOH F 6 .   ? 21.847 48.670 23.883  1.00 36.81  ? 733 HOH A O   1 
HETATM 4356 O O   . HOH F 6 .   ? 21.356 77.811 39.499  1.00 37.45  ? 734 HOH A O   1 
HETATM 4357 O O   . HOH F 6 .   ? 34.492 38.577 1.257   1.00 46.42  ? 735 HOH A O   1 
HETATM 4358 O O   . HOH F 6 .   ? 31.553 36.374 24.396  1.00 42.42  ? 736 HOH A O   1 
HETATM 4359 O O   . HOH F 6 .   ? 31.898 57.183 -1.792  1.00 47.12  ? 737 HOH A O   1 
HETATM 4360 O O   . HOH F 6 .   ? 28.027 45.361 32.660  1.00 31.24  ? 738 HOH A O   1 
HETATM 4361 O O   . HOH F 6 .   ? 9.977  63.771 -2.628  1.00 26.87  ? 739 HOH A O   1 
HETATM 4362 O O   . HOH F 6 .   ? 16.738 77.984 7.093   1.00 30.31  ? 740 HOH A O   1 
HETATM 4363 O O   . HOH F 6 .   ? 19.215 74.016 -6.541  1.00 31.37  ? 741 HOH A O   1 
HETATM 4364 O O   . HOH F 6 .   ? 39.127 71.825 -17.976 1.00 64.27  ? 742 HOH A O   1 
HETATM 4365 O O   . HOH F 6 .   ? 21.493 72.065 -5.840  1.00 26.46  ? 743 HOH A O   1 
HETATM 4366 O O   . HOH F 6 .   ? 25.340 35.570 25.415  1.00 46.04  ? 744 HOH A O   1 
HETATM 4367 O O   . HOH F 6 .   ? 37.383 60.786 11.134  1.00 45.17  ? 745 HOH A O   1 
HETATM 4368 O O   . HOH F 6 .   ? 35.161 65.693 25.082  1.00 31.26  ? 746 HOH A O   1 
HETATM 4369 O O   . HOH F 6 .   ? 25.497 75.368 -10.327 1.00 41.17  ? 747 HOH A O   1 
HETATM 4370 O O   . HOH F 6 .   ? 43.570 50.478 23.551  1.00 47.03  ? 748 HOH A O   1 
HETATM 4371 O O   . HOH F 6 .   ? 7.444  67.791 -6.802  1.00 49.68  ? 749 HOH A O   1 
HETATM 4372 O O   . HOH F 6 .   ? 36.363 48.892 -11.543 1.00 41.94  ? 750 HOH A O   1 
HETATM 4373 O O   . HOH F 6 .   ? -2.858 83.443 -3.389  1.00 38.01  ? 751 HOH A O   1 
HETATM 4374 O O   . HOH F 6 .   ? 21.105 80.634 40.497  1.00 53.27  ? 752 HOH A O   1 
HETATM 4375 O O   . HOH F 6 .   ? 37.922 44.470 23.218  1.00 41.41  ? 753 HOH A O   1 
HETATM 4376 O O   . HOH F 6 .   ? 12.141 68.424 20.115  1.00 54.66  ? 754 HOH A O   1 
HETATM 4377 O O   . HOH F 6 .   ? 35.795 60.873 28.913  1.00 53.26  ? 755 HOH A O   1 
HETATM 4378 O O   . HOH F 6 .   ? 5.012  67.530 -2.622  1.00 40.02  ? 756 HOH A O   1 
HETATM 4379 O O   . HOH F 6 .   ? 24.783 78.515 20.065  1.00 45.37  ? 757 HOH A O   1 
HETATM 4380 O O   . HOH F 6 .   ? 38.328 74.242 -16.024 1.00 64.28  ? 758 HOH A O   1 
HETATM 4381 O O   . HOH F 6 .   ? 44.255 45.261 24.361  1.00 40.23  ? 759 HOH A O   1 
HETATM 4382 O O   . HOH F 6 .   ? 34.891 71.026 -5.174  1.00 50.52  ? 760 HOH A O   1 
HETATM 4383 O O   . HOH F 6 .   ? 37.895 70.350 -5.186  1.00 38.61  ? 761 HOH A O   1 
HETATM 4384 O O   . HOH F 6 .   ? 33.518 58.683 28.683  1.00 53.23  ? 762 HOH A O   1 
HETATM 4385 O O   . HOH F 6 .   ? 33.693 66.288 -11.166 1.00 34.58  ? 763 HOH A O   1 
HETATM 4386 O O   . HOH F 6 .   ? 29.355 41.405 26.238  1.00 52.35  ? 764 HOH A O   1 
HETATM 4387 O O   . HOH F 6 .   ? 8.898  83.367 -10.095 1.00 40.86  ? 765 HOH A O   1 
HETATM 4388 O O   . HOH F 6 .   ? 41.617 54.962 22.694  1.00 34.13  ? 766 HOH A O   1 
HETATM 4389 O O   . HOH F 6 .   ? 14.099 70.100 21.655  1.00 45.17  ? 767 HOH A O   1 
HETATM 4390 O O   . HOH F 6 .   ? 13.340 68.028 27.890  1.00 31.39  ? 768 HOH A O   1 
HETATM 4391 O O   . HOH F 6 .   ? 32.151 73.874 11.235  1.00 48.17  ? 769 HOH A O   1 
HETATM 4392 O O   . HOH F 6 .   ? 40.001 45.905 0.723   1.00 39.74  ? 770 HOH A O   1 
HETATM 4393 O O   . HOH F 6 .   ? 15.137 97.088 -6.465  1.00 52.02  ? 771 HOH A O   1 
HETATM 4394 O O   . HOH F 6 .   ? 20.511 68.397 26.240  1.00 52.20  ? 772 HOH A O   1 
HETATM 4395 O O   . HOH F 6 .   ? 41.860 73.289 40.405  1.00 49.39  ? 773 HOH A O   1 
HETATM 4396 O O   . HOH F 6 .   ? 2.614  55.943 22.706  1.00 56.51  ? 774 HOH A O   1 
HETATM 4397 O O   . HOH F 6 .   ? 18.716 46.898 35.555  1.00 41.43  ? 775 HOH A O   1 
HETATM 4398 O O   . HOH F 6 .   ? 48.623 50.026 -1.793  1.00 38.96  ? 776 HOH A O   1 
HETATM 4399 O O   . HOH F 6 .   ? 37.861 68.451 -18.661 1.00 52.58  ? 777 HOH A O   1 
HETATM 4400 O O   . HOH F 6 .   ? 38.338 55.928 3.890   1.00 25.92  ? 778 HOH A O   1 
HETATM 4401 O O   . HOH F 6 .   ? 37.931 81.663 9.821   1.00 52.26  ? 779 HOH A O   1 
HETATM 4402 O O   . HOH F 6 .   ? 7.082  50.475 27.845  1.00 51.92  ? 780 HOH A O   1 
HETATM 4403 O O   . HOH F 6 .   ? 7.348  53.972 -3.387  1.00 34.56  ? 781 HOH A O   1 
HETATM 4404 O O   . HOH F 6 .   ? 47.960 45.494 17.696  1.00 46.00  ? 782 HOH A O   1 
HETATM 4405 O O   . HOH F 6 .   ? 12.218 45.324 22.808  1.00 43.00  ? 783 HOH A O   1 
HETATM 4406 O O   . HOH F 6 .   ? 11.210 63.390 14.420  1.00 42.95  ? 784 HOH A O   1 
HETATM 4407 O O   . HOH F 6 .   ? 39.877 61.075 31.853  1.00 37.97  ? 785 HOH A O   1 
HETATM 4408 O O   . HOH F 6 .   ? 21.084 44.488 35.444  1.00 53.07  ? 786 HOH A O   1 
HETATM 4409 O O   . HOH F 6 .   ? 0.818  56.925 25.180  1.00 58.00  ? 787 HOH A O   1 
HETATM 4410 O O   . HOH F 6 .   ? 16.395 69.469 27.133  1.00 46.05  ? 788 HOH A O   1 
HETATM 4411 O O   . HOH F 6 .   ? 9.203  82.232 -14.314 1.00 33.66  ? 789 HOH A O   1 
HETATM 4412 O O   . HOH F 6 .   ? 32.850 78.620 6.289   1.00 39.57  ? 790 HOH A O   1 
HETATM 4413 O O   . HOH F 6 .   ? 17.761 73.357 25.318  1.00 53.70  ? 791 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   ?   ?   ?   A . n 
A 1 2   ILE 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  SER 10  10  10  SER SER A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  THR 20  20  20  THR THR A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLN 22  22  22  GLN GLN A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  HIS 27  27  27  HIS HIS A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  THR 30  30  30  THR THR A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  PRO 47  47  47  PRO PRO A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  CYS 66  66  66  CYS CYS A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  TYR 73  73  73  TYR TYR A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  ILE 82  82  82  ILE ILE A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  ASN 84  84  84  ASN ASN A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  ASN 88  88  88  ASN ASN A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  CYS 93  93  93  CYS CYS A . n 
A 1 94  LEU 94  94  94  LEU LEU A . n 
A 1 95  TYR 95  95  95  TYR TYR A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  ASN 97  97  97  ASN ASN A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 PRO 101 101 101 PRO PRO A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LYS 103 103 ?   ?   ?   A . n 
A 1 104 ALA 104 104 ?   ?   ?   A . n 
A 1 105 ARG 105 105 ?   ?   ?   A . n 
A 1 106 LEU 106 106 ?   ?   ?   A . n 
A 1 107 ARG 107 107 ?   ?   ?   A . n 
A 1 108 HIS 108 108 ?   ?   ?   A . n 
A 1 109 GLY 109 109 ?   ?   ?   A . n 
A 1 110 ARG 110 110 ?   ?   ?   A . n 
A 1 111 GLY 111 111 ?   ?   ?   A . n 
A 1 112 ALA 112 112 ?   ?   ?   A . n 
A 1 113 ASN 113 113 ?   ?   ?   A . n 
A 1 114 GLY 114 114 ?   ?   ?   A . n 
A 1 115 GLY 115 115 ?   ?   ?   A . n 
A 1 116 GLU 116 116 ?   ?   ?   A . n 
A 1 117 HIS 117 117 ?   ?   ?   A . n 
A 1 118 PRO 118 118 ?   ?   ?   A . n 
A 1 119 ASN 119 119 ?   ?   ?   A . n 
A 1 120 GLY 120 120 ?   ?   ?   A . n 
A 1 121 LYS 121 121 ?   ?   ?   A . n 
A 1 122 GLN 122 122 ?   ?   ?   A . n 
A 1 123 ALA 123 123 ?   ?   ?   A . n 
A 1 124 ASP 124 124 ?   ?   ?   A . n 
A 1 125 THR 125 125 ?   ?   ?   A . n 
A 1 126 ASP 126 126 ?   ?   ?   A . n 
A 1 127 HIS 127 127 ?   ?   ?   A . n 
A 1 128 LEU 128 128 ?   ?   ?   A . n 
A 1 129 ILE 129 129 ?   ?   ?   A . n 
A 1 130 HIS 130 130 ?   ?   ?   A . n 
A 1 131 ASN 131 131 ?   ?   ?   A . n 
A 1 132 GLY 132 132 ?   ?   ?   A . n 
A 1 133 ASN 133 133 ?   ?   ?   A . n 
A 1 134 PRO 134 134 ?   ?   ?   A . n 
A 1 135 GLN 135 135 ?   ?   ?   A . n 
A 1 136 ASN 136 136 ?   ?   ?   A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 THR 154 154 154 THR THR A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PHE 178 178 178 PHE PHE A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 TYR 180 180 180 TYR TYR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 HIS 189 189 189 HIS HIS A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 PRO 195 195 195 PRO PRO A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 ALA 199 199 199 ALA ALA A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 PRO 203 203 203 PRO PRO A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 TRP 209 209 209 TRP TRP A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 LEU 213 213 213 LEU LEU A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 MET 232 232 232 MET MET A . n 
A 1 233 THR 233 233 233 THR THR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 SER 238 238 238 SER SER A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 GLN 247 247 247 GLN GLN A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 MET 249 249 249 MET MET A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 ARG 254 254 254 ARG ARG A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 ARG 259 259 259 ARG ARG A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 MET 261 261 261 MET MET A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 GLN 263 263 263 GLN GLN A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 MET 267 267 267 MET MET A . n 
A 1 268 ASN 268 268 268 ASN ASN A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 TRP 271 271 271 TRP TRP A . n 
A 1 272 SER 272 272 272 SER SER A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 MET 274 274 274 MET MET A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 VAL 280 280 280 VAL VAL A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 ALA 285 285 285 ALA ALA A . n 
A 1 286 LEU 286 286 286 LEU LEU A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASP 289 289 289 ASP ASP A . n 
A 1 290 CYS 290 290 290 CYS CYS A . n 
A 1 291 ASN 291 291 291 ASN ASN A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 LYS 298 298 298 LYS LYS A . n 
A 1 299 THR 299 299 299 THR THR A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 MET 305 305 305 MET MET A . n 
A 1 306 SER 306 306 306 SER SER A . n 
A 1 307 CYS 307 307 307 CYS CYS A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 VAL 311 311 311 VAL VAL A . n 
A 1 312 ASP 312 312 312 ASP ASP A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 LYS 314 314 314 LYS LYS A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 SER 317 317 317 SER SER A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 GLN 319 319 319 GLN GLN A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 TRP 321 321 321 TRP TRP A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 ILE 327 327 327 ILE ILE A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 THR 335 335 335 THR THR A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ASP 337 337 337 ASP ASP A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 PRO 342 342 342 PRO PRO A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 ASP 344 344 344 ASP ASP A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 MET 346 346 346 MET MET A . n 
A 1 347 THR 347 347 347 THR THR A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 ALA 352 352 352 ALA ALA A . n 
A 1 353 ASP 353 353 353 ASP ASP A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TYR 357 357 357 TYR TYR A . n 
A 1 358 ASP 358 358 358 ASP ASP A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 MET 361 361 361 MET MET A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 VAL 364 364 364 VAL VAL A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ASP 366 366 366 ASP ASP A . n 
A 1 367 GLU 367 367 367 GLU GLU A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 TYR 370 370 370 TYR TYR A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 TYR 374 374 374 TYR TYR A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PHE 376 376 376 PHE PHE A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASP 378 378 378 ASP ASP A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ASP 383 383 383 ASP ASP A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 ALA 385 385 385 ALA ALA A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 PRO 389 389 389 PRO PRO A . n 
A 1 390 ARG 390 390 390 ARG ARG A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 LYS 392 392 392 LYS LYS A . n 
A 1 393 TYR 393 393 393 TYR TYR A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 GLU 395 395 395 GLU GLU A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 MET 397 397 397 MET MET A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 PHE 401 401 401 PHE PHE A . n 
A 1 402 GLY 402 402 402 GLY GLY A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 THR 405 405 405 THR THR A . n 
A 1 406 GLN 406 406 406 GLN GLN A . n 
A 1 407 ALA 407 407 407 ALA ALA A . n 
A 1 408 GLU 408 408 408 GLU GLU A . n 
A 1 409 ARG 409 409 409 ARG ARG A . n 
A 1 410 GLU 410 410 410 GLU GLU A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 THR 417 417 417 THR THR A . n 
A 1 418 SER 418 418 418 SER SER A . n 
A 1 419 TRP 419 419 419 TRP TRP A . n 
A 1 420 GLU 420 420 420 GLU GLU A . n 
A 1 421 GLY 421 421 421 GLY GLY A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 TYR 425 425 425 TYR TYR A . n 
A 1 426 GLN 426 426 426 GLN GLN A . n 
A 1 427 ASN 427 427 427 ASN ASN A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 GLN 429 429 429 GLN GLN A . n 
A 1 430 GLN 430 430 430 GLN GLN A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ASP 437 437 437 ASP ASP A . n 
A 1 438 HIS 438 438 438 HIS HIS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 THR 441 441 441 THR THR A . n 
A 1 442 CYS 442 442 442 CYS CYS A . n 
A 1 443 PRO 443 443 443 PRO PRO A . n 
A 1 444 THR 444 444 444 THR THR A . n 
A 1 445 ASN 445 445 445 ASN ASN A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 TYR 447 447 447 TYR TYR A . n 
A 1 448 ALA 448 448 448 ALA ALA A . n 
A 1 449 GLN 449 449 449 GLN GLN A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 ALA 452 452 452 ALA ALA A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 GLY 455 455 455 GLY GLY A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 SER 457 457 457 SER SER A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 TYR 460 460 460 TYR TYR A . n 
A 1 461 TYR 461 461 461 TYR TYR A . n 
A 1 462 TYR 462 462 462 TYR TYR A . n 
A 1 463 PHE 463 463 463 PHE PHE A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 HIS 465 465 465 HIS HIS A . n 
A 1 466 ARG 466 466 466 ARG ARG A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 THR 469 469 469 THR THR A . n 
A 1 470 SER 470 470 470 SER SER A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 TRP 472 472 472 TRP TRP A . n 
A 1 473 GLY 473 473 473 GLY GLY A . n 
A 1 474 GLU 474 474 474 GLU GLU A . n 
A 1 475 TRP 475 475 475 TRP TRP A . n 
A 1 476 MET 476 476 476 MET MET A . n 
A 1 477 GLY 477 477 477 GLY GLY A . n 
A 1 478 VAL 478 478 478 VAL VAL A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 HIS 480 480 480 HIS HIS A . n 
A 1 481 GLY 481 481 481 GLY GLY A . n 
A 1 482 ASP 482 482 482 ASP ASP A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 TYR 486 486 486 TYR TYR A . n 
A 1 487 PHE 487 487 487 PHE PHE A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 GLN 490 490 490 GLN GLN A . n 
A 1 491 PRO 491 491 491 PRO PRO A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LEU 496 496 496 LEU LEU A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 VAL 501 501 501 VAL VAL A . n 
A 1 502 GLU 502 502 502 GLU GLU A . n 
A 1 503 ARG 503 503 503 ARG ARG A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 LYS 507 507 507 LYS LYS A . n 
A 1 508 ARG 508 508 508 ARG ARG A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 SER 511 511 511 SER SER A . n 
A 1 512 ALA 512 512 512 ALA ALA A . n 
A 1 513 VAL 513 513 513 VAL VAL A . n 
A 1 514 ILE 514 514 514 ILE ILE A . n 
A 1 515 GLU 515 515 515 GLU GLU A . n 
A 1 516 PHE 516 516 516 PHE PHE A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 LYS 518 518 518 LYS LYS A . n 
A 1 519 THR 519 519 519 THR THR A . n 
A 1 520 GLY 520 520 520 GLY GLY A . n 
A 1 521 ASN 521 521 521 ASN ASN A . n 
A 1 522 PRO 522 522 522 PRO PRO A . n 
A 1 523 ALA 523 523 523 ALA ALA A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 ASP 525 525 525 ASP ASP A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLU 527 527 527 GLU GLU A . n 
A 1 528 GLU 528 528 528 GLU GLU A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 PRO 530 530 530 PRO PRO A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 PHE 532 532 532 PHE PHE A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LYS 534 534 534 LYS LYS A . n 
A 1 535 GLU 535 535 535 GLU GLU A . n 
A 1 536 ASP 536 536 536 ASP ASP A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 VAL 538 538 538 VAL VAL A . n 
A 1 539 TYR 539 539 539 TYR TYR A . n 
A 1 540 TYR 540 540 540 TYR TYR A . n 
A 1 541 ILE 541 541 541 ILE ILE A . n 
A 1 542 PHE 542 542 542 PHE PHE A . n 
A 1 543 SER 543 543 543 SER SER A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 ASP 546 546 546 ASP ASP A . n 
A 1 547 LYS 547 547 547 LYS LYS A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLU 549 549 549 GLU GLU A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 ALA 552 552 552 ALA ALA A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 GLY 554 554 554 GLY GLY A . n 
A 1 555 PRO 555 555 555 PRO PRO A . n 
A 1 556 LEU 556 556 556 LEU LEU A . n 
A 1 557 ALA 557 557 557 ALA ALA A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 ARG 559 559 559 ARG ARG A . n 
A 1 560 CYS 560 560 560 CYS CYS A . n 
A 1 561 SER 561 561 561 SER SER A . n 
A 1 562 PHE 562 562 562 PHE PHE A . n 
A 1 563 TRP 563 563 563 TRP TRP A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASP 565 565 565 ASP ASP A . n 
A 1 566 TYR 566 566 566 TYR TYR A . n 
A 1 567 LEU 567 567 567 LEU LEU A . n 
A 1 568 PRO 568 568 568 PRO PRO A . n 
A 1 569 LYS 569 569 569 LYS LYS A . n 
A 1 570 VAL 570 570 570 VAL VAL A . n 
A 1 571 ARG 571 571 571 ARG ARG A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 TRP 573 573 573 TRP TRP A . n 
A 1 574 ALA 574 574 ?   ?   ?   A . n 
A 1 575 GLY 575 575 ?   ?   ?   A . n 
A 1 576 THR 576 576 ?   ?   ?   A . n 
A 1 577 CYS 577 577 ?   ?   ?   A . n 
A 1 578 ASP 578 578 ?   ?   ?   A . n 
A 1 579 GLY 579 579 ?   ?   ?   A . n 
A 1 580 ASP 580 580 ?   ?   ?   A . n 
A 1 581 SER 581 581 ?   ?   ?   A . n 
A 1 582 GLY 582 582 ?   ?   ?   A . n 
A 1 583 SER 583 583 ?   ?   ?   A . n 
A 1 584 ALA 584 584 ?   ?   ?   A . n 
A 1 585 SER 585 585 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 SO4 1  601 1574 SO4 SO4 A . 
D 4 NAG 1  602 1676 NAG NAG A . 
E 5 760 1  603 1580 760 760 A . 
F 6 HOH 1  701 2068 HOH HOH A . 
F 6 HOH 2  702 2055 HOH HOH A . 
F 6 HOH 3  703 2065 HOH HOH A . 
F 6 HOH 4  704 2027 HOH HOH A . 
F 6 HOH 5  705 2038 HOH HOH A . 
F 6 HOH 6  706 2039 HOH HOH A . 
F 6 HOH 7  707 2086 HOH HOH A . 
F 6 HOH 8  708 2077 HOH HOH A . 
F 6 HOH 9  709 2079 HOH HOH A . 
F 6 HOH 10 710 2030 HOH HOH A . 
F 6 HOH 11 711 2005 HOH HOH A . 
F 6 HOH 12 712 2021 HOH HOH A . 
F 6 HOH 13 713 2062 HOH HOH A . 
F 6 HOH 14 714 2020 HOH HOH A . 
F 6 HOH 15 715 2024 HOH HOH A . 
F 6 HOH 16 716 2067 HOH HOH A . 
F 6 HOH 17 717 2011 HOH HOH A . 
F 6 HOH 18 718 2069 HOH HOH A . 
F 6 HOH 19 719 2019 HOH HOH A . 
F 6 HOH 20 720 2053 HOH HOH A . 
F 6 HOH 21 721 2009 HOH HOH A . 
F 6 HOH 22 722 2044 HOH HOH A . 
F 6 HOH 23 723 2050 HOH HOH A . 
F 6 HOH 24 724 2023 HOH HOH A . 
F 6 HOH 25 725 2072 HOH HOH A . 
F 6 HOH 26 726 2075 HOH HOH A . 
F 6 HOH 27 727 2081 HOH HOH A . 
F 6 HOH 28 728 2045 HOH HOH A . 
F 6 HOH 29 729 2028 HOH HOH A . 
F 6 HOH 30 730 2057 HOH HOH A . 
F 6 HOH 31 731 2022 HOH HOH A . 
F 6 HOH 32 732 2006 HOH HOH A . 
F 6 HOH 33 733 2063 HOH HOH A . 
F 6 HOH 34 734 2051 HOH HOH A . 
F 6 HOH 35 735 2003 HOH HOH A . 
F 6 HOH 36 736 2073 HOH HOH A . 
F 6 HOH 37 737 2025 HOH HOH A . 
F 6 HOH 38 738 2085 HOH HOH A . 
F 6 HOH 39 739 2033 HOH HOH A . 
F 6 HOH 40 740 2043 HOH HOH A . 
F 6 HOH 41 741 2007 HOH HOH A . 
F 6 HOH 42 742 3001 HOH HOH A . 
F 6 HOH 43 743 2017 HOH HOH A . 
F 6 HOH 44 744 2074 HOH HOH A . 
F 6 HOH 45 745 2066 HOH HOH A . 
F 6 HOH 46 746 2048 HOH HOH A . 
F 6 HOH 47 747 2018 HOH HOH A . 
F 6 HOH 48 748 2082 HOH HOH A . 
F 6 HOH 49 749 2010 HOH HOH A . 
F 6 HOH 50 750 2002 HOH HOH A . 
F 6 HOH 51 751 2031 HOH HOH A . 
F 6 HOH 52 752 2052 HOH HOH A . 
F 6 HOH 53 753 2084 HOH HOH A . 
F 6 HOH 54 754 2046 HOH HOH A . 
F 6 HOH 55 755 2088 HOH HOH A . 
F 6 HOH 56 756 2008 HOH HOH A . 
F 6 HOH 57 757 2042 HOH HOH A . 
F 6 HOH 58 758 3002 HOH HOH A . 
F 6 HOH 59 759 2083 HOH HOH A . 
F 6 HOH 60 760 2015 HOH HOH A . 
F 6 HOH 61 761 2012 HOH HOH A . 
F 6 HOH 62 762 2087 HOH HOH A . 
F 6 HOH 63 763 2016 HOH HOH A . 
F 6 HOH 64 764 2076 HOH HOH A . 
F 6 HOH 65 765 2041 HOH HOH A . 
F 6 HOH 66 766 2064 HOH HOH A . 
F 6 HOH 67 767 2037 HOH HOH A . 
F 6 HOH 68 768 2060 HOH HOH A . 
F 6 HOH 69 769 2049 HOH HOH A . 
F 6 HOH 70 770 2004 HOH HOH A . 
F 6 HOH 71 771 2040 HOH HOH A . 
F 6 HOH 72 772 2058 HOH HOH A . 
F 6 HOH 73 773 2054 HOH HOH A . 
F 6 HOH 74 774 2047 HOH HOH A . 
F 6 HOH 75 775 2080 HOH HOH A . 
F 6 HOH 76 776 2070 HOH HOH A . 
F 6 HOH 77 777 3003 HOH HOH A . 
F 6 HOH 78 778 2026 HOH HOH A . 
F 6 HOH 79 779 2014 HOH HOH A . 
F 6 HOH 80 780 2061 HOH HOH A . 
F 6 HOH 81 781 2034 HOH HOH A . 
F 6 HOH 82 782 2071 HOH HOH A . 
F 6 HOH 83 783 2078 HOH HOH A . 
F 6 HOH 84 784 2036 HOH HOH A . 
F 6 HOH 85 785 2056 HOH HOH A . 
F 6 HOH 86 786 2001 HOH HOH A . 
F 6 HOH 87 787 2029 HOH HOH A . 
F 6 HOH 88 788 2032 HOH HOH A . 
F 6 HOH 89 789 2035 HOH HOH A . 
F 6 HOH 90 790 2013 HOH HOH A . 
F 6 HOH 91 791 2059 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 88  A ASN 88  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 493 A ASN 493 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F 
1 2 A,C,D,E,F   
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 95.8100000000 -1.0000000000 
0.0000000000 0.0000000000 95.8100000000 0.0000000000 0.0000000000 -1.0000000000 81.0150000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-21 
2 'Structure model' 1 1 2011-07-27 
3 'Structure model' 1 2 2019-10-09 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 3 0 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'       
2  2 'Structure model' 'Derived calculations'      
3  2 'Structure model' 'Non-polymer description'   
4  2 'Structure model' Other                       
5  2 'Structure model' 'Refinement description'    
6  2 'Structure model' 'Source and taxonomy'       
7  2 'Structure model' 'Structure summary'         
8  2 'Structure model' 'Version format compliance' 
9  3 'Structure model' 'Data collection'           
10 3 'Structure model' 'Database references'       
11 3 'Structure model' Other                       
12 4 'Structure model' 'Atomic model'              
13 4 'Structure model' 'Data collection'           
14 4 'Structure model' 'Derived calculations'      
15 4 'Structure model' 'Structure summary'         
16 5 'Structure model' 'Atomic model'              
17 5 'Structure model' 'Data collection'           
18 5 'Structure model' 'Derived calculations'      
19 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' pdbx_database_status          
3  4 'Structure model' atom_site                     
4  4 'Structure model' chem_comp                     
5  4 'Structure model' entity                        
6  4 'Structure model' pdbx_branch_scheme            
7  4 'Structure model' pdbx_chem_comp_identifier     
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_assembly_gen      
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
19 5 'Structure model' atom_site                     
20 5 'Structure model' chem_comp                     
21 5 'Structure model' pdbx_nonpoly_scheme           
22 5 'Structure model' pdbx_struct_assembly          
23 5 'Structure model' pdbx_struct_assembly_gen      
24 5 'Structure model' pdbx_struct_oper_list         
25 5 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.page_last'                      
2  3 'Structure model' '_citation.pdbx_database_id_DOI'           
3  3 'Structure model' '_citation.title'                          
4  3 'Structure model' '_pdbx_database_status.status_code_sf'     
5  4 'Structure model' '_atom_site.B_iso_or_equiv'                
6  4 'Structure model' '_atom_site.Cartn_x'                       
7  4 'Structure model' '_atom_site.Cartn_y'                       
8  4 'Structure model' '_atom_site.Cartn_z'                       
9  4 'Structure model' '_atom_site.auth_asym_id'                  
10 4 'Structure model' '_atom_site.auth_atom_id'                  
11 4 'Structure model' '_atom_site.auth_comp_id'                  
12 4 'Structure model' '_atom_site.auth_seq_id'                   
13 4 'Structure model' '_atom_site.label_asym_id'                 
14 4 'Structure model' '_atom_site.label_atom_id'                 
15 4 'Structure model' '_atom_site.label_comp_id'                 
16 4 'Structure model' '_atom_site.label_entity_id'               
17 4 'Structure model' '_atom_site.type_symbol'                   
18 4 'Structure model' '_chem_comp.name'                          
19 4 'Structure model' '_chem_comp.type'                          
20 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'   
21 4 'Structure model' '_struct_conn.pdbx_role'                   
22 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'          
23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'           
24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'         
25 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'          
26 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'           
27 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'         
28 5 'Structure model' '_atom_site.auth_seq_id'                   
29 5 'Structure model' '_chem_comp.pdbx_synonyms'                 
30 5 'Structure model' '_pdbx_nonpoly_scheme.pdb_seq_num'         
31 5 'Structure model' '_pdbx_struct_assembly.details'            
32 5 'Structure model' '_pdbx_struct_assembly.method_details'     
33 5 'Structure model' '_pdbx_struct_assembly.oligomeric_count'   
34 5 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 
35 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'      
36 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       3.8 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CCP4      phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1DX4 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'RESIDUES 103-136 ARE MISSING DUE TO DISORDER.' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    238 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O3 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SO4 
_pdbx_validate_close_contact.auth_seq_id_2    601 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A ASN 422 ? ? N A PRO 423 ? ? CD A PRO 423 ? ? 113.61 128.40 -14.79 2.10 Y 
2 1 CA A PRO 423 ? ? N A PRO 423 ? ? CD A PRO 423 ? ? 102.33 111.70 -9.37  1.40 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 38  ? ? -67.17  67.14   
2  1 GLU A 40  ? ? 55.53   -114.19 
3  1 PHE A 44  ? ? 67.93   -14.96  
4  1 ALA A 59  ? ? -106.41 55.99   
5  1 LEU A 94  ? ? -69.83  84.07   
6  1 THR A 138 ? ? -5.74   108.06  
7  1 ASN A 139 ? ? 169.99  28.96   
8  1 PHE A 152 ? ? 58.49   10.49   
9  1 ASN A 172 ? ? 60.75   63.72   
10 1 ASN A 205 ? ? 56.84   19.67   
11 1 PRO A 229 ? ? -38.78  -37.80  
12 1 TRP A 231 ? ? -108.19 53.76   
13 1 SER A 238 ? ? 68.90   -142.90 
14 1 ARG A 254 ? ? -33.55  122.65  
15 1 ASN A 291 ? ? 101.75  -36.67  
16 1 ASN A 300 ? ? -117.88 75.19   
17 1 SER A 325 ? ? -77.75  -81.95  
18 1 ALA A 339 ? ? -126.01 -86.67  
19 1 ALA A 343 ? ? -114.32 -159.35 
20 1 PRO A 345 ? ? -40.04  -8.73   
21 1 LYS A 350 ? ? -19.95  -37.35  
22 1 LEU A 354 ? ? -82.81  34.22   
23 1 PRO A 423 ? ? -70.19  -81.41  
24 1 TYR A 425 ? ? 125.07  -43.84  
25 1 PHE A 440 ? ? -132.23 -76.46  
26 1 HIS A 480 ? ? -31.92  119.77  
27 1 ASP A 565 ? ? -150.83 -60.16  
28 1 SER A 572 ? ? -49.70  92.81   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? A VAL 1   
2  1 Y 1 A ILE 2   ? A ILE 2   
3  1 Y 1 A LYS 103 ? A LYS 103 
4  1 Y 1 A ALA 104 ? A ALA 104 
5  1 Y 1 A ARG 105 ? A ARG 105 
6  1 Y 1 A LEU 106 ? A LEU 106 
7  1 Y 1 A ARG 107 ? A ARG 107 
8  1 Y 1 A HIS 108 ? A HIS 108 
9  1 Y 1 A GLY 109 ? A GLY 109 
10 1 Y 1 A ARG 110 ? A ARG 110 
11 1 Y 1 A GLY 111 ? A GLY 111 
12 1 Y 1 A ALA 112 ? A ALA 112 
13 1 Y 1 A ASN 113 ? A ASN 113 
14 1 Y 1 A GLY 114 ? A GLY 114 
15 1 Y 1 A GLY 115 ? A GLY 115 
16 1 Y 1 A GLU 116 ? A GLU 116 
17 1 Y 1 A HIS 117 ? A HIS 117 
18 1 Y 1 A PRO 118 ? A PRO 118 
19 1 Y 1 A ASN 119 ? A ASN 119 
20 1 Y 1 A GLY 120 ? A GLY 120 
21 1 Y 1 A LYS 121 ? A LYS 121 
22 1 Y 1 A GLN 122 ? A GLN 122 
23 1 Y 1 A ALA 123 ? A ALA 123 
24 1 Y 1 A ASP 124 ? A ASP 124 
25 1 Y 1 A THR 125 ? A THR 125 
26 1 Y 1 A ASP 126 ? A ASP 126 
27 1 Y 1 A HIS 127 ? A HIS 127 
28 1 Y 1 A LEU 128 ? A LEU 128 
29 1 Y 1 A ILE 129 ? A ILE 129 
30 1 Y 1 A HIS 130 ? A HIS 130 
31 1 Y 1 A ASN 131 ? A ASN 131 
32 1 Y 1 A GLY 132 ? A GLY 132 
33 1 Y 1 A ASN 133 ? A ASN 133 
34 1 Y 1 A PRO 134 ? A PRO 134 
35 1 Y 1 A GLN 135 ? A GLN 135 
36 1 Y 1 A ASN 136 ? A ASN 136 
37 1 Y 1 A ALA 574 ? A ALA 574 
38 1 Y 1 A GLY 575 ? A GLY 575 
39 1 Y 1 A THR 576 ? A THR 576 
40 1 Y 1 A CYS 577 ? A CYS 577 
41 1 Y 1 A ASP 578 ? A ASP 578 
42 1 Y 1 A GLY 579 ? A GLY 579 
43 1 Y 1 A ASP 580 ? A ASP 580 
44 1 Y 1 A SER 581 ? A SER 581 
45 1 Y 1 A GLY 582 ? A GLY 582 
46 1 Y 1 A SER 583 ? A SER 583 
47 1 Y 1 A ALA 584 ? A ALA 584 
48 1 Y 1 A SER 585 ? A SER 585 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 A NAG 1575 n 
B 2 NAG 2 B NAG 2 A NAG 1577 n 
B 2 MAN 3 B MAN 3 A MAN 1578 n 
B 2 BMA 4 B BMA 4 A BMA 1579 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-3DManpa1-4DGlcpNAcb1-4DGlcpNAcb1-                                                           
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/3,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5][a1122h-1b_1-5]/1-1-2-3/a4-b1_b4-c1_c3-d1' WURCS PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-Manp]{[(3+1)][b-D-Manp]{}}}}}'            LINUCS PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 MAN C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 BMA C1 O1 3 MAN O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 MAN 3 n 
2 BMA 4 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION'                                        SO4 
4 2-acetamido-2-deoxy-beta-D-glucopyranose             NAG 
5 '9-(3-PHENYLMETHYLAMINO)-1,2,3,4-TETRAHYDROACRIDINE' 760 
6 water                                                HOH 
#