data_1DXS
# 
_entry.id   1DXS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DXS         
PDBE  EBI-4375     
WWPDB D_1290004375 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1COK 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'STRUCTURE OF THE C-TERMINAL DOMAIN OF P73' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DXS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-01-15 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wang, W.K.' 1 ? 
'Chen, Y.W.' 2 ? 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of the C-Terminal Sterile Alpha-Motif (Sam) Domain of Human P73 Alpha'                               
'Acta Crystallogr.,Sect.D' 57 545  ? 2001 ABCRE6 DK 0907-4449 0766 ? 11264583 10.1107/S0907444901002529 
1       'Crystallization and Preliminary Crystallographic Studies of a Sam Domain at the C-Terminus of Human P73 Alpha' 
'Acta Crystallogr.,Sect.D' 56 769  ? 2000 ABCRE6 DK 0907-4449 0766 ? 10818360 10.1107/S0907444900005059 
2       'Solution Structure of a Conserved C-Terminal Domain of P73 with Structural Homology to the Sam Domain'         'Embo J.' 
18 4438 ? 1999 EMJODG UK 0261-4189 0897 ? 10449409 10.1093/EMBOJ/18.16.4438  
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, W.K.'       1  ? 
primary 'Bycroft, M.'      2  ? 
primary 'Foster, N.W.'     3  ? 
primary 'Buckle, A.M.'     4  ? 
primary 'Fersht, A.R.'     5  ? 
primary 'Chen, Y.W.'       6  ? 
1       'Wang, W.K.'       7  ? 
1       'Proctor, M.'      8  ? 
1       'Buckle, A.M.'     9  ? 
1       'Bycroft, M.'      10 ? 
1       'Chen, Y.W.'       11 ? 
2       'Chi, S.-W.'       12 ? 
2       'Ayed, A.'         13 ? 
2       'Arrowsmith, C.H.' 14 ? 
# 
_cell.entry_id           1DXS 
_cell.length_a           32.020 
_cell.length_b           32.020 
_cell.length_c           133.840 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DXS 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'P53-LIKE TRANSCRIPTION FACTOR' 9026.124 1  ? ? 'C-TERMINAL STERILE ALPHA MOTIF (SAM) DOMAIN' ? 
2 water   nat water                           18.015   26 ? ? ?                                             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSS 
_entity_poly.pdbx_seq_one_letter_code_can   GSYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  TYR n 
1 4  HIS n 
1 5  ALA n 
1 6  ASP n 
1 7  PRO n 
1 8  SER n 
1 9  LEU n 
1 10 VAL n 
1 11 SER n 
1 12 PHE n 
1 13 LEU n 
1 14 THR n 
1 15 GLY n 
1 16 LEU n 
1 17 GLY n 
1 18 CYS n 
1 19 PRO n 
1 20 ASN n 
1 21 CYS n 
1 22 ILE n 
1 23 GLU n 
1 24 TYR n 
1 25 PHE n 
1 26 THR n 
1 27 SER n 
1 28 GLN n 
1 29 GLY n 
1 30 LEU n 
1 31 GLN n 
1 32 SER n 
1 33 ILE n 
1 34 TYR n 
1 35 HIS n 
1 36 LEU n 
1 37 GLN n 
1 38 ASN n 
1 39 LEU n 
1 40 THR n 
1 41 ILE n 
1 42 GLU n 
1 43 ASP n 
1 44 LEU n 
1 45 GLY n 
1 46 ALA n 
1 47 LEU n 
1 48 LYS n 
1 49 ILE n 
1 50 PRO n 
1 51 GLU n 
1 52 GLN n 
1 53 TYR n 
1 54 ARG n 
1 55 MET n 
1 56 THR n 
1 57 ILE n 
1 58 TRP n 
1 59 ARG n 
1 60 GLY n 
1 61 LEU n 
1 62 GLN n 
1 63 ASP n 
1 64 LEU n 
1 65 LYS n 
1 66 GLN n 
1 67 GLY n 
1 68 HIS n 
1 69 ASP n 
1 70 TYR n 
1 71 SER n 
1 72 THR n 
1 73 ALA n 
1 74 GLN n 
1 75 GLN n 
1 76 LEU n 
1 77 LEU n 
1 78 ARG n 
1 79 SER n 
1 80 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 P73 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEUS 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              C41 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'MODIFIED PRESET A' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1DXS   1 ? ? 1DXS   ? 
2 UNP O15350 1 ? ? O15350 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DXS A 1 ? 2  ? 1DXS   -2  ? -1  ? -2 -1 
2 2 1DXS A 3 ? 80 ? O15350 487 ? 564 ? 1  78 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DXS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.93 
_exptl_crystal.density_percent_sol   36 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'CRYSTALLIZED IN 0.1M TRIS-HCL PH8.5, 2.0M MONO-AMMONIUM DIHYDROGEN PHOSPHATE, AT 290K., pH 8.50' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100.0 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-06-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1DXS 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.000 
_reflns.d_resolution_high            2.540 
_reflns.number_obs                   2510 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            0.07300 
_reflns.pdbx_Rsym_value              0.06700 
_reflns.pdbx_netI_over_sigmaI        7.6000 
_reflns.B_iso_Wilson_estimate        59.4 
_reflns.pdbx_redundancy              6.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.54 
_reflns_shell.d_res_low              2.71 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           0.40800 
_reflns_shell.pdbx_Rsym_value        0.37700 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        6.80 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1DXS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     2510 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.0 
_refine.ls_d_res_high                            2.54 
_refine.ls_percent_reflns_obs                    94.9 
_refine.ls_R_factor_obs                          0.275 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.275 
_refine.ls_R_factor_R_free                       0.346 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.2 
_refine.ls_number_reflns_R_free                  269 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               62.1 
_refine.aniso_B[1][1]                            -9.93 
_refine.aniso_B[2][2]                            -9.93 
_refine.aniso_B[3][3]                            19.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'MASKED FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.352 
_refine.solvent_model_param_bsol                 92.7 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'C TERMINAL RESIDUES ARE NOT SEEN IN THE DENSITY MAPS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1COK' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             UNRESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1DXS 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.57 
_refine_analyze.Luzzati_sigma_a_free            0.55 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        441 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             26 
_refine_hist.number_atoms_total               467 
_refine_hist.d_res_high                       2.54 
_refine_hist.d_res_low                        26.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      20.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.71  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             7.8   ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            12.1  ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             14.0  ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            19.4  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.54 
_refine_ls_shell.d_res_low                        2.63 
_refine_ls_shell.number_reflns_R_work             207 
_refine_ls_shell.R_factor_R_work                  0.351 
_refine_ls_shell.percent_reflns_obs               96.4 
_refine_ls_shell.R_factor_R_free                  0.483 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            12.9 
_refine_ls_shell.number_reflns_R_free             32 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
# 
_struct.entry_id                  1DXS 
_struct.title                     
'Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha splice variant' 
_struct.pdbx_descriptor           'P53-LIKE TRANSCRIPTION FACTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DXS 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'P73 SAM-LIKE DOMAIN, GENE REGULATION, P53 P63 HOMOLOGUE, STERILE ALPHA MOTIF, TUMOUR SUPRESSOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'BIOLOGICAL_UNIT: MONOMER' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 8  ? LEU A 16 ? SER A 6  LEU A 14 1 ? 9  
HELX_P HELX_P2 2 CYS A 21 ? SER A 27 ? CYS A 19 SER A 25 1 ? 7  
HELX_P HELX_P3 3 SER A 32 ? ASN A 38 ? SER A 30 ASN A 36 1 ? 7  
HELX_P HELX_P4 4 THR A 40 ? LEU A 47 ? THR A 38 LEU A 45 1 ? 8  
HELX_P HELX_P5 5 TYR A 53 ? LEU A 64 ? TYR A 51 LEU A 62 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1DXS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DXS 
_atom_sites.fract_transf_matrix[1][1]   0.031230 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.031230 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007472 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . SER A 1 8  ? 27.556 15.405 35.206 1.00 63.01  ? 6    SER A N   1 
ATOM   2   C CA  . SER A 1 8  ? 27.815 16.739 34.595 1.00 63.01  ? 6    SER A CA  1 
ATOM   3   C C   . SER A 1 8  ? 26.768 17.021 33.524 1.00 63.01  ? 6    SER A C   1 
ATOM   4   O O   . SER A 1 8  ? 26.257 18.136 33.430 1.00 63.01  ? 6    SER A O   1 
ATOM   5   C CB  . SER A 1 8  ? 29.214 16.777 33.987 1.00 30.35  ? 6    SER A CB  1 
ATOM   6   N N   . LEU A 1 9  ? 26.456 16.009 32.715 1.00 40.50  ? 7    LEU A N   1 
ATOM   7   C CA  . LEU A 1 9  ? 25.449 16.151 31.669 1.00 40.50  ? 7    LEU A CA  1 
ATOM   8   C C   . LEU A 1 9  ? 24.103 16.512 32.282 1.00 40.50  ? 7    LEU A C   1 
ATOM   9   O O   . LEU A 1 9  ? 23.397 17.400 31.803 1.00 40.50  ? 7    LEU A O   1 
ATOM   10  C CB  . LEU A 1 9  ? 25.290 14.846 30.896 1.00 33.03  ? 7    LEU A CB  1 
ATOM   11  C CG  . LEU A 1 9  ? 24.174 14.903 29.856 1.00 33.03  ? 7    LEU A CG  1 
ATOM   12  C CD1 . LEU A 1 9  ? 24.595 15.831 28.720 1.00 33.03  ? 7    LEU A CD1 1 
ATOM   13  C CD2 . LEU A 1 9  ? 23.887 13.515 29.330 1.00 33.03  ? 7    LEU A CD2 1 
ATOM   14  N N   . VAL A 1 10 ? 23.749 15.793 33.340 1.00 45.39  ? 8    VAL A N   1 
ATOM   15  C CA  . VAL A 1 10 ? 22.495 16.030 34.030 1.00 45.39  ? 8    VAL A CA  1 
ATOM   16  C C   . VAL A 1 10 ? 22.490 17.425 34.632 1.00 45.39  ? 8    VAL A C   1 
ATOM   17  O O   . VAL A 1 10 ? 21.515 18.152 34.508 1.00 45.39  ? 8    VAL A O   1 
ATOM   18  C CB  . VAL A 1 10 ? 22.268 15.001 35.162 1.00 32.63  ? 8    VAL A CB  1 
ATOM   19  C CG1 . VAL A 1 10 ? 21.112 15.459 36.052 1.00 32.63  ? 8    VAL A CG1 1 
ATOM   20  C CG2 . VAL A 1 10 ? 21.957 13.623 34.563 1.00 32.63  ? 8    VAL A CG2 1 
ATOM   21  N N   . SER A 1 11 ? 23.586 17.794 35.284 1.00 43.12  ? 9    SER A N   1 
ATOM   22  C CA  . SER A 1 11 ? 23.685 19.112 35.903 1.00 43.12  ? 9    SER A CA  1 
ATOM   23  C C   . SER A 1 11 ? 23.654 20.169 34.805 1.00 43.12  ? 9    SER A C   1 
ATOM   24  O O   . SER A 1 11 ? 22.912 21.155 34.885 1.00 43.12  ? 9    SER A O   1 
ATOM   25  C CB  . SER A 1 11 ? 24.982 19.232 36.706 1.00 61.67  ? 9    SER A CB  1 
ATOM   26  O OG  . SER A 1 11 ? 26.112 19.057 35.874 1.00 61.67  ? 9    SER A OG  1 
ATOM   27  N N   . PHE A 1 12 ? 24.448 19.940 33.764 1.00 51.11  ? 10   PHE A N   1 
ATOM   28  C CA  . PHE A 1 12 ? 24.525 20.878 32.657 1.00 51.11  ? 10   PHE A CA  1 
ATOM   29  C C   . PHE A 1 12 ? 23.147 21.314 32.149 1.00 51.11  ? 10   PHE A C   1 
ATOM   30  O O   . PHE A 1 12 ? 22.796 22.486 32.244 1.00 51.11  ? 10   PHE A O   1 
ATOM   31  C CB  . PHE A 1 12 ? 25.347 20.278 31.509 1.00 61.98  ? 10   PHE A CB  1 
ATOM   32  C CG  . PHE A 1 12 ? 25.471 21.186 30.319 1.00 61.98  ? 10   PHE A CG  1 
ATOM   33  C CD1 . PHE A 1 12 ? 26.173 22.382 30.410 1.00 61.98  ? 10   PHE A CD1 1 
ATOM   34  C CD2 . PHE A 1 12 ? 24.856 20.861 29.113 1.00 61.98  ? 10   PHE A CD2 1 
ATOM   35  C CE1 . PHE A 1 12 ? 26.259 23.244 29.319 1.00 61.98  ? 10   PHE A CE1 1 
ATOM   36  C CE2 . PHE A 1 12 ? 24.937 21.720 28.012 1.00 61.98  ? 10   PHE A CE2 1 
ATOM   37  C CZ  . PHE A 1 12 ? 25.640 22.914 28.118 1.00 61.98  ? 10   PHE A CZ  1 
ATOM   38  N N   . LEU A 1 13 ? 22.367 20.380 31.615 1.00 55.48  ? 11   LEU A N   1 
ATOM   39  C CA  . LEU A 1 13 ? 21.050 20.724 31.095 1.00 55.48  ? 11   LEU A CA  1 
ATOM   40  C C   . LEU A 1 13 ? 20.163 21.383 32.148 1.00 55.48  ? 11   LEU A C   1 
ATOM   41  O O   . LEU A 1 13 ? 19.365 22.277 31.834 1.00 55.48  ? 11   LEU A O   1 
ATOM   42  C CB  . LEU A 1 13 ? 20.364 19.477 30.518 1.00 33.84  ? 11   LEU A CB  1 
ATOM   43  C CG  . LEU A 1 13 ? 21.189 18.769 29.428 1.00 33.84  ? 11   LEU A CG  1 
ATOM   44  C CD1 . LEU A 1 13 ? 20.330 17.748 28.682 1.00 33.84  ? 11   LEU A CD1 1 
ATOM   45  C CD2 . LEU A 1 13 ? 21.735 19.810 28.453 1.00 33.84  ? 11   LEU A CD2 1 
ATOM   46  N N   . THR A 1 14 ? 20.308 20.948 33.399 1.00 49.09  ? 12   THR A N   1 
ATOM   47  C CA  . THR A 1 14 ? 19.518 21.505 34.493 1.00 49.09  ? 12   THR A CA  1 
ATOM   48  C C   . THR A 1 14 ? 19.930 22.945 34.837 1.00 49.09  ? 12   THR A C   1 
ATOM   49  O O   . THR A 1 14 ? 19.079 23.822 34.969 1.00 49.09  ? 12   THR A O   1 
ATOM   50  C CB  . THR A 1 14 ? 19.623 20.624 35.764 1.00 62.37  ? 12   THR A CB  1 
ATOM   51  O OG1 . THR A 1 14 ? 20.997 20.459 36.124 1.00 62.37  ? 12   THR A OG1 1 
ATOM   52  C CG2 . THR A 1 14 ? 19.011 19.256 35.521 1.00 62.37  ? 12   THR A CG2 1 
ATOM   53  N N   . GLY A 1 15 ? 21.230 23.186 34.973 1.00 74.88  ? 13   GLY A N   1 
ATOM   54  C CA  . GLY A 1 15 ? 21.700 24.524 35.295 1.00 74.88  ? 13   GLY A CA  1 
ATOM   55  C C   . GLY A 1 15 ? 21.518 25.487 34.139 1.00 74.88  ? 13   GLY A C   1 
ATOM   56  O O   . GLY A 1 15 ? 21.821 26.675 34.243 1.00 74.88  ? 13   GLY A O   1 
ATOM   57  N N   . LEU A 1 16 ? 21.017 24.957 33.030 1.00 52.17  ? 14   LEU A N   1 
ATOM   58  C CA  . LEU A 1 16 ? 20.772 25.716 31.811 1.00 52.17  ? 14   LEU A CA  1 
ATOM   59  C C   . LEU A 1 16 ? 19.264 25.888 31.712 1.00 52.17  ? 14   LEU A C   1 
ATOM   60  O O   . LEU A 1 16 ? 18.763 26.631 30.870 1.00 52.17  ? 14   LEU A O   1 
ATOM   61  C CB  . LEU A 1 16 ? 21.263 24.920 30.602 1.00 67.43  ? 14   LEU A CB  1 
ATOM   62  C CG  . LEU A 1 16 ? 21.976 25.613 29.443 1.00 67.43  ? 14   LEU A CG  1 
ATOM   63  C CD1 . LEU A 1 16 ? 23.384 25.997 29.865 1.00 67.43  ? 14   LEU A CD1 1 
ATOM   64  C CD2 . LEU A 1 16 ? 22.035 24.669 28.257 1.00 67.43  ? 14   LEU A CD2 1 
ATOM   65  N N   . GLY A 1 17 ? 18.551 25.174 32.578 1.00 50.74  ? 15   GLY A N   1 
ATOM   66  C CA  . GLY A 1 17 ? 17.099 25.233 32.599 1.00 50.74  ? 15   GLY A CA  1 
ATOM   67  C C   . GLY A 1 17 ? 16.364 24.313 31.629 1.00 50.74  ? 15   GLY A C   1 
ATOM   68  O O   . GLY A 1 17 ? 15.222 24.591 31.278 1.00 50.74  ? 15   GLY A O   1 
ATOM   69  N N   . CYS A 1 18 ? 16.984 23.222 31.182 1.00 54.88  ? 16   CYS A N   1 
ATOM   70  C CA  . CYS A 1 18 ? 16.294 22.315 30.254 1.00 54.88  ? 16   CYS A CA  1 
ATOM   71  C C   . CYS A 1 18 ? 16.545 20.820 30.508 1.00 54.88  ? 16   CYS A C   1 
ATOM   72  O O   . CYS A 1 18 ? 16.996 20.091 29.625 1.00 54.88  ? 16   CYS A O   1 
ATOM   73  C CB  . CYS A 1 18 ? 16.662 22.677 28.812 1.00 80.89  ? 16   CYS A CB  1 
ATOM   74  S SG  . CYS A 1 18 ? 18.374 23.189 28.602 1.00 80.89  ? 16   CYS A SG  1 
ATOM   75  N N   . PRO A 1 19 ? 16.229 20.347 31.724 1.00 46.38  ? 17   PRO A N   1 
ATOM   76  C CA  . PRO A 1 19 ? 16.406 18.950 32.131 1.00 46.38  ? 17   PRO A CA  1 
ATOM   77  C C   . PRO A 1 19 ? 15.492 18.041 31.323 1.00 46.38  ? 17   PRO A C   1 
ATOM   78  O O   . PRO A 1 19 ? 15.595 16.814 31.372 1.00 46.38  ? 17   PRO A O   1 
ATOM   79  C CB  . PRO A 1 19 ? 16.018 18.970 33.607 1.00 92.95  ? 17   PRO A CB  1 
ATOM   80  C CG  . PRO A 1 19 ? 16.260 20.393 34.017 1.00 92.95  ? 17   PRO A CG  1 
ATOM   81  C CD  . PRO A 1 19 ? 15.725 21.148 32.848 1.00 92.95  ? 17   PRO A CD  1 
ATOM   82  N N   . ASN A 1 20 ? 14.581 18.672 30.596 1.00 41.57  ? 18   ASN A N   1 
ATOM   83  C CA  . ASN A 1 20 ? 13.624 17.972 29.757 1.00 41.57  ? 18   ASN A CA  1 
ATOM   84  C C   . ASN A 1 20 ? 14.321 17.601 28.450 1.00 41.57  ? 18   ASN A C   1 
ATOM   85  O O   . ASN A 1 20 ? 13.828 16.792 27.659 1.00 41.57  ? 18   ASN A O   1 
ATOM   86  C CB  . ASN A 1 20 ? 12.412 18.882 29.510 1.00 59.25  ? 18   ASN A CB  1 
ATOM   87  C CG  . ASN A 1 20 ? 12.792 20.216 28.886 1.00 59.25  ? 18   ASN A CG  1 
ATOM   88  O OD1 . ASN A 1 20 ? 13.880 20.745 29.123 1.00 59.25  ? 18   ASN A OD1 1 
ATOM   89  N ND2 . ASN A 1 20 ? 11.881 20.774 28.095 1.00 59.25  ? 18   ASN A ND2 1 
ATOM   90  N N   . CYS A 1 21 ? 15.487 18.196 28.239 1.00 44.01  ? 19   CYS A N   1 
ATOM   91  C CA  . CYS A 1 21 ? 16.263 17.919 27.043 1.00 44.01  ? 19   CYS A CA  1 
ATOM   92  C C   . CYS A 1 21 ? 17.191 16.744 27.279 1.00 44.01  ? 19   CYS A C   1 
ATOM   93  O O   . CYS A 1 21 ? 17.777 16.205 26.329 1.00 44.01  ? 19   CYS A O   1 
ATOM   94  C CB  . CYS A 1 21 ? 17.088 19.150 26.642 1.00 49.25  ? 19   CYS A CB  1 
ATOM   95  S SG  . CYS A 1 21 ? 16.107 20.500 25.974 1.00 49.25  ? 19   CYS A SG  1 
ATOM   96  N N   . ILE A 1 22 ? 17.324 16.351 28.545 1.00 30.63  ? 20   ILE A N   1 
ATOM   97  C CA  . ILE A 1 22 ? 18.207 15.251 28.898 1.00 30.63  ? 20   ILE A CA  1 
ATOM   98  C C   . ILE A 1 22 ? 17.911 13.977 28.128 1.00 30.63  ? 20   ILE A C   1 
ATOM   99  O O   . ILE A 1 22 ? 18.815 13.358 27.582 1.00 30.63  ? 20   ILE A O   1 
ATOM   100 C CB  . ILE A 1 22 ? 18.167 14.929 30.422 1.00 41.24  ? 20   ILE A CB  1 
ATOM   101 C CG1 . ILE A 1 22 ? 18.952 15.989 31.205 1.00 41.24  ? 20   ILE A CG1 1 
ATOM   102 C CG2 . ILE A 1 22 ? 18.786 13.554 30.680 1.00 41.24  ? 20   ILE A CG2 1 
ATOM   103 C CD1 . ILE A 1 22 ? 18.826 15.877 32.704 1.00 41.24  ? 20   ILE A CD1 1 
ATOM   104 N N   . GLU A 1 23 ? 16.646 13.591 28.077 1.00 49.64  ? 21   GLU A N   1 
ATOM   105 C CA  . GLU A 1 23 ? 16.281 12.370 27.389 1.00 49.64  ? 21   GLU A CA  1 
ATOM   106 C C   . GLU A 1 23 ? 16.799 12.294 25.962 1.00 49.64  ? 21   GLU A C   1 
ATOM   107 O O   . GLU A 1 23 ? 17.251 11.239 25.522 1.00 49.64  ? 21   GLU A O   1 
ATOM   108 C CB  . GLU A 1 23 ? 14.766 12.187 27.397 1.00 73.91  ? 21   GLU A CB  1 
ATOM   109 C CG  . GLU A 1 23 ? 14.330 11.038 28.280 1.00 73.91  ? 21   GLU A CG  1 
ATOM   110 C CD  . GLU A 1 23 ? 13.149 10.286 27.711 1.00 73.91  ? 21   GLU A CD  1 
ATOM   111 O OE1 . GLU A 1 23 ? 12.056 10.883 27.612 1.00 73.91  ? 21   GLU A OE1 1 
ATOM   112 O OE2 . GLU A 1 23 ? 13.317 9.097  27.358 1.00 73.91  ? 21   GLU A OE2 1 
ATOM   113 N N   . TYR A 1 24 ? 16.736 13.417 25.251 1.00 38.25  ? 22   TYR A N   1 
ATOM   114 C CA  . TYR A 1 24 ? 17.184 13.479 23.872 1.00 38.25  ? 22   TYR A CA  1 
ATOM   115 C C   . TYR A 1 24 ? 18.577 12.915 23.672 1.00 38.25  ? 22   TYR A C   1 
ATOM   116 O O   . TYR A 1 24 ? 18.836 12.235 22.683 1.00 38.25  ? 22   TYR A O   1 
ATOM   117 C CB  . TYR A 1 24 ? 17.148 14.919 23.369 1.00 61.61  ? 22   TYR A CB  1 
ATOM   118 C CG  . TYR A 1 24 ? 15.776 15.526 23.425 1.00 61.61  ? 22   TYR A CG  1 
ATOM   119 C CD1 . TYR A 1 24 ? 14.756 15.062 22.598 1.00 61.61  ? 22   TYR A CD1 1 
ATOM   120 C CD2 . TYR A 1 24 ? 15.474 16.527 24.345 1.00 61.61  ? 22   TYR A CD2 1 
ATOM   121 C CE1 . TYR A 1 24 ? 13.469 15.576 22.690 1.00 61.61  ? 22   TYR A CE1 1 
ATOM   122 C CE2 . TYR A 1 24 ? 14.187 17.049 24.447 1.00 61.61  ? 22   TYR A CE2 1 
ATOM   123 C CZ  . TYR A 1 24 ? 13.189 16.566 23.617 1.00 61.61  ? 22   TYR A CZ  1 
ATOM   124 O OH  . TYR A 1 24 ? 11.912 17.066 23.721 1.00 61.61  ? 22   TYR A OH  1 
ATOM   125 N N   . PHE A 1 25 ? 19.474 13.196 24.608 1.00 36.22  ? 23   PHE A N   1 
ATOM   126 C CA  . PHE A 1 25 ? 20.838 12.723 24.490 1.00 36.22  ? 23   PHE A CA  1 
ATOM   127 C C   . PHE A 1 25 ? 21.020 11.310 25.016 1.00 36.22  ? 23   PHE A C   1 
ATOM   128 O O   . PHE A 1 25 ? 21.586 10.459 24.329 1.00 36.22  ? 23   PHE A O   1 
ATOM   129 C CB  . PHE A 1 25 ? 21.785 13.665 25.220 1.00 38.69  ? 23   PHE A CB  1 
ATOM   130 C CG  . PHE A 1 25 ? 21.698 15.078 24.753 1.00 38.69  ? 23   PHE A CG  1 
ATOM   131 C CD1 . PHE A 1 25 ? 20.754 15.949 25.298 1.00 38.69  ? 23   PHE A CD1 1 
ATOM   132 C CD2 . PHE A 1 25 ? 22.522 15.534 23.727 1.00 38.69  ? 23   PHE A CD2 1 
ATOM   133 C CE1 . PHE A 1 25 ? 20.627 17.258 24.824 1.00 38.69  ? 23   PHE A CE1 1 
ATOM   134 C CE2 . PHE A 1 25 ? 22.400 16.835 23.252 1.00 38.69  ? 23   PHE A CE2 1 
ATOM   135 C CZ  . PHE A 1 25 ? 21.446 17.702 23.804 1.00 38.69  ? 23   PHE A CZ  1 
ATOM   136 N N   . THR A 1 26 ? 20.543 11.061 26.235 1.00 44.94  ? 24   THR A N   1 
ATOM   137 C CA  . THR A 1 26 ? 20.669 9.744  26.849 1.00 44.94  ? 24   THR A CA  1 
ATOM   138 C C   . THR A 1 26 ? 19.893 8.710  26.061 1.00 44.94  ? 24   THR A C   1 
ATOM   139 O O   . THR A 1 26 ? 20.120 7.522  26.204 1.00 44.94  ? 24   THR A O   1 
ATOM   140 C CB  . THR A 1 26 ? 20.160 9.734  28.314 1.00 28.62  ? 24   THR A CB  1 
ATOM   141 O OG1 . THR A 1 26 ? 18.768 10.065 28.340 1.00 28.62  ? 24   THR A OG1 1 
ATOM   142 C CG2 . THR A 1 26 ? 20.946 10.718 29.155 1.00 28.62  ? 24   THR A CG2 1 
ATOM   143 N N   . SER A 1 27 ? 18.977 9.166  25.223 1.00 47.57  ? 25   SER A N   1 
ATOM   144 C CA  . SER A 1 27 ? 18.198 8.252  24.411 1.00 47.57  ? 25   SER A CA  1 
ATOM   145 C C   . SER A 1 27 ? 19.075 7.688  23.286 1.00 47.57  ? 25   SER A C   1 
ATOM   146 O O   . SER A 1 27 ? 18.815 6.611  22.759 1.00 47.57  ? 25   SER A O   1 
ATOM   147 C CB  . SER A 1 27 ? 16.995 8.980  23.819 1.00 54.62  ? 25   SER A CB  1 
ATOM   148 O OG  . SER A 1 27 ? 16.049 8.046  23.341 1.00 54.62  ? 25   SER A OG  1 
ATOM   149 N N   . GLN A 1 28 ? 20.120 8.424  22.926 1.00 51.46  ? 26   GLN A N   1 
ATOM   150 C CA  . GLN A 1 28 ? 21.031 7.999  21.873 1.00 51.46  ? 26   GLN A CA  1 
ATOM   151 C C   . GLN A 1 28 ? 22.336 7.448  22.429 1.00 51.46  ? 26   GLN A C   1 
ATOM   152 O O   . GLN A 1 28 ? 23.245 7.102  21.670 1.00 51.46  ? 26   GLN A O   1 
ATOM   153 C CB  . GLN A 1 28 ? 21.337 9.160  20.926 1.00 37.12  ? 26   GLN A CB  1 
ATOM   154 C CG  . GLN A 1 28 ? 20.163 9.594  20.074 1.00 37.12  ? 26   GLN A CG  1 
ATOM   155 C CD  . GLN A 1 28 ? 19.641 8.481  19.192 1.00 37.12  ? 26   GLN A CD  1 
ATOM   156 O OE1 . GLN A 1 28 ? 20.382 7.568  18.817 1.00 37.12  ? 26   GLN A OE1 1 
ATOM   157 N NE2 . GLN A 1 28 ? 18.364 8.555  18.842 1.00 37.12  ? 26   GLN A NE2 1 
ATOM   158 N N   . GLY A 1 29 ? 22.433 7.364  23.751 1.00 34.01  ? 27   GLY A N   1 
ATOM   159 C CA  . GLY A 1 29 ? 23.646 6.837  24.349 1.00 34.01  ? 27   GLY A CA  1 
ATOM   160 C C   . GLY A 1 29 ? 24.658 7.917  24.656 1.00 34.01  ? 27   GLY A C   1 
ATOM   161 O O   . GLY A 1 29 ? 25.802 7.631  25.008 1.00 34.01  ? 27   GLY A O   1 
ATOM   162 N N   . LEU A 1 30 ? 24.229 9.168  24.508 1.00 44.80  ? 28   LEU A N   1 
ATOM   163 C CA  . LEU A 1 30 ? 25.074 10.322 24.785 1.00 44.80  ? 28   LEU A CA  1 
ATOM   164 C C   . LEU A 1 30 ? 24.966 10.603 26.275 1.00 44.80  ? 28   LEU A C   1 
ATOM   165 O O   . LEU A 1 30 ? 23.868 10.804 26.795 1.00 44.80  ? 28   LEU A O   1 
ATOM   166 C CB  . LEU A 1 30 ? 24.589 11.531 23.980 1.00 30.34  ? 28   LEU A CB  1 
ATOM   167 C CG  . LEU A 1 30 ? 24.550 11.326 22.461 1.00 30.34  ? 28   LEU A CG  1 
ATOM   168 C CD1 . LEU A 1 30 ? 23.899 12.501 21.769 1.00 30.34  ? 28   LEU A CD1 1 
ATOM   169 C CD2 . LEU A 1 30 ? 25.963 11.131 21.973 1.00 30.34  ? 28   LEU A CD2 1 
ATOM   170 N N   . GLN A 1 31 ? 26.107 10.608 26.954 1.00 57.36  ? 29   GLN A N   1 
ATOM   171 C CA  . GLN A 1 31 ? 26.149 10.829 28.394 1.00 57.36  ? 29   GLN A CA  1 
ATOM   172 C C   . GLN A 1 31 ? 27.395 11.613 28.794 1.00 57.36  ? 29   GLN A C   1 
ATOM   173 O O   . GLN A 1 31 ? 27.518 12.055 29.933 1.00 57.36  ? 29   GLN A O   1 
ATOM   174 C CB  . GLN A 1 31 ? 26.122 9.471  29.111 1.00 123.66 ? 29   GLN A CB  1 
ATOM   175 C CG  . GLN A 1 31 ? 26.336 9.508  30.623 1.00 123.66 ? 29   GLN A CG  1 
ATOM   176 C CD  . GLN A 1 31 ? 25.082 9.845  31.406 1.00 123.66 ? 29   GLN A CD  1 
ATOM   177 O OE1 . GLN A 1 31 ? 24.525 10.934 31.276 1.00 123.66 ? 29   GLN A OE1 1 
ATOM   178 N NE2 . GLN A 1 31 ? 24.636 8.906  32.234 1.00 123.66 ? 29   GLN A NE2 1 
ATOM   179 N N   . SER A 1 32 ? 28.310 11.789 27.848 1.00 82.90  ? 30   SER A N   1 
ATOM   180 C CA  . SER A 1 32 ? 29.553 12.515 28.091 1.00 82.90  ? 30   SER A CA  1 
ATOM   181 C C   . SER A 1 32 ? 29.501 13.951 27.599 1.00 82.90  ? 30   SER A C   1 
ATOM   182 O O   . SER A 1 32 ? 28.800 14.267 26.639 1.00 82.90  ? 30   SER A O   1 
ATOM   183 C CB  . SER A 1 32 ? 30.722 11.806 27.403 1.00 86.40  ? 30   SER A CB  1 
ATOM   184 O OG  . SER A 1 32 ? 31.868 12.645 27.351 1.00 86.40  ? 30   SER A OG  1 
ATOM   185 N N   . ILE A 1 33 ? 30.262 14.817 28.256 1.00 68.76  ? 31   ILE A N   1 
ATOM   186 C CA  . ILE A 1 33 ? 30.313 16.216 27.872 1.00 68.76  ? 31   ILE A CA  1 
ATOM   187 C C   . ILE A 1 33 ? 31.256 16.427 26.693 1.00 68.76  ? 31   ILE A C   1 
ATOM   188 O O   . ILE A 1 33 ? 31.031 17.316 25.873 1.00 68.76  ? 31   ILE A O   1 
ATOM   189 C CB  . ILE A 1 33 ? 30.766 17.097 29.047 1.00 53.81  ? 31   ILE A CB  1 
ATOM   190 C CG1 . ILE A 1 33 ? 29.641 17.198 30.076 1.00 53.81  ? 31   ILE A CG1 1 
ATOM   191 C CG2 . ILE A 1 33 ? 31.161 18.472 28.546 1.00 53.81  ? 31   ILE A CG2 1 
ATOM   192 C CD1 . ILE A 1 33 ? 28.357 17.743 29.508 1.00 53.81  ? 31   ILE A CD1 1 
ATOM   193 N N   . TYR A 1 34 ? 32.311 15.617 26.614 1.00 99.84  ? 32   TYR A N   1 
ATOM   194 C CA  . TYR A 1 34 ? 33.274 15.714 25.516 1.00 99.84  ? 32   TYR A CA  1 
ATOM   195 C C   . TYR A 1 34 ? 32.531 15.605 24.199 1.00 99.84  ? 32   TYR A C   1 
ATOM   196 O O   . TYR A 1 34 ? 32.417 16.568 23.440 1.00 99.84  ? 32   TYR A O   1 
ATOM   197 C CB  . TYR A 1 34 ? 34.291 14.573 25.569 1.00 147.19 ? 32   TYR A CB  1 
ATOM   198 C CG  . TYR A 1 34 ? 35.450 14.776 26.511 1.00 147.19 ? 32   TYR A CG  1 
ATOM   199 C CD1 . TYR A 1 34 ? 35.255 14.835 27.889 1.00 147.19 ? 32   TYR A CD1 1 
ATOM   200 C CD2 . TYR A 1 34 ? 36.751 14.878 26.022 1.00 147.19 ? 32   TYR A CD2 1 
ATOM   201 C CE1 . TYR A 1 34 ? 36.330 14.986 28.759 1.00 147.19 ? 32   TYR A CE1 1 
ATOM   202 C CE2 . TYR A 1 34 ? 37.832 15.030 26.880 1.00 147.19 ? 32   TYR A CE2 1 
ATOM   203 C CZ  . TYR A 1 34 ? 37.616 15.082 28.247 1.00 147.19 ? 32   TYR A CZ  1 
ATOM   204 O OH  . TYR A 1 34 ? 38.685 15.219 29.102 1.00 147.19 ? 32   TYR A OH  1 
ATOM   205 N N   . HIS A 1 35 ? 32.040 14.399 23.946 1.00 92.61  ? 33   HIS A N   1 
ATOM   206 C CA  . HIS A 1 35 ? 31.297 14.080 22.740 1.00 92.61  ? 33   HIS A CA  1 
ATOM   207 C C   . HIS A 1 35 ? 30.242 15.133 22.451 1.00 92.61  ? 33   HIS A C   1 
ATOM   208 O O   . HIS A 1 35 ? 30.046 15.546 21.307 1.00 92.61  ? 33   HIS A O   1 
ATOM   209 C CB  . HIS A 1 35 ? 30.636 12.722 22.898 1.00 82.86  ? 33   HIS A CB  1 
ATOM   210 N N   . LEU A 1 36 ? 29.566 15.569 23.503 1.00 53.57  ? 34   LEU A N   1 
ATOM   211 C CA  . LEU A 1 36 ? 28.508 16.559 23.372 1.00 53.57  ? 34   LEU A CA  1 
ATOM   212 C C   . LEU A 1 36 ? 28.955 17.881 22.732 1.00 53.57  ? 34   LEU A C   1 
ATOM   213 O O   . LEU A 1 36 ? 28.161 18.553 22.078 1.00 53.57  ? 34   LEU A O   1 
ATOM   214 C CB  . LEU A 1 36 ? 27.893 16.842 24.744 1.00 74.92  ? 34   LEU A CB  1 
ATOM   215 C CG  . LEU A 1 36 ? 26.366 16.925 24.745 1.00 74.92  ? 34   LEU A CG  1 
ATOM   216 C CD1 . LEU A 1 36 ? 25.788 15.536 24.523 1.00 74.92  ? 34   LEU A CD1 1 
ATOM   217 C CD2 . LEU A 1 36 ? 25.877 17.486 26.057 1.00 74.92  ? 34   LEU A CD2 1 
ATOM   218 N N   . GLN A 1 37 ? 30.224 18.238 22.907 1.00 71.42  ? 35   GLN A N   1 
ATOM   219 C CA  . GLN A 1 37 ? 30.746 19.493 22.376 1.00 71.42  ? 35   GLN A CA  1 
ATOM   220 C C   . GLN A 1 37 ? 30.926 19.578 20.861 1.00 71.42  ? 35   GLN A C   1 
ATOM   221 O O   . GLN A 1 37 ? 30.803 20.662 20.279 1.00 71.42  ? 35   GLN A O   1 
ATOM   222 C CB  . GLN A 1 37 ? 32.073 19.834 23.059 1.00 102.14 ? 35   GLN A CB  1 
ATOM   223 C CG  . GLN A 1 37 ? 31.869 20.178 24.418 1.00 102.14 ? 35   GLN A CG  1 
ATOM   224 N N   . ASN A 1 38 ? 31.217 18.452 20.218 1.00 68.53  ? 36   ASN A N   1 
ATOM   225 C CA  . ASN A 1 38 ? 31.420 18.465 18.776 1.00 68.53  ? 36   ASN A CA  1 
ATOM   226 C C   . ASN A 1 38 ? 30.152 18.232 17.959 1.00 68.53  ? 36   ASN A C   1 
ATOM   227 O O   . ASN A 1 38 ? 30.222 17.865 16.787 1.00 68.53  ? 36   ASN A O   1 
ATOM   228 C CB  . ASN A 1 38 ? 32.496 17.452 18.387 1.00 119.80 ? 36   ASN A CB  1 
ATOM   229 C CG  . ASN A 1 38 ? 32.255 16.087 18.991 1.00 119.80 ? 36   ASN A CG  1 
ATOM   230 O OD1 . ASN A 1 38 ? 31.195 15.487 18.793 1.00 119.80 ? 36   ASN A OD1 1 
ATOM   231 N ND2 . ASN A 1 38 ? 33.242 15.584 19.733 1.00 119.80 ? 36   ASN A ND2 1 
ATOM   232 N N   . LEU A 1 39 ? 28.993 18.440 18.579 1.00 42.79  ? 37   LEU A N   1 
ATOM   233 C CA  . LEU A 1 39 ? 27.728 18.296 17.873 1.00 42.79  ? 37   LEU A CA  1 
ATOM   234 C C   . LEU A 1 39 ? 27.439 19.650 17.240 1.00 42.79  ? 37   LEU A C   1 
ATOM   235 O O   . LEU A 1 39 ? 27.863 20.687 17.758 1.00 42.79  ? 37   LEU A O   1 
ATOM   236 C CB  . LEU A 1 39 ? 26.589 17.929 18.835 1.00 41.78  ? 37   LEU A CB  1 
ATOM   237 C CG  . LEU A 1 39 ? 26.501 16.488 19.361 1.00 41.78  ? 37   LEU A CG  1 
ATOM   238 C CD1 . LEU A 1 39 ? 25.390 16.407 20.410 1.00 41.78  ? 37   LEU A CD1 1 
ATOM   239 C CD2 . LEU A 1 39 ? 26.230 15.509 18.218 1.00 41.78  ? 37   LEU A CD2 1 
ATOM   240 N N   . THR A 1 40 ? 26.726 19.652 16.118 1.00 39.28  ? 38   THR A N   1 
ATOM   241 C CA  . THR A 1 40 ? 26.412 20.911 15.466 1.00 39.28  ? 38   THR A CA  1 
ATOM   242 C C   . THR A 1 40 ? 24.989 21.322 15.780 1.00 39.28  ? 38   THR A C   1 
ATOM   243 O O   . THR A 1 40 ? 24.209 20.545 16.332 1.00 39.28  ? 38   THR A O   1 
ATOM   244 C CB  . THR A 1 40 ? 26.553 20.826 13.930 1.00 35.02  ? 38   THR A CB  1 
ATOM   245 O OG1 . THR A 1 40 ? 25.615 19.874 13.412 1.00 35.02  ? 38   THR A OG1 1 
ATOM   246 C CG2 . THR A 1 40 ? 27.966 20.424 13.542 1.00 35.02  ? 38   THR A CG2 1 
ATOM   247 N N   . ILE A 1 41 ? 24.671 22.558 15.414 1.00 42.49  ? 39   ILE A N   1 
ATOM   248 C CA  . ILE A 1 41 ? 23.349 23.104 15.603 1.00 42.49  ? 39   ILE A CA  1 
ATOM   249 C C   . ILE A 1 41 ? 22.366 22.218 14.829 1.00 42.49  ? 39   ILE A C   1 
ATOM   250 O O   . ILE A 1 41 ? 21.228 22.006 15.260 1.00 42.49  ? 39   ILE A O   1 
ATOM   251 C CB  . ILE A 1 41 ? 23.302 24.574 15.088 1.00 33.14  ? 39   ILE A CB  1 
ATOM   252 C CG1 . ILE A 1 41 ? 24.305 25.419 15.874 1.00 33.14  ? 39   ILE A CG1 1 
ATOM   253 C CG2 . ILE A 1 41 ? 21.902 25.145 15.213 1.00 33.14  ? 39   ILE A CG2 1 
ATOM   254 C CD1 . ILE A 1 41 ? 24.307 26.889 15.473 1.00 33.14  ? 39   ILE A CD1 1 
ATOM   255 N N   . GLU A 1 42 ? 22.807 21.699 13.686 1.00 32.83  ? 40   GLU A N   1 
ATOM   256 C CA  . GLU A 1 42 ? 21.962 20.816 12.891 1.00 32.83  ? 40   GLU A CA  1 
ATOM   257 C C   . GLU A 1 42 ? 21.770 19.492 13.639 1.00 32.83  ? 40   GLU A C   1 
ATOM   258 O O   . GLU A 1 42 ? 20.680 18.911 13.633 1.00 32.83  ? 40   GLU A O   1 
ATOM   259 C CB  . GLU A 1 42 ? 22.594 20.557 11.521 1.00 55.53  ? 40   GLU A CB  1 
ATOM   260 C CG  . GLU A 1 42 ? 21.787 19.632 10.622 1.00 55.53  ? 40   GLU A CG  1 
ATOM   261 C CD  . GLU A 1 42 ? 22.419 19.451 9.252  1.00 55.53  ? 40   GLU A CD  1 
ATOM   262 O OE1 . GLU A 1 42 ? 23.623 19.116 9.183  1.00 55.53  ? 40   GLU A OE1 1 
ATOM   263 O OE2 . GLU A 1 42 ? 21.709 19.641 8.239  1.00 55.53  ? 40   GLU A OE2 1 
ATOM   264 N N   . ASP A 1 43 ? 22.834 19.017 14.275 1.00 37.60  ? 41   ASP A N   1 
ATOM   265 C CA  . ASP A 1 43 ? 22.775 17.781 15.043 1.00 37.60  ? 41   ASP A CA  1 
ATOM   266 C C   . ASP A 1 43 ? 21.696 17.890 16.114 1.00 37.60  ? 41   ASP A C   1 
ATOM   267 O O   . ASP A 1 43 ? 20.876 16.992 16.260 1.00 37.60  ? 41   ASP A O   1 
ATOM   268 C CB  . ASP A 1 43 ? 24.132 17.495 15.704 1.00 31.62  ? 41   ASP A CB  1 
ATOM   269 C CG  . ASP A 1 43 ? 25.138 16.936 14.734 1.00 31.62  ? 41   ASP A CG  1 
ATOM   270 O OD1 . ASP A 1 43 ? 24.716 16.548 13.631 1.00 31.62  ? 41   ASP A OD1 1 
ATOM   271 O OD2 . ASP A 1 43 ? 26.343 16.880 15.073 1.00 31.62  ? 41   ASP A OD2 1 
ATOM   272 N N   . LEU A 1 44 ? 21.696 18.993 16.855 1.00 36.49  ? 42   LEU A N   1 
ATOM   273 C CA  . LEU A 1 44 ? 20.708 19.197 17.907 1.00 36.49  ? 42   LEU A CA  1 
ATOM   274 C C   . LEU A 1 44 ? 19.307 19.095 17.333 1.00 36.49  ? 42   LEU A C   1 
ATOM   275 O O   . LEU A 1 44 ? 18.389 18.594 17.987 1.00 36.49  ? 42   LEU A O   1 
ATOM   276 C CB  . LEU A 1 44 ? 20.912 20.564 18.575 1.00 38.25  ? 42   LEU A CB  1 
ATOM   277 C CG  . LEU A 1 44 ? 22.280 20.629 19.261 1.00 38.25  ? 42   LEU A CG  1 
ATOM   278 C CD1 . LEU A 1 44 ? 22.442 21.978 19.925 1.00 38.25  ? 42   LEU A CD1 1 
ATOM   279 C CD2 . LEU A 1 44 ? 22.412 19.467 20.299 1.00 38.25  ? 42   LEU A CD2 1 
ATOM   280 N N   . GLY A 1 45 ? 19.161 19.564 16.097 1.00 41.19  ? 43   GLY A N   1 
ATOM   281 C CA  . GLY A 1 45 ? 17.878 19.519 15.435 1.00 41.19  ? 43   GLY A CA  1 
ATOM   282 C C   . GLY A 1 45 ? 17.511 18.099 15.075 1.00 41.19  ? 43   GLY A C   1 
ATOM   283 O O   . GLY A 1 45 ? 16.343 17.705 15.206 1.00 41.19  ? 43   GLY A O   1 
ATOM   284 N N   . ALA A 1 46 ? 18.498 17.328 14.617 1.00 39.93  ? 44   ALA A N   1 
ATOM   285 C CA  . ALA A 1 46 ? 18.266 15.929 14.253 1.00 39.93  ? 44   ALA A CA  1 
ATOM   286 C C   . ALA A 1 46 ? 17.889 15.149 15.506 1.00 39.93  ? 44   ALA A C   1 
ATOM   287 O O   . ALA A 1 46 ? 17.088 14.223 15.439 1.00 39.93  ? 44   ALA A O   1 
ATOM   288 C CB  . ALA A 1 46 ? 19.521 15.317 13.594 1.00 13.02  ? 44   ALA A CB  1 
ATOM   289 N N   . LEU A 1 47 ? 18.464 15.534 16.643 1.00 32.40  ? 45   LEU A N   1 
ATOM   290 C CA  . LEU A 1 47 ? 18.169 14.887 17.915 1.00 32.40  ? 45   LEU A CA  1 
ATOM   291 C C   . LEU A 1 47 ? 16.800 15.318 18.439 1.00 32.40  ? 45   LEU A C   1 
ATOM   292 O O   . LEU A 1 47 ? 16.537 15.231 19.634 1.00 32.40  ? 45   LEU A O   1 
ATOM   293 C CB  . LEU A 1 47 ? 19.236 15.230 18.962 1.00 26.45  ? 45   LEU A CB  1 
ATOM   294 C CG  . LEU A 1 47 ? 20.639 14.632 18.834 1.00 26.45  ? 45   LEU A CG  1 
ATOM   295 C CD1 . LEU A 1 47 ? 21.565 15.345 19.775 1.00 26.45  ? 45   LEU A CD1 1 
ATOM   296 C CD2 . LEU A 1 47 ? 20.614 13.117 19.144 1.00 26.45  ? 45   LEU A CD2 1 
ATOM   297 N N   . LYS A 1 48 ? 15.939 15.788 17.542 1.00 68.89  ? 46   LYS A N   1 
ATOM   298 C CA  . LYS A 1 48 ? 14.587 16.226 17.887 1.00 68.89  ? 46   LYS A CA  1 
ATOM   299 C C   . LYS A 1 48 ? 14.478 17.167 19.093 1.00 68.89  ? 46   LYS A C   1 
ATOM   300 O O   . LYS A 1 48 ? 13.465 17.176 19.800 1.00 68.89  ? 46   LYS A O   1 
ATOM   301 C CB  . LYS A 1 48 ? 13.679 15.009 18.106 1.00 57.44  ? 46   LYS A CB  1 
ATOM   302 C CG  . LYS A 1 48 ? 13.275 14.270 16.827 1.00 57.44  ? 46   LYS A CG  1 
ATOM   303 C CD  . LYS A 1 48 ? 12.217 13.198 17.141 1.00 57.44  ? 46   LYS A CD  1 
ATOM   304 C CE  . LYS A 1 48 ? 11.664 12.484 15.899 1.00 57.44  ? 46   LYS A CE  1 
ATOM   305 N NZ  . LYS A 1 48 ? 12.537 11.398 15.376 1.00 57.44  ? 46   LYS A NZ  1 
ATOM   306 N N   . ILE A 1 49 ? 15.514 17.965 19.319 1.00 73.37  ? 47   ILE A N   1 
ATOM   307 C CA  . ILE A 1 49 ? 15.520 18.908 20.432 1.00 73.37  ? 47   ILE A CA  1 
ATOM   308 C C   . ILE A 1 49 ? 14.692 20.153 20.112 1.00 73.37  ? 47   ILE A C   1 
ATOM   309 O O   . ILE A 1 49 ? 14.810 20.731 19.030 1.00 73.37  ? 47   ILE A O   1 
ATOM   310 C CB  . ILE A 1 49 ? 16.949 19.351 20.767 1.00 38.13  ? 47   ILE A CB  1 
ATOM   311 C CG1 . ILE A 1 49 ? 17.755 18.148 21.265 1.00 38.13  ? 47   ILE A CG1 1 
ATOM   312 C CG2 . ILE A 1 49 ? 16.920 20.482 21.802 1.00 38.13  ? 47   ILE A CG2 1 
ATOM   313 C CD1 . ILE A 1 49 ? 19.251 18.424 21.404 1.00 38.13  ? 47   ILE A CD1 1 
ATOM   314 N N   . PRO A 1 50 ? 13.843 20.584 21.056 1.00 65.31  ? 48   PRO A N   1 
ATOM   315 C CA  . PRO A 1 50 ? 12.998 21.767 20.860 1.00 65.31  ? 48   PRO A CA  1 
ATOM   316 C C   . PRO A 1 50 ? 13.771 23.021 20.436 1.00 65.31  ? 48   PRO A C   1 
ATOM   317 O O   . PRO A 1 50 ? 14.710 23.462 21.117 1.00 65.31  ? 48   PRO A O   1 
ATOM   318 C CB  . PRO A 1 50 ? 12.317 21.919 22.213 1.00 111.10 ? 48   PRO A CB  1 
ATOM   319 C CG  . PRO A 1 50 ? 12.138 20.490 22.635 1.00 111.10 ? 48   PRO A CG  1 
ATOM   320 C CD  . PRO A 1 50 ? 13.493 19.897 22.311 1.00 111.10 ? 48   PRO A CD  1 
ATOM   321 N N   . GLU A 1 51 ? 13.351 23.589 19.306 1.00 59.98  ? 49   GLU A N   1 
ATOM   322 C CA  . GLU A 1 51 ? 13.969 24.781 18.725 1.00 59.98  ? 49   GLU A CA  1 
ATOM   323 C C   . GLU A 1 51 ? 14.231 25.869 19.760 1.00 59.98  ? 49   GLU A C   1 
ATOM   324 O O   . GLU A 1 51 ? 15.003 26.797 19.526 1.00 59.98  ? 49   GLU A O   1 
ATOM   325 C CB  . GLU A 1 51 ? 13.068 25.332 17.614 1.00 104.79 ? 49   GLU A CB  1 
ATOM   326 C CG  . GLU A 1 51 ? 13.782 25.621 16.299 1.00 104.79 ? 49   GLU A CG  1 
ATOM   327 C CD  . GLU A 1 51 ? 14.846 26.693 16.427 1.00 104.79 ? 49   GLU A CD  1 
ATOM   328 O OE1 . GLU A 1 51 ? 14.503 27.834 16.802 1.00 104.79 ? 49   GLU A OE1 1 
ATOM   329 O OE2 . GLU A 1 51 ? 16.028 26.394 16.150 1.00 104.79 ? 49   GLU A OE2 1 
ATOM   330 N N   . GLN A 1 52 ? 13.576 25.750 20.905 1.00 64.33  ? 50   GLN A N   1 
ATOM   331 C CA  . GLN A 1 52 ? 13.726 26.718 21.977 1.00 64.33  ? 50   GLN A CA  1 
ATOM   332 C C   . GLN A 1 52 ? 15.023 26.585 22.773 1.00 64.33  ? 50   GLN A C   1 
ATOM   333 O O   . GLN A 1 52 ? 15.545 27.583 23.267 1.00 64.33  ? 50   GLN A O   1 
ATOM   334 C CB  . GLN A 1 52 ? 12.539 26.611 22.935 1.00 77.05  ? 50   GLN A CB  1 
ATOM   335 C CG  . GLN A 1 52 ? 12.770 27.353 24.120 1.00 77.05  ? 50   GLN A CG  1 
ATOM   336 N N   . TYR A 1 53 ? 15.557 25.372 22.899 1.00 47.70  ? 51   TYR A N   1 
ATOM   337 C CA  . TYR A 1 53 ? 16.775 25.212 23.682 1.00 47.70  ? 51   TYR A CA  1 
ATOM   338 C C   . TYR A 1 53 ? 18.015 24.980 22.858 1.00 47.70  ? 51   TYR A C   1 
ATOM   339 O O   . TYR A 1 53 ? 19.129 24.963 23.386 1.00 47.70  ? 51   TYR A O   1 
ATOM   340 C CB  . TYR A 1 53 ? 16.613 24.072 24.677 1.00 54.67  ? 51   TYR A CB  1 
ATOM   341 C CG  . TYR A 1 53 ? 15.252 24.044 25.318 1.00 54.67  ? 51   TYR A CG  1 
ATOM   342 C CD1 . TYR A 1 53 ? 14.994 24.763 26.485 1.00 54.67  ? 51   TYR A CD1 1 
ATOM   343 C CD2 . TYR A 1 53 ? 14.209 23.324 24.743 1.00 54.67  ? 51   TYR A CD2 1 
ATOM   344 C CE1 . TYR A 1 53 ? 13.725 24.767 27.063 1.00 54.67  ? 51   TYR A CE1 1 
ATOM   345 C CE2 . TYR A 1 53 ? 12.941 23.318 25.311 1.00 54.67  ? 51   TYR A CE2 1 
ATOM   346 C CZ  . TYR A 1 53 ? 12.706 24.042 26.468 1.00 54.67  ? 51   TYR A CZ  1 
ATOM   347 O OH  . TYR A 1 53 ? 11.447 24.048 27.016 1.00 54.67  ? 51   TYR A OH  1 
ATOM   348 N N   . ARG A 1 54 ? 17.827 24.831 21.558 1.00 37.62  ? 52   ARG A N   1 
ATOM   349 C CA  . ARG A 1 54 ? 18.951 24.564 20.680 1.00 37.62  ? 52   ARG A CA  1 
ATOM   350 C C   . ARG A 1 54 ? 20.182 25.429 20.903 1.00 37.62  ? 52   ARG A C   1 
ATOM   351 O O   . ARG A 1 54 ? 21.230 24.910 21.312 1.00 37.62  ? 52   ARG A O   1 
ATOM   352 C CB  . ARG A 1 54 ? 18.490 24.626 19.224 1.00 61.08  ? 52   ARG A CB  1 
ATOM   353 C CG  . ARG A 1 54 ? 17.366 23.642 18.956 1.00 61.08  ? 52   ARG A CG  1 
ATOM   354 C CD  . ARG A 1 54 ? 17.140 23.397 17.482 1.00 61.08  ? 52   ARG A CD  1 
ATOM   355 N NE  . ARG A 1 54 ? 15.930 22.605 17.284 1.00 61.08  ? 52   ARG A NE  1 
ATOM   356 C CZ  . ARG A 1 54 ? 15.456 22.234 16.100 1.00 61.08  ? 52   ARG A CZ  1 
ATOM   357 N NH1 . ARG A 1 54 ? 16.094 22.581 14.984 1.00 61.08  ? 52   ARG A NH1 1 
ATOM   358 N NH2 . ARG A 1 54 ? 14.339 21.518 16.035 1.00 61.08  ? 52   ARG A NH2 1 
ATOM   359 N N   . MET A 1 55 ? 20.062 26.736 20.653 1.00 43.47  ? 53   MET A N   1 
ATOM   360 C CA  . MET A 1 55 ? 21.190 27.662 20.828 1.00 43.47  ? 53   MET A CA  1 
ATOM   361 C C   . MET A 1 55 ? 21.620 27.727 22.278 1.00 43.47  ? 53   MET A C   1 
ATOM   362 O O   . MET A 1 55 ? 22.813 27.812 22.563 1.00 43.47  ? 53   MET A O   1 
ATOM   363 C CB  . MET A 1 55 ? 20.838 29.070 20.346 1.00 54.58  ? 53   MET A CB  1 
ATOM   364 C CG  . MET A 1 55 ? 20.483 29.159 18.875 1.00 54.58  ? 53   MET A CG  1 
ATOM   365 S SD  . MET A 1 55 ? 21.703 28.374 17.812 1.00 54.58  ? 53   MET A SD  1 
ATOM   366 C CE  . MET A 1 55 ? 23.115 29.498 17.975 1.00 54.58  ? 53   MET A CE  1 
ATOM   367 N N   . THR A 1 56 ? 20.652 27.690 23.191 1.00 44.02  ? 54   THR A N   1 
ATOM   368 C CA  . THR A 1 56 ? 20.973 27.715 24.614 1.00 44.02  ? 54   THR A CA  1 
ATOM   369 C C   . THR A 1 56 ? 22.032 26.648 24.817 1.00 44.02  ? 54   THR A C   1 
ATOM   370 O O   . THR A 1 56 ? 23.188 26.938 25.159 1.00 44.02  ? 54   THR A O   1 
ATOM   371 C CB  . THR A 1 56 ? 19.770 27.333 25.490 1.00 60.98  ? 54   THR A CB  1 
ATOM   372 O OG1 . THR A 1 56 ? 18.660 28.190 25.205 1.00 60.98  ? 54   THR A OG1 1 
ATOM   373 C CG2 . THR A 1 56 ? 20.140 27.461 26.957 1.00 60.98  ? 54   THR A CG2 1 
ATOM   374 N N   . ILE A 1 57 ? 21.614 25.407 24.588 1.00 40.17  ? 55   ILE A N   1 
ATOM   375 C CA  . ILE A 1 57 ? 22.491 24.249 24.705 1.00 40.17  ? 55   ILE A CA  1 
ATOM   376 C C   . ILE A 1 57 ? 23.756 24.425 23.849 1.00 40.17  ? 55   ILE A C   1 
ATOM   377 O O   . ILE A 1 57 ? 24.885 24.348 24.364 1.00 40.17  ? 55   ILE A O   1 
ATOM   378 C CB  . ILE A 1 57 ? 21.754 22.940 24.247 1.00 26.14  ? 55   ILE A CB  1 
ATOM   379 C CG1 . ILE A 1 57 ? 20.554 22.671 25.159 1.00 26.14  ? 55   ILE A CG1 1 
ATOM   380 C CG2 . ILE A 1 57 ? 22.727 21.763 24.227 1.00 26.14  ? 55   ILE A CG2 1 
ATOM   381 C CD1 . ILE A 1 57 ? 19.692 21.554 24.716 1.00 26.14  ? 55   ILE A CD1 1 
ATOM   382 N N   . TRP A 1 58 ? 23.567 24.680 22.554 1.00 30.07  ? 56   TRP A N   1 
ATOM   383 C CA  . TRP A 1 58 ? 24.712 24.818 21.666 1.00 30.07  ? 56   TRP A CA  1 
ATOM   384 C C   . TRP A 1 58 ? 25.697 25.830 22.201 1.00 30.07  ? 56   TRP A C   1 
ATOM   385 O O   . TRP A 1 58 ? 26.893 25.552 22.324 1.00 30.07  ? 56   TRP A O   1 
ATOM   386 C CB  . TRP A 1 58 ? 24.281 25.223 20.250 1.00 55.16  ? 56   TRP A CB  1 
ATOM   387 C CG  . TRP A 1 58 ? 25.449 25.277 19.292 1.00 55.16  ? 56   TRP A CG  1 
ATOM   388 C CD1 . TRP A 1 58 ? 26.112 24.213 18.740 1.00 55.16  ? 56   TRP A CD1 1 
ATOM   389 C CD2 . TRP A 1 58 ? 26.149 26.449 18.855 1.00 55.16  ? 56   TRP A CD2 1 
ATOM   390 N NE1 . TRP A 1 58 ? 27.184 24.649 17.994 1.00 55.16  ? 56   TRP A NE1 1 
ATOM   391 C CE2 . TRP A 1 58 ? 27.229 26.018 18.048 1.00 55.16  ? 56   TRP A CE2 1 
ATOM   392 C CE3 . TRP A 1 58 ? 25.971 27.824 19.068 1.00 55.16  ? 56   TRP A CE3 1 
ATOM   393 C CZ2 . TRP A 1 58 ? 28.127 26.917 17.456 1.00 55.16  ? 56   TRP A CZ2 1 
ATOM   394 C CZ3 . TRP A 1 58 ? 26.865 28.711 18.479 1.00 55.16  ? 56   TRP A CZ3 1 
ATOM   395 C CH2 . TRP A 1 58 ? 27.928 28.252 17.684 1.00 55.16  ? 56   TRP A CH2 1 
ATOM   396 N N   . ARG A 1 59 ? 25.191 27.017 22.507 1.00 44.86  ? 57   ARG A N   1 
ATOM   397 C CA  . ARG A 1 59 ? 26.029 28.078 23.030 1.00 44.86  ? 57   ARG A CA  1 
ATOM   398 C C   . ARG A 1 59 ? 26.756 27.516 24.257 1.00 44.86  ? 57   ARG A C   1 
ATOM   399 O O   . ARG A 1 59 ? 27.987 27.531 24.320 1.00 44.86  ? 57   ARG A O   1 
ATOM   400 C CB  . ARG A 1 59 ? 25.144 29.286 23.386 1.00 103.93 ? 57   ARG A CB  1 
ATOM   401 C CG  . ARG A 1 59 ? 25.878 30.584 23.718 1.00 103.93 ? 57   ARG A CG  1 
ATOM   402 C CD  . ARG A 1 59 ? 26.954 30.889 22.689 1.00 103.93 ? 57   ARG A CD  1 
ATOM   403 N NE  . ARG A 1 59 ? 27.717 32.110 22.966 1.00 103.93 ? 57   ARG A NE  1 
ATOM   404 C CZ  . ARG A 1 59 ? 28.220 32.451 24.156 1.00 103.93 ? 57   ARG A CZ  1 
ATOM   405 N NH1 . ARG A 1 59 ? 28.022 31.684 25.228 1.00 103.93 ? 57   ARG A NH1 1 
ATOM   406 N NH2 . ARG A 1 59 ? 28.908 33.583 24.280 1.00 103.93 ? 57   ARG A NH2 1 
ATOM   407 N N   . GLY A 1 60 ? 25.982 26.982 25.204 1.00 61.72  ? 58   GLY A N   1 
ATOM   408 C CA  . GLY A 1 60 ? 26.551 26.409 26.415 1.00 61.72  ? 58   GLY A CA  1 
ATOM   409 C C   . GLY A 1 60 ? 27.667 25.397 26.191 1.00 61.72  ? 58   GLY A C   1 
ATOM   410 O O   . GLY A 1 60 ? 28.694 25.422 26.883 1.00 61.72  ? 58   GLY A O   1 
ATOM   411 N N   . LEU A 1 61 ? 27.474 24.492 25.235 1.00 48.00  ? 59   LEU A N   1 
ATOM   412 C CA  . LEU A 1 61 ? 28.492 23.493 24.952 1.00 48.00  ? 59   LEU A CA  1 
ATOM   413 C C   . LEU A 1 61 ? 29.739 24.134 24.346 1.00 48.00  ? 59   LEU A C   1 
ATOM   414 O O   . LEU A 1 61 ? 30.848 23.620 24.499 1.00 48.00  ? 59   LEU A O   1 
ATOM   415 C CB  . LEU A 1 61 ? 27.938 22.423 24.012 1.00 67.96  ? 59   LEU A CB  1 
ATOM   416 C CG  . LEU A 1 61 ? 26.844 21.541 24.610 1.00 67.96  ? 59   LEU A CG  1 
ATOM   417 C CD1 . LEU A 1 61 ? 26.231 20.685 23.523 1.00 67.96  ? 59   LEU A CD1 1 
ATOM   418 C CD2 . LEU A 1 61 ? 27.429 20.685 25.730 1.00 67.96  ? 59   LEU A CD2 1 
ATOM   419 N N   . GLN A 1 62 ? 29.565 25.252 23.649 1.00 70.47  ? 60   GLN A N   1 
ATOM   420 C CA  . GLN A 1 62 ? 30.710 25.937 23.062 1.00 70.47  ? 60   GLN A CA  1 
ATOM   421 C C   . GLN A 1 62 ? 31.584 26.421 24.205 1.00 70.47  ? 60   GLN A C   1 
ATOM   422 O O   . GLN A 1 62 ? 32.809 26.319 24.155 1.00 70.47  ? 60   GLN A O   1 
ATOM   423 C CB  . GLN A 1 62 ? 30.255 27.130 22.219 1.00 76.20  ? 60   GLN A CB  1 
ATOM   424 C CG  . GLN A 1 62 ? 30.597 26.992 20.753 1.00 76.20  ? 60   GLN A CG  1 
ATOM   425 C CD  . GLN A 1 62 ? 30.283 25.601 20.227 1.00 76.20  ? 60   GLN A CD  1 
ATOM   426 O OE1 . GLN A 1 62 ? 29.108 25.179 20.335 1.00 76.20  ? 60   GLN A OE1 1 
ATOM   427 N NE2 . GLN A 1 62 ? 31.208 24.931 19.714 1.00 76.20  ? 60   GLN A NE2 1 
ATOM   428 N N   . ASP A 1 63 ? 30.937 26.939 25.244 1.00 82.18  ? 61   ASP A N   1 
ATOM   429 C CA  . ASP A 1 63 ? 31.644 27.439 26.414 1.00 82.18  ? 61   ASP A CA  1 
ATOM   430 C C   . ASP A 1 63 ? 32.558 26.367 26.999 1.00 82.18  ? 61   ASP A C   1 
ATOM   431 O O   . ASP A 1 63 ? 33.552 26.677 27.647 1.00 82.18  ? 61   ASP A O   1 
ATOM   432 C CB  . ASP A 1 63 ? 30.641 27.926 27.463 1.00 69.67  ? 61   ASP A CB  1 
ATOM   433 C CG  . ASP A 1 63 ? 29.716 29.010 26.924 1.00 69.67  ? 61   ASP A CG  1 
ATOM   434 O OD1 . ASP A 1 63 ? 30.223 29.929 26.254 1.00 69.67  ? 61   ASP A OD1 1 
ATOM   435 O OD2 . ASP A 1 63 ? 28.491 28.954 27.172 1.00 69.67  ? 61   ASP A OD2 1 
ATOM   436 N N   . LEU A 1 64 ? 32.224 25.104 26.766 1.00 132.92 ? 62   LEU A N   1 
ATOM   437 C CA  . LEU A 1 64 ? 33.052 24.014 27.261 1.00 132.92 ? 62   LEU A CA  1 
ATOM   438 C C   . LEU A 1 64 ? 33.692 23.313 26.067 1.00 132.92 ? 62   LEU A C   1 
ATOM   439 O O   . LEU A 1 64 ? 33.480 22.092 25.908 1.00 132.92 ? 62   LEU A O   1 
ATOM   440 C CB  . LEU A 1 64 ? 32.213 23.017 28.069 1.00 91.51  ? 62   LEU A CB  1 
ATOM   441 C CG  . LEU A 1 64 ? 31.308 22.308 27.241 1.00 91.51  ? 62   LEU A CG  1 
HETATM 442 O O   . HOH B 2 .  ? 25.318 12.253 33.952 1.00 80.52  ? 3001 HOH A O   1 
HETATM 443 O O   . HOH B 2 .  ? 28.718 16.615 13.453 1.00 49.42  ? 3002 HOH A O   1 
HETATM 444 O O   . HOH B 2 .  ? 25.462 19.187 10.796 1.00 58.98  ? 3003 HOH A O   1 
HETATM 445 O O   . HOH B 2 .  ? 23.295 28.653 27.024 1.00 57.73  ? 3004 HOH A O   1 
HETATM 446 O O   . HOH B 2 .  ? 18.744 18.642 11.602 1.00 73.34  ? 3005 HOH A O   1 
HETATM 447 O O   . HOH B 2 .  ? 27.638 11.751 33.140 1.00 68.72  ? 3006 HOH A O   1 
HETATM 448 O O   . HOH B 2 .  ? 33.412 23.698 20.974 1.00 53.75  ? 3007 HOH A O   1 
HETATM 449 O O   . HOH B 2 .  ? 10.950 22.463 17.860 1.00 71.21  ? 3008 HOH A O   1 
HETATM 450 O O   . HOH B 2 .  ? 33.679 9.341  28.622 1.00 75.12  ? 3009 HOH A O   1 
HETATM 451 O O   . HOH B 2 .  ? 22.860 27.184 36.853 1.00 67.86  ? 3010 HOH A O   1 
HETATM 452 O O   . HOH B 2 .  ? 12.656 23.074 34.497 1.00 62.02  ? 3011 HOH A O   1 
HETATM 453 O O   . HOH B 2 .  ? 13.264 23.876 13.651 1.00 47.48  ? 3012 HOH A O   1 
HETATM 454 O O   . HOH B 2 .  ? 28.087 15.545 11.341 1.00 54.35  ? 3013 HOH A O   1 
HETATM 455 O O   . HOH B 2 .  ? 22.713 31.417 22.540 1.00 55.46  ? 3014 HOH A O   1 
HETATM 456 O O   . HOH B 2 .  ? 9.262  10.185 28.645 1.00 65.66  ? 3015 HOH A O   1 
HETATM 457 O O   . HOH B 2 .  ? 17.789 28.119 19.894 1.00 70.93  ? 3016 HOH A O   1 
HETATM 458 O O   . HOH B 2 .  ? 12.304 19.806 14.643 1.00 55.13  ? 3017 HOH A O   1 
HETATM 459 O O   . HOH B 2 .  ? 33.982 17.100 29.432 1.00 70.92  ? 3018 HOH A O   1 
HETATM 460 O O   . HOH B 2 .  ? 25.999 6.022  33.459 0.50 59.93  ? 3019 HOH A O   1 
HETATM 461 O O   . HOH B 2 .  ? 11.582 31.951 22.200 1.00 59.70  ? 3020 HOH A O   1 
HETATM 462 O O   . HOH B 2 .  ? 22.432 9.589  33.459 0.50 65.08  ? 3021 HOH A O   1 
HETATM 463 O O   . HOH B 2 .  ? 14.002 10.093 17.316 1.00 74.45  ? 3022 HOH A O   1 
HETATM 464 O O   . HOH B 2 .  ? 15.133 21.448 12.292 1.00 61.48  ? 3023 HOH A O   1 
HETATM 465 O O   . HOH B 2 .  ? 25.777 21.897 40.306 1.00 80.59  ? 3024 HOH A O   1 
HETATM 466 O O   . HOH B 2 .  ? 36.689 26.056 25.393 1.00 62.56  ? 3025 HOH A O   1 
HETATM 467 O O   . HOH B 2 .  ? 31.654 18.135 36.925 1.00 60.60  ? 3026 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -2 ?  ?   ?   A . n 
A 1 2  SER 2  -1 ?  ?   ?   A . n 
A 1 3  TYR 3  1  ?  ?   ?   A . n 
A 1 4  HIS 4  2  ?  ?   ?   A . n 
A 1 5  ALA 5  3  ?  ?   ?   A . n 
A 1 6  ASP 6  4  ?  ?   ?   A . n 
A 1 7  PRO 7  5  ?  ?   ?   A . n 
A 1 8  SER 8  6  6  SER SER A . n 
A 1 9  LEU 9  7  7  LEU LEU A . n 
A 1 10 VAL 10 8  8  VAL VAL A . n 
A 1 11 SER 11 9  9  SER SER A . n 
A 1 12 PHE 12 10 10 PHE PHE A . n 
A 1 13 LEU 13 11 11 LEU LEU A . n 
A 1 14 THR 14 12 12 THR THR A . n 
A 1 15 GLY 15 13 13 GLY GLY A . n 
A 1 16 LEU 16 14 14 LEU LEU A . n 
A 1 17 GLY 17 15 15 GLY GLY A . n 
A 1 18 CYS 18 16 16 CYS CYS A . n 
A 1 19 PRO 19 17 17 PRO PRO A . n 
A 1 20 ASN 20 18 18 ASN ASN A . n 
A 1 21 CYS 21 19 19 CYS CYS A . n 
A 1 22 ILE 22 20 20 ILE ILE A . n 
A 1 23 GLU 23 21 21 GLU GLU A . n 
A 1 24 TYR 24 22 22 TYR TYR A . n 
A 1 25 PHE 25 23 23 PHE PHE A . n 
A 1 26 THR 26 24 24 THR THR A . n 
A 1 27 SER 27 25 25 SER SER A . n 
A 1 28 GLN 28 26 26 GLN GLN A . n 
A 1 29 GLY 29 27 27 GLY GLY A . n 
A 1 30 LEU 30 28 28 LEU LEU A . n 
A 1 31 GLN 31 29 29 GLN GLN A . n 
A 1 32 SER 32 30 30 SER SER A . n 
A 1 33 ILE 33 31 31 ILE ILE A . n 
A 1 34 TYR 34 32 32 TYR TYR A . n 
A 1 35 HIS 35 33 33 HIS HIS A . n 
A 1 36 LEU 36 34 34 LEU LEU A . n 
A 1 37 GLN 37 35 35 GLN GLN A . n 
A 1 38 ASN 38 36 36 ASN ASN A . n 
A 1 39 LEU 39 37 37 LEU LEU A . n 
A 1 40 THR 40 38 38 THR THR A . n 
A 1 41 ILE 41 39 39 ILE ILE A . n 
A 1 42 GLU 42 40 40 GLU GLU A . n 
A 1 43 ASP 43 41 41 ASP ASP A . n 
A 1 44 LEU 44 42 42 LEU LEU A . n 
A 1 45 GLY 45 43 43 GLY GLY A . n 
A 1 46 ALA 46 44 44 ALA ALA A . n 
A 1 47 LEU 47 45 45 LEU LEU A . n 
A 1 48 LYS 48 46 46 LYS LYS A . n 
A 1 49 ILE 49 47 47 ILE ILE A . n 
A 1 50 PRO 50 48 48 PRO PRO A . n 
A 1 51 GLU 51 49 49 GLU GLU A . n 
A 1 52 GLN 52 50 50 GLN GLN A . n 
A 1 53 TYR 53 51 51 TYR TYR A . n 
A 1 54 ARG 54 52 52 ARG ARG A . n 
A 1 55 MET 55 53 53 MET MET A . n 
A 1 56 THR 56 54 54 THR THR A . n 
A 1 57 ILE 57 55 55 ILE ILE A . n 
A 1 58 TRP 58 56 56 TRP TRP A . n 
A 1 59 ARG 59 57 57 ARG ARG A . n 
A 1 60 GLY 60 58 58 GLY GLY A . n 
A 1 61 LEU 61 59 59 LEU LEU A . n 
A 1 62 GLN 62 60 60 GLN GLN A . n 
A 1 63 ASP 63 61 61 ASP ASP A . n 
A 1 64 LEU 64 62 62 LEU LEU A . n 
A 1 65 LYS 65 63 ?  ?   ?   A . n 
A 1 66 GLN 66 64 ?  ?   ?   A . n 
A 1 67 GLY 67 65 ?  ?   ?   A . n 
A 1 68 HIS 68 66 ?  ?   ?   A . n 
A 1 69 ASP 69 67 ?  ?   ?   A . n 
A 1 70 TYR 70 68 ?  ?   ?   A . n 
A 1 71 SER 71 69 ?  ?   ?   A . n 
A 1 72 THR 72 70 ?  ?   ?   A . n 
A 1 73 ALA 73 71 ?  ?   ?   A . n 
A 1 74 GLN 74 72 ?  ?   ?   A . n 
A 1 75 GLN 75 73 ?  ?   ?   A . n 
A 1 76 LEU 76 74 ?  ?   ?   A . n 
A 1 77 LEU 77 75 ?  ?   ?   A . n 
A 1 78 ARG 78 76 ?  ?   ?   A . n 
A 1 79 SER 79 77 ?  ?   ?   A . n 
A 1 80 SER 80 78 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  3001 3001 HOH HOH A . 
B 2 HOH 2  3002 3002 HOH HOH A . 
B 2 HOH 3  3003 3003 HOH HOH A . 
B 2 HOH 4  3004 3004 HOH HOH A . 
B 2 HOH 5  3005 3005 HOH HOH A . 
B 2 HOH 6  3006 3006 HOH HOH A . 
B 2 HOH 7  3007 3007 HOH HOH A . 
B 2 HOH 8  3008 3008 HOH HOH A . 
B 2 HOH 9  3009 3009 HOH HOH A . 
B 2 HOH 10 3010 3010 HOH HOH A . 
B 2 HOH 11 3011 3011 HOH HOH A . 
B 2 HOH 12 3012 3012 HOH HOH A . 
B 2 HOH 13 3013 3013 HOH HOH A . 
B 2 HOH 14 3014 3014 HOH HOH A . 
B 2 HOH 15 3015 3015 HOH HOH A . 
B 2 HOH 16 3016 3016 HOH HOH A . 
B 2 HOH 17 3017 3017 HOH HOH A . 
B 2 HOH 18 3018 3018 HOH HOH A . 
B 2 HOH 19 3019 3019 HOH HOH A . 
B 2 HOH 20 3020 3020 HOH HOH A . 
B 2 HOH 21 3021 3021 HOH HOH A . 
B 2 HOH 22 3022 3022 HOH HOH A . 
B 2 HOH 23 3023 3023 HOH HOH A . 
B 2 HOH 24 3024 3024 HOH HOH A . 
B 2 HOH 25 3025 3025 HOH HOH A . 
B 2 HOH 26 3026 3026 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 3019 ? B HOH . 
2 1 A HOH 3021 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-01-12 
2 'Structure model' 1 1 2011-05-07 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-07-05 
5 'Structure model' 1 4 2018-01-24 
6 'Structure model' 1 5 2019-02-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Source and taxonomy'       
5 6 'Structure model' 'Data collection'           
6 6 'Structure model' 'Experimental preparation'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source      
2 5 'Structure model' entity_src_gen     
3 6 'Structure model' exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.type'                            
2 5 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
3 5 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
4 5 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
5 5 'Structure model' '_entity_src_gen.pdbx_host_org_variant'          
6 6 'Structure model' '_exptl_crystal_grow.method'                     
7 6 'Structure model' '_exptl_crystal_grow.temp'                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
CNS     refinement       0.9 ? 1 ? ? ? ? 
iMOSFLM 'data reduction' .   ? 2 ? ? ? ? 
SCALA   'data scaling'   .   ? 3 ? ? ? ? 
AMoRE   phasing          .   ? 4 ? ? ? ? 
# 
_pdbx_entry_details.entry_id             1DXS 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'RESIDUES GLY-SER (-2 TO -1) CLONING ARTIFACT' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16 ? ? -140.60 57.53  
2 1 GLN A 29 ? ? -144.87 -9.56  
3 1 TYR A 32 ? ? -54.87  -70.01 
4 1 LEU A 45 ? ? -75.32  22.02  
5 1 GLU A 49 ? ? -45.76  -16.97 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       3020 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.99 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 6  ? OG  ? A SER 8  OG  
2  1 Y 1 A HIS 33 ? CG  ? A HIS 35 CG  
3  1 Y 1 A HIS 33 ? ND1 ? A HIS 35 ND1 
4  1 Y 1 A HIS 33 ? CD2 ? A HIS 35 CD2 
5  1 Y 1 A HIS 33 ? CE1 ? A HIS 35 CE1 
6  1 Y 1 A HIS 33 ? NE2 ? A HIS 35 NE2 
7  1 Y 1 A GLN 35 ? CD  ? A GLN 37 CD  
8  1 Y 1 A GLN 35 ? OE1 ? A GLN 37 OE1 
9  1 Y 1 A GLN 35 ? NE2 ? A GLN 37 NE2 
10 1 Y 1 A GLN 50 ? CD  ? A GLN 52 CD  
11 1 Y 1 A GLN 50 ? OE1 ? A GLN 52 OE1 
12 1 Y 1 A GLN 50 ? NE2 ? A GLN 52 NE2 
13 1 Y 1 A LEU 62 ? CD1 ? A LEU 64 CD1 
14 1 Y 1 A LEU 62 ? CD2 ? A LEU 64 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -2 ? A GLY 1  
2  1 Y 1 A SER -1 ? A SER 2  
3  1 Y 1 A TYR 1  ? A TYR 3  
4  1 Y 1 A HIS 2  ? A HIS 4  
5  1 Y 1 A ALA 3  ? A ALA 5  
6  1 Y 1 A ASP 4  ? A ASP 6  
7  1 Y 1 A PRO 5  ? A PRO 7  
8  1 Y 1 A LYS 63 ? A LYS 65 
9  1 Y 1 A GLN 64 ? A GLN 66 
10 1 Y 1 A GLY 65 ? A GLY 67 
11 1 Y 1 A HIS 66 ? A HIS 68 
12 1 Y 1 A ASP 67 ? A ASP 69 
13 1 Y 1 A TYR 68 ? A TYR 70 
14 1 Y 1 A SER 69 ? A SER 71 
15 1 Y 1 A THR 70 ? A THR 72 
16 1 Y 1 A ALA 71 ? A ALA 73 
17 1 Y 1 A GLN 72 ? A GLN 74 
18 1 Y 1 A GLN 73 ? A GLN 75 
19 1 Y 1 A LEU 74 ? A LEU 76 
20 1 Y 1 A LEU 75 ? A LEU 77 
21 1 Y 1 A ARG 76 ? A ARG 78 
22 1 Y 1 A SER 77 ? A SER 79 
23 1 Y 1 A SER 78 ? A SER 80 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#