data_1E3Q
# 
_entry.id   1E3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.282 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1E3Q         
WWPDB D_1290005071 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA' 
PDB 3ACE unspecified .                                                                     
PDB 4ACE unspecified .                                                                     
PDB 1ACJ unspecified .                                                                     
PDB 2ACK unspecified .                                                                     
PDB 1ACL unspecified .                                                                     
PDB 1AMN unspecified .                                                                     
PDB 1FSS unspecified .                                                                     
PDB 1VOT unspecified .                                                                     
PDB 1AX9 unspecified .                                                                     
PDB 1EVE unspecified .                                                                     
PDB 1CFJ unspecified .                                                                     
PDB 1OCE unspecified .                                                                     
PDB 2DFP unspecified .                                                                     
PDB 1SOM unspecified .                                                                     
PDB 2DX6 unspecified .                                                                     
PDB 1VXO unspecified .                                                                     
PDB 1VXR unspecified .                                                                     
PDB 1QTI unspecified .                                                                     
PDB 1QIG unspecified .                                                                     
PDB 1QIH unspecified .                                                                     
PDB 1QII unspecified .                                                                     
PDB 1QIJ unspecified .                                                                     
PDB 1QIK unspecified .                                                                     
PDB 1QIM unspecified .                                                                     
PDB 1QID unspecified .                                                                     
PDB 1QIE unspecified .                                                                     
PDB 1QIF unspecified .                                                                     
PDB 1EEA unspecified .                                                                     
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1E3Q 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-21 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Felder, C.E.'  1 
'Harel, M.'     2 
'Silman, I.'    3 
'Sussman, J.L.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of a Complex of the Potent and Specific Inhibitor Bw284C51 with Torpedo Californica Acetylcholinesterase' 
'Acta Crystallogr.,Sect.D' 58 1765 ? 2002 ABCRE6 DK 0907-4449 0766 ? 12351819 10.1107/S0907444902011642       
1       
'Structure of Acetylcholinesterase Complexed with E2020 (Aricept): Implications for the Design of New Anti-Alzheimer Drugs' 
Structure                  7  297  ? 1999 STRUE6 UK 0969-2126 2005 ? 10368299 '10.1016/S0969-2126(99)80040-9' 
2       'Quaternary Ligand Binding to Aromatic Residues in the Active-Site Gorge of Acetylcholinesterase' Proc.Natl.Acad.Sci.USA 
90 9031 ? 1993 PNASA6 US 0027-8424 0040 ? 8415649  10.1073/PNAS.90.19.9031         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Felder, C.E.'        1  
primary 'Harel, M.'           2  
primary 'Silman, I.'          3  
primary 'Sussman, J.L.'       4  
1       'Kryger, G.'          5  
1       'Silman, I.'          6  
1       'Sussman, J.L.'       7  
2       'Harel, M.'           8  
2       'Schalk, I.'          9  
2       'Ehret-Sabattier, L.' 10 
2       'Bouet, F.'           11 
2       'Goeldner, M.'        12 
2       'Hirth, C.'           13 
2       'Axelsen, P.H.'       14 
2       'Silman, I.'          15 
2       'Sussman, J.L.'       16 
# 
_cell.entry_id           1E3Q 
_cell.length_a           114.000 
_cell.length_b           114.000 
_cell.length_c           138.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1E3Q 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                                                                                 61325.090 1 
3.1.1.7 ? ? ? 
2 non-polymer syn '4-(5-{4-[DIMETHYL(PROP-2-ENYL)AMMONIO]PHENYL}-3-OXOPENTYL)-N,N-DIMETHYL-N-PROP-2-ENYLBENZENAMINIUM' 406.603   1 
?       ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                                                        96.063    1 
?       ? ? ? 
4 non-polymer man N-ACETYL-D-GLUCOSAMINE                                                                               221.208   3 
?       ? ? ? 
5 water       nat water                                                                                                18.015    
128 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDGELSS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
1 538 ASP n 
1 539 GLY n 
1 540 GLU n 
1 541 LEU n 
1 542 SER n 
1 543 SER n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1E3Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 543 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  564 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                              ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                             ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                           ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                      ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                             ? 
'C3 H7 N O2 S'   121.158 
EBW non-polymer         . '4-(5-{4-[DIMETHYL(PROP-2-ENYL)AMMONIO]PHENYL}-3-OXOPENTYL)-N,N-DIMETHYL-N-PROP-2-ENYLBENZENAMINIUM' ? 
'C27 H38 N2 O 2' 406.603 
GLN 'L-peptide linking' y GLUTAMINE                                                                                            ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                      ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                              ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                            ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                                ? 
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                           ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                              ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                               ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                           ? 
'C5 H11 N O2 S'  149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                                                               ? 
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                        ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                              ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                               ? 
'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                                        ? 
'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                                                                            ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                           ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                             ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                               ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1E3Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.23 
_exptl_crystal.density_percent_sol   70.9 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.80' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'MULTIWIRE XENTRONICS' 
_diffrn_detector.pdbx_collection_date   1991-12-15 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1E3Q 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            2.830 
_reflns.number_obs                   48244 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         77.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.10400 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        39.9 
_reflns.pdbx_redundancy              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.83 
_reflns_shell.d_res_low              3.16 
_reflns_shell.percent_possible_all   47.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.28600 
_reflns_shell.meanI_over_sigI_obs    2.800 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1E3Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22783 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               8544140.69 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.94 
_refine.ls_d_res_high                            2.85 
_refine.ls_percent_reflns_obs                    95.6 
_refine.ls_R_factor_obs                          0.190 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.190 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1110 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.5 
_refine.aniso_B[1][1]                            4.21 
_refine.aniso_B[2][2]                            4.21 
_refine.aniso_B[3][3]                            -8.41 
_refine.aniso_B[1][2]                            11.37 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.329151 
_refine.solvent_model_param_bsol                 48.655 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;SEVERAL RESIDUES ARE NOT SEEN IN THE CRYSTAL STRUCTURE, DUE TO DISORDER. THESE INCLUDE ASP 1, ASP 2 AND THE C-TERMINAL RESIDUES AFTER THR 535.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1E3Q 
_refine_analyze.Luzzati_coordinate_error_obs    0.35 
_refine_analyze.Luzzati_sigma_a_obs             0.90 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.42 
_refine_analyze.Luzzati_sigma_a_free            1.02 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4244 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         77 
_refine_hist.number_atoms_solvent             128 
_refine_hist.number_atoms_total               4449 
_refine_hist.d_res_high                       2.85 
_refine_hist.d_res_low                        18.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.8  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.06  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.40  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.47  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.01  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.26  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.85 
_refine_ls_shell.d_res_low                        3.03 
_refine_ls_shell.number_reflns_R_work             2117 
_refine_ls_shell.R_factor_R_work                  0.386 
_refine_ls_shell.percent_reflns_obs               55.5 
_refine_ls_shell.R_factor_R_free                  0.393 
_refine_ls_shell.R_factor_R_free_error            0.037 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 3 BW.PAR             CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 4 CARBOHYDRATE.PARAM BW.TOP           
# 
_struct.entry_id                  1E3Q 
_struct.title                     'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1E3Q 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'SERINE HYDROLASE, HYDROLASE, INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;THE ENZYME IS A GPI-ANCHORED DIMER.  THE                     
 TWO MONOMERS IN THE DIMER ARE RELATED BY                             
 CRYSTALLOGRAPHIC TWO-FOLDSYMMETRY.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P2  AA2 LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P3  AA3 GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P4  AA4 GLY A 151 ? LEU A 156 ? GLY A 151 LEU A 156 1 ? 6  
HELX_P HELX_P5  AA5 ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P6  AA6 GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P7  AA7 SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P8  AA8 SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P9  AA9 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P10 AB1 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P11 AB2 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P12 AB3 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P13 AB4 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P14 AB5 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P15 AB6 GLU A 350 ? VAL A 360 ? GLU A 350 VAL A 360 1 ? 11 
HELX_P HELX_P16 AB7 ASN A 364 ? THR A 376 ? ASN A 364 THR A 376 1 ? 13 
HELX_P HELX_P17 AB8 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P18 AB9 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P19 AC1 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P20 AC2 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P21 AC3 GLY A 449 ? ASN A 457 ? GLY A 449 ASN A 457 5 ? 9  
HELX_P HELX_P22 AC4 THR A 459 ? LYS A 478 ? THR A 459 LYS A 478 1 ? 20 
HELX_P HELX_P23 AC5 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P24 AC6 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.046 ? 
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 59  A NAG 603 1_555 ? ? ? ? ? ? ? 1.466 ? 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 416 A NAG 604 1_555 ? ? ? ? ? ? ? 1.453 ? 
covale3 covale one ? A ASN 457 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 457 A NAG 605 1_555 ? ? ? ? ? ? ? 1.470 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.49 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA4 1  2  ? parallel      
AA5 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA1 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AA2 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AA2 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AA2 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AA2 4  VAL A 142 ? LEU A 146 ? VAL A 142 LEU A 146 
AA2 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AA2 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AA2 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AA2 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AA2 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AA2 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AA2 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AA3 1  ALA A 36  ? GLU A 37  ? ALA A 36  GLU A 37  
AA3 2  GLU A 49  ? PRO A 50  ? GLU A 49  PRO A 50  
AA4 1  ASN A 66  ? CYS A 67  ? ASN A 66  CYS A 67  
AA4 2  MET A 90  ? SER A 91  ? MET A 90  SER A 91  
AA5 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AA5 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 8   ? N VAL A 8   O VAL A 15  ? O VAL A 15  
AA1 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AA2 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
AA2 2  3  N PHE A 30  ? N PHE A 30  O ILE A 99  ? O ILE A 99  
AA2 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AA2 4  5  O VAL A 144 ? O VAL A 144 N TRP A 114 ? N TRP A 114 
AA2 5  6  N THR A 109 ? N THR A 109 O ASP A 190 ? O ASP A 190 
AA2 6  7  N GLY A 198 ? N GLY A 198 O GLN A 225 ? O GLN A 225 
AA2 7  8  N ALA A 222 ? N ALA A 222 O LEU A 320 ? O LEU A 320 
AA2 8  9  N ILE A 319 ? N ILE A 319 O TYR A 419 ? O TYR A 419 
AA2 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AA2 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AA3 1  2  N GLU A 37  ? N GLU A 37  O GLU A 49  ? O GLU A 49  
AA4 1  2  N ASN A 66  ? N ASN A 66  O SER A 91  ? O SER A 91  
AA5 1  2  N VAL A 236 ? N VAL A 236 O ILE A 296 ? O ILE A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 593'                                       
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE EBW A 550'                                       
AC3 Software ? ? ? ? 4  'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 59 RESIDUES 900 TO 900'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR CHAIN A OF SUGAR BOUND TO ASN A 416 RESIDUES 901 TO 901' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR MONO-SACCHARIDE NAG A 902 BOUND TO ASN A 457'            
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 406 ? HIS A 406 . ? 1_555 ? 
2  AC1 4  ASN A 409 ? ASN A 409 . ? 1_555 ? 
3  AC1 4  ASN A 525 ? ASN A 525 . ? 1_555 ? 
4  AC1 4  GLN A 526 ? GLN A 526 . ? 1_555 ? 
5  AC2 13 TYR A 70  ? TYR A 70  . ? 1_555 ? 
6  AC2 13 GLN A 74  ? GLN A 74  . ? 1_555 ? 
7  AC2 13 TRP A 84  ? TRP A 84  . ? 1_555 ? 
8  AC2 13 GLY A 117 ? GLY A 117 . ? 1_555 ? 
9  AC2 13 TYR A 121 ? TYR A 121 . ? 1_555 ? 
10 AC2 13 GLU A 199 ? GLU A 199 . ? 1_555 ? 
11 AC2 13 TRP A 279 ? TRP A 279 . ? 1_555 ? 
12 AC2 13 PHE A 290 ? PHE A 290 . ? 1_555 ? 
13 AC2 13 PHE A 330 ? PHE A 330 . ? 1_555 ? 
14 AC2 13 PHE A 331 ? PHE A 331 . ? 1_555 ? 
15 AC2 13 TYR A 334 ? TYR A 334 . ? 1_555 ? 
16 AC2 13 HIS A 440 ? HIS A 440 . ? 1_555 ? 
17 AC2 13 HOH G .   ? HOH A 744 . ? 1_555 ? 
18 AC3 4  ASN A 59  ? ASN A 59  . ? 1_555 ? 
19 AC3 4  SER A 61  ? SER A 61  . ? 1_555 ? 
20 AC3 4  HOH G .   ? HOH A 738 . ? 1_555 ? 
21 AC3 4  HOH G .   ? HOH A 773 . ? 1_555 ? 
22 AC4 4  ASN A 416 ? ASN A 416 . ? 1_555 ? 
23 AC4 4  GLY A 417 ? GLY A 417 . ? 1_555 ? 
24 AC4 4  HOH G .   ? HOH A 705 . ? 1_555 ? 
25 AC4 4  HOH G .   ? HOH A 715 . ? 1_555 ? 
26 AC5 1  ASN A 457 ? ASN A 457 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1E3Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1E3Q 
_atom_sites.fract_transf_matrix[1][1]   0.008772 
_atom_sites.fract_transf_matrix[1][2]   0.005064 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010129 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007236 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 3   ? -13.602 91.371 40.703 1.00 86.62 ? 3   HIS A N   1 
ATOM   2    C CA  . HIS A 1 3   ? -12.789 91.632 39.482 1.00 86.16 ? 3   HIS A CA  1 
ATOM   3    C C   . HIS A 1 3   ? -12.793 90.358 38.631 1.00 84.37 ? 3   HIS A C   1 
ATOM   4    O O   . HIS A 1 3   ? -13.413 89.363 39.008 1.00 85.33 ? 3   HIS A O   1 
ATOM   5    C CB  . HIS A 1 3   ? -11.354 92.005 39.892 1.00 88.31 ? 3   HIS A CB  1 
ATOM   6    C CG  . HIS A 1 3   ? -10.604 92.790 38.853 1.00 92.10 ? 3   HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 3   ? -10.312 92.292 37.599 1.00 94.01 ? 3   HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 3   ? -10.079 94.039 38.889 1.00 93.14 ? 3   HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 3   ? -9.640  93.197 36.908 1.00 93.91 ? 3   HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 3   ? -9.485  94.267 37.668 1.00 93.89 ? 3   HIS A NE2 1 
ATOM   11   N N   . SER A 1 4   ? -12.129 90.400 37.476 1.00 81.48 ? 4   SER A N   1 
ATOM   12   C CA  . SER A 1 4   ? -12.024 89.236 36.593 1.00 77.87 ? 4   SER A CA  1 
ATOM   13   C C   . SER A 1 4   ? -10.894 88.382 37.160 1.00 74.94 ? 4   SER A C   1 
ATOM   14   O O   . SER A 1 4   ? -10.962 87.149 37.149 1.00 75.28 ? 4   SER A O   1 
ATOM   15   C CB  . SER A 1 4   ? -11.668 89.668 35.173 1.00 78.86 ? 4   SER A CB  1 
ATOM   16   O OG  . SER A 1 4   ? -12.610 90.601 34.681 1.00 81.04 ? 4   SER A OG  1 
ATOM   17   N N   . GLU A 1 5   ? -9.854  89.063 37.646 1.00 69.75 ? 5   GLU A N   1 
ATOM   18   C CA  . GLU A 1 5   ? -8.708  88.415 38.262 1.00 63.74 ? 5   GLU A CA  1 
ATOM   19   C C   . GLU A 1 5   ? -9.242  87.449 39.302 1.00 59.93 ? 5   GLU A C   1 
ATOM   20   O O   . GLU A 1 5   ? -8.733  86.343 39.459 1.00 59.98 ? 5   GLU A O   1 
ATOM   21   C CB  . GLU A 1 5   ? -7.830  89.454 38.950 1.00 63.87 ? 5   GLU A CB  1 
ATOM   22   C CG  . GLU A 1 5   ? -6.694  89.953 38.107 1.00 66.04 ? 5   GLU A CG  1 
ATOM   23   C CD  . GLU A 1 5   ? -5.334  89.521 38.639 1.00 68.22 ? 5   GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 5   ? -5.218  89.210 39.848 1.00 69.75 ? 5   GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 5   ? -4.370  89.501 37.845 1.00 68.89 ? 5   GLU A OE2 1 
ATOM   26   N N   . LEU A 1 6   ? -10.294 87.878 39.991 1.00 54.67 ? 6   LEU A N   1 
ATOM   27   C CA  . LEU A 1 6   ? -10.915 87.092 41.037 1.00 49.54 ? 6   LEU A CA  1 
ATOM   28   C C   . LEU A 1 6   ? -11.992 86.115 40.635 1.00 46.96 ? 6   LEU A C   1 
ATOM   29   O O   . LEU A 1 6   ? -12.631 85.513 41.488 1.00 46.05 ? 6   LEU A O   1 
ATOM   30   C CB  . LEU A 1 6   ? -11.466 88.017 42.105 1.00 49.14 ? 6   LEU A CB  1 
ATOM   31   C CG  . LEU A 1 6   ? -10.504 88.139 43.277 1.00 49.22 ? 6   LEU A CG  1 
ATOM   32   C CD1 . LEU A 1 6   ? -9.181  88.774 42.821 1.00 48.79 ? 6   LEU A CD1 1 
ATOM   33   C CD2 . LEU A 1 6   ? -11.173 88.935 44.373 1.00 49.10 ? 6   LEU A CD2 1 
ATOM   34   N N   . LEU A 1 7   ? -12.218 85.952 39.345 1.00 45.14 ? 7   LEU A N   1 
ATOM   35   C CA  . LEU A 1 7   ? -13.220 84.988 38.919 1.00 44.26 ? 7   LEU A CA  1 
ATOM   36   C C   . LEU A 1 7   ? -12.558 83.944 38.014 1.00 43.85 ? 7   LEU A C   1 
ATOM   37   O O   . LEU A 1 7   ? -11.940 84.285 37.006 1.00 44.95 ? 7   LEU A O   1 
ATOM   38   C CB  . LEU A 1 7   ? -14.369 85.687 38.190 1.00 42.87 ? 7   LEU A CB  1 
ATOM   39   C CG  . LEU A 1 7   ? -15.645 84.872 37.934 1.00 41.92 ? 7   LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 7   ? -15.402 83.768 36.923 1.00 42.14 ? 7   LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 7   ? -16.126 84.292 39.236 1.00 42.70 ? 7   LEU A CD2 1 
ATOM   42   N N   . VAL A 1 8   ? -12.667 82.674 38.388 1.00 42.15 ? 8   VAL A N   1 
ATOM   43   C CA  . VAL A 1 8   ? -12.075 81.618 37.595 1.00 40.59 ? 8   VAL A CA  1 
ATOM   44   C C   . VAL A 1 8   ? -13.062 80.504 37.327 1.00 40.94 ? 8   VAL A C   1 
ATOM   45   O O   . VAL A 1 8   ? -13.913 80.182 38.157 1.00 40.85 ? 8   VAL A O   1 
ATOM   46   C CB  . VAL A 1 8   ? -10.825 81.048 38.268 1.00 39.87 ? 8   VAL A CB  1 
ATOM   47   C CG1 . VAL A 1 8   ? -10.359 79.800 37.543 1.00 39.84 ? 8   VAL A CG1 1 
ATOM   48   C CG2 . VAL A 1 8   ? -9.730  82.077 38.244 1.00 38.46 ? 8   VAL A CG2 1 
ATOM   49   N N   . ASN A 1 9   ? -12.925 79.916 36.148 1.00 41.28 ? 9   ASN A N   1 
ATOM   50   C CA  . ASN A 1 9   ? -13.793 78.844 35.700 1.00 41.47 ? 9   ASN A CA  1 
ATOM   51   C C   . ASN A 1 9   ? -13.121 77.476 35.679 1.00 40.61 ? 9   ASN A C   1 
ATOM   52   O O   . ASN A 1 9   ? -12.346 77.176 34.779 1.00 41.57 ? 9   ASN A O   1 
ATOM   53   C CB  . ASN A 1 9   ? -14.270 79.167 34.305 1.00 43.05 ? 9   ASN A CB  1 
ATOM   54   C CG  . ASN A 1 9   ? -15.745 79.247 34.226 1.00 45.50 ? 9   ASN A CG  1 
ATOM   55   O OD1 . ASN A 1 9   ? -16.448 78.373 34.744 1.00 46.56 ? 9   ASN A OD1 1 
ATOM   56   N ND2 . ASN A 1 9   ? -16.247 80.294 33.573 1.00 46.69 ? 9   ASN A ND2 1 
ATOM   57   N N   . THR A 1 10  ? -13.420 76.624 36.644 1.00 38.85 ? 10  THR A N   1 
ATOM   58   C CA  . THR A 1 10  ? -12.783 75.322 36.633 1.00 36.17 ? 10  THR A CA  1 
ATOM   59   C C   . THR A 1 10  ? -13.753 74.295 36.116 1.00 34.89 ? 10  THR A C   1 
ATOM   60   O O   . THR A 1 10  ? -14.969 74.494 36.168 1.00 34.77 ? 10  THR A O   1 
ATOM   61   C CB  . THR A 1 10  ? -12.333 74.906 38.028 1.00 36.28 ? 10  THR A CB  1 
ATOM   62   O OG1 . THR A 1 10  ? -13.459 74.428 38.771 1.00 34.02 ? 10  THR A OG1 1 
ATOM   63   C CG2 . THR A 1 10  ? -11.701 76.102 38.747 1.00 36.14 ? 10  THR A CG2 1 
ATOM   64   N N   . LYS A 1 11  ? -13.208 73.194 35.619 1.00 33.06 ? 11  LYS A N   1 
ATOM   65   C CA  . LYS A 1 11  ? -14.026 72.116 35.089 1.00 31.63 ? 11  LYS A CA  1 
ATOM   66   C C   . LYS A 1 11  ? -15.095 71.673 36.089 1.00 32.97 ? 11  LYS A C   1 
ATOM   67   O O   . LYS A 1 11  ? -16.068 71.032 35.700 1.00 33.91 ? 11  LYS A O   1 
ATOM   68   C CB  . LYS A 1 11  ? -13.148 70.922 34.711 1.00 27.54 ? 11  LYS A CB  1 
ATOM   69   C CG  . LYS A 1 11  ? -12.034 71.239 33.729 1.00 21.74 ? 11  LYS A CG  1 
ATOM   70   C CD  . LYS A 1 11  ? -11.307 69.975 33.353 1.00 19.06 ? 11  LYS A CD  1 
ATOM   71   C CE  . LYS A 1 11  ? -10.049 70.258 32.577 1.00 18.74 ? 11  LYS A CE  1 
ATOM   72   N NZ  . LYS A 1 11  ? -9.281  68.993 32.365 1.00 20.64 ? 11  LYS A NZ  1 
ATOM   73   N N   . SER A 1 12  ? -14.910 72.017 37.367 1.00 34.01 ? 12  SER A N   1 
ATOM   74   C CA  . SER A 1 12  ? -15.859 71.663 38.437 1.00 34.50 ? 12  SER A CA  1 
ATOM   75   C C   . SER A 1 12  ? -16.989 72.673 38.577 1.00 33.19 ? 12  SER A C   1 
ATOM   76   O O   . SER A 1 12  ? -18.116 72.302 38.889 1.00 31.00 ? 12  SER A O   1 
ATOM   77   C CB  . SER A 1 12  ? -15.140 71.558 39.799 1.00 36.85 ? 12  SER A CB  1 
ATOM   78   O OG  . SER A 1 12  ? -14.751 70.228 40.123 1.00 39.34 ? 12  SER A OG  1 
ATOM   79   N N   . GLY A 1 13  ? -16.664 73.943 38.358 1.00 33.20 ? 13  GLY A N   1 
ATOM   80   C CA  . GLY A 1 13  ? -17.639 75.009 38.465 1.00 36.69 ? 13  GLY A CA  1 
ATOM   81   C C   . GLY A 1 13  ? -16.922 76.344 38.493 1.00 39.61 ? 13  GLY A C   1 
ATOM   82   O O   . GLY A 1 13  ? -15.706 76.386 38.276 1.00 39.57 ? 13  GLY A O   1 
ATOM   83   N N   . LYS A 1 14  ? -17.653 77.435 38.742 1.00 42.03 ? 14  LYS A N   1 
ATOM   84   C CA  . LYS A 1 14  ? -17.030 78.767 38.802 1.00 44.09 ? 14  LYS A CA  1 
ATOM   85   C C   . LYS A 1 14  ? -16.607 79.095 40.224 1.00 43.98 ? 14  LYS A C   1 
ATOM   86   O O   . LYS A 1 14  ? -17.304 78.764 41.189 1.00 44.20 ? 14  LYS A O   1 
ATOM   87   C CB  . LYS A 1 14  ? -17.976 79.860 38.284 1.00 46.23 ? 14  LYS A CB  1 
ATOM   88   C CG  . LYS A 1 14  ? -17.864 80.096 36.797 1.00 48.35 ? 14  LYS A CG  1 
ATOM   89   C CD  . LYS A 1 14  ? -18.985 80.976 36.252 1.00 52.69 ? 14  LYS A CD  1 
ATOM   90   C CE  . LYS A 1 14  ? -18.938 81.005 34.700 1.00 56.78 ? 14  LYS A CE  1 
ATOM   91   N NZ  . LYS A 1 14  ? -19.768 82.050 33.984 1.00 59.14 ? 14  LYS A NZ  1 
ATOM   92   N N   . VAL A 1 15  ? -15.464 79.758 40.348 1.00 43.45 ? 15  VAL A N   1 
ATOM   93   C CA  . VAL A 1 15  ? -14.938 80.093 41.654 1.00 42.84 ? 15  VAL A CA  1 
ATOM   94   C C   . VAL A 1 15  ? -14.535 81.554 41.803 1.00 43.38 ? 15  VAL A C   1 
ATOM   95   O O   . VAL A 1 15  ? -13.762 82.088 41.012 1.00 43.29 ? 15  VAL A O   1 
ATOM   96   C CB  . VAL A 1 15  ? -13.747 79.176 41.972 1.00 41.52 ? 15  VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 15  ? -12.944 79.721 43.116 1.00 42.53 ? 15  VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 15  ? -14.258 77.805 42.323 1.00 40.47 ? 15  VAL A CG2 1 
ATOM   99   N N   . MET A 1 16  ? -15.076 82.183 42.841 1.00 44.01 ? 16  MET A N   1 
ATOM   100  C CA  . MET A 1 16  ? -14.814 83.582 43.164 1.00 44.42 ? 16  MET A CA  1 
ATOM   101  C C   . MET A 1 16  ? -13.860 83.667 44.352 1.00 43.28 ? 16  MET A C   1 
ATOM   102  O O   . MET A 1 16  ? -14.202 83.266 45.468 1.00 42.36 ? 16  MET A O   1 
ATOM   103  C CB  . MET A 1 16  ? -16.130 84.278 43.527 1.00 47.50 ? 16  MET A CB  1 
ATOM   104  C CG  . MET A 1 16  ? -16.010 85.740 43.976 1.00 50.11 ? 16  MET A CG  1 
ATOM   105  S SD  . MET A 1 16  ? -16.305 86.883 42.623 1.00 51.71 ? 16  MET A SD  1 
ATOM   106  C CE  . MET A 1 16  ? -14.638 87.382 42.213 1.00 51.38 ? 16  MET A CE  1 
ATOM   107  N N   . GLY A 1 17  ? -12.672 84.205 44.114 1.00 42.48 ? 17  GLY A N   1 
ATOM   108  C CA  . GLY A 1 17  ? -11.697 84.323 45.177 1.00 42.15 ? 17  GLY A CA  1 
ATOM   109  C C   . GLY A 1 17  ? -11.750 85.643 45.906 1.00 42.11 ? 17  GLY A C   1 
ATOM   110  O O   . GLY A 1 17  ? -12.798 86.271 46.003 1.00 41.04 ? 17  GLY A O   1 
ATOM   111  N N   . THR A 1 18  ? -10.598 86.050 46.420 1.00 43.88 ? 18  THR A N   1 
ATOM   112  C CA  . THR A 1 18  ? -10.450 87.294 47.162 1.00 47.41 ? 18  THR A CA  1 
ATOM   113  C C   . THR A 1 18  ? -9.029  87.784 47.024 1.00 48.34 ? 18  THR A C   1 
ATOM   114  O O   . THR A 1 18  ? -8.105  86.985 46.900 1.00 48.10 ? 18  THR A O   1 
ATOM   115  C CB  . THR A 1 18  ? -10.708 87.093 48.667 1.00 49.50 ? 18  THR A CB  1 
ATOM   116  O OG1 . THR A 1 18  ? -12.107 86.866 48.880 1.00 53.18 ? 18  THR A OG1 1 
ATOM   117  C CG2 . THR A 1 18  ? -10.251 88.321 49.477 1.00 49.87 ? 18  THR A CG2 1 
ATOM   118  N N   . ARG A 1 19  ? -8.846  89.098 47.033 1.00 50.53 ? 19  ARG A N   1 
ATOM   119  C CA  . ARG A 1 19  ? -7.494  89.623 46.949 1.00 53.01 ? 19  ARG A CA  1 
ATOM   120  C C   . ARG A 1 19  ? -7.040  89.914 48.372 1.00 51.85 ? 19  ARG A C   1 
ATOM   121  O O   . ARG A 1 19  ? -7.803  90.417 49.201 1.00 52.45 ? 19  ARG A O   1 
ATOM   122  C CB  . ARG A 1 19  ? -7.417  90.888 46.083 1.00 56.46 ? 19  ARG A CB  1 
ATOM   123  C CG  . ARG A 1 19  ? -5.976  91.382 45.872 1.00 62.07 ? 19  ARG A CG  1 
ATOM   124  C CD  . ARG A 1 19  ? -5.866  92.349 44.708 1.00 67.26 ? 19  ARG A CD  1 
ATOM   125  N NE  . ARG A 1 19  ? -7.021  93.249 44.637 1.00 74.04 ? 19  ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 19  ? -7.421  94.072 45.614 1.00 77.12 ? 19  ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 19  ? -6.761  94.124 46.769 1.00 78.83 ? 19  ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 19  ? -8.486  94.857 45.438 1.00 78.35 ? 19  ARG A NH2 1 
ATOM   129  N N   . VAL A 1 20  ? -5.793  89.574 48.656 1.00 49.94 ? 20  VAL A N   1 
ATOM   130  C CA  . VAL A 1 20  ? -5.254  89.764 49.980 1.00 47.54 ? 20  VAL A CA  1 
ATOM   131  C C   . VAL A 1 20  ? -3.932  90.499 49.949 1.00 47.16 ? 20  VAL A C   1 
ATOM   132  O O   . VAL A 1 20  ? -3.119  90.330 49.040 1.00 48.44 ? 20  VAL A O   1 
ATOM   133  C CB  . VAL A 1 20  ? -5.067  88.416 50.663 1.00 46.38 ? 20  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 20  ? -6.394  87.688 50.676 1.00 45.54 ? 20  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 20  ? -4.015  87.594 49.925 1.00 44.71 ? 20  VAL A CG2 1 
ATOM   136  N N   . PRO A 1 21  ? -3.703  91.343 50.947 1.00 45.53 ? 21  PRO A N   1 
ATOM   137  C CA  . PRO A 1 21  ? -2.456  92.091 50.994 1.00 44.90 ? 21  PRO A CA  1 
ATOM   138  C C   . PRO A 1 21  ? -1.273  91.207 51.330 1.00 44.63 ? 21  PRO A C   1 
ATOM   139  O O   . PRO A 1 21  ? -1.400  90.247 52.073 1.00 43.69 ? 21  PRO A O   1 
ATOM   140  C CB  . PRO A 1 21  ? -2.735  93.121 52.072 1.00 45.39 ? 21  PRO A CB  1 
ATOM   141  C CG  . PRO A 1 21  ? -3.671  92.382 53.002 1.00 44.52 ? 21  PRO A CG  1 
ATOM   142  C CD  . PRO A 1 21  ? -4.608  91.739 52.038 1.00 44.62 ? 21  PRO A CD  1 
ATOM   143  N N   . VAL A 1 22  ? -0.121  91.526 50.769 1.00 45.66 ? 22  VAL A N   1 
ATOM   144  C CA  . VAL A 1 22  ? 1.079   90.767 51.058 1.00 48.13 ? 22  VAL A CA  1 
ATOM   145  C C   . VAL A 1 22  ? 2.234   91.741 50.972 1.00 50.39 ? 22  VAL A C   1 
ATOM   146  O O   . VAL A 1 22  ? 2.568   92.223 49.896 1.00 51.14 ? 22  VAL A O   1 
ATOM   147  C CB  . VAL A 1 22  ? 1.293   89.601 50.062 1.00 47.59 ? 22  VAL A CB  1 
ATOM   148  C CG1 . VAL A 1 22  ? 1.473   90.112 48.651 1.00 46.83 ? 22  VAL A CG1 1 
ATOM   149  C CG2 . VAL A 1 22  ? 2.501   88.807 50.472 1.00 48.60 ? 22  VAL A CG2 1 
ATOM   150  N N   . LEU A 1 23  ? 2.839   92.048 52.111 1.00 52.94 ? 23  LEU A N   1 
ATOM   151  C CA  . LEU A 1 23  ? 3.938   93.000 52.117 1.00 55.31 ? 23  LEU A CA  1 
ATOM   152  C C   . LEU A 1 23  ? 3.462   94.296 51.469 1.00 57.54 ? 23  LEU A C   1 
ATOM   153  O O   . LEU A 1 23  ? 2.400   94.838 51.801 1.00 57.68 ? 23  LEU A O   1 
ATOM   154  C CB  . LEU A 1 23  ? 5.129   92.441 51.336 1.00 54.05 ? 23  LEU A CB  1 
ATOM   155  C CG  . LEU A 1 23  ? 5.993   91.375 52.021 1.00 54.91 ? 23  LEU A CG  1 
ATOM   156  C CD1 . LEU A 1 23  ? 5.299   90.823 53.274 1.00 53.95 ? 23  LEU A CD1 1 
ATOM   157  C CD2 . LEU A 1 23  ? 6.317   90.268 51.008 1.00 54.42 ? 23  LEU A CD2 1 
ATOM   158  N N   . SER A 1 24  ? 4.252   94.777 50.524 1.00 60.06 ? 24  SER A N   1 
ATOM   159  C CA  . SER A 1 24  ? 3.927   96.007 49.825 1.00 62.56 ? 24  SER A CA  1 
ATOM   160  C C   . SER A 1 24  ? 2.831   95.885 48.739 1.00 62.72 ? 24  SER A C   1 
ATOM   161  O O   . SER A 1 24  ? 2.097   96.845 48.502 1.00 63.08 ? 24  SER A O   1 
ATOM   162  C CB  . SER A 1 24  ? 5.218   96.591 49.222 1.00 64.20 ? 24  SER A CB  1 
ATOM   163  O OG  . SER A 1 24  ? 5.922   95.621 48.449 1.00 66.50 ? 24  SER A OG  1 
ATOM   164  N N   . SER A 1 25  ? 2.700   94.724 48.095 1.00 62.22 ? 25  SER A N   1 
ATOM   165  C CA  . SER A 1 25  ? 1.703   94.573 47.033 1.00 62.08 ? 25  SER A CA  1 
ATOM   166  C C   . SER A 1 25  ? 0.367   93.904 47.436 1.00 62.45 ? 25  SER A C   1 
ATOM   167  O O   . SER A 1 25  ? -0.059  93.979 48.593 1.00 62.56 ? 25  SER A O   1 
ATOM   168  C CB  . SER A 1 25  ? 2.343   93.831 45.850 1.00 61.52 ? 25  SER A CB  1 
ATOM   169  O OG  . SER A 1 25  ? 1.680   94.112 44.625 1.00 61.26 ? 25  SER A OG  1 
ATOM   170  N N   . HIS A 1 26  ? -0.283  93.259 46.466 1.00 62.66 ? 26  HIS A N   1 
ATOM   171  C CA  . HIS A 1 26  ? -1.575  92.579 46.655 1.00 62.34 ? 26  HIS A CA  1 
ATOM   172  C C   . HIS A 1 26  ? -1.719  91.361 45.739 1.00 59.66 ? 26  HIS A C   1 
ATOM   173  O O   . HIS A 1 26  ? -1.635  91.504 44.522 1.00 61.47 ? 26  HIS A O   1 
ATOM   174  C CB  . HIS A 1 26  ? -2.713  93.524 46.291 1.00 67.06 ? 26  HIS A CB  1 
ATOM   175  C CG  . HIS A 1 26  ? -3.229  94.330 47.434 1.00 72.66 ? 26  HIS A CG  1 
ATOM   176  N ND1 . HIS A 1 26  ? -4.101  95.386 47.259 1.00 75.72 ? 26  HIS A ND1 1 
ATOM   177  C CD2 . HIS A 1 26  ? -3.056  94.200 48.770 1.00 74.53 ? 26  HIS A CD2 1 
ATOM   178  C CE1 . HIS A 1 26  ? -4.447  95.868 48.440 1.00 76.83 ? 26  HIS A CE1 1 
ATOM   179  N NE2 . HIS A 1 26  ? -3.828  95.166 49.374 1.00 77.10 ? 26  HIS A NE2 1 
ATOM   180  N N   . ILE A 1 27  ? -1.952  90.174 46.285 1.00 54.94 ? 27  ILE A N   1 
ATOM   181  C CA  . ILE A 1 27  ? -2.135  89.017 45.412 1.00 49.99 ? 27  ILE A CA  1 
ATOM   182  C C   . ILE A 1 27  ? -3.528  88.461 45.637 1.00 47.15 ? 27  ILE A C   1 
ATOM   183  O O   . ILE A 1 27  ? -4.209  88.883 46.559 1.00 46.50 ? 27  ILE A O   1 
ATOM   184  C CB  . ILE A 1 27  ? -1.072  87.951 45.657 1.00 48.64 ? 27  ILE A CB  1 
ATOM   185  C CG1 . ILE A 1 27  ? -1.300  87.277 46.992 1.00 47.69 ? 27  ILE A CG1 1 
ATOM   186  C CG2 . ILE A 1 27  ? 0.299   88.593 45.620 1.00 48.59 ? 27  ILE A CG2 1 
ATOM   187  C CD1 . ILE A 1 27  ? -1.765  85.892 46.832 1.00 48.79 ? 27  ILE A CD1 1 
ATOM   188  N N   . SER A 1 28  ? -3.970  87.542 44.789 1.00 44.66 ? 28  SER A N   1 
ATOM   189  C CA  . SER A 1 28  ? -5.320  86.984 44.926 1.00 42.26 ? 28  SER A CA  1 
ATOM   190  C C   . SER A 1 28  ? -5.293  85.576 45.521 1.00 39.96 ? 28  SER A C   1 
ATOM   191  O O   . SER A 1 28  ? -4.328  84.836 45.320 1.00 40.62 ? 28  SER A O   1 
ATOM   192  C CB  . SER A 1 28  ? -6.043  86.997 43.558 1.00 43.03 ? 28  SER A CB  1 
ATOM   193  O OG  . SER A 1 28  ? -5.221  86.537 42.483 1.00 43.61 ? 28  SER A OG  1 
ATOM   194  N N   . ALA A 1 29  ? -6.336  85.204 46.260 1.00 35.83 ? 29  ALA A N   1 
ATOM   195  C CA  . ALA A 1 29  ? -6.368  83.886 46.875 1.00 32.87 ? 29  ALA A CA  1 
ATOM   196  C C   . ALA A 1 29  ? -7.720  83.216 46.829 1.00 31.81 ? 29  ALA A C   1 
ATOM   197  O O   . ALA A 1 29  ? -8.737  83.822 47.115 1.00 32.17 ? 29  ALA A O   1 
ATOM   198  C CB  . ALA A 1 29  ? -5.918  83.988 48.294 1.00 33.33 ? 29  ALA A CB  1 
ATOM   199  N N   . PHE A 1 30  ? -7.724  81.944 46.477 1.00 31.53 ? 30  PHE A N   1 
ATOM   200  C CA  . PHE A 1 30  ? -8.962  81.181 46.406 1.00 32.35 ? 30  PHE A CA  1 
ATOM   201  C C   . PHE A 1 30  ? -8.943  80.189 47.569 1.00 32.14 ? 30  PHE A C   1 
ATOM   202  O O   . PHE A 1 30  ? -8.172  79.220 47.562 1.00 32.64 ? 30  PHE A O   1 
ATOM   203  C CB  . PHE A 1 30  ? -9.041  80.451 45.058 1.00 33.49 ? 30  PHE A CB  1 
ATOM   204  C CG  . PHE A 1 30  ? -9.000  81.375 43.879 1.00 34.75 ? 30  PHE A CG  1 
ATOM   205  C CD1 . PHE A 1 30  ? -7.786  81.935 43.461 1.00 35.40 ? 30  PHE A CD1 1 
ATOM   206  C CD2 . PHE A 1 30  ? -10.179 81.763 43.241 1.00 35.03 ? 30  PHE A CD2 1 
ATOM   207  C CE1 . PHE A 1 30  ? -7.746  82.879 42.430 1.00 34.77 ? 30  PHE A CE1 1 
ATOM   208  C CE2 . PHE A 1 30  ? -10.159 82.706 42.203 1.00 34.74 ? 30  PHE A CE2 1 
ATOM   209  C CZ  . PHE A 1 30  ? -8.940  83.267 41.799 1.00 34.94 ? 30  PHE A CZ  1 
ATOM   210  N N   . LEU A 1 31  ? -9.793  80.427 48.563 1.00 30.42 ? 31  LEU A N   1 
ATOM   211  C CA  . LEU A 1 31  ? -9.825  79.573 49.742 1.00 28.82 ? 31  LEU A CA  1 
ATOM   212  C C   . LEU A 1 31  ? -10.969 78.581 49.886 1.00 29.71 ? 31  LEU A C   1 
ATOM   213  O O   . LEU A 1 31  ? -12.142 78.919 49.730 1.00 30.31 ? 31  LEU A O   1 
ATOM   214  C CB  . LEU A 1 31  ? -9.801  80.440 50.995 1.00 26.11 ? 31  LEU A CB  1 
ATOM   215  C CG  . LEU A 1 31  ? -8.541  81.141 51.505 1.00 24.52 ? 31  LEU A CG  1 
ATOM   216  C CD1 . LEU A 1 31  ? -7.389  81.232 50.495 1.00 21.81 ? 31  LEU A CD1 1 
ATOM   217  C CD2 . LEU A 1 31  ? -9.017  82.492 51.939 1.00 22.62 ? 31  LEU A CD2 1 
ATOM   218  N N   . GLY A 1 32  ? -10.603 77.347 50.211 1.00 30.60 ? 32  GLY A N   1 
ATOM   219  C CA  . GLY A 1 32  ? -11.587 76.305 50.455 1.00 31.18 ? 32  GLY A CA  1 
ATOM   220  C C   . GLY A 1 32  ? -12.441 75.780 49.321 1.00 30.73 ? 32  GLY A C   1 
ATOM   221  O O   . GLY A 1 32  ? -13.668 75.649 49.464 1.00 32.07 ? 32  GLY A O   1 
ATOM   222  N N   . ILE A 1 33  ? -11.794 75.478 48.201 1.00 28.00 ? 33  ILE A N   1 
ATOM   223  C CA  . ILE A 1 33  ? -12.474 74.930 47.048 1.00 25.02 ? 33  ILE A CA  1 
ATOM   224  C C   . ILE A 1 33  ? -12.553 73.447 47.344 1.00 24.82 ? 33  ILE A C   1 
ATOM   225  O O   . ILE A 1 33  ? -11.548 72.840 47.699 1.00 26.43 ? 33  ILE A O   1 
ATOM   226  C CB  . ILE A 1 33  ? -11.639 75.135 45.818 1.00 23.36 ? 33  ILE A CB  1 
ATOM   227  C CG1 . ILE A 1 33  ? -11.296 76.615 45.681 1.00 23.08 ? 33  ILE A CG1 1 
ATOM   228  C CG2 . ILE A 1 33  ? -12.377 74.635 44.624 1.00 22.85 ? 33  ILE A CG2 1 
ATOM   229  C CD1 . ILE A 1 33  ? -10.387 76.913 44.512 1.00 23.35 ? 33  ILE A CD1 1 
ATOM   230  N N   . PRO A 1 34  ? -13.739 72.838 47.216 1.00 23.90 ? 34  PRO A N   1 
ATOM   231  C CA  . PRO A 1 34  ? -13.882 71.400 47.496 1.00 24.08 ? 34  PRO A CA  1 
ATOM   232  C C   . PRO A 1 34  ? -13.367 70.505 46.371 1.00 24.51 ? 34  PRO A C   1 
ATOM   233  O O   . PRO A 1 34  ? -13.604 70.787 45.210 1.00 24.79 ? 34  PRO A O   1 
ATOM   234  C CB  . PRO A 1 34  ? -15.384 71.247 47.709 1.00 23.55 ? 34  PRO A CB  1 
ATOM   235  C CG  . PRO A 1 34  ? -15.937 72.231 46.704 1.00 22.20 ? 34  PRO A CG  1 
ATOM   236  C CD  . PRO A 1 34  ? -15.033 73.444 46.863 1.00 22.45 ? 34  PRO A CD  1 
ATOM   237  N N   . PHE A 1 35  ? -12.662 69.429 46.698 1.00 25.87 ? 35  PHE A N   1 
ATOM   238  C CA  . PHE A 1 35  ? -12.169 68.539 45.645 1.00 27.69 ? 35  PHE A CA  1 
ATOM   239  C C   . PHE A 1 35  ? -12.791 67.153 45.718 1.00 28.00 ? 35  PHE A C   1 
ATOM   240  O O   . PHE A 1 35  ? -12.514 66.295 44.884 1.00 27.42 ? 35  PHE A O   1 
ATOM   241  C CB  . PHE A 1 35  ? -10.636 68.432 45.672 1.00 29.35 ? 35  PHE A CB  1 
ATOM   242  C CG  . PHE A 1 35  ? -10.074 67.951 46.980 1.00 32.30 ? 35  PHE A CG  1 
ATOM   243  C CD1 . PHE A 1 35  ? -10.318 66.655 47.431 1.00 33.13 ? 35  PHE A CD1 1 
ATOM   244  C CD2 . PHE A 1 35  ? -9.286  68.794 47.761 1.00 33.49 ? 35  PHE A CD2 1 
ATOM   245  C CE1 . PHE A 1 35  ? -9.785  66.202 48.642 1.00 33.03 ? 35  PHE A CE1 1 
ATOM   246  C CE2 . PHE A 1 35  ? -8.751  68.351 48.969 1.00 33.94 ? 35  PHE A CE2 1 
ATOM   247  C CZ  . PHE A 1 35  ? -9.003  67.049 49.408 1.00 33.77 ? 35  PHE A CZ  1 
ATOM   248  N N   . ALA A 1 36  ? -13.650 66.955 46.711 1.00 28.98 ? 36  ALA A N   1 
ATOM   249  C CA  . ALA A 1 36  ? -14.331 65.686 46.901 1.00 30.82 ? 36  ALA A CA  1 
ATOM   250  C C   . ALA A 1 36  ? -15.664 65.856 47.650 1.00 32.66 ? 36  ALA A C   1 
ATOM   251  O O   . ALA A 1 36  ? -15.886 66.867 48.320 1.00 33.66 ? 36  ALA A O   1 
ATOM   252  C CB  . ALA A 1 36  ? -13.429 64.736 47.654 1.00 28.73 ? 36  ALA A CB  1 
ATOM   253  N N   . GLU A 1 37  ? -16.554 64.876 47.506 1.00 33.97 ? 37  GLU A N   1 
ATOM   254  C CA  . GLU A 1 37  ? -17.842 64.883 48.186 1.00 34.85 ? 37  GLU A CA  1 
ATOM   255  C C   . GLU A 1 37  ? -17.526 64.640 49.652 1.00 35.11 ? 37  GLU A C   1 
ATOM   256  O O   . GLU A 1 37  ? -16.815 63.672 49.964 1.00 36.50 ? 37  GLU A O   1 
ATOM   257  C CB  . GLU A 1 37  ? -18.718 63.740 47.675 1.00 36.97 ? 37  GLU A CB  1 
ATOM   258  C CG  . GLU A 1 37  ? -19.378 64.022 46.361 1.00 40.17 ? 37  GLU A CG  1 
ATOM   259  C CD  . GLU A 1 37  ? -20.164 65.305 46.412 1.00 43.20 ? 37  GLU A CD  1 
ATOM   260  O OE1 . GLU A 1 37  ? -21.191 65.346 47.129 1.00 43.84 ? 37  GLU A OE1 1 
ATOM   261  O OE2 . GLU A 1 37  ? -19.742 66.279 45.747 1.00 45.40 ? 37  GLU A OE2 1 
ATOM   262  N N   . PRO A 1 38  ? -18.061 65.488 50.569 1.00 34.30 ? 38  PRO A N   1 
ATOM   263  C CA  . PRO A 1 38  ? -17.838 65.385 52.018 1.00 33.77 ? 38  PRO A CA  1 
ATOM   264  C C   . PRO A 1 38  ? -18.004 63.974 52.576 1.00 33.93 ? 38  PRO A C   1 
ATOM   265  O O   . PRO A 1 38  ? -19.054 63.344 52.425 1.00 34.73 ? 38  PRO A O   1 
ATOM   266  C CB  . PRO A 1 38  ? -18.832 66.395 52.601 1.00 32.25 ? 38  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 38  ? -19.888 66.443 51.612 1.00 32.58 ? 38  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 38  ? -19.130 66.462 50.305 1.00 33.83 ? 38  PRO A CD  1 
ATOM   269  N N   . PRO A 1 39  ? -16.947 63.468 53.227 1.00 33.38 ? 39  PRO A N   1 
ATOM   270  C CA  . PRO A 1 39  ? -16.846 62.148 53.840 1.00 33.74 ? 39  PRO A CA  1 
ATOM   271  C C   . PRO A 1 39  ? -17.573 62.054 55.151 1.00 34.08 ? 39  PRO A C   1 
ATOM   272  O O   . PRO A 1 39  ? -17.016 61.562 56.132 1.00 35.27 ? 39  PRO A O   1 
ATOM   273  C CB  . PRO A 1 39  ? -15.351 61.977 54.022 1.00 34.29 ? 39  PRO A CB  1 
ATOM   274  C CG  . PRO A 1 39  ? -14.948 63.335 54.416 1.00 34.89 ? 39  PRO A CG  1 
ATOM   275  C CD  . PRO A 1 39  ? -15.704 64.224 53.447 1.00 33.60 ? 39  PRO A CD  1 
ATOM   276  N N   . VAL A 1 40  ? -18.816 62.520 55.158 1.00 33.83 ? 40  VAL A N   1 
ATOM   277  C CA  . VAL A 1 40  ? -19.660 62.494 56.345 1.00 32.94 ? 40  VAL A CA  1 
ATOM   278  C C   . VAL A 1 40  ? -20.663 61.362 56.214 1.00 34.10 ? 40  VAL A C   1 
ATOM   279  O O   . VAL A 1 40  ? -20.639 60.611 55.251 1.00 33.50 ? 40  VAL A O   1 
ATOM   280  C CB  . VAL A 1 40  ? -20.412 63.789 56.454 1.00 30.65 ? 40  VAL A CB  1 
ATOM   281  C CG1 . VAL A 1 40  ? -19.444 64.920 56.661 1.00 29.54 ? 40  VAL A CG1 1 
ATOM   282  C CG2 . VAL A 1 40  ? -21.171 64.016 55.179 1.00 29.88 ? 40  VAL A CG2 1 
ATOM   283  N N   . GLY A 1 41  ? -21.550 61.233 57.184 1.00 36.77 ? 41  GLY A N   1 
ATOM   284  C CA  . GLY A 1 41  ? -22.550 60.180 57.099 1.00 40.64 ? 41  GLY A CA  1 
ATOM   285  C C   . GLY A 1 41  ? -21.929 58.808 57.165 1.00 42.19 ? 41  GLY A C   1 
ATOM   286  O O   . GLY A 1 41  ? -21.196 58.508 58.102 1.00 43.36 ? 41  GLY A O   1 
ATOM   287  N N   . ASN A 1 42  ? -22.232 57.959 56.195 1.00 44.14 ? 42  ASN A N   1 
ATOM   288  C CA  . ASN A 1 42  ? -21.635 56.626 56.176 1.00 47.09 ? 42  ASN A CA  1 
ATOM   289  C C   . ASN A 1 42  ? -20.551 56.586 55.116 1.00 45.84 ? 42  ASN A C   1 
ATOM   290  O O   . ASN A 1 42  ? -20.151 55.525 54.645 1.00 44.52 ? 42  ASN A O   1 
ATOM   291  C CB  . ASN A 1 42  ? -22.679 55.575 55.880 1.00 50.80 ? 42  ASN A CB  1 
ATOM   292  C CG  . ASN A 1 42  ? -23.727 56.092 54.975 1.00 55.65 ? 42  ASN A CG  1 
ATOM   293  O OD1 . ASN A 1 42  ? -23.420 56.701 53.936 1.00 58.49 ? 42  ASN A OD1 1 
ATOM   294  N ND2 . ASN A 1 42  ? -24.987 55.880 55.349 1.00 58.47 ? 42  ASN A ND2 1 
ATOM   295  N N   . MET A 1 43  ? -20.111 57.770 54.722 1.00 45.02 ? 43  MET A N   1 
ATOM   296  C CA  . MET A 1 43  ? -19.033 57.883 53.771 1.00 44.42 ? 43  MET A CA  1 
ATOM   297  C C   . MET A 1 43  ? -17.849 57.694 54.693 1.00 43.19 ? 43  MET A C   1 
ATOM   298  O O   . MET A 1 43  ? -16.750 57.349 54.244 1.00 44.87 ? 43  MET A O   1 
ATOM   299  C CB  . MET A 1 43  ? -18.974 59.286 53.168 1.00 46.24 ? 43  MET A CB  1 
ATOM   300  C CG  . MET A 1 43  ? -20.090 59.607 52.218 1.00 48.72 ? 43  MET A CG  1 
ATOM   301  S SD  . MET A 1 43  ? -19.825 58.854 50.608 1.00 53.23 ? 43  MET A SD  1 
ATOM   302  C CE  . MET A 1 43  ? -19.688 60.393 49.549 1.00 52.35 ? 43  MET A CE  1 
ATOM   303  N N   . ARG A 1 44  ? -18.092 57.912 55.988 1.00 39.04 ? 44  ARG A N   1 
ATOM   304  C CA  . ARG A 1 44  ? -17.046 57.791 56.982 1.00 36.63 ? 44  ARG A CA  1 
ATOM   305  C C   . ARG A 1 44  ? -16.238 56.527 56.809 1.00 36.34 ? 44  ARG A C   1 
ATOM   306  O O   . ARG A 1 44  ? -16.789 55.438 56.796 1.00 34.69 ? 44  ARG A O   1 
ATOM   307  C CB  . ARG A 1 44  ? -17.606 57.813 58.399 1.00 35.14 ? 44  ARG A CB  1 
ATOM   308  C CG  . ARG A 1 44  ? -16.481 57.818 59.432 1.00 33.00 ? 44  ARG A CG  1 
ATOM   309  C CD  . ARG A 1 44  ? -16.953 57.717 60.843 1.00 30.12 ? 44  ARG A CD  1 
ATOM   310  N NE  . ARG A 1 44  ? -17.501 58.976 61.314 1.00 29.44 ? 44  ARG A NE  1 
ATOM   311  C CZ  . ARG A 1 44  ? -18.005 59.150 62.532 1.00 29.89 ? 44  ARG A CZ  1 
ATOM   312  N NH1 . ARG A 1 44  ? -18.034 58.137 63.398 1.00 29.26 ? 44  ARG A NH1 1 
ATOM   313  N NH2 . ARG A 1 44  ? -18.460 60.343 62.892 1.00 28.61 ? 44  ARG A NH2 1 
ATOM   314  N N   . PHE A 1 45  ? -14.924 56.696 56.686 1.00 37.41 ? 45  PHE A N   1 
ATOM   315  C CA  . PHE A 1 45  ? -13.991 55.598 56.514 1.00 39.63 ? 45  PHE A CA  1 
ATOM   316  C C   . PHE A 1 45  ? -13.768 55.185 55.056 1.00 42.13 ? 45  PHE A C   1 
ATOM   317  O O   . PHE A 1 45  ? -12.771 54.530 54.746 1.00 43.14 ? 45  PHE A O   1 
ATOM   318  C CB  . PHE A 1 45  ? -14.446 54.370 57.311 1.00 38.66 ? 45  PHE A CB  1 
ATOM   319  C CG  . PHE A 1 45  ? -14.555 54.605 58.793 1.00 38.58 ? 45  PHE A CG  1 
ATOM   320  C CD1 . PHE A 1 45  ? -13.556 55.289 59.487 1.00 38.54 ? 45  PHE A CD1 1 
ATOM   321  C CD2 . PHE A 1 45  ? -15.644 54.117 59.508 1.00 38.05 ? 45  PHE A CD2 1 
ATOM   322  C CE1 . PHE A 1 45  ? -13.642 55.481 60.866 1.00 36.23 ? 45  PHE A CE1 1 
ATOM   323  C CE2 . PHE A 1 45  ? -15.734 54.309 60.887 1.00 36.76 ? 45  PHE A CE2 1 
ATOM   324  C CZ  . PHE A 1 45  ? -14.730 54.991 61.561 1.00 35.96 ? 45  PHE A CZ  1 
ATOM   325  N N   . ARG A 1 46  ? -14.681 55.565 54.165 1.00 44.56 ? 46  ARG A N   1 
ATOM   326  C CA  . ARG A 1 46  ? -14.575 55.194 52.755 1.00 47.20 ? 46  ARG A CA  1 
ATOM   327  C C   . ARG A 1 46  ? -13.718 56.084 51.874 1.00 46.98 ? 46  ARG A C   1 
ATOM   328  O O   . ARG A 1 46  ? -13.447 57.228 52.222 1.00 47.45 ? 46  ARG A O   1 
ATOM   329  C CB  . ARG A 1 46  ? -15.961 55.086 52.141 1.00 50.19 ? 46  ARG A CB  1 
ATOM   330  C CG  . ARG A 1 46  ? -16.513 53.698 52.213 1.00 56.79 ? 46  ARG A CG  1 
ATOM   331  C CD  . ARG A 1 46  ? -17.817 53.653 51.508 1.00 63.93 ? 46  ARG A CD  1 
ATOM   332  N NE  . ARG A 1 46  ? -18.666 54.728 52.005 1.00 71.99 ? 46  ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 46  ? -19.884 55.001 51.538 1.00 76.31 ? 46  ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 46  ? -20.402 54.266 50.551 1.00 77.86 ? 46  ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 46  ? -20.583 56.014 52.054 1.00 77.42 ? 46  ARG A NH2 1 
ATOM   336  N N   . ARG A 1 47  ? -13.295 55.543 50.730 1.00 46.22 ? 47  ARG A N   1 
ATOM   337  C CA  . ARG A 1 47  ? -12.474 56.279 49.776 1.00 45.52 ? 47  ARG A CA  1 
ATOM   338  C C   . ARG A 1 47  ? -13.155 57.598 49.422 1.00 44.07 ? 47  ARG A C   1 
ATOM   339  O O   . ARG A 1 47  ? -14.370 57.713 49.516 1.00 43.06 ? 47  ARG A O   1 
ATOM   340  C CB  . ARG A 1 47  ? -12.292 55.468 48.497 1.00 48.05 ? 47  ARG A CB  1 
ATOM   341  C CG  . ARG A 1 47  ? -11.481 54.191 48.620 1.00 52.26 ? 47  ARG A CG  1 
ATOM   342  C CD  . ARG A 1 47  ? -11.370 53.507 47.244 1.00 55.91 ? 47  ARG A CD  1 
ATOM   343  N NE  . ARG A 1 47  ? -10.312 52.489 47.162 1.00 59.77 ? 47  ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 47  ? -10.371 51.251 47.666 1.00 61.25 ? 47  ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 47  ? -11.459 50.823 48.320 1.00 60.12 ? 47  ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 47  ? -9.328  50.428 47.500 1.00 61.77 ? 47  ARG A NH2 1 
ATOM   347  N N   . PRO A 1 48  ? -12.382 58.613 49.005 1.00 43.48 ? 48  PRO A N   1 
ATOM   348  C CA  . PRO A 1 48  ? -12.996 59.896 48.653 1.00 43.51 ? 48  PRO A CA  1 
ATOM   349  C C   . PRO A 1 48  ? -13.818 59.757 47.378 1.00 44.53 ? 48  PRO A C   1 
ATOM   350  O O   . PRO A 1 48  ? -13.547 58.897 46.541 1.00 44.74 ? 48  PRO A O   1 
ATOM   351  C CB  . PRO A 1 48  ? -11.792 60.811 48.437 1.00 42.61 ? 48  PRO A CB  1 
ATOM   352  C CG  . PRO A 1 48  ? -10.706 60.180 49.232 1.00 42.06 ? 48  PRO A CG  1 
ATOM   353  C CD  . PRO A 1 48  ? -10.915 58.714 48.958 1.00 42.66 ? 48  PRO A CD  1 
ATOM   354  N N   . GLU A 1 49  ? -14.815 60.612 47.217 1.00 45.37 ? 49  GLU A N   1 
ATOM   355  C CA  . GLU A 1 49  ? -15.646 60.567 46.019 1.00 44.80 ? 49  GLU A CA  1 
ATOM   356  C C   . GLU A 1 49  ? -15.472 61.903 45.311 1.00 42.77 ? 49  GLU A C   1 
ATOM   357  O O   . GLU A 1 49  ? -15.528 62.942 45.937 1.00 43.41 ? 49  GLU A O   1 
ATOM   358  C CB  . GLU A 1 49  ? -17.088 60.381 46.433 1.00 48.27 ? 49  GLU A CB  1 
ATOM   359  C CG  . GLU A 1 49  ? -17.928 59.589 45.483 1.00 52.88 ? 49  GLU A CG  1 
ATOM   360  C CD  . GLU A 1 49  ? -19.362 59.496 45.965 1.00 56.79 ? 49  GLU A CD  1 
ATOM   361  O OE1 . GLU A 1 49  ? -20.088 60.524 45.925 1.00 57.96 ? 49  GLU A OE1 1 
ATOM   362  O OE2 . GLU A 1 49  ? -19.754 58.393 46.404 1.00 59.58 ? 49  GLU A OE2 1 
ATOM   363  N N   . PRO A 1 50  ? -15.274 61.897 43.997 1.00 41.30 ? 50  PRO A N   1 
ATOM   364  C CA  . PRO A 1 50  ? -15.091 63.146 43.258 1.00 41.85 ? 50  PRO A CA  1 
ATOM   365  C C   . PRO A 1 50  ? -16.218 64.111 43.552 1.00 42.93 ? 50  PRO A C   1 
ATOM   366  O O   . PRO A 1 50  ? -17.337 63.676 43.803 1.00 44.46 ? 50  PRO A O   1 
ATOM   367  C CB  . PRO A 1 50  ? -15.097 62.693 41.810 1.00 41.53 ? 50  PRO A CB  1 
ATOM   368  C CG  . PRO A 1 50  ? -14.649 61.289 41.889 1.00 42.39 ? 50  PRO A CG  1 
ATOM   369  C CD  . PRO A 1 50  ? -15.410 60.774 43.072 1.00 41.64 ? 50  PRO A CD  1 
ATOM   370  N N   . LYS A 1 51  ? -15.930 65.412 43.495 1.00 42.97 ? 51  LYS A N   1 
ATOM   371  C CA  . LYS A 1 51  ? -16.923 66.441 43.798 1.00 43.16 ? 51  LYS A CA  1 
ATOM   372  C C   . LYS A 1 51  ? -17.858 66.820 42.652 1.00 43.36 ? 51  LYS A C   1 
ATOM   373  O O   . LYS A 1 51  ? -17.471 67.571 41.764 1.00 44.01 ? 51  LYS A O   1 
ATOM   374  C CB  . LYS A 1 51  ? -16.217 67.703 44.282 1.00 43.50 ? 51  LYS A CB  1 
ATOM   375  C CG  . LYS A 1 51  ? -17.004 68.468 45.310 1.00 44.68 ? 51  LYS A CG  1 
ATOM   376  C CD  . LYS A 1 51  ? -18.369 68.846 44.794 1.00 46.47 ? 51  LYS A CD  1 
ATOM   377  C CE  . LYS A 1 51  ? -19.231 69.387 45.910 1.00 47.23 ? 51  LYS A CE  1 
ATOM   378  N NZ  . LYS A 1 51  ? -18.580 70.570 46.517 1.00 49.58 ? 51  LYS A NZ  1 
ATOM   379  N N   . LYS A 1 52  ? -19.093 66.330 42.696 1.00 43.26 ? 52  LYS A N   1 
ATOM   380  C CA  . LYS A 1 52  ? -20.080 66.629 41.664 1.00 44.32 ? 52  LYS A CA  1 
ATOM   381  C C   . LYS A 1 52  ? -20.128 68.117 41.391 1.00 43.25 ? 52  LYS A C   1 
ATOM   382  O O   . LYS A 1 52  ? -20.465 68.893 42.279 1.00 43.26 ? 52  LYS A O   1 
ATOM   383  C CB  . LYS A 1 52  ? -21.456 66.178 42.114 1.00 48.19 ? 52  LYS A CB  1 
ATOM   384  C CG  . LYS A 1 52  ? -21.577 64.692 42.345 1.00 54.32 ? 52  LYS A CG  1 
ATOM   385  C CD  . LYS A 1 52  ? -22.977 64.358 42.840 1.00 59.45 ? 52  LYS A CD  1 
ATOM   386  C CE  . LYS A 1 52  ? -23.150 62.862 43.119 1.00 63.61 ? 52  LYS A CE  1 
ATOM   387  N NZ  . LYS A 1 52  ? -24.543 62.519 43.593 1.00 66.34 ? 52  LYS A NZ  1 
ATOM   388  N N   . PRO A 1 53  ? -19.834 68.535 40.145 1.00 42.63 ? 53  PRO A N   1 
ATOM   389  C CA  . PRO A 1 53  ? -19.844 69.952 39.787 1.00 41.97 ? 53  PRO A CA  1 
ATOM   390  C C   . PRO A 1 53  ? -21.031 70.699 40.330 1.00 42.30 ? 53  PRO A C   1 
ATOM   391  O O   . PRO A 1 53  ? -22.146 70.189 40.368 1.00 42.11 ? 53  PRO A O   1 
ATOM   392  C CB  . PRO A 1 53  ? -19.825 69.924 38.270 1.00 40.39 ? 53  PRO A CB  1 
ATOM   393  C CG  . PRO A 1 53  ? -19.031 68.734 37.978 1.00 40.93 ? 53  PRO A CG  1 
ATOM   394  C CD  . PRO A 1 53  ? -19.630 67.723 38.936 1.00 42.54 ? 53  PRO A CD  1 
ATOM   395  N N   . TRP A 1 54  ? -20.761 71.915 40.775 1.00 43.58 ? 54  TRP A N   1 
ATOM   396  C CA  . TRP A 1 54  ? -21.786 72.774 41.310 1.00 45.50 ? 54  TRP A CA  1 
ATOM   397  C C   . TRP A 1 54  ? -22.121 73.780 40.230 1.00 49.02 ? 54  TRP A C   1 
ATOM   398  O O   . TRP A 1 54  ? -21.469 73.858 39.176 1.00 49.02 ? 54  TRP A O   1 
ATOM   399  C CB  . TRP A 1 54  ? -21.282 73.507 42.550 1.00 43.08 ? 54  TRP A CB  1 
ATOM   400  C CG  . TRP A 1 54  ? -20.070 74.320 42.286 1.00 40.49 ? 54  TRP A CG  1 
ATOM   401  C CD1 . TRP A 1 54  ? -20.020 75.589 41.786 1.00 39.69 ? 54  TRP A CD1 1 
ATOM   402  C CD2 . TRP A 1 54  ? -18.719 73.876 42.393 1.00 40.94 ? 54  TRP A CD2 1 
ATOM   403  N NE1 . TRP A 1 54  ? -18.716 75.964 41.566 1.00 39.64 ? 54  TRP A NE1 1 
ATOM   404  C CE2 . TRP A 1 54  ? -17.895 74.928 41.928 1.00 40.39 ? 54  TRP A CE2 1 
ATOM   405  C CE3 . TRP A 1 54  ? -18.120 72.683 42.830 1.00 40.79 ? 54  TRP A CE3 1 
ATOM   406  C CZ2 . TRP A 1 54  ? -16.505 74.823 41.886 1.00 39.99 ? 54  TRP A CZ2 1 
ATOM   407  C CZ3 . TRP A 1 54  ? -16.743 72.576 42.786 1.00 40.71 ? 54  TRP A CZ3 1 
ATOM   408  C CH2 . TRP A 1 54  ? -15.948 73.644 42.316 1.00 40.84 ? 54  TRP A CH2 1 
ATOM   409  N N   . SER A 1 55  ? -23.158 74.551 40.513 1.00 52.91 ? 55  SER A N   1 
ATOM   410  C CA  . SER A 1 55  ? -23.639 75.580 39.608 1.00 54.70 ? 55  SER A CA  1 
ATOM   411  C C   . SER A 1 55  ? -23.536 76.914 40.332 1.00 54.08 ? 55  SER A C   1 
ATOM   412  O O   . SER A 1 55  ? -23.514 76.981 41.572 1.00 53.38 ? 55  SER A O   1 
ATOM   413  C CB  . SER A 1 55  ? -25.092 75.289 39.225 1.00 56.81 ? 55  SER A CB  1 
ATOM   414  O OG  . SER A 1 55  ? -25.827 74.870 40.374 1.00 62.11 ? 55  SER A OG  1 
ATOM   415  N N   . GLY A 1 56  ? -23.480 77.980 39.554 1.00 53.31 ? 56  GLY A N   1 
ATOM   416  C CA  . GLY A 1 56  ? -23.357 79.272 40.171 1.00 52.29 ? 56  GLY A CA  1 
ATOM   417  C C   . GLY A 1 56  ? -21.921 79.387 40.607 1.00 51.10 ? 56  GLY A C   1 
ATOM   418  O O   . GLY A 1 56  ? -21.106 78.497 40.349 1.00 51.05 ? 56  GLY A O   1 
ATOM   419  N N   . VAL A 1 57  ? -21.614 80.486 41.273 1.00 50.32 ? 57  VAL A N   1 
ATOM   420  C CA  . VAL A 1 57  ? -20.269 80.730 41.724 1.00 49.78 ? 57  VAL A CA  1 
ATOM   421  C C   . VAL A 1 57  ? -20.073 80.274 43.157 1.00 50.13 ? 57  VAL A C   1 
ATOM   422  O O   . VAL A 1 57  ? -20.986 80.342 43.978 1.00 50.34 ? 57  VAL A O   1 
ATOM   423  C CB  . VAL A 1 57  ? -19.937 82.216 41.584 1.00 48.85 ? 57  VAL A CB  1 
ATOM   424  C CG1 . VAL A 1 57  ? -18.585 82.515 42.188 1.00 50.06 ? 57  VAL A CG1 1 
ATOM   425  C CG2 . VAL A 1 57  ? -19.940 82.585 40.125 1.00 47.74 ? 57  VAL A CG2 1 
ATOM   426  N N   . TRP A 1 58  ? -18.874 79.786 43.442 1.00 50.24 ? 58  TRP A N   1 
ATOM   427  C CA  . TRP A 1 58  ? -18.535 79.327 44.773 1.00 50.63 ? 58  TRP A CA  1 
ATOM   428  C C   . TRP A 1 58  ? -17.719 80.434 45.468 1.00 52.46 ? 58  TRP A C   1 
ATOM   429  O O   . TRP A 1 58  ? -16.786 80.987 44.873 1.00 52.41 ? 58  TRP A O   1 
ATOM   430  C CB  . TRP A 1 58  ? -17.745 78.039 44.650 1.00 47.58 ? 58  TRP A CB  1 
ATOM   431  C CG  . TRP A 1 58  ? -17.407 77.459 45.938 1.00 45.15 ? 58  TRP A CG  1 
ATOM   432  C CD1 . TRP A 1 58  ? -16.409 77.851 46.778 1.00 44.24 ? 58  TRP A CD1 1 
ATOM   433  C CD2 . TRP A 1 58  ? -18.055 76.354 46.563 1.00 44.22 ? 58  TRP A CD2 1 
ATOM   434  N NE1 . TRP A 1 58  ? -16.391 77.052 47.892 1.00 44.25 ? 58  TRP A NE1 1 
ATOM   435  C CE2 . TRP A 1 58  ? -17.395 76.122 47.784 1.00 44.22 ? 58  TRP A CE2 1 
ATOM   436  C CE3 . TRP A 1 58  ? -19.129 75.531 46.207 1.00 43.55 ? 58  TRP A CE3 1 
ATOM   437  C CZ2 . TRP A 1 58  ? -17.777 75.094 48.656 1.00 43.04 ? 58  TRP A CZ2 1 
ATOM   438  C CZ3 . TRP A 1 58  ? -19.505 74.509 47.073 1.00 41.95 ? 58  TRP A CZ3 1 
ATOM   439  C CH2 . TRP A 1 58  ? -18.831 74.303 48.280 1.00 41.68 ? 58  TRP A CH2 1 
ATOM   440  N N   . ASN A 1 59  ? -18.076 80.760 46.714 1.00 53.64 ? 59  ASN A N   1 
ATOM   441  C CA  . ASN A 1 59  ? -17.402 81.829 47.461 1.00 54.90 ? 59  ASN A CA  1 
ATOM   442  C C   . ASN A 1 59  ? -16.084 81.358 48.081 1.00 53.06 ? 59  ASN A C   1 
ATOM   443  O O   . ASN A 1 59  ? -16.025 81.065 49.271 1.00 53.74 ? 59  ASN A O   1 
ATOM   444  C CB  . ASN A 1 59  ? -18.341 82.366 48.567 1.00 60.15 ? 59  ASN A CB  1 
ATOM   445  C CG  . ASN A 1 59  ? -18.080 83.844 48.923 1.00 65.79 ? 59  ASN A CG  1 
ATOM   446  O OD1 . ASN A 1 59  ? -16.948 84.315 48.821 1.00 66.22 ? 59  ASN A OD1 1 
ATOM   447  N ND2 . ASN A 1 59  ? -19.128 84.564 49.340 1.00 71.67 ? 59  ASN A ND2 1 
ATOM   448  N N   . ALA A 1 60  ? -15.019 81.295 47.290 1.00 50.50 ? 60  ALA A N   1 
ATOM   449  C CA  . ALA A 1 60  ? -13.733 80.853 47.827 1.00 49.03 ? 60  ALA A CA  1 
ATOM   450  C C   . ALA A 1 60  ? -12.970 82.003 48.476 1.00 48.19 ? 60  ALA A C   1 
ATOM   451  O O   . ALA A 1 60  ? -11.765 82.174 48.248 1.00 47.13 ? 60  ALA A O   1 
ATOM   452  C CB  . ALA A 1 60  ? -12.892 80.227 46.729 1.00 49.66 ? 60  ALA A CB  1 
ATOM   453  N N   . SER A 1 61  ? -13.682 82.772 49.304 1.00 47.54 ? 61  SER A N   1 
ATOM   454  C CA  . SER A 1 61  ? -13.123 83.936 49.997 1.00 45.86 ? 61  SER A CA  1 
ATOM   455  C C   . SER A 1 61  ? -12.759 83.666 51.454 1.00 45.40 ? 61  SER A C   1 
ATOM   456  O O   . SER A 1 61  ? -11.901 84.340 52.021 1.00 45.06 ? 61  SER A O   1 
ATOM   457  C CB  . SER A 1 61  ? -14.116 85.091 49.941 1.00 44.83 ? 61  SER A CB  1 
ATOM   458  O OG  . SER A 1 61  ? -15.304 84.739 50.613 1.00 43.59 ? 61  SER A OG  1 
ATOM   459  N N   . THR A 1 62  ? -13.414 82.681 52.055 1.00 44.50 ? 62  THR A N   1 
ATOM   460  C CA  . THR A 1 62  ? -13.143 82.323 53.441 1.00 43.52 ? 62  THR A CA  1 
ATOM   461  C C   . THR A 1 62  ? -12.473 80.953 53.597 1.00 42.77 ? 62  THR A C   1 
ATOM   462  O O   . THR A 1 62  ? -12.512 80.124 52.683 1.00 42.50 ? 62  THR A O   1 
ATOM   463  C CB  . THR A 1 62  ? -14.434 82.328 54.228 1.00 43.55 ? 62  THR A CB  1 
ATOM   464  O OG1 . THR A 1 62  ? -15.468 81.730 53.436 1.00 43.82 ? 62  THR A OG1 1 
ATOM   465  C CG2 . THR A 1 62  ? -14.815 83.744 54.572 1.00 43.87 ? 62  THR A CG2 1 
ATOM   466  N N   . TYR A 1 63  ? -11.862 80.722 54.759 1.00 41.65 ? 63  TYR A N   1 
ATOM   467  C CA  . TYR A 1 63  ? -11.194 79.455 55.042 1.00 40.05 ? 63  TYR A CA  1 
ATOM   468  C C   . TYR A 1 63  ? -12.129 78.318 55.331 1.00 39.00 ? 63  TYR A C   1 
ATOM   469  O O   . TYR A 1 63  ? -13.221 78.511 55.850 1.00 38.97 ? 63  TYR A O   1 
ATOM   470  C CB  . TYR A 1 63  ? -10.277 79.570 56.227 1.00 40.22 ? 63  TYR A CB  1 
ATOM   471  C CG  . TYR A 1 63  ? -8.902  79.994 55.864 1.00 41.91 ? 63  TYR A CG  1 
ATOM   472  C CD1 . TYR A 1 63  ? -8.029  79.109 55.243 1.00 41.89 ? 63  TYR A CD1 1 
ATOM   473  C CD2 . TYR A 1 63  ? -8.445  81.270 56.185 1.00 43.21 ? 63  TYR A CD2 1 
ATOM   474  C CE1 . TYR A 1 63  ? -6.722  79.484 54.956 1.00 43.44 ? 63  TYR A CE1 1 
ATOM   475  C CE2 . TYR A 1 63  ? -7.141  81.656 55.905 1.00 44.35 ? 63  TYR A CE2 1 
ATOM   476  C CZ  . TYR A 1 63  ? -6.284  80.760 55.295 1.00 44.15 ? 63  TYR A CZ  1 
ATOM   477  O OH  . TYR A 1 63  ? -4.984  81.135 55.055 1.00 45.53 ? 63  TYR A OH  1 
ATOM   478  N N   . PRO A 1 64  ? -11.688 77.100 55.022 1.00 38.27 ? 64  PRO A N   1 
ATOM   479  C CA  . PRO A 1 64  ? -12.485 75.897 55.243 1.00 38.00 ? 64  PRO A CA  1 
ATOM   480  C C   . PRO A 1 64  ? -12.396 75.365 56.673 1.00 37.66 ? 64  PRO A C   1 
ATOM   481  O O   . PRO A 1 64  ? -11.589 75.847 57.471 1.00 37.45 ? 64  PRO A O   1 
ATOM   482  C CB  . PRO A 1 64  ? -11.913 74.922 54.210 1.00 38.46 ? 64  PRO A CB  1 
ATOM   483  C CG  . PRO A 1 64  ? -10.484 75.285 54.157 1.00 37.95 ? 64  PRO A CG  1 
ATOM   484  C CD  . PRO A 1 64  ? -10.472 76.801 54.241 1.00 38.00 ? 64  PRO A CD  1 
ATOM   485  N N   . ASN A 1 65  ? -13.249 74.388 56.989 1.00 37.24 ? 65  ASN A N   1 
ATOM   486  C CA  . ASN A 1 65  ? -13.253 73.757 58.308 1.00 36.08 ? 65  ASN A CA  1 
ATOM   487  C C   . ASN A 1 65  ? -12.024 72.882 58.343 1.00 34.33 ? 65  ASN A C   1 
ATOM   488  O O   . ASN A 1 65  ? -11.443 72.601 57.300 1.00 34.28 ? 65  ASN A O   1 
ATOM   489  C CB  . ASN A 1 65  ? -14.470 72.844 58.510 1.00 37.10 ? 65  ASN A CB  1 
ATOM   490  C CG  . ASN A 1 65  ? -15.777 73.596 58.535 1.00 38.18 ? 65  ASN A CG  1 
ATOM   491  O OD1 . ASN A 1 65  ? -15.873 74.686 59.105 1.00 37.94 ? 65  ASN A OD1 1 
ATOM   492  N ND2 . ASN A 1 65  ? -16.807 73.004 57.935 1.00 39.78 ? 65  ASN A ND2 1 
ATOM   493  N N   . ASN A 1 66  ? -11.640 72.444 59.538 1.00 32.96 ? 66  ASN A N   1 
ATOM   494  C CA  . ASN A 1 66  ? -10.483 71.576 59.700 1.00 32.13 ? 66  ASN A CA  1 
ATOM   495  C C   . ASN A 1 66  ? -10.973 70.174 60.039 1.00 31.11 ? 66  ASN A C   1 
ATOM   496  O O   . ASN A 1 66  ? -12.004 70.013 60.682 1.00 30.51 ? 66  ASN A O   1 
ATOM   497  C CB  . ASN A 1 66  ? -9.568  72.117 60.802 1.00 31.93 ? 66  ASN A CB  1 
ATOM   498  C CG  . ASN A 1 66  ? -8.979  73.484 60.460 1.00 32.02 ? 66  ASN A CG  1 
ATOM   499  O OD1 . ASN A 1 66  ? -8.221  74.060 61.241 1.00 31.47 ? 66  ASN A OD1 1 
ATOM   500  N ND2 . ASN A 1 66  ? -9.322  74.005 59.289 1.00 34.19 ? 66  ASN A ND2 1 
ATOM   501  N N   . CYS A 1 67  ? -10.251 69.157 59.599 1.00 30.72 ? 67  CYS A N   1 
ATOM   502  C CA  . CYS A 1 67  ? -10.690 67.806 59.880 1.00 32.10 ? 67  CYS A CA  1 
ATOM   503  C C   . CYS A 1 67  ? -10.625 67.466 61.362 1.00 32.60 ? 67  CYS A C   1 
ATOM   504  O O   . CYS A 1 67  ? -9.803  68.014 62.094 1.00 33.08 ? 67  CYS A O   1 
ATOM   505  C CB  . CYS A 1 67  ? -9.861  66.804 59.097 1.00 32.18 ? 67  CYS A CB  1 
ATOM   506  S SG  . CYS A 1 67  ? -10.022 66.939 57.295 1.00 36.01 ? 67  CYS A SG  1 
ATOM   507  N N   . GLN A 1 68  ? -11.498 66.557 61.793 1.00 32.82 ? 68  GLN A N   1 
ATOM   508  C CA  . GLN A 1 68  ? -11.563 66.113 63.183 1.00 32.58 ? 68  GLN A CA  1 
ATOM   509  C C   . GLN A 1 68  ? -10.211 65.617 63.622 1.00 31.97 ? 68  GLN A C   1 
ATOM   510  O O   . GLN A 1 68  ? -9.511  64.968 62.849 1.00 32.05 ? 68  GLN A O   1 
ATOM   511  C CB  . GLN A 1 68  ? -12.575 64.985 63.332 1.00 34.27 ? 68  GLN A CB  1 
ATOM   512  C CG  . GLN A 1 68  ? -14.010 65.399 63.053 1.00 37.11 ? 68  GLN A CG  1 
ATOM   513  C CD  . GLN A 1 68  ? -14.537 66.432 64.039 1.00 36.96 ? 68  GLN A CD  1 
ATOM   514  O OE1 . GLN A 1 68  ? -15.703 66.828 63.969 1.00 36.85 ? 68  GLN A OE1 1 
ATOM   515  N NE2 . GLN A 1 68  ? -13.684 66.870 64.960 1.00 37.66 ? 68  GLN A NE2 1 
ATOM   516  N N   . GLN A 1 69  ? -9.851  65.887 64.873 1.00 31.73 ? 69  GLN A N   1 
ATOM   517  C CA  . GLN A 1 69  ? -8.539  65.479 65.357 1.00 30.71 ? 69  GLN A CA  1 
ATOM   518  C C   . GLN A 1 69  ? -8.236  65.793 66.811 1.00 30.36 ? 69  GLN A C   1 
ATOM   519  O O   . GLN A 1 69  ? -8.912  66.583 67.476 1.00 30.75 ? 69  GLN A O   1 
ATOM   520  C CB  . GLN A 1 69  ? -7.481  66.168 64.520 1.00 29.09 ? 69  GLN A CB  1 
ATOM   521  C CG  . GLN A 1 69  ? -7.663  67.666 64.574 1.00 27.87 ? 69  GLN A CG  1 
ATOM   522  C CD  . GLN A 1 69  ? -6.754  68.375 63.634 1.00 28.48 ? 69  GLN A CD  1 
ATOM   523  O OE1 . GLN A 1 69  ? -5.534  68.233 63.718 1.00 29.53 ? 69  GLN A OE1 1 
ATOM   524  N NE2 . GLN A 1 69  ? -7.331  69.145 62.717 1.00 28.63 ? 69  GLN A NE2 1 
ATOM   525  N N   . TYR A 1 70  ? -7.166  65.173 67.281 1.00 29.89 ? 70  TYR A N   1 
ATOM   526  C CA  . TYR A 1 70  ? -6.703  65.378 68.629 1.00 29.51 ? 70  TYR A CA  1 
ATOM   527  C C   . TYR A 1 70  ? -6.126  66.804 68.741 1.00 28.47 ? 70  TYR A C   1 
ATOM   528  O O   . TYR A 1 70  ? -5.335  67.252 67.912 1.00 27.54 ? 70  TYR A O   1 
ATOM   529  C CB  . TYR A 1 70  ? -5.641  64.328 68.970 1.00 30.04 ? 70  TYR A CB  1 
ATOM   530  C CG  . TYR A 1 70  ? -5.044  64.492 70.347 1.00 32.25 ? 70  TYR A CG  1 
ATOM   531  C CD1 . TYR A 1 70  ? -5.729  64.067 71.481 1.00 32.58 ? 70  TYR A CD1 1 
ATOM   532  C CD2 . TYR A 1 70  ? -3.817  65.145 70.521 1.00 32.98 ? 70  TYR A CD2 1 
ATOM   533  C CE1 . TYR A 1 70  ? -5.207  64.300 72.765 1.00 34.64 ? 70  TYR A CE1 1 
ATOM   534  C CE2 . TYR A 1 70  ? -3.290  65.378 71.793 1.00 33.48 ? 70  TYR A CE2 1 
ATOM   535  C CZ  . TYR A 1 70  ? -3.987  64.959 72.915 1.00 33.88 ? 70  TYR A CZ  1 
ATOM   536  O OH  . TYR A 1 70  ? -3.475  65.212 74.179 1.00 33.60 ? 70  TYR A OH  1 
ATOM   537  N N   . VAL A 1 71  ? -6.551  67.523 69.768 1.00 27.67 ? 71  VAL A N   1 
ATOM   538  C CA  . VAL A 1 71  ? -6.069  68.870 69.989 1.00 26.81 ? 71  VAL A CA  1 
ATOM   539  C C   . VAL A 1 71  ? -5.087  68.892 71.166 1.00 28.04 ? 71  VAL A C   1 
ATOM   540  O O   . VAL A 1 71  ? -5.404  68.429 72.255 1.00 27.96 ? 71  VAL A O   1 
ATOM   541  C CB  . VAL A 1 71  ? -7.248  69.801 70.227 1.00 23.72 ? 71  VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 71  ? -6.781  71.185 70.534 1.00 21.33 ? 71  VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 71  ? -8.088  69.814 68.990 1.00 22.88 ? 71  VAL A CG2 1 
ATOM   544  N N   . ASP A 1 72  ? -3.884  69.406 70.915 1.00 28.82 ? 72  ASP A N   1 
ATOM   545  C CA  . ASP A 1 72  ? -2.836  69.487 71.916 1.00 30.29 ? 72  ASP A CA  1 
ATOM   546  C C   . ASP A 1 72  ? -3.180  70.524 72.951 1.00 32.11 ? 72  ASP A C   1 
ATOM   547  O O   . ASP A 1 72  ? -3.188  71.714 72.649 1.00 33.33 ? 72  ASP A O   1 
ATOM   548  C CB  . ASP A 1 72  ? -1.520  69.874 71.262 1.00 30.63 ? 72  ASP A CB  1 
ATOM   549  C CG  . ASP A 1 72  ? -0.417  70.114 72.270 1.00 30.35 ? 72  ASP A CG  1 
ATOM   550  O OD1 . ASP A 1 72  ? -0.455  69.531 73.369 1.00 30.40 ? 72  ASP A OD1 1 
ATOM   551  O OD2 . ASP A 1 72  ? 0.502   70.884 71.951 1.00 31.47 ? 72  ASP A OD2 1 
ATOM   552  N N   . GLU A 1 73  ? -3.453  70.085 74.175 1.00 33.40 ? 73  GLU A N   1 
ATOM   553  C CA  . GLU A 1 73  ? -3.807  71.020 75.233 1.00 34.41 ? 73  GLU A CA  1 
ATOM   554  C C   . GLU A 1 73  ? -2.757  71.054 76.319 1.00 34.40 ? 73  GLU A C   1 
ATOM   555  O O   . GLU A 1 73  ? -2.965  71.600 77.397 1.00 34.40 ? 73  GLU A O   1 
ATOM   556  C CB  . GLU A 1 73  ? -5.163  70.651 75.817 1.00 35.17 ? 73  GLU A CB  1 
ATOM   557  C CG  . GLU A 1 73  ? -6.292  71.434 75.197 1.00 38.18 ? 73  GLU A CG  1 
ATOM   558  C CD  . GLU A 1 73  ? -7.643  70.911 75.614 1.00 41.37 ? 73  GLU A CD  1 
ATOM   559  O OE1 . GLU A 1 73  ? -8.009  69.799 75.174 1.00 43.03 ? 73  GLU A OE1 1 
ATOM   560  O OE2 . GLU A 1 73  ? -8.338  71.604 76.389 1.00 44.30 ? 73  GLU A OE2 1 
ATOM   561  N N   . GLN A 1 74  ? -1.612  70.475 76.006 1.00 34.50 ? 74  GLN A N   1 
ATOM   562  C CA  . GLN A 1 74  ? -0.495  70.410 76.927 1.00 34.76 ? 74  GLN A CA  1 
ATOM   563  C C   . GLN A 1 74  ? -0.009  71.737 77.527 1.00 33.89 ? 74  GLN A C   1 
ATOM   564  O O   . GLN A 1 74  ? 0.314   71.811 78.709 1.00 35.19 ? 74  GLN A O   1 
ATOM   565  C CB  . GLN A 1 74  ? 0.647   69.696 76.228 1.00 36.50 ? 74  GLN A CB  1 
ATOM   566  C CG  . GLN A 1 74  ? 0.755   68.300 76.680 1.00 39.86 ? 74  GLN A CG  1 
ATOM   567  C CD  . GLN A 1 74  ? 1.266   68.258 78.087 1.00 42.89 ? 74  GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 74  ? 1.011   67.306 78.826 1.00 45.35 ? 74  GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 74  ? 2.012   69.297 78.475 1.00 43.21 ? 74  GLN A NE2 1 
ATOM   570  N N   . PHE A 1 75  ? 0.065   72.782 76.721 1.00 32.05 ? 75  PHE A N   1 
ATOM   571  C CA  . PHE A 1 75  ? 0.510   74.060 77.228 1.00 29.76 ? 75  PHE A CA  1 
ATOM   572  C C   . PHE A 1 75  ? -0.490  75.070 76.751 1.00 29.77 ? 75  PHE A C   1 
ATOM   573  O O   . PHE A 1 75  ? -0.208  75.840 75.838 1.00 29.49 ? 75  PHE A O   1 
ATOM   574  C CB  . PHE A 1 75  ? 1.890   74.404 76.687 1.00 29.75 ? 75  PHE A CB  1 
ATOM   575  C CG  . PHE A 1 75  ? 2.919   73.347 76.951 1.00 30.22 ? 75  PHE A CG  1 
ATOM   576  C CD1 . PHE A 1 75  ? 3.619   73.326 78.138 1.00 30.00 ? 75  PHE A CD1 1 
ATOM   577  C CD2 . PHE A 1 75  ? 3.178   72.363 76.019 1.00 32.21 ? 75  PHE A CD2 1 
ATOM   578  C CE1 . PHE A 1 75  ? 4.557   72.346 78.393 1.00 30.74 ? 75  PHE A CE1 1 
ATOM   579  C CE2 . PHE A 1 75  ? 4.120   71.376 76.273 1.00 32.32 ? 75  PHE A CE2 1 
ATOM   580  C CZ  . PHE A 1 75  ? 4.807   71.372 77.460 1.00 31.22 ? 75  PHE A CZ  1 
ATOM   581  N N   . PRO A 1 76  ? -1.694  75.063 77.351 1.00 29.59 ? 76  PRO A N   1 
ATOM   582  C CA  . PRO A 1 76  ? -2.766  75.990 76.989 1.00 29.07 ? 76  PRO A CA  1 
ATOM   583  C C   . PRO A 1 76  ? -2.216  77.401 76.924 1.00 29.80 ? 76  PRO A C   1 
ATOM   584  O O   . PRO A 1 76  ? -1.472  77.825 77.817 1.00 30.80 ? 76  PRO A O   1 
ATOM   585  C CB  . PRO A 1 76  ? -3.763  75.813 78.126 1.00 28.13 ? 76  PRO A CB  1 
ATOM   586  C CG  . PRO A 1 76  ? -3.613  74.386 78.481 1.00 27.53 ? 76  PRO A CG  1 
ATOM   587  C CD  . PRO A 1 76  ? -2.111  74.203 78.473 1.00 28.44 ? 76  PRO A CD  1 
ATOM   588  N N   . GLY A 1 77  ? -2.565  78.117 75.860 1.00 29.77 ? 77  GLY A N   1 
ATOM   589  C CA  . GLY A 1 77  ? -2.102  79.484 75.706 1.00 30.24 ? 77  GLY A CA  1 
ATOM   590  C C   . GLY A 1 77  ? -0.693  79.666 75.165 1.00 31.11 ? 77  GLY A C   1 
ATOM   591  O O   . GLY A 1 77  ? -0.396  80.698 74.565 1.00 33.03 ? 77  GLY A O   1 
ATOM   592  N N   . PHE A 1 78  ? 0.184   78.689 75.373 1.00 30.57 ? 78  PHE A N   1 
ATOM   593  C CA  . PHE A 1 78  ? 1.560   78.785 74.879 1.00 28.84 ? 78  PHE A CA  1 
ATOM   594  C C   . PHE A 1 78  ? 1.546   78.866 73.353 1.00 29.37 ? 78  PHE A C   1 
ATOM   595  O O   . PHE A 1 78  ? 0.974   77.998 72.680 1.00 29.83 ? 78  PHE A O   1 
ATOM   596  C CB  . PHE A 1 78  ? 2.353   77.562 75.345 1.00 26.58 ? 78  PHE A CB  1 
ATOM   597  C CG  . PHE A 1 78  ? 3.806   77.607 75.003 1.00 24.51 ? 78  PHE A CG  1 
ATOM   598  C CD1 . PHE A 1 78  ? 4.528   78.780 75.129 1.00 23.92 ? 78  PHE A CD1 1 
ATOM   599  C CD2 . PHE A 1 78  ? 4.469   76.456 74.605 1.00 24.65 ? 78  PHE A CD2 1 
ATOM   600  C CE1 . PHE A 1 78  ? 5.902   78.807 74.866 1.00 24.55 ? 78  PHE A CE1 1 
ATOM   601  C CE2 . PHE A 1 78  ? 5.841   76.474 74.340 1.00 25.45 ? 78  PHE A CE2 1 
ATOM   602  C CZ  . PHE A 1 78  ? 6.559   77.652 74.471 1.00 24.29 ? 78  PHE A CZ  1 
ATOM   603  N N   . SER A 1 79  ? 2.143   79.918 72.801 1.00 29.10 ? 79  SER A N   1 
ATOM   604  C CA  . SER A 1 79  ? 2.190   80.069 71.346 1.00 29.07 ? 79  SER A CA  1 
ATOM   605  C C   . SER A 1 79  ? 2.897   78.867 70.752 1.00 28.44 ? 79  SER A C   1 
ATOM   606  O O   . SER A 1 79  ? 2.363   78.195 69.877 1.00 29.27 ? 79  SER A O   1 
ATOM   607  C CB  . SER A 1 79  ? 2.941   81.334 70.978 1.00 29.60 ? 79  SER A CB  1 
ATOM   608  O OG  . SER A 1 79  ? 3.668   81.789 72.108 1.00 34.45 ? 79  SER A OG  1 
ATOM   609  N N   . GLY A 1 80  ? 4.097   78.594 71.249 1.00 27.78 ? 80  GLY A N   1 
ATOM   610  C CA  . GLY A 1 80  ? 4.860   77.460 70.772 1.00 27.01 ? 80  GLY A CA  1 
ATOM   611  C C   . GLY A 1 80  ? 4.014   76.248 70.444 1.00 26.72 ? 80  GLY A C   1 
ATOM   612  O O   . GLY A 1 80  ? 4.167   75.655 69.383 1.00 25.36 ? 80  GLY A O   1 
ATOM   613  N N   . SER A 1 81  ? 3.099   75.890 71.333 1.00 27.92 ? 81  SER A N   1 
ATOM   614  C CA  . SER A 1 81  ? 2.266   74.714 71.101 1.00 30.53 ? 81  SER A CA  1 
ATOM   615  C C   . SER A 1 81  ? 1.000   74.942 70.261 1.00 32.13 ? 81  SER A C   1 
ATOM   616  O O   . SER A 1 81  ? 0.674   74.139 69.372 1.00 31.89 ? 81  SER A O   1 
ATOM   617  C CB  . SER A 1 81  ? 1.875   74.067 72.442 1.00 29.78 ? 81  SER A CB  1 
ATOM   618  O OG  . SER A 1 81  ? 0.677   74.621 72.960 1.00 27.80 ? 81  SER A OG  1 
ATOM   619  N N   . GLU A 1 82  ? 0.290   76.030 70.524 1.00 33.50 ? 82  GLU A N   1 
ATOM   620  C CA  . GLU A 1 82  ? -0.938  76.272 69.792 1.00 35.11 ? 82  GLU A CA  1 
ATOM   621  C C   . GLU A 1 82  ? -0.831  76.688 68.333 1.00 34.12 ? 82  GLU A C   1 
ATOM   622  O O   . GLU A 1 82  ? -1.812  76.594 67.594 1.00 35.27 ? 82  GLU A O   1 
ATOM   623  C CB  . GLU A 1 82  ? -1.821  77.254 70.560 1.00 39.17 ? 82  GLU A CB  1 
ATOM   624  C CG  . GLU A 1 82  ? -3.033  76.555 71.195 1.00 45.04 ? 82  GLU A CG  1 
ATOM   625  C CD  . GLU A 1 82  ? -3.070  76.703 72.705 1.00 49.43 ? 82  GLU A CD  1 
ATOM   626  O OE1 . GLU A 1 82  ? -2.452  77.679 73.201 1.00 50.90 ? 82  GLU A OE1 1 
ATOM   627  O OE2 . GLU A 1 82  ? -3.719  75.855 73.385 1.00 51.65 ? 82  GLU A OE2 1 
ATOM   628  N N   . MET A 1 83  ? 0.341   77.124 67.888 1.00 32.38 ? 83  MET A N   1 
ATOM   629  C CA  . MET A 1 83  ? 0.472   77.514 66.484 1.00 30.12 ? 83  MET A CA  1 
ATOM   630  C C   . MET A 1 83  ? 0.202   76.322 65.561 1.00 28.23 ? 83  MET A C   1 
ATOM   631  O O   . MET A 1 83  ? 0.029   76.501 64.365 1.00 27.03 ? 83  MET A O   1 
ATOM   632  C CB  . MET A 1 83  ? 1.863   78.063 66.204 1.00 28.95 ? 83  MET A CB  1 
ATOM   633  C CG  . MET A 1 83  ? 2.917   77.038 66.429 1.00 29.12 ? 83  MET A CG  1 
ATOM   634  S SD  . MET A 1 83  ? 4.498   77.707 66.095 1.00 30.04 ? 83  MET A SD  1 
ATOM   635  C CE  . MET A 1 83  ? 4.618   77.349 64.357 1.00 29.67 ? 83  MET A CE  1 
ATOM   636  N N   . TRP A 1 84  ? 0.169   75.111 66.115 1.00 27.38 ? 84  TRP A N   1 
ATOM   637  C CA  . TRP A 1 84  ? -0.094  73.923 65.308 1.00 26.69 ? 84  TRP A CA  1 
ATOM   638  C C   . TRP A 1 84  ? -1.502  73.389 65.482 1.00 25.95 ? 84  TRP A C   1 
ATOM   639  O O   . TRP A 1 84  ? -1.943  72.557 64.686 1.00 26.78 ? 84  TRP A O   1 
ATOM   640  C CB  . TRP A 1 84  ? 0.881   72.797 65.635 1.00 25.70 ? 84  TRP A CB  1 
ATOM   641  C CG  . TRP A 1 84  ? 2.266   73.242 65.703 1.00 25.43 ? 84  TRP A CG  1 
ATOM   642  C CD1 . TRP A 1 84  ? 2.988   73.480 66.826 1.00 26.10 ? 84  TRP A CD1 1 
ATOM   643  C CD2 . TRP A 1 84  ? 3.130   73.504 64.604 1.00 25.33 ? 84  TRP A CD2 1 
ATOM   644  N NE1 . TRP A 1 84  ? 4.263   73.869 66.498 1.00 25.57 ? 84  TRP A NE1 1 
ATOM   645  C CE2 . TRP A 1 84  ? 4.377   73.891 65.138 1.00 25.71 ? 84  TRP A CE2 1 
ATOM   646  C CE3 . TRP A 1 84  ? 2.977   73.446 63.217 1.00 25.29 ? 84  TRP A CE3 1 
ATOM   647  C CZ2 . TRP A 1 84  ? 5.462   74.215 64.338 1.00 26.62 ? 84  TRP A CZ2 1 
ATOM   648  C CZ3 . TRP A 1 84  ? 4.055   73.770 62.418 1.00 25.66 ? 84  TRP A CZ3 1 
ATOM   649  C CH2 . TRP A 1 84  ? 5.283   74.149 62.980 1.00 27.63 ? 84  TRP A CH2 1 
ATOM   650  N N   . ASN A 1 85  ? -2.193  73.847 66.518 1.00 24.20 ? 85  ASN A N   1 
ATOM   651  C CA  . ASN A 1 85  ? -3.546  73.400 66.769 1.00 25.09 ? 85  ASN A CA  1 
ATOM   652  C C   . ASN A 1 85  ? -4.472  73.968 65.720 1.00 26.23 ? 85  ASN A C   1 
ATOM   653  O O   . ASN A 1 85  ? -4.234  75.070 65.227 1.00 26.28 ? 85  ASN A O   1 
ATOM   654  C CB  . ASN A 1 85  ? -4.010  73.874 68.123 1.00 28.17 ? 85  ASN A CB  1 
ATOM   655  C CG  . ASN A 1 85  ? -3.594  72.959 69.226 1.00 31.19 ? 85  ASN A CG  1 
ATOM   656  O OD1 . ASN A 1 85  ? -4.088  71.837 69.341 1.00 31.70 ? 85  ASN A OD1 1 
ATOM   657  N ND2 . ASN A 1 85  ? -2.676  73.429 70.060 1.00 34.39 ? 85  ASN A ND2 1 
ATOM   658  N N   . PRO A 1 86  ? -5.567  73.240 65.386 1.00 27.10 ? 86  PRO A N   1 
ATOM   659  C CA  . PRO A 1 86  ? -6.511  73.719 64.372 1.00 26.90 ? 86  PRO A CA  1 
ATOM   660  C C   . PRO A 1 86  ? -7.047  75.079 64.765 1.00 26.99 ? 86  PRO A C   1 
ATOM   661  O O   . PRO A 1 86  ? -7.356  75.305 65.930 1.00 27.07 ? 86  PRO A O   1 
ATOM   662  C CB  . PRO A 1 86  ? -7.598  72.645 64.370 1.00 25.48 ? 86  PRO A CB  1 
ATOM   663  C CG  . PRO A 1 86  ? -7.635  72.212 65.744 1.00 25.29 ? 86  PRO A CG  1 
ATOM   664  C CD  . PRO A 1 86  ? -6.160  72.106 66.123 1.00 26.77 ? 86  PRO A CD  1 
ATOM   665  N N   . ASN A 1 87  ? -7.145  75.982 63.796 1.00 27.12 ? 87  ASN A N   1 
ATOM   666  C CA  . ASN A 1 87  ? -7.642  77.313 64.069 1.00 27.18 ? 87  ASN A CA  1 
ATOM   667  C C   . ASN A 1 87  ? -8.979  77.616 63.422 1.00 27.90 ? 87  ASN A C   1 
ATOM   668  O O   . ASN A 1 87  ? -9.342  78.770 63.327 1.00 29.05 ? 87  ASN A O   1 
ATOM   669  C CB  . ASN A 1 87  ? -6.642  78.349 63.607 1.00 25.80 ? 87  ASN A CB  1 
ATOM   670  C CG  . ASN A 1 87  ? -6.349  78.226 62.157 1.00 26.35 ? 87  ASN A CG  1 
ATOM   671  O OD1 . ASN A 1 87  ? -7.023  77.476 61.445 1.00 23.66 ? 87  ASN A OD1 1 
ATOM   672  N ND2 . ASN A 1 87  ? -5.337  78.956 61.688 1.00 27.83 ? 87  ASN A ND2 1 
ATOM   673  N N   . ARG A 1 88  ? -9.703  76.602 62.966 1.00 29.36 ? 88  ARG A N   1 
ATOM   674  C CA  . ARG A 1 88  ? -11.014 76.810 62.352 1.00 30.72 ? 88  ARG A CA  1 
ATOM   675  C C   . ARG A 1 88  ? -11.901 75.715 62.900 1.00 31.47 ? 88  ARG A C   1 
ATOM   676  O O   . ARG A 1 88  ? -11.399 74.709 63.387 1.00 32.40 ? 88  ARG A O   1 
ATOM   677  C CB  . ARG A 1 88  ? -10.960 76.684 60.825 1.00 33.17 ? 88  ARG A CB  1 
ATOM   678  C CG  . ARG A 1 88  ? -10.044 77.666 60.104 1.00 36.07 ? 88  ARG A CG  1 
ATOM   679  C CD  . ARG A 1 88  ? -10.304 79.107 60.537 1.00 40.25 ? 88  ARG A CD  1 
ATOM   680  N NE  . ARG A 1 88  ? -11.266 79.834 59.716 1.00 44.21 ? 88  ARG A NE  1 
ATOM   681  C CZ  . ARG A 1 88  ? -12.517 79.443 59.477 1.00 48.63 ? 88  ARG A CZ  1 
ATOM   682  N NH1 . ARG A 1 88  ? -12.989 78.301 59.985 1.00 50.07 ? 88  ARG A NH1 1 
ATOM   683  N NH2 . ARG A 1 88  ? -13.302 80.198 58.713 1.00 50.42 ? 88  ARG A NH2 1 
ATOM   684  N N   . GLU A 1 89  ? -13.214 75.909 62.815 1.00 32.39 ? 89  GLU A N   1 
ATOM   685  C CA  . GLU A 1 89  ? -14.192 74.939 63.321 1.00 32.79 ? 89  GLU A CA  1 
ATOM   686  C C   . GLU A 1 89  ? -13.867 73.571 62.748 1.00 32.00 ? 89  GLU A C   1 
ATOM   687  O O   . GLU A 1 89  ? -13.725 73.432 61.541 1.00 33.31 ? 89  GLU A O   1 
ATOM   688  C CB  . GLU A 1 89  ? -15.605 75.361 62.882 1.00 35.59 ? 89  GLU A CB  1 
ATOM   689  C CG  . GLU A 1 89  ? -16.762 74.571 63.489 1.00 38.05 ? 89  GLU A CG  1 
ATOM   690  C CD  . GLU A 1 89  ? -17.097 75.028 64.902 1.00 40.29 ? 89  GLU A CD  1 
ATOM   691  N N   . MET A 1 90  ? -13.732 72.556 63.591 1.00 31.02 ? 90  MET A N   1 
ATOM   692  C CA  . MET A 1 90  ? -13.429 71.233 63.064 1.00 30.70 ? 90  MET A CA  1 
ATOM   693  C C   . MET A 1 90  ? -14.726 70.645 62.550 1.00 31.19 ? 90  MET A C   1 
ATOM   694  O O   . MET A 1 90  ? -15.801 71.041 63.005 1.00 31.47 ? 90  MET A O   1 
ATOM   695  C CB  . MET A 1 90  ? -12.843 70.325 64.141 1.00 29.76 ? 90  MET A CB  1 
ATOM   696  C CG  . MET A 1 90  ? -11.526 70.802 64.699 1.00 30.78 ? 90  MET A CG  1 
ATOM   697  S SD  . MET A 1 90  ? -10.680 69.521 65.633 1.00 32.46 ? 90  MET A SD  1 
ATOM   698  C CE  . MET A 1 90  ? -11.738 69.347 67.033 1.00 33.01 ? 90  MET A CE  1 
ATOM   699  N N   . SER A 1 91  ? -14.626 69.713 61.606 1.00 30.83 ? 91  SER A N   1 
ATOM   700  C CA  . SER A 1 91  ? -15.803 69.073 61.033 1.00 31.00 ? 91  SER A CA  1 
ATOM   701  C C   . SER A 1 91  ? -15.369 67.864 60.239 1.00 31.50 ? 91  SER A C   1 
ATOM   702  O O   . SER A 1 91  ? -14.211 67.796 59.841 1.00 32.57 ? 91  SER A O   1 
ATOM   703  C CB  . SER A 1 91  ? -16.512 70.038 60.086 1.00 30.74 ? 91  SER A CB  1 
ATOM   704  O OG  . SER A 1 91  ? -17.627 69.415 59.465 1.00 30.63 ? 91  SER A OG  1 
ATOM   705  N N   . GLU A 1 92  ? -16.273 66.909 60.010 1.00 31.01 ? 92  GLU A N   1 
ATOM   706  C CA  . GLU A 1 92  ? -15.913 65.763 59.189 1.00 31.25 ? 92  GLU A CA  1 
ATOM   707  C C   . GLU A 1 92  ? -15.905 66.220 57.723 1.00 32.76 ? 92  GLU A C   1 
ATOM   708  O O   . GLU A 1 92  ? -15.264 65.599 56.874 1.00 32.11 ? 92  GLU A O   1 
ATOM   709  C CB  . GLU A 1 92  ? -16.877 64.611 59.396 1.00 29.78 ? 92  GLU A CB  1 
ATOM   710  C CG  . GLU A 1 92  ? -16.500 63.747 60.566 1.00 30.32 ? 92  GLU A CG  1 
ATOM   711  C CD  . GLU A 1 92  ? -17.310 62.468 60.630 1.00 31.61 ? 92  GLU A CD  1 
ATOM   712  O OE1 . GLU A 1 92  ? -18.545 62.537 60.802 1.00 31.68 ? 92  GLU A OE1 1 
ATOM   713  O OE2 . GLU A 1 92  ? -16.710 61.384 60.501 1.00 32.67 ? 92  GLU A OE2 1 
ATOM   714  N N   . ASP A 1 93  ? -16.620 67.312 57.434 1.00 34.26 ? 93  ASP A N   1 
ATOM   715  C CA  . ASP A 1 93  ? -16.643 67.892 56.089 1.00 35.25 ? 93  ASP A CA  1 
ATOM   716  C C   . ASP A 1 93  ? -15.475 68.847 56.076 1.00 35.36 ? 93  ASP A C   1 
ATOM   717  O O   . ASP A 1 93  ? -15.608 70.006 56.465 1.00 35.73 ? 93  ASP A O   1 
ATOM   718  C CB  . ASP A 1 93  ? -17.893 68.719 55.815 1.00 36.22 ? 93  ASP A CB  1 
ATOM   719  C CG  . ASP A 1 93  ? -17.771 69.522 54.519 1.00 38.86 ? 93  ASP A CG  1 
ATOM   720  O OD1 . ASP A 1 93  ? -16.974 69.108 53.641 1.00 41.32 ? 93  ASP A OD1 1 
ATOM   721  O OD2 . ASP A 1 93  ? -18.457 70.557 54.365 1.00 38.58 ? 93  ASP A OD2 1 
ATOM   722  N N   . CYS A 1 94  ? -14.339 68.373 55.599 1.00 35.29 ? 94  CYS A N   1 
ATOM   723  C CA  . CYS A 1 94  ? -13.147 69.188 55.606 1.00 35.75 ? 94  CYS A CA  1 
ATOM   724  C C   . CYS A 1 94  ? -12.291 68.939 54.379 1.00 36.98 ? 94  CYS A C   1 
ATOM   725  O O   . CYS A 1 94  ? -11.088 69.226 54.401 1.00 38.56 ? 94  CYS A O   1 
ATOM   726  C CB  . CYS A 1 94  ? -12.353 68.825 56.857 1.00 35.42 ? 94  CYS A CB  1 
ATOM   727  S SG  . CYS A 1 94  ? -12.024 67.030 56.951 1.00 33.14 ? 94  CYS A SG  1 
ATOM   728  N N   . LEU A 1 95  ? -12.887 68.407 53.309 1.00 36.09 ? 95  LEU A N   1 
ATOM   729  C CA  . LEU A 1 95  ? -12.098 68.096 52.118 1.00 33.80 ? 95  LEU A CA  1 
ATOM   730  C C   . LEU A 1 95  ? -12.025 69.214 51.080 1.00 33.37 ? 95  LEU A C   1 
ATOM   731  O O   . LEU A 1 95  ? -12.647 69.145 50.019 1.00 34.65 ? 95  LEU A O   1 
ATOM   732  C CB  . LEU A 1 95  ? -12.597 66.776 51.511 1.00 31.49 ? 95  LEU A CB  1 
ATOM   733  C CG  . LEU A 1 95  ? -12.177 65.601 52.405 1.00 29.00 ? 95  LEU A CG  1 
ATOM   734  C CD1 . LEU A 1 95  ? -12.654 64.269 51.892 1.00 27.29 ? 95  LEU A CD1 1 
ATOM   735  C CD2 . LEU A 1 95  ? -10.674 65.617 52.492 1.00 28.95 ? 95  LEU A CD2 1 
ATOM   736  N N   . TYR A 1 96  ? -11.236 70.239 51.402 1.00 32.00 ? 96  TYR A N   1 
ATOM   737  C CA  . TYR A 1 96  ? -11.061 71.405 50.542 1.00 30.86 ? 96  TYR A CA  1 
ATOM   738  C C   . TYR A 1 96  ? -9.607  71.687 50.274 1.00 29.92 ? 96  TYR A C   1 
ATOM   739  O O   . TYR A 1 96  ? -8.725  71.054 50.845 1.00 30.05 ? 96  TYR A O   1 
ATOM   740  C CB  . TYR A 1 96  ? -11.667 72.646 51.199 1.00 30.61 ? 96  TYR A CB  1 
ATOM   741  C CG  . TYR A 1 96  ? -13.102 72.451 51.548 1.00 30.58 ? 96  TYR A CG  1 
ATOM   742  C CD1 . TYR A 1 96  ? -13.469 71.689 52.653 1.00 30.62 ? 96  TYR A CD1 1 
ATOM   743  C CD2 . TYR A 1 96  ? -14.101 72.937 50.711 1.00 31.83 ? 96  TYR A CD2 1 
ATOM   744  C CE1 . TYR A 1 96  ? -14.802 71.404 52.911 1.00 34.01 ? 96  TYR A CE1 1 
ATOM   745  C CE2 . TYR A 1 96  ? -15.439 72.661 50.949 1.00 34.02 ? 96  TYR A CE2 1 
ATOM   746  C CZ  . TYR A 1 96  ? -15.792 71.893 52.046 1.00 35.24 ? 96  TYR A CZ  1 
ATOM   747  O OH  . TYR A 1 96  ? -17.128 71.608 52.265 1.00 35.70 ? 96  TYR A OH  1 
ATOM   748  N N   . LEU A 1 97  ? -9.363  72.651 49.401 1.00 28.80 ? 97  LEU A N   1 
ATOM   749  C CA  . LEU A 1 97  ? -8.008  73.041 49.099 1.00 28.87 ? 97  LEU A CA  1 
ATOM   750  C C   . LEU A 1 97  ? -7.956  74.558 48.932 1.00 30.15 ? 97  LEU A C   1 
ATOM   751  O O   . LEU A 1 97  ? -8.995  75.192 48.738 1.00 30.37 ? 97  LEU A O   1 
ATOM   752  C CB  . LEU A 1 97  ? -7.502  72.293 47.861 1.00 26.58 ? 97  LEU A CB  1 
ATOM   753  C CG  . LEU A 1 97  ? -8.157  72.357 46.487 1.00 24.25 ? 97  LEU A CG  1 
ATOM   754  C CD1 . LEU A 1 97  ? -7.963  73.726 45.863 1.00 24.08 ? 97  LEU A CD1 1 
ATOM   755  C CD2 . LEU A 1 97  ? -7.509  71.312 45.614 1.00 22.62 ? 97  LEU A CD2 1 
ATOM   756  N N   . ASN A 1 98  ? -6.755  75.133 49.045 1.00 31.37 ? 98  ASN A N   1 
ATOM   757  C CA  . ASN A 1 98  ? -6.545  76.583 48.930 1.00 31.50 ? 98  ASN A CA  1 
ATOM   758  C C   . ASN A 1 98  ? -5.466  76.912 47.897 1.00 32.01 ? 98  ASN A C   1 
ATOM   759  O O   . ASN A 1 98  ? -4.479  76.172 47.767 1.00 32.57 ? 98  ASN A O   1 
ATOM   760  C CB  . ASN A 1 98  ? -6.105  77.159 50.279 1.00 31.66 ? 98  ASN A CB  1 
ATOM   761  C CG  . ASN A 1 98  ? -6.980  76.704 51.421 1.00 31.99 ? 98  ASN A CG  1 
ATOM   762  O OD1 . ASN A 1 98  ? -8.151  77.068 51.500 1.00 33.65 ? 98  ASN A OD1 1 
ATOM   763  N ND2 . ASN A 1 98  ? -6.417  75.896 52.316 1.00 31.29 ? 98  ASN A ND2 1 
ATOM   764  N N   . ILE A 1 99  ? -5.635  78.035 47.194 1.00 31.32 ? 99  ILE A N   1 
ATOM   765  C CA  . ILE A 1 99  ? -4.668  78.453 46.175 1.00 31.27 ? 99  ILE A CA  1 
ATOM   766  C C   . ILE A 1 99  ? -4.246  79.924 46.206 1.00 30.96 ? 99  ILE A C   1 
ATOM   767  O O   . ILE A 1 99  ? -5.080  80.824 46.137 1.00 30.53 ? 99  ILE A O   1 
ATOM   768  C CB  . ILE A 1 99  ? -5.207  78.184 44.764 1.00 31.29 ? 99  ILE A CB  1 
ATOM   769  C CG1 . ILE A 1 99  ? -5.791  76.767 44.694 1.00 30.08 ? 99  ILE A CG1 1 
ATOM   770  C CG2 . ILE A 1 99  ? -4.086  78.419 43.742 1.00 30.59 ? 99  ILE A CG2 1 
ATOM   771  C CD1 . ILE A 1 99  ? -7.022  76.645 43.840 1.00 28.73 ? 99  ILE A CD1 1 
ATOM   772  N N   . TRP A 1 100 ? -2.949  80.172 46.297 1.00 31.04 ? 100 TRP A N   1 
ATOM   773  C CA  . TRP A 1 100 ? -2.485  81.541 46.296 1.00 32.04 ? 100 TRP A CA  1 
ATOM   774  C C   . TRP A 1 100 ? -1.932  81.766 44.923 1.00 32.97 ? 100 TRP A C   1 
ATOM   775  O O   . TRP A 1 100 ? -0.982  81.111 44.519 1.00 33.28 ? 100 TRP A O   1 
ATOM   776  C CB  . TRP A 1 100 ? -1.424  81.770 47.373 1.00 32.59 ? 100 TRP A CB  1 
ATOM   777  C CG  . TRP A 1 100 ? -2.052  81.909 48.730 1.00 33.70 ? 100 TRP A CG  1 
ATOM   778  C CD1 . TRP A 1 100 ? -2.624  83.038 49.271 1.00 33.63 ? 100 TRP A CD1 1 
ATOM   779  C CD2 . TRP A 1 100 ? -2.320  80.852 49.652 1.00 33.81 ? 100 TRP A CD2 1 
ATOM   780  N NE1 . TRP A 1 100 ? -3.239  82.737 50.465 1.00 32.65 ? 100 TRP A NE1 1 
ATOM   781  C CE2 . TRP A 1 100 ? -3.069  81.402 50.720 1.00 33.32 ? 100 TRP A CE2 1 
ATOM   782  C CE3 . TRP A 1 100 ? -2.008  79.486 49.676 1.00 33.49 ? 100 TRP A CE3 1 
ATOM   783  C CZ2 . TRP A 1 100 ? -3.505  80.632 51.792 1.00 33.11 ? 100 TRP A CZ2 1 
ATOM   784  C CZ3 . TRP A 1 100 ? -2.446  78.723 50.747 1.00 33.23 ? 100 TRP A CZ3 1 
ATOM   785  C CH2 . TRP A 1 100 ? -3.185  79.298 51.788 1.00 33.27 ? 100 TRP A CH2 1 
ATOM   786  N N   . VAL A 1 101 ? -2.564  82.686 44.200 1.00 34.51 ? 101 VAL A N   1 
ATOM   787  C CA  . VAL A 1 101 ? -2.185  83.028 42.825 1.00 34.93 ? 101 VAL A CA  1 
ATOM   788  C C   . VAL A 1 101 ? -1.596  84.430 42.703 1.00 34.65 ? 101 VAL A C   1 
ATOM   789  O O   . VAL A 1 101 ? -2.098  85.389 43.306 1.00 34.03 ? 101 VAL A O   1 
ATOM   790  C CB  . VAL A 1 101 ? -3.415  82.969 41.849 1.00 35.11 ? 101 VAL A CB  1 
ATOM   791  C CG1 . VAL A 1 101 ? -2.938  83.068 40.413 1.00 33.27 ? 101 VAL A CG1 1 
ATOM   792  C CG2 . VAL A 1 101 ? -4.238  81.687 42.074 1.00 34.97 ? 101 VAL A CG2 1 
ATOM   793  N N   . PRO A 1 102 ? -0.502  84.561 41.941 1.00 34.95 ? 102 PRO A N   1 
ATOM   794  C CA  . PRO A 1 102 ? 0.093   85.883 41.780 1.00 36.79 ? 102 PRO A CA  1 
ATOM   795  C C   . PRO A 1 102 ? -0.876  86.860 41.100 1.00 39.35 ? 102 PRO A C   1 
ATOM   796  O O   . PRO A 1 102 ? -1.983  86.483 40.683 1.00 39.26 ? 102 PRO A O   1 
ATOM   797  C CB  . PRO A 1 102 ? 1.332   85.587 40.943 1.00 35.19 ? 102 PRO A CB  1 
ATOM   798  C CG  . PRO A 1 102 ? 1.783   84.292 41.506 1.00 33.42 ? 102 PRO A CG  1 
ATOM   799  C CD  . PRO A 1 102 ? 0.472   83.514 41.583 1.00 34.56 ? 102 PRO A CD  1 
ATOM   800  N N   . SER A 1 103 ? -0.473  88.123 41.027 1.00 42.27 ? 103 SER A N   1 
ATOM   801  C CA  . SER A 1 103 ? -1.294  89.144 40.378 1.00 45.80 ? 103 SER A CA  1 
ATOM   802  C C   . SER A 1 103 ? -0.381  90.145 39.663 1.00 47.55 ? 103 SER A C   1 
ATOM   803  O O   . SER A 1 103 ? 0.506   90.743 40.278 1.00 48.94 ? 103 SER A O   1 
ATOM   804  C CB  . SER A 1 103 ? -2.183  89.874 41.395 1.00 45.25 ? 103 SER A CB  1 
ATOM   805  O OG  . SER A 1 103 ? -2.987  90.851 40.753 1.00 44.55 ? 103 SER A OG  1 
ATOM   806  N N   . PRO A 1 104 ? -0.575  90.321 38.344 1.00 47.82 ? 104 PRO A N   1 
ATOM   807  C CA  . PRO A 1 104 ? -1.589  89.648 37.530 1.00 46.96 ? 104 PRO A CA  1 
ATOM   808  C C   . PRO A 1 104 ? -1.417  88.128 37.444 1.00 46.33 ? 104 PRO A C   1 
ATOM   809  O O   . PRO A 1 104 ? -0.312  87.586 37.640 1.00 44.11 ? 104 PRO A O   1 
ATOM   810  C CB  . PRO A 1 104 ? -1.427  90.319 36.175 1.00 47.61 ? 104 PRO A CB  1 
ATOM   811  C CG  . PRO A 1 104 ? 0.053   90.485 36.095 1.00 48.80 ? 104 PRO A CG  1 
ATOM   812  C CD  . PRO A 1 104 ? 0.377   91.042 37.479 1.00 48.82 ? 104 PRO A CD  1 
ATOM   813  N N   . ARG A 1 105 ? -2.529  87.458 37.150 1.00 46.11 ? 105 ARG A N   1 
ATOM   814  C CA  . ARG A 1 105 ? -2.544  86.013 37.021 1.00 46.68 ? 105 ARG A CA  1 
ATOM   815  C C   . ARG A 1 105 ? -1.470  85.598 36.032 1.00 47.30 ? 105 ARG A C   1 
ATOM   816  O O   . ARG A 1 105 ? -1.361  86.175 34.956 1.00 48.62 ? 105 ARG A O   1 
ATOM   817  C CB  . ARG A 1 105 ? -3.898  85.541 36.515 1.00 45.59 ? 105 ARG A CB  1 
ATOM   818  C CG  . ARG A 1 105 ? -3.972  84.039 36.357 1.00 45.57 ? 105 ARG A CG  1 
ATOM   819  C CD  . ARG A 1 105 ? -5.334  83.608 35.892 1.00 44.94 ? 105 ARG A CD  1 
ATOM   820  N NE  . ARG A 1 105 ? -6.386  84.237 36.677 1.00 44.85 ? 105 ARG A NE  1 
ATOM   821  C CZ  . ARG A 1 105 ? -7.665  84.234 36.322 1.00 45.77 ? 105 ARG A CZ  1 
ATOM   822  N NH1 . ARG A 1 105 ? -8.035  83.625 35.194 1.00 44.62 ? 105 ARG A NH1 1 
ATOM   823  N NH2 . ARG A 1 105 ? -8.568  84.853 37.079 1.00 45.23 ? 105 ARG A NH2 1 
ATOM   824  N N   . PRO A 1 106 ? -0.664  84.586 36.376 1.00 47.35 ? 106 PRO A N   1 
ATOM   825  C CA  . PRO A 1 106 ? 0.372   84.186 35.428 1.00 47.18 ? 106 PRO A CA  1 
ATOM   826  C C   . PRO A 1 106 ? -0.275  83.514 34.244 1.00 47.02 ? 106 PRO A C   1 
ATOM   827  O O   . PRO A 1 106 ? -1.473  83.217 34.248 1.00 46.74 ? 106 PRO A O   1 
ATOM   828  C CB  . PRO A 1 106 ? 1.230   83.189 36.214 1.00 47.71 ? 106 PRO A CB  1 
ATOM   829  C CG  . PRO A 1 106 ? 0.718   83.264 37.636 1.00 48.16 ? 106 PRO A CG  1 
ATOM   830  C CD  . PRO A 1 106 ? -0.719  83.650 37.505 1.00 47.61 ? 106 PRO A CD  1 
ATOM   831  N N   . LYS A 1 107 ? 0.555   83.271 33.243 1.00 46.88 ? 107 LYS A N   1 
ATOM   832  C CA  . LYS A 1 107 ? 0.181   82.609 32.005 1.00 46.28 ? 107 LYS A CA  1 
ATOM   833  C C   . LYS A 1 107 ? 0.018   81.117 32.336 1.00 45.44 ? 107 LYS A C   1 
ATOM   834  O O   . LYS A 1 107 ? -1.032  80.500 32.147 1.00 44.94 ? 107 LYS A O   1 
ATOM   835  C CB  . LYS A 1 107 ? 1.334   82.804 31.023 1.00 48.28 ? 107 LYS A CB  1 
ATOM   836  C CG  . LYS A 1 107 ? 2.698   82.123 31.454 1.00 47.64 ? 107 LYS A CG  1 
ATOM   837  C CD  . LYS A 1 107 ? 3.241   82.509 32.847 1.00 44.40 ? 107 LYS A CD  1 
ATOM   838  C CE  . LYS A 1 107 ? 3.989   83.835 32.840 1.00 43.85 ? 107 LYS A CE  1 
ATOM   839  N NZ  . LYS A 1 107 ? 3.120   85.043 32.740 1.00 43.33 ? 107 LYS A NZ  1 
ATOM   840  N N   . SER A 1 108 ? 1.102   80.559 32.841 1.00 43.83 ? 108 SER A N   1 
ATOM   841  C CA  . SER A 1 108 ? 1.171   79.181 33.243 1.00 43.24 ? 108 SER A CA  1 
ATOM   842  C C   . SER A 1 108 ? 2.540   79.163 33.894 1.00 42.31 ? 108 SER A C   1 
ATOM   843  O O   . SER A 1 108 ? 3.558   79.320 33.219 1.00 42.94 ? 108 SER A O   1 
ATOM   844  C CB  . SER A 1 108 ? 1.130   78.248 32.035 1.00 43.02 ? 108 SER A CB  1 
ATOM   845  O OG  . SER A 1 108 ? 2.431   78.003 31.545 1.00 43.11 ? 108 SER A OG  1 
ATOM   846  N N   . THR A 1 109 ? 2.549   79.025 35.217 1.00 40.85 ? 109 THR A N   1 
ATOM   847  C CA  . THR A 1 109 ? 3.789   79.006 35.981 1.00 37.66 ? 109 THR A CA  1 
ATOM   848  C C   . THR A 1 109 ? 3.857   77.824 36.953 1.00 36.01 ? 109 THR A C   1 
ATOM   849  O O   . THR A 1 109 ? 2.875   77.090 37.148 1.00 35.78 ? 109 THR A O   1 
ATOM   850  C CB  . THR A 1 109 ? 3.979   80.329 36.761 1.00 36.47 ? 109 THR A CB  1 
ATOM   851  O OG1 . THR A 1 109 ? 5.215   80.279 37.479 1.00 34.29 ? 109 THR A OG1 1 
ATOM   852  C CG2 . THR A 1 109 ? 2.828   80.558 37.729 1.00 34.53 ? 109 THR A CG2 1 
ATOM   853  N N   . THR A 1 110 ? 5.032   77.654 37.554 1.00 32.83 ? 110 THR A N   1 
ATOM   854  C CA  . THR A 1 110 ? 5.296   76.567 38.489 1.00 29.24 ? 110 THR A CA  1 
ATOM   855  C C   . THR A 1 110 ? 4.280   76.472 39.619 1.00 27.56 ? 110 THR A C   1 
ATOM   856  O O   . THR A 1 110 ? 3.972   77.461 40.276 1.00 27.36 ? 110 THR A O   1 
ATOM   857  C CB  . THR A 1 110 ? 6.691   76.713 39.100 1.00 27.82 ? 110 THR A CB  1 
ATOM   858  O OG1 . THR A 1 110 ? 7.644   76.931 38.056 1.00 26.18 ? 110 THR A OG1 1 
ATOM   859  C CG2 . THR A 1 110 ? 7.070   75.464 39.850 1.00 27.77 ? 110 THR A CG2 1 
ATOM   860  N N   . VAL A 1 111 ? 3.768   75.266 39.832 1.00 25.36 ? 111 VAL A N   1 
ATOM   861  C CA  . VAL A 1 111 ? 2.800   75.006 40.879 1.00 23.58 ? 111 VAL A CA  1 
ATOM   862  C C   . VAL A 1 111 ? 3.480   74.250 42.012 1.00 24.09 ? 111 VAL A C   1 
ATOM   863  O O   . VAL A 1 111 ? 4.266   73.342 41.753 1.00 24.96 ? 111 VAL A O   1 
ATOM   864  C CB  . VAL A 1 111 ? 1.653   74.131 40.362 1.00 22.91 ? 111 VAL A CB  1 
ATOM   865  C CG1 . VAL A 1 111 ? 0.710   73.794 41.492 1.00 22.25 ? 111 VAL A CG1 1 
ATOM   866  C CG2 . VAL A 1 111 ? 0.919   74.838 39.251 1.00 23.23 ? 111 VAL A CG2 1 
ATOM   867  N N   . MET A 1 112 ? 3.177   74.633 43.258 1.00 24.08 ? 112 MET A N   1 
ATOM   868  C CA  . MET A 1 112 ? 3.709   73.989 44.463 1.00 21.76 ? 112 MET A CA  1 
ATOM   869  C C   . MET A 1 112 ? 2.555   73.565 45.366 1.00 21.32 ? 112 MET A C   1 
ATOM   870  O O   . MET A 1 112 ? 1.743   74.406 45.778 1.00 20.92 ? 112 MET A O   1 
ATOM   871  C CB  . MET A 1 112 ? 4.638   74.940 45.204 1.00 20.15 ? 112 MET A CB  1 
ATOM   872  C CG  . MET A 1 112 ? 5.992   74.977 44.572 1.00 21.90 ? 112 MET A CG  1 
ATOM   873  S SD  . MET A 1 112 ? 7.160   76.075 45.363 1.00 26.67 ? 112 MET A SD  1 
ATOM   874  C CE  . MET A 1 112 ? 8.301   74.929 46.150 1.00 25.02 ? 112 MET A CE  1 
ATOM   875  N N   . VAL A 1 113 ? 2.471   72.264 45.657 1.00 20.21 ? 113 VAL A N   1 
ATOM   876  C CA  . VAL A 1 113 ? 1.393   71.746 46.506 1.00 20.45 ? 113 VAL A CA  1 
ATOM   877  C C   . VAL A 1 113 ? 1.914   71.397 47.903 1.00 20.76 ? 113 VAL A C   1 
ATOM   878  O O   . VAL A 1 113 ? 2.821   70.594 48.051 1.00 20.62 ? 113 VAL A O   1 
ATOM   879  C CB  . VAL A 1 113 ? 0.715   70.472 45.892 1.00 19.20 ? 113 VAL A CB  1 
ATOM   880  C CG1 . VAL A 1 113 ? -0.616  70.202 46.568 1.00 17.82 ? 113 VAL A CG1 1 
ATOM   881  C CG2 . VAL A 1 113 ? 0.484   70.656 44.428 1.00 19.20 ? 113 VAL A CG2 1 
ATOM   882  N N   . TRP A 1 114 ? 1.328   71.999 48.928 1.00 21.28 ? 114 TRP A N   1 
ATOM   883  C CA  . TRP A 1 114 ? 1.763   71.727 50.279 1.00 22.59 ? 114 TRP A CA  1 
ATOM   884  C C   . TRP A 1 114 ? 0.923   70.668 50.963 1.00 23.96 ? 114 TRP A C   1 
ATOM   885  O O   . TRP A 1 114 ? -0.306  70.799 51.050 1.00 24.88 ? 114 TRP A O   1 
ATOM   886  C CB  . TRP A 1 114 ? 1.697   73.004 51.111 1.00 25.36 ? 114 TRP A CB  1 
ATOM   887  C CG  . TRP A 1 114 ? 1.970   72.782 52.600 1.00 26.84 ? 114 TRP A CG  1 
ATOM   888  C CD1 . TRP A 1 114 ? 1.068   72.863 53.635 1.00 26.69 ? 114 TRP A CD1 1 
ATOM   889  C CD2 . TRP A 1 114 ? 3.223   72.428 53.194 1.00 26.12 ? 114 TRP A CD2 1 
ATOM   890  N NE1 . TRP A 1 114 ? 1.689   72.579 54.827 1.00 25.96 ? 114 TRP A NE1 1 
ATOM   891  C CE2 . TRP A 1 114 ? 3.010   72.311 54.583 1.00 25.94 ? 114 TRP A CE2 1 
ATOM   892  C CE3 . TRP A 1 114 ? 4.505   72.198 52.684 1.00 25.46 ? 114 TRP A CE3 1 
ATOM   893  C CZ2 . TRP A 1 114 ? 4.030   71.977 55.463 1.00 26.37 ? 114 TRP A CZ2 1 
ATOM   894  C CZ3 . TRP A 1 114 ? 5.516   71.866 53.556 1.00 24.92 ? 114 TRP A CZ3 1 
ATOM   895  C CH2 . TRP A 1 114 ? 5.276   71.758 54.932 1.00 26.31 ? 114 TRP A CH2 1 
ATOM   896  N N   . ILE A 1 115 ? 1.576   69.619 51.454 1.00 24.11 ? 115 ILE A N   1 
ATOM   897  C CA  . ILE A 1 115 ? 0.872   68.569 52.188 1.00 24.18 ? 115 ILE A CA  1 
ATOM   898  C C   . ILE A 1 115 ? 1.371   68.630 53.643 1.00 25.66 ? 115 ILE A C   1 
ATOM   899  O O   . ILE A 1 115 ? 2.502   68.215 53.949 1.00 25.90 ? 115 ILE A O   1 
ATOM   900  C CB  . ILE A 1 115 ? 1.167   67.160 51.627 1.00 23.63 ? 115 ILE A CB  1 
ATOM   901  C CG1 . ILE A 1 115 ? 1.121   67.169 50.102 1.00 21.80 ? 115 ILE A CG1 1 
ATOM   902  C CG2 . ILE A 1 115 ? 0.136   66.161 52.159 1.00 22.36 ? 115 ILE A CG2 1 
ATOM   903  C CD1 . ILE A 1 115 ? 1.163   65.789 49.513 1.00 20.47 ? 115 ILE A CD1 1 
ATOM   904  N N   . TYR A 1 116 ? 0.532   69.170 54.526 1.00 25.21 ? 116 TYR A N   1 
ATOM   905  C CA  . TYR A 1 116 ? 0.869   69.303 55.936 1.00 24.60 ? 116 TYR A CA  1 
ATOM   906  C C   . TYR A 1 116 ? 0.958   67.932 56.586 1.00 24.55 ? 116 TYR A C   1 
ATOM   907  O O   . TYR A 1 116 ? 0.564   66.932 55.998 1.00 24.73 ? 116 TYR A O   1 
ATOM   908  C CB  . TYR A 1 116 ? -0.203  70.137 56.650 1.00 25.91 ? 116 TYR A CB  1 
ATOM   909  C CG  . TYR A 1 116 ? -1.559  69.476 56.714 1.00 25.68 ? 116 TYR A CG  1 
ATOM   910  C CD1 . TYR A 1 116 ? -1.728  68.255 57.363 1.00 26.42 ? 116 TYR A CD1 1 
ATOM   911  C CD2 . TYR A 1 116 ? -2.665  70.050 56.100 1.00 25.83 ? 116 TYR A CD2 1 
ATOM   912  C CE1 . TYR A 1 116 ? -2.966  67.609 57.396 1.00 27.02 ? 116 TYR A CE1 1 
ATOM   913  C CE2 . TYR A 1 116 ? -3.919  69.412 56.130 1.00 27.39 ? 116 TYR A CE2 1 
ATOM   914  C CZ  . TYR A 1 116 ? -4.059  68.183 56.782 1.00 26.61 ? 116 TYR A CZ  1 
ATOM   915  O OH  . TYR A 1 116 ? -5.274  67.526 56.814 1.00 24.02 ? 116 TYR A OH  1 
ATOM   916  N N   . GLY A 1 117 ? 1.445   67.880 57.816 1.00 24.48 ? 117 GLY A N   1 
ATOM   917  C CA  . GLY A 1 117 ? 1.540   66.596 58.483 1.00 24.29 ? 117 GLY A CA  1 
ATOM   918  C C   . GLY A 1 117 ? 1.764   66.674 59.979 1.00 23.69 ? 117 GLY A C   1 
ATOM   919  O O   . GLY A 1 117 ? 2.381   67.607 60.474 1.00 25.13 ? 117 GLY A O   1 
ATOM   920  N N   . GLY A 1 118 ? 1.270   65.689 60.708 1.00 22.02 ? 118 GLY A N   1 
ATOM   921  C CA  . GLY A 1 118 ? 1.468   65.697 62.132 1.00 21.20 ? 118 GLY A CA  1 
ATOM   922  C C   . GLY A 1 118 ? 1.200   64.317 62.652 1.00 22.33 ? 118 GLY A C   1 
ATOM   923  O O   . GLY A 1 118 ? 0.139   64.076 63.215 1.00 23.50 ? 118 GLY A O   1 
ATOM   924  N N   . GLY A 1 119 ? 2.141   63.400 62.459 1.00 22.92 ? 119 GLY A N   1 
ATOM   925  C CA  . GLY A 1 119 ? 1.945   62.039 62.947 1.00 24.30 ? 119 GLY A CA  1 
ATOM   926  C C   . GLY A 1 119 ? 0.746   61.268 62.395 1.00 24.93 ? 119 GLY A C   1 
ATOM   927  O O   . GLY A 1 119 ? 0.407   60.191 62.894 1.00 24.60 ? 119 GLY A O   1 
ATOM   928  N N   . PHE A 1 120 ? 0.121   61.814 61.352 1.00 25.64 ? 120 PHE A N   1 
ATOM   929  C CA  . PHE A 1 120 ? -1.045  61.214 60.702 1.00 25.15 ? 120 PHE A CA  1 
ATOM   930  C C   . PHE A 1 120 ? -2.312  61.263 61.558 1.00 25.23 ? 120 PHE A C   1 
ATOM   931  O O   . PHE A 1 120 ? -3.324  60.667 61.201 1.00 26.16 ? 120 PHE A O   1 
ATOM   932  C CB  . PHE A 1 120 ? -0.750  59.765 60.302 1.00 24.68 ? 120 PHE A CB  1 
ATOM   933  C CG  . PHE A 1 120 ? 0.150   59.629 59.087 1.00 25.62 ? 120 PHE A CG  1 
ATOM   934  C CD1 . PHE A 1 120 ? -0.216  60.179 57.864 1.00 23.58 ? 120 PHE A CD1 1 
ATOM   935  C CD2 . PHE A 1 120 ? 1.345   58.894 59.156 1.00 26.24 ? 120 PHE A CD2 1 
ATOM   936  C CE1 . PHE A 1 120 ? 0.586   59.995 56.736 1.00 22.93 ? 120 PHE A CE1 1 
ATOM   937  C CE2 . PHE A 1 120 ? 2.154   58.706 58.023 1.00 23.90 ? 120 PHE A CE2 1 
ATOM   938  C CZ  . PHE A 1 120 ? 1.771   59.256 56.817 1.00 23.06 ? 120 PHE A CZ  1 
ATOM   939  N N   . TYR A 1 121 ? -2.259  61.989 62.671 1.00 24.35 ? 121 TYR A N   1 
ATOM   940  C CA  . TYR A 1 121 ? -3.401  62.097 63.572 1.00 24.76 ? 121 TYR A CA  1 
ATOM   941  C C   . TYR A 1 121 ? -3.891  63.561 63.708 1.00 25.64 ? 121 TYR A C   1 
ATOM   942  O O   . TYR A 1 121 ? -4.983  63.838 64.240 1.00 25.15 ? 121 TYR A O   1 
ATOM   943  C CB  . TYR A 1 121 ? -3.006  61.537 64.941 1.00 24.43 ? 121 TYR A CB  1 
ATOM   944  C CG  . TYR A 1 121 ? -2.128  62.463 65.775 1.00 24.58 ? 121 TYR A CG  1 
ATOM   945  C CD1 . TYR A 1 121 ? -2.646  63.653 66.297 1.00 24.15 ? 121 TYR A CD1 1 
ATOM   946  C CD2 . TYR A 1 121 ? -0.804  62.137 66.076 1.00 22.76 ? 121 TYR A CD2 1 
ATOM   947  C CE1 . TYR A 1 121 ? -1.888  64.485 67.095 1.00 22.86 ? 121 TYR A CE1 1 
ATOM   948  C CE2 . TYR A 1 121 ? -0.038  62.969 66.877 1.00 22.47 ? 121 TYR A CE2 1 
ATOM   949  C CZ  . TYR A 1 121 ? -0.596  64.140 67.390 1.00 22.93 ? 121 TYR A CZ  1 
ATOM   950  O OH  . TYR A 1 121 ? 0.089   64.946 68.273 1.00 24.63 ? 121 TYR A OH  1 
ATOM   951  N N   . SER A 1 122 ? -3.070  64.493 63.228 1.00 24.86 ? 122 SER A N   1 
ATOM   952  C CA  . SER A 1 122 ? -3.397  65.909 63.285 1.00 23.30 ? 122 SER A CA  1 
ATOM   953  C C   . SER A 1 122 ? -2.862  66.566 62.038 1.00 23.14 ? 122 SER A C   1 
ATOM   954  O O   . SER A 1 122 ? -2.058  65.985 61.324 1.00 21.93 ? 122 SER A O   1 
ATOM   955  C CB  . SER A 1 122 ? -2.758  66.551 64.506 1.00 23.79 ? 122 SER A CB  1 
ATOM   956  O OG  . SER A 1 122 ? -1.341  66.424 64.469 1.00 25.56 ? 122 SER A OG  1 
ATOM   957  N N   . GLY A 1 123 ? -3.316  67.785 61.792 1.00 24.77 ? 123 GLY A N   1 
ATOM   958  C CA  . GLY A 1 123 ? -2.894  68.536 60.622 1.00 28.91 ? 123 GLY A CA  1 
ATOM   959  C C   . GLY A 1 123 ? -3.855  69.689 60.341 1.00 31.14 ? 123 GLY A C   1 
ATOM   960  O O   . GLY A 1 123 ? -4.828  69.883 61.078 1.00 33.57 ? 123 GLY A O   1 
ATOM   961  N N   . SER A 1 124 ? -3.609  70.460 59.287 1.00 30.60 ? 124 SER A N   1 
ATOM   962  C CA  . SER A 1 124 ? -4.491  71.574 58.996 1.00 30.97 ? 124 SER A CA  1 
ATOM   963  C C   . SER A 1 124 ? -3.847  72.486 57.979 1.00 31.14 ? 124 SER A C   1 
ATOM   964  O O   . SER A 1 124 ? -2.707  72.906 58.146 1.00 30.40 ? 124 SER A O   1 
ATOM   965  C CB  . SER A 1 124 ? -4.780  72.349 60.278 1.00 32.23 ? 124 SER A CB  1 
ATOM   966  O OG  . SER A 1 124 ? -5.858  73.238 60.095 1.00 34.63 ? 124 SER A OG  1 
ATOM   967  N N   . SER A 1 125 ? -4.588  72.795 56.923 1.00 32.31 ? 125 SER A N   1 
ATOM   968  C CA  . SER A 1 125 ? -4.083  73.652 55.845 1.00 32.93 ? 125 SER A CA  1 
ATOM   969  C C   . SER A 1 125 ? -4.226  75.153 56.118 1.00 32.10 ? 125 SER A C   1 
ATOM   970  O O   . SER A 1 125 ? -3.643  75.992 55.408 1.00 31.80 ? 125 SER A O   1 
ATOM   971  C CB  . SER A 1 125 ? -4.822  73.317 54.545 1.00 33.36 ? 125 SER A CB  1 
ATOM   972  O OG  . SER A 1 125 ? -6.216  73.540 54.673 1.00 33.16 ? 125 SER A OG  1 
ATOM   973  N N   . THR A 1 126 ? -4.991  75.459 57.164 1.00 30.13 ? 126 THR A N   1 
ATOM   974  C CA  . THR A 1 126 ? -5.316  76.814 57.545 1.00 27.13 ? 126 THR A CA  1 
ATOM   975  C C   . THR A 1 126 ? -4.391  77.478 58.548 1.00 26.35 ? 126 THR A C   1 
ATOM   976  O O   . THR A 1 126 ? -4.503  78.667 58.804 1.00 26.03 ? 126 THR A O   1 
ATOM   977  C CB  . THR A 1 126 ? -6.788  76.867 58.070 1.00 27.21 ? 126 THR A CB  1 
ATOM   978  O OG1 . THR A 1 126 ? -6.896  76.180 59.324 1.00 26.35 ? 126 THR A OG1 1 
ATOM   979  C CG2 . THR A 1 126 ? -7.735  76.199 57.075 1.00 24.52 ? 126 THR A CG2 1 
ATOM   980  N N   . LEU A 1 127 ? -3.467  76.734 59.122 1.00 26.62 ? 127 LEU A N   1 
ATOM   981  C CA  . LEU A 1 127 ? -2.572  77.349 60.092 1.00 28.18 ? 127 LEU A CA  1 
ATOM   982  C C   . LEU A 1 127 ? -1.847  78.549 59.495 1.00 29.46 ? 127 LEU A C   1 
ATOM   983  O O   . LEU A 1 127 ? -1.461  78.540 58.329 1.00 30.03 ? 127 LEU A O   1 
ATOM   984  C CB  . LEU A 1 127 ? -1.543  76.338 60.584 1.00 27.97 ? 127 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 127 ? -2.099  75.038 61.147 1.00 26.71 ? 127 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 127 ? -0.958  74.289 61.778 1.00 27.19 ? 127 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 127 ? -3.201  75.310 62.160 1.00 25.40 ? 127 LEU A CD2 1 
ATOM   988  N N   . ASP A 1 128 ? -1.634  79.576 60.302 1.00 31.24 ? 128 ASP A N   1 
ATOM   989  C CA  . ASP A 1 128 ? -0.965  80.771 59.814 1.00 33.34 ? 128 ASP A CA  1 
ATOM   990  C C   . ASP A 1 128 ? 0.470   80.529 59.374 1.00 33.79 ? 128 ASP A C   1 
ATOM   991  O O   . ASP A 1 128 ? 1.024   81.331 58.634 1.00 34.60 ? 128 ASP A O   1 
ATOM   992  C CB  . ASP A 1 128 ? -0.998  81.860 60.884 1.00 35.64 ? 128 ASP A CB  1 
ATOM   993  C CG  . ASP A 1 128 ? -2.394  82.076 61.438 1.00 40.01 ? 128 ASP A CG  1 
ATOM   994  O OD1 . ASP A 1 128 ? -3.321  82.314 60.628 1.00 43.34 ? 128 ASP A OD1 1 
ATOM   995  O OD2 . ASP A 1 128 ? -2.576  82.002 62.676 1.00 41.51 ? 128 ASP A OD2 1 
ATOM   996  N N   . VAL A 1 129 ? 1.079   79.438 59.825 1.00 34.10 ? 129 VAL A N   1 
ATOM   997  C CA  . VAL A 1 129 ? 2.460   79.159 59.448 1.00 33.86 ? 129 VAL A CA  1 
ATOM   998  C C   . VAL A 1 129 ? 2.503   78.623 58.037 1.00 35.67 ? 129 VAL A C   1 
ATOM   999  O O   . VAL A 1 129 ? 3.590   78.541 57.445 1.00 37.55 ? 129 VAL A O   1 
ATOM   1000 C CB  . VAL A 1 129 ? 3.110   78.093 60.324 1.00 32.90 ? 129 VAL A CB  1 
ATOM   1001 C CG1 . VAL A 1 129 ? 4.531   78.502 60.643 1.00 31.66 ? 129 VAL A CG1 1 
ATOM   1002 C CG2 . VAL A 1 129 ? 2.276   77.850 61.557 1.00 32.61 ? 129 VAL A CG2 1 
ATOM   1003 N N   . TYR A 1 130 ? 1.333   78.233 57.511 1.00 34.77 ? 130 TYR A N   1 
ATOM   1004 C CA  . TYR A 1 130 ? 1.231   77.694 56.151 1.00 34.33 ? 130 TYR A CA  1 
ATOM   1005 C C   . TYR A 1 130 ? 0.497   78.661 55.229 1.00 35.29 ? 130 TYR A C   1 
ATOM   1006 O O   . TYR A 1 130 ? -0.327  78.241 54.406 1.00 35.68 ? 130 TYR A O   1 
ATOM   1007 C CB  . TYR A 1 130 ? 0.459   76.374 56.129 1.00 33.01 ? 130 TYR A CB  1 
ATOM   1008 C CG  . TYR A 1 130 ? 0.923   75.280 57.069 1.00 32.14 ? 130 TYR A CG  1 
ATOM   1009 C CD1 . TYR A 1 130 ? 2.269   75.100 57.385 1.00 30.01 ? 130 TYR A CD1 1 
ATOM   1010 C CD2 . TYR A 1 130 ? 0.001   74.371 57.586 1.00 32.71 ? 130 TYR A CD2 1 
ATOM   1011 C CE1 . TYR A 1 130 ? 2.676   74.034 58.190 1.00 29.68 ? 130 TYR A CE1 1 
ATOM   1012 C CE2 . TYR A 1 130 ? 0.397   73.306 58.387 1.00 31.29 ? 130 TYR A CE2 1 
ATOM   1013 C CZ  . TYR A 1 130 ? 1.731   73.134 58.688 1.00 29.87 ? 130 TYR A CZ  1 
ATOM   1014 O OH  . TYR A 1 130 ? 2.091   72.046 59.469 1.00 26.68 ? 130 TYR A OH  1 
ATOM   1015 N N   . ASN A 1 131 ? 0.781   79.952 55.370 1.00 36.01 ? 131 ASN A N   1 
ATOM   1016 C CA  . ASN A 1 131 ? 0.120   80.952 54.555 1.00 36.28 ? 131 ASN A CA  1 
ATOM   1017 C C   . ASN A 1 131 ? 0.890   81.191 53.283 1.00 36.51 ? 131 ASN A C   1 
ATOM   1018 O O   . ASN A 1 131 ? 1.985   81.754 53.303 1.00 37.12 ? 131 ASN A O   1 
ATOM   1019 C CB  . ASN A 1 131 ? -0.029  82.265 55.298 1.00 37.16 ? 131 ASN A CB  1 
ATOM   1020 C CG  . ASN A 1 131 ? -1.150  83.101 54.735 1.00 39.34 ? 131 ASN A CG  1 
ATOM   1021 O OD1 . ASN A 1 131 ? -1.167  83.432 53.543 1.00 39.21 ? 131 ASN A OD1 1 
ATOM   1022 N ND2 . ASN A 1 131 ? -2.114  83.432 55.584 1.00 42.01 ? 131 ASN A ND2 1 
ATOM   1023 N N   . GLY A 1 132 ? 0.275   80.783 52.176 1.00 36.15 ? 132 GLY A N   1 
ATOM   1024 C CA  . GLY A 1 132 ? 0.884   80.884 50.868 1.00 34.09 ? 132 GLY A CA  1 
ATOM   1025 C C   . GLY A 1 132 ? 1.301   82.228 50.348 1.00 32.98 ? 132 GLY A C   1 
ATOM   1026 O O   . GLY A 1 132 ? 2.312   82.303 49.676 1.00 33.72 ? 132 GLY A O   1 
ATOM   1027 N N   . LYS A 1 133 ? 0.574   83.289 50.671 1.00 32.42 ? 133 LYS A N   1 
ATOM   1028 C CA  . LYS A 1 133 ? 0.914   84.588 50.106 1.00 33.34 ? 133 LYS A CA  1 
ATOM   1029 C C   . LYS A 1 133 ? 2.370   85.020 50.054 1.00 33.38 ? 133 LYS A C   1 
ATOM   1030 O O   . LYS A 1 133 ? 2.815   85.532 49.033 1.00 34.23 ? 133 LYS A O   1 
ATOM   1031 C CB  . LYS A 1 133 ? 0.061   85.707 50.719 1.00 33.33 ? 133 LYS A CB  1 
ATOM   1032 C CG  . LYS A 1 133 ? 0.342   86.138 52.140 1.00 34.58 ? 133 LYS A CG  1 
ATOM   1033 C CD  . LYS A 1 133 ? -0.992  86.604 52.742 1.00 37.04 ? 133 LYS A CD  1 
ATOM   1034 C CE  . LYS A 1 133 ? -0.875  87.336 54.065 1.00 38.55 ? 133 LYS A CE  1 
ATOM   1035 N NZ  . LYS A 1 133 ? -0.436  88.746 53.868 1.00 41.27 ? 133 LYS A NZ  1 
ATOM   1036 N N   . TYR A 1 134 ? 3.141   84.807 51.102 1.00 33.15 ? 134 TYR A N   1 
ATOM   1037 C CA  . TYR A 1 134 ? 4.527   85.257 51.035 1.00 34.09 ? 134 TYR A CA  1 
ATOM   1038 C C   . TYR A 1 134 ? 5.338   84.501 49.968 1.00 33.76 ? 134 TYR A C   1 
ATOM   1039 O O   . TYR A 1 134 ? 6.111   85.091 49.206 1.00 32.96 ? 134 TYR A O   1 
ATOM   1040 C CB  . TYR A 1 134 ? 5.167   85.140 52.425 1.00 35.42 ? 134 TYR A CB  1 
ATOM   1041 C CG  . TYR A 1 134 ? 4.371   85.874 53.485 1.00 36.15 ? 134 TYR A CG  1 
ATOM   1042 C CD1 . TYR A 1 134 ? 4.443   87.254 53.597 1.00 37.07 ? 134 TYR A CD1 1 
ATOM   1043 C CD2 . TYR A 1 134 ? 3.505   85.187 54.345 1.00 37.14 ? 134 TYR A CD2 1 
ATOM   1044 C CE1 . TYR A 1 134 ? 3.674   87.944 54.538 1.00 39.36 ? 134 TYR A CE1 1 
ATOM   1045 C CE2 . TYR A 1 134 ? 2.727   85.859 55.290 1.00 37.98 ? 134 TYR A CE2 1 
ATOM   1046 C CZ  . TYR A 1 134 ? 2.819   87.244 55.384 1.00 39.83 ? 134 TYR A CZ  1 
ATOM   1047 O OH  . TYR A 1 134 ? 2.073   87.943 56.321 1.00 39.99 ? 134 TYR A OH  1 
ATOM   1048 N N   . LEU A 1 135 ? 5.143   83.195 49.901 1.00 33.66 ? 135 LEU A N   1 
ATOM   1049 C CA  . LEU A 1 135 ? 5.864   82.389 48.933 1.00 33.96 ? 135 LEU A CA  1 
ATOM   1050 C C   . LEU A 1 135 ? 5.322   82.654 47.531 1.00 34.86 ? 135 LEU A C   1 
ATOM   1051 O O   . LEU A 1 135 ? 6.082   82.885 46.596 1.00 35.60 ? 135 LEU A O   1 
ATOM   1052 C CB  . LEU A 1 135 ? 5.732   80.905 49.289 1.00 32.01 ? 135 LEU A CB  1 
ATOM   1053 C CG  . LEU A 1 135 ? 6.700   79.953 48.592 1.00 29.39 ? 135 LEU A CG  1 
ATOM   1054 C CD1 . LEU A 1 135 ? 8.133   80.436 48.757 1.00 29.29 ? 135 LEU A CD1 1 
ATOM   1055 C CD2 . LEU A 1 135 ? 6.546   78.589 49.183 1.00 27.75 ? 135 LEU A CD2 1 
ATOM   1056 N N   . ALA A 1 136 ? 4.001   82.617 47.394 1.00 35.72 ? 136 ALA A N   1 
ATOM   1057 C CA  . ALA A 1 136 ? 3.354   82.867 46.112 1.00 36.26 ? 136 ALA A CA  1 
ATOM   1058 C C   . ALA A 1 136 ? 3.856   84.201 45.552 1.00 36.97 ? 136 ALA A C   1 
ATOM   1059 O O   . ALA A 1 136 ? 4.338   84.288 44.419 1.00 37.44 ? 136 ALA A O   1 
ATOM   1060 C CB  . ALA A 1 136 ? 1.823   82.904 46.290 1.00 34.27 ? 136 ALA A CB  1 
ATOM   1061 N N   . TYR A 1 137 ? 3.764   85.241 46.365 1.00 37.50 ? 137 TYR A N   1 
ATOM   1062 C CA  . TYR A 1 137 ? 4.194   86.565 45.944 1.00 37.89 ? 137 TYR A CA  1 
ATOM   1063 C C   . TYR A 1 137 ? 5.706   86.744 45.773 1.00 36.91 ? 137 TYR A C   1 
ATOM   1064 O O   . TYR A 1 137 ? 6.176   87.182 44.729 1.00 36.83 ? 137 TYR A O   1 
ATOM   1065 C CB  . TYR A 1 137 ? 3.647   87.596 46.925 1.00 39.24 ? 137 TYR A CB  1 
ATOM   1066 C CG  . TYR A 1 137 ? 4.213   88.966 46.747 1.00 41.14 ? 137 TYR A CG  1 
ATOM   1067 C CD1 . TYR A 1 137 ? 3.654   89.846 45.837 1.00 43.28 ? 137 TYR A CD1 1 
ATOM   1068 C CD2 . TYR A 1 137 ? 5.292   89.397 47.504 1.00 43.23 ? 137 TYR A CD2 1 
ATOM   1069 C CE1 . TYR A 1 137 ? 4.150   91.143 45.677 1.00 45.50 ? 137 TYR A CE1 1 
ATOM   1070 C CE2 . TYR A 1 137 ? 5.799   90.694 47.358 1.00 46.01 ? 137 TYR A CE2 1 
ATOM   1071 C CZ  . TYR A 1 137 ? 5.216   91.565 46.442 1.00 45.78 ? 137 TYR A CZ  1 
ATOM   1072 O OH  . TYR A 1 137 ? 5.655   92.865 46.323 1.00 46.75 ? 137 TYR A OH  1 
ATOM   1073 N N   . THR A 1 138 ? 6.478   86.405 46.789 1.00 35.71 ? 138 THR A N   1 
ATOM   1074 C CA  . THR A 1 138 ? 7.900   86.589 46.665 1.00 34.39 ? 138 THR A CA  1 
ATOM   1075 C C   . THR A 1 138 ? 8.516   85.822 45.527 1.00 34.27 ? 138 THR A C   1 
ATOM   1076 O O   . THR A 1 138 ? 9.471   86.287 44.925 1.00 34.61 ? 138 THR A O   1 
ATOM   1077 C CB  . THR A 1 138 ? 8.611   86.236 47.964 1.00 33.95 ? 138 THR A CB  1 
ATOM   1078 O OG1 . THR A 1 138 ? 8.568   87.379 48.821 1.00 34.89 ? 138 THR A OG1 1 
ATOM   1079 C CG2 . THR A 1 138 ? 10.067  85.846 47.712 1.00 33.34 ? 138 THR A CG2 1 
ATOM   1080 N N   . GLU A 1 139 ? 7.968   84.663 45.200 1.00 34.59 ? 139 GLU A N   1 
ATOM   1081 C CA  . GLU A 1 139 ? 8.561   83.870 44.137 1.00 35.76 ? 139 GLU A CA  1 
ATOM   1082 C C   . GLU A 1 139 ? 7.776   83.723 42.848 1.00 37.56 ? 139 GLU A C   1 
ATOM   1083 O O   . GLU A 1 139 ? 8.224   83.005 41.961 1.00 38.33 ? 139 GLU A O   1 
ATOM   1084 C CB  . GLU A 1 139 ? 8.904   82.474 44.657 1.00 34.23 ? 139 GLU A CB  1 
ATOM   1085 C CG  . GLU A 1 139 ? 10.103  82.406 45.591 1.00 34.63 ? 139 GLU A CG  1 
ATOM   1086 C CD  . GLU A 1 139 ? 11.418  82.644 44.871 1.00 35.48 ? 139 GLU A CD  1 
ATOM   1087 O OE1 . GLU A 1 139 ? 11.457  82.418 43.647 1.00 37.03 ? 139 GLU A OE1 1 
ATOM   1088 O OE2 . GLU A 1 139 ? 12.414  83.039 45.519 1.00 34.71 ? 139 GLU A OE2 1 
ATOM   1089 N N   . GLU A 1 140 ? 6.634   84.399 42.718 1.00 40.02 ? 140 GLU A N   1 
ATOM   1090 C CA  . GLU A 1 140 ? 5.810   84.269 41.502 1.00 42.27 ? 140 GLU A CA  1 
ATOM   1091 C C   . GLU A 1 140 ? 5.557   82.782 41.335 1.00 41.51 ? 140 GLU A C   1 
ATOM   1092 O O   . GLU A 1 140 ? 6.190   82.115 40.519 1.00 42.20 ? 140 GLU A O   1 
ATOM   1093 C CB  . GLU A 1 140 ? 6.549   84.771 40.255 1.00 45.35 ? 140 GLU A CB  1 
ATOM   1094 C CG  . GLU A 1 140 ? 6.044   86.086 39.688 1.00 48.86 ? 140 GLU A CG  1 
ATOM   1095 C CD  . GLU A 1 140 ? 7.050   87.200 39.891 1.00 51.72 ? 140 GLU A CD  1 
ATOM   1096 O OE1 . GLU A 1 140 ? 8.234   87.014 39.502 1.00 51.42 ? 140 GLU A OE1 1 
ATOM   1097 O OE2 . GLU A 1 140 ? 6.649   88.254 40.446 1.00 53.65 ? 140 GLU A OE2 1 
ATOM   1098 N N   . VAL A 1 141 ? 4.617   82.264 42.098 1.00 40.08 ? 141 VAL A N   1 
ATOM   1099 C CA  . VAL A 1 141 ? 4.353   80.847 42.060 1.00 38.15 ? 141 VAL A CA  1 
ATOM   1100 C C   . VAL A 1 141 ? 2.932   80.573 42.514 1.00 38.36 ? 141 VAL A C   1 
ATOM   1101 O O   . VAL A 1 141 ? 2.398   81.260 43.386 1.00 38.84 ? 141 VAL A O   1 
ATOM   1102 C CB  . VAL A 1 141 ? 5.348   80.130 43.001 1.00 36.69 ? 141 VAL A CB  1 
ATOM   1103 C CG1 . VAL A 1 141 ? 4.728   78.896 43.585 1.00 37.49 ? 141 VAL A CG1 1 
ATOM   1104 C CG2 . VAL A 1 141 ? 6.606   79.785 42.258 1.00 34.43 ? 141 VAL A CG2 1 
ATOM   1105 N N   . VAL A 1 142 ? 2.305   79.580 41.909 1.00 37.79 ? 142 VAL A N   1 
ATOM   1106 C CA  . VAL A 1 142 ? 0.966   79.217 42.324 1.00 37.62 ? 142 VAL A CA  1 
ATOM   1107 C C   . VAL A 1 142 ? 1.119   78.187 43.470 1.00 38.11 ? 142 VAL A C   1 
ATOM   1108 O O   . VAL A 1 142 ? 1.570   77.058 43.268 1.00 39.45 ? 142 VAL A O   1 
ATOM   1109 C CB  . VAL A 1 142 ? 0.178   78.662 41.133 1.00 36.05 ? 142 VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 142 ? -1.200  78.212 41.560 1.00 35.78 ? 142 VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 142 ? 0.064   79.742 40.095 1.00 35.80 ? 142 VAL A CG2 1 
ATOM   1112 N N   . LEU A 1 143 ? 0.771   78.610 44.682 1.00 36.90 ? 143 LEU A N   1 
ATOM   1113 C CA  . LEU A 1 143 ? 0.873   77.775 45.873 1.00 34.41 ? 143 LEU A CA  1 
ATOM   1114 C C   . LEU A 1 143 ? -0.508  77.213 46.206 1.00 33.44 ? 143 LEU A C   1 
ATOM   1115 O O   . LEU A 1 143 ? -1.505  77.947 46.240 1.00 33.74 ? 143 LEU A O   1 
ATOM   1116 C CB  . LEU A 1 143 ? 1.356   78.632 47.050 1.00 34.56 ? 143 LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 143 ? 2.020   78.051 48.292 1.00 33.23 ? 143 LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 143 ? 1.421   76.711 48.650 1.00 34.81 ? 143 LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 143 ? 3.476   77.890 48.007 1.00 34.14 ? 143 LEU A CD2 1 
ATOM   1120 N N   . VAL A 1 144 ? -0.569  75.912 46.448 1.00 30.66 ? 144 VAL A N   1 
ATOM   1121 C CA  . VAL A 1 144 ? -1.829  75.299 46.807 1.00 27.85 ? 144 VAL A CA  1 
ATOM   1122 C C   . VAL A 1 144 ? -1.546  74.344 47.964 1.00 27.00 ? 144 VAL A C   1 
ATOM   1123 O O   . VAL A 1 144 ? -0.565  73.598 47.949 1.00 26.09 ? 144 VAL A O   1 
ATOM   1124 C CB  . VAL A 1 144 ? -2.465  74.553 45.581 1.00 26.92 ? 144 VAL A CB  1 
ATOM   1125 C CG1 . VAL A 1 144 ? -1.535  73.479 45.083 1.00 27.27 ? 144 VAL A CG1 1 
ATOM   1126 C CG2 . VAL A 1 144 ? -3.802  73.950 45.954 1.00 24.40 ? 144 VAL A CG2 1 
ATOM   1127 N N   . SER A 1 145 ? -2.362  74.430 49.007 1.00 25.77 ? 145 SER A N   1 
ATOM   1128 C CA  . SER A 1 145 ? -2.215  73.524 50.137 1.00 24.81 ? 145 SER A CA  1 
ATOM   1129 C C   . SER A 1 145 ? -3.527  72.741 50.146 1.00 24.69 ? 145 SER A C   1 
ATOM   1130 O O   . SER A 1 145 ? -4.595  73.299 49.866 1.00 23.87 ? 145 SER A O   1 
ATOM   1131 C CB  . SER A 1 145 ? -1.985  74.277 51.457 1.00 23.60 ? 145 SER A CB  1 
ATOM   1132 O OG  . SER A 1 145 ? -3.043  75.150 51.791 1.00 23.02 ? 145 SER A OG  1 
ATOM   1133 N N   . LEU A 1 146 ? -3.437  71.443 50.427 1.00 23.43 ? 146 LEU A N   1 
ATOM   1134 C CA  . LEU A 1 146 ? -4.605  70.583 50.412 1.00 21.74 ? 146 LEU A CA  1 
ATOM   1135 C C   . LEU A 1 146 ? -4.959  70.098 51.797 1.00 22.34 ? 146 LEU A C   1 
ATOM   1136 O O   . LEU A 1 146 ? -4.244  70.387 52.746 1.00 22.29 ? 146 LEU A O   1 
ATOM   1137 C CB  . LEU A 1 146 ? -4.340  69.410 49.473 1.00 19.29 ? 146 LEU A CB  1 
ATOM   1138 C CG  . LEU A 1 146 ? -2.999  68.701 49.652 1.00 16.86 ? 146 LEU A CG  1 
ATOM   1139 C CD1 . LEU A 1 146 ? -3.101  67.795 50.863 1.00 17.14 ? 146 LEU A CD1 1 
ATOM   1140 C CD2 . LEU A 1 146 ? -2.643  67.888 48.414 1.00 14.08 ? 146 LEU A CD2 1 
ATOM   1141 N N   . SER A 1 147 ? -6.074  69.379 51.907 1.00 23.18 ? 147 SER A N   1 
ATOM   1142 C CA  . SER A 1 147 ? -6.541  68.845 53.185 1.00 24.52 ? 147 SER A CA  1 
ATOM   1143 C C   . SER A 1 147 ? -6.734  67.376 53.040 1.00 23.50 ? 147 SER A C   1 
ATOM   1144 O O   . SER A 1 147 ? -6.969  66.904 51.945 1.00 23.58 ? 147 SER A O   1 
ATOM   1145 C CB  . SER A 1 147 ? -7.890  69.441 53.578 1.00 26.63 ? 147 SER A CB  1 
ATOM   1146 O OG  . SER A 1 147 ? -7.761  70.788 54.001 1.00 32.29 ? 147 SER A OG  1 
ATOM   1147 N N   . TYR A 1 148 ? -6.644  66.644 54.139 1.00 23.28 ? 148 TYR A N   1 
ATOM   1148 C CA  . TYR A 1 148 ? -6.857  65.202 54.073 1.00 23.88 ? 148 TYR A CA  1 
ATOM   1149 C C   . TYR A 1 148 ? -7.251  64.651 55.431 1.00 23.37 ? 148 TYR A C   1 
ATOM   1150 O O   . TYR A 1 148 ? -6.911  65.208 56.471 1.00 22.36 ? 148 TYR A O   1 
ATOM   1151 C CB  . TYR A 1 148 ? -5.618  64.468 53.505 1.00 23.96 ? 148 TYR A CB  1 
ATOM   1152 C CG  . TYR A 1 148 ? -4.361  64.479 54.369 1.00 23.35 ? 148 TYR A CG  1 
ATOM   1153 C CD1 . TYR A 1 148 ? -4.141  63.498 55.363 1.00 22.03 ? 148 TYR A CD1 1 
ATOM   1154 C CD2 . TYR A 1 148 ? -3.390  65.463 54.190 1.00 22.61 ? 148 TYR A CD2 1 
ATOM   1155 C CE1 . TYR A 1 148 ? -2.989  63.507 56.145 1.00 20.13 ? 148 TYR A CE1 1 
ATOM   1156 C CE2 . TYR A 1 148 ? -2.233  65.479 54.970 1.00 22.12 ? 148 TYR A CE2 1 
ATOM   1157 C CZ  . TYR A 1 148 ? -2.038  64.506 55.940 1.00 20.81 ? 148 TYR A CZ  1 
ATOM   1158 O OH  . TYR A 1 148 ? -0.890  64.569 56.692 1.00 17.98 ? 148 TYR A OH  1 
ATOM   1159 N N   . ARG A 1 149 ? -7.984  63.552 55.409 1.00 23.52 ? 149 ARG A N   1 
ATOM   1160 C CA  . ARG A 1 149 ? -8.462  62.941 56.633 1.00 24.65 ? 149 ARG A CA  1 
ATOM   1161 C C   . ARG A 1 149 ? -7.415  62.271 57.514 1.00 25.15 ? 149 ARG A C   1 
ATOM   1162 O O   . ARG A 1 149 ? -6.793  61.281 57.109 1.00 26.86 ? 149 ARG A O   1 
ATOM   1163 C CB  . ARG A 1 149 ? -9.565  61.943 56.287 1.00 24.54 ? 149 ARG A CB  1 
ATOM   1164 C CG  . ARG A 1 149 ? -10.884 62.603 56.014 1.00 22.79 ? 149 ARG A CG  1 
ATOM   1165 C CD  . ARG A 1 149 ? -11.865 61.572 55.634 1.00 23.90 ? 149 ARG A CD  1 
ATOM   1166 N NE  . ARG A 1 149 ? -11.454 60.929 54.392 1.00 24.93 ? 149 ARG A NE  1 
ATOM   1167 C CZ  . ARG A 1 149 ? -12.166 59.992 53.778 1.00 24.26 ? 149 ARG A CZ  1 
ATOM   1168 N NH1 . ARG A 1 149 ? -13.318 59.580 54.303 1.00 23.49 ? 149 ARG A NH1 1 
ATOM   1169 N NH2 . ARG A 1 149 ? -11.725 59.465 52.650 1.00 21.74 ? 149 ARG A NH2 1 
ATOM   1170 N N   . VAL A 1 150 ? -7.249  62.800 58.729 1.00 24.75 ? 150 VAL A N   1 
ATOM   1171 C CA  . VAL A 1 150 ? -6.286  62.262 59.698 1.00 23.94 ? 150 VAL A CA  1 
ATOM   1172 C C   . VAL A 1 150 ? -6.945  61.402 60.773 1.00 25.43 ? 150 VAL A C   1 
ATOM   1173 O O   . VAL A 1 150 ? -8.168  61.383 60.902 1.00 27.32 ? 150 VAL A O   1 
ATOM   1174 C CB  . VAL A 1 150 ? -5.530  63.379 60.411 1.00 20.23 ? 150 VAL A CB  1 
ATOM   1175 C CG1 . VAL A 1 150 ? -4.876  64.273 59.386 1.00 19.86 ? 150 VAL A CG1 1 
ATOM   1176 C CG2 . VAL A 1 150 ? -6.477  64.148 61.308 1.00 15.97 ? 150 VAL A CG2 1 
ATOM   1177 N N   . GLY A 1 151 ? -6.123  60.704 61.550 1.00 26.17 ? 151 GLY A N   1 
ATOM   1178 C CA  . GLY A 1 151 ? -6.636  59.852 62.611 1.00 25.27 ? 151 GLY A CA  1 
ATOM   1179 C C   . GLY A 1 151 ? -7.433  58.679 62.083 1.00 24.87 ? 151 GLY A C   1 
ATOM   1180 O O   . GLY A 1 151 ? -7.274  58.257 60.943 1.00 24.67 ? 151 GLY A O   1 
ATOM   1181 N N   . ALA A 1 152 ? -8.310  58.149 62.915 1.00 25.41 ? 152 ALA A N   1 
ATOM   1182 C CA  . ALA A 1 152 ? -9.129  57.014 62.514 1.00 25.91 ? 152 ALA A CA  1 
ATOM   1183 C C   . ALA A 1 152 ? -9.961  57.320 61.285 1.00 25.07 ? 152 ALA A C   1 
ATOM   1184 O O   . ALA A 1 152 ? -10.217 56.435 60.472 1.00 23.79 ? 152 ALA A O   1 
ATOM   1185 C CB  . ALA A 1 152 ? -10.043 56.591 63.669 1.00 26.36 ? 152 ALA A CB  1 
ATOM   1186 N N   . PHE A 1 153 ? -10.377 58.579 61.165 1.00 26.10 ? 153 PHE A N   1 
ATOM   1187 C CA  . PHE A 1 153 ? -11.209 59.039 60.050 1.00 27.45 ? 153 PHE A CA  1 
ATOM   1188 C C   . PHE A 1 153 ? -10.577 58.828 58.694 1.00 27.54 ? 153 PHE A C   1 
ATOM   1189 O O   . PHE A 1 153 ? -11.281 58.684 57.689 1.00 28.07 ? 153 PHE A O   1 
ATOM   1190 C CB  . PHE A 1 153 ? -11.557 60.524 60.214 1.00 27.88 ? 153 PHE A CB  1 
ATOM   1191 C CG  . PHE A 1 153 ? -12.283 60.819 61.476 1.00 30.73 ? 153 PHE A CG  1 
ATOM   1192 C CD1 . PHE A 1 153 ? -13.644 60.542 61.587 1.00 31.91 ? 153 PHE A CD1 1 
ATOM   1193 C CD2 . PHE A 1 153 ? -11.604 61.273 62.590 1.00 31.85 ? 153 PHE A CD2 1 
ATOM   1194 C CE1 . PHE A 1 153 ? -14.315 60.704 62.795 1.00 31.16 ? 153 PHE A CE1 1 
ATOM   1195 C CE2 . PHE A 1 153 ? -12.271 61.439 63.800 1.00 32.98 ? 153 PHE A CE2 1 
ATOM   1196 C CZ  . PHE A 1 153 ? -13.631 61.150 63.898 1.00 31.75 ? 153 PHE A CZ  1 
ATOM   1197 N N   . GLY A 1 154 ? -9.247  58.809 58.671 1.00 26.78 ? 154 GLY A N   1 
ATOM   1198 C CA  . GLY A 1 154 ? -8.546  58.626 57.424 1.00 24.55 ? 154 GLY A CA  1 
ATOM   1199 C C   . GLY A 1 154 ? -7.616  57.438 57.407 1.00 23.78 ? 154 GLY A C   1 
ATOM   1200 O O   . GLY A 1 154 ? -7.002  57.197 56.389 1.00 25.26 ? 154 GLY A O   1 
ATOM   1201 N N   . PHE A 1 155 ? -7.495  56.673 58.486 1.00 22.57 ? 155 PHE A N   1 
ATOM   1202 C CA  . PHE A 1 155 ? -6.567  55.553 58.429 1.00 21.58 ? 155 PHE A CA  1 
ATOM   1203 C C   . PHE A 1 155 ? -6.996  54.246 59.073 1.00 21.35 ? 155 PHE A C   1 
ATOM   1204 O O   . PHE A 1 155 ? -6.244  53.273 59.077 1.00 21.22 ? 155 PHE A O   1 
ATOM   1205 C CB  . PHE A 1 155 ? -5.204  56.011 58.955 1.00 21.88 ? 155 PHE A CB  1 
ATOM   1206 C CG  . PHE A 1 155 ? -4.533  57.009 58.055 1.00 22.50 ? 155 PHE A CG  1 
ATOM   1207 C CD1 . PHE A 1 155 ? -3.809  56.587 56.942 1.00 22.73 ? 155 PHE A CD1 1 
ATOM   1208 C CD2 . PHE A 1 155 ? -4.715  58.377 58.248 1.00 22.62 ? 155 PHE A CD2 1 
ATOM   1209 C CE1 . PHE A 1 155 ? -3.283  57.524 56.026 1.00 22.10 ? 155 PHE A CE1 1 
ATOM   1210 C CE2 . PHE A 1 155 ? -4.193  59.314 57.331 1.00 22.12 ? 155 PHE A CE2 1 
ATOM   1211 C CZ  . PHE A 1 155 ? -3.481  58.882 56.226 1.00 20.68 ? 155 PHE A CZ  1 
ATOM   1212 N N   . LEU A 1 156 ? -8.205  54.208 59.607 1.00 21.14 ? 156 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 156 ? -8.708  52.979 60.199 1.00 23.63 ? 156 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 156 ? -8.703  51.907 59.095 1.00 26.39 ? 156 LEU A C   1 
ATOM   1215 O O   . LEU A 1 156 ? -9.324  52.113 58.055 1.00 28.06 ? 156 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 156 ? -10.126 53.212 60.669 1.00 22.11 ? 156 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 156 ? -10.818 51.915 61.011 1.00 21.19 ? 156 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 156 ? -10.628 51.631 62.483 1.00 20.30 ? 156 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 156 ? -12.271 52.027 60.642 1.00 21.10 ? 156 LEU A CD2 1 
ATOM   1220 N N   . ALA A 1 157 ? -8.044  50.762 59.292 1.00 28.33 ? 157 ALA A N   1 
ATOM   1221 C CA  . ALA A 1 157 ? -8.006  49.765 58.207 1.00 29.34 ? 157 ALA A CA  1 
ATOM   1222 C C   . ALA A 1 157 ? -8.423  48.306 58.429 1.00 30.42 ? 157 ALA A C   1 
ATOM   1223 O O   . ALA A 1 157 ? -7.662  47.488 58.943 1.00 30.86 ? 157 ALA A O   1 
ATOM   1224 C CB  . ALA A 1 157 ? -6.633  49.784 57.559 1.00 28.18 ? 157 ALA A CB  1 
ATOM   1225 N N   . LEU A 1 158 ? -9.633  47.981 57.994 1.00 31.39 ? 158 LEU A N   1 
ATOM   1226 C CA  . LEU A 1 158 ? -10.136 46.625 58.089 1.00 32.75 ? 158 LEU A CA  1 
ATOM   1227 C C   . LEU A 1 158 ? -9.960  46.070 56.692 1.00 35.48 ? 158 LEU A C   1 
ATOM   1228 O O   . LEU A 1 158 ? -10.911 45.995 55.933 1.00 36.00 ? 158 LEU A O   1 
ATOM   1229 C CB  . LEU A 1 158 ? -11.601 46.651 58.466 1.00 30.66 ? 158 LEU A CB  1 
ATOM   1230 C CG  . LEU A 1 158 ? -11.784 47.061 59.918 1.00 29.25 ? 158 LEU A CG  1 
ATOM   1231 C CD1 . LEU A 1 158 ? -13.226 47.405 60.178 1.00 26.89 ? 158 LEU A CD1 1 
ATOM   1232 C CD2 . LEU A 1 158 ? -11.289 45.933 60.812 1.00 28.43 ? 158 LEU A CD2 1 
ATOM   1233 N N   . HIS A 1 159 ? -8.725  45.682 56.384 1.00 39.03 ? 159 HIS A N   1 
ATOM   1234 C CA  . HIS A 1 159 ? -8.299  45.181 55.076 1.00 42.07 ? 159 HIS A CA  1 
ATOM   1235 C C   . HIS A 1 159 ? -9.254  44.554 54.062 1.00 43.05 ? 159 HIS A C   1 
ATOM   1236 O O   . HIS A 1 159 ? -9.290  44.966 52.887 1.00 42.51 ? 159 HIS A O   1 
ATOM   1237 C CB  . HIS A 1 159 ? -7.119  44.233 55.239 1.00 45.75 ? 159 HIS A CB  1 
ATOM   1238 C CG  . HIS A 1 159 ? -6.523  43.808 53.930 1.00 50.37 ? 159 HIS A CG  1 
ATOM   1239 N ND1 . HIS A 1 159 ? -6.311  44.693 52.890 1.00 50.12 ? 159 HIS A ND1 1 
ATOM   1240 C CD2 . HIS A 1 159 ? -6.084  42.602 53.491 1.00 52.14 ? 159 HIS A CD2 1 
ATOM   1241 C CE1 . HIS A 1 159 ? -5.767  44.051 51.871 1.00 50.90 ? 159 HIS A CE1 1 
ATOM   1242 N NE2 . HIS A 1 159 ? -5.618  42.781 52.209 1.00 52.26 ? 159 HIS A NE2 1 
ATOM   1243 N N   . GLY A 1 160 ? -9.998  43.540 54.478 1.00 43.81 ? 160 GLY A N   1 
ATOM   1244 C CA  . GLY A 1 160 ? -10.905 42.906 53.535 1.00 44.91 ? 160 GLY A CA  1 
ATOM   1245 C C   . GLY A 1 160 ? -12.064 43.776 53.073 1.00 44.80 ? 160 GLY A C   1 
ATOM   1246 O O   . GLY A 1 160 ? -12.425 43.770 51.899 1.00 44.95 ? 160 GLY A O   1 
ATOM   1247 N N   . SER A 1 161 ? -12.635 44.529 54.009 1.00 44.95 ? 161 SER A N   1 
ATOM   1248 C CA  . SER A 1 161 ? -13.775 45.392 53.750 1.00 44.57 ? 161 SER A CA  1 
ATOM   1249 C C   . SER A 1 161 ? -13.571 46.540 52.789 1.00 44.55 ? 161 SER A C   1 
ATOM   1250 O O   . SER A 1 161 ? -12.514 47.167 52.752 1.00 43.83 ? 161 SER A O   1 
ATOM   1251 C CB  . SER A 1 161 ? -14.299 45.964 55.060 1.00 45.13 ? 161 SER A CB  1 
ATOM   1252 O OG  . SER A 1 161 ? -15.344 46.886 54.805 1.00 46.15 ? 161 SER A OG  1 
ATOM   1253 N N   . GLN A 1 162 ? -14.618 46.805 52.014 1.00 45.59 ? 162 GLN A N   1 
ATOM   1254 C CA  . GLN A 1 162 ? -14.627 47.896 51.047 1.00 46.34 ? 162 GLN A CA  1 
ATOM   1255 C C   . GLN A 1 162 ? -15.138 49.114 51.794 1.00 46.17 ? 162 GLN A C   1 
ATOM   1256 O O   . GLN A 1 162 ? -14.939 50.252 51.360 1.00 47.45 ? 162 GLN A O   1 
ATOM   1257 C CB  . GLN A 1 162 ? -15.562 47.590 49.861 1.00 46.55 ? 162 GLN A CB  1 
ATOM   1258 C CG  . GLN A 1 162 ? -14.881 46.949 48.653 1.00 46.64 ? 162 GLN A CG  1 
ATOM   1259 N N   . GLU A 1 163 ? -15.796 48.863 52.922 1.00 44.85 ? 163 GLU A N   1 
ATOM   1260 C CA  . GLU A 1 163 ? -16.340 49.936 53.738 1.00 44.24 ? 163 GLU A CA  1 
ATOM   1261 C C   . GLU A 1 163 ? -15.267 50.662 54.550 1.00 42.21 ? 163 GLU A C   1 
ATOM   1262 O O   . GLU A 1 163 ? -15.441 51.813 54.939 1.00 42.50 ? 163 GLU A O   1 
ATOM   1263 C CB  . GLU A 1 163 ? -17.434 49.389 54.664 1.00 46.46 ? 163 GLU A CB  1 
ATOM   1264 C CG  . GLU A 1 163 ? -18.767 49.191 53.970 1.00 50.24 ? 163 GLU A CG  1 
ATOM   1265 C CD  . GLU A 1 163 ? -19.283 50.489 53.349 1.00 53.79 ? 163 GLU A CD  1 
ATOM   1266 O OE1 . GLU A 1 163 ? -18.623 51.540 53.543 1.00 55.08 ? 163 GLU A OE1 1 
ATOM   1267 O OE2 . GLU A 1 163 ? -20.342 50.463 52.671 1.00 54.79 ? 163 GLU A OE2 1 
ATOM   1268 N N   . ALA A 1 164 ? -14.156 49.994 54.804 1.00 39.27 ? 164 ALA A N   1 
ATOM   1269 C CA  . ALA A 1 164 ? -13.107 50.624 55.559 1.00 37.11 ? 164 ALA A CA  1 
ATOM   1270 C C   . ALA A 1 164 ? -11.744 50.055 55.237 1.00 37.32 ? 164 ALA A C   1 
ATOM   1271 O O   . ALA A 1 164 ? -11.158 49.300 56.028 1.00 36.40 ? 164 ALA A O   1 
ATOM   1272 C CB  . ALA A 1 164 ? -13.381 50.516 57.046 1.00 36.67 ? 164 ALA A CB  1 
ATOM   1273 N N   . PRO A 1 165 ? -11.250 50.341 54.021 1.00 37.24 ? 165 PRO A N   1 
ATOM   1274 C CA  . PRO A 1 165 ? -9.919  49.848 53.668 1.00 36.97 ? 165 PRO A CA  1 
ATOM   1275 C C   . PRO A 1 165 ? -9.029  50.991 54.227 1.00 37.54 ? 165 PRO A C   1 
ATOM   1276 O O   . PRO A 1 165 ? -9.543  52.083 54.557 1.00 39.84 ? 165 PRO A O   1 
ATOM   1277 C CB  . PRO A 1 165 ? -9.960  49.813 52.143 1.00 35.48 ? 165 PRO A CB  1 
ATOM   1278 C CG  . PRO A 1 165 ? -10.798 51.003 51.819 1.00 34.82 ? 165 PRO A CG  1 
ATOM   1279 C CD  . PRO A 1 165 ? -11.931 50.897 52.836 1.00 36.23 ? 165 PRO A CD  1 
ATOM   1280 N N   . GLY A 1 166 ? -7.729  50.783 54.368 1.00 34.47 ? 166 GLY A N   1 
ATOM   1281 C CA  . GLY A 1 166 ? -6.929  51.865 54.908 1.00 30.48 ? 166 GLY A CA  1 
ATOM   1282 C C   . GLY A 1 166 ? -6.456  52.860 53.868 1.00 27.82 ? 166 GLY A C   1 
ATOM   1283 O O   . GLY A 1 166 ? -7.023  52.969 52.786 1.00 25.85 ? 166 GLY A O   1 
ATOM   1284 N N   . ASN A 1 167 ? -5.406  53.593 54.220 1.00 26.33 ? 167 ASN A N   1 
ATOM   1285 C CA  . ASN A 1 167 ? -4.806  54.567 53.327 1.00 25.15 ? 167 ASN A CA  1 
ATOM   1286 C C   . ASN A 1 167 ? -5.798  55.550 52.758 1.00 24.54 ? 167 ASN A C   1 
ATOM   1287 O O   . ASN A 1 167 ? -5.433  56.387 51.939 1.00 24.62 ? 167 ASN A O   1 
ATOM   1288 C CB  . ASN A 1 167 ? -4.098  53.864 52.173 1.00 23.09 ? 167 ASN A CB  1 
ATOM   1289 C CG  . ASN A 1 167 ? -3.074  52.869 52.645 1.00 23.16 ? 167 ASN A CG  1 
ATOM   1290 O OD1 . ASN A 1 167 ? -2.354  53.112 53.611 1.00 24.04 ? 167 ASN A OD1 1 
ATOM   1291 N ND2 . ASN A 1 167 ? -2.988  51.742 51.957 1.00 23.99 ? 167 ASN A ND2 1 
ATOM   1292 N N   . VAL A 1 168 ? -7.048  55.450 53.190 1.00 23.56 ? 168 VAL A N   1 
ATOM   1293 C CA  . VAL A 1 168 ? -8.090  56.333 52.700 1.00 23.12 ? 168 VAL A CA  1 
ATOM   1294 C C   . VAL A 1 168 ? -7.683  57.796 52.680 1.00 22.79 ? 168 VAL A C   1 
ATOM   1295 O O   . VAL A 1 168 ? -7.910  58.470 51.694 1.00 23.50 ? 168 VAL A O   1 
ATOM   1296 C CB  . VAL A 1 168 ? -9.359  56.157 53.514 1.00 23.81 ? 168 VAL A CB  1 
ATOM   1297 C CG1 . VAL A 1 168 ? -10.196 57.402 53.449 1.00 24.36 ? 168 VAL A CG1 1 
ATOM   1298 C CG2 . VAL A 1 168 ? -10.133 54.981 52.967 1.00 24.50 ? 168 VAL A CG2 1 
ATOM   1299 N N   . GLY A 1 169 ? -7.078  58.284 53.755 1.00 23.11 ? 169 GLY A N   1 
ATOM   1300 C CA  . GLY A 1 169 ? -6.635  59.676 53.807 1.00 23.98 ? 169 GLY A CA  1 
ATOM   1301 C C   . GLY A 1 169 ? -5.499  59.987 52.834 1.00 23.88 ? 169 GLY A C   1 
ATOM   1302 O O   . GLY A 1 169 ? -5.216  61.149 52.494 1.00 23.19 ? 169 GLY A O   1 
ATOM   1303 N N   . LEU A 1 170 ? -4.832  58.925 52.398 1.00 23.59 ? 170 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 170 ? -3.753  59.025 51.429 1.00 23.04 ? 170 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 170 ? -4.394  59.322 50.044 1.00 22.93 ? 170 LEU A C   1 
ATOM   1306 O O   . LEU A 1 170 ? -3.793  59.978 49.186 1.00 21.88 ? 170 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 170 ? -2.991  57.697 51.428 1.00 21.67 ? 170 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 170 ? -1.481  57.730 51.629 1.00 20.08 ? 170 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 170 ? -1.052  59.070 52.195 1.00 18.44 ? 170 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 170 ? -1.079  56.579 52.522 1.00 18.29 ? 170 LEU A CD2 1 
ATOM   1311 N N   . LEU A 1 171 ? -5.630  58.842 49.861 1.00 22.76 ? 171 LEU A N   1 
ATOM   1312 C CA  . LEU A 1 171 ? -6.406  59.043 48.636 1.00 21.76 ? 171 LEU A CA  1 
ATOM   1313 C C   . LEU A 1 171 ? -6.951  60.466 48.573 1.00 22.84 ? 171 LEU A C   1 
ATOM   1314 O O   . LEU A 1 171 ? -6.896  61.097 47.524 1.00 23.67 ? 171 LEU A O   1 
ATOM   1315 C CB  . LEU A 1 171 ? -7.568  58.050 48.558 1.00 18.96 ? 171 LEU A CB  1 
ATOM   1316 C CG  . LEU A 1 171 ? -7.185  56.573 48.634 1.00 17.58 ? 171 LEU A CG  1 
ATOM   1317 C CD1 . LEU A 1 171 ? -8.355  55.728 48.205 1.00 16.14 ? 171 LEU A CD1 1 
ATOM   1318 C CD2 . LEU A 1 171 ? -5.987  56.298 47.748 1.00 16.53 ? 171 LEU A CD2 1 
ATOM   1319 N N   . ASP A 1 172 ? -7.495  60.965 49.680 1.00 23.74 ? 172 ASP A N   1 
ATOM   1320 C CA  . ASP A 1 172 ? -7.989  62.339 49.713 1.00 25.00 ? 172 ASP A CA  1 
ATOM   1321 C C   . ASP A 1 172 ? -6.889  63.176 49.051 1.00 24.14 ? 172 ASP A C   1 
ATOM   1322 O O   . ASP A 1 172 ? -7.167  64.123 48.305 1.00 23.37 ? 172 ASP A O   1 
ATOM   1323 C CB  . ASP A 1 172 ? -8.157  62.830 51.159 1.00 28.67 ? 172 ASP A CB  1 
ATOM   1324 C CG  . ASP A 1 172 ? -9.175  62.030 51.946 1.00 32.60 ? 172 ASP A CG  1 
ATOM   1325 O OD1 . ASP A 1 172 ? -9.088  60.793 51.946 1.00 35.45 ? 172 ASP A OD1 1 
ATOM   1326 O OD2 . ASP A 1 172 ? -10.061 62.632 52.587 1.00 36.51 ? 172 ASP A OD2 1 
ATOM   1327 N N   . GLN A 1 173 ? -5.638  62.799 49.338 1.00 22.21 ? 173 GLN A N   1 
ATOM   1328 C CA  . GLN A 1 173 ? -4.458  63.477 48.819 1.00 19.85 ? 173 GLN A CA  1 
ATOM   1329 C C   . GLN A 1 173 ? -4.373  63.376 47.325 1.00 19.29 ? 173 GLN A C   1 
ATOM   1330 O O   . GLN A 1 173 ? -4.290  64.387 46.634 1.00 18.73 ? 173 GLN A O   1 
ATOM   1331 C CB  . GLN A 1 173 ? -3.202  62.895 49.453 1.00 19.32 ? 173 GLN A CB  1 
ATOM   1332 C CG  . GLN A 1 173 ? -2.805  63.609 50.738 1.00 19.30 ? 173 GLN A CG  1 
ATOM   1333 C CD  . GLN A 1 173 ? -1.685  62.924 51.492 1.00 19.14 ? 173 GLN A CD  1 
ATOM   1334 O OE1 . GLN A 1 173 ? -0.678  62.528 50.917 1.00 21.48 ? 173 GLN A OE1 1 
ATOM   1335 N NE2 . GLN A 1 173 ? -1.850  62.801 52.794 1.00 17.69 ? 173 GLN A NE2 1 
ATOM   1336 N N   . ARG A 1 174 ? -4.403  62.146 46.833 1.00 20.23 ? 174 ARG A N   1 
ATOM   1337 C CA  . ARG A 1 174 ? -4.350  61.866 45.394 1.00 20.89 ? 174 ARG A CA  1 
ATOM   1338 C C   . ARG A 1 174 ? -5.424  62.645 44.660 1.00 20.89 ? 174 ARG A C   1 
ATOM   1339 O O   . ARG A 1 174 ? -5.144  63.259 43.635 1.00 20.32 ? 174 ARG A O   1 
ATOM   1340 C CB  . ARG A 1 174 ? -4.574  60.385 45.138 1.00 20.27 ? 174 ARG A CB  1 
ATOM   1341 C CG  . ARG A 1 174 ? -3.834  59.850 43.957 1.00 20.16 ? 174 ARG A CG  1 
ATOM   1342 C CD  . ARG A 1 174 ? -4.275  58.437 43.696 1.00 21.36 ? 174 ARG A CD  1 
ATOM   1343 N NE  . ARG A 1 174 ? -3.216  57.480 43.957 1.00 21.31 ? 174 ARG A NE  1 
ATOM   1344 C CZ  . ARG A 1 174 ? -3.415  56.173 44.080 1.00 23.01 ? 174 ARG A CZ  1 
ATOM   1345 N NH1 . ARG A 1 174 ? -4.637  55.659 43.987 1.00 21.63 ? 174 ARG A NH1 1 
ATOM   1346 N NH2 . ARG A 1 174 ? -2.385  55.373 44.309 1.00 26.23 ? 174 ARG A NH2 1 
ATOM   1347 N N   . MET A 1 175 ? -6.649  62.599 45.193 1.00 22.00 ? 175 MET A N   1 
ATOM   1348 C CA  . MET A 1 175 ? -7.812  63.305 44.644 1.00 22.15 ? 175 MET A CA  1 
ATOM   1349 C C   . MET A 1 175 ? -7.570  64.804 44.560 1.00 22.54 ? 175 MET A C   1 
ATOM   1350 O O   . MET A 1 175 ? -7.914  65.437 43.567 1.00 23.15 ? 175 MET A O   1 
ATOM   1351 C CB  . MET A 1 175 ? -9.026  63.058 45.514 1.00 23.61 ? 175 MET A CB  1 
ATOM   1352 C CG  . MET A 1 175 ? -10.288 63.680 44.983 1.00 26.41 ? 175 MET A CG  1 
ATOM   1353 S SD  . MET A 1 175 ? -11.542 62.439 44.639 1.00 29.58 ? 175 MET A SD  1 
ATOM   1354 C CE  . MET A 1 175 ? -10.780 61.722 43.148 1.00 27.67 ? 175 MET A CE  1 
ATOM   1355 N N   . ALA A 1 176 ? -6.998  65.390 45.607 1.00 22.61 ? 176 ALA A N   1 
ATOM   1356 C CA  . ALA A 1 176 ? -6.688  66.812 45.563 1.00 21.98 ? 176 ALA A CA  1 
ATOM   1357 C C   . ALA A 1 176 ? -5.673  66.960 44.428 1.00 22.40 ? 176 ALA A C   1 
ATOM   1358 O O   . ALA A 1 176 ? -5.800  67.827 43.563 1.00 21.87 ? 176 ALA A O   1 
ATOM   1359 C CB  . ALA A 1 176 ? -6.080  67.244 46.856 1.00 21.32 ? 176 ALA A CB  1 
ATOM   1360 N N   . LEU A 1 177 ? -4.673  66.080 44.438 1.00 22.27 ? 177 LEU A N   1 
ATOM   1361 C CA  . LEU A 1 177 ? -3.624  66.046 43.418 1.00 22.67 ? 177 LEU A CA  1 
ATOM   1362 C C   . LEU A 1 177 ? -4.225  65.916 42.005 1.00 24.20 ? 177 LEU A C   1 
ATOM   1363 O O   . LEU A 1 177 ? -3.683  66.463 41.039 1.00 24.90 ? 177 LEU A O   1 
ATOM   1364 C CB  . LEU A 1 177 ? -2.682  64.870 43.710 1.00 20.43 ? 177 LEU A CB  1 
ATOM   1365 C CG  . LEU A 1 177 ? -1.178  65.127 43.902 1.00 18.55 ? 177 LEU A CG  1 
ATOM   1366 C CD1 . LEU A 1 177 ? -0.932  66.524 44.465 1.00 18.26 ? 177 LEU A CD1 1 
ATOM   1367 C CD2 . LEU A 1 177 ? -0.597  64.051 44.807 1.00 13.11 ? 177 LEU A CD2 1 
ATOM   1368 N N   . GLN A 1 178 ? -5.346  65.198 41.901 1.00 24.77 ? 178 GLN A N   1 
ATOM   1369 C CA  . GLN A 1 178 ? -6.047  64.993 40.632 1.00 24.76 ? 178 GLN A CA  1 
ATOM   1370 C C   . GLN A 1 178 ? -6.683  66.285 40.199 1.00 23.69 ? 178 GLN A C   1 
ATOM   1371 O O   . GLN A 1 178 ? -6.514  66.717 39.065 1.00 25.30 ? 178 GLN A O   1 
ATOM   1372 C CB  . GLN A 1 178 ? -7.175  63.962 40.766 1.00 27.30 ? 178 GLN A CB  1 
ATOM   1373 C CG  . GLN A 1 178 ? -7.014  62.647 39.977 1.00 30.29 ? 178 GLN A CG  1 
ATOM   1374 C CD  . GLN A 1 178 ? -6.917  62.846 38.478 1.00 31.73 ? 178 GLN A CD  1 
ATOM   1375 O OE1 . GLN A 1 178 ? -6.785  61.885 37.728 1.00 32.50 ? 178 GLN A OE1 1 
ATOM   1376 N NE2 . GLN A 1 178 ? -6.976  64.096 38.035 1.00 33.54 ? 178 GLN A NE2 1 
ATOM   1377 N N   . TRP A 1 179 ? -7.436  66.894 41.100 1.00 21.12 ? 179 TRP A N   1 
ATOM   1378 C CA  . TRP A 1 179 ? -8.108  68.134 40.778 1.00 21.70 ? 179 TRP A CA  1 
ATOM   1379 C C   . TRP A 1 179 ? -7.114  69.225 40.357 1.00 22.94 ? 179 TRP A C   1 
ATOM   1380 O O   . TRP A 1 179 ? -7.365  69.984 39.427 1.00 22.55 ? 179 TRP A O   1 
ATOM   1381 C CB  . TRP A 1 179 ? -8.911  68.596 41.981 1.00 21.03 ? 179 TRP A CB  1 
ATOM   1382 C CG  . TRP A 1 179 ? -9.877  69.675 41.683 1.00 20.24 ? 179 TRP A CG  1 
ATOM   1383 C CD1 . TRP A 1 179 ? -11.201 69.533 41.444 1.00 20.60 ? 179 TRP A CD1 1 
ATOM   1384 C CD2 . TRP A 1 179 ? -9.601  71.077 41.603 1.00 21.42 ? 179 TRP A CD2 1 
ATOM   1385 N NE1 . TRP A 1 179 ? -11.782 70.757 41.223 1.00 21.66 ? 179 TRP A NE1 1 
ATOM   1386 C CE2 . TRP A 1 179 ? -10.818 71.725 41.315 1.00 22.15 ? 179 TRP A CE2 1 
ATOM   1387 C CE3 . TRP A 1 179 ? -8.441  71.850 41.744 1.00 21.29 ? 179 TRP A CE3 1 
ATOM   1388 C CZ2 . TRP A 1 179 ? -10.913 73.122 41.166 1.00 23.15 ? 179 TRP A CZ2 1 
ATOM   1389 C CZ3 . TRP A 1 179 ? -8.540  73.244 41.593 1.00 22.21 ? 179 TRP A CZ3 1 
ATOM   1390 C CH2 . TRP A 1 179 ? -9.763  73.859 41.310 1.00 20.98 ? 179 TRP A CH2 1 
ATOM   1391 N N   . VAL A 1 180 ? -5.985  69.311 41.046 1.00 24.07 ? 180 VAL A N   1 
ATOM   1392 C CA  . VAL A 1 180 ? -4.981  70.309 40.708 1.00 25.33 ? 180 VAL A CA  1 
ATOM   1393 C C   . VAL A 1 180 ? -4.500  70.097 39.279 1.00 26.69 ? 180 VAL A C   1 
ATOM   1394 O O   . VAL A 1 180 ? -4.399  71.036 38.484 1.00 26.27 ? 180 VAL A O   1 
ATOM   1395 C CB  . VAL A 1 180 ? -3.762  70.205 41.640 1.00 24.83 ? 180 VAL A CB  1 
ATOM   1396 C CG1 . VAL A 1 180 ? -2.686  71.213 41.232 1.00 22.58 ? 180 VAL A CG1 1 
ATOM   1397 C CG2 . VAL A 1 180 ? -4.198  70.436 43.057 1.00 24.64 ? 180 VAL A CG2 1 
ATOM   1398 N N   . HIS A 1 181 ? -4.185  68.849 38.968 1.00 28.39 ? 181 HIS A N   1 
ATOM   1399 C CA  . HIS A 1 181 ? -3.708  68.493 37.642 1.00 31.17 ? 181 HIS A CA  1 
ATOM   1400 C C   . HIS A 1 181 ? -4.735  68.887 36.569 1.00 31.66 ? 181 HIS A C   1 
ATOM   1401 O O   . HIS A 1 181 ? -4.387  69.465 35.534 1.00 32.27 ? 181 HIS A O   1 
ATOM   1402 C CB  . HIS A 1 181 ? -3.412  66.990 37.624 1.00 32.34 ? 181 HIS A CB  1 
ATOM   1403 C CG  . HIS A 1 181 ? -3.079  66.441 36.271 1.00 34.05 ? 181 HIS A CG  1 
ATOM   1404 N ND1 . HIS A 1 181 ? -4.045  66.014 35.383 1.00 33.80 ? 181 HIS A ND1 1 
ATOM   1405 C CD2 . HIS A 1 181 ? -1.887  66.169 35.688 1.00 34.20 ? 181 HIS A CD2 1 
ATOM   1406 C CE1 . HIS A 1 181 ? -3.465  65.491 34.318 1.00 33.17 ? 181 HIS A CE1 1 
ATOM   1407 N NE2 . HIS A 1 181 ? -2.156  65.572 34.480 1.00 35.01 ? 181 HIS A NE2 1 
ATOM   1408 N N   . ASP A 1 182 ? -6.004  68.605 36.849 1.00 31.63 ? 182 ASP A N   1 
ATOM   1409 C CA  . ASP A 1 182 ? -7.102  68.906 35.939 1.00 31.16 ? 182 ASP A CA  1 
ATOM   1410 C C   . ASP A 1 182 ? -7.594  70.363 35.901 1.00 30.45 ? 182 ASP A C   1 
ATOM   1411 O O   . ASP A 1 182 ? -8.356  70.712 35.019 1.00 31.49 ? 182 ASP A O   1 
ATOM   1412 C CB  . ASP A 1 182 ? -8.294  68.012 36.283 1.00 32.45 ? 182 ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 182 ? -8.077  66.571 35.895 1.00 33.90 ? 182 ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 182 ? -7.281  66.318 34.962 1.00 36.51 ? 182 ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 182 ? -8.721  65.693 36.507 1.00 32.94 ? 182 ASP A OD2 1 
ATOM   1416 N N   . ASN A 1 183 ? -7.168  71.222 36.820 1.00 29.02 ? 183 ASN A N   1 
ATOM   1417 C CA  . ASN A 1 183 ? -7.683  72.584 36.826 1.00 27.15 ? 183 ASN A CA  1 
ATOM   1418 C C   . ASN A 1 183 ? -6.721  73.725 37.080 1.00 28.31 ? 183 ASN A C   1 
ATOM   1419 O O   . ASN A 1 183 ? -7.036  74.880 36.785 1.00 27.88 ? 183 ASN A O   1 
ATOM   1420 C CB  . ASN A 1 183 ? -8.772  72.681 37.868 1.00 25.58 ? 183 ASN A CB  1 
ATOM   1421 C CG  . ASN A 1 183 ? -10.006 71.956 37.467 1.00 25.39 ? 183 ASN A CG  1 
ATOM   1422 O OD1 . ASN A 1 183 ? -10.752 72.436 36.624 1.00 27.83 ? 183 ASN A OD1 1 
ATOM   1423 N ND2 . ASN A 1 183 ? -10.240 70.789 38.058 1.00 24.00 ? 183 ASN A ND2 1 
ATOM   1424 N N   . ILE A 1 184 ? -5.560  73.418 37.640 1.00 29.19 ? 184 ILE A N   1 
ATOM   1425 C CA  . ILE A 1 184 ? -4.603  74.456 37.978 1.00 29.53 ? 184 ILE A CA  1 
ATOM   1426 C C   . ILE A 1 184 ? -4.203  75.319 36.777 1.00 32.02 ? 184 ILE A C   1 
ATOM   1427 O O   . ILE A 1 184 ? -3.671  76.426 36.941 1.00 31.50 ? 184 ILE A O   1 
ATOM   1428 C CB  . ILE A 1 184 ? -3.369  73.836 38.654 1.00 27.10 ? 184 ILE A CB  1 
ATOM   1429 C CG1 . ILE A 1 184 ? -2.613  74.917 39.415 1.00 24.50 ? 184 ILE A CG1 1 
ATOM   1430 C CG2 . ILE A 1 184 ? -2.517  73.119 37.632 1.00 27.26 ? 184 ILE A CG2 1 
ATOM   1431 C CD1 . ILE A 1 184 ? -3.432  75.555 40.502 1.00 20.62 ? 184 ILE A CD1 1 
ATOM   1432 N N   . GLN A 1 185 ? -4.477  74.817 35.572 1.00 34.43 ? 185 GLN A N   1 
ATOM   1433 C CA  . GLN A 1 185 ? -4.164  75.556 34.340 1.00 35.97 ? 185 GLN A CA  1 
ATOM   1434 C C   . GLN A 1 185 ? -5.045  76.788 34.188 1.00 35.25 ? 185 GLN A C   1 
ATOM   1435 O O   . GLN A 1 185 ? -4.690  77.705 33.458 1.00 36.19 ? 185 GLN A O   1 
ATOM   1436 C CB  . GLN A 1 185 ? -4.353  74.670 33.104 1.00 36.75 ? 185 GLN A CB  1 
ATOM   1437 C CG  . GLN A 1 185 ? -5.636  73.877 33.161 1.00 41.32 ? 185 GLN A CG  1 
ATOM   1438 C CD  . GLN A 1 185 ? -6.077  73.340 31.819 1.00 43.07 ? 185 GLN A CD  1 
ATOM   1439 O OE1 . GLN A 1 185 ? -5.450  72.450 31.257 1.00 45.51 ? 185 GLN A OE1 1 
ATOM   1440 N NE2 . GLN A 1 185 ? -7.169  73.879 31.297 1.00 44.11 ? 185 GLN A NE2 1 
ATOM   1441 N N   . PHE A 1 186 ? -6.189  76.806 34.868 1.00 34.07 ? 186 PHE A N   1 
ATOM   1442 C CA  . PHE A 1 186 ? -7.106  77.940 34.777 1.00 34.16 ? 186 PHE A CA  1 
ATOM   1443 C C   . PHE A 1 186 ? -6.756  79.067 35.744 1.00 34.52 ? 186 PHE A C   1 
ATOM   1444 O O   . PHE A 1 186 ? -7.336  80.165 35.692 1.00 35.43 ? 186 PHE A O   1 
ATOM   1445 C CB  . PHE A 1 186 ? -8.533  77.488 35.036 1.00 34.07 ? 186 PHE A CB  1 
ATOM   1446 C CG  . PHE A 1 186 ? -9.011  76.462 34.079 1.00 34.92 ? 186 PHE A CG  1 
ATOM   1447 C CD1 . PHE A 1 186 ? -9.416  76.827 32.804 1.00 35.20 ? 186 PHE A CD1 1 
ATOM   1448 C CD2 . PHE A 1 186 ? -9.042  75.123 34.437 1.00 36.61 ? 186 PHE A CD2 1 
ATOM   1449 C CE1 . PHE A 1 186 ? -9.843  75.877 31.893 1.00 35.14 ? 186 PHE A CE1 1 
ATOM   1450 C CE2 . PHE A 1 186 ? -9.469  74.157 33.532 1.00 36.45 ? 186 PHE A CE2 1 
ATOM   1451 C CZ  . PHE A 1 186 ? -9.869  74.539 32.258 1.00 36.52 ? 186 PHE A CZ  1 
ATOM   1452 N N   . PHE A 1 187 ? -5.822  78.784 36.644 1.00 32.57 ? 187 PHE A N   1 
ATOM   1453 C CA  . PHE A 1 187 ? -5.391  79.776 37.596 1.00 29.34 ? 187 PHE A CA  1 
ATOM   1454 C C   . PHE A 1 187 ? -4.021  80.207 37.135 1.00 27.77 ? 187 PHE A C   1 
ATOM   1455 O O   . PHE A 1 187 ? -3.310  80.884 37.853 1.00 28.61 ? 187 PHE A O   1 
ATOM   1456 C CB  . PHE A 1 187 ? -5.314  79.179 38.993 1.00 29.22 ? 187 PHE A CB  1 
ATOM   1457 C CG  . PHE A 1 187 ? -6.611  78.601 39.472 1.00 29.65 ? 187 PHE A CG  1 
ATOM   1458 C CD1 . PHE A 1 187 ? -7.026  77.345 39.051 1.00 31.08 ? 187 PHE A CD1 1 
ATOM   1459 C CD2 . PHE A 1 187 ? -7.421  79.312 40.352 1.00 29.94 ? 187 PHE A CD2 1 
ATOM   1460 C CE1 . PHE A 1 187 ? -8.243  76.802 39.506 1.00 32.38 ? 187 PHE A CE1 1 
ATOM   1461 C CE2 . PHE A 1 187 ? -8.629  78.786 40.811 1.00 30.16 ? 187 PHE A CE2 1 
ATOM   1462 C CZ  . PHE A 1 187 ? -9.042  77.528 40.388 1.00 31.28 ? 187 PHE A CZ  1 
ATOM   1463 N N   . GLY A 1 188 ? -3.650  79.794 35.930 1.00 26.22 ? 188 GLY A N   1 
ATOM   1464 C CA  . GLY A 1 188 ? -2.361  80.170 35.380 1.00 25.32 ? 188 GLY A CA  1 
ATOM   1465 C C   . GLY A 1 188 ? -1.199  79.355 35.904 1.00 25.08 ? 188 GLY A C   1 
ATOM   1466 O O   . GLY A 1 188 ? -0.072  79.843 35.972 1.00 23.85 ? 188 GLY A O   1 
ATOM   1467 N N   . GLY A 1 189 ? -1.466  78.114 36.288 1.00 25.20 ? 189 GLY A N   1 
ATOM   1468 C CA  . GLY A 1 189 ? -0.399  77.275 36.792 1.00 25.85 ? 189 GLY A CA  1 
ATOM   1469 C C   . GLY A 1 189 ? -0.046  76.266 35.734 1.00 26.89 ? 189 GLY A C   1 
ATOM   1470 O O   . GLY A 1 189 ? -0.908  75.830 34.990 1.00 27.30 ? 189 GLY A O   1 
ATOM   1471 N N   . ASP A 1 190 ? 1.218   75.895 35.647 1.00 28.51 ? 190 ASP A N   1 
ATOM   1472 C CA  . ASP A 1 190 ? 1.630   74.923 34.645 1.00 31.02 ? 190 ASP A CA  1 
ATOM   1473 C C   . ASP A 1 190 ? 1.523   73.471 35.160 1.00 31.35 ? 190 ASP A C   1 
ATOM   1474 O O   . ASP A 1 190 ? 2.364   73.015 35.939 1.00 34.55 ? 190 ASP A O   1 
ATOM   1475 C CB  . ASP A 1 190 ? 3.064   75.212 34.216 1.00 32.51 ? 190 ASP A CB  1 
ATOM   1476 C CG  . ASP A 1 190 ? 3.554   74.227 33.202 1.00 34.69 ? 190 ASP A CG  1 
ATOM   1477 O OD1 . ASP A 1 190 ? 2.756   73.348 32.822 1.00 36.55 ? 190 ASP A OD1 1 
ATOM   1478 O OD2 . ASP A 1 190 ? 4.716   74.323 32.777 1.00 36.90 ? 190 ASP A OD2 1 
ATOM   1479 N N   . PRO A 1 191 ? 0.516   72.716 34.706 1.00 29.14 ? 191 PRO A N   1 
ATOM   1480 C CA  . PRO A 1 191 ? 0.348   71.337 35.159 1.00 29.57 ? 191 PRO A CA  1 
ATOM   1481 C C   . PRO A 1 191 ? 1.545   70.431 34.946 1.00 31.62 ? 191 PRO A C   1 
ATOM   1482 O O   . PRO A 1 191 ? 1.756   69.490 35.702 1.00 32.46 ? 191 PRO A O   1 
ATOM   1483 C CB  . PRO A 1 191 ? -0.857  70.862 34.370 1.00 28.00 ? 191 PRO A CB  1 
ATOM   1484 C CG  . PRO A 1 191 ? -1.605  72.101 34.135 1.00 28.04 ? 191 PRO A CG  1 
ATOM   1485 C CD  . PRO A 1 191 ? -0.527  73.058 33.742 1.00 27.44 ? 191 PRO A CD  1 
ATOM   1486 N N   . LYS A 1 192 ? 2.330   70.697 33.912 1.00 34.05 ? 192 LYS A N   1 
ATOM   1487 C CA  . LYS A 1 192 ? 3.481   69.849 33.638 1.00 36.21 ? 192 LYS A CA  1 
ATOM   1488 C C   . LYS A 1 192 ? 4.594   70.131 34.610 1.00 36.41 ? 192 LYS A C   1 
ATOM   1489 O O   . LYS A 1 192 ? 5.636   69.475 34.569 1.00 36.85 ? 192 LYS A O   1 
ATOM   1490 C CB  . LYS A 1 192 ? 3.976   70.035 32.195 1.00 38.44 ? 192 LYS A CB  1 
ATOM   1491 C CG  . LYS A 1 192 ? 4.029   71.482 31.715 1.00 42.13 ? 192 LYS A CG  1 
ATOM   1492 C CD  . LYS A 1 192 ? 4.448   71.596 30.267 1.00 44.22 ? 192 LYS A CD  1 
ATOM   1493 C CE  . LYS A 1 192 ? 3.650   70.634 29.413 1.00 46.80 ? 192 LYS A CE  1 
ATOM   1494 N NZ  . LYS A 1 192 ? 4.152   70.613 28.014 1.00 49.81 ? 192 LYS A NZ  1 
ATOM   1495 N N   . THR A 1 193 ? 4.370   71.096 35.496 1.00 36.41 ? 193 THR A N   1 
ATOM   1496 C CA  . THR A 1 193 ? 5.386   71.440 36.475 1.00 37.26 ? 193 THR A CA  1 
ATOM   1497 C C   . THR A 1 193 ? 4.898   71.701 37.880 1.00 36.29 ? 193 THR A C   1 
ATOM   1498 O O   . THR A 1 193 ? 4.989   72.830 38.363 1.00 36.40 ? 193 THR A O   1 
ATOM   1499 C CB  . THR A 1 193 ? 6.204   72.665 36.044 1.00 38.44 ? 193 THR A CB  1 
ATOM   1500 O OG1 . THR A 1 193 ? 6.693   72.462 34.712 1.00 40.91 ? 193 THR A OG1 1 
ATOM   1501 C CG2 . THR A 1 193 ? 7.401   72.854 36.983 1.00 38.43 ? 193 THR A CG2 1 
ATOM   1502 N N   . VAL A 1 194 ? 4.371   70.665 38.533 1.00 35.14 ? 194 VAL A N   1 
ATOM   1503 C CA  . VAL A 1 194 ? 3.938   70.821 39.910 1.00 33.70 ? 194 VAL A CA  1 
ATOM   1504 C C   . VAL A 1 194 ? 4.831   69.976 40.772 1.00 33.84 ? 194 VAL A C   1 
ATOM   1505 O O   . VAL A 1 194 ? 5.160   68.829 40.453 1.00 33.28 ? 194 VAL A O   1 
ATOM   1506 C CB  . VAL A 1 194 ? 2.484   70.380 40.197 1.00 31.73 ? 194 VAL A CB  1 
ATOM   1507 C CG1 . VAL A 1 194 ? 1.564   70.831 39.077 1.00 30.57 ? 194 VAL A CG1 1 
ATOM   1508 C CG2 . VAL A 1 194 ? 2.437   68.893 40.462 1.00 29.88 ? 194 VAL A CG2 1 
ATOM   1509 N N   . THR A 1 195 ? 5.198   70.584 41.885 1.00 34.19 ? 195 THR A N   1 
ATOM   1510 C CA  . THR A 1 195 ? 6.053   69.993 42.887 1.00 32.85 ? 195 THR A CA  1 
ATOM   1511 C C   . THR A 1 195 ? 5.221   69.821 44.153 1.00 31.66 ? 195 THR A C   1 
ATOM   1512 O O   . THR A 1 195 ? 4.527   70.751 44.598 1.00 31.40 ? 195 THR A O   1 
ATOM   1513 C CB  . THR A 1 195 ? 7.215   70.944 43.181 1.00 32.82 ? 195 THR A CB  1 
ATOM   1514 O OG1 . THR A 1 195 ? 7.823   71.313 41.939 1.00 35.13 ? 195 THR A OG1 1 
ATOM   1515 C CG2 . THR A 1 195 ? 8.236   70.300 44.090 1.00 32.48 ? 195 THR A CG2 1 
ATOM   1516 N N   . ILE A 1 196 ? 5.245   68.621 44.710 1.00 28.92 ? 196 ILE A N   1 
ATOM   1517 C CA  . ILE A 1 196 ? 4.542   68.414 45.947 1.00 26.71 ? 196 ILE A CA  1 
ATOM   1518 C C   . ILE A 1 196 ? 5.650   68.341 47.012 1.00 29.01 ? 196 ILE A C   1 
ATOM   1519 O O   . ILE A 1 196 ? 6.663   67.644 46.838 1.00 29.77 ? 196 ILE A O   1 
ATOM   1520 C CB  . ILE A 1 196 ? 3.703   67.129 45.917 1.00 24.00 ? 196 ILE A CB  1 
ATOM   1521 C CG1 . ILE A 1 196 ? 4.555   65.937 45.460 1.00 23.47 ? 196 ILE A CG1 1 
ATOM   1522 C CG2 . ILE A 1 196 ? 2.517   67.337 45.025 1.00 22.25 ? 196 ILE A CG2 1 
ATOM   1523 C CD1 . ILE A 1 196 ? 4.064   64.575 45.953 1.00 19.27 ? 196 ILE A CD1 1 
ATOM   1524 N N   . PHE A 1 197 ? 5.479   69.120 48.081 1.00 29.79 ? 197 PHE A N   1 
ATOM   1525 C CA  . PHE A 1 197 ? 6.423   69.171 49.193 1.00 29.86 ? 197 PHE A CA  1 
ATOM   1526 C C   . PHE A 1 197 ? 5.636   69.111 50.510 1.00 31.54 ? 197 PHE A C   1 
ATOM   1527 O O   . PHE A 1 197 ? 4.616   69.802 50.656 1.00 34.95 ? 197 PHE A O   1 
ATOM   1528 C CB  . PHE A 1 197 ? 7.300   70.452 49.111 1.00 28.76 ? 197 PHE A CB  1 
ATOM   1529 C CG  . PHE A 1 197 ? 6.560   71.772 49.341 1.00 28.21 ? 197 PHE A CG  1 
ATOM   1530 C CD1 . PHE A 1 197 ? 5.389   72.084 48.666 1.00 27.60 ? 197 PHE A CD1 1 
ATOM   1531 C CD2 . PHE A 1 197 ? 7.094   72.740 50.191 1.00 29.41 ? 197 PHE A CD2 1 
ATOM   1532 C CE1 . PHE A 1 197 ? 4.770   73.341 48.833 1.00 27.33 ? 197 PHE A CE1 1 
ATOM   1533 C CE2 . PHE A 1 197 ? 6.472   74.004 50.359 1.00 28.06 ? 197 PHE A CE2 1 
ATOM   1534 C CZ  . PHE A 1 197 ? 5.316   74.294 49.679 1.00 25.94 ? 197 PHE A CZ  1 
ATOM   1535 N N   . GLY A 1 198 ? 6.084   68.263 51.445 1.00 30.58 ? 198 GLY A N   1 
ATOM   1536 C CA  . GLY A 1 198 ? 5.428   68.129 52.741 1.00 26.37 ? 198 GLY A CA  1 
ATOM   1537 C C   . GLY A 1 198 ? 6.463   67.863 53.817 1.00 24.67 ? 198 GLY A C   1 
ATOM   1538 O O   . GLY A 1 198 ? 7.570   67.435 53.511 1.00 23.98 ? 198 GLY A O   1 
ATOM   1539 N N   . GLU A 1 199 ? 6.113   68.120 55.073 1.00 23.90 ? 199 GLU A N   1 
ATOM   1540 C CA  . GLU A 1 199 ? 7.016   67.894 56.207 1.00 23.48 ? 199 GLU A CA  1 
ATOM   1541 C C   . GLU A 1 199 ? 6.448   66.924 57.260 1.00 23.66 ? 199 GLU A C   1 
ATOM   1542 O O   . GLU A 1 199 ? 5.248   66.905 57.553 1.00 23.00 ? 199 GLU A O   1 
ATOM   1543 C CB  . GLU A 1 199 ? 7.369   69.233 56.874 1.00 23.77 ? 199 GLU A CB  1 
ATOM   1544 C CG  . GLU A 1 199 ? 8.224   69.139 58.145 1.00 23.38 ? 199 GLU A CG  1 
ATOM   1545 C CD  . GLU A 1 199 ? 7.395   69.081 59.424 1.00 24.36 ? 199 GLU A CD  1 
ATOM   1546 O OE1 . GLU A 1 199 ? 6.168   69.297 59.353 1.00 26.13 ? 199 GLU A OE1 1 
ATOM   1547 O OE2 . GLU A 1 199 ? 7.966   68.828 60.502 1.00 22.38 ? 199 GLU A OE2 1 
ATOM   1548 N N   . SER A 1 200 ? 7.334   66.126 57.843 1.00 24.13 ? 200 SER A N   1 
ATOM   1549 C CA  . SER A 1 200 ? 6.939   65.161 58.853 1.00 23.07 ? 200 SER A CA  1 
ATOM   1550 C C   . SER A 1 200 ? 6.053   64.120 58.185 1.00 21.52 ? 200 SER A C   1 
ATOM   1551 O O   . SER A 1 200 ? 6.496   63.487 57.238 1.00 22.62 ? 200 SER A O   1 
ATOM   1552 C CB  . SER A 1 200 ? 6.208   65.858 59.999 1.00 23.54 ? 200 SER A CB  1 
ATOM   1553 O OG  . SER A 1 200 ? 5.674   64.900 60.896 1.00 26.44 ? 200 SER A OG  1 
ATOM   1554 N N   . ALA A 1 201 ? 4.822   63.934 58.654 1.00 19.72 ? 201 ALA A N   1 
ATOM   1555 C CA  . ALA A 1 201 ? 3.938   62.944 58.053 1.00 18.50 ? 201 ALA A CA  1 
ATOM   1556 C C   . ALA A 1 201 ? 3.655   63.349 56.610 1.00 19.97 ? 201 ALA A C   1 
ATOM   1557 O O   . ALA A 1 201 ? 3.367   62.494 55.757 1.00 20.98 ? 201 ALA A O   1 
ATOM   1558 C CB  . ALA A 1 201 ? 2.652   62.837 58.832 1.00 16.31 ? 201 ALA A CB  1 
ATOM   1559 N N   . GLY A 1 202 ? 3.744   64.653 56.333 1.00 19.47 ? 202 GLY A N   1 
ATOM   1560 C CA  . GLY A 1 202 ? 3.524   65.146 54.979 1.00 17.75 ? 202 GLY A CA  1 
ATOM   1561 C C   . GLY A 1 202 ? 4.684   64.730 54.087 1.00 17.94 ? 202 GLY A C   1 
ATOM   1562 O O   . GLY A 1 202 ? 4.497   64.364 52.934 1.00 18.97 ? 202 GLY A O   1 
ATOM   1563 N N   . GLY A 1 203 ? 5.897   64.785 54.624 1.00 17.29 ? 203 GLY A N   1 
ATOM   1564 C CA  . GLY A 1 203 ? 7.057   64.389 53.857 1.00 15.76 ? 203 GLY A CA  1 
ATOM   1565 C C   . GLY A 1 203 ? 6.978   62.909 53.555 1.00 15.78 ? 203 GLY A C   1 
ATOM   1566 O O   . GLY A 1 203 ? 7.353   62.488 52.469 1.00 16.33 ? 203 GLY A O   1 
ATOM   1567 N N   . ALA A 1 204 ? 6.507   62.115 54.514 1.00 15.24 ? 204 ALA A N   1 
ATOM   1568 C CA  . ALA A 1 204 ? 6.370   60.681 54.305 1.00 15.68 ? 204 ALA A CA  1 
ATOM   1569 C C   . ALA A 1 204 ? 5.286   60.442 53.242 1.00 16.41 ? 204 ALA A C   1 
ATOM   1570 O O   . ALA A 1 204 ? 5.446   59.576 52.377 1.00 17.01 ? 204 ALA A O   1 
ATOM   1571 C CB  . ALA A 1 204 ? 5.999   59.985 55.599 1.00 14.33 ? 204 ALA A CB  1 
ATOM   1572 N N   . SER A 1 205 ? 4.189   61.201 53.299 1.00 15.34 ? 205 SER A N   1 
ATOM   1573 C CA  . SER A 1 205 ? 3.120   61.056 52.300 1.00 15.25 ? 205 SER A CA  1 
ATOM   1574 C C   . SER A 1 205 ? 3.701   61.348 50.902 1.00 16.54 ? 205 SER A C   1 
ATOM   1575 O O   . SER A 1 205 ? 3.472   60.592 49.957 1.00 16.50 ? 205 SER A O   1 
ATOM   1576 C CB  . SER A 1 205 ? 1.973   62.029 52.586 1.00 14.10 ? 205 SER A CB  1 
ATOM   1577 O OG  . SER A 1 205 ? 1.545   61.951 53.928 1.00 10.35 ? 205 SER A OG  1 
ATOM   1578 N N   . VAL A 1 206 ? 4.449   62.447 50.782 1.00 17.18 ? 206 VAL A N   1 
ATOM   1579 C CA  . VAL A 1 206 ? 5.085   62.823 49.520 1.00 17.77 ? 206 VAL A CA  1 
ATOM   1580 C C   . VAL A 1 206 ? 5.852   61.620 48.977 1.00 20.00 ? 206 VAL A C   1 
ATOM   1581 O O   . VAL A 1 206 ? 5.704   61.246 47.824 1.00 22.36 ? 206 VAL A O   1 
ATOM   1582 C CB  . VAL A 1 206 ? 6.068   64.018 49.705 1.00 15.46 ? 206 VAL A CB  1 
ATOM   1583 C CG1 . VAL A 1 206 ? 6.973   64.153 48.514 1.00 13.31 ? 206 VAL A CG1 1 
ATOM   1584 C CG2 . VAL A 1 206 ? 5.290   65.300 49.874 1.00 15.05 ? 206 VAL A CG2 1 
ATOM   1585 N N   . GLY A 1 207 ? 6.663   60.994 49.814 1.00 21.45 ? 207 GLY A N   1 
ATOM   1586 C CA  . GLY A 1 207 ? 7.420   59.846 49.353 1.00 22.24 ? 207 GLY A CA  1 
ATOM   1587 C C   . GLY A 1 207 ? 6.565   58.629 49.060 1.00 22.15 ? 207 GLY A C   1 
ATOM   1588 O O   . GLY A 1 207 ? 6.997   57.749 48.321 1.00 22.59 ? 207 GLY A O   1 
ATOM   1589 N N   . MET A 1 208 ? 5.364   58.563 49.637 1.00 21.66 ? 208 MET A N   1 
ATOM   1590 C CA  . MET A 1 208 ? 4.491   57.415 49.416 1.00 20.94 ? 208 MET A CA  1 
ATOM   1591 C C   . MET A 1 208 ? 3.785   57.544 48.090 1.00 21.34 ? 208 MET A C   1 
ATOM   1592 O O   . MET A 1 208 ? 3.263   56.563 47.582 1.00 23.76 ? 208 MET A O   1 
ATOM   1593 C CB  . MET A 1 208 ? 3.491   57.242 50.565 1.00 18.89 ? 208 MET A CB  1 
ATOM   1594 C CG  . MET A 1 208 ? 4.204   56.894 51.865 1.00 22.16 ? 208 MET A CG  1 
ATOM   1595 S SD  . MET A 1 208 ? 3.241   56.490 53.339 1.00 23.36 ? 208 MET A SD  1 
ATOM   1596 C CE  . MET A 1 208 ? 2.197   57.915 53.397 1.00 23.56 ? 208 MET A CE  1 
ATOM   1597 N N   . HIS A 1 209 ? 3.775   58.752 47.527 1.00 20.10 ? 209 HIS A N   1 
ATOM   1598 C CA  . HIS A 1 209 ? 3.168   58.990 46.220 1.00 18.20 ? 209 HIS A CA  1 
ATOM   1599 C C   . HIS A 1 209 ? 4.253   58.795 45.159 1.00 18.04 ? 209 HIS A C   1 
ATOM   1600 O O   . HIS A 1 209 ? 3.959   58.566 44.003 1.00 19.00 ? 209 HIS A O   1 
ATOM   1601 C CB  . HIS A 1 209 ? 2.599   60.399 46.133 1.00 16.86 ? 209 HIS A CB  1 
ATOM   1602 C CG  . HIS A 1 209 ? 1.311   60.581 46.875 1.00 19.96 ? 209 HIS A CG  1 
ATOM   1603 N ND1 . HIS A 1 209 ? 1.075   61.658 47.708 1.00 19.70 ? 209 HIS A ND1 1 
ATOM   1604 C CD2 . HIS A 1 209 ? 0.162   59.860 46.861 1.00 20.89 ? 209 HIS A CD2 1 
ATOM   1605 C CE1 . HIS A 1 209 ? -0.163  61.594 48.170 1.00 20.82 ? 209 HIS A CE1 1 
ATOM   1606 N NE2 . HIS A 1 209 ? -0.740  60.515 47.670 1.00 20.82 ? 209 HIS A NE2 1 
ATOM   1607 N N   . ILE A 1 210 ? 5.514   58.906 45.549 1.00 17.47 ? 210 ILE A N   1 
ATOM   1608 C CA  . ILE A 1 210 ? 6.599   58.689 44.609 1.00 17.38 ? 210 ILE A CA  1 
ATOM   1609 C C   . ILE A 1 210 ? 6.656   57.193 44.394 1.00 18.10 ? 210 ILE A C   1 
ATOM   1610 O O   . ILE A 1 210 ? 7.026   56.704 43.347 1.00 18.03 ? 210 ILE A O   1 
ATOM   1611 C CB  . ILE A 1 210 ? 7.952   59.125 45.202 1.00 17.33 ? 210 ILE A CB  1 
ATOM   1612 C CG1 . ILE A 1 210 ? 8.100   60.633 45.063 1.00 18.99 ? 210 ILE A CG1 1 
ATOM   1613 C CG2 . ILE A 1 210 ? 9.114   58.377 44.529 1.00 14.84 ? 210 ILE A CG2 1 
ATOM   1614 C CD1 . ILE A 1 210 ? 9.500   61.136 45.394 1.00 22.24 ? 210 ILE A CD1 1 
ATOM   1615 N N   . LEU A 1 211 ? 6.260   56.476 45.424 1.00 20.24 ? 211 LEU A N   1 
ATOM   1616 C CA  . LEU A 1 211 ? 6.293   55.031 45.453 1.00 21.80 ? 211 LEU A CA  1 
ATOM   1617 C C   . LEU A 1 211 ? 5.061   54.389 44.838 1.00 23.76 ? 211 LEU A C   1 
ATOM   1618 O O   . LEU A 1 211 ? 5.148   53.377 44.140 1.00 24.20 ? 211 LEU A O   1 
ATOM   1619 C CB  . LEU A 1 211 ? 6.399   54.620 46.908 1.00 22.57 ? 211 LEU A CB  1 
ATOM   1620 C CG  . LEU A 1 211 ? 7.420   53.628 47.436 1.00 24.84 ? 211 LEU A CG  1 
ATOM   1621 C CD1 . LEU A 1 211 ? 8.677   53.589 46.595 1.00 25.93 ? 211 LEU A CD1 1 
ATOM   1622 C CD2 . LEU A 1 211 ? 7.718   54.056 48.869 1.00 24.85 ? 211 LEU A CD2 1 
ATOM   1623 N N   . SER A 1 212 ? 3.905   54.978 45.102 1.00 24.97 ? 212 SER A N   1 
ATOM   1624 C CA  . SER A 1 212 ? 2.664   54.416 44.614 1.00 26.88 ? 212 SER A CA  1 
ATOM   1625 C C   . SER A 1 212 ? 2.379   54.633 43.143 1.00 29.28 ? 212 SER A C   1 
ATOM   1626 O O   . SER A 1 212 ? 2.506   55.742 42.625 1.00 30.51 ? 212 SER A O   1 
ATOM   1627 C CB  . SER A 1 212 ? 1.500   54.959 45.430 1.00 27.05 ? 212 SER A CB  1 
ATOM   1628 O OG  . SER A 1 212 ? 0.277   54.375 45.026 1.00 27.12 ? 212 SER A OG  1 
ATOM   1629 N N   . PRO A 1 213 ? 1.991   53.557 42.440 1.00 30.79 ? 213 PRO A N   1 
ATOM   1630 C CA  . PRO A 1 213 ? 1.663   53.581 41.014 1.00 30.55 ? 213 PRO A CA  1 
ATOM   1631 C C   . PRO A 1 213 ? 0.558   54.586 40.673 1.00 31.36 ? 213 PRO A C   1 
ATOM   1632 O O   . PRO A 1 213 ? 0.742   55.431 39.792 1.00 33.76 ? 213 PRO A O   1 
ATOM   1633 C CB  . PRO A 1 213 ? 1.228   52.150 40.752 1.00 29.60 ? 213 PRO A CB  1 
ATOM   1634 C CG  . PRO A 1 213 ? 2.139   51.385 41.615 1.00 29.92 ? 213 PRO A CG  1 
ATOM   1635 C CD  . PRO A 1 213 ? 2.117   52.165 42.914 1.00 30.74 ? 213 PRO A CD  1 
ATOM   1636 N N   . GLY A 1 214 ? -0.577  54.498 41.370 1.00 29.62 ? 214 GLY A N   1 
ATOM   1637 C CA  . GLY A 1 214 ? -1.696  55.390 41.097 1.00 29.54 ? 214 GLY A CA  1 
ATOM   1638 C C   . GLY A 1 214 ? -1.493  56.891 41.278 1.00 30.02 ? 214 GLY A C   1 
ATOM   1639 O O   . GLY A 1 214 ? -2.279  57.712 40.780 1.00 29.43 ? 214 GLY A O   1 
ATOM   1640 N N   . SER A 1 215 ? -0.445  57.260 42.005 1.00 30.23 ? 215 SER A N   1 
ATOM   1641 C CA  . SER A 1 215 ? -0.149  58.665 42.250 1.00 29.08 ? 215 SER A CA  1 
ATOM   1642 C C   . SER A 1 215 ? 0.946   59.150 41.302 1.00 28.51 ? 215 SER A C   1 
ATOM   1643 O O   . SER A 1 215 ? 0.853   60.237 40.755 1.00 29.40 ? 215 SER A O   1 
ATOM   1644 C CB  . SER A 1 215 ? 0.299   58.852 43.701 1.00 28.67 ? 215 SER A CB  1 
ATOM   1645 O OG  . SER A 1 215 ? -0.638  58.287 44.599 1.00 28.81 ? 215 SER A OG  1 
ATOM   1646 N N   . ARG A 1 216 ? 1.975   58.325 41.127 1.00 26.91 ? 216 ARG A N   1 
ATOM   1647 C CA  . ARG A 1 216 ? 3.133   58.596 40.279 1.00 26.05 ? 216 ARG A CA  1 
ATOM   1648 C C   . ARG A 1 216 ? 3.008   59.634 39.151 1.00 26.42 ? 216 ARG A C   1 
ATOM   1649 O O   . ARG A 1 216 ? 3.814   60.564 39.071 1.00 25.33 ? 216 ARG A O   1 
ATOM   1650 C CB  . ARG A 1 216 ? 3.614   57.273 39.679 1.00 27.06 ? 216 ARG A CB  1 
ATOM   1651 C CG  . ARG A 1 216 ? 4.993   56.801 40.117 1.00 26.71 ? 216 ARG A CG  1 
ATOM   1652 C CD  . ARG A 1 216 ? 4.914   55.417 40.767 1.00 26.92 ? 216 ARG A CD  1 
ATOM   1653 N NE  . ARG A 1 216 ? 5.644   54.369 40.054 1.00 25.30 ? 216 ARG A NE  1 
ATOM   1654 C CZ  . ARG A 1 216 ? 5.913   53.164 40.560 1.00 25.45 ? 216 ARG A CZ  1 
ATOM   1655 N NH1 . ARG A 1 216 ? 5.540   52.835 41.787 1.00 24.12 ? 216 ARG A NH1 1 
ATOM   1656 N NH2 . ARG A 1 216 ? 6.573   52.279 39.840 1.00 27.30 ? 216 ARG A NH2 1 
ATOM   1657 N N   . ASP A 1 217 ? 2.012   59.466 38.279 1.00 27.61 ? 217 ASP A N   1 
ATOM   1658 C CA  . ASP A 1 217 ? 1.793   60.351 37.106 1.00 29.17 ? 217 ASP A CA  1 
ATOM   1659 C C   . ASP A 1 217 ? 1.301   61.803 37.331 1.00 28.16 ? 217 ASP A C   1 
ATOM   1660 O O   . ASP A 1 217 ? 1.466   62.659 36.455 1.00 27.46 ? 217 ASP A O   1 
ATOM   1661 C CB  . ASP A 1 217 ? 0.797   59.693 36.126 1.00 31.34 ? 217 ASP A CB  1 
ATOM   1662 C CG  . ASP A 1 217 ? 1.300   58.382 35.536 1.00 33.95 ? 217 ASP A CG  1 
ATOM   1663 O OD1 . ASP A 1 217 ? 2.393   57.905 35.936 1.00 34.61 ? 217 ASP A OD1 1 
ATOM   1664 O OD2 . ASP A 1 217 ? 0.582   57.833 34.659 1.00 34.81 ? 217 ASP A OD2 1 
ATOM   1665 N N   . LEU A 1 218 ? 0.691   62.048 38.491 1.00 26.68 ? 218 LEU A N   1 
ATOM   1666 C CA  . LEU A 1 218 ? 0.099   63.321 38.876 1.00 24.21 ? 218 LEU A CA  1 
ATOM   1667 C C   . LEU A 1 218 ? 0.972   64.482 39.335 1.00 24.62 ? 218 LEU A C   1 
ATOM   1668 O O   . LEU A 1 218 ? 0.440   65.534 39.686 1.00 24.42 ? 218 LEU A O   1 
ATOM   1669 C CB  . LEU A 1 218 ? -0.933  63.069 39.960 1.00 24.16 ? 218 LEU A CB  1 
ATOM   1670 C CG  . LEU A 1 218 ? -2.174  62.244 39.655 1.00 23.99 ? 218 LEU A CG  1 
ATOM   1671 C CD1 . LEU A 1 218 ? -2.809  61.838 40.964 1.00 24.95 ? 218 LEU A CD1 1 
ATOM   1672 C CD2 . LEU A 1 218 ? -3.143  63.038 38.825 1.00 24.15 ? 218 LEU A CD2 1 
ATOM   1673 N N   . PHE A 1 219 ? 2.287   64.322 39.373 1.00 24.64 ? 219 PHE A N   1 
ATOM   1674 C CA  . PHE A 1 219 ? 3.130   65.444 39.777 1.00 25.70 ? 219 PHE A CA  1 
ATOM   1675 C C   . PHE A 1 219 ? 4.476   65.357 39.111 1.00 26.10 ? 219 PHE A C   1 
ATOM   1676 O O   . PHE A 1 219 ? 4.845   64.304 38.605 1.00 27.22 ? 219 PHE A O   1 
ATOM   1677 C CB  . PHE A 1 219 ? 3.306   65.503 41.294 1.00 26.51 ? 219 PHE A CB  1 
ATOM   1678 C CG  . PHE A 1 219 ? 3.861   64.242 41.894 1.00 27.11 ? 219 PHE A CG  1 
ATOM   1679 C CD1 . PHE A 1 219 ? 3.054   63.098 42.013 1.00 25.31 ? 219 PHE A CD1 1 
ATOM   1680 C CD2 . PHE A 1 219 ? 5.197   64.191 42.321 1.00 26.11 ? 219 PHE A CD2 1 
ATOM   1681 C CE1 . PHE A 1 219 ? 3.564   61.928 42.540 1.00 25.51 ? 219 PHE A CE1 1 
ATOM   1682 C CE2 . PHE A 1 219 ? 5.729   63.027 42.852 1.00 26.42 ? 219 PHE A CE2 1 
ATOM   1683 C CZ  . PHE A 1 219 ? 4.912   61.885 42.963 1.00 28.18 ? 219 PHE A CZ  1 
ATOM   1684 N N   . ARG A 1 220 ? 5.217   66.459 39.128 1.00 26.26 ? 220 ARG A N   1 
ATOM   1685 C CA  . ARG A 1 220 ? 6.517   66.507 38.477 1.00 25.39 ? 220 ARG A CA  1 
ATOM   1686 C C   . ARG A 1 220 ? 7.666   66.079 39.373 1.00 24.27 ? 220 ARG A C   1 
ATOM   1687 O O   . ARG A 1 220 ? 8.260   65.035 39.145 1.00 22.73 ? 220 ARG A O   1 
ATOM   1688 C CB  . ARG A 1 220 ? 6.744   67.925 37.920 1.00 27.29 ? 220 ARG A CB  1 
ATOM   1689 C CG  . ARG A 1 220 ? 8.011   68.155 37.089 1.00 29.18 ? 220 ARG A CG  1 
ATOM   1690 C CD  . ARG A 1 220 ? 8.209   67.048 36.096 1.00 33.80 ? 220 ARG A CD  1 
ATOM   1691 N NE  . ARG A 1 220 ? 9.329   67.255 35.175 1.00 37.87 ? 220 ARG A NE  1 
ATOM   1692 C CZ  . ARG A 1 220 ? 9.275   67.993 34.066 1.00 39.67 ? 220 ARG A CZ  1 
ATOM   1693 N NH1 . ARG A 1 220 ? 8.150   68.620 33.729 1.00 39.80 ? 220 ARG A NH1 1 
ATOM   1694 N NH2 . ARG A 1 220 ? 10.336  68.064 33.264 1.00 39.53 ? 220 ARG A NH2 1 
ATOM   1695 N N   . ARG A 1 221 ? 7.967   66.888 40.388 1.00 25.42 ? 221 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 221 ? 9.068   66.635 41.325 1.00 25.72 ? 221 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 221 ? 8.526   66.570 42.739 1.00 26.61 ? 221 ARG A C   1 
ATOM   1698 O O   . ARG A 1 221 ? 7.315   66.721 42.947 1.00 28.13 ? 221 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 221 ? 10.096  67.766 41.287 1.00 25.52 ? 221 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 221 ? 10.466  68.256 39.928 1.00 26.12 ? 221 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 221 ? 11.503  69.323 40.035 1.00 29.60 ? 221 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 221 ? 11.280  70.379 39.063 1.00 34.78 ? 221 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 221 ? 11.368  70.228 37.742 1.00 37.94 ? 221 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 221 ? 11.686  69.052 37.219 1.00 37.82 ? 221 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 221 ? 11.107  71.254 36.932 1.00 39.90 ? 221 ARG A NH2 1 
ATOM   1706 N N   . ALA A 1 222 ? 9.435   66.387 43.705 1.00 26.20 ? 222 ALA A N   1 
ATOM   1707 C CA  . ALA A 1 222 ? 9.082   66.293 45.130 1.00 24.91 ? 222 ALA A CA  1 
ATOM   1708 C C   . ALA A 1 222 ? 10.126  66.889 46.074 1.00 24.62 ? 222 ALA A C   1 
ATOM   1709 O O   . ALA A 1 222 ? 11.306  67.048 45.718 1.00 24.62 ? 222 ALA A O   1 
ATOM   1710 C CB  . ALA A 1 222 ? 8.845   64.819 45.520 1.00 23.04 ? 222 ALA A CB  1 
ATOM   1711 N N   . ILE A 1 223 ? 9.662   67.215 47.282 1.00 23.34 ? 223 ILE A N   1 
ATOM   1712 C CA  . ILE A 1 223 ? 10.502  67.739 48.362 1.00 20.91 ? 223 ILE A CA  1 
ATOM   1713 C C   . ILE A 1 223 ? 9.986   67.072 49.636 1.00 20.32 ? 223 ILE A C   1 
ATOM   1714 O O   . ILE A 1 223 ? 8.784   67.052 49.888 1.00 20.18 ? 223 ILE A O   1 
ATOM   1715 C CB  . ILE A 1 223 ? 10.371  69.281 48.554 1.00 19.14 ? 223 ILE A CB  1 
ATOM   1716 C CG1 . ILE A 1 223 ? 10.735  70.028 47.276 1.00 18.06 ? 223 ILE A CG1 1 
ATOM   1717 C CG2 . ILE A 1 223 ? 11.302  69.739 49.647 1.00 17.73 ? 223 ILE A CG2 1 
ATOM   1718 C CD1 . ILE A 1 223 ? 10.736  71.512 47.447 1.00 16.07 ? 223 ILE A CD1 1 
ATOM   1719 N N   . LEU A 1 224 ? 10.882  66.487 50.417 1.00 20.35 ? 224 LEU A N   1 
ATOM   1720 C CA  . LEU A 1 224 ? 10.479  65.860 51.677 1.00 20.17 ? 224 LEU A CA  1 
ATOM   1721 C C   . LEU A 1 224 ? 11.267  66.574 52.768 1.00 20.93 ? 224 LEU A C   1 
ATOM   1722 O O   . LEU A 1 224 ? 12.482  66.755 52.650 1.00 20.70 ? 224 LEU A O   1 
ATOM   1723 C CB  . LEU A 1 224 ? 10.798  64.354 51.713 1.00 17.22 ? 224 LEU A CB  1 
ATOM   1724 C CG  . LEU A 1 224 ? 10.169  63.451 50.652 1.00 16.39 ? 224 LEU A CG  1 
ATOM   1725 C CD1 . LEU A 1 224 ? 10.852  63.728 49.320 1.00 16.53 ? 224 LEU A CD1 1 
ATOM   1726 C CD2 . LEU A 1 224 ? 10.316  61.987 51.037 1.00 12.69 ? 224 LEU A CD2 1 
ATOM   1727 N N   . GLN A 1 225 ? 10.565  67.000 53.816 1.00 21.60 ? 225 GLN A N   1 
ATOM   1728 C CA  . GLN A 1 225 ? 11.189  67.700 54.927 1.00 20.81 ? 225 GLN A CA  1 
ATOM   1729 C C   . GLN A 1 225 ? 10.958  66.911 56.191 1.00 19.32 ? 225 GLN A C   1 
ATOM   1730 O O   . GLN A 1 225 ? 9.819   66.692 56.587 1.00 18.05 ? 225 GLN A O   1 
ATOM   1731 C CB  . GLN A 1 225 ? 10.583  69.091 55.062 1.00 22.73 ? 225 GLN A CB  1 
ATOM   1732 C CG  . GLN A 1 225 ? 10.584  69.841 53.751 1.00 25.96 ? 225 GLN A CG  1 
ATOM   1733 C CD  . GLN A 1 225 ? 10.133  71.269 53.891 1.00 27.87 ? 225 GLN A CD  1 
ATOM   1734 O OE1 . GLN A 1 225 ? 9.906   71.957 52.893 1.00 28.63 ? 225 GLN A OE1 1 
ATOM   1735 N NE2 . GLN A 1 225 ? 10.007  71.732 55.132 1.00 28.12 ? 225 GLN A NE2 1 
ATOM   1736 N N   . SER A 1 226 ? 12.049  66.484 56.815 1.00 18.46 ? 226 SER A N   1 
ATOM   1737 C CA  . SER A 1 226 ? 11.980  65.706 58.040 1.00 18.98 ? 226 SER A CA  1 
ATOM   1738 C C   . SER A 1 226 ? 10.957  64.590 57.915 1.00 19.56 ? 226 SER A C   1 
ATOM   1739 O O   . SER A 1 226 ? 10.020  64.505 58.713 1.00 19.53 ? 226 SER A O   1 
ATOM   1740 C CB  . SER A 1 226 ? 11.630  66.603 59.242 1.00 18.51 ? 226 SER A CB  1 
ATOM   1741 O OG  . SER A 1 226 ? 12.645  67.569 59.499 1.00 17.19 ? 226 SER A OG  1 
ATOM   1742 N N   . GLY A 1 227 ? 11.128  63.743 56.903 1.00 20.06 ? 227 GLY A N   1 
ATOM   1743 C CA  . GLY A 1 227 ? 10.213  62.628 56.729 1.00 20.88 ? 227 GLY A CA  1 
ATOM   1744 C C   . GLY A 1 227 ? 10.377  61.810 55.463 1.00 21.70 ? 227 GLY A C   1 
ATOM   1745 O O   . GLY A 1 227 ? 10.299  62.358 54.371 1.00 23.75 ? 227 GLY A O   1 
ATOM   1746 N N   . SER A 1 228 ? 10.640  60.512 55.584 1.00 21.17 ? 228 SER A N   1 
ATOM   1747 C CA  . SER A 1 228 ? 10.727  59.685 54.384 1.00 21.75 ? 228 SER A CA  1 
ATOM   1748 C C   . SER A 1 228 ? 9.541   58.710 54.546 1.00 21.27 ? 228 SER A C   1 
ATOM   1749 O O   . SER A 1 228 ? 9.004   58.601 55.635 1.00 21.21 ? 228 SER A O   1 
ATOM   1750 C CB  . SER A 1 228 ? 12.107  59.003 54.255 1.00 19.67 ? 228 SER A CB  1 
ATOM   1751 O OG  . SER A 1 228 ? 12.269  57.935 55.147 1.00 20.61 ? 228 SER A OG  1 
ATOM   1752 N N   . PRO A 1 229 ? 9.106   58.018 53.475 1.00 21.30 ? 229 PRO A N   1 
ATOM   1753 C CA  . PRO A 1 229 ? 7.971   57.101 53.583 1.00 21.30 ? 229 PRO A CA  1 
ATOM   1754 C C   . PRO A 1 229 ? 8.240   55.806 54.319 1.00 21.78 ? 229 PRO A C   1 
ATOM   1755 O O   . PRO A 1 229 ? 7.318   55.090 54.695 1.00 22.11 ? 229 PRO A O   1 
ATOM   1756 C CB  . PRO A 1 229 ? 7.618   56.844 52.131 1.00 21.14 ? 229 PRO A CB  1 
ATOM   1757 C CG  . PRO A 1 229 ? 8.963   56.731 51.511 1.00 21.60 ? 229 PRO A CG  1 
ATOM   1758 C CD  . PRO A 1 229 ? 9.742   57.879 52.150 1.00 22.42 ? 229 PRO A CD  1 
ATOM   1759 N N   . ASN A 1 230 ? 9.505   55.491 54.521 1.00 21.91 ? 230 ASN A N   1 
ATOM   1760 C CA  . ASN A 1 230 ? 9.823   54.254 55.188 1.00 22.00 ? 230 ASN A CA  1 
ATOM   1761 C C   . ASN A 1 230 ? 10.135  54.467 56.655 1.00 23.70 ? 230 ASN A C   1 
ATOM   1762 O O   . ASN A 1 230 ? 10.845  53.671 57.266 1.00 25.87 ? 230 ASN A O   1 
ATOM   1763 C CB  . ASN A 1 230 ? 10.997  53.578 54.488 1.00 19.96 ? 230 ASN A CB  1 
ATOM   1764 C CG  . ASN A 1 230 ? 12.277  54.379 54.585 1.00 18.97 ? 230 ASN A CG  1 
ATOM   1765 O OD1 . ASN A 1 230 ? 12.322  55.558 54.227 1.00 18.47 ? 230 ASN A OD1 1 
ATOM   1766 N ND2 . ASN A 1 230 ? 13.337  53.734 55.063 1.00 18.36 ? 230 ASN A ND2 1 
ATOM   1767 N N   . CYS A 1 231 ? 9.617   55.534 57.243 1.00 23.72 ? 231 CYS A N   1 
ATOM   1768 C CA  . CYS A 1 231 ? 9.899   55.736 58.649 1.00 24.12 ? 231 CYS A CA  1 
ATOM   1769 C C   . CYS A 1 231 ? 9.171   54.690 59.468 1.00 24.09 ? 231 CYS A C   1 
ATOM   1770 O O   . CYS A 1 231 ? 8.037   54.318 59.159 1.00 24.03 ? 231 CYS A O   1 
ATOM   1771 C CB  . CYS A 1 231 ? 9.503   57.131 59.085 1.00 24.63 ? 231 CYS A CB  1 
ATOM   1772 S SG  . CYS A 1 231 ? 10.764  58.296 58.639 1.00 26.32 ? 231 CYS A SG  1 
ATOM   1773 N N   . PRO A 1 232 ? 9.822   54.210 60.537 1.00 23.55 ? 232 PRO A N   1 
ATOM   1774 C CA  . PRO A 1 232 ? 9.301   53.193 61.443 1.00 22.34 ? 232 PRO A CA  1 
ATOM   1775 C C   . PRO A 1 232 ? 7.923   53.530 61.956 1.00 22.06 ? 232 PRO A C   1 
ATOM   1776 O O   . PRO A 1 232 ? 7.148   52.637 62.306 1.00 21.90 ? 232 PRO A O   1 
ATOM   1777 C CB  . PRO A 1 232 ? 10.350  53.160 62.549 1.00 22.74 ? 232 PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 232 ? 10.796  54.569 62.614 1.00 23.39 ? 232 PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 232 ? 10.966  54.904 61.155 1.00 24.10 ? 232 PRO A CD  1 
ATOM   1780 N N   . TRP A 1 233 ? 7.613   54.822 61.986 1.00 21.92 ? 233 TRP A N   1 
ATOM   1781 C CA  . TRP A 1 233 ? 6.319   55.270 62.476 1.00 22.30 ? 233 TRP A CA  1 
ATOM   1782 C C   . TRP A 1 233 ? 5.300   55.549 61.390 1.00 22.46 ? 233 TRP A C   1 
ATOM   1783 O O   . TRP A 1 233 ? 4.162   55.874 61.703 1.00 23.38 ? 233 TRP A O   1 
ATOM   1784 C CB  . TRP A 1 233 ? 6.474   56.537 63.315 1.00 23.06 ? 233 TRP A CB  1 
ATOM   1785 C CG  . TRP A 1 233 ? 7.241   57.613 62.610 1.00 25.26 ? 233 TRP A CG  1 
ATOM   1786 C CD1 . TRP A 1 233 ? 8.588   57.850 62.692 1.00 25.88 ? 233 TRP A CD1 1 
ATOM   1787 C CD2 . TRP A 1 233 ? 6.728   58.553 61.655 1.00 25.40 ? 233 TRP A CD2 1 
ATOM   1788 N NE1 . TRP A 1 233 ? 8.941   58.875 61.850 1.00 25.39 ? 233 TRP A NE1 1 
ATOM   1789 C CE2 . TRP A 1 233 ? 7.820   59.323 61.197 1.00 25.24 ? 233 TRP A CE2 1 
ATOM   1790 C CE3 . TRP A 1 233 ? 5.452   58.815 61.135 1.00 25.55 ? 233 TRP A CE3 1 
ATOM   1791 C CZ2 . TRP A 1 233 ? 7.675   60.338 60.240 1.00 24.22 ? 233 TRP A CZ2 1 
ATOM   1792 C CZ3 . TRP A 1 233 ? 5.310   59.827 60.183 1.00 25.22 ? 233 TRP A CZ3 1 
ATOM   1793 C CH2 . TRP A 1 233 ? 6.419   60.574 59.748 1.00 24.07 ? 233 TRP A CH2 1 
ATOM   1794 N N   . ALA A 1 234 ? 5.678   55.401 60.122 1.00 22.29 ? 234 ALA A N   1 
ATOM   1795 C CA  . ALA A 1 234 ? 4.755   55.722 59.040 1.00 21.42 ? 234 ALA A CA  1 
ATOM   1796 C C   . ALA A 1 234 ? 3.895   54.640 58.366 1.00 21.34 ? 234 ALA A C   1 
ATOM   1797 O O   . ALA A 1 234 ? 3.122   54.963 57.470 1.00 21.38 ? 234 ALA A O   1 
ATOM   1798 C CB  . ALA A 1 234 ? 5.500   56.525 57.985 1.00 21.76 ? 234 ALA A CB  1 
ATOM   1799 N N   . SER A 1 235 ? 4.009   53.375 58.761 1.00 21.51 ? 235 SER A N   1 
ATOM   1800 C CA  . SER A 1 235 ? 3.152   52.341 58.158 1.00 21.64 ? 235 SER A CA  1 
ATOM   1801 C C   . SER A 1 235 ? 2.973   51.136 59.075 1.00 21.41 ? 235 SER A C   1 
ATOM   1802 O O   . SER A 1 235 ? 3.634   51.041 60.104 1.00 22.80 ? 235 SER A O   1 
ATOM   1803 C CB  . SER A 1 235 ? 3.720   51.878 56.812 1.00 21.51 ? 235 SER A CB  1 
ATOM   1804 O OG  . SER A 1 235 ? 4.947   51.189 56.975 1.00 23.26 ? 235 SER A OG  1 
ATOM   1805 N N   . VAL A 1 236 ? 2.050   50.245 58.723 1.00 21.32 ? 236 VAL A N   1 
ATOM   1806 C CA  . VAL A 1 236 ? 1.820   49.007 59.479 1.00 21.43 ? 236 VAL A CA  1 
ATOM   1807 C C   . VAL A 1 236 ? 1.229   47.940 58.563 1.00 22.87 ? 236 VAL A C   1 
ATOM   1808 O O   . VAL A 1 236 ? 0.714   48.244 57.479 1.00 22.55 ? 236 VAL A O   1 
ATOM   1809 C CB  . VAL A 1 236 ? 0.874   49.180 60.703 1.00 20.40 ? 236 VAL A CB  1 
ATOM   1810 C CG1 . VAL A 1 236 ? 1.579   49.928 61.777 1.00 19.80 ? 236 VAL A CG1 1 
ATOM   1811 C CG2 . VAL A 1 236 ? -0.415  49.881 60.311 1.00 19.55 ? 236 VAL A CG2 1 
ATOM   1812 N N   . SER A 1 237 ? 1.321   46.685 58.987 1.00 24.82 ? 237 SER A N   1 
ATOM   1813 C CA  . SER A 1 237 ? 0.795   45.589 58.189 1.00 27.87 ? 237 SER A CA  1 
ATOM   1814 C C   . SER A 1 237 ? -0.715  45.674 58.205 1.00 28.72 ? 237 SER A C   1 
ATOM   1815 O O   . SER A 1 237 ? -1.285  46.321 59.083 1.00 28.14 ? 237 SER A O   1 
ATOM   1816 C CB  . SER A 1 237 ? 1.259   44.240 58.750 1.00 30.11 ? 237 SER A CB  1 
ATOM   1817 O OG  . SER A 1 237 ? 0.942   44.109 60.125 1.00 32.75 ? 237 SER A OG  1 
ATOM   1818 N N   . VAL A 1 238 ? -1.369  45.030 57.239 1.00 30.15 ? 238 VAL A N   1 
ATOM   1819 C CA  . VAL A 1 238 ? -2.826  45.087 57.190 1.00 30.27 ? 238 VAL A CA  1 
ATOM   1820 C C   . VAL A 1 238 ? -3.341  44.423 58.448 1.00 32.38 ? 238 VAL A C   1 
ATOM   1821 O O   . VAL A 1 238 ? -4.455  44.726 58.910 1.00 34.02 ? 238 VAL A O   1 
ATOM   1822 C CB  . VAL A 1 238 ? -3.391  44.373 55.961 1.00 26.80 ? 238 VAL A CB  1 
ATOM   1823 C CG1 . VAL A 1 238 ? -2.412  44.479 54.822 1.00 26.33 ? 238 VAL A CG1 1 
ATOM   1824 C CG2 . VAL A 1 238 ? -3.704  42.954 56.285 1.00 26.07 ? 238 VAL A CG2 1 
ATOM   1825 N N   . ALA A 1 239 ? -2.502  43.534 58.990 1.00 32.65 ? 239 ALA A N   1 
ATOM   1826 C CA  . ALA A 1 239 ? -2.780  42.780 60.211 1.00 33.68 ? 239 ALA A CA  1 
ATOM   1827 C C   . ALA A 1 239 ? -2.863  43.691 61.440 1.00 35.53 ? 239 ALA A C   1 
ATOM   1828 O O   . ALA A 1 239 ? -3.904  43.733 62.124 1.00 35.56 ? 239 ALA A O   1 
ATOM   1829 C CB  . ALA A 1 239 ? -1.700  41.758 60.420 1.00 33.39 ? 239 ALA A CB  1 
ATOM   1830 N N   . GLU A 1 240 ? -1.754  44.394 61.719 1.00 35.99 ? 240 GLU A N   1 
ATOM   1831 C CA  . GLU A 1 240 ? -1.660  45.327 62.846 1.00 35.29 ? 240 GLU A CA  1 
ATOM   1832 C C   . GLU A 1 240 ? -2.743  46.361 62.674 1.00 35.28 ? 240 GLU A C   1 
ATOM   1833 O O   . GLU A 1 240 ? -3.371  46.772 63.638 1.00 36.56 ? 240 GLU A O   1 
ATOM   1834 C CB  . GLU A 1 240 ? -0.308  46.030 62.872 1.00 34.93 ? 240 GLU A CB  1 
ATOM   1835 C CG  . GLU A 1 240 ? 0.474   45.851 64.170 1.00 36.79 ? 240 GLU A CG  1 
ATOM   1836 C CD  . GLU A 1 240 ? -0.161  46.526 65.387 1.00 37.14 ? 240 GLU A CD  1 
ATOM   1837 O OE1 . GLU A 1 240 ? 0.008   47.748 65.547 1.00 37.63 ? 240 GLU A OE1 1 
ATOM   1838 O OE2 . GLU A 1 240 ? -0.824  45.843 66.194 1.00 38.19 ? 240 GLU A OE2 1 
ATOM   1839 N N   . GLY A 1 241 ? -2.959  46.783 61.437 1.00 34.94 ? 241 GLY A N   1 
ATOM   1840 C CA  . GLY A 1 241 ? -3.997  47.757 61.179 1.00 34.78 ? 241 GLY A CA  1 
ATOM   1841 C C   . GLY A 1 241 ? -5.339  47.232 61.640 1.00 34.62 ? 241 GLY A C   1 
ATOM   1842 O O   . GLY A 1 241 ? -6.117  47.956 62.255 1.00 32.85 ? 241 GLY A O   1 
ATOM   1843 N N   . ARG A 1 242 ? -5.606  45.963 61.342 1.00 36.42 ? 242 ARG A N   1 
ATOM   1844 C CA  . ARG A 1 242 ? -6.864  45.338 61.729 1.00 38.16 ? 242 ARG A CA  1 
ATOM   1845 C C   . ARG A 1 242 ? -6.983  45.230 63.247 1.00 37.28 ? 242 ARG A C   1 
ATOM   1846 O O   . ARG A 1 242 ? -8.054  45.492 63.803 1.00 36.33 ? 242 ARG A O   1 
ATOM   1847 C CB  . ARG A 1 242 ? -7.001  43.950 61.080 1.00 40.67 ? 242 ARG A CB  1 
ATOM   1848 C CG  . ARG A 1 242 ? -8.189  43.140 61.610 1.00 44.56 ? 242 ARG A CG  1 
ATOM   1849 C CD  . ARG A 1 242 ? -8.623  42.015 60.676 1.00 46.65 ? 242 ARG A CD  1 
ATOM   1850 N NE  . ARG A 1 242 ? -9.832  42.362 59.927 1.00 50.54 ? 242 ARG A NE  1 
ATOM   1851 C CZ  . ARG A 1 242 ? -9.848  42.715 58.641 1.00 53.42 ? 242 ARG A CZ  1 
ATOM   1852 N NH1 . ARG A 1 242 ? -8.711  42.753 57.948 1.00 55.38 ? 242 ARG A NH1 1 
ATOM   1853 N NH2 . ARG A 1 242 ? -11.000 43.017 58.039 1.00 53.29 ? 242 ARG A NH2 1 
ATOM   1854 N N   . ARG A 1 243 ? -5.892  44.847 63.913 1.00 36.25 ? 243 ARG A N   1 
ATOM   1855 C CA  . ARG A 1 243 ? -5.910  44.731 65.372 1.00 35.34 ? 243 ARG A CA  1 
ATOM   1856 C C   . ARG A 1 243 ? -6.397  46.043 65.945 1.00 31.97 ? 243 ARG A C   1 
ATOM   1857 O O   . ARG A 1 243 ? -7.421  46.096 66.617 1.00 32.18 ? 243 ARG A O   1 
ATOM   1858 C CB  . ARG A 1 243 ? -4.515  44.431 65.949 1.00 38.99 ? 243 ARG A CB  1 
ATOM   1859 C CG  . ARG A 1 243 ? -3.903  43.119 65.482 1.00 46.10 ? 243 ARG A CG  1 
ATOM   1860 C CD  . ARG A 1 243 ? -2.544  42.786 66.151 1.00 51.99 ? 243 ARG A CD  1 
ATOM   1861 N NE  . ARG A 1 243 ? -1.929  41.572 65.573 1.00 57.92 ? 243 ARG A NE  1 
ATOM   1862 C CZ  . ARG A 1 243 ? -1.142  41.534 64.487 1.00 60.92 ? 243 ARG A CZ  1 
ATOM   1863 N NH1 . ARG A 1 243 ? -0.804  42.649 63.838 1.00 62.10 ? 243 ARG A NH1 1 
ATOM   1864 N NH2 . ARG A 1 243 ? -0.658  40.371 64.056 1.00 62.91 ? 243 ARG A NH2 1 
ATOM   1865 N N   . ARG A 1 244 ? -5.665  47.108 65.653 1.00 28.16 ? 244 ARG A N   1 
ATOM   1866 C CA  . ARG A 1 244 ? -6.007  48.419 66.161 1.00 25.89 ? 244 ARG A CA  1 
ATOM   1867 C C   . ARG A 1 244 ? -7.394  48.868 65.759 1.00 26.66 ? 244 ARG A C   1 
ATOM   1868 O O   . ARG A 1 244 ? -8.000  49.697 66.431 1.00 27.60 ? 244 ARG A O   1 
ATOM   1869 C CB  . ARG A 1 244 ? -4.981  49.434 65.701 1.00 23.31 ? 244 ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 244 ? -3.567  49.023 66.029 1.00 20.24 ? 244 ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 244 ? -2.642  50.142 65.682 1.00 19.19 ? 244 ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 244 ? -1.243  49.799 65.862 1.00 17.32 ? 244 ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 244 ? -0.245  50.634 65.599 1.00 17.29 ? 244 ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 244 ? -0.496  51.858 65.158 1.00 15.73 ? 244 ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 244 ? 1.005   50.248 65.780 1.00 18.46 ? 244 ARG A NH2 1 
ATOM   1876 N N   . ALA A 1 245 ? -7.899  48.320 64.660 1.00 27.26 ? 245 ALA A N   1 
ATOM   1877 C CA  . ALA A 1 245 ? -9.225  48.677 64.185 1.00 25.29 ? 245 ALA A CA  1 
ATOM   1878 C C   . ALA A 1 245 ? -10.204 48.151 65.200 1.00 24.82 ? 245 ALA A C   1 
ATOM   1879 O O   . ALA A 1 245 ? -10.985 48.906 65.751 1.00 24.64 ? 245 ALA A O   1 
ATOM   1880 C CB  . ALA A 1 245 ? -9.481  48.054 62.836 1.00 25.56 ? 245 ALA A CB  1 
ATOM   1881 N N   . VAL A 1 246 ? -10.141 46.855 65.471 1.00 25.71 ? 246 VAL A N   1 
ATOM   1882 C CA  . VAL A 1 246 ? -11.057 46.257 66.435 1.00 28.55 ? 246 VAL A CA  1 
ATOM   1883 C C   . VAL A 1 246 ? -10.793 46.738 67.865 1.00 30.51 ? 246 VAL A C   1 
ATOM   1884 O O   . VAL A 1 246 ? -11.732 46.988 68.619 1.00 31.77 ? 246 VAL A O   1 
ATOM   1885 C CB  . VAL A 1 246 ? -11.008 44.696 66.395 1.00 27.65 ? 246 VAL A CB  1 
ATOM   1886 C CG1 . VAL A 1 246 ? -10.136 44.238 65.249 1.00 27.04 ? 246 VAL A CG1 1 
ATOM   1887 C CG2 . VAL A 1 246 ? -10.505 44.136 67.720 1.00 26.42 ? 246 VAL A CG2 1 
ATOM   1888 N N   . GLU A 1 247 ? -9.528  46.867 68.248 1.00 31.74 ? 247 GLU A N   1 
ATOM   1889 C CA  . GLU A 1 247 ? -9.231  47.327 69.592 1.00 32.89 ? 247 GLU A CA  1 
ATOM   1890 C C   . GLU A 1 247 ? -9.903  48.678 69.832 1.00 32.02 ? 247 GLU A C   1 
ATOM   1891 O O   . GLU A 1 247 ? -10.256 49.020 70.962 1.00 31.66 ? 247 GLU A O   1 
ATOM   1892 C CB  . GLU A 1 247 ? -7.728  47.453 69.801 1.00 36.40 ? 247 GLU A CB  1 
ATOM   1893 C CG  . GLU A 1 247 ? -7.355  47.693 71.253 1.00 43.52 ? 247 GLU A CG  1 
ATOM   1894 C CD  . GLU A 1 247 ? -7.872  46.581 72.168 1.00 47.17 ? 247 GLU A CD  1 
ATOM   1895 O OE1 . GLU A 1 247 ? -8.271  45.518 71.625 1.00 48.77 ? 247 GLU A OE1 1 
ATOM   1896 O OE2 . GLU A 1 247 ? -7.875  46.769 73.417 1.00 48.25 ? 247 GLU A OE2 1 
ATOM   1897 N N   . LEU A 1 248 ? -10.074 49.453 68.769 1.00 30.44 ? 248 LEU A N   1 
ATOM   1898 C CA  . LEU A 1 248 ? -10.727 50.735 68.902 1.00 29.29 ? 248 LEU A CA  1 
ATOM   1899 C C   . LEU A 1 248 ? -12.183 50.440 69.191 1.00 30.56 ? 248 LEU A C   1 
ATOM   1900 O O   . LEU A 1 248 ? -12.778 51.010 70.090 1.00 30.61 ? 248 LEU A O   1 
ATOM   1901 C CB  . LEU A 1 248 ? -10.628 51.533 67.613 1.00 27.55 ? 248 LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 248 ? -11.382 52.858 67.696 1.00 27.09 ? 248 LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 248 ? -10.658 53.786 68.641 1.00 27.38 ? 248 LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 248 ? -11.483 53.485 66.342 1.00 26.86 ? 248 LEU A CD2 1 
ATOM   1905 N N   . GLY A 1 249 ? -12.759 49.533 68.415 1.00 32.76 ? 249 GLY A N   1 
ATOM   1906 C CA  . GLY A 1 249 ? -14.153 49.180 68.609 1.00 34.39 ? 249 GLY A CA  1 
ATOM   1907 C C   . GLY A 1 249 ? -14.356 48.696 70.016 1.00 35.90 ? 249 GLY A C   1 
ATOM   1908 O O   . GLY A 1 249 ? -15.311 49.067 70.682 1.00 35.83 ? 249 GLY A O   1 
ATOM   1909 N N   . ARG A 1 250 ? -13.433 47.872 70.480 1.00 38.73 ? 250 ARG A N   1 
ATOM   1910 C CA  . ARG A 1 250 ? -13.523 47.352 71.821 1.00 41.88 ? 250 ARG A CA  1 
ATOM   1911 C C   . ARG A 1 250 ? -13.660 48.469 72.858 1.00 43.21 ? 250 ARG A C   1 
ATOM   1912 O O   . ARG A 1 250 ? -14.513 48.387 73.727 1.00 44.22 ? 250 ARG A O   1 
ATOM   1913 C CB  . ARG A 1 250 ? -12.313 46.500 72.134 1.00 42.80 ? 250 ARG A CB  1 
ATOM   1914 C CG  . ARG A 1 250 ? -12.540 45.666 73.342 1.00 47.91 ? 250 ARG A CG  1 
ATOM   1915 C CD  . ARG A 1 250 ? -11.306 44.903 73.717 1.00 54.21 ? 250 ARG A CD  1 
ATOM   1916 N NE  . ARG A 1 250 ? -10.802 44.079 72.618 1.00 59.47 ? 250 ARG A NE  1 
ATOM   1917 C CZ  . ARG A 1 250 ? -11.413 43.003 72.121 1.00 60.76 ? 250 ARG A CZ  1 
ATOM   1918 N NH1 . ARG A 1 250 ? -12.579 42.587 72.613 1.00 60.98 ? 250 ARG A NH1 1 
ATOM   1919 N NH2 . ARG A 1 250 ? -10.843 42.341 71.123 1.00 61.21 ? 250 ARG A NH2 1 
ATOM   1920 N N   . ASN A 1 251 ? -12.843 49.514 72.788 1.00 44.65 ? 251 ASN A N   1 
ATOM   1921 C CA  . ASN A 1 251 ? -12.978 50.596 73.764 1.00 46.99 ? 251 ASN A CA  1 
ATOM   1922 C C   . ASN A 1 251 ? -14.343 51.281 73.654 1.00 47.69 ? 251 ASN A C   1 
ATOM   1923 O O   . ASN A 1 251 ? -14.942 51.652 74.655 1.00 48.47 ? 251 ASN A O   1 
ATOM   1924 C CB  . ASN A 1 251 ? -11.898 51.675 73.589 1.00 49.79 ? 251 ASN A CB  1 
ATOM   1925 C CG  . ASN A 1 251 ? -10.491 51.171 73.887 1.00 53.86 ? 251 ASN A CG  1 
ATOM   1926 O OD1 . ASN A 1 251 ? -9.628  51.937 74.341 1.00 54.72 ? 251 ASN A OD1 1 
ATOM   1927 N ND2 . ASN A 1 251 ? -10.241 49.890 73.612 1.00 56.05 ? 251 ASN A ND2 1 
ATOM   1928 N N   . LEU A 1 252 ? -14.840 51.459 72.440 1.00 48.29 ? 252 LEU A N   1 
ATOM   1929 C CA  . LEU A 1 252 ? -16.114 52.129 72.266 1.00 48.28 ? 252 LEU A CA  1 
ATOM   1930 C C   . LEU A 1 252 ? -17.307 51.202 72.399 1.00 50.25 ? 252 LEU A C   1 
ATOM   1931 O O   . LEU A 1 252 ? -18.380 51.470 71.863 1.00 50.70 ? 252 LEU A O   1 
ATOM   1932 C CB  . LEU A 1 252 ? -16.137 52.851 70.921 1.00 46.49 ? 252 LEU A CB  1 
ATOM   1933 C CG  . LEU A 1 252 ? -15.336 54.152 70.918 1.00 44.44 ? 252 LEU A CG  1 
ATOM   1934 C CD1 . LEU A 1 252 ? -15.225 54.728 69.530 1.00 45.14 ? 252 LEU A CD1 1 
ATOM   1935 C CD2 . LEU A 1 252 ? -16.026 55.127 71.807 1.00 43.55 ? 252 LEU A CD2 1 
ATOM   1936 N N   . ASN A 1 253 ? -17.124 50.109 73.127 1.00 52.82 ? 253 ASN A N   1 
ATOM   1937 C CA  . ASN A 1 253 ? -18.210 49.155 73.348 1.00 55.62 ? 253 ASN A CA  1 
ATOM   1938 C C   . ASN A 1 253 ? -18.866 48.699 72.089 1.00 54.62 ? 253 ASN A C   1 
ATOM   1939 O O   . ASN A 1 253 ? -20.080 48.558 72.041 1.00 53.84 ? 253 ASN A O   1 
ATOM   1940 C CB  . ASN A 1 253 ? -19.293 49.758 74.231 1.00 59.98 ? 253 ASN A CB  1 
ATOM   1941 C CG  . ASN A 1 253 ? -18.894 49.779 75.672 1.00 64.68 ? 253 ASN A CG  1 
ATOM   1942 O OD1 . ASN A 1 253 ? -18.479 48.749 76.214 1.00 66.96 ? 253 ASN A OD1 1 
ATOM   1943 N ND2 . ASN A 1 253 ? -19.003 50.948 76.313 1.00 66.99 ? 253 ASN A ND2 1 
ATOM   1944 N N   . CYS A 1 254 ? -18.072 48.484 71.060 1.00 54.52 ? 254 CYS A N   1 
ATOM   1945 C CA  . CYS A 1 254 ? -18.639 48.037 69.817 1.00 54.23 ? 254 CYS A CA  1 
ATOM   1946 C C   . CYS A 1 254 ? -18.804 46.553 69.845 1.00 56.14 ? 254 CYS A C   1 
ATOM   1947 O O   . CYS A 1 254 ? -18.309 45.869 70.751 1.00 56.74 ? 254 CYS A O   1 
ATOM   1948 C CB  . CYS A 1 254 ? -17.763 48.423 68.643 1.00 51.43 ? 254 CYS A CB  1 
ATOM   1949 S SG  . CYS A 1 254 ? -17.982 50.159 68.193 1.00 48.23 ? 254 CYS A SG  1 
ATOM   1950 N N   . ASN A 1 255 ? -19.515 46.082 68.830 1.00 57.77 ? 255 ASN A N   1 
ATOM   1951 C CA  . ASN A 1 255 ? -19.822 44.681 68.623 1.00 58.84 ? 255 ASN A CA  1 
ATOM   1952 C C   . ASN A 1 255 ? -18.703 44.135 67.749 1.00 59.05 ? 255 ASN A C   1 
ATOM   1953 O O   . ASN A 1 255 ? -18.745 44.268 66.533 1.00 58.95 ? 255 ASN A O   1 
ATOM   1954 C CB  . ASN A 1 255 ? -21.167 44.602 67.909 1.00 59.82 ? 255 ASN A CB  1 
ATOM   1955 C CG  . ASN A 1 255 ? -21.504 43.217 67.450 1.00 61.36 ? 255 ASN A CG  1 
ATOM   1956 O OD1 . ASN A 1 255 ? -20.658 42.497 66.918 1.00 62.57 ? 255 ASN A OD1 1 
ATOM   1957 N ND2 . ASN A 1 255 ? -22.759 42.836 67.625 1.00 61.88 ? 255 ASN A ND2 1 
ATOM   1958 N N   . LEU A 1 256 ? -17.696 43.530 68.369 1.00 60.15 ? 256 LEU A N   1 
ATOM   1959 C CA  . LEU A 1 256 ? -16.564 42.998 67.615 1.00 61.62 ? 256 LEU A CA  1 
ATOM   1960 C C   . LEU A 1 256 ? -16.870 41.674 66.930 1.00 62.20 ? 256 LEU A C   1 
ATOM   1961 O O   . LEU A 1 256 ? -15.956 40.966 66.526 1.00 63.00 ? 256 LEU A O   1 
ATOM   1962 C CB  . LEU A 1 256 ? -15.342 42.800 68.525 1.00 61.96 ? 256 LEU A CB  1 
ATOM   1963 C CG  . LEU A 1 256 ? -14.753 43.959 69.333 1.00 63.67 ? 256 LEU A CG  1 
ATOM   1964 C CD1 . LEU A 1 256 ? -14.573 45.167 68.419 1.00 65.13 ? 256 LEU A CD1 1 
ATOM   1965 C CD2 . LEU A 1 256 ? -15.663 44.303 70.514 1.00 64.84 ? 256 LEU A CD2 1 
ATOM   1966 N N   . ASN A 1 257 ? -18.143 41.335 66.782 1.00 62.59 ? 257 ASN A N   1 
ATOM   1967 C CA  . ASN A 1 257 ? -18.500 40.064 66.166 1.00 63.01 ? 257 ASN A CA  1 
ATOM   1968 C C   . ASN A 1 257 ? -18.284 39.981 64.657 1.00 60.91 ? 257 ASN A C   1 
ATOM   1969 O O   . ASN A 1 257 ? -17.594 39.096 64.146 1.00 59.65 ? 257 ASN A O   1 
ATOM   1970 C CB  . ASN A 1 257 ? -19.958 39.740 66.458 1.00 67.24 ? 257 ASN A CB  1 
ATOM   1971 C CG  . ASN A 1 257 ? -20.370 38.403 65.884 1.00 71.59 ? 257 ASN A CG  1 
ATOM   1972 O OD1 . ASN A 1 257 ? -20.019 37.348 66.433 1.00 74.11 ? 257 ASN A OD1 1 
ATOM   1973 N ND2 . ASN A 1 257 ? -21.095 38.431 64.757 1.00 72.98 ? 257 ASN A ND2 1 
ATOM   1974 N N   . SER A 1 258 ? -18.911 40.899 63.947 1.00 58.98 ? 258 SER A N   1 
ATOM   1975 C CA  . SER A 1 258 ? -18.803 40.925 62.513 1.00 57.81 ? 258 SER A CA  1 
ATOM   1976 C C   . SER A 1 258 ? -18.093 42.167 61.997 1.00 57.40 ? 258 SER A C   1 
ATOM   1977 O O   . SER A 1 258 ? -18.409 43.295 62.370 1.00 58.17 ? 258 SER A O   1 
ATOM   1978 C CB  . SER A 1 258 ? -20.188 40.843 61.901 1.00 57.81 ? 258 SER A CB  1 
ATOM   1979 O OG  . SER A 1 258 ? -20.157 41.328 60.577 1.00 58.70 ? 258 SER A OG  1 
ATOM   1980 N N   . ASP A 1 259 ? -17.128 41.942 61.124 1.00 56.32 ? 259 ASP A N   1 
ATOM   1981 C CA  . ASP A 1 259 ? -16.364 43.011 60.517 1.00 54.76 ? 259 ASP A CA  1 
ATOM   1982 C C   . ASP A 1 259 ? -17.296 44.109 59.958 1.00 53.98 ? 259 ASP A C   1 
ATOM   1983 O O   . ASP A 1 259 ? -16.918 45.267 59.915 1.00 53.39 ? 259 ASP A O   1 
ATOM   1984 C CB  . ASP A 1 259 ? -15.507 42.394 59.413 1.00 54.99 ? 259 ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 259 ? -14.274 43.198 59.107 1.00 54.76 ? 259 ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 259 ? -14.399 44.221 58.409 1.00 55.31 ? 259 ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 259 ? -13.180 42.801 59.565 1.00 53.72 ? 259 ASP A OD2 1 
ATOM   1988 N N   . GLU A 1 260 ? -18.513 43.748 59.542 1.00 53.99 ? 260 GLU A N   1 
ATOM   1989 C CA  . GLU A 1 260 ? -19.470 44.722 58.993 1.00 53.88 ? 260 GLU A CA  1 
ATOM   1990 C C   . GLU A 1 260 ? -20.081 45.524 60.094 1.00 52.45 ? 260 GLU A C   1 
ATOM   1991 O O   . GLU A 1 260 ? -20.266 46.723 59.965 1.00 51.54 ? 260 GLU A O   1 
ATOM   1992 C CB  . GLU A 1 260 ? -20.620 44.047 58.231 1.00 57.02 ? 260 GLU A CB  1 
ATOM   1993 C CG  . GLU A 1 260 ? -20.252 43.472 56.857 1.00 62.17 ? 260 GLU A CG  1 
ATOM   1994 C CD  . GLU A 1 260 ? -19.403 42.194 56.936 1.00 65.16 ? 260 GLU A CD  1 
ATOM   1995 O OE1 . GLU A 1 260 ? -19.651 41.340 57.828 1.00 65.34 ? 260 GLU A OE1 1 
ATOM   1996 O OE2 . GLU A 1 260 ? -18.491 42.044 56.086 1.00 67.44 ? 260 GLU A OE2 1 
ATOM   1997 N N   . GLU A 1 261 ? -20.406 44.836 61.175 1.00 52.38 ? 261 GLU A N   1 
ATOM   1998 C CA  . GLU A 1 261 ? -21.007 45.456 62.342 1.00 53.09 ? 261 GLU A CA  1 
ATOM   1999 C C   . GLU A 1 261 ? -20.030 46.399 63.050 1.00 51.64 ? 261 GLU A C   1 
ATOM   2000 O O   . GLU A 1 261 ? -20.432 47.479 63.507 1.00 52.49 ? 261 GLU A O   1 
ATOM   2001 C CB  . GLU A 1 261 ? -21.472 44.371 63.311 1.00 55.97 ? 261 GLU A CB  1 
ATOM   2002 C CG  . GLU A 1 261 ? -22.249 43.251 62.635 1.00 61.20 ? 261 GLU A CG  1 
ATOM   2003 C CD  . GLU A 1 261 ? -22.686 42.147 63.600 1.00 64.68 ? 261 GLU A CD  1 
ATOM   2004 O OE1 . GLU A 1 261 ? -22.566 42.336 64.837 1.00 65.78 ? 261 GLU A OE1 1 
ATOM   2005 O OE2 . GLU A 1 261 ? -23.158 41.088 63.114 1.00 66.61 ? 261 GLU A OE2 1 
ATOM   2006 N N   . LEU A 1 262 ? -18.758 45.992 63.143 1.00 48.66 ? 262 LEU A N   1 
ATOM   2007 C CA  . LEU A 1 262 ? -17.724 46.808 63.790 1.00 45.28 ? 262 LEU A CA  1 
ATOM   2008 C C   . LEU A 1 262 ? -17.745 48.185 63.134 1.00 44.61 ? 262 LEU A C   1 
ATOM   2009 O O   . LEU A 1 262 ? -17.810 49.216 63.797 1.00 43.97 ? 262 LEU A O   1 
ATOM   2010 C CB  . LEU A 1 262 ? -16.335 46.174 63.613 1.00 41.93 ? 262 LEU A CB  1 
ATOM   2011 C CG  . LEU A 1 262 ? -15.274 46.496 64.678 1.00 39.58 ? 262 LEU A CG  1 
ATOM   2012 C CD1 . LEU A 1 262 ? -13.941 45.929 64.256 1.00 36.51 ? 262 LEU A CD1 1 
ATOM   2013 C CD2 . LEU A 1 262 ? -15.159 47.988 64.881 1.00 38.78 ? 262 LEU A CD2 1 
ATOM   2014 N N   . ILE A 1 263 ? -17.706 48.184 61.812 1.00 44.34 ? 263 ILE A N   1 
ATOM   2015 C CA  . ILE A 1 263 ? -17.730 49.412 61.054 1.00 45.28 ? 263 ILE A CA  1 
ATOM   2016 C C   . ILE A 1 263 ? -19.012 50.215 61.302 1.00 46.89 ? 263 ILE A C   1 
ATOM   2017 O O   . ILE A 1 263 ? -18.969 51.439 61.456 1.00 47.33 ? 263 ILE A O   1 
ATOM   2018 C CB  . ILE A 1 263 ? -17.571 49.099 59.565 1.00 44.26 ? 263 ILE A CB  1 
ATOM   2019 C CG1 . ILE A 1 263 ? -16.162 48.574 59.323 1.00 43.70 ? 263 ILE A CG1 1 
ATOM   2020 C CG2 . ILE A 1 263 ? -17.816 50.335 58.729 1.00 44.90 ? 263 ILE A CG2 1 
ATOM   2021 C CD1 . ILE A 1 263 ? -15.953 48.009 57.951 1.00 43.82 ? 263 ILE A CD1 1 
ATOM   2022 N N   A HIS A 1 264 ? -20.150 49.529 61.343 0.50 46.72 ? 264 HIS A N   1 
ATOM   2023 N N   B HIS A 1 264 ? -20.149 49.532 61.344 0.50 47.46 ? 264 HIS A N   1 
ATOM   2024 C CA  A HIS A 1 264 ? -21.416 50.212 61.578 0.50 46.65 ? 264 HIS A CA  1 
ATOM   2025 C CA  B HIS A 1 264 ? -21.413 50.219 61.567 0.50 47.92 ? 264 HIS A CA  1 
ATOM   2026 C C   A HIS A 1 264 ? -21.351 50.959 62.899 0.50 46.07 ? 264 HIS A C   1 
ATOM   2027 C C   B HIS A 1 264 ? -21.387 50.946 62.906 0.50 46.87 ? 264 HIS A C   1 
ATOM   2028 O O   A HIS A 1 264 ? -21.665 52.150 62.976 0.50 46.14 ? 264 HIS A O   1 
ATOM   2029 O O   B HIS A 1 264 ? -21.763 52.117 62.999 0.50 46.81 ? 264 HIS A O   1 
ATOM   2030 C CB  A HIS A 1 264 ? -22.579 49.215 61.621 0.50 47.02 ? 264 HIS A CB  1 
ATOM   2031 C CB  B HIS A 1 264 ? -22.573 49.223 61.509 0.50 49.99 ? 264 HIS A CB  1 
ATOM   2032 C CG  A HIS A 1 264 ? -23.892 49.838 61.992 0.50 47.35 ? 264 HIS A CG  1 
ATOM   2033 C CG  B HIS A 1 264 ? -22.641 48.464 60.221 0.50 52.17 ? 264 HIS A CG  1 
ATOM   2034 N ND1 A HIS A 1 264 ? -24.483 50.833 61.241 0.50 47.55 ? 264 HIS A ND1 1 
ATOM   2035 N ND1 B HIS A 1 264 ? -22.391 49.052 58.999 0.50 52.89 ? 264 HIS A ND1 1 
ATOM   2036 C CD2 A HIS A 1 264 ? -24.718 49.619 63.042 0.50 46.81 ? 264 HIS A CD2 1 
ATOM   2037 C CD2 B HIS A 1 264 ? -22.915 47.163 59.963 0.50 53.75 ? 264 HIS A CD2 1 
ATOM   2038 C CE1 A HIS A 1 264 ? -25.616 51.198 61.813 0.50 47.00 ? 264 HIS A CE1 1 
ATOM   2039 C CE1 B HIS A 1 264 ? -22.501 48.146 58.044 0.50 53.82 ? 264 HIS A CE1 1 
ATOM   2040 N NE2 A HIS A 1 264 ? -25.782 50.477 62.907 0.50 46.82 ? 264 HIS A NE2 1 
ATOM   2041 N NE2 B HIS A 1 264 ? -22.817 46.991 58.602 0.50 54.84 ? 264 HIS A NE2 1 
ATOM   2042 N N   . CYS A 1 265 ? -20.933 50.245 63.937 1.00 45.36 ? 265 CYS A N   1 
ATOM   2043 C CA  . CYS A 1 265 ? -20.835 50.821 65.262 1.00 43.88 ? 265 CYS A CA  1 
ATOM   2044 C C   . CYS A 1 265 ? -19.970 52.080 65.240 1.00 41.89 ? 265 CYS A C   1 
ATOM   2045 O O   . CYS A 1 265 ? -20.412 53.155 65.667 1.00 42.36 ? 265 CYS A O   1 
ATOM   2046 C CB  . CYS A 1 265 ? -20.240 49.785 66.221 1.00 44.96 ? 265 CYS A CB  1 
ATOM   2047 S SG  . CYS A 1 265 ? -19.977 50.310 67.950 1.00 44.04 ? 265 CYS A SG  1 
ATOM   2048 N N   . LEU A 1 266 ? -18.744 51.938 64.732 1.00 37.82 ? 266 LEU A N   1 
ATOM   2049 C CA  . LEU A 1 266 ? -17.804 53.040 64.667 1.00 33.81 ? 266 LEU A CA  1 
ATOM   2050 C C   . LEU A 1 266 ? -18.368 54.153 63.826 1.00 35.36 ? 266 LEU A C   1 
ATOM   2051 O O   . LEU A 1 266 ? -17.998 55.315 63.981 1.00 35.40 ? 266 LEU A O   1 
ATOM   2052 C CB  . LEU A 1 266 ? -16.486 52.577 64.068 1.00 28.68 ? 266 LEU A CB  1 
ATOM   2053 C CG  . LEU A 1 266 ? -15.662 51.604 64.895 1.00 24.54 ? 266 LEU A CG  1 
ATOM   2054 C CD1 . LEU A 1 266 ? -14.368 51.310 64.216 1.00 22.50 ? 266 LEU A CD1 1 
ATOM   2055 C CD2 . LEU A 1 266 ? -15.386 52.219 66.221 1.00 24.25 ? 266 LEU A CD2 1 
ATOM   2056 N N   . ARG A 1 267 ? -19.288 53.802 62.941 1.00 37.90 ? 267 ARG A N   1 
ATOM   2057 C CA  . ARG A 1 267 ? -19.871 54.797 62.055 1.00 40.35 ? 267 ARG A CA  1 
ATOM   2058 C C   . ARG A 1 267 ? -20.940 55.653 62.734 1.00 40.34 ? 267 ARG A C   1 
ATOM   2059 O O   . ARG A 1 267 ? -21.254 56.754 62.270 1.00 37.48 ? 267 ARG A O   1 
ATOM   2060 C CB  . ARG A 1 267 ? -20.427 54.110 60.795 1.00 41.73 ? 267 ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 267 ? -20.268 54.944 59.518 1.00 42.49 ? 267 ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 267 ? -19.235 54.356 58.578 1.00 43.77 ? 267 ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 267 ? -19.863 53.665 57.456 1.00 46.46 ? 267 ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 267 ? -19.211 53.071 56.454 1.00 47.67 ? 267 ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 267 ? -17.886 53.050 56.396 1.00 47.87 ? 267 ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 267 ? -19.900 52.484 55.496 1.00 48.94 ? 267 ARG A NH2 1 
ATOM   2067 N N   . GLU A 1 268 ? -21.471 55.151 63.843 1.00 43.03 ? 268 GLU A N   1 
ATOM   2068 C CA  . GLU A 1 268 ? -22.502 55.863 64.590 1.00 47.92 ? 268 GLU A CA  1 
ATOM   2069 C C   . GLU A 1 268 ? -22.027 56.676 65.779 1.00 48.16 ? 268 GLU A C   1 
ATOM   2070 O O   . GLU A 1 268 ? -22.835 57.345 66.423 1.00 49.16 ? 268 GLU A O   1 
ATOM   2071 C CB  . GLU A 1 268 ? -23.554 54.897 65.104 1.00 52.48 ? 268 GLU A CB  1 
ATOM   2072 C CG  . GLU A 1 268 ? -24.644 54.586 64.115 1.00 61.34 ? 268 GLU A CG  1 
ATOM   2073 C CD  . GLU A 1 268 ? -25.622 53.560 64.664 1.00 66.97 ? 268 GLU A CD  1 
ATOM   2074 O OE1 . GLU A 1 268 ? -25.469 53.174 65.854 1.00 69.80 ? 268 GLU A OE1 1 
ATOM   2075 O OE2 . GLU A 1 268 ? -26.538 53.140 63.909 1.00 70.14 ? 268 GLU A OE2 1 
ATOM   2076 N N   . LYS A 1 269 ? -20.735 56.619 66.083 1.00 47.53 ? 269 LYS A N   1 
ATOM   2077 C CA  . LYS A 1 269 ? -20.198 57.357 67.216 1.00 45.90 ? 269 LYS A CA  1 
ATOM   2078 C C   . LYS A 1 269 ? -19.850 58.783 66.844 1.00 45.63 ? 269 LYS A C   1 
ATOM   2079 O O   . LYS A 1 269 ? -19.384 59.047 65.743 1.00 45.63 ? 269 LYS A O   1 
ATOM   2080 C CB  . LYS A 1 269 ? -18.942 56.672 67.727 1.00 46.06 ? 269 LYS A CB  1 
ATOM   2081 C CG  . LYS A 1 269 ? -19.106 55.207 67.998 1.00 47.24 ? 269 LYS A CG  1 
ATOM   2082 C CD  . LYS A 1 269 ? -19.779 54.985 69.313 1.00 50.12 ? 269 LYS A CD  1 
ATOM   2083 C CE  . LYS A 1 269 ? -19.928 53.504 69.578 1.00 53.38 ? 269 LYS A CE  1 
ATOM   2084 N NZ  . LYS A 1 269 ? -20.365 53.228 70.982 1.00 55.53 ? 269 LYS A NZ  1 
ATOM   2085 N N   . LYS A 1 270 ? -20.089 59.708 67.763 1.00 45.89 ? 270 LYS A N   1 
ATOM   2086 C CA  . LYS A 1 270 ? -19.740 61.101 67.530 1.00 46.53 ? 270 LYS A CA  1 
ATOM   2087 C C   . LYS A 1 270 ? -18.232 61.100 67.278 1.00 44.85 ? 270 LYS A C   1 
ATOM   2088 O O   . LYS A 1 270 ? -17.471 60.463 67.991 1.00 45.05 ? 270 LYS A O   1 
ATOM   2089 C CB  . LYS A 1 270 ? -20.049 61.953 68.767 1.00 50.12 ? 270 LYS A CB  1 
ATOM   2090 C CG  . LYS A 1 270 ? -21.519 62.344 68.970 1.00 54.55 ? 270 LYS A CG  1 
ATOM   2091 C CD  . LYS A 1 270 ? -22.009 63.264 67.839 1.00 59.09 ? 270 LYS A CD  1 
ATOM   2092 C CE  . LYS A 1 270 ? -23.176 64.173 68.270 1.00 61.13 ? 270 LYS A CE  1 
ATOM   2093 N NZ  . LYS A 1 270 ? -24.378 63.424 68.743 1.00 63.33 ? 270 LYS A NZ  1 
ATOM   2094 N N   . PRO A 1 271 ? -17.781 61.841 66.280 1.00 43.34 ? 271 PRO A N   1 
ATOM   2095 C CA  . PRO A 1 271 ? -16.356 61.902 65.949 1.00 43.00 ? 271 PRO A CA  1 
ATOM   2096 C C   . PRO A 1 271 ? -15.414 61.979 67.146 1.00 42.59 ? 271 PRO A C   1 
ATOM   2097 O O   . PRO A 1 271 ? -14.466 61.194 67.279 1.00 40.63 ? 271 PRO A O   1 
ATOM   2098 C CB  . PRO A 1 271 ? -16.271 63.148 65.080 1.00 43.54 ? 271 PRO A CB  1 
ATOM   2099 C CG  . PRO A 1 271 ? -17.343 64.010 65.667 1.00 43.82 ? 271 PRO A CG  1 
ATOM   2100 C CD  . PRO A 1 271 ? -18.475 63.044 65.803 1.00 43.19 ? 271 PRO A CD  1 
ATOM   2101 N N   . GLN A 1 272 ? -15.682 62.946 68.013 1.00 42.96 ? 272 GLN A N   1 
ATOM   2102 C CA  . GLN A 1 272 ? -14.864 63.168 69.193 1.00 42.76 ? 272 GLN A CA  1 
ATOM   2103 C C   . GLN A 1 272 ? -14.789 61.963 70.141 1.00 40.30 ? 272 GLN A C   1 
ATOM   2104 O O   . GLN A 1 272 ? -13.875 61.863 70.954 1.00 39.14 ? 272 GLN A O   1 
ATOM   2105 C CB  . GLN A 1 272 ? -15.380 64.410 69.923 1.00 45.14 ? 272 GLN A CB  1 
ATOM   2106 C CG  . GLN A 1 272 ? -14.643 64.760 71.214 1.00 48.86 ? 272 GLN A CG  1 
ATOM   2107 C CD  . GLN A 1 272 ? -13.158 65.018 71.018 1.00 51.69 ? 272 GLN A CD  1 
ATOM   2108 O OE1 . GLN A 1 272 ? -12.741 65.823 70.167 1.00 53.15 ? 272 GLN A OE1 1 
ATOM   2109 N NE2 . GLN A 1 272 ? -12.345 64.340 71.819 1.00 53.51 ? 272 GLN A NE2 1 
ATOM   2110 N N   . GLU A 1 273 ? -15.742 61.047 70.043 1.00 38.24 ? 273 GLU A N   1 
ATOM   2111 C CA  . GLU A 1 273 ? -15.706 59.877 70.900 1.00 37.05 ? 273 GLU A CA  1 
ATOM   2112 C C   . GLU A 1 273 ? -14.597 58.972 70.431 1.00 35.55 ? 273 GLU A C   1 
ATOM   2113 O O   . GLU A 1 273 ? -13.982 58.289 71.235 1.00 36.25 ? 273 GLU A O   1 
ATOM   2114 C CB  . GLU A 1 273 ? -16.994 59.086 70.821 1.00 39.48 ? 273 GLU A CB  1 
ATOM   2115 C CG  . GLU A 1 273 ? -18.242 59.839 71.157 1.00 42.86 ? 273 GLU A CG  1 
ATOM   2116 C CD  . GLU A 1 273 ? -19.418 58.899 71.305 1.00 44.97 ? 273 GLU A CD  1 
ATOM   2117 O OE1 . GLU A 1 273 ? -19.375 58.031 72.212 1.00 46.16 ? 273 GLU A OE1 1 
ATOM   2118 O OE2 . GLU A 1 273 ? -20.376 59.021 70.511 1.00 46.99 ? 273 GLU A OE2 1 
ATOM   2119 N N   . LEU A 1 274 ? -14.377 58.934 69.118 1.00 33.95 ? 274 LEU A N   1 
ATOM   2120 C CA  . LEU A 1 274 ? -13.322 58.104 68.537 1.00 32.03 ? 274 LEU A CA  1 
ATOM   2121 C C   . LEU A 1 274 ? -11.993 58.736 68.933 1.00 30.55 ? 274 LEU A C   1 
ATOM   2122 O O   . LEU A 1 274 ? -11.027 58.060 69.279 1.00 28.71 ? 274 LEU A O   1 
ATOM   2123 C CB  . LEU A 1 274 ? -13.420 58.077 66.997 1.00 32.41 ? 274 LEU A CB  1 
ATOM   2124 C CG  . LEU A 1 274 ? -14.335 57.152 66.168 1.00 31.04 ? 274 LEU A CG  1 
ATOM   2125 C CD1 . LEU A 1 274 ? -14.063 55.711 66.505 1.00 31.17 ? 274 LEU A CD1 1 
ATOM   2126 C CD2 . LEU A 1 274 ? -15.766 57.468 66.432 1.00 32.14 ? 274 LEU A CD2 1 
ATOM   2127 N N   . ILE A 1 275 ? -11.973 60.059 68.879 1.00 29.67 ? 275 ILE A N   1 
ATOM   2128 C CA  . ILE A 1 275 ? -10.790 60.823 69.205 1.00 28.49 ? 275 ILE A CA  1 
ATOM   2129 C C   . ILE A 1 275 ? -10.375 60.658 70.653 1.00 27.36 ? 275 ILE A C   1 
ATOM   2130 O O   . ILE A 1 275 ? -9.198  60.743 70.966 1.00 27.97 ? 275 ILE A O   1 
ATOM   2131 C CB  . ILE A 1 275 ? -11.021 62.312 68.895 1.00 28.82 ? 275 ILE A CB  1 
ATOM   2132 C CG1 . ILE A 1 275 ? -11.545 62.453 67.462 1.00 28.62 ? 275 ILE A CG1 1 
ATOM   2133 C CG2 . ILE A 1 275 ? -9.728  63.093 69.070 1.00 29.49 ? 275 ILE A CG2 1 
ATOM   2134 C CD1 . ILE A 1 275 ? -11.664 63.867 66.978 1.00 28.37 ? 275 ILE A CD1 1 
ATOM   2135 N N   . ASP A 1 276 ? -11.340 60.423 71.532 1.00 26.89 ? 276 ASP A N   1 
ATOM   2136 C CA  . ASP A 1 276 ? -11.056 60.247 72.950 1.00 27.19 ? 276 ASP A CA  1 
ATOM   2137 C C   . ASP A 1 276 ? -10.277 58.972 73.263 1.00 27.06 ? 276 ASP A C   1 
ATOM   2138 O O   . ASP A 1 276 ? -9.376  58.993 74.091 1.00 28.89 ? 276 ASP A O   1 
ATOM   2139 C CB  . ASP A 1 276 ? -12.350 60.255 73.772 1.00 29.45 ? 276 ASP A CB  1 
ATOM   2140 C CG  . ASP A 1 276 ? -12.875 61.666 74.043 1.00 32.25 ? 276 ASP A CG  1 
ATOM   2141 O OD1 . ASP A 1 276 ? -12.092 62.631 73.899 1.00 34.38 ? 276 ASP A OD1 1 
ATOM   2142 O OD2 . ASP A 1 276 ? -14.065 61.811 74.422 1.00 32.17 ? 276 ASP A OD2 1 
ATOM   2143 N N   . VAL A 1 277 ? -10.615 57.863 72.615 1.00 26.25 ? 277 VAL A N   1 
ATOM   2144 C CA  . VAL A 1 277 ? -9.915  56.596 72.853 1.00 26.00 ? 277 VAL A CA  1 
ATOM   2145 C C   . VAL A 1 277 ? -8.788  56.300 71.853 1.00 25.70 ? 277 VAL A C   1 
ATOM   2146 O O   . VAL A 1 277 ? -8.069  55.312 71.977 1.00 24.05 ? 277 VAL A O   1 
ATOM   2147 C CB  . VAL A 1 277 ? -10.901 55.397 72.822 1.00 26.94 ? 277 VAL A CB  1 
ATOM   2148 C CG1 . VAL A 1 277 ? -11.732 55.393 74.076 1.00 27.05 ? 277 VAL A CG1 1 
ATOM   2149 C CG2 . VAL A 1 277 ? -11.801 55.460 71.576 1.00 25.33 ? 277 VAL A CG2 1 
ATOM   2150 N N   . GLU A 1 278 ? -8.644  57.172 70.866 1.00 26.58 ? 278 GLU A N   1 
ATOM   2151 C CA  . GLU A 1 278 ? -7.649  57.028 69.814 1.00 27.25 ? 278 GLU A CA  1 
ATOM   2152 C C   . GLU A 1 278 ? -6.277  56.484 70.192 1.00 27.72 ? 278 GLU A C   1 
ATOM   2153 O O   . GLU A 1 278 ? -5.741  55.637 69.488 1.00 26.19 ? 278 GLU A O   1 
ATOM   2154 C CB  . GLU A 1 278 ? -7.446  58.362 69.121 1.00 27.66 ? 278 GLU A CB  1 
ATOM   2155 C CG  . GLU A 1 278 ? -7.042  58.197 67.695 1.00 30.24 ? 278 GLU A CG  1 
ATOM   2156 C CD  . GLU A 1 278 ? -6.372  59.419 67.153 1.00 31.61 ? 278 GLU A CD  1 
ATOM   2157 O OE1 . GLU A 1 278 ? -5.145  59.533 67.352 1.00 32.95 ? 278 GLU A OE1 1 
ATOM   2158 O OE2 . GLU A 1 278 ? -7.066  60.264 66.543 1.00 31.14 ? 278 GLU A OE2 1 
ATOM   2159 N N   . TRP A 1 279 ? -5.706  56.984 71.286 1.00 29.25 ? 279 TRP A N   1 
ATOM   2160 C CA  . TRP A 1 279 ? -4.380  56.563 71.725 1.00 29.80 ? 279 TRP A CA  1 
ATOM   2161 C C   . TRP A 1 279 ? -4.352  55.293 72.552 1.00 31.83 ? 279 TRP A C   1 
ATOM   2162 O O   . TRP A 1 279 ? -3.281  54.779 72.842 1.00 33.05 ? 279 TRP A O   1 
ATOM   2163 C CB  . TRP A 1 279 ? -3.703  57.658 72.545 1.00 28.67 ? 279 TRP A CB  1 
ATOM   2164 C CG  . TRP A 1 279 ? -3.450  58.940 71.826 1.00 27.93 ? 279 TRP A CG  1 
ATOM   2165 C CD1 . TRP A 1 279 ? -4.288  60.016 71.736 1.00 27.55 ? 279 TRP A CD1 1 
ATOM   2166 C CD2 . TRP A 1 279 ? -2.279  59.282 71.081 1.00 28.23 ? 279 TRP A CD2 1 
ATOM   2167 N NE1 . TRP A 1 279 ? -3.710  61.008 70.982 1.00 26.10 ? 279 TRP A NE1 1 
ATOM   2168 C CE2 . TRP A 1 279 ? -2.478  60.583 70.563 1.00 27.27 ? 279 TRP A CE2 1 
ATOM   2169 C CE3 . TRP A 1 279 ? -1.081  58.615 70.794 1.00 28.08 ? 279 TRP A CE3 1 
ATOM   2170 C CZ2 . TRP A 1 279 ? -1.524  61.228 69.775 1.00 27.71 ? 279 TRP A CZ2 1 
ATOM   2171 C CZ3 . TRP A 1 279 ? -0.132  59.259 70.010 1.00 28.73 ? 279 TRP A CZ3 1 
ATOM   2172 C CH2 . TRP A 1 279 ? -0.360  60.553 69.508 1.00 28.17 ? 279 TRP A CH2 1 
ATOM   2173 N N   . ASN A 1 280 ? -5.509  54.783 72.954 1.00 33.38 ? 280 ASN A N   1 
ATOM   2174 C CA  . ASN A 1 280 ? -5.517  53.560 73.750 1.00 34.35 ? 280 ASN A CA  1 
ATOM   2175 C C   . ASN A 1 280 ? -5.308  52.298 72.946 1.00 33.96 ? 280 ASN A C   1 
ATOM   2176 O O   . ASN A 1 280 ? -5.463  51.210 73.491 1.00 35.67 ? 280 ASN A O   1 
ATOM   2177 C CB  . ASN A 1 280 ? -6.832  53.399 74.499 1.00 35.98 ? 280 ASN A CB  1 
ATOM   2178 C CG  . ASN A 1 280 ? -7.147  54.577 75.354 1.00 38.82 ? 280 ASN A CG  1 
ATOM   2179 O OD1 . ASN A 1 280 ? -6.269  55.393 75.651 1.00 39.85 ? 280 ASN A OD1 1 
ATOM   2180 N ND2 . ASN A 1 280 ? -8.408  54.682 75.774 1.00 40.44 ? 280 ASN A ND2 1 
ATOM   2181 N N   . VAL A 1 281 ? -4.983  52.411 71.663 1.00 32.81 ? 281 VAL A N   1 
ATOM   2182 C CA  . VAL A 1 281 ? -4.808  51.205 70.872 1.00 32.09 ? 281 VAL A CA  1 
ATOM   2183 C C   . VAL A 1 281 ? -3.355  50.851 70.625 1.00 32.84 ? 281 VAL A C   1 
ATOM   2184 O O   . VAL A 1 281 ? -3.061  49.710 70.265 1.00 33.95 ? 281 VAL A O   1 
ATOM   2185 C CB  . VAL A 1 281 ? -5.585  51.262 69.521 1.00 31.20 ? 281 VAL A CB  1 
ATOM   2186 C CG1 . VAL A 1 281 ? -7.079  51.264 69.778 1.00 31.04 ? 281 VAL A CG1 1 
ATOM   2187 C CG2 . VAL A 1 281 ? -5.206  52.483 68.741 1.00 30.85 ? 281 VAL A CG2 1 
ATOM   2188 N N   . LEU A 1 282 ? -2.440  51.799 70.826 1.00 32.79 ? 282 LEU A N   1 
ATOM   2189 C CA  . LEU A 1 282 ? -1.023  51.496 70.638 1.00 32.96 ? 282 LEU A CA  1 
ATOM   2190 C C   . LEU A 1 282 ? -0.755  50.196 71.373 1.00 34.11 ? 282 LEU A C   1 
ATOM   2191 O O   . LEU A 1 282 ? -1.328  49.936 72.423 1.00 35.51 ? 282 LEU A O   1 
ATOM   2192 C CB  . LEU A 1 282 ? -0.139  52.596 71.214 1.00 32.20 ? 282 LEU A CB  1 
ATOM   2193 C CG  . LEU A 1 282 ? 0.349   53.661 70.235 1.00 30.69 ? 282 LEU A CG  1 
ATOM   2194 C CD1 . LEU A 1 282 ? 1.197   53.004 69.164 1.00 32.17 ? 282 LEU A CD1 1 
ATOM   2195 C CD2 . LEU A 1 282 ? -0.820  54.366 69.619 1.00 30.20 ? 282 LEU A CD2 1 
ATOM   2196 N N   . PRO A 1 283 ? 0.128   49.361 70.836 1.00 35.18 ? 283 PRO A N   1 
ATOM   2197 C CA  . PRO A 1 283 ? 0.435   48.079 71.470 1.00 36.83 ? 283 PRO A CA  1 
ATOM   2198 C C   . PRO A 1 283 ? 1.610   48.039 72.457 1.00 38.93 ? 283 PRO A C   1 
ATOM   2199 O O   . PRO A 1 283 ? 1.988   46.963 72.923 1.00 39.41 ? 283 PRO A O   1 
ATOM   2200 C CB  . PRO A 1 283 ? 0.690   47.196 70.272 1.00 36.30 ? 283 PRO A CB  1 
ATOM   2201 C CG  . PRO A 1 283 ? 1.474   48.132 69.378 1.00 35.21 ? 283 PRO A CG  1 
ATOM   2202 C CD  . PRO A 1 283 ? 0.710   49.436 69.485 1.00 35.51 ? 283 PRO A CD  1 
ATOM   2203 N N   . PHE A 1 284 ? 2.181   49.196 72.782 1.00 40.27 ? 284 PHE A N   1 
ATOM   2204 C CA  . PHE A 1 284 ? 3.334   49.250 73.680 1.00 40.62 ? 284 PHE A CA  1 
ATOM   2205 C C   . PHE A 1 284 ? 3.585   50.670 74.128 1.00 39.08 ? 284 PHE A C   1 
ATOM   2206 O O   . PHE A 1 284 ? 3.249   51.607 73.425 1.00 39.05 ? 284 PHE A O   1 
ATOM   2207 C CB  . PHE A 1 284 ? 4.586   48.742 72.954 1.00 43.52 ? 284 PHE A CB  1 
ATOM   2208 C CG  . PHE A 1 284 ? 4.691   49.208 71.515 1.00 47.62 ? 284 PHE A CG  1 
ATOM   2209 C CD1 . PHE A 1 284 ? 4.060   50.393 71.085 1.00 50.04 ? 284 PHE A CD1 1 
ATOM   2210 C CD2 . PHE A 1 284 ? 5.407   48.464 70.582 1.00 48.55 ? 284 PHE A CD2 1 
ATOM   2211 C CE1 . PHE A 1 284 ? 4.136   50.828 69.738 1.00 50.48 ? 284 PHE A CE1 1 
ATOM   2212 C CE2 . PHE A 1 284 ? 5.496   48.883 69.235 1.00 50.82 ? 284 PHE A CE2 1 
ATOM   2213 C CZ  . PHE A 1 284 ? 4.855   50.071 68.813 1.00 51.07 ? 284 PHE A CZ  1 
ATOM   2214 N N   . ASP A 1 285 ? 4.185   50.828 75.297 1.00 38.24 ? 285 ASP A N   1 
ATOM   2215 C CA  . ASP A 1 285 ? 4.494   52.158 75.803 1.00 38.16 ? 285 ASP A CA  1 
ATOM   2216 C C   . ASP A 1 285 ? 5.637   52.669 74.919 1.00 38.02 ? 285 ASP A C   1 
ATOM   2217 O O   . ASP A 1 285 ? 6.677   52.018 74.795 1.00 39.60 ? 285 ASP A O   1 
ATOM   2218 C CB  . ASP A 1 285 ? 4.935   52.063 77.268 1.00 38.48 ? 285 ASP A CB  1 
ATOM   2219 C CG  . ASP A 1 285 ? 4.826   53.384 78.008 1.00 39.87 ? 285 ASP A CG  1 
ATOM   2220 O OD1 . ASP A 1 285 ? 4.455   54.406 77.387 1.00 41.04 ? 285 ASP A OD1 1 
ATOM   2221 O OD2 . ASP A 1 285 ? 5.113   53.396 79.227 1.00 41.34 ? 285 ASP A OD2 1 
ATOM   2222 N N   . SER A 1 286 ? 5.460   53.826 74.298 1.00 36.68 ? 286 SER A N   1 
ATOM   2223 C CA  . SER A 1 286 ? 6.500   54.326 73.420 1.00 35.28 ? 286 SER A CA  1 
ATOM   2224 C C   . SER A 1 286 ? 6.295   55.744 72.939 1.00 34.37 ? 286 SER A C   1 
ATOM   2225 O O   . SER A 1 286 ? 5.182   56.232 72.785 1.00 35.77 ? 286 SER A O   1 
ATOM   2226 C CB  . SER A 1 286 ? 6.601   53.439 72.196 1.00 36.20 ? 286 SER A CB  1 
ATOM   2227 O OG  . SER A 1 286 ? 5.410   53.553 71.437 1.00 36.36 ? 286 SER A OG  1 
ATOM   2228 N N   . ILE A 1 287 ? 7.411   56.376 72.649 1.00 32.28 ? 287 ILE A N   1 
ATOM   2229 C CA  . ILE A 1 287 ? 7.444   57.733 72.184 1.00 29.75 ? 287 ILE A CA  1 
ATOM   2230 C C   . ILE A 1 287 ? 7.655   57.672 70.656 1.00 29.05 ? 287 ILE A C   1 
ATOM   2231 O O   . ILE A 1 287 ? 8.511   56.927 70.174 1.00 28.32 ? 287 ILE A O   1 
ATOM   2232 C CB  . ILE A 1 287 ? 8.607   58.447 72.927 1.00 29.48 ? 287 ILE A CB  1 
ATOM   2233 C CG1 . ILE A 1 287 ? 8.800   59.860 72.421 1.00 31.96 ? 287 ILE A CG1 1 
ATOM   2234 C CG2 . ILE A 1 287 ? 9.901   57.673 72.752 1.00 28.74 ? 287 ILE A CG2 1 
ATOM   2235 C CD1 . ILE A 1 287 ? 10.149  60.447 72.827 1.00 33.43 ? 287 ILE A CD1 1 
ATOM   2236 N N   . PHE A 1 288 ? 6.838   58.418 69.908 1.00 27.76 ? 288 PHE A N   1 
ATOM   2237 C CA  . PHE A 1 288 ? 6.920   58.505 68.443 1.00 25.17 ? 288 PHE A CA  1 
ATOM   2238 C C   . PHE A 1 288 ? 6.293   57.355 67.663 1.00 24.71 ? 288 PHE A C   1 
ATOM   2239 O O   . PHE A 1 288 ? 6.939   56.755 66.810 1.00 25.21 ? 288 PHE A O   1 
ATOM   2240 C CB  . PHE A 1 288 ? 8.371   58.652 67.987 1.00 23.91 ? 288 PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 288 ? 8.561   59.592 66.821 1.00 22.68 ? 288 PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 288 ? 7.651   59.632 65.775 1.00 21.73 ? 288 PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 288 ? 9.684   60.433 66.765 1.00 22.64 ? 288 PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 288 ? 7.856   60.503 64.681 1.00 23.02 ? 288 PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 288 ? 9.897   61.304 65.678 1.00 21.70 ? 288 PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 288 ? 8.984   61.340 64.636 1.00 21.34 ? 288 PHE A CZ  1 
ATOM   2247 N N   . ARG A 1 289 ? 5.042   57.041 67.972 1.00 23.65 ? 289 ARG A N   1 
ATOM   2248 C CA  . ARG A 1 289 ? 4.283   56.013 67.261 1.00 21.26 ? 289 ARG A CA  1 
ATOM   2249 C C   . ARG A 1 289 ? 2.850   56.517 67.324 1.00 21.27 ? 289 ARG A C   1 
ATOM   2250 O O   . ARG A 1 289 ? 2.428   57.056 68.338 1.00 21.77 ? 289 ARG A O   1 
ATOM   2251 C CB  . ARG A 1 289 ? 4.386   54.650 67.933 1.00 18.83 ? 289 ARG A CB  1 
ATOM   2252 C CG  . ARG A 1 289 ? 5.757   54.065 67.898 1.00 17.77 ? 289 ARG A CG  1 
ATOM   2253 C CD  . ARG A 1 289 ? 6.271   53.833 66.508 1.00 16.99 ? 289 ARG A CD  1 
ATOM   2254 N NE  . ARG A 1 289 ? 7.524   53.072 66.523 1.00 18.38 ? 289 ARG A NE  1 
ATOM   2255 C CZ  . ARG A 1 289 ? 8.747   53.603 66.470 1.00 19.38 ? 289 ARG A CZ  1 
ATOM   2256 N NH1 . ARG A 1 289 ? 8.908   54.920 66.388 1.00 19.14 ? 289 ARG A NH1 1 
ATOM   2257 N NH2 . ARG A 1 289 ? 9.818   52.809 66.503 1.00 19.42 ? 289 ARG A NH2 1 
ATOM   2258 N N   . PHE A 1 290 ? 2.107   56.341 66.243 1.00 20.97 ? 290 PHE A N   1 
ATOM   2259 C CA  . PHE A 1 290 ? 0.744   56.821 66.177 1.00 20.84 ? 290 PHE A CA  1 
ATOM   2260 C C   . PHE A 1 290 ? -0.180  55.674 65.847 1.00 20.74 ? 290 PHE A C   1 
ATOM   2261 O O   . PHE A 1 290 ? 0.204   54.754 65.145 1.00 20.08 ? 290 PHE A O   1 
ATOM   2262 C CB  . PHE A 1 290 ? 0.701   57.913 65.121 1.00 22.80 ? 290 PHE A CB  1 
ATOM   2263 C CG  . PHE A 1 290 ? 1.875   58.853 65.211 1.00 23.30 ? 290 PHE A CG  1 
ATOM   2264 C CD1 . PHE A 1 290 ? 2.024   59.695 66.316 1.00 23.71 ? 290 PHE A CD1 1 
ATOM   2265 C CD2 . PHE A 1 290 ? 2.882   58.824 64.251 1.00 22.80 ? 290 PHE A CD2 1 
ATOM   2266 C CE1 . PHE A 1 290 ? 3.163   60.490 66.467 1.00 23.82 ? 290 PHE A CE1 1 
ATOM   2267 C CE2 . PHE A 1 290 ? 4.024   59.613 64.393 1.00 23.40 ? 290 PHE A CE2 1 
ATOM   2268 C CZ  . PHE A 1 290 ? 4.164   60.448 65.507 1.00 23.67 ? 290 PHE A CZ  1 
ATOM   2269 N N   . SER A 1 291 ? -1.402  55.740 66.355 1.00 22.04 ? 291 SER A N   1 
ATOM   2270 C CA  . SER A 1 291 ? -2.393  54.683 66.169 1.00 24.11 ? 291 SER A CA  1 
ATOM   2271 C C   . SER A 1 291 ? -2.875  54.356 64.750 1.00 24.47 ? 291 SER A C   1 
ATOM   2272 O O   . SER A 1 291 ? -2.775  53.210 64.297 1.00 23.57 ? 291 SER A O   1 
ATOM   2273 C CB  . SER A 1 291 ? -3.598  54.979 67.057 1.00 26.16 ? 291 SER A CB  1 
ATOM   2274 O OG  . SER A 1 291 ? -3.241  54.901 68.430 1.00 29.50 ? 291 SER A OG  1 
ATOM   2275 N N   . PHE A 1 292 ? -3.432  55.341 64.056 1.00 25.26 ? 292 PHE A N   1 
ATOM   2276 C CA  . PHE A 1 292 ? -3.897  55.105 62.697 1.00 25.92 ? 292 PHE A CA  1 
ATOM   2277 C C   . PHE A 1 292 ? -2.931  55.718 61.694 1.00 25.69 ? 292 PHE A C   1 
ATOM   2278 O O   . PHE A 1 292 ? -2.675  56.928 61.651 1.00 26.45 ? 292 PHE A O   1 
ATOM   2279 C CB  . PHE A 1 292 ? -5.325  55.586 62.585 1.00 27.13 ? 292 PHE A CB  1 
ATOM   2280 C CG  . PHE A 1 292 ? -6.199  54.925 63.583 1.00 28.97 ? 292 PHE A CG  1 
ATOM   2281 C CD1 . PHE A 1 292 ? -6.674  53.637 63.351 1.00 30.31 ? 292 PHE A CD1 1 
ATOM   2282 C CD2 . PHE A 1 292 ? -6.419  55.506 64.820 1.00 29.52 ? 292 PHE A CD2 1 
ATOM   2283 C CE1 . PHE A 1 292 ? -7.345  52.932 64.337 1.00 30.76 ? 292 PHE A CE1 1 
ATOM   2284 C CE2 . PHE A 1 292 ? -7.090  54.809 65.813 1.00 31.51 ? 292 PHE A CE2 1 
ATOM   2285 C CZ  . PHE A 1 292 ? -7.553  53.516 65.571 1.00 31.51 ? 292 PHE A CZ  1 
ATOM   2286 N N   . VAL A 1 293 ? -2.387  54.830 60.882 1.00 23.42 ? 293 VAL A N   1 
ATOM   2287 C CA  . VAL A 1 293 ? -1.352  55.200 59.975 1.00 21.72 ? 293 VAL A CA  1 
ATOM   2288 C C   . VAL A 1 293 ? -1.507  54.409 58.661 1.00 23.51 ? 293 VAL A C   1 
ATOM   2289 O O   . VAL A 1 293 ? -2.325  53.480 58.596 1.00 25.25 ? 293 VAL A O   1 
ATOM   2290 C CB  . VAL A 1 293 ? -0.063  54.883 60.741 1.00 18.82 ? 293 VAL A CB  1 
ATOM   2291 C CG1 . VAL A 1 293 ? 0.731   53.841 60.023 1.00 19.55 ? 293 VAL A CG1 1 
ATOM   2292 C CG2 . VAL A 1 293 ? 0.688   56.152 61.051 1.00 16.09 ? 293 VAL A CG2 1 
ATOM   2293 N N   . PRO A 1 294 ? -0.767  54.789 57.583 1.00 23.18 ? 294 PRO A N   1 
ATOM   2294 C CA  . PRO A 1 294 ? -0.901  54.040 56.331 1.00 22.63 ? 294 PRO A CA  1 
ATOM   2295 C C   . PRO A 1 294 ? -0.600  52.554 56.521 1.00 24.05 ? 294 PRO A C   1 
ATOM   2296 O O   . PRO A 1 294 ? 0.303   52.166 57.283 1.00 23.76 ? 294 PRO A O   1 
ATOM   2297 C CB  . PRO A 1 294 ? 0.103   54.722 55.413 1.00 20.12 ? 294 PRO A CB  1 
ATOM   2298 C CG  . PRO A 1 294 ? 0.004   56.112 55.830 1.00 20.53 ? 294 PRO A CG  1 
ATOM   2299 C CD  . PRO A 1 294 ? 0.015   56.014 57.344 1.00 21.76 ? 294 PRO A CD  1 
ATOM   2300 N N   . VAL A 1 295 ? -1.375  51.732 55.821 1.00 24.56 ? 295 VAL A N   1 
ATOM   2301 C CA  . VAL A 1 295 ? -1.228  50.289 55.875 1.00 23.69 ? 295 VAL A CA  1 
ATOM   2302 C C   . VAL A 1 295 ? -0.592  49.806 54.560 1.00 23.80 ? 295 VAL A C   1 
ATOM   2303 O O   . VAL A 1 295 ? -0.888  50.360 53.496 1.00 22.11 ? 295 VAL A O   1 
ATOM   2304 C CB  . VAL A 1 295 ? -2.618  49.654 56.096 1.00 22.64 ? 295 VAL A CB  1 
ATOM   2305 C CG1 . VAL A 1 295 ? -3.228  49.196 54.785 1.00 21.16 ? 295 VAL A CG1 1 
ATOM   2306 C CG2 . VAL A 1 295 ? -2.503  48.530 57.073 1.00 24.03 ? 295 VAL A CG2 1 
ATOM   2307 N N   . ILE A 1 296 ? 0.309   48.823 54.622 1.00 24.69 ? 296 ILE A N   1 
ATOM   2308 C CA  . ILE A 1 296 ? 0.920   48.313 53.386 1.00 27.23 ? 296 ILE A CA  1 
ATOM   2309 C C   . ILE A 1 296 ? -0.070  47.269 52.917 1.00 30.88 ? 296 ILE A C   1 
ATOM   2310 O O   . ILE A 1 296 ? 0.026   46.104 53.277 1.00 32.65 ? 296 ILE A O   1 
ATOM   2311 C CB  . ILE A 1 296 ? 2.255   47.643 53.630 1.00 24.15 ? 296 ILE A CB  1 
ATOM   2312 C CG1 . ILE A 1 296 ? 3.097   48.491 54.572 1.00 24.87 ? 296 ILE A CG1 1 
ATOM   2313 C CG2 . ILE A 1 296 ? 2.976   47.481 52.325 1.00 22.19 ? 296 ILE A CG2 1 
ATOM   2314 C CD1 . ILE A 1 296 ? 3.542   49.810 54.001 1.00 25.64 ? 296 ILE A CD1 1 
ATOM   2315 N N   . ASP A 1 297 ? -1.023  47.702 52.101 1.00 34.41 ? 297 ASP A N   1 
ATOM   2316 C CA  . ASP A 1 297 ? -2.119  46.853 51.656 1.00 36.53 ? 297 ASP A CA  1 
ATOM   2317 C C   . ASP A 1 297 ? -1.965  46.013 50.423 1.00 38.40 ? 297 ASP A C   1 
ATOM   2318 O O   . ASP A 1 297 ? -2.586  44.961 50.331 1.00 40.53 ? 297 ASP A O   1 
ATOM   2319 C CB  . ASP A 1 297 ? -3.361  47.706 51.462 1.00 36.57 ? 297 ASP A CB  1 
ATOM   2320 C CG  . ASP A 1 297 ? -3.154  48.766 50.420 1.00 35.48 ? 297 ASP A CG  1 
ATOM   2321 O OD1 . ASP A 1 297 ? -2.013  48.861 49.921 1.00 34.20 ? 297 ASP A OD1 1 
ATOM   2322 O OD2 . ASP A 1 297 ? -4.115  49.497 50.104 1.00 36.13 ? 297 ASP A OD2 1 
ATOM   2323 N N   . GLY A 1 298 ? -1.180  46.466 49.456 1.00 39.11 ? 298 GLY A N   1 
ATOM   2324 C CA  . GLY A 1 298 ? -1.044  45.673 48.250 1.00 38.24 ? 298 GLY A CA  1 
ATOM   2325 C C   . GLY A 1 298 ? -1.798  46.347 47.130 1.00 37.96 ? 298 GLY A C   1 
ATOM   2326 O O   . GLY A 1 298 ? -1.633  45.988 45.972 1.00 39.01 ? 298 GLY A O   1 
ATOM   2327 N N   . GLU A 1 299 ? -2.637  47.319 47.480 1.00 37.00 ? 299 GLU A N   1 
ATOM   2328 C CA  . GLU A 1 299 ? -3.398  48.078 46.491 1.00 35.58 ? 299 GLU A CA  1 
ATOM   2329 C C   . GLU A 1 299 ? -2.679  49.425 46.275 1.00 34.66 ? 299 GLU A C   1 
ATOM   2330 O O   . GLU A 1 299 ? -2.270  49.743 45.162 1.00 36.38 ? 299 GLU A O   1 
ATOM   2331 C CB  . GLU A 1 299 ? -4.835  48.291 46.975 1.00 36.09 ? 299 GLU A CB  1 
ATOM   2332 C CG  . GLU A 1 299 ? -5.752  48.933 45.953 1.00 36.27 ? 299 GLU A CG  1 
ATOM   2333 N N   . PHE A 1 300 ? -2.500  50.207 47.338 1.00 32.69 ? 300 PHE A N   1 
ATOM   2334 C CA  . PHE A 1 300 ? -1.801  51.497 47.240 1.00 30.09 ? 300 PHE A CA  1 
ATOM   2335 C C   . PHE A 1 300 ? -0.305  51.216 47.089 1.00 30.15 ? 300 PHE A C   1 
ATOM   2336 O O   . PHE A 1 300 ? 0.416   51.916 46.377 1.00 30.01 ? 300 PHE A O   1 
ATOM   2337 C CB  . PHE A 1 300 ? -2.029  52.320 48.508 1.00 25.89 ? 300 PHE A CB  1 
ATOM   2338 C CG  . PHE A 1 300 ? -1.703  53.775 48.355 1.00 22.35 ? 300 PHE A CG  1 
ATOM   2339 C CD1 . PHE A 1 300 ? -0.385  54.205 48.300 1.00 21.34 ? 300 PHE A CD1 1 
ATOM   2340 C CD2 . PHE A 1 300 ? -2.716  54.720 48.290 1.00 20.29 ? 300 PHE A CD2 1 
ATOM   2341 C CE1 . PHE A 1 300 ? -0.081  55.557 48.187 1.00 19.42 ? 300 PHE A CE1 1 
ATOM   2342 C CE2 . PHE A 1 300 ? -2.422  56.064 48.177 1.00 19.34 ? 300 PHE A CE2 1 
ATOM   2343 C CZ  . PHE A 1 300 ? -1.096  56.484 48.126 1.00 19.06 ? 300 PHE A CZ  1 
ATOM   2344 N N   . PHE A 1 301 ? 0.146   50.183 47.786 1.00 30.09 ? 301 PHE A N   1 
ATOM   2345 C CA  . PHE A 1 301 ? 1.533   49.769 47.748 1.00 30.47 ? 301 PHE A CA  1 
ATOM   2346 C C   . PHE A 1 301 ? 1.506   48.362 47.192 1.00 31.02 ? 301 PHE A C   1 
ATOM   2347 O O   . PHE A 1 301 ? 0.850   47.491 47.747 1.00 30.53 ? 301 PHE A O   1 
ATOM   2348 C CB  . PHE A 1 301 ? 2.158   49.744 49.164 1.00 29.99 ? 301 PHE A CB  1 
ATOM   2349 C CG  . PHE A 1 301 ? 2.163   51.084 49.864 1.00 28.28 ? 301 PHE A CG  1 
ATOM   2350 C CD1 . PHE A 1 301 ? 3.046   52.080 49.482 1.00 27.53 ? 301 PHE A CD1 1 
ATOM   2351 C CD2 . PHE A 1 301 ? 1.219   51.374 50.849 1.00 27.89 ? 301 PHE A CD2 1 
ATOM   2352 C CE1 . PHE A 1 301 ? 2.981   53.349 50.059 1.00 27.47 ? 301 PHE A CE1 1 
ATOM   2353 C CE2 . PHE A 1 301 ? 1.146   52.634 51.429 1.00 26.56 ? 301 PHE A CE2 1 
ATOM   2354 C CZ  . PHE A 1 301 ? 2.027   53.626 51.032 1.00 26.65 ? 301 PHE A CZ  1 
ATOM   2355 N N   . PRO A 1 302 ? 2.205   48.128 46.076 1.00 31.77 ? 302 PRO A N   1 
ATOM   2356 C CA  . PRO A 1 302 ? 2.279   46.817 45.435 1.00 32.27 ? 302 PRO A CA  1 
ATOM   2357 C C   . PRO A 1 302 ? 2.924   45.848 46.409 1.00 33.74 ? 302 PRO A C   1 
ATOM   2358 O O   . PRO A 1 302 ? 2.354   44.807 46.709 1.00 34.56 ? 302 PRO A O   1 
ATOM   2359 C CB  . PRO A 1 302 ? 3.169   47.068 44.236 1.00 31.44 ? 302 PRO A CB  1 
ATOM   2360 C CG  . PRO A 1 302 ? 2.919   48.491 43.930 1.00 32.49 ? 302 PRO A CG  1 
ATOM   2361 C CD  . PRO A 1 302 ? 2.920   49.130 45.278 1.00 32.70 ? 302 PRO A CD  1 
ATOM   2362 N N   . THR A 1 303 ? 4.114   46.188 46.904 1.00 34.26 ? 303 THR A N   1 
ATOM   2363 C CA  . THR A 1 303 ? 4.785   45.322 47.868 1.00 35.36 ? 303 THR A CA  1 
ATOM   2364 C C   . THR A 1 303 ? 5.280   46.115 49.029 1.00 35.90 ? 303 THR A C   1 
ATOM   2365 O O   . THR A 1 303 ? 4.965   47.287 49.167 1.00 36.83 ? 303 THR A O   1 
ATOM   2366 C CB  . THR A 1 303 ? 6.011   44.671 47.312 1.00 35.32 ? 303 THR A CB  1 
ATOM   2367 O OG1 . THR A 1 303 ? 5.765   44.328 45.958 1.00 38.11 ? 303 THR A OG1 1 
ATOM   2368 C CG2 . THR A 1 303 ? 6.344   43.399 48.104 1.00 36.37 ? 303 THR A CG2 1 
ATOM   2369 N N   . SER A 1 304 ? 6.071   45.452 49.862 1.00 36.45 ? 304 SER A N   1 
ATOM   2370 C CA  . SER A 1 304 ? 6.673   46.085 51.017 1.00 36.55 ? 304 SER A CA  1 
ATOM   2371 C C   . SER A 1 304 ? 7.496   47.243 50.463 1.00 35.58 ? 304 SER A C   1 
ATOM   2372 O O   . SER A 1 304 ? 8.023   47.172 49.344 1.00 35.28 ? 304 SER A O   1 
ATOM   2373 C CB  . SER A 1 304 ? 7.585   45.092 51.732 1.00 37.39 ? 304 SER A CB  1 
ATOM   2374 O OG  . SER A 1 304 ? 8.527   44.543 50.825 1.00 36.48 ? 304 SER A OG  1 
ATOM   2375 N N   . LEU A 1 305 ? 7.597   48.313 51.234 1.00 33.64 ? 305 LEU A N   1 
ATOM   2376 C CA  . LEU A 1 305 ? 8.341   49.442 50.768 1.00 32.39 ? 305 LEU A CA  1 
ATOM   2377 C C   . LEU A 1 305 ? 9.771   49.066 50.505 1.00 34.08 ? 305 LEU A C   1 
ATOM   2378 O O   . LEU A 1 305 ? 10.360  49.555 49.554 1.00 36.45 ? 305 LEU A O   1 
ATOM   2379 C CB  . LEU A 1 305 ? 8.307   50.558 51.784 1.00 30.34 ? 305 LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 305 ? 7.146   51.528 51.820 1.00 28.53 ? 305 LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 305 ? 5.892   50.916 51.259 1.00 28.70 ? 305 LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 305 ? 6.978   51.947 53.270 1.00 28.17 ? 305 LEU A CD2 1 
ATOM   2383 N N   . GLU A 1 306 ? 10.348  48.190 51.316 1.00 35.65 ? 306 GLU A N   1 
ATOM   2384 C CA  . GLU A 1 306 ? 11.754  47.862 51.097 1.00 37.87 ? 306 GLU A CA  1 
ATOM   2385 C C   . GLU A 1 306 ? 12.103  47.321 49.717 1.00 37.96 ? 306 GLU A C   1 
ATOM   2386 O O   . GLU A 1 306 ? 13.138  47.679 49.147 1.00 37.10 ? 306 GLU A O   1 
ATOM   2387 C CB  . GLU A 1 306 ? 12.258  46.921 52.179 1.00 40.52 ? 306 GLU A CB  1 
ATOM   2388 C CG  . GLU A 1 306 ? 13.275  47.602 53.090 1.00 45.05 ? 306 GLU A CG  1 
ATOM   2389 C CD  . GLU A 1 306 ? 14.409  48.277 52.308 1.00 47.41 ? 306 GLU A CD  1 
ATOM   2390 O OE1 . GLU A 1 306 ? 15.176  47.577 51.606 1.00 48.97 ? 306 GLU A OE1 1 
ATOM   2391 O OE2 . GLU A 1 306 ? 14.535  49.515 52.395 1.00 48.60 ? 306 GLU A OE2 1 
ATOM   2392 N N   . SER A 1 307 ? 11.234  46.475 49.176 1.00 39.03 ? 307 SER A N   1 
ATOM   2393 C CA  . SER A 1 307 ? 11.436  45.903 47.847 1.00 39.71 ? 307 SER A CA  1 
ATOM   2394 C C   . SER A 1 307 ? 11.350  47.017 46.822 1.00 39.28 ? 307 SER A C   1 
ATOM   2395 O O   . SER A 1 307 ? 12.247  47.199 45.995 1.00 40.12 ? 307 SER A O   1 
ATOM   2396 C CB  . SER A 1 307 ? 10.348  44.887 47.535 1.00 40.24 ? 307 SER A CB  1 
ATOM   2397 O OG  . SER A 1 307 ? 10.165  44.013 48.628 1.00 42.97 ? 307 SER A OG  1 
ATOM   2398 N N   . MET A 1 308 ? 10.254  47.758 46.872 1.00 37.38 ? 308 MET A N   1 
ATOM   2399 C CA  . MET A 1 308 ? 10.073  48.844 45.936 1.00 36.63 ? 308 MET A CA  1 
ATOM   2400 C C   . MET A 1 308 ? 11.332  49.703 45.889 1.00 36.36 ? 308 MET A C   1 
ATOM   2401 O O   . MET A 1 308 ? 11.894  49.956 44.814 1.00 35.21 ? 308 MET A O   1 
ATOM   2402 C CB  . MET A 1 308 ? 8.842   49.649 46.335 1.00 34.65 ? 308 MET A CB  1 
ATOM   2403 C CG  . MET A 1 308 ? 7.627   48.757 46.377 1.00 34.00 ? 308 MET A CG  1 
ATOM   2404 S SD  . MET A 1 308 ? 6.106   49.644 46.405 1.00 33.79 ? 308 MET A SD  1 
ATOM   2405 C CE  . MET A 1 308 ? 6.209   50.513 44.890 1.00 33.68 ? 308 MET A CE  1 
ATOM   2406 N N   . LEU A 1 309 ? 11.778  50.126 47.064 1.00 36.32 ? 309 LEU A N   1 
ATOM   2407 C CA  . LEU A 1 309 ? 12.976  50.945 47.186 1.00 37.51 ? 309 LEU A CA  1 
ATOM   2408 C C   . LEU A 1 309 ? 14.121  50.199 46.513 1.00 38.46 ? 309 LEU A C   1 
ATOM   2409 O O   . LEU A 1 309 ? 14.915  50.765 45.739 1.00 38.54 ? 309 LEU A O   1 
ATOM   2410 C CB  . LEU A 1 309 ? 13.319  51.155 48.670 1.00 36.85 ? 309 LEU A CB  1 
ATOM   2411 C CG  . LEU A 1 309 ? 12.949  52.417 49.458 1.00 34.79 ? 309 LEU A CG  1 
ATOM   2412 C CD1 . LEU A 1 309 ? 13.827  53.550 49.005 1.00 35.32 ? 309 LEU A CD1 1 
ATOM   2413 C CD2 . LEU A 1 309 ? 11.499  52.764 49.283 1.00 34.32 ? 309 LEU A CD2 1 
ATOM   2414 N N   . ASN A 1 310 ? 14.181  48.909 46.811 1.00 38.68 ? 310 ASN A N   1 
ATOM   2415 C CA  . ASN A 1 310 ? 15.230  48.065 46.292 1.00 39.34 ? 310 ASN A CA  1 
ATOM   2416 C C   . ASN A 1 310 ? 15.318  47.782 44.810 1.00 39.23 ? 310 ASN A C   1 
ATOM   2417 O O   . ASN A 1 310 ? 16.417  47.706 44.284 1.00 39.96 ? 310 ASN A O   1 
ATOM   2418 C CB  . ASN A 1 310 ? 15.236  46.762 47.047 1.00 41.39 ? 310 ASN A CB  1 
ATOM   2419 C CG  . ASN A 1 310 ? 16.414  46.662 47.941 1.00 44.70 ? 310 ASN A CG  1 
ATOM   2420 O OD1 . ASN A 1 310 ? 17.547  46.603 47.465 1.00 47.03 ? 310 ASN A OD1 1 
ATOM   2421 N ND2 . ASN A 1 310 ? 16.178  46.675 49.250 1.00 46.64 ? 310 ASN A ND2 1 
ATOM   2422 N N   . SER A 1 311 ? 14.190  47.624 44.127 1.00 38.39 ? 311 SER A N   1 
ATOM   2423 C CA  . SER A 1 311 ? 14.228  47.343 42.697 1.00 37.17 ? 311 SER A CA  1 
ATOM   2424 C C   . SER A 1 311 ? 14.051  48.570 41.813 1.00 36.53 ? 311 SER A C   1 
ATOM   2425 O O   . SER A 1 311 ? 14.128  48.476 40.601 1.00 36.91 ? 311 SER A O   1 
ATOM   2426 C CB  . SER A 1 311 ? 13.147  46.349 42.340 1.00 37.78 ? 311 SER A CB  1 
ATOM   2427 O OG  . SER A 1 311 ? 11.891  46.964 42.502 1.00 41.58 ? 311 SER A OG  1 
ATOM   2428 N N   . GLY A 1 312 ? 13.803  49.726 42.400 1.00 36.18 ? 312 GLY A N   1 
ATOM   2429 C CA  . GLY A 1 312 ? 13.630  50.896 41.567 1.00 35.12 ? 312 GLY A CA  1 
ATOM   2430 C C   . GLY A 1 312 ? 12.185  50.993 41.137 1.00 34.23 ? 312 GLY A C   1 
ATOM   2431 O O   . GLY A 1 312 ? 11.834  51.658 40.150 1.00 34.15 ? 312 GLY A O   1 
ATOM   2432 N N   . ASN A 1 313 ? 11.331  50.315 41.884 1.00 32.24 ? 313 ASN A N   1 
ATOM   2433 C CA  . ASN A 1 313 ? 9.927   50.357 41.566 1.00 31.51 ? 313 ASN A CA  1 
ATOM   2434 C C   . ASN A 1 313 ? 9.356   51.625 42.160 1.00 30.32 ? 313 ASN A C   1 
ATOM   2435 O O   . ASN A 1 313 ? 8.718   51.597 43.209 1.00 30.98 ? 313 ASN A O   1 
ATOM   2436 C CB  . ASN A 1 313 ? 9.212   49.149 42.147 1.00 32.72 ? 313 ASN A CB  1 
ATOM   2437 C CG  . ASN A 1 313 ? 7.746   49.099 41.761 1.00 33.18 ? 313 ASN A CG  1 
ATOM   2438 O OD1 . ASN A 1 313 ? 7.280   49.855 40.899 1.00 33.31 ? 313 ASN A OD1 1 
ATOM   2439 N ND2 . ASN A 1 313 ? 7.012   48.192 42.390 1.00 33.23 ? 313 ASN A ND2 1 
ATOM   2440 N N   . PHE A 1 314 ? 9.605   52.743 41.493 1.00 28.08 ? 314 PHE A N   1 
ATOM   2441 C CA  . PHE A 1 314 ? 9.103   54.021 41.956 1.00 25.62 ? 314 PHE A CA  1 
ATOM   2442 C C   . PHE A 1 314 ? 9.334   55.067 40.895 1.00 25.51 ? 314 PHE A C   1 
ATOM   2443 O O   . PHE A 1 314 ? 10.089  54.835 39.943 1.00 25.85 ? 314 PHE A O   1 
ATOM   2444 C CB  . PHE A 1 314 ? 9.790   54.433 43.268 1.00 23.46 ? 314 PHE A CB  1 
ATOM   2445 C CG  . PHE A 1 314 ? 11.301  54.472 43.202 1.00 22.30 ? 314 PHE A CG  1 
ATOM   2446 C CD1 . PHE A 1 314 ? 11.971  55.577 42.668 1.00 22.03 ? 314 PHE A CD1 1 
ATOM   2447 C CD2 . PHE A 1 314 ? 12.064  53.418 43.723 1.00 21.50 ? 314 PHE A CD2 1 
ATOM   2448 C CE1 . PHE A 1 314 ? 13.385  55.630 42.661 1.00 21.28 ? 314 PHE A CE1 1 
ATOM   2449 C CE2 . PHE A 1 314 ? 13.478  53.469 43.721 1.00 20.94 ? 314 PHE A CE2 1 
ATOM   2450 C CZ  . PHE A 1 314 ? 14.135  54.579 43.189 1.00 19.80 ? 314 PHE A CZ  1 
ATOM   2451 N N   . LYS A 1 315 ? 8.660   56.205 41.054 1.00 25.03 ? 315 LYS A N   1 
ATOM   2452 C CA  . LYS A 1 315 ? 8.795   57.328 40.134 1.00 23.97 ? 315 LYS A CA  1 
ATOM   2453 C C   . LYS A 1 315 ? 10.221  57.860 40.212 1.00 24.78 ? 315 LYS A C   1 
ATOM   2454 O O   . LYS A 1 315 ? 10.711  58.221 41.294 1.00 24.91 ? 315 LYS A O   1 
ATOM   2455 C CB  . LYS A 1 315 ? 7.822   58.447 40.502 1.00 20.92 ? 315 LYS A CB  1 
ATOM   2456 C CG  . LYS A 1 315 ? 7.954   59.667 39.616 1.00 21.06 ? 315 LYS A CG  1 
ATOM   2457 C CD  . LYS A 1 315 ? 7.125   60.837 40.127 1.00 20.93 ? 315 LYS A CD  1 
ATOM   2458 C CE  . LYS A 1 315 ? 7.035   61.983 39.107 1.00 18.90 ? 315 LYS A CE  1 
ATOM   2459 N NZ  . LYS A 1 315 ? 6.019   61.758 38.043 1.00 16.45 ? 315 LYS A NZ  1 
ATOM   2460 N N   . LYS A 1 316 ? 10.905  57.884 39.075 1.00 25.22 ? 316 LYS A N   1 
ATOM   2461 C CA  . LYS A 1 316 ? 12.255  58.407 39.089 1.00 26.53 ? 316 LYS A CA  1 
ATOM   2462 C C   . LYS A 1 316 ? 12.257  59.801 38.479 1.00 26.07 ? 316 LYS A C   1 
ATOM   2463 O O   . LYS A 1 316 ? 12.165  59.976 37.278 1.00 26.09 ? 316 LYS A O   1 
ATOM   2464 C CB  . LYS A 1 316 ? 13.218  57.472 38.358 1.00 27.05 ? 316 LYS A CB  1 
ATOM   2465 C CG  . LYS A 1 316 ? 12.547  56.443 37.494 1.00 29.92 ? 316 LYS A CG  1 
ATOM   2466 C CD  . LYS A 1 316 ? 12.767  55.026 38.008 1.00 32.85 ? 316 LYS A CD  1 
ATOM   2467 C CE  . LYS A 1 316 ? 12.337  54.035 36.920 1.00 36.13 ? 316 LYS A CE  1 
ATOM   2468 N NZ  . LYS A 1 316 ? 12.159  52.633 37.387 1.00 38.77 ? 316 LYS A NZ  1 
ATOM   2469 N N   . THR A 1 317 ? 12.315  60.792 39.355 1.00 25.86 ? 317 THR A N   1 
ATOM   2470 C CA  . THR A 1 317 ? 12.343  62.202 38.992 1.00 24.36 ? 317 THR A CA  1 
ATOM   2471 C C   . THR A 1 317 ? 13.482  62.755 39.866 1.00 25.76 ? 317 THR A C   1 
ATOM   2472 O O   . THR A 1 317 ? 14.384  61.996 40.246 1.00 26.55 ? 317 THR A O   1 
ATOM   2473 C CB  . THR A 1 317 ? 10.992  62.857 39.343 1.00 21.68 ? 317 THR A CB  1 
ATOM   2474 O OG1 . THR A 1 317 ? 11.151  64.276 39.444 1.00 19.44 ? 317 THR A OG1 1 
ATOM   2475 C CG2 . THR A 1 317 ? 10.450  62.279 40.637 1.00 16.55 ? 317 THR A CG2 1 
ATOM   2476 N N   . GLN A 1 318 ? 13.491  64.047 40.168 1.00 24.85 ? 318 GLN A N   1 
ATOM   2477 C CA  . GLN A 1 318 ? 14.535  64.544 41.043 1.00 24.96 ? 318 GLN A CA  1 
ATOM   2478 C C   . GLN A 1 318 ? 13.861  65.041 42.319 1.00 25.05 ? 318 GLN A C   1 
ATOM   2479 O O   . GLN A 1 318 ? 12.744  65.555 42.296 1.00 26.33 ? 318 GLN A O   1 
ATOM   2480 C CB  . GLN A 1 318 ? 15.370  65.637 40.368 1.00 26.91 ? 318 GLN A CB  1 
ATOM   2481 C CG  . GLN A 1 318 ? 14.598  66.833 39.864 1.00 30.17 ? 318 GLN A CG  1 
ATOM   2482 C CD  . GLN A 1 318 ? 14.029  66.648 38.470 1.00 31.40 ? 318 GLN A CD  1 
ATOM   2483 O OE1 . GLN A 1 318 ? 13.111  67.362 38.077 1.00 33.48 ? 318 GLN A OE1 1 
ATOM   2484 N NE2 . GLN A 1 318 ? 14.581  65.711 37.712 1.00 31.10 ? 318 GLN A NE2 1 
ATOM   2485 N N   . ILE A 1 319 ? 14.538  64.864 43.442 1.00 24.46 ? 319 ILE A N   1 
ATOM   2486 C CA  . ILE A 1 319 ? 13.995  65.233 44.738 1.00 22.68 ? 319 ILE A CA  1 
ATOM   2487 C C   . ILE A 1 319 ? 14.963  66.056 45.571 1.00 23.13 ? 319 ILE A C   1 
ATOM   2488 O O   . ILE A 1 319 ? 16.187  65.965 45.434 1.00 21.54 ? 319 ILE A O   1 
ATOM   2489 C CB  . ILE A 1 319 ? 13.683  63.978 45.585 1.00 21.84 ? 319 ILE A CB  1 
ATOM   2490 C CG1 . ILE A 1 319 ? 14.953  63.138 45.680 1.00 20.04 ? 319 ILE A CG1 1 
ATOM   2491 C CG2 . ILE A 1 319 ? 12.536  63.178 44.995 1.00 20.77 ? 319 ILE A CG2 1 
ATOM   2492 C CD1 . ILE A 1 319 ? 14.842  61.997 46.585 1.00 21.65 ? 319 ILE A CD1 1 
ATOM   2493 N N   . LEU A 1 320 ? 14.382  66.827 46.478 1.00 24.06 ? 320 LEU A N   1 
ATOM   2494 C CA  . LEU A 1 320 ? 15.139  67.658 47.391 1.00 24.19 ? 320 LEU A CA  1 
ATOM   2495 C C   . LEU A 1 320 ? 14.536  67.368 48.753 1.00 25.15 ? 320 LEU A C   1 
ATOM   2496 O O   . LEU A 1 320 ? 13.342  67.581 48.967 1.00 26.18 ? 320 LEU A O   1 
ATOM   2497 C CB  . LEU A 1 320 ? 14.968  69.123 47.009 1.00 22.28 ? 320 LEU A CB  1 
ATOM   2498 C CG  . LEU A 1 320 ? 15.629  70.176 47.863 1.00 19.96 ? 320 LEU A CG  1 
ATOM   2499 C CD1 . LEU A 1 320 ? 15.758  71.445 47.093 1.00 20.33 ? 320 LEU A CD1 1 
ATOM   2500 C CD2 . LEU A 1 320 ? 14.786  70.395 49.070 1.00 21.37 ? 320 LEU A CD2 1 
ATOM   2501 N N   . LEU A 1 321 ? 15.357  66.842 49.657 1.00 25.75 ? 321 LEU A N   1 
ATOM   2502 C CA  . LEU A 1 321 ? 14.908  66.512 51.003 1.00 26.91 ? 321 LEU A CA  1 
ATOM   2503 C C   . LEU A 1 321 ? 15.910  66.956 52.079 1.00 28.69 ? 321 LEU A C   1 
ATOM   2504 O O   . LEU A 1 321 ? 17.068  67.284 51.786 1.00 29.70 ? 321 LEU A O   1 
ATOM   2505 C CB  . LEU A 1 321 ? 14.615  65.008 51.115 1.00 24.00 ? 321 LEU A CB  1 
ATOM   2506 C CG  . LEU A 1 321 ? 15.710  63.960 50.964 1.00 22.35 ? 321 LEU A CG  1 
ATOM   2507 C CD1 . LEU A 1 321 ? 15.043  62.620 50.668 1.00 22.10 ? 321 LEU A CD1 1 
ATOM   2508 C CD2 . LEU A 1 321 ? 16.654  64.321 49.832 1.00 21.43 ? 321 LEU A CD2 1 
ATOM   2509 N N   . GLY A 1 322 ? 15.453  66.982 53.325 1.00 28.64 ? 322 GLY A N   1 
ATOM   2510 C CA  . GLY A 1 322 ? 16.326  67.417 54.387 1.00 28.35 ? 322 GLY A CA  1 
ATOM   2511 C C   . GLY A 1 322 ? 15.899  66.965 55.760 1.00 28.31 ? 322 GLY A C   1 
ATOM   2512 O O   . GLY A 1 322 ? 14.868  66.324 55.926 1.00 29.70 ? 322 GLY A O   1 
ATOM   2513 N N   . VAL A 1 323 ? 16.689  67.359 56.749 1.00 27.02 ? 323 VAL A N   1 
ATOM   2514 C CA  . VAL A 1 323 ? 16.484  66.959 58.117 1.00 25.41 ? 323 VAL A CA  1 
ATOM   2515 C C   . VAL A 1 323 ? 16.924  68.145 59.010 1.00 26.41 ? 323 VAL A C   1 
ATOM   2516 O O   . VAL A 1 323 ? 17.731  68.983 58.585 1.00 25.73 ? 323 VAL A O   1 
ATOM   2517 C CB  . VAL A 1 323 ? 17.342  65.655 58.318 1.00 24.65 ? 323 VAL A CB  1 
ATOM   2518 C CG1 . VAL A 1 323 ? 18.476  65.887 59.294 1.00 25.09 ? 323 VAL A CG1 1 
ATOM   2519 C CG2 . VAL A 1 323 ? 16.461  64.483 58.696 1.00 23.21 ? 323 VAL A CG2 1 
ATOM   2520 N N   . ASN A 1 324 ? 16.370  68.233 60.223 1.00 26.99 ? 324 ASN A N   1 
ATOM   2521 C CA  . ASN A 1 324 ? 16.717  69.304 61.173 1.00 27.93 ? 324 ASN A CA  1 
ATOM   2522 C C   . ASN A 1 324 ? 17.678  68.850 62.254 1.00 29.57 ? 324 ASN A C   1 
ATOM   2523 O O   . ASN A 1 324 ? 17.688  67.682 62.639 1.00 31.23 ? 324 ASN A O   1 
ATOM   2524 C CB  . ASN A 1 324 ? 15.473  69.859 61.836 1.00 25.85 ? 324 ASN A CB  1 
ATOM   2525 C CG  . ASN A 1 324 ? 14.729  70.788 60.942 1.00 25.94 ? 324 ASN A CG  1 
ATOM   2526 O OD1 . ASN A 1 324 ? 14.955  70.817 59.728 1.00 24.97 ? 324 ASN A OD1 1 
ATOM   2527 N ND2 . ASN A 1 324 ? 13.823  71.553 61.520 1.00 25.42 ? 324 ASN A ND2 1 
ATOM   2528 N N   . LYS A 1 325 ? 18.458  69.785 62.779 1.00 30.74 ? 325 LYS A N   1 
ATOM   2529 C CA  . LYS A 1 325 ? 19.458  69.447 63.780 1.00 32.54 ? 325 LYS A CA  1 
ATOM   2530 C C   . LYS A 1 325 ? 18.979  68.670 65.013 1.00 32.91 ? 325 LYS A C   1 
ATOM   2531 O O   . LYS A 1 325 ? 19.604  67.683 65.383 1.00 33.65 ? 325 LYS A O   1 
ATOM   2532 C CB  . LYS A 1 325 ? 20.201  70.712 64.203 1.00 34.20 ? 325 LYS A CB  1 
ATOM   2533 C CG  . LYS A 1 325 ? 21.537  70.430 64.851 1.00 35.50 ? 325 LYS A CG  1 
ATOM   2534 C CD  . LYS A 1 325 ? 21.484  70.660 66.340 1.00 37.32 ? 325 LYS A CD  1 
ATOM   2535 C CE  . LYS A 1 325 ? 22.331  71.854 66.714 1.00 38.66 ? 325 LYS A CE  1 
ATOM   2536 N NZ  . LYS A 1 325 ? 23.743  71.622 66.317 1.00 41.96 ? 325 LYS A NZ  1 
ATOM   2537 N N   . ASP A 1 326 ? 17.892  69.100 65.650 1.00 32.45 ? 326 ASP A N   1 
ATOM   2538 C CA  . ASP A 1 326 ? 17.381  68.399 66.830 1.00 32.41 ? 326 ASP A CA  1 
ATOM   2539 C C   . ASP A 1 326 ? 15.984  67.852 66.603 1.00 32.44 ? 326 ASP A C   1 
ATOM   2540 O O   . ASP A 1 326 ? 14.977  68.440 67.019 1.00 33.17 ? 326 ASP A O   1 
ATOM   2541 C CB  . ASP A 1 326 ? 17.349  69.336 68.015 1.00 33.43 ? 326 ASP A CB  1 
ATOM   2542 C CG  . ASP A 1 326 ? 18.695  69.834 68.371 1.00 34.50 ? 326 ASP A CG  1 
ATOM   2543 O OD1 . ASP A 1 326 ? 19.560  68.982 68.683 1.00 36.51 ? 326 ASP A OD1 1 
ATOM   2544 O OD2 . ASP A 1 326 ? 18.883  71.068 68.332 1.00 33.55 ? 326 ASP A OD2 1 
ATOM   2545 N N   . GLU A 1 327 ? 15.913  66.704 65.962 1.00 31.81 ? 327 GLU A N   1 
ATOM   2546 C CA  . GLU A 1 327 ? 14.617  66.144 65.668 1.00 31.27 ? 327 GLU A CA  1 
ATOM   2547 C C   . GLU A 1 327 ? 13.906  65.585 66.896 1.00 30.83 ? 327 GLU A C   1 
ATOM   2548 O O   . GLU A 1 327 ? 12.798  66.032 67.216 1.00 31.17 ? 327 GLU A O   1 
ATOM   2549 C CB  . GLU A 1 327 ? 14.753  65.093 64.553 1.00 31.15 ? 327 GLU A CB  1 
ATOM   2550 C CG  . GLU A 1 327 ? 15.242  65.667 63.203 1.00 29.69 ? 327 GLU A CG  1 
ATOM   2551 C CD  . GLU A 1 327 ? 14.123  66.238 62.334 1.00 29.95 ? 327 GLU A CD  1 
ATOM   2552 O OE1 . GLU A 1 327 ? 13.125  66.740 62.876 1.00 30.98 ? 327 GLU A OE1 1 
ATOM   2553 O OE2 . GLU A 1 327 ? 14.239  66.208 61.096 1.00 29.84 ? 327 GLU A OE2 1 
ATOM   2554 N N   . GLY A 1 328 ? 14.548  64.649 67.592 1.00 30.05 ? 328 GLY A N   1 
ATOM   2555 C CA  . GLY A 1 328 ? 13.946  64.026 68.775 1.00 30.62 ? 328 GLY A CA  1 
ATOM   2556 C C   . GLY A 1 328 ? 13.485  64.902 69.947 1.00 30.08 ? 328 GLY A C   1 
ATOM   2557 O O   . GLY A 1 328 ? 12.610  64.518 70.741 1.00 29.81 ? 328 GLY A O   1 
ATOM   2558 N N   . SER A 1 329 ? 14.098  66.075 70.055 1.00 28.66 ? 329 SER A N   1 
ATOM   2559 C CA  . SER A 1 329 ? 13.801  67.068 71.071 1.00 26.39 ? 329 SER A CA  1 
ATOM   2560 C C   . SER A 1 329 ? 12.308  67.183 71.438 1.00 25.02 ? 329 SER A C   1 
ATOM   2561 O O   . SER A 1 329 ? 11.897  66.943 72.565 1.00 24.74 ? 329 SER A O   1 
ATOM   2562 C CB  . SER A 1 329 ? 14.318  68.410 70.553 1.00 26.56 ? 329 SER A CB  1 
ATOM   2563 O OG  . SER A 1 329 ? 13.979  69.470 71.408 1.00 29.79 ? 329 SER A OG  1 
ATOM   2564 N N   . PHE A 1 330 ? 11.495  67.550 70.467 1.00 24.33 ? 330 PHE A N   1 
ATOM   2565 C CA  . PHE A 1 330 ? 10.066  67.739 70.690 1.00 22.61 ? 330 PHE A CA  1 
ATOM   2566 C C   . PHE A 1 330 ? 9.294   66.567 71.275 1.00 20.92 ? 330 PHE A C   1 
ATOM   2567 O O   . PHE A 1 330 ? 8.386   66.762 72.078 1.00 19.55 ? 330 PHE A O   1 
ATOM   2568 C CB  . PHE A 1 330 ? 9.417   68.162 69.369 1.00 23.06 ? 330 PHE A CB  1 
ATOM   2569 C CG  . PHE A 1 330 ? 7.993   68.577 69.501 1.00 22.60 ? 330 PHE A CG  1 
ATOM   2570 C CD1 . PHE A 1 330 ? 7.672   69.894 69.799 1.00 21.06 ? 330 PHE A CD1 1 
ATOM   2571 C CD2 . PHE A 1 330 ? 6.966   67.656 69.319 1.00 25.42 ? 330 PHE A CD2 1 
ATOM   2572 C CE1 . PHE A 1 330 ? 6.350   70.302 69.915 1.00 21.59 ? 330 PHE A CE1 1 
ATOM   2573 C CE2 . PHE A 1 330 ? 5.624   68.054 69.434 1.00 26.13 ? 330 PHE A CE2 1 
ATOM   2574 C CZ  . PHE A 1 330 ? 5.321   69.386 69.734 1.00 24.01 ? 330 PHE A CZ  1 
ATOM   2575 N N   . PHE A 1 331 ? 9.650   65.354 70.866 1.00 20.25 ? 331 PHE A N   1 
ATOM   2576 C CA  . PHE A 1 331 ? 8.948   64.151 71.313 1.00 19.17 ? 331 PHE A CA  1 
ATOM   2577 C C   . PHE A 1 331 ? 9.261   63.756 72.733 1.00 18.46 ? 331 PHE A C   1 
ATOM   2578 O O   . PHE A 1 331 ? 8.374   63.318 73.466 1.00 18.26 ? 331 PHE A O   1 
ATOM   2579 C CB  . PHE A 1 331 ? 9.226   63.009 70.337 1.00 19.05 ? 331 PHE A CB  1 
ATOM   2580 C CG  . PHE A 1 331 ? 8.849   63.350 68.918 1.00 20.20 ? 331 PHE A CG  1 
ATOM   2581 C CD1 . PHE A 1 331 ? 9.718   64.074 68.106 1.00 19.59 ? 331 PHE A CD1 1 
ATOM   2582 C CD2 . PHE A 1 331 ? 7.579   63.050 68.430 1.00 21.38 ? 331 PHE A CD2 1 
ATOM   2583 C CE1 . PHE A 1 331 ? 9.331   64.493 66.852 1.00 18.86 ? 331 PHE A CE1 1 
ATOM   2584 C CE2 . PHE A 1 331 ? 7.174   63.473 67.158 1.00 19.67 ? 331 PHE A CE2 1 
ATOM   2585 C CZ  . PHE A 1 331 ? 8.049   64.192 66.375 1.00 19.49 ? 331 PHE A CZ  1 
ATOM   2586 N N   . LEU A 1 332 ? 10.520  63.930 73.123 1.00 17.68 ? 332 LEU A N   1 
ATOM   2587 C CA  . LEU A 1 332 ? 10.956  63.632 74.481 1.00 16.81 ? 332 LEU A CA  1 
ATOM   2588 C C   . LEU A 1 332 ? 10.172  64.542 75.413 1.00 17.67 ? 332 LEU A C   1 
ATOM   2589 O O   . LEU A 1 332 ? 9.498   64.086 76.329 1.00 18.79 ? 332 LEU A O   1 
ATOM   2590 C CB  . LEU A 1 332 ? 12.455  63.895 74.619 1.00 14.71 ? 332 LEU A CB  1 
ATOM   2591 C CG  . LEU A 1 332 ? 13.328  62.914 73.823 1.00 14.37 ? 332 LEU A CG  1 
ATOM   2592 C CD1 . LEU A 1 332 ? 14.732  63.456 73.686 1.00 12.63 ? 332 LEU A CD1 1 
ATOM   2593 C CD2 . LEU A 1 332 ? 13.320  61.540 74.502 1.00 12.06 ? 332 LEU A CD2 1 
ATOM   2594 N N   . LEU A 1 333 ? 10.249  65.840 75.162 1.00 18.08 ? 333 LEU A N   1 
ATOM   2595 C CA  . LEU A 1 333 ? 9.529   66.806 75.974 1.00 18.11 ? 333 LEU A CA  1 
ATOM   2596 C C   . LEU A 1 333 ? 8.095   66.339 76.239 1.00 17.86 ? 333 LEU A C   1 
ATOM   2597 O O   . LEU A 1 333 ? 7.657   66.322 77.378 1.00 18.05 ? 333 LEU A O   1 
ATOM   2598 C CB  . LEU A 1 333 ? 9.536   68.170 75.267 1.00 18.78 ? 333 LEU A CB  1 
ATOM   2599 C CG  . LEU A 1 333 ? 8.919   69.428 75.897 1.00 19.30 ? 333 LEU A CG  1 
ATOM   2600 C CD1 . LEU A 1 333 ? 7.404   69.440 75.758 1.00 18.90 ? 333 LEU A CD1 1 
ATOM   2601 C CD2 . LEU A 1 333 ? 9.337   69.508 77.342 1.00 19.92 ? 333 LEU A CD2 1 
ATOM   2602 N N   . TYR A 1 334 ? 7.384   65.933 75.190 1.00 18.65 ? 334 TYR A N   1 
ATOM   2603 C CA  . TYR A 1 334 ? 5.994   65.486 75.308 1.00 18.75 ? 334 TYR A CA  1 
ATOM   2604 C C   . TYR A 1 334 ? 5.779   64.101 75.852 1.00 19.67 ? 334 TYR A C   1 
ATOM   2605 O O   . TYR A 1 334 ? 4.706   63.817 76.367 1.00 19.61 ? 334 TYR A O   1 
ATOM   2606 C CB  . TYR A 1 334 ? 5.274   65.537 73.962 1.00 17.42 ? 334 TYR A CB  1 
ATOM   2607 C CG  . TYR A 1 334 ? 4.652   66.869 73.632 1.00 18.52 ? 334 TYR A CG  1 
ATOM   2608 C CD1 . TYR A 1 334 ? 5.450   67.990 73.424 1.00 18.76 ? 334 TYR A CD1 1 
ATOM   2609 C CD2 . TYR A 1 334 ? 3.259   67.022 73.573 1.00 18.81 ? 334 TYR A CD2 1 
ATOM   2610 C CE1 . TYR A 1 334 ? 4.891   69.236 73.178 1.00 19.73 ? 334 TYR A CE1 1 
ATOM   2611 C CE2 . TYR A 1 334 ? 2.672   68.274 73.320 1.00 19.29 ? 334 TYR A CE2 1 
ATOM   2612 C CZ  . TYR A 1 334 ? 3.502   69.384 73.130 1.00 21.04 ? 334 TYR A CZ  1 
ATOM   2613 O OH  . TYR A 1 334 ? 2.976   70.657 72.945 1.00 21.35 ? 334 TYR A OH  1 
ATOM   2614 N N   . GLY A 1 335 ? 6.773   63.230 75.749 1.00 21.07 ? 335 GLY A N   1 
ATOM   2615 C CA  . GLY A 1 335 ? 6.542   61.879 76.218 1.00 24.08 ? 335 GLY A CA  1 
ATOM   2616 C C   . GLY A 1 335 ? 7.512   61.195 77.149 1.00 26.09 ? 335 GLY A C   1 
ATOM   2617 O O   . GLY A 1 335 ? 7.148   60.225 77.807 1.00 27.86 ? 335 GLY A O   1 
ATOM   2618 N N   . ALA A 1 336 ? 8.749   61.657 77.211 1.00 27.55 ? 336 ALA A N   1 
ATOM   2619 C CA  . ALA A 1 336 ? 9.708   61.023 78.101 1.00 27.24 ? 336 ALA A CA  1 
ATOM   2620 C C   . ALA A 1 336 ? 9.619   61.656 79.476 1.00 27.81 ? 336 ALA A C   1 
ATOM   2621 O O   . ALA A 1 336 ? 9.244   62.832 79.622 1.00 27.70 ? 336 ALA A O   1 
ATOM   2622 C CB  . ALA A 1 336 ? 11.123  61.168 77.559 1.00 27.10 ? 336 ALA A CB  1 
ATOM   2623 N N   . PRO A 1 337 ? 9.943   60.868 80.509 1.00 28.01 ? 337 PRO A N   1 
ATOM   2624 C CA  . PRO A 1 337 ? 9.933   61.285 81.913 1.00 27.05 ? 337 PRO A CA  1 
ATOM   2625 C C   . PRO A 1 337 ? 11.219  62.057 82.219 1.00 26.93 ? 337 PRO A C   1 
ATOM   2626 O O   . PRO A 1 337 ? 12.323  61.592 81.932 1.00 27.71 ? 337 PRO A O   1 
ATOM   2627 C CB  . PRO A 1 337 ? 9.872   59.957 82.647 1.00 26.73 ? 337 PRO A CB  1 
ATOM   2628 C CG  . PRO A 1 337 ? 10.735  59.079 81.771 1.00 27.75 ? 337 PRO A CG  1 
ATOM   2629 C CD  . PRO A 1 337 ? 10.216  59.421 80.393 1.00 27.95 ? 337 PRO A CD  1 
ATOM   2630 N N   . GLY A 1 338 ? 11.089  63.244 82.782 1.00 26.09 ? 338 GLY A N   1 
ATOM   2631 C CA  . GLY A 1 338 ? 12.287  63.989 83.088 1.00 26.96 ? 338 GLY A CA  1 
ATOM   2632 C C   . GLY A 1 338 ? 12.437  65.246 82.266 1.00 27.75 ? 338 GLY A C   1 
ATOM   2633 O O   . GLY A 1 338 ? 13.197  66.144 82.631 1.00 29.66 ? 338 GLY A O   1 
ATOM   2634 N N   . PHE A 1 339 ? 11.724  65.316 81.150 1.00 27.41 ? 339 PHE A N   1 
ATOM   2635 C CA  . PHE A 1 339 ? 11.777  66.497 80.302 1.00 25.95 ? 339 PHE A CA  1 
ATOM   2636 C C   . PHE A 1 339 ? 10.670  67.463 80.709 1.00 26.16 ? 339 PHE A C   1 
ATOM   2637 O O   . PHE A 1 339 ? 9.532   67.065 80.931 1.00 27.63 ? 339 PHE A O   1 
ATOM   2638 C CB  . PHE A 1 339 ? 11.632  66.099 78.839 1.00 24.38 ? 339 PHE A CB  1 
ATOM   2639 C CG  . PHE A 1 339 ? 12.790  65.301 78.320 1.00 22.83 ? 339 PHE A CG  1 
ATOM   2640 C CD1 . PHE A 1 339 ? 12.852  63.933 78.523 1.00 22.07 ? 339 PHE A CD1 1 
ATOM   2641 C CD2 . PHE A 1 339 ? 13.830  65.928 77.640 1.00 22.18 ? 339 PHE A CD2 1 
ATOM   2642 C CE1 . PHE A 1 339 ? 13.930  63.196 78.056 1.00 22.76 ? 339 PHE A CE1 1 
ATOM   2643 C CE2 . PHE A 1 339 ? 14.913  65.209 77.169 1.00 21.89 ? 339 PHE A CE2 1 
ATOM   2644 C CZ  . PHE A 1 339 ? 14.970  63.834 77.374 1.00 22.40 ? 339 PHE A CZ  1 
ATOM   2645 N N   . SER A 1 340 ? 11.010  68.734 80.827 1.00 25.85 ? 340 SER A N   1 
ATOM   2646 C CA  . SER A 1 340 ? 10.029  69.721 81.226 1.00 26.65 ? 340 SER A CA  1 
ATOM   2647 C C   . SER A 1 340 ? 10.268  70.939 80.386 1.00 26.22 ? 340 SER A C   1 
ATOM   2648 O O   . SER A 1 340 ? 11.404  71.224 80.015 1.00 24.94 ? 340 SER A O   1 
ATOM   2649 C CB  . SER A 1 340 ? 10.214  70.085 82.692 1.00 28.53 ? 340 SER A CB  1 
ATOM   2650 O OG  . SER A 1 340 ? 10.581  68.940 83.436 1.00 32.34 ? 340 SER A OG  1 
ATOM   2651 N N   . LYS A 1 341 ? 9.205   71.672 80.094 1.00 26.80 ? 341 LYS A N   1 
ATOM   2652 C CA  . LYS A 1 341 ? 9.360   72.848 79.274 1.00 27.76 ? 341 LYS A CA  1 
ATOM   2653 C C   . LYS A 1 341 ? 10.043  73.986 79.991 1.00 28.32 ? 341 LYS A C   1 
ATOM   2654 O O   . LYS A 1 341 ? 10.965  74.580 79.452 1.00 29.10 ? 341 LYS A O   1 
ATOM   2655 C CB  . LYS A 1 341 ? 8.017   73.325 78.746 1.00 27.46 ? 341 LYS A CB  1 
ATOM   2656 C CG  . LYS A 1 341 ? 8.122   74.686 78.078 1.00 27.53 ? 341 LYS A CG  1 
ATOM   2657 C CD  . LYS A 1 341 ? 6.802   75.107 77.489 1.00 27.05 ? 341 LYS A CD  1 
ATOM   2658 C CE  . LYS A 1 341 ? 6.559   76.562 77.756 1.00 26.70 ? 341 LYS A CE  1 
ATOM   2659 N NZ  . LYS A 1 341 ? 6.442   76.807 79.216 1.00 25.61 ? 341 LYS A NZ  1 
ATOM   2660 N N   . ASP A 1 342 ? 9.600   74.287 81.205 1.00 28.92 ? 342 ASP A N   1 
ATOM   2661 C CA  . ASP A 1 342 ? 10.180  75.386 81.954 1.00 30.00 ? 342 ASP A CA  1 
ATOM   2662 C C   . ASP A 1 342 ? 11.451  75.005 82.699 1.00 30.89 ? 342 ASP A C   1 
ATOM   2663 O O   . ASP A 1 342 ? 11.927  75.752 83.555 1.00 30.74 ? 342 ASP A O   1 
ATOM   2664 C CB  . ASP A 1 342 ? 9.129   75.959 82.907 1.00 30.69 ? 342 ASP A CB  1 
ATOM   2665 C CG  . ASP A 1 342 ? 8.146   76.882 82.188 1.00 33.34 ? 342 ASP A CG  1 
ATOM   2666 O OD1 . ASP A 1 342 ? 8.446   77.208 81.012 1.00 34.34 ? 342 ASP A OD1 1 
ATOM   2667 O OD2 . ASP A 1 342 ? 7.099   77.287 82.775 1.00 32.34 ? 342 ASP A OD2 1 
ATOM   2668 N N   . SER A 1 343 ? 12.024  73.861 82.333 1.00 32.05 ? 343 SER A N   1 
ATOM   2669 C CA  . SER A 1 343 ? 13.234  73.356 82.982 1.00 32.37 ? 343 SER A CA  1 
ATOM   2670 C C   . SER A 1 343 ? 14.406  73.026 82.078 1.00 32.48 ? 343 SER A C   1 
ATOM   2671 O O   . SER A 1 343 ? 14.242  72.769 80.895 1.00 32.80 ? 343 SER A O   1 
ATOM   2672 C CB  . SER A 1 343 ? 12.922  72.094 83.764 1.00 32.23 ? 343 SER A CB  1 
ATOM   2673 O OG  . SER A 1 343 ? 14.102  71.323 83.871 1.00 33.21 ? 343 SER A OG  1 
ATOM   2674 N N   . GLU A 1 344 ? 15.586  73.001 82.680 1.00 33.07 ? 344 GLU A N   1 
ATOM   2675 C CA  . GLU A 1 344 ? 16.833  72.693 81.998 1.00 34.35 ? 344 GLU A CA  1 
ATOM   2676 C C   . GLU A 1 344 ? 16.805  71.277 81.466 1.00 31.96 ? 344 GLU A C   1 
ATOM   2677 O O   . GLU A 1 344 ? 17.486  70.936 80.509 1.00 30.14 ? 344 GLU A O   1 
ATOM   2678 C CB  . GLU A 1 344 ? 17.986  72.820 82.990 1.00 40.98 ? 344 GLU A CB  1 
ATOM   2679 C CG  . GLU A 1 344 ? 18.735  74.127 82.927 1.00 50.47 ? 344 GLU A CG  1 
ATOM   2680 C CD  . GLU A 1 344 ? 19.647  74.199 81.707 1.00 56.55 ? 344 GLU A CD  1 
ATOM   2681 O OE1 . GLU A 1 344 ? 19.128  74.258 80.556 1.00 59.48 ? 344 GLU A OE1 1 
ATOM   2682 O OE2 . GLU A 1 344 ? 20.891  74.182 81.908 1.00 59.81 ? 344 GLU A OE2 1 
ATOM   2683 N N   . SER A 1 345 ? 16.018  70.451 82.129 1.00 31.63 ? 345 SER A N   1 
ATOM   2684 C CA  . SER A 1 345 ? 15.875  69.045 81.787 1.00 31.61 ? 345 SER A CA  1 
ATOM   2685 C C   . SER A 1 345 ? 17.133  68.186 81.690 1.00 31.36 ? 345 SER A C   1 
ATOM   2686 O O   . SER A 1 345 ? 17.395  67.605 80.644 1.00 30.95 ? 345 SER A O   1 
ATOM   2687 C CB  . SER A 1 345 ? 15.060  68.894 80.506 1.00 31.12 ? 345 SER A CB  1 
ATOM   2688 O OG  . SER A 1 345 ? 13.689  69.108 80.783 1.00 30.65 ? 345 SER A OG  1 
ATOM   2689 N N   . LYS A 1 346 ? 17.902  68.100 82.777 1.00 31.66 ? 346 LYS A N   1 
ATOM   2690 C CA  . LYS A 1 346 ? 19.076  67.241 82.793 1.00 33.68 ? 346 LYS A CA  1 
ATOM   2691 C C   . LYS A 1 346 ? 18.453  65.901 83.147 1.00 35.30 ? 346 LYS A C   1 
ATOM   2692 O O   . LYS A 1 346 ? 17.542  65.842 83.968 1.00 35.36 ? 346 LYS A O   1 
ATOM   2693 C CB  . LYS A 1 346 ? 20.067  67.647 83.882 1.00 35.35 ? 346 LYS A CB  1 
ATOM   2694 C CG  . LYS A 1 346 ? 20.569  69.088 83.813 1.00 39.77 ? 346 LYS A CG  1 
ATOM   2695 C CD  . LYS A 1 346 ? 21.805  69.315 84.711 1.00 43.07 ? 346 LYS A CD  1 
ATOM   2696 C CE  . LYS A 1 346 ? 21.796  70.701 85.371 1.00 45.89 ? 346 LYS A CE  1 
ATOM   2697 N NZ  . LYS A 1 346 ? 21.371  71.791 84.429 1.00 47.82 ? 346 LYS A NZ  1 
ATOM   2698 N N   . ILE A 1 347 ? 18.925  64.819 82.544 1.00 37.96 ? 347 ILE A N   1 
ATOM   2699 C CA  . ILE A 1 347 ? 18.323  63.514 82.809 1.00 39.67 ? 347 ILE A CA  1 
ATOM   2700 C C   . ILE A 1 347 ? 19.174  62.526 83.598 1.00 39.97 ? 347 ILE A C   1 
ATOM   2701 O O   . ILE A 1 347 ? 20.366  62.334 83.328 1.00 37.91 ? 347 ILE A O   1 
ATOM   2702 C CB  . ILE A 1 347 ? 17.825  62.863 81.453 1.00 40.72 ? 347 ILE A CB  1 
ATOM   2703 C CG1 . ILE A 1 347 ? 16.416  63.372 81.122 1.00 41.03 ? 347 ILE A CG1 1 
ATOM   2704 C CG2 . ILE A 1 347 ? 17.779  61.339 81.545 1.00 40.73 ? 347 ILE A CG2 1 
ATOM   2705 C CD1 . ILE A 1 347 ? 16.316  64.868 80.883 1.00 41.09 ? 347 ILE A CD1 1 
ATOM   2706 N N   . SER A 1 348 ? 18.534  61.908 84.588 1.00 42.32 ? 348 SER A N   1 
ATOM   2707 C CA  . SER A 1 348 ? 19.193  60.917 85.430 1.00 45.47 ? 348 SER A CA  1 
ATOM   2708 C C   . SER A 1 348 ? 19.540  59.704 84.588 1.00 47.52 ? 348 SER A C   1 
ATOM   2709 O O   . SER A 1 348 ? 18.896  59.439 83.583 1.00 49.44 ? 348 SER A O   1 
ATOM   2710 C CB  . SER A 1 348 ? 18.285  60.499 86.595 1.00 45.16 ? 348 SER A CB  1 
ATOM   2711 O OG  . SER A 1 348 ? 17.012  60.074 86.153 1.00 44.17 ? 348 SER A OG  1 
ATOM   2712 N N   . ARG A 1 349 ? 20.568  58.973 84.992 1.00 49.80 ? 349 ARG A N   1 
ATOM   2713 C CA  . ARG A 1 349 ? 20.991  57.786 84.264 1.00 50.88 ? 349 ARG A CA  1 
ATOM   2714 C C   . ARG A 1 349 ? 19.873  56.754 84.405 1.00 50.04 ? 349 ARG A C   1 
ATOM   2715 O O   . ARG A 1 349 ? 19.860  55.715 83.749 1.00 48.49 ? 349 ARG A O   1 
ATOM   2716 C CB  . ARG A 1 349 ? 22.308  57.280 84.865 1.00 53.23 ? 349 ARG A CB  1 
ATOM   2717 C CG  . ARG A 1 349 ? 22.844  55.988 84.283 1.00 58.53 ? 349 ARG A CG  1 
ATOM   2718 C CD  . ARG A 1 349 ? 24.189  56.188 83.577 1.00 62.23 ? 349 ARG A CD  1 
ATOM   2719 N NE  . ARG A 1 349 ? 24.074  56.368 82.121 1.00 64.36 ? 349 ARG A NE  1 
ATOM   2720 C CZ  . ARG A 1 349 ? 23.916  55.382 81.230 1.00 63.99 ? 349 ARG A CZ  1 
ATOM   2721 N NH1 . ARG A 1 349 ? 23.848  54.106 81.616 1.00 62.78 ? 349 ARG A NH1 1 
ATOM   2722 N NH2 . ARG A 1 349 ? 23.843  55.678 79.938 1.00 63.56 ? 349 ARG A NH2 1 
ATOM   2723 N N   . GLU A 1 350 ? 18.909  57.088 85.247 1.00 50.32 ? 350 GLU A N   1 
ATOM   2724 C CA  . GLU A 1 350 ? 17.781  56.219 85.517 1.00 52.04 ? 350 GLU A CA  1 
ATOM   2725 C C   . GLU A 1 350 ? 16.544  56.544 84.658 1.00 50.55 ? 350 GLU A C   1 
ATOM   2726 O O   . GLU A 1 350 ? 15.693  55.684 84.432 1.00 51.16 ? 350 GLU A O   1 
ATOM   2727 C CB  . GLU A 1 350 ? 17.476  56.322 87.006 1.00 56.05 ? 350 GLU A CB  1 
ATOM   2728 C CG  . GLU A 1 350 ? 16.307  55.527 87.523 1.00 62.26 ? 350 GLU A CG  1 
ATOM   2729 C CD  . GLU A 1 350 ? 16.038  55.893 88.974 1.00 67.07 ? 350 GLU A CD  1 
ATOM   2730 O OE1 . GLU A 1 350 ? 15.978  57.115 89.277 1.00 68.82 ? 350 GLU A OE1 1 
ATOM   2731 O OE2 . GLU A 1 350 ? 15.894  54.975 89.813 1.00 69.82 ? 350 GLU A OE2 1 
ATOM   2732 N N   . ASP A 1 351 ? 16.435  57.785 84.194 1.00 48.46 ? 351 ASP A N   1 
ATOM   2733 C CA  . ASP A 1 351 ? 15.319  58.183 83.337 1.00 45.69 ? 351 ASP A CA  1 
ATOM   2734 C C   . ASP A 1 351 ? 15.782  57.991 81.914 1.00 44.01 ? 351 ASP A C   1 
ATOM   2735 O O   . ASP A 1 351 ? 14.980  57.846 80.995 1.00 45.45 ? 351 ASP A O   1 
ATOM   2736 C CB  . ASP A 1 351 ? 14.945  59.651 83.537 1.00 45.61 ? 351 ASP A CB  1 
ATOM   2737 C CG  . ASP A 1 351 ? 13.960  59.850 84.658 1.00 45.16 ? 351 ASP A CG  1 
ATOM   2738 O OD1 . ASP A 1 351 ? 13.039  59.012 84.786 1.00 44.67 ? 351 ASP A OD1 1 
ATOM   2739 O OD2 . ASP A 1 351 ? 14.100  60.849 85.397 1.00 45.62 ? 351 ASP A OD2 1 
ATOM   2740 N N   . PHE A 1 352 ? 17.094  58.021 81.746 1.00 41.57 ? 352 PHE A N   1 
ATOM   2741 C CA  . PHE A 1 352 ? 17.706  57.822 80.457 1.00 40.20 ? 352 PHE A CA  1 
ATOM   2742 C C   . PHE A 1 352 ? 17.430  56.395 80.023 1.00 40.86 ? 352 PHE A C   1 
ATOM   2743 O O   . PHE A 1 352 ? 17.278  56.132 78.843 1.00 41.23 ? 352 PHE A O   1 
ATOM   2744 C CB  . PHE A 1 352 ? 19.202  58.029 80.558 1.00 38.41 ? 352 PHE A CB  1 
ATOM   2745 C CG  . PHE A 1 352 ? 19.946  57.611 79.339 1.00 37.13 ? 352 PHE A CG  1 
ATOM   2746 C CD1 . PHE A 1 352 ? 20.357  56.296 79.186 1.00 37.18 ? 352 PHE A CD1 1 
ATOM   2747 C CD2 . PHE A 1 352 ? 20.260  58.532 78.352 1.00 36.46 ? 352 PHE A CD2 1 
ATOM   2748 C CE1 . PHE A 1 352 ? 21.078  55.906 78.064 1.00 37.85 ? 352 PHE A CE1 1 
ATOM   2749 C CE2 . PHE A 1 352 ? 20.979  58.158 77.228 1.00 36.37 ? 352 PHE A CE2 1 
ATOM   2750 C CZ  . PHE A 1 352 ? 21.393  56.844 77.081 1.00 37.44 ? 352 PHE A CZ  1 
ATOM   2751 N N   . MET A 1 353 ? 17.381  55.471 80.979 1.00 41.98 ? 353 MET A N   1 
ATOM   2752 C CA  . MET A 1 353 ? 17.105  54.069 80.669 1.00 43.09 ? 353 MET A CA  1 
ATOM   2753 C C   . MET A 1 353 ? 15.663  53.924 80.248 1.00 40.65 ? 353 MET A C   1 
ATOM   2754 O O   . MET A 1 353 ? 15.353  53.226 79.288 1.00 39.09 ? 353 MET A O   1 
ATOM   2755 C CB  . MET A 1 353 ? 17.355  53.183 81.886 1.00 49.39 ? 353 MET A CB  1 
ATOM   2756 C CG  . MET A 1 353 ? 18.828  53.032 82.247 1.00 56.45 ? 353 MET A CG  1 
ATOM   2757 S SD  . MET A 1 353 ? 19.829  52.425 80.840 1.00 64.66 ? 353 MET A SD  1 
ATOM   2758 C CE  . MET A 1 353 ? 21.541  52.509 81.583 1.00 61.86 ? 353 MET A CE  1 
ATOM   2759 N N   . SER A 1 354 ? 14.789  54.590 80.997 1.00 38.97 ? 354 SER A N   1 
ATOM   2760 C CA  . SER A 1 354 ? 13.353  54.602 80.740 1.00 37.12 ? 354 SER A CA  1 
ATOM   2761 C C   . SER A 1 354 ? 13.147  55.223 79.374 1.00 35.76 ? 354 SER A C   1 
ATOM   2762 O O   . SER A 1 354 ? 12.354  54.729 78.574 1.00 35.70 ? 354 SER A O   1 
ATOM   2763 C CB  . SER A 1 354 ? 12.644  55.460 81.782 1.00 37.49 ? 354 SER A CB  1 
ATOM   2764 O OG  . SER A 1 354 ? 13.168  55.226 83.080 1.00 39.44 ? 354 SER A OG  1 
ATOM   2765 N N   . GLY A 1 355 ? 13.866  56.325 79.138 1.00 34.09 ? 355 GLY A N   1 
ATOM   2766 C CA  . GLY A 1 355 ? 13.807  57.039 77.876 1.00 30.98 ? 355 GLY A CA  1 
ATOM   2767 C C   . GLY A 1 355 ? 14.095  56.103 76.716 1.00 29.79 ? 355 GLY A C   1 
ATOM   2768 O O   . GLY A 1 355 ? 13.258  55.922 75.823 1.00 29.55 ? 355 GLY A O   1 
ATOM   2769 N N   . VAL A 1 356 ? 15.277  55.495 76.736 1.00 27.62 ? 356 VAL A N   1 
ATOM   2770 C CA  . VAL A 1 356 ? 15.672  54.565 75.697 1.00 25.09 ? 356 VAL A CA  1 
ATOM   2771 C C   . VAL A 1 356 ? 14.625  53.502 75.435 1.00 25.63 ? 356 VAL A C   1 
ATOM   2772 O O   . VAL A 1 356 ? 14.306  53.250 74.293 1.00 27.21 ? 356 VAL A O   1 
ATOM   2773 C CB  . VAL A 1 356 ? 16.974  53.865 76.034 1.00 23.83 ? 356 VAL A CB  1 
ATOM   2774 C CG1 . VAL A 1 356 ? 17.276  52.830 74.987 1.00 24.31 ? 356 VAL A CG1 1 
ATOM   2775 C CG2 . VAL A 1 356 ? 18.095  54.862 76.081 1.00 23.33 ? 356 VAL A CG2 1 
ATOM   2776 N N   . LYS A 1 357 ? 14.082  52.866 76.464 1.00 26.71 ? 357 LYS A N   1 
ATOM   2777 C CA  . LYS A 1 357 ? 13.068  51.841 76.219 1.00 28.31 ? 357 LYS A CA  1 
ATOM   2778 C C   . LYS A 1 357 ? 11.906  52.381 75.371 1.00 27.58 ? 357 LYS A C   1 
ATOM   2779 O O   . LYS A 1 357 ? 11.498  51.746 74.398 1.00 28.45 ? 357 LYS A O   1 
ATOM   2780 C CB  . LYS A 1 357 ? 12.473  51.313 77.521 1.00 32.10 ? 357 LYS A CB  1 
ATOM   2781 C CG  . LYS A 1 357 ? 13.440  50.997 78.624 1.00 39.44 ? 357 LYS A CG  1 
ATOM   2782 C CD  . LYS A 1 357 ? 12.641  50.609 79.883 1.00 47.09 ? 357 LYS A CD  1 
ATOM   2783 C CE  . LYS A 1 357 ? 13.422  50.815 81.214 1.00 50.69 ? 357 LYS A CE  1 
ATOM   2784 N NZ  . LYS A 1 357 ? 12.544  50.807 82.459 1.00 51.09 ? 357 LYS A NZ  1 
ATOM   2785 N N   . LEU A 1 358 ? 11.361  53.536 75.757 1.00 25.44 ? 358 LEU A N   1 
ATOM   2786 C CA  . LEU A 1 358 ? 10.236  54.151 75.048 1.00 22.73 ? 358 LEU A CA  1 
ATOM   2787 C C   . LEU A 1 358 ? 10.541  54.396 73.575 1.00 23.64 ? 358 LEU A C   1 
ATOM   2788 O O   . LEU A 1 358 ? 9.665   54.267 72.722 1.00 24.17 ? 358 LEU A O   1 
ATOM   2789 C CB  . LEU A 1 358 ? 9.891   55.495 75.675 1.00 19.87 ? 358 LEU A CB  1 
ATOM   2790 C CG  . LEU A 1 358 ? 9.398   55.622 77.107 1.00 16.42 ? 358 LEU A CG  1 
ATOM   2791 C CD1 . LEU A 1 358 ? 9.283   57.101 77.450 1.00 13.14 ? 358 LEU A CD1 1 
ATOM   2792 C CD2 . LEU A 1 358 ? 8.070   54.922 77.251 1.00 12.60 ? 358 LEU A CD2 1 
ATOM   2793 N N   . SER A 1 359 ? 11.786  54.758 73.286 1.00 23.39 ? 359 SER A N   1 
ATOM   2794 C CA  . SER A 1 359 ? 12.221  55.056 71.929 1.00 23.62 ? 359 SER A CA  1 
ATOM   2795 C C   . SER A 1 359 ? 12.377  53.891 70.975 1.00 23.74 ? 359 SER A C   1 
ATOM   2796 O O   . SER A 1 359 ? 12.036  54.000 69.814 1.00 24.22 ? 359 SER A O   1 
ATOM   2797 C CB  . SER A 1 359 ? 13.512  55.838 72.002 1.00 23.61 ? 359 SER A CB  1 
ATOM   2798 O OG  . SER A 1 359 ? 13.272  56.964 72.827 1.00 25.98 ? 359 SER A OG  1 
ATOM   2799 N N   . VAL A 1 360 ? 12.903  52.777 71.443 1.00 24.81 ? 360 VAL A N   1 
ATOM   2800 C CA  . VAL A 1 360 ? 13.050  51.612 70.584 1.00 27.27 ? 360 VAL A CA  1 
ATOM   2801 C C   . VAL A 1 360 ? 12.153  50.566 71.235 1.00 29.93 ? 360 VAL A C   1 
ATOM   2802 O O   . VAL A 1 360 ? 12.651  49.603 71.822 1.00 32.35 ? 360 VAL A O   1 
ATOM   2803 C CB  . VAL A 1 360 ? 14.499  51.118 70.596 1.00 26.55 ? 360 VAL A CB  1 
ATOM   2804 C CG1 . VAL A 1 360 ? 14.839  50.451 69.279 1.00 26.28 ? 360 VAL A CG1 1 
ATOM   2805 C CG2 . VAL A 1 360 ? 15.425  52.281 70.873 1.00 26.59 ? 360 VAL A CG2 1 
ATOM   2806 N N   . PRO A 1 361 ? 10.815  50.740 71.141 1.00 31.24 ? 361 PRO A N   1 
ATOM   2807 C CA  . PRO A 1 361 ? 9.809   49.841 71.726 1.00 31.72 ? 361 PRO A CA  1 
ATOM   2808 C C   . PRO A 1 361 ? 9.794   48.410 71.210 1.00 32.62 ? 361 PRO A C   1 
ATOM   2809 O O   . PRO A 1 361 ? 9.329   47.498 71.879 1.00 32.50 ? 361 PRO A O   1 
ATOM   2810 C CB  . PRO A 1 361 ? 8.499   50.575 71.450 1.00 30.67 ? 361 PRO A CB  1 
ATOM   2811 C CG  . PRO A 1 361 ? 8.762   51.217 70.144 1.00 29.86 ? 361 PRO A CG  1 
ATOM   2812 C CD  . PRO A 1 361 ? 10.162  51.760 70.298 1.00 30.84 ? 361 PRO A CD  1 
ATOM   2813 N N   . HIS A 1 362 ? 10.318  48.215 70.020 1.00 34.18 ? 362 HIS A N   1 
ATOM   2814 C CA  . HIS A 1 362 ? 10.351  46.894 69.427 1.00 37.23 ? 362 HIS A CA  1 
ATOM   2815 C C   . HIS A 1 362 ? 11.678  46.197 69.717 1.00 38.73 ? 362 HIS A C   1 
ATOM   2816 O O   . HIS A 1 362 ? 11.986  45.183 69.107 1.00 40.56 ? 362 HIS A O   1 
ATOM   2817 C CB  . HIS A 1 362 ? 10.207  47.041 67.925 1.00 38.73 ? 362 HIS A CB  1 
ATOM   2818 C CG  . HIS A 1 362 ? 11.135  48.065 67.350 1.00 39.47 ? 362 HIS A CG  1 
ATOM   2819 N ND1 . HIS A 1 362 ? 10.955  49.420 67.543 1.00 39.18 ? 362 HIS A ND1 1 
ATOM   2820 C CD2 . HIS A 1 362 ? 12.287  47.931 66.651 1.00 39.01 ? 362 HIS A CD2 1 
ATOM   2821 C CE1 . HIS A 1 362 ? 11.957  50.075 66.988 1.00 39.77 ? 362 HIS A CE1 1 
ATOM   2822 N NE2 . HIS A 1 362 ? 12.780  49.195 66.442 1.00 40.50 ? 362 HIS A NE2 1 
ATOM   2823 N N   . ALA A 1 363 ? 12.481  46.731 70.622 1.00 39.06 ? 363 ALA A N   1 
ATOM   2824 C CA  . ALA A 1 363 ? 13.762  46.112 70.891 1.00 39.65 ? 363 ALA A CA  1 
ATOM   2825 C C   . ALA A 1 363 ? 13.779  45.307 72.178 1.00 41.50 ? 363 ALA A C   1 
ATOM   2826 O O   . ALA A 1 363 ? 13.087  45.646 73.149 1.00 42.33 ? 363 ALA A O   1 
ATOM   2827 C CB  . ALA A 1 363 ? 14.835  47.172 70.937 1.00 39.47 ? 363 ALA A CB  1 
ATOM   2828 N N   . ASN A 1 364 ? 14.570  44.235 72.177 1.00 42.44 ? 364 ASN A N   1 
ATOM   2829 C CA  . ASN A 1 364 ? 14.727  43.389 73.354 1.00 43.43 ? 364 ASN A CA  1 
ATOM   2830 C C   . ASN A 1 364 ? 15.933  43.907 74.137 1.00 45.26 ? 364 ASN A C   1 
ATOM   2831 O O   . ASN A 1 364 ? 16.534  44.918 73.755 1.00 47.00 ? 364 ASN A O   1 
ATOM   2832 C CB  . ASN A 1 364 ? 14.968  41.944 72.947 1.00 41.90 ? 364 ASN A CB  1 
ATOM   2833 C CG  . ASN A 1 364 ? 16.144  41.794 72.036 1.00 40.82 ? 364 ASN A CG  1 
ATOM   2834 O OD1 . ASN A 1 364 ? 17.070  42.590 72.078 1.00 40.03 ? 364 ASN A OD1 1 
ATOM   2835 N ND2 . ASN A 1 364 ? 16.126  40.757 71.207 1.00 42.21 ? 364 ASN A ND2 1 
ATOM   2836 N N   . ASP A 1 365 ? 16.296  43.221 75.219 1.00 45.93 ? 365 ASP A N   1 
ATOM   2837 C CA  . ASP A 1 365 ? 17.431  43.637 76.047 1.00 46.16 ? 365 ASP A CA  1 
ATOM   2838 C C   . ASP A 1 365 ? 18.674  43.963 75.278 1.00 42.95 ? 365 ASP A C   1 
ATOM   2839 O O   . ASP A 1 365 ? 19.130  45.108 75.231 1.00 41.78 ? 365 ASP A O   1 
ATOM   2840 C CB  . ASP A 1 365 ? 17.794  42.548 77.027 1.00 52.92 ? 365 ASP A CB  1 
ATOM   2841 C CG  . ASP A 1 365 ? 16.911  42.562 78.223 1.00 59.65 ? 365 ASP A CG  1 
ATOM   2842 O OD1 . ASP A 1 365 ? 15.680  42.361 78.039 1.00 63.34 ? 365 ASP A OD1 1 
ATOM   2843 O OD2 . ASP A 1 365 ? 17.452  42.789 79.337 1.00 63.67 ? 365 ASP A OD2 1 
ATOM   2844 N N   . LEU A 1 366 ? 19.235  42.907 74.716 1.00 39.02 ? 366 LEU A N   1 
ATOM   2845 C CA  . LEU A 1 366 ? 20.426  42.992 73.923 1.00 36.47 ? 366 LEU A CA  1 
ATOM   2846 C C   . LEU A 1 366 ? 20.368  44.229 73.017 1.00 35.49 ? 366 LEU A C   1 
ATOM   2847 O O   . LEU A 1 366 ? 21.323  45.012 72.955 1.00 36.15 ? 366 LEU A O   1 
ATOM   2848 C CB  . LEU A 1 366 ? 20.530  41.717 73.107 1.00 35.45 ? 366 LEU A CB  1 
ATOM   2849 C CG  . LEU A 1 366 ? 21.933  41.393 72.640 1.00 35.43 ? 366 LEU A CG  1 
ATOM   2850 C CD1 . LEU A 1 366 ? 22.891  41.552 73.821 1.00 35.75 ? 366 LEU A CD1 1 
ATOM   2851 C CD2 . LEU A 1 366 ? 21.957  39.986 72.063 1.00 35.13 ? 366 LEU A CD2 1 
ATOM   2852 N N   . GLY A 1 367 ? 19.245  44.399 72.321 1.00 33.62 ? 367 GLY A N   1 
ATOM   2853 C CA  . GLY A 1 367 ? 19.071  45.546 71.450 1.00 30.94 ? 367 GLY A CA  1 
ATOM   2854 C C   . GLY A 1 367 ? 19.215  46.826 72.248 1.00 29.76 ? 367 GLY A C   1 
ATOM   2855 O O   . GLY A 1 367 ? 19.979  47.711 71.883 1.00 29.54 ? 367 GLY A O   1 
ATOM   2856 N N   . LEU A 1 368 ? 18.496  46.935 73.355 1.00 28.91 ? 368 LEU A N   1 
ATOM   2857 C CA  . LEU A 1 368 ? 18.600  48.135 74.176 1.00 29.26 ? 368 LEU A CA  1 
ATOM   2858 C C   . LEU A 1 368 ? 20.037  48.432 74.605 1.00 29.19 ? 368 LEU A C   1 
ATOM   2859 O O   . LEU A 1 368 ? 20.467  49.586 74.575 1.00 28.10 ? 368 LEU A O   1 
ATOM   2860 C CB  . LEU A 1 368 ? 17.674  48.022 75.391 1.00 28.18 ? 368 LEU A CB  1 
ATOM   2861 C CG  . LEU A 1 368 ? 16.196  48.197 75.006 1.00 27.95 ? 368 LEU A CG  1 
ATOM   2862 C CD1 . LEU A 1 368 ? 15.375  47.156 75.704 1.00 29.27 ? 368 LEU A CD1 1 
ATOM   2863 C CD2 . LEU A 1 368 ? 15.697  49.593 75.335 1.00 26.04 ? 368 LEU A CD2 1 
ATOM   2864 N N   . ASP A 1 369 ? 20.777  47.395 74.994 1.00 30.49 ? 369 ASP A N   1 
ATOM   2865 C CA  . ASP A 1 369 ? 22.176  47.553 75.397 1.00 30.92 ? 369 ASP A CA  1 
ATOM   2866 C C   . ASP A 1 369 ? 22.971  48.126 74.253 1.00 29.57 ? 369 ASP A C   1 
ATOM   2867 O O   . ASP A 1 369 ? 23.760  49.057 74.430 1.00 28.81 ? 369 ASP A O   1 
ATOM   2868 C CB  . ASP A 1 369 ? 22.795  46.216 75.753 1.00 34.73 ? 369 ASP A CB  1 
ATOM   2869 C CG  . ASP A 1 369 ? 22.233  45.639 77.020 1.00 39.80 ? 369 ASP A CG  1 
ATOM   2870 O OD1 . ASP A 1 369 ? 22.239  46.344 78.058 1.00 42.44 ? 369 ASP A OD1 1 
ATOM   2871 O OD2 . ASP A 1 369 ? 21.789  44.472 76.979 1.00 43.42 ? 369 ASP A OD2 1 
ATOM   2872 N N   . ALA A 1 370 ? 22.773  47.529 73.082 1.00 27.68 ? 370 ALA A N   1 
ATOM   2873 C CA  . ALA A 1 370 ? 23.444  47.963 71.870 1.00 26.03 ? 370 ALA A CA  1 
ATOM   2874 C C   . ALA A 1 370 ? 23.235  49.463 71.727 1.00 25.39 ? 370 ALA A C   1 
ATOM   2875 O O   . ALA A 1 370 ? 24.184  50.230 71.588 1.00 25.25 ? 370 ALA A O   1 
ATOM   2876 C CB  . ALA A 1 370 ? 22.863  47.241 70.683 1.00 24.58 ? 370 ALA A CB  1 
ATOM   2877 N N   . VAL A 1 371 ? 21.971  49.863 71.791 1.00 24.87 ? 371 VAL A N   1 
ATOM   2878 C CA  . VAL A 1 371 ? 21.566  51.260 71.675 1.00 22.87 ? 371 VAL A CA  1 
ATOM   2879 C C   . VAL A 1 371 ? 22.279  52.134 72.696 1.00 22.00 ? 371 VAL A C   1 
ATOM   2880 O O   . VAL A 1 371 ? 22.728  53.234 72.378 1.00 19.90 ? 371 VAL A O   1 
ATOM   2881 C CB  . VAL A 1 371 ? 20.029  51.401 71.882 1.00 22.36 ? 371 VAL A CB  1 
ATOM   2882 C CG1 . VAL A 1 371 ? 19.602  52.855 71.775 1.00 21.36 ? 371 VAL A CG1 1 
ATOM   2883 C CG2 . VAL A 1 371 ? 19.303  50.568 70.863 1.00 21.08 ? 371 VAL A CG2 1 
ATOM   2884 N N   . THR A 1 372 ? 22.377  51.635 73.924 1.00 22.05 ? 372 THR A N   1 
ATOM   2885 C CA  . THR A 1 372 ? 23.007  52.384 74.999 1.00 23.93 ? 372 THR A CA  1 
ATOM   2886 C C   . THR A 1 372 ? 24.508  52.429 74.819 1.00 26.00 ? 372 THR A C   1 
ATOM   2887 O O   . THR A 1 372 ? 25.125  53.491 74.907 1.00 25.62 ? 372 THR A O   1 
ATOM   2888 C CB  . THR A 1 372 ? 22.718  51.748 76.344 1.00 23.61 ? 372 THR A CB  1 
ATOM   2889 O OG1 . THR A 1 372 ? 21.332  51.418 76.426 1.00 23.55 ? 372 THR A OG1 1 
ATOM   2890 C CG2 . THR A 1 372 ? 23.056  52.701 77.449 1.00 23.78 ? 372 THR A CG2 1 
ATOM   2891 N N   . LEU A 1 373 ? 25.091  51.256 74.579 1.00 27.72 ? 373 LEU A N   1 
ATOM   2892 C CA  . LEU A 1 373 ? 26.520  51.144 74.381 1.00 27.75 ? 373 LEU A CA  1 
ATOM   2893 C C   . LEU A 1 373 ? 26.870  52.182 73.353 1.00 28.72 ? 373 LEU A C   1 
ATOM   2894 O O   . LEU A 1 373 ? 27.921  52.792 73.401 1.00 29.68 ? 373 LEU A O   1 
ATOM   2895 C CB  . LEU A 1 373 ? 26.868  49.758 73.860 1.00 26.77 ? 373 LEU A CB  1 
ATOM   2896 C CG  . LEU A 1 373 ? 28.324  49.503 73.462 1.00 27.65 ? 373 LEU A CG  1 
ATOM   2897 C CD1 . LEU A 1 373 ? 29.264  49.773 74.612 1.00 26.87 ? 373 LEU A CD1 1 
ATOM   2898 C CD2 . LEU A 1 373 ? 28.461  48.061 73.028 1.00 28.33 ? 373 LEU A CD2 1 
ATOM   2899 N N   . GLN A 1 374 ? 25.939  52.403 72.440 1.00 30.47 ? 374 GLN A N   1 
ATOM   2900 C CA  . GLN A 1 374 ? 26.117  53.357 71.357 1.00 32.45 ? 374 GLN A CA  1 
ATOM   2901 C C   . GLN A 1 374 ? 26.069  54.832 71.702 1.00 32.84 ? 374 GLN A C   1 
ATOM   2902 O O   . GLN A 1 374 ? 26.960  55.583 71.334 1.00 32.62 ? 374 GLN A O   1 
ATOM   2903 C CB  . GLN A 1 374 ? 25.081  53.093 70.272 1.00 33.81 ? 374 GLN A CB  1 
ATOM   2904 C CG  . GLN A 1 374 ? 25.435  51.951 69.367 1.00 35.14 ? 374 GLN A CG  1 
ATOM   2905 C CD  . GLN A 1 374 ? 26.677  52.255 68.586 1.00 36.45 ? 374 GLN A CD  1 
ATOM   2906 O OE1 . GLN A 1 374 ? 26.725  53.245 67.835 1.00 36.70 ? 374 GLN A OE1 1 
ATOM   2907 N NE2 . GLN A 1 374 ? 27.702  51.418 68.756 1.00 36.03 ? 374 GLN A NE2 1 
ATOM   2908 N N   . TYR A 1 375 ? 25.022  55.258 72.391 1.00 33.97 ? 375 TYR A N   1 
ATOM   2909 C CA  . TYR A 1 375 ? 24.899  56.670 72.702 1.00 35.34 ? 375 TYR A CA  1 
ATOM   2910 C C   . TYR A 1 375 ? 25.426  57.105 74.060 1.00 37.45 ? 375 TYR A C   1 
ATOM   2911 O O   . TYR A 1 375 ? 25.456  58.295 74.372 1.00 37.37 ? 375 TYR A O   1 
ATOM   2912 C CB  . TYR A 1 375 ? 23.444  57.106 72.519 1.00 32.81 ? 375 TYR A CB  1 
ATOM   2913 C CG  . TYR A 1 375 ? 23.024  57.116 71.065 1.00 30.43 ? 375 TYR A CG  1 
ATOM   2914 C CD1 . TYR A 1 375 ? 22.667  55.940 70.418 1.00 30.28 ? 375 TYR A CD1 1 
ATOM   2915 C CD2 . TYR A 1 375 ? 23.026  58.295 70.325 1.00 29.56 ? 375 TYR A CD2 1 
ATOM   2916 C CE1 . TYR A 1 375 ? 22.321  55.933 69.069 1.00 28.75 ? 375 TYR A CE1 1 
ATOM   2917 C CE2 . TYR A 1 375 ? 22.684  58.300 68.979 1.00 29.10 ? 375 TYR A CE2 1 
ATOM   2918 C CZ  . TYR A 1 375 ? 22.330  57.112 68.360 1.00 29.04 ? 375 TYR A CZ  1 
ATOM   2919 O OH  . TYR A 1 375 ? 21.970  57.101 67.034 1.00 29.39 ? 375 TYR A OH  1 
ATOM   2920 N N   . THR A 1 376 ? 25.872  56.153 74.865 1.00 40.13 ? 376 THR A N   1 
ATOM   2921 C CA  . THR A 1 376 ? 26.385  56.506 76.176 1.00 41.37 ? 376 THR A CA  1 
ATOM   2922 C C   . THR A 1 376 ? 27.842  56.870 76.099 1.00 44.23 ? 376 THR A C   1 
ATOM   2923 O O   . THR A 1 376 ? 28.613  56.284 75.341 1.00 44.66 ? 376 THR A O   1 
ATOM   2924 C CB  . THR A 1 376 ? 26.259  55.349 77.177 1.00 39.46 ? 376 THR A CB  1 
ATOM   2925 O OG1 . THR A 1 376 ? 24.945  54.788 77.090 1.00 39.60 ? 376 THR A OG1 1 
ATOM   2926 C CG2 . THR A 1 376 ? 26.507  55.841 78.597 1.00 35.84 ? 376 THR A CG2 1 
ATOM   2927 N N   . ASP A 1 377 ? 28.198  57.872 76.884 1.00 48.32 ? 377 ASP A N   1 
ATOM   2928 C CA  . ASP A 1 377 ? 29.572  58.324 77.013 1.00 52.55 ? 377 ASP A CA  1 
ATOM   2929 C C   . ASP A 1 377 ? 30.006  57.611 78.305 1.00 54.77 ? 377 ASP A C   1 
ATOM   2930 O O   . ASP A 1 377 ? 29.388  57.807 79.350 1.00 55.70 ? 377 ASP A O   1 
ATOM   2931 C CB  . ASP A 1 377 ? 29.605  59.833 77.221 1.00 52.85 ? 377 ASP A CB  1 
ATOM   2932 C CG  . ASP A 1 377 ? 30.997  60.339 77.445 1.00 53.92 ? 377 ASP A CG  1 
ATOM   2933 O OD1 . ASP A 1 377 ? 31.825  59.538 77.932 1.00 54.15 ? 377 ASP A OD1 1 
ATOM   2934 O OD2 . ASP A 1 377 ? 31.267  61.523 77.146 1.00 54.98 ? 377 ASP A OD2 1 
ATOM   2935 N N   . TRP A 1 378 ? 31.047  56.791 78.267 1.00 56.88 ? 378 TRP A N   1 
ATOM   2936 C CA  . TRP A 1 378 ? 31.410  56.075 79.487 1.00 59.15 ? 378 TRP A CA  1 
ATOM   2937 C C   . TRP A 1 378 ? 32.516  56.700 80.312 1.00 60.75 ? 378 TRP A C   1 
ATOM   2938 O O   . TRP A 1 378 ? 32.787  56.264 81.429 1.00 60.30 ? 378 TRP A O   1 
ATOM   2939 C CB  . TRP A 1 378 ? 31.759  54.627 79.151 1.00 59.68 ? 378 TRP A CB  1 
ATOM   2940 C CG  . TRP A 1 378 ? 30.691  53.963 78.345 1.00 59.09 ? 378 TRP A CG  1 
ATOM   2941 C CD1 . TRP A 1 378 ? 30.605  53.893 76.976 1.00 58.71 ? 378 TRP A CD1 1 
ATOM   2942 C CD2 . TRP A 1 378 ? 29.514  53.343 78.855 1.00 58.72 ? 378 TRP A CD2 1 
ATOM   2943 N NE1 . TRP A 1 378 ? 29.440  53.266 76.609 1.00 58.38 ? 378 TRP A NE1 1 
ATOM   2944 C CE2 . TRP A 1 378 ? 28.750  52.917 77.743 1.00 59.43 ? 378 TRP A CE2 1 
ATOM   2945 C CE3 . TRP A 1 378 ? 29.023  53.107 80.146 1.00 58.23 ? 378 TRP A CE3 1 
ATOM   2946 C CZ2 . TRP A 1 378 ? 27.515  52.263 77.887 1.00 59.99 ? 378 TRP A CZ2 1 
ATOM   2947 C CZ3 . TRP A 1 378 ? 27.798  52.460 80.291 1.00 58.71 ? 378 TRP A CZ3 1 
ATOM   2948 C CH2 . TRP A 1 378 ? 27.058  52.045 79.167 1.00 59.19 ? 378 TRP A CH2 1 
ATOM   2949 N N   . MET A 1 379 ? 33.141  57.727 79.754 1.00 63.41 ? 379 MET A N   1 
ATOM   2950 C CA  . MET A 1 379 ? 34.217  58.453 80.415 1.00 66.70 ? 379 MET A CA  1 
ATOM   2951 C C   . MET A 1 379 ? 33.590  59.388 81.448 1.00 67.32 ? 379 MET A C   1 
ATOM   2952 O O   . MET A 1 379 ? 34.267  59.923 82.327 1.00 67.52 ? 379 MET A O   1 
ATOM   2953 C CB  . MET A 1 379 ? 34.965  59.288 79.375 1.00 69.66 ? 379 MET A CB  1 
ATOM   2954 C CG  . MET A 1 379 ? 36.340  59.717 79.796 1.00 73.96 ? 379 MET A CG  1 
ATOM   2955 S SD  . MET A 1 379 ? 37.383  58.259 79.941 1.00 79.83 ? 379 MET A SD  1 
ATOM   2956 C CE  . MET A 1 379 ? 37.895  58.010 78.202 1.00 78.72 ? 379 MET A CE  1 
ATOM   2957 N N   . ASP A 1 380 ? 32.277  59.555 81.313 1.00 68.08 ? 380 ASP A N   1 
ATOM   2958 C CA  . ASP A 1 380 ? 31.454  60.438 82.136 1.00 68.56 ? 380 ASP A CA  1 
ATOM   2959 C C   . ASP A 1 380 ? 30.007  60.023 81.811 1.00 69.15 ? 380 ASP A C   1 
ATOM   2960 O O   . ASP A 1 380 ? 29.286  60.740 81.110 1.00 69.39 ? 380 ASP A O   1 
ATOM   2961 C CB  . ASP A 1 380 ? 31.739  61.878 81.688 1.00 68.53 ? 380 ASP A CB  1 
ATOM   2962 C CG  . ASP A 1 380 ? 30.804  62.888 82.299 1.00 69.00 ? 380 ASP A CG  1 
ATOM   2963 O OD1 . ASP A 1 380 ? 29.950  62.494 83.122 1.00 70.25 ? 380 ASP A OD1 1 
ATOM   2964 O OD2 . ASP A 1 380 ? 30.935  64.083 81.944 1.00 67.71 ? 380 ASP A OD2 1 
ATOM   2965 N N   . ASP A 1 381 ? 29.599  58.859 82.325 1.00 69.77 ? 381 ASP A N   1 
ATOM   2966 C CA  . ASP A 1 381 ? 28.275  58.275 82.056 1.00 70.05 ? 381 ASP A CA  1 
ATOM   2967 C C   . ASP A 1 381 ? 27.091  58.684 82.916 1.00 69.52 ? 381 ASP A C   1 
ATOM   2968 O O   . ASP A 1 381 ? 26.050  58.032 82.887 1.00 68.63 ? 381 ASP A O   1 
ATOM   2969 C CB  . ASP A 1 381 ? 28.365  56.755 82.097 1.00 71.47 ? 381 ASP A CB  1 
ATOM   2970 C CG  . ASP A 1 381 ? 28.738  56.239 83.469 1.00 74.07 ? 381 ASP A CG  1 
ATOM   2971 O OD1 . ASP A 1 381 ? 28.885  57.058 84.410 1.00 74.99 ? 381 ASP A OD1 1 
ATOM   2972 O OD2 . ASP A 1 381 ? 28.889  55.009 83.608 1.00 76.22 ? 381 ASP A OD2 1 
ATOM   2973 N N   . ASN A 1 382 ? 27.236  59.739 83.700 1.00 69.43 ? 382 ASN A N   1 
ATOM   2974 C CA  . ASN A 1 382 ? 26.112  60.172 84.506 1.00 68.30 ? 382 ASN A CA  1 
ATOM   2975 C C   . ASN A 1 382 ? 25.995  61.676 84.420 1.00 65.39 ? 382 ASN A C   1 
ATOM   2976 O O   . ASN A 1 382 ? 25.727  62.351 85.420 1.00 66.27 ? 382 ASN A O   1 
ATOM   2977 C CB  . ASN A 1 382 ? 26.269  59.763 85.966 1.00 71.77 ? 382 ASN A CB  1 
ATOM   2978 C CG  . ASN A 1 382 ? 24.943  59.770 86.694 1.00 74.77 ? 382 ASN A CG  1 
ATOM   2979 O OD1 . ASN A 1 382 ? 24.180  58.808 86.601 1.00 77.52 ? 382 ASN A OD1 1 
ATOM   2980 N ND2 . ASN A 1 382 ? 24.640  60.869 87.391 1.00 75.08 ? 382 ASN A ND2 1 
ATOM   2981 N N   . ASN A 1 383 ? 26.209  62.197 83.217 1.00 60.44 ? 383 ASN A N   1 
ATOM   2982 C CA  . ASN A 1 383 ? 26.119  63.621 82.989 1.00 55.20 ? 383 ASN A CA  1 
ATOM   2983 C C   . ASN A 1 383 ? 24.688  63.974 82.622 1.00 52.56 ? 383 ASN A C   1 
ATOM   2984 O O   . ASN A 1 383 ? 24.108  63.422 81.692 1.00 52.20 ? 383 ASN A O   1 
ATOM   2985 C CB  . ASN A 1 383 ? 27.049  64.035 81.871 1.00 54.28 ? 383 ASN A CB  1 
ATOM   2986 C CG  . ASN A 1 383 ? 27.250  65.511 81.829 1.00 54.52 ? 383 ASN A CG  1 
ATOM   2987 O OD1 . ASN A 1 383 ? 26.502  66.265 82.447 1.00 54.91 ? 383 ASN A OD1 1 
ATOM   2988 N ND2 . ASN A 1 383 ? 28.261  65.948 81.095 1.00 55.56 ? 383 ASN A ND2 1 
ATOM   2989 N N   . GLY A 1 384 ? 24.114  64.900 83.372 1.00 49.91 ? 384 GLY A N   1 
ATOM   2990 C CA  . GLY A 1 384 ? 22.749  65.297 83.115 1.00 45.66 ? 384 GLY A CA  1 
ATOM   2991 C C   . GLY A 1 384 ? 22.527  65.698 81.682 1.00 42.51 ? 384 GLY A C   1 
ATOM   2992 O O   . GLY A 1 384 ? 21.611  65.201 81.057 1.00 43.14 ? 384 GLY A O   1 
ATOM   2993 N N   . ILE A 1 385 ? 23.369  66.584 81.162 1.00 39.98 ? 385 ILE A N   1 
ATOM   2994 C CA  . ILE A 1 385 ? 23.238  67.068 79.792 1.00 37.92 ? 385 ILE A CA  1 
ATOM   2995 C C   . ILE A 1 385 ? 23.529  65.994 78.758 1.00 37.85 ? 385 ILE A C   1 
ATOM   2996 O O   . ILE A 1 385 ? 22.793  65.820 77.789 1.00 37.61 ? 385 ILE A O   1 
ATOM   2997 C CB  . ILE A 1 385 ? 24.183  68.241 79.524 1.00 36.18 ? 385 ILE A CB  1 
ATOM   2998 C CG1 . ILE A 1 385 ? 24.301  69.102 80.772 1.00 34.83 ? 385 ILE A CG1 1 
ATOM   2999 C CG2 . ILE A 1 385 ? 23.639  69.088 78.408 1.00 35.29 ? 385 ILE A CG2 1 
ATOM   3000 C CD1 . ILE A 1 385 ? 22.977  69.618 81.249 1.00 35.15 ? 385 ILE A CD1 1 
ATOM   3001 N N   . LYS A 1 386 ? 24.617  65.275 78.954 1.00 37.64 ? 386 LYS A N   1 
ATOM   3002 C CA  . LYS A 1 386 ? 24.956  64.236 78.018 1.00 38.55 ? 386 LYS A CA  1 
ATOM   3003 C C   . LYS A 1 386 ? 23.819  63.209 77.893 1.00 38.20 ? 386 LYS A C   1 
ATOM   3004 O O   . LYS A 1 386 ? 23.488  62.775 76.794 1.00 38.99 ? 386 LYS A O   1 
ATOM   3005 C CB  . LYS A 1 386 ? 26.273  63.578 78.441 1.00 40.31 ? 386 LYS A CB  1 
ATOM   3006 C CG  . LYS A 1 386 ? 27.450  64.536 78.392 1.00 41.36 ? 386 LYS A CG  1 
ATOM   3007 C CD  . LYS A 1 386 ? 28.781  63.808 78.436 1.00 45.26 ? 386 LYS A CD  1 
ATOM   3008 C CE  . LYS A 1 386 ? 29.949  64.800 78.309 1.00 48.34 ? 386 LYS A CE  1 
ATOM   3009 N NZ  . LYS A 1 386 ? 31.322  64.170 78.289 1.00 51.38 ? 386 LYS A NZ  1 
ATOM   3010 N N   . ASN A 1 387 ? 23.211  62.820 79.005 1.00 37.28 ? 387 ASN A N   1 
ATOM   3011 C CA  . ASN A 1 387 ? 22.119  61.862 78.932 1.00 36.89 ? 387 ASN A CA  1 
ATOM   3012 C C   . ASN A 1 387 ? 20.898  62.464 78.255 1.00 35.42 ? 387 ASN A C   1 
ATOM   3013 O O   . ASN A 1 387 ? 20.129  61.756 77.618 1.00 35.83 ? 387 ASN A O   1 
ATOM   3014 C CB  . ASN A 1 387 ? 21.728  61.375 80.325 1.00 40.30 ? 387 ASN A CB  1 
ATOM   3015 C CG  . ASN A 1 387 ? 22.735  60.408 80.906 1.00 43.19 ? 387 ASN A CG  1 
ATOM   3016 O OD1 . ASN A 1 387 ? 23.459  59.731 80.166 1.00 44.53 ? 387 ASN A OD1 1 
ATOM   3017 N ND2 . ASN A 1 387 ? 22.774  60.317 82.238 1.00 44.51 ? 387 ASN A ND2 1 
ATOM   3018 N N   . ARG A 1 388 ? 20.716  63.772 78.406 1.00 33.73 ? 388 ARG A N   1 
ATOM   3019 C CA  . ARG A 1 388 ? 19.591  64.476 77.798 1.00 31.32 ? 388 ARG A CA  1 
ATOM   3020 C C   . ARG A 1 388 ? 19.829  64.569 76.286 1.00 30.41 ? 388 ARG A C   1 
ATOM   3021 O O   . ARG A 1 388 ? 19.053  64.054 75.483 1.00 30.89 ? 388 ARG A O   1 
ATOM   3022 C CB  . ARG A 1 388 ? 19.457  65.874 78.411 1.00 29.59 ? 388 ARG A CB  1 
ATOM   3023 C CG  . ARG A 1 388 ? 18.250  66.674 77.947 1.00 29.38 ? 388 ARG A CG  1 
ATOM   3024 C CD  . ARG A 1 388 ? 18.668  67.946 77.209 1.00 29.55 ? 388 ARG A CD  1 
ATOM   3025 N NE  . ARG A 1 388 ? 19.025  69.055 78.089 1.00 29.31 ? 388 ARG A NE  1 
ATOM   3026 C CZ  . ARG A 1 388 ? 20.049  69.876 77.871 1.00 31.01 ? 388 ARG A CZ  1 
ATOM   3027 N NH1 . ARG A 1 388 ? 20.833  69.699 76.817 1.00 31.94 ? 388 ARG A NH1 1 
ATOM   3028 N NH2 . ARG A 1 388 ? 20.309  70.869 78.712 1.00 32.59 ? 388 ARG A NH2 1 
ATOM   3029 N N   . ASP A 1 389 ? 20.918  65.212 75.898 1.00 29.16 ? 389 ASP A N   1 
ATOM   3030 C CA  . ASP A 1 389 ? 21.251  65.347 74.484 1.00 28.19 ? 389 ASP A CA  1 
ATOM   3031 C C   . ASP A 1 389 ? 21.427  63.999 73.766 1.00 27.76 ? 389 ASP A C   1 
ATOM   3032 O O   . ASP A 1 389 ? 21.079  63.868 72.600 1.00 28.60 ? 389 ASP A O   1 
ATOM   3033 C CB  . ASP A 1 389 ? 22.530  66.167 74.351 1.00 27.14 ? 389 ASP A CB  1 
ATOM   3034 C CG  . ASP A 1 389 ? 22.364  67.576 74.859 1.00 26.99 ? 389 ASP A CG  1 
ATOM   3035 O OD1 . ASP A 1 389 ? 21.217  68.068 74.891 1.00 26.81 ? 389 ASP A OD1 1 
ATOM   3036 O OD2 . ASP A 1 389 ? 23.380  68.199 75.215 1.00 28.00 ? 389 ASP A OD2 1 
ATOM   3037 N N   . GLY A 1 390 ? 21.973  63.007 74.463 1.00 27.13 ? 390 GLY A N   1 
ATOM   3038 C CA  . GLY A 1 390 ? 22.198  61.709 73.859 1.00 25.31 ? 390 GLY A CA  1 
ATOM   3039 C C   . GLY A 1 390 ? 20.893  61.039 73.534 1.00 25.66 ? 390 GLY A C   1 
ATOM   3040 O O   . GLY A 1 390 ? 20.790  60.257 72.587 1.00 25.30 ? 390 GLY A O   1 
ATOM   3041 N N   . LEU A 1 391 ? 19.886  61.357 74.336 1.00 26.36 ? 391 LEU A N   1 
ATOM   3042 C CA  . LEU A 1 391 ? 18.553  60.797 74.161 1.00 26.43 ? 391 LEU A CA  1 
ATOM   3043 C C   . LEU A 1 391 ? 17.903  61.486 72.963 1.00 26.37 ? 391 LEU A C   1 
ATOM   3044 O O   . LEU A 1 391 ? 17.224  60.850 72.177 1.00 26.31 ? 391 LEU A O   1 
ATOM   3045 C CB  . LEU A 1 391 ? 17.732  61.001 75.447 1.00 26.29 ? 391 LEU A CB  1 
ATOM   3046 C CG  . LEU A 1 391 ? 16.775  59.874 75.854 1.00 26.11 ? 391 LEU A CG  1 
ATOM   3047 C CD1 . LEU A 1 391 ? 17.461  58.522 75.756 1.00 24.48 ? 391 LEU A CD1 1 
ATOM   3048 C CD2 . LEU A 1 391 ? 16.279  60.126 77.262 1.00 26.23 ? 391 LEU A CD2 1 
ATOM   3049 N N   . ASP A 1 392 ? 18.125  62.787 72.823 1.00 27.15 ? 392 ASP A N   1 
ATOM   3050 C CA  . ASP A 1 392 ? 17.591  63.538 71.698 1.00 28.53 ? 392 ASP A CA  1 
ATOM   3051 C C   . ASP A 1 392 ? 18.101  62.891 70.392 1.00 28.85 ? 392 ASP A C   1 
ATOM   3052 O O   . ASP A 1 392 ? 17.342  62.744 69.427 1.00 29.89 ? 392 ASP A O   1 
ATOM   3053 C CB  . ASP A 1 392 ? 18.038  65.003 71.828 1.00 31.76 ? 392 ASP A CB  1 
ATOM   3054 C CG  . ASP A 1 392 ? 17.721  65.861 70.593 1.00 36.07 ? 392 ASP A CG  1 
ATOM   3055 O OD1 . ASP A 1 392 ? 17.350  65.336 69.513 1.00 38.26 ? 392 ASP A OD1 1 
ATOM   3056 O OD2 . ASP A 1 392 ? 17.866  67.099 70.709 1.00 38.58 ? 392 ASP A OD2 1 
ATOM   3057 N N   . ASP A 1 393 ? 19.372  62.481 70.358 1.00 27.84 ? 393 ASP A N   1 
ATOM   3058 C CA  . ASP A 1 393 ? 19.935  61.853 69.158 1.00 25.88 ? 393 ASP A CA  1 
ATOM   3059 C C   . ASP A 1 393 ? 19.333  60.492 68.860 1.00 24.32 ? 393 ASP A C   1 
ATOM   3060 O O   . ASP A 1 393 ? 19.141  60.131 67.702 1.00 23.70 ? 393 ASP A O   1 
ATOM   3061 C CB  . ASP A 1 393 ? 21.443  61.712 69.276 1.00 27.58 ? 393 ASP A CB  1 
ATOM   3062 C CG  . ASP A 1 393 ? 22.152  63.040 69.185 1.00 31.18 ? 393 ASP A CG  1 
ATOM   3063 O OD1 . ASP A 1 393 ? 21.486  64.043 68.842 1.00 32.62 ? 393 ASP A OD1 1 
ATOM   3064 O OD2 . ASP A 1 393 ? 23.378  63.085 69.448 1.00 34.07 ? 393 ASP A OD2 1 
ATOM   3065 N N   . ILE A 1 394 ? 19.046  59.724 69.904 1.00 22.18 ? 394 ILE A N   1 
ATOM   3066 C CA  . ILE A 1 394 ? 18.446  58.414 69.713 1.00 19.41 ? 394 ILE A CA  1 
ATOM   3067 C C   . ILE A 1 394 ? 17.085  58.574 69.027 1.00 19.03 ? 394 ILE A C   1 
ATOM   3068 O O   . ILE A 1 394 ? 16.862  58.012 67.955 1.00 18.19 ? 394 ILE A O   1 
ATOM   3069 C CB  . ILE A 1 394 ? 18.295  57.679 71.058 1.00 17.65 ? 394 ILE A CB  1 
ATOM   3070 C CG1 . ILE A 1 394 ? 19.677  57.476 71.678 1.00 16.15 ? 394 ILE A CG1 1 
ATOM   3071 C CG2 . ILE A 1 394 ? 17.606  56.351 70.855 1.00 15.51 ? 394 ILE A CG2 1 
ATOM   3072 C CD1 . ILE A 1 394 ? 19.651  56.826 73.027 1.00 15.60 ? 394 ILE A CD1 1 
ATOM   3073 N N   . VAL A 1 395 ? 16.190  59.358 69.629 1.00 18.80 ? 395 VAL A N   1 
ATOM   3074 C CA  . VAL A 1 395 ? 14.868  59.584 69.049 1.00 18.81 ? 395 VAL A CA  1 
ATOM   3075 C C   . VAL A 1 395 ? 15.005  60.079 67.601 1.00 20.30 ? 395 VAL A C   1 
ATOM   3076 O O   . VAL A 1 395 ? 14.420  59.491 66.680 1.00 20.51 ? 395 VAL A O   1 
ATOM   3077 C CB  . VAL A 1 395 ? 14.032  60.627 69.865 1.00 17.67 ? 395 VAL A CB  1 
ATOM   3078 C CG1 . VAL A 1 395 ? 12.636  60.756 69.269 1.00 15.98 ? 395 VAL A CG1 1 
ATOM   3079 C CG2 . VAL A 1 395 ? 13.921  60.208 71.318 1.00 15.68 ? 395 VAL A CG2 1 
ATOM   3080 N N   . GLY A 1 396 ? 15.789  61.143 67.404 1.00 20.75 ? 396 GLY A N   1 
ATOM   3081 C CA  . GLY A 1 396 ? 15.980  61.706 66.074 1.00 21.22 ? 396 GLY A CA  1 
ATOM   3082 C C   . GLY A 1 396 ? 16.494  60.732 65.021 1.00 22.46 ? 396 GLY A C   1 
ATOM   3083 O O   . GLY A 1 396 ? 15.844  60.504 64.001 1.00 22.05 ? 396 GLY A O   1 
ATOM   3084 N N   . ASP A 1 397 ? 17.676  60.168 65.266 1.00 23.59 ? 397 ASP A N   1 
ATOM   3085 C CA  . ASP A 1 397 ? 18.311  59.215 64.357 1.00 23.27 ? 397 ASP A CA  1 
ATOM   3086 C C   . ASP A 1 397 ? 17.384  58.080 63.986 1.00 22.99 ? 397 ASP A C   1 
ATOM   3087 O O   . ASP A 1 397 ? 17.146  57.812 62.807 1.00 24.92 ? 397 ASP A O   1 
ATOM   3088 C CB  . ASP A 1 397 ? 19.549  58.600 65.002 1.00 23.53 ? 397 ASP A CB  1 
ATOM   3089 C CG  . ASP A 1 397 ? 20.642  59.596 65.211 1.00 25.27 ? 397 ASP A CG  1 
ATOM   3090 O OD1 . ASP A 1 397 ? 20.490  60.740 64.720 1.00 25.29 ? 397 ASP A OD1 1 
ATOM   3091 O OD2 . ASP A 1 397 ? 21.651  59.230 65.861 1.00 26.30 ? 397 ASP A OD2 1 
ATOM   3092 N N   . HIS A 1 398 ? 16.873  57.407 65.007 1.00 20.74 ? 398 HIS A N   1 
ATOM   3093 C CA  . HIS A 1 398 ? 16.005  56.277 64.792 1.00 18.98 ? 398 HIS A CA  1 
ATOM   3094 C C   . HIS A 1 398 ? 14.755  56.596 63.985 1.00 18.34 ? 398 HIS A C   1 
ATOM   3095 O O   . HIS A 1 398 ? 14.466  55.906 63.011 1.00 17.96 ? 398 HIS A O   1 
ATOM   3096 C CB  . HIS A 1 398 ? 15.626  55.637 66.133 1.00 18.21 ? 398 HIS A CB  1 
ATOM   3097 C CG  . HIS A 1 398 ? 14.595  54.564 66.006 1.00 18.92 ? 398 HIS A CG  1 
ATOM   3098 N ND1 . HIS A 1 398 ? 14.751  53.484 65.164 1.00 20.15 ? 398 HIS A ND1 1 
ATOM   3099 C CD2 . HIS A 1 398 ? 13.363  54.439 66.554 1.00 19.40 ? 398 HIS A CD2 1 
ATOM   3100 C CE1 . HIS A 1 398 ? 13.658  52.744 65.196 1.00 21.19 ? 398 HIS A CE1 1 
ATOM   3101 N NE2 . HIS A 1 398 ? 12.799  53.301 66.032 1.00 20.14 ? 398 HIS A NE2 1 
ATOM   3102 N N   . ASN A 1 399 ? 14.032  57.651 64.354 1.00 17.71 ? 399 ASN A N   1 
ATOM   3103 C CA  . ASN A 1 399 ? 12.792  57.982 63.657 1.00 17.33 ? 399 ASN A CA  1 
ATOM   3104 C C   . ASN A 1 399 ? 12.800  58.910 62.454 1.00 17.88 ? 399 ASN A C   1 
ATOM   3105 O O   . ASN A 1 399 ? 11.856  58.873 61.675 1.00 20.44 ? 399 ASN A O   1 
ATOM   3106 C CB  . ASN A 1 399 ? 11.781  58.544 64.635 1.00 16.44 ? 399 ASN A CB  1 
ATOM   3107 C CG  . ASN A 1 399 ? 11.472  57.594 65.752 1.00 17.46 ? 399 ASN A CG  1 
ATOM   3108 O OD1 . ASN A 1 399 ? 10.713  56.630 65.586 1.00 16.65 ? 399 ASN A OD1 1 
ATOM   3109 N ND2 . ASN A 1 399 ? 12.062  57.853 66.909 1.00 16.98 ? 399 ASN A ND2 1 
ATOM   3110 N N   . VAL A 1 400 ? 13.819  59.740 62.271 1.00 16.14 ? 400 VAL A N   1 
ATOM   3111 C CA  . VAL A 1 400 ? 13.764  60.651 61.145 1.00 14.39 ? 400 VAL A CA  1 
ATOM   3112 C C   . VAL A 1 400 ? 14.981  60.626 60.257 1.00 16.92 ? 400 VAL A C   1 
ATOM   3113 O O   . VAL A 1 400 ? 14.869  60.342 59.065 1.00 18.21 ? 400 VAL A O   1 
ATOM   3114 C CB  . VAL A 1 400 ? 13.542  62.116 61.608 1.00 11.44 ? 400 VAL A CB  1 
ATOM   3115 C CG1 . VAL A 1 400 ? 13.267  62.990 60.427 1.00 10.74 ? 400 VAL A CG1 1 
ATOM   3116 C CG2 . VAL A 1 400 ? 12.390  62.206 62.552 1.00 8.51  ? 400 VAL A CG2 1 
ATOM   3117 N N   . ILE A 1 401 ? 16.146  60.931 60.825 1.00 18.10 ? 401 ILE A N   1 
ATOM   3118 C CA  . ILE A 1 401 ? 17.387  60.973 60.045 1.00 17.58 ? 401 ILE A CA  1 
ATOM   3119 C C   . ILE A 1 401 ? 17.792  59.668 59.383 1.00 17.51 ? 401 ILE A C   1 
ATOM   3120 O O   . ILE A 1 401 ? 17.743  59.555 58.148 1.00 16.10 ? 401 ILE A O   1 
ATOM   3121 C CB  . ILE A 1 401 ? 18.539  61.496 60.906 1.00 17.72 ? 401 ILE A CB  1 
ATOM   3122 C CG1 . ILE A 1 401 ? 18.229  62.951 61.253 1.00 17.55 ? 401 ILE A CG1 1 
ATOM   3123 C CG2 . ILE A 1 401 ? 19.884  61.325 60.189 1.00 13.84 ? 401 ILE A CG2 1 
ATOM   3124 C CD1 . ILE A 1 401 ? 19.171  63.560 62.212 1.00 19.71 ? 401 ILE A CD1 1 
ATOM   3125 N N   . CYS A 1 402 ? 18.171  58.674 60.177 1.00 17.32 ? 402 CYS A N   1 
ATOM   3126 C CA  . CYS A 1 402 ? 18.570  57.421 59.571 1.00 19.83 ? 402 CYS A CA  1 
ATOM   3127 C C   . CYS A 1 402 ? 17.611  56.806 58.558 1.00 20.43 ? 402 CYS A C   1 
ATOM   3128 O O   . CYS A 1 402 ? 18.076  56.295 57.549 1.00 22.63 ? 402 CYS A O   1 
ATOM   3129 C CB  . CYS A 1 402 ? 18.930  56.408 60.625 1.00 20.85 ? 402 CYS A CB  1 
ATOM   3130 S SG  . CYS A 1 402 ? 20.436  56.913 61.498 1.00 26.58 ? 402 CYS A SG  1 
ATOM   3131 N N   . PRO A 1 403 ? 16.277  56.827 58.798 1.00 19.65 ? 403 PRO A N   1 
ATOM   3132 C CA  . PRO A 1 403 ? 15.376  56.237 57.792 1.00 17.55 ? 403 PRO A CA  1 
ATOM   3133 C C   . PRO A 1 403 ? 15.442  57.006 56.466 1.00 17.27 ? 403 PRO A C   1 
ATOM   3134 O O   . PRO A 1 403 ? 15.365  56.403 55.394 1.00 14.69 ? 403 PRO A O   1 
ATOM   3135 C CB  . PRO A 1 403 ? 13.996  56.359 58.429 1.00 16.64 ? 403 PRO A CB  1 
ATOM   3136 C CG  . PRO A 1 403 ? 14.295  56.317 59.878 1.00 19.24 ? 403 PRO A CG  1 
ATOM   3137 C CD  . PRO A 1 403 ? 15.531  57.167 60.023 1.00 19.43 ? 403 PRO A CD  1 
ATOM   3138 N N   . LEU A 1 404 ? 15.588  58.336 56.558 1.00 17.85 ? 404 LEU A N   1 
ATOM   3139 C CA  . LEU A 1 404 ? 15.650  59.209 55.383 1.00 18.02 ? 404 LEU A CA  1 
ATOM   3140 C C   . LEU A 1 404 ? 16.938  58.963 54.644 1.00 18.15 ? 404 LEU A C   1 
ATOM   3141 O O   . LEU A 1 404 ? 16.959  58.912 53.415 1.00 17.86 ? 404 LEU A O   1 
ATOM   3142 C CB  . LEU A 1 404 ? 15.554  60.698 55.775 1.00 18.47 ? 404 LEU A CB  1 
ATOM   3143 C CG  . LEU A 1 404 ? 15.681  61.791 54.677 1.00 17.88 ? 404 LEU A CG  1 
ATOM   3144 C CD1 . LEU A 1 404 ? 14.993  63.082 55.122 1.00 15.96 ? 404 LEU A CD1 1 
ATOM   3145 C CD2 . LEU A 1 404 ? 17.150  62.055 54.351 1.00 14.39 ? 404 LEU A CD2 1 
ATOM   3146 N N   . MET A 1 405 ? 18.023  58.818 55.386 1.00 18.56 ? 405 MET A N   1 
ATOM   3147 C CA  . MET A 1 405 ? 19.286  58.549 54.726 1.00 20.09 ? 405 MET A CA  1 
ATOM   3148 C C   . MET A 1 405 ? 19.182  57.243 53.943 1.00 20.40 ? 405 MET A C   1 
ATOM   3149 O O   . MET A 1 405 ? 19.690  57.134 52.841 1.00 20.67 ? 405 MET A O   1 
ATOM   3150 C CB  . MET A 1 405 ? 20.420  58.485 55.742 1.00 19.36 ? 405 MET A CB  1 
ATOM   3151 C CG  . MET A 1 405 ? 20.785  59.848 56.272 1.00 19.99 ? 405 MET A CG  1 
ATOM   3152 S SD  . MET A 1 405 ? 20.932  61.015 54.920 1.00 20.29 ? 405 MET A SD  1 
ATOM   3153 C CE  . MET A 1 405 ? 22.585  60.512 54.254 1.00 22.22 ? 405 MET A CE  1 
ATOM   3154 N N   . HIS A 1 406 ? 18.504  56.256 54.504 1.00 21.46 ? 406 HIS A N   1 
ATOM   3155 C CA  . HIS A 1 406 ? 18.342  54.999 53.811 1.00 23.07 ? 406 HIS A CA  1 
ATOM   3156 C C   . HIS A 1 406 ? 17.576  55.262 52.523 1.00 24.93 ? 406 HIS A C   1 
ATOM   3157 O O   . HIS A 1 406 ? 17.989  54.856 51.444 1.00 26.75 ? 406 HIS A O   1 
ATOM   3158 C CB  . HIS A 1 406 ? 17.541  54.034 54.657 1.00 23.07 ? 406 HIS A CB  1 
ATOM   3159 C CG  . HIS A 1 406 ? 17.425  52.675 54.055 1.00 25.16 ? 406 HIS A CG  1 
ATOM   3160 N ND1 . HIS A 1 406 ? 18.443  51.750 54.112 1.00 26.42 ? 406 HIS A ND1 1 
ATOM   3161 C CD2 . HIS A 1 406 ? 16.421  52.087 53.363 1.00 26.64 ? 406 HIS A CD2 1 
ATOM   3162 C CE1 . HIS A 1 406 ? 18.071  50.648 53.485 1.00 27.47 ? 406 HIS A CE1 1 
ATOM   3163 N NE2 . HIS A 1 406 ? 16.847  50.826 53.021 1.00 26.95 ? 406 HIS A NE2 1 
ATOM   3164 N N   . PHE A 1 407 ? 16.445  55.945 52.648 1.00 26.58 ? 407 PHE A N   1 
ATOM   3165 C CA  . PHE A 1 407 ? 15.598  56.263 51.503 1.00 25.78 ? 407 PHE A CA  1 
ATOM   3166 C C   . PHE A 1 407 ? 16.388  57.013 50.477 1.00 25.88 ? 407 PHE A C   1 
ATOM   3167 O O   . PHE A 1 407 ? 16.223  56.786 49.291 1.00 26.79 ? 407 PHE A O   1 
ATOM   3168 C CB  . PHE A 1 407 ? 14.403  57.121 51.924 1.00 25.87 ? 407 PHE A CB  1 
ATOM   3169 C CG  . PHE A 1 407 ? 13.604  57.641 50.776 1.00 23.84 ? 407 PHE A CG  1 
ATOM   3170 C CD1 . PHE A 1 407 ? 12.796  56.795 50.039 1.00 22.11 ? 407 PHE A CD1 1 
ATOM   3171 C CD2 . PHE A 1 407 ? 13.681  58.983 50.412 1.00 24.47 ? 407 PHE A CD2 1 
ATOM   3172 C CE1 . PHE A 1 407 ? 12.083  57.270 48.961 1.00 22.28 ? 407 PHE A CE1 1 
ATOM   3173 C CE2 . PHE A 1 407 ? 12.962  59.472 49.323 1.00 23.15 ? 407 PHE A CE2 1 
ATOM   3174 C CZ  . PHE A 1 407 ? 12.165  58.616 48.600 1.00 22.04 ? 407 PHE A CZ  1 
ATOM   3175 N N   . VAL A 1 408 ? 17.245  57.918 50.929 1.00 26.14 ? 408 VAL A N   1 
ATOM   3176 C CA  . VAL A 1 408 ? 18.048  58.684 49.993 1.00 26.74 ? 408 VAL A CA  1 
ATOM   3177 C C   . VAL A 1 408 ? 19.060  57.848 49.237 1.00 27.46 ? 408 VAL A C   1 
ATOM   3178 O O   . VAL A 1 408 ? 19.251  58.052 48.045 1.00 28.06 ? 408 VAL A O   1 
ATOM   3179 C CB  . VAL A 1 408 ? 18.770  59.841 50.676 1.00 25.89 ? 408 VAL A CB  1 
ATOM   3180 C CG1 . VAL A 1 408 ? 20.140  60.043 50.075 1.00 23.71 ? 408 VAL A CG1 1 
ATOM   3181 C CG2 . VAL A 1 408 ? 17.958  61.089 50.485 1.00 26.24 ? 408 VAL A CG2 1 
ATOM   3182 N N   . ASN A 1 409 ? 19.713  56.908 49.905 1.00 28.27 ? 409 ASN A N   1 
ATOM   3183 C CA  . ASN A 1 409 ? 20.679  56.099 49.196 1.00 29.51 ? 409 ASN A CA  1 
ATOM   3184 C C   . ASN A 1 409 ? 19.982  55.231 48.194 1.00 30.17 ? 409 ASN A C   1 
ATOM   3185 O O   . ASN A 1 409 ? 20.292  55.302 47.013 1.00 32.45 ? 409 ASN A O   1 
ATOM   3186 C CB  . ASN A 1 409 ? 21.496  55.253 50.151 1.00 31.13 ? 409 ASN A CB  1 
ATOM   3187 C CG  . ASN A 1 409 ? 22.377  56.102 51.036 1.00 34.93 ? 409 ASN A CG  1 
ATOM   3188 O OD1 . ASN A 1 409 ? 23.019  57.044 50.554 1.00 36.44 ? 409 ASN A OD1 1 
ATOM   3189 N ND2 . ASN A 1 409 ? 22.417  55.788 52.335 1.00 35.28 ? 409 ASN A ND2 1 
ATOM   3190 N N   . LYS A 1 410 ? 19.010  54.441 48.631 1.00 29.59 ? 410 LYS A N   1 
ATOM   3191 C CA  . LYS A 1 410 ? 18.318  53.555 47.692 1.00 29.87 ? 410 LYS A CA  1 
ATOM   3192 C C   . LYS A 1 410 ? 17.643  54.315 46.548 1.00 29.40 ? 410 LYS A C   1 
ATOM   3193 O O   . LYS A 1 410 ? 17.458  53.787 45.448 1.00 28.62 ? 410 LYS A O   1 
ATOM   3194 C CB  . LYS A 1 410 ? 17.288  52.674 48.425 1.00 30.08 ? 410 LYS A CB  1 
ATOM   3195 C CG  . LYS A 1 410 ? 17.858  51.829 49.586 1.00 31.43 ? 410 LYS A CG  1 
ATOM   3196 C CD  . LYS A 1 410 ? 19.046  50.934 49.181 1.00 30.50 ? 410 LYS A CD  1 
ATOM   3197 C CE  . LYS A 1 410 ? 18.617  49.579 48.618 1.00 29.61 ? 410 LYS A CE  1 
ATOM   3198 N NZ  . LYS A 1 410 ? 18.055  48.666 49.665 1.00 27.69 ? 410 LYS A NZ  1 
ATOM   3199 N N   . TYR A 1 411 ? 17.293  55.567 46.799 1.00 29.77 ? 411 TYR A N   1 
ATOM   3200 C CA  . TYR A 1 411 ? 16.625  56.345 45.772 1.00 30.32 ? 411 TYR A CA  1 
ATOM   3201 C C   . TYR A 1 411 ? 17.571  56.849 44.718 1.00 30.06 ? 411 TYR A C   1 
ATOM   3202 O O   . TYR A 1 411 ? 17.380  56.553 43.553 1.00 29.84 ? 411 TYR A O   1 
ATOM   3203 C CB  . TYR A 1 411 ? 15.867  57.567 46.351 1.00 29.38 ? 411 TYR A CB  1 
ATOM   3204 C CG  . TYR A 1 411 ? 15.049  58.296 45.294 1.00 27.26 ? 411 TYR A CG  1 
ATOM   3205 C CD1 . TYR A 1 411 ? 13.807  57.795 44.883 1.00 26.37 ? 411 TYR A CD1 1 
ATOM   3206 C CD2 . TYR A 1 411 ? 15.555  59.421 44.631 1.00 26.08 ? 411 TYR A CD2 1 
ATOM   3207 C CE1 . TYR A 1 411 ? 13.090  58.380 43.838 1.00 25.44 ? 411 TYR A CE1 1 
ATOM   3208 C CE2 . TYR A 1 411 ? 14.839  60.016 43.578 1.00 25.86 ? 411 TYR A CE2 1 
ATOM   3209 C CZ  . TYR A 1 411 ? 13.610  59.479 43.193 1.00 25.97 ? 411 TYR A CZ  1 
ATOM   3210 O OH  . TYR A 1 411 ? 12.905  60.005 42.144 1.00 26.65 ? 411 TYR A OH  1 
ATOM   3211 N N   . THR A 1 412 ? 18.586  57.607 45.126 1.00 31.00 ? 412 THR A N   1 
ATOM   3212 C CA  . THR A 1 412 ? 19.511  58.200 44.170 1.00 33.35 ? 412 THR A CA  1 
ATOM   3213 C C   . THR A 1 412 ? 20.209  57.200 43.257 1.00 35.80 ? 412 THR A C   1 
ATOM   3214 O O   . THR A 1 412 ? 20.919  57.583 42.331 1.00 37.30 ? 412 THR A O   1 
ATOM   3215 C CB  . THR A 1 412 ? 20.567  59.080 44.865 1.00 31.72 ? 412 THR A CB  1 
ATOM   3216 O OG1 . THR A 1 412 ? 21.691  58.287 45.239 1.00 29.89 ? 412 THR A OG1 1 
ATOM   3217 C CG2 . THR A 1 412 ? 19.977  59.731 46.095 1.00 30.69 ? 412 THR A CG2 1 
ATOM   3218 N N   . LYS A 1 413 ? 19.978  55.918 43.501 1.00 37.59 ? 413 LYS A N   1 
ATOM   3219 C CA  . LYS A 1 413 ? 20.559  54.860 42.689 1.00 37.95 ? 413 LYS A CA  1 
ATOM   3220 C C   . LYS A 1 413 ? 19.789  54.699 41.366 1.00 37.85 ? 413 LYS A C   1 
ATOM   3221 O O   . LYS A 1 413 ? 20.195  53.959 40.486 1.00 37.85 ? 413 LYS A O   1 
ATOM   3222 C CB  . LYS A 1 413 ? 20.514  53.570 43.493 1.00 39.44 ? 413 LYS A CB  1 
ATOM   3223 C CG  . LYS A 1 413 ? 21.170  52.403 42.838 1.00 43.25 ? 413 LYS A CG  1 
ATOM   3224 C CD  . LYS A 1 413 ? 21.303  51.261 43.832 1.00 46.79 ? 413 LYS A CD  1 
ATOM   3225 N N   . PHE A 1 414 ? 18.677  55.414 41.239 1.00 38.78 ? 414 PHE A N   1 
ATOM   3226 C CA  . PHE A 1 414 ? 17.818  55.363 40.057 1.00 39.56 ? 414 PHE A CA  1 
ATOM   3227 C C   . PHE A 1 414 ? 17.253  56.746 39.765 1.00 40.49 ? 414 PHE A C   1 
ATOM   3228 O O   . PHE A 1 414 ? 16.879  57.052 38.636 1.00 40.99 ? 414 PHE A O   1 
ATOM   3229 C CB  . PHE A 1 414 ? 16.628  54.438 40.304 1.00 39.11 ? 414 PHE A CB  1 
ATOM   3230 C CG  . PHE A 1 414 ? 16.998  53.011 40.534 1.00 39.87 ? 414 PHE A CG  1 
ATOM   3231 C CD1 . PHE A 1 414 ? 17.191  52.151 39.470 1.00 40.31 ? 414 PHE A CD1 1 
ATOM   3232 C CD2 . PHE A 1 414 ? 17.112  52.511 41.819 1.00 41.83 ? 414 PHE A CD2 1 
ATOM   3233 C CE1 . PHE A 1 414 ? 17.487  50.811 39.680 1.00 39.94 ? 414 PHE A CE1 1 
ATOM   3234 C CE2 . PHE A 1 414 ? 17.409  51.169 42.040 1.00 41.76 ? 414 PHE A CE2 1 
ATOM   3235 C CZ  . PHE A 1 414 ? 17.594  50.322 40.964 1.00 40.49 ? 414 PHE A CZ  1 
ATOM   3236 N N   . GLY A 1 415 ? 17.170  57.567 40.805 1.00 41.56 ? 415 GLY A N   1 
ATOM   3237 C CA  . GLY A 1 415 ? 16.621  58.905 40.676 1.00 42.96 ? 415 GLY A CA  1 
ATOM   3238 C C   . GLY A 1 415 ? 17.321  59.807 39.690 1.00 43.35 ? 415 GLY A C   1 
ATOM   3239 O O   . GLY A 1 415 ? 18.479  59.586 39.342 1.00 43.88 ? 415 GLY A O   1 
ATOM   3240 N N   . ASN A 1 416 ? 16.619  60.844 39.253 1.00 43.66 ? 416 ASN A N   1 
ATOM   3241 C CA  . ASN A 1 416 ? 17.184  61.765 38.293 1.00 45.37 ? 416 ASN A CA  1 
ATOM   3242 C C   . ASN A 1 416 ? 17.704  63.042 38.936 1.00 44.14 ? 416 ASN A C   1 
ATOM   3243 O O   . ASN A 1 416 ? 17.662  64.106 38.330 1.00 44.79 ? 416 ASN A O   1 
ATOM   3244 C CB  . ASN A 1 416 ? 16.138  62.110 37.247 1.00 50.31 ? 416 ASN A CB  1 
ATOM   3245 C CG  . ASN A 1 416 ? 16.713  62.869 36.078 1.00 55.98 ? 416 ASN A CG  1 
ATOM   3246 O OD1 . ASN A 1 416 ? 15.978  63.574 35.383 1.00 55.97 ? 416 ASN A OD1 1 
ATOM   3247 N ND2 . ASN A 1 416 ? 18.017  62.720 35.847 1.00 63.07 ? 416 ASN A ND2 1 
ATOM   3248 N N   . GLY A 1 417 ? 18.203  62.938 40.160 1.00 42.95 ? 417 GLY A N   1 
ATOM   3249 C CA  . GLY A 1 417 ? 18.730  64.107 40.842 1.00 40.89 ? 417 GLY A CA  1 
ATOM   3250 C C   . GLY A 1 417 ? 18.365  64.047 42.302 1.00 39.71 ? 417 GLY A C   1 
ATOM   3251 O O   . GLY A 1 417 ? 17.237  63.711 42.632 1.00 40.69 ? 417 GLY A O   1 
ATOM   3252 N N   . THR A 1 418 ? 19.307  64.361 43.182 1.00 38.37 ? 418 THR A N   1 
ATOM   3253 C CA  . THR A 1 418 ? 19.041  64.321 44.618 1.00 36.39 ? 418 THR A CA  1 
ATOM   3254 C C   . THR A 1 418 ? 19.774  65.447 45.337 1.00 35.21 ? 418 THR A C   1 
ATOM   3255 O O   . THR A 1 418 ? 20.999  65.532 45.270 1.00 35.38 ? 418 THR A O   1 
ATOM   3256 C CB  . THR A 1 418 ? 19.471  62.958 45.219 1.00 35.58 ? 418 THR A CB  1 
ATOM   3257 O OG1 . THR A 1 418 ? 18.727  61.907 44.588 1.00 36.72 ? 418 THR A OG1 1 
ATOM   3258 C CG2 . THR A 1 418 ? 19.202  62.915 46.703 1.00 34.39 ? 418 THR A CG2 1 
ATOM   3259 N N   . TYR A 1 419 ? 19.022  66.319 46.009 1.00 33.59 ? 419 TYR A N   1 
ATOM   3260 C CA  . TYR A 1 419 ? 19.613  67.434 46.750 1.00 32.99 ? 419 TYR A CA  1 
ATOM   3261 C C   . TYR A 1 419 ? 19.286  67.300 48.239 1.00 32.11 ? 419 TYR A C   1 
ATOM   3262 O O   . TYR A 1 419 ? 18.119  67.167 48.607 1.00 32.90 ? 419 TYR A O   1 
ATOM   3263 C CB  . TYR A 1 419 ? 19.104  68.765 46.189 1.00 33.34 ? 419 TYR A CB  1 
ATOM   3264 C CG  . TYR A 1 419 ? 19.533  68.995 44.753 1.00 33.00 ? 419 TYR A CG  1 
ATOM   3265 C CD1 . TYR A 1 419 ? 20.781  69.538 44.456 1.00 32.02 ? 419 TYR A CD1 1 
ATOM   3266 C CD2 . TYR A 1 419 ? 18.716  68.618 43.696 1.00 33.34 ? 419 TYR A CD2 1 
ATOM   3267 C CE1 . TYR A 1 419 ? 21.201  69.695 43.155 1.00 32.36 ? 419 TYR A CE1 1 
ATOM   3268 C CE2 . TYR A 1 419 ? 19.127  68.768 42.389 1.00 33.88 ? 419 TYR A CE2 1 
ATOM   3269 C CZ  . TYR A 1 419 ? 20.371  69.306 42.121 1.00 33.87 ? 419 TYR A CZ  1 
ATOM   3270 O OH  . TYR A 1 419 ? 20.783  69.434 40.810 1.00 35.62 ? 419 TYR A OH  1 
ATOM   3271 N N   . LEU A 1 420 ? 20.310  67.354 49.092 1.00 29.66 ? 420 LEU A N   1 
ATOM   3272 C CA  . LEU A 1 420 ? 20.099  67.153 50.523 1.00 27.73 ? 420 LEU A CA  1 
ATOM   3273 C C   . LEU A 1 420 ? 20.620  68.246 51.456 1.00 28.16 ? 420 LEU A C   1 
ATOM   3274 O O   . LEU A 1 420 ? 21.804  68.580 51.450 1.00 29.32 ? 420 LEU A O   1 
ATOM   3275 C CB  . LEU A 1 420 ? 20.708  65.802 50.907 1.00 25.18 ? 420 LEU A CB  1 
ATOM   3276 C CG  . LEU A 1 420 ? 20.660  65.360 52.357 1.00 23.11 ? 420 LEU A CG  1 
ATOM   3277 C CD1 . LEU A 1 420 ? 19.231  65.441 52.860 1.00 23.05 ? 420 LEU A CD1 1 
ATOM   3278 C CD2 . LEU A 1 420 ? 21.200  63.959 52.468 1.00 20.65 ? 420 LEU A CD2 1 
ATOM   3279 N N   . TYR A 1 421 ? 19.728  68.777 52.287 1.00 27.60 ? 421 TYR A N   1 
ATOM   3280 C CA  . TYR A 1 421 ? 20.095  69.840 53.220 1.00 26.78 ? 421 TYR A CA  1 
ATOM   3281 C C   . TYR A 1 421 ? 20.037  69.381 54.672 1.00 26.95 ? 421 TYR A C   1 
ATOM   3282 O O   . TYR A 1 421 ? 19.363  68.413 55.000 1.00 26.96 ? 421 TYR A O   1 
ATOM   3283 C CB  . TYR A 1 421 ? 19.159  71.046 53.036 1.00 24.60 ? 421 TYR A CB  1 
ATOM   3284 C CG  . TYR A 1 421 ? 17.749  70.812 53.547 1.00 22.32 ? 421 TYR A CG  1 
ATOM   3285 C CD1 . TYR A 1 421 ? 17.453  70.917 54.897 1.00 21.24 ? 421 TYR A CD1 1 
ATOM   3286 C CD2 . TYR A 1 421 ? 16.726  70.435 52.681 1.00 21.92 ? 421 TYR A CD2 1 
ATOM   3287 C CE1 . TYR A 1 421 ? 16.180  70.646 55.375 1.00 21.35 ? 421 TYR A CE1 1 
ATOM   3288 C CE2 . TYR A 1 421 ? 15.447  70.162 53.145 1.00 20.61 ? 421 TYR A CE2 1 
ATOM   3289 C CZ  . TYR A 1 421 ? 15.176  70.264 54.495 1.00 21.10 ? 421 TYR A CZ  1 
ATOM   3290 O OH  . TYR A 1 421 ? 13.919  69.942 54.978 1.00 20.22 ? 421 TYR A OH  1 
ATOM   3291 N N   . PHE A 1 422 ? 20.758  70.090 55.533 1.00 27.86 ? 422 PHE A N   1 
ATOM   3292 C CA  . PHE A 1 422 ? 20.777  69.809 56.964 1.00 28.96 ? 422 PHE A CA  1 
ATOM   3293 C C   . PHE A 1 422 ? 20.542  71.155 57.623 1.00 29.82 ? 422 PHE A C   1 
ATOM   3294 O O   . PHE A 1 422 ? 21.473  71.955 57.745 1.00 30.22 ? 422 PHE A O   1 
ATOM   3295 C CB  . PHE A 1 422 ? 22.135  69.284 57.393 1.00 29.21 ? 422 PHE A CB  1 
ATOM   3296 C CG  . PHE A 1 422 ? 22.270  69.110 58.870 1.00 30.00 ? 422 PHE A CG  1 
ATOM   3297 C CD1 . PHE A 1 422 ? 21.607  68.082 59.525 1.00 30.95 ? 422 PHE A CD1 1 
ATOM   3298 C CD2 . PHE A 1 422 ? 23.065  69.971 59.612 1.00 30.47 ? 422 PHE A CD2 1 
ATOM   3299 C CE1 . PHE A 1 422 ? 21.738  67.910 60.917 1.00 31.55 ? 422 PHE A CE1 1 
ATOM   3300 C CE2 . PHE A 1 422 ? 23.202  69.811 60.995 1.00 31.01 ? 422 PHE A CE2 1 
ATOM   3301 C CZ  . PHE A 1 422 ? 22.534  68.773 61.649 1.00 30.82 ? 422 PHE A CZ  1 
ATOM   3302 N N   . PHE A 1 423 ? 19.299  71.407 58.028 1.00 30.17 ? 423 PHE A N   1 
ATOM   3303 C CA  . PHE A 1 423 ? 18.921  72.677 58.650 1.00 30.46 ? 423 PHE A CA  1 
ATOM   3304 C C   . PHE A 1 423 ? 19.315  72.723 60.122 1.00 31.65 ? 423 PHE A C   1 
ATOM   3305 O O   . PHE A 1 423 ? 19.006  71.812 60.892 1.00 32.17 ? 423 PHE A O   1 
ATOM   3306 C CB  . PHE A 1 423 ? 17.419  72.880 58.515 1.00 29.08 ? 423 PHE A CB  1 
ATOM   3307 C CG  . PHE A 1 423 ? 16.927  74.174 59.073 1.00 27.41 ? 423 PHE A CG  1 
ATOM   3308 C CD1 . PHE A 1 423 ? 17.027  75.340 58.337 1.00 26.65 ? 423 PHE A CD1 1 
ATOM   3309 C CD2 . PHE A 1 423 ? 16.305  74.214 60.318 1.00 27.33 ? 423 PHE A CD2 1 
ATOM   3310 C CE1 . PHE A 1 423 ? 16.505  76.532 58.828 1.00 27.31 ? 423 PHE A CE1 1 
ATOM   3311 C CE2 . PHE A 1 423 ? 15.779  75.401 60.818 1.00 27.03 ? 423 PHE A CE2 1 
ATOM   3312 C CZ  . PHE A 1 423 ? 15.877  76.563 60.071 1.00 27.13 ? 423 PHE A CZ  1 
ATOM   3313 N N   . ASN A 1 424 ? 19.976  73.796 60.528 1.00 31.91 ? 424 ASN A N   1 
ATOM   3314 C CA  . ASN A 1 424 ? 20.407  73.868 61.903 1.00 32.43 ? 424 ASN A CA  1 
ATOM   3315 C C   . ASN A 1 424 ? 20.520  75.275 62.454 1.00 33.16 ? 424 ASN A C   1 
ATOM   3316 O O   . ASN A 1 424 ? 21.417  75.570 63.233 1.00 34.01 ? 424 ASN A O   1 
ATOM   3317 C CB  . ASN A 1 424 ? 21.737  73.173 62.028 1.00 31.64 ? 424 ASN A CB  1 
ATOM   3318 C CG  . ASN A 1 424 ? 22.774  73.821 61.179 1.00 32.56 ? 424 ASN A CG  1 
ATOM   3319 O OD1 . ASN A 1 424 ? 22.471  74.722 60.394 1.00 33.19 ? 424 ASN A OD1 1 
ATOM   3320 N ND2 . ASN A 1 424 ? 24.008  73.377 61.316 1.00 34.35 ? 424 ASN A ND2 1 
ATOM   3321 N N   . HIS A 1 425 ? 19.620  76.150 62.044 1.00 33.56 ? 425 HIS A N   1 
ATOM   3322 C CA  . HIS A 1 425 ? 19.620  77.492 62.573 1.00 34.41 ? 425 HIS A CA  1 
ATOM   3323 C C   . HIS A 1 425 ? 18.493  77.587 63.604 1.00 35.99 ? 425 HIS A C   1 
ATOM   3324 O O   . HIS A 1 425 ? 17.363  77.183 63.325 1.00 36.30 ? 425 HIS A O   1 
ATOM   3325 C CB  . HIS A 1 425 ? 19.349  78.498 61.469 1.00 33.76 ? 425 HIS A CB  1 
ATOM   3326 C CG  . HIS A 1 425 ? 19.127  79.885 61.979 1.00 34.56 ? 425 HIS A CG  1 
ATOM   3327 N ND1 . HIS A 1 425 ? 20.146  80.659 62.494 1.00 34.49 ? 425 HIS A ND1 1 
ATOM   3328 C CD2 . HIS A 1 425 ? 17.993  80.612 62.119 1.00 35.00 ? 425 HIS A CD2 1 
ATOM   3329 C CE1 . HIS A 1 425 ? 19.648  81.803 62.930 1.00 35.69 ? 425 HIS A CE1 1 
ATOM   3330 N NE2 . HIS A 1 425 ? 18.344  81.800 62.716 1.00 35.54 ? 425 HIS A NE2 1 
ATOM   3331 N N   . ARG A 1 426 ? 18.783  78.105 64.795 1.00 37.62 ? 426 ARG A N   1 
ATOM   3332 C CA  . ARG A 1 426 ? 17.725  78.254 65.794 1.00 39.12 ? 426 ARG A CA  1 
ATOM   3333 C C   . ARG A 1 426 ? 17.181  79.673 65.767 1.00 39.42 ? 426 ARG A C   1 
ATOM   3334 O O   . ARG A 1 426 ? 17.880  80.622 66.140 1.00 39.25 ? 426 ARG A O   1 
ATOM   3335 C CB  . ARG A 1 426 ? 18.223  77.942 67.205 1.00 40.53 ? 426 ARG A CB  1 
ATOM   3336 C CG  . ARG A 1 426 ? 17.132  78.096 68.274 1.00 42.75 ? 426 ARG A CG  1 
ATOM   3337 C CD  . ARG A 1 426 ? 17.531  77.419 69.563 1.00 45.04 ? 426 ARG A CD  1 
ATOM   3338 N NE  . ARG A 1 426 ? 16.473  77.409 70.572 1.00 48.16 ? 426 ARG A NE  1 
ATOM   3339 C CZ  . ARG A 1 426 ? 16.108  78.454 71.309 1.00 50.19 ? 426 ARG A CZ  1 
ATOM   3340 N NH1 . ARG A 1 426 ? 16.712  79.628 71.153 1.00 51.80 ? 426 ARG A NH1 1 
ATOM   3341 N NH2 . ARG A 1 426 ? 15.165  78.313 72.236 1.00 50.48 ? 426 ARG A NH2 1 
ATOM   3342 N N   . ALA A 1 427 ? 15.932  79.809 65.325 1.00 39.54 ? 427 ALA A N   1 
ATOM   3343 C CA  . ALA A 1 427 ? 15.281  81.110 65.239 1.00 40.00 ? 427 ALA A CA  1 
ATOM   3344 C C   . ALA A 1 427 ? 15.575  81.940 66.477 1.00 40.75 ? 427 ALA A C   1 
ATOM   3345 O O   . ALA A 1 427 ? 15.484  81.446 67.604 1.00 41.11 ? 427 ALA A O   1 
ATOM   3346 C CB  . ALA A 1 427 ? 13.784  80.940 65.072 1.00 39.46 ? 427 ALA A CB  1 
ATOM   3347 N N   . SER A 1 428 ? 15.929  83.202 66.250 1.00 41.06 ? 428 SER A N   1 
ATOM   3348 C CA  . SER A 1 428 ? 16.251  84.134 67.323 1.00 40.23 ? 428 SER A CA  1 
ATOM   3349 C C   . SER A 1 428 ? 15.105  84.285 68.310 1.00 40.18 ? 428 SER A C   1 
ATOM   3350 O O   . SER A 1 428 ? 15.337  84.473 69.498 1.00 40.64 ? 428 SER A O   1 
ATOM   3351 C CB  . SER A 1 428 ? 16.580  85.514 66.751 1.00 39.87 ? 428 SER A CB  1 
ATOM   3352 O OG  . SER A 1 428 ? 15.409  86.307 66.619 1.00 38.55 ? 428 SER A OG  1 
ATOM   3353 N N   . ASN A 1 429 ? 13.872  84.197 67.818 1.00 39.93 ? 429 ASN A N   1 
ATOM   3354 C CA  . ASN A 1 429 ? 12.703  84.359 68.673 1.00 40.39 ? 429 ASN A CA  1 
ATOM   3355 C C   . ASN A 1 429 ? 11.950  83.096 69.076 1.00 40.30 ? 429 ASN A C   1 
ATOM   3356 O O   . ASN A 1 429 ? 10.806  83.191 69.526 1.00 41.44 ? 429 ASN A O   1 
ATOM   3357 C CB  . ASN A 1 429 ? 11.705  85.318 68.019 1.00 41.10 ? 429 ASN A CB  1 
ATOM   3358 C CG  . ASN A 1 429 ? 11.291  84.870 66.629 1.00 41.82 ? 429 ASN A CG  1 
ATOM   3359 O OD1 . ASN A 1 429 ? 11.614  83.759 66.199 1.00 41.92 ? 429 ASN A OD1 1 
ATOM   3360 N ND2 . ASN A 1 429 ? 10.567  85.733 65.920 1.00 41.90 ? 429 ASN A ND2 1 
ATOM   3361 N N   . LEU A 1 430 ? 12.554  81.922 68.926 1.00 39.36 ? 430 LEU A N   1 
ATOM   3362 C CA  . LEU A 1 430 ? 11.843  80.704 69.302 1.00 37.99 ? 430 LEU A CA  1 
ATOM   3363 C C   . LEU A 1 430 ? 11.338  80.873 70.724 1.00 36.93 ? 430 LEU A C   1 
ATOM   3364 O O   . LEU A 1 430 ? 12.038  81.438 71.558 1.00 37.63 ? 430 LEU A O   1 
ATOM   3365 C CB  . LEU A 1 430 ? 12.759  79.470 69.224 1.00 37.67 ? 430 LEU A CB  1 
ATOM   3366 C CG  . LEU A 1 430 ? 12.337  78.431 68.173 1.00 37.71 ? 430 LEU A CG  1 
ATOM   3367 C CD1 . LEU A 1 430 ? 13.028  77.107 68.423 1.00 37.13 ? 430 LEU A CD1 1 
ATOM   3368 C CD2 . LEU A 1 430 ? 10.835  78.245 68.219 1.00 36.61 ? 430 LEU A CD2 1 
ATOM   3369 N N   . VAL A 1 431 ? 10.121  80.409 70.994 1.00 35.77 ? 431 VAL A N   1 
ATOM   3370 C CA  . VAL A 1 431 ? 9.559   80.503 72.341 1.00 34.52 ? 431 VAL A CA  1 
ATOM   3371 C C   . VAL A 1 431 ? 9.843   79.239 73.161 1.00 34.33 ? 431 VAL A C   1 
ATOM   3372 O O   . VAL A 1 431 ? 9.612   79.202 74.369 1.00 34.74 ? 431 VAL A O   1 
ATOM   3373 C CB  . VAL A 1 431 ? 8.028   80.739 72.313 1.00 33.78 ? 431 VAL A CB  1 
ATOM   3374 C CG1 . VAL A 1 431 ? 7.730   82.009 71.584 1.00 33.61 ? 431 VAL A CG1 1 
ATOM   3375 C CG2 . VAL A 1 431 ? 7.315   79.573 71.655 1.00 32.83 ? 431 VAL A CG2 1 
ATOM   3376 N N   . TRP A 1 432 ? 10.339  78.196 72.506 1.00 33.39 ? 432 TRP A N   1 
ATOM   3377 C CA  . TRP A 1 432 ? 10.642  76.965 73.213 1.00 31.53 ? 432 TRP A CA  1 
ATOM   3378 C C   . TRP A 1 432 ? 11.989  77.129 73.903 1.00 31.66 ? 432 TRP A C   1 
ATOM   3379 O O   . TRP A 1 432 ? 12.773  78.011 73.558 1.00 31.94 ? 432 TRP A O   1 
ATOM   3380 C CB  . TRP A 1 432 ? 10.670  75.778 72.241 1.00 29.02 ? 432 TRP A CB  1 
ATOM   3381 C CG  . TRP A 1 432 ? 9.310   75.383 71.692 1.00 27.09 ? 432 TRP A CG  1 
ATOM   3382 C CD1 . TRP A 1 432 ? 8.795   75.700 70.471 1.00 25.36 ? 432 TRP A CD1 1 
ATOM   3383 C CD2 . TRP A 1 432 ? 8.306   74.600 72.356 1.00 26.62 ? 432 TRP A CD2 1 
ATOM   3384 N NE1 . TRP A 1 432 ? 7.537   75.165 70.329 1.00 24.47 ? 432 TRP A NE1 1 
ATOM   3385 C CE2 . TRP A 1 432 ? 7.212   74.486 71.471 1.00 25.74 ? 432 TRP A CE2 1 
ATOM   3386 C CE3 . TRP A 1 432 ? 8.225   73.986 73.619 1.00 27.01 ? 432 TRP A CE3 1 
ATOM   3387 C CZ2 . TRP A 1 432 ? 6.048   73.783 71.803 1.00 26.79 ? 432 TRP A CZ2 1 
ATOM   3388 C CZ3 . TRP A 1 432 ? 7.067   73.284 73.956 1.00 26.68 ? 432 TRP A CZ3 1 
ATOM   3389 C CH2 . TRP A 1 432 ? 5.992   73.190 73.048 1.00 27.62 ? 432 TRP A CH2 1 
ATOM   3390 N N   . PRO A 1 433 ? 12.266  76.296 74.910 1.00 31.83 ? 433 PRO A N   1 
ATOM   3391 C CA  . PRO A 1 433 ? 13.536  76.373 75.633 1.00 31.70 ? 433 PRO A CA  1 
ATOM   3392 C C   . PRO A 1 433 ? 14.722  75.946 74.782 1.00 31.27 ? 433 PRO A C   1 
ATOM   3393 O O   . PRO A 1 433 ? 14.581  75.162 73.862 1.00 32.03 ? 433 PRO A O   1 
ATOM   3394 C CB  . PRO A 1 433 ? 13.313  75.433 76.814 1.00 32.59 ? 433 PRO A CB  1 
ATOM   3395 C CG  . PRO A 1 433 ? 12.397  74.403 76.242 1.00 32.60 ? 433 PRO A CG  1 
ATOM   3396 C CD  . PRO A 1 433 ? 11.401  75.256 75.489 1.00 32.70 ? 433 PRO A CD  1 
ATOM   3397 N N   . GLU A 1 434 ? 15.893  76.456 75.115 1.00 31.29 ? 434 GLU A N   1 
ATOM   3398 C CA  . GLU A 1 434 ? 17.110  76.136 74.400 1.00 32.01 ? 434 GLU A CA  1 
ATOM   3399 C C   . GLU A 1 434 ? 17.528  74.672 74.368 1.00 30.49 ? 434 GLU A C   1 
ATOM   3400 O O   . GLU A 1 434 ? 18.024  74.194 73.363 1.00 30.52 ? 434 GLU A O   1 
ATOM   3401 C CB  . GLU A 1 434 ? 18.257  76.913 74.998 1.00 36.48 ? 434 GLU A CB  1 
ATOM   3402 C CG  . GLU A 1 434 ? 17.951  78.347 75.246 1.00 44.39 ? 434 GLU A CG  1 
ATOM   3403 C CD  . GLU A 1 434 ? 19.077  79.218 74.757 1.00 50.14 ? 434 GLU A CD  1 
ATOM   3404 O OE1 . GLU A 1 434 ? 20.075  79.378 75.511 1.00 52.81 ? 434 GLU A OE1 1 
ATOM   3405 O OE2 . GLU A 1 434 ? 18.972  79.719 73.606 1.00 53.31 ? 434 GLU A OE2 1 
ATOM   3406 N N   . TRP A 1 435 ? 17.377  73.947 75.460 1.00 30.00 ? 435 TRP A N   1 
ATOM   3407 C CA  . TRP A 1 435 ? 17.807  72.562 75.416 1.00 30.25 ? 435 TRP A CA  1 
ATOM   3408 C C   . TRP A 1 435 ? 17.141  71.824 74.243 1.00 30.56 ? 435 TRP A C   1 
ATOM   3409 O O   . TRP A 1 435 ? 17.568  70.736 73.851 1.00 32.57 ? 435 TRP A O   1 
ATOM   3410 C CB  . TRP A 1 435 ? 17.522  71.852 76.752 1.00 30.12 ? 435 TRP A CB  1 
ATOM   3411 C CG  . TRP A 1 435 ? 16.078  71.705 77.100 1.00 31.11 ? 435 TRP A CG  1 
ATOM   3412 C CD1 . TRP A 1 435 ? 15.325  72.559 77.847 1.00 31.89 ? 435 TRP A CD1 1 
ATOM   3413 C CD2 . TRP A 1 435 ? 15.204  70.634 76.706 1.00 31.47 ? 435 TRP A CD2 1 
ATOM   3414 N NE1 . TRP A 1 435 ? 14.034  72.086 77.950 1.00 31.92 ? 435 TRP A NE1 1 
ATOM   3415 C CE2 . TRP A 1 435 ? 13.934  70.908 77.258 1.00 31.50 ? 435 TRP A CE2 1 
ATOM   3416 C CE3 . TRP A 1 435 ? 15.370  69.474 75.936 1.00 31.58 ? 435 TRP A CE3 1 
ATOM   3417 C CZ2 . TRP A 1 435 ? 12.835  70.062 77.067 1.00 32.22 ? 435 TRP A CZ2 1 
ATOM   3418 C CZ3 . TRP A 1 435 ? 14.278  68.635 75.745 1.00 31.86 ? 435 TRP A CZ3 1 
ATOM   3419 C CH2 . TRP A 1 435 ? 13.025  68.934 76.309 1.00 32.10 ? 435 TRP A CH2 1 
ATOM   3420 N N   . MET A 1 436 ? 16.106  72.427 73.671 1.00 29.39 ? 436 MET A N   1 
ATOM   3421 C CA  . MET A 1 436 ? 15.397  71.822 72.556 1.00 27.62 ? 436 MET A CA  1 
ATOM   3422 C C   . MET A 1 436 ? 16.105  72.047 71.219 1.00 27.71 ? 436 MET A C   1 
ATOM   3423 O O   . MET A 1 436 ? 15.931  71.271 70.286 1.00 27.91 ? 436 MET A O   1 
ATOM   3424 C CB  . MET A 1 436 ? 13.982  72.371 72.491 1.00 26.58 ? 436 MET A CB  1 
ATOM   3425 C CG  . MET A 1 436 ? 13.143  72.042 73.689 1.00 25.42 ? 436 MET A CG  1 
ATOM   3426 S SD  . MET A 1 436 ? 11.429  71.890 73.188 1.00 27.74 ? 436 MET A SD  1 
ATOM   3427 C CE  . MET A 1 436 ? 10.605  72.185 74.693 1.00 28.64 ? 436 MET A CE  1 
ATOM   3428 N N   . GLY A 1 437 ? 16.894  73.115 71.137 1.00 27.65 ? 437 GLY A N   1 
ATOM   3429 C CA  . GLY A 1 437 ? 17.645  73.432 69.930 1.00 27.77 ? 437 GLY A CA  1 
ATOM   3430 C C   . GLY A 1 437 ? 16.838  73.653 68.662 1.00 27.71 ? 437 GLY A C   1 
ATOM   3431 O O   . GLY A 1 437 ? 15.740  74.206 68.718 1.00 27.92 ? 437 GLY A O   1 
ATOM   3432 N N   . VAL A 1 438 ? 17.403  73.236 67.521 1.00 26.78 ? 438 VAL A N   1 
ATOM   3433 C CA  . VAL A 1 438 ? 16.750  73.339 66.215 1.00 24.49 ? 438 VAL A CA  1 
ATOM   3434 C C   . VAL A 1 438 ? 15.690  72.235 66.175 1.00 23.27 ? 438 VAL A C   1 
ATOM   3435 O O   . VAL A 1 438 ? 15.944  71.098 65.789 1.00 21.28 ? 438 VAL A O   1 
ATOM   3436 C CB  . VAL A 1 438 ? 17.755  73.129 65.087 1.00 24.47 ? 438 VAL A CB  1 
ATOM   3437 C CG1 . VAL A 1 438 ? 17.110  73.451 63.749 1.00 24.54 ? 438 VAL A CG1 1 
ATOM   3438 C CG2 . VAL A 1 438 ? 18.956  73.998 65.314 1.00 23.17 ? 438 VAL A CG2 1 
ATOM   3439 N N   . ILE A 1 439 ? 14.495  72.616 66.586 1.00 23.28 ? 439 ILE A N   1 
ATOM   3440 C CA  . ILE A 1 439 ? 13.355  71.730 66.704 1.00 24.72 ? 439 ILE A CA  1 
ATOM   3441 C C   . ILE A 1 439 ? 12.716  71.210 65.427 1.00 26.40 ? 439 ILE A C   1 
ATOM   3442 O O   . ILE A 1 439 ? 12.843  71.786 64.349 1.00 26.72 ? 439 ILE A O   1 
ATOM   3443 C CB  . ILE A 1 439 ? 12.268  72.430 67.565 1.00 23.93 ? 439 ILE A CB  1 
ATOM   3444 C CG1 . ILE A 1 439 ? 12.851  72.741 68.943 1.00 21.71 ? 439 ILE A CG1 1 
ATOM   3445 C CG2 . ILE A 1 439 ? 11.005  71.573 67.673 1.00 22.95 ? 439 ILE A CG2 1 
ATOM   3446 C CD1 . ILE A 1 439 ? 12.054  73.720 69.713 1.00 20.37 ? 439 ILE A CD1 1 
ATOM   3447 N N   . HIS A 1 440 ? 12.008  70.098 65.589 1.00 28.04 ? 440 HIS A N   1 
ATOM   3448 C CA  . HIS A 1 440 ? 11.283  69.434 64.511 1.00 26.30 ? 440 HIS A CA  1 
ATOM   3449 C C   . HIS A 1 440 ? 10.138  70.329 64.028 1.00 26.06 ? 440 HIS A C   1 
ATOM   3450 O O   . HIS A 1 440 ? 9.332   70.830 64.825 1.00 25.70 ? 440 HIS A O   1 
ATOM   3451 C CB  . HIS A 1 440 ? 10.729  68.114 65.036 1.00 24.54 ? 440 HIS A CB  1 
ATOM   3452 C CG  . HIS A 1 440 ? 9.980   67.329 64.018 1.00 22.63 ? 440 HIS A CG  1 
ATOM   3453 N ND1 . HIS A 1 440 ? 10.603  66.699 62.963 1.00 22.68 ? 440 HIS A ND1 1 
ATOM   3454 C CD2 . HIS A 1 440 ? 8.659   67.059 63.895 1.00 22.39 ? 440 HIS A CD2 1 
ATOM   3455 C CE1 . HIS A 1 440 ? 9.698   66.071 62.233 1.00 24.06 ? 440 HIS A CE1 1 
ATOM   3456 N NE2 . HIS A 1 440 ? 8.511   66.274 62.777 1.00 23.25 ? 440 HIS A NE2 1 
ATOM   3457 N N   . GLY A 1 441 ? 10.081  70.533 62.719 1.00 25.29 ? 441 GLY A N   1 
ATOM   3458 C CA  . GLY A 1 441 ? 9.035   71.358 62.154 1.00 24.50 ? 441 GLY A CA  1 
ATOM   3459 C C   . GLY A 1 441 ? 9.309   72.844 62.231 1.00 23.66 ? 441 GLY A C   1 
ATOM   3460 O O   . GLY A 1 441 ? 8.464   73.647 61.872 1.00 22.93 ? 441 GLY A O   1 
ATOM   3461 N N   . TYR A 1 442 ? 10.489  73.238 62.678 1.00 23.85 ? 442 TYR A N   1 
ATOM   3462 C CA  . TYR A 1 442 ? 10.735  74.660 62.756 1.00 24.43 ? 442 TYR A CA  1 
ATOM   3463 C C   . TYR A 1 442 ? 11.494  75.305 61.613 1.00 24.48 ? 442 TYR A C   1 
ATOM   3464 O O   . TYR A 1 442 ? 11.985  76.426 61.736 1.00 25.75 ? 442 TYR A O   1 
ATOM   3465 C CB  . TYR A 1 442 ? 11.345  75.012 64.114 1.00 24.54 ? 442 TYR A CB  1 
ATOM   3466 C CG  . TYR A 1 442 ? 10.234  75.189 65.114 1.00 26.20 ? 442 TYR A CG  1 
ATOM   3467 C CD1 . TYR A 1 442 ? 9.603   74.081 65.687 1.00 26.14 ? 442 TYR A CD1 1 
ATOM   3468 C CD2 . TYR A 1 442 ? 9.690   76.457 65.356 1.00 26.23 ? 442 TYR A CD2 1 
ATOM   3469 C CE1 . TYR A 1 442 ? 8.453   74.230 66.463 1.00 25.59 ? 442 TYR A CE1 1 
ATOM   3470 C CE2 . TYR A 1 442 ? 8.542   76.614 66.126 1.00 25.72 ? 442 TYR A CE2 1 
ATOM   3471 C CZ  . TYR A 1 442 ? 7.928   75.497 66.674 1.00 25.28 ? 442 TYR A CZ  1 
ATOM   3472 O OH  . TYR A 1 442 ? 6.786   75.650 67.421 1.00 24.42 ? 442 TYR A OH  1 
ATOM   3473 N N   . GLU A 1 443 ? 11.571  74.605 60.489 1.00 24.24 ? 443 GLU A N   1 
ATOM   3474 C CA  . GLU A 1 443 ? 12.234  75.142 59.314 1.00 23.47 ? 443 GLU A CA  1 
ATOM   3475 C C   . GLU A 1 443 ? 11.086  75.497 58.416 1.00 23.94 ? 443 GLU A C   1 
ATOM   3476 O O   . GLU A 1 443 ? 11.271  76.056 57.354 1.00 24.93 ? 443 GLU A O   1 
ATOM   3477 C CB  . GLU A 1 443 ? 13.092  74.091 58.621 1.00 22.06 ? 443 GLU A CB  1 
ATOM   3478 C CG  . GLU A 1 443 ? 12.329  73.109 57.720 1.00 23.13 ? 443 GLU A CG  1 
ATOM   3479 C CD  . GLU A 1 443 ? 11.425  72.145 58.482 1.00 23.36 ? 443 GLU A CD  1 
ATOM   3480 O OE1 . GLU A 1 443 ? 11.721  71.865 59.656 1.00 24.57 ? 443 GLU A OE1 1 
ATOM   3481 O OE2 . GLU A 1 443 ? 10.431  71.648 57.909 1.00 22.46 ? 443 GLU A OE2 1 
ATOM   3482 N N   . ILE A 1 444 ? 9.885   75.143 58.851 1.00 24.14 ? 444 ILE A N   1 
ATOM   3483 C CA  . ILE A 1 444 ? 8.702   75.428 58.067 1.00 25.12 ? 444 ILE A CA  1 
ATOM   3484 C C   . ILE A 1 444 ? 8.483   76.933 57.949 1.00 27.16 ? 444 ILE A C   1 
ATOM   3485 O O   . ILE A 1 444 ? 8.327   77.471 56.849 1.00 27.51 ? 444 ILE A O   1 
ATOM   3486 C CB  . ILE A 1 444 ? 7.445   74.768 58.688 1.00 24.32 ? 444 ILE A CB  1 
ATOM   3487 C CG1 . ILE A 1 444 ? 7.544   73.239 58.547 1.00 23.63 ? 444 ILE A CG1 1 
ATOM   3488 C CG2 . ILE A 1 444 ? 6.174   75.337 58.029 1.00 24.54 ? 444 ILE A CG2 1 
ATOM   3489 C CD1 . ILE A 1 444 ? 6.329   72.455 59.025 1.00 19.75 ? 444 ILE A CD1 1 
ATOM   3490 N N   . GLU A 1 445 ? 8.487   77.626 59.080 1.00 28.92 ? 445 GLU A N   1 
ATOM   3491 C CA  . GLU A 1 445 ? 8.260   79.063 59.053 1.00 29.29 ? 445 GLU A CA  1 
ATOM   3492 C C   . GLU A 1 445 ? 9.245   79.783 58.130 1.00 29.15 ? 445 GLU A C   1 
ATOM   3493 O O   . GLU A 1 445 ? 8.925   80.853 57.598 1.00 28.64 ? 445 GLU A O   1 
ATOM   3494 C CB  . GLU A 1 445 ? 8.281   79.640 60.484 1.00 28.75 ? 445 GLU A CB  1 
ATOM   3495 C CG  . GLU A 1 445 ? 9.578   79.469 61.237 1.00 29.86 ? 445 GLU A CG  1 
ATOM   3496 C CD  . GLU A 1 445 ? 9.363   79.434 62.733 1.00 30.51 ? 445 GLU A CD  1 
ATOM   3497 O OE1 . GLU A 1 445 ? 8.195   79.264 63.152 1.00 30.71 ? 445 GLU A OE1 1 
ATOM   3498 O OE2 . GLU A 1 445 ? 10.358  79.563 63.482 1.00 29.83 ? 445 GLU A OE2 1 
ATOM   3499 N N   . PHE A 1 446 ? 10.422  79.192 57.911 1.00 28.48 ? 446 PHE A N   1 
ATOM   3500 C CA  . PHE A 1 446 ? 11.396  79.821 57.022 1.00 29.31 ? 446 PHE A CA  1 
ATOM   3501 C C   . PHE A 1 446 ? 11.098  79.600 55.559 1.00 29.14 ? 446 PHE A C   1 
ATOM   3502 O O   . PHE A 1 446 ? 11.305  80.486 54.736 1.00 29.68 ? 446 PHE A O   1 
ATOM   3503 C CB  . PHE A 1 446 ? 12.791  79.319 57.301 1.00 29.97 ? 446 PHE A CB  1 
ATOM   3504 C CG  . PHE A 1 446 ? 13.435  79.997 58.444 1.00 32.51 ? 446 PHE A CG  1 
ATOM   3505 C CD1 . PHE A 1 446 ? 13.188  79.568 59.749 1.00 33.23 ? 446 PHE A CD1 1 
ATOM   3506 C CD2 . PHE A 1 446 ? 14.275  81.090 58.227 1.00 31.72 ? 446 PHE A CD2 1 
ATOM   3507 C CE1 . PHE A 1 446 ? 13.775  80.224 60.828 1.00 33.36 ? 446 PHE A CE1 1 
ATOM   3508 C CE2 . PHE A 1 446 ? 14.867  81.753 59.295 1.00 31.59 ? 446 PHE A CE2 1 
ATOM   3509 C CZ  . PHE A 1 446 ? 14.621  81.324 60.595 1.00 32.47 ? 446 PHE A CZ  1 
ATOM   3510 N N   . VAL A 1 447 ? 10.628  78.396 55.249 1.00 28.91 ? 447 VAL A N   1 
ATOM   3511 C CA  . VAL A 1 447 ? 10.265  77.997 53.898 1.00 26.11 ? 447 VAL A CA  1 
ATOM   3512 C C   . VAL A 1 447 ? 9.079   78.813 53.414 1.00 25.56 ? 447 VAL A C   1 
ATOM   3513 O O   . VAL A 1 447 ? 9.053   79.223 52.261 1.00 24.17 ? 447 VAL A O   1 
ATOM   3514 C CB  . VAL A 1 447 ? 9.887   76.524 53.868 1.00 24.69 ? 447 VAL A CB  1 
ATOM   3515 C CG1 . VAL A 1 447 ? 9.182   76.200 52.578 1.00 24.11 ? 447 VAL A CG1 1 
ATOM   3516 C CG2 . VAL A 1 447 ? 11.123  75.681 54.050 1.00 22.90 ? 447 VAL A CG2 1 
ATOM   3517 N N   . PHE A 1 448 ? 8.106   79.045 54.295 1.00 25.38 ? 448 PHE A N   1 
ATOM   3518 C CA  . PHE A 1 448 ? 6.920   79.826 53.948 1.00 27.32 ? 448 PHE A CA  1 
ATOM   3519 C C   . PHE A 1 448 ? 7.091   81.342 54.095 1.00 28.81 ? 448 PHE A C   1 
ATOM   3520 O O   . PHE A 1 448 ? 6.120   82.102 54.029 1.00 26.49 ? 448 PHE A O   1 
ATOM   3521 C CB  . PHE A 1 448 ? 5.721   79.359 54.764 1.00 27.46 ? 448 PHE A CB  1 
ATOM   3522 C CG  . PHE A 1 448 ? 4.976   78.231 54.139 1.00 26.52 ? 448 PHE A CG  1 
ATOM   3523 C CD1 . PHE A 1 448 ? 5.504   76.941 54.151 1.00 27.20 ? 448 PHE A CD1 1 
ATOM   3524 C CD2 . PHE A 1 448 ? 3.752   78.455 53.529 1.00 25.31 ? 448 PHE A CD2 1 
ATOM   3525 C CE1 . PHE A 1 448 ? 4.821   75.875 53.556 1.00 27.00 ? 448 PHE A CE1 1 
ATOM   3526 C CE2 . PHE A 1 448 ? 3.057   77.409 52.933 1.00 26.76 ? 448 PHE A CE2 1 
ATOM   3527 C CZ  . PHE A 1 448 ? 3.594   76.107 52.944 1.00 27.02 ? 448 PHE A CZ  1 
ATOM   3528 N N   . GLY A 1 449 ? 8.334   81.760 54.323 1.00 31.68 ? 449 GLY A N   1 
ATOM   3529 C CA  . GLY A 1 449 ? 8.684   83.175 54.404 1.00 34.73 ? 449 GLY A CA  1 
ATOM   3530 C C   . GLY A 1 449 ? 8.220   84.141 55.482 1.00 36.39 ? 449 GLY A C   1 
ATOM   3531 O O   . GLY A 1 449 ? 8.194   85.345 55.227 1.00 36.85 ? 449 GLY A O   1 
ATOM   3532 N N   . LEU A 1 450 ? 7.874   83.649 56.673 1.00 37.28 ? 450 LEU A N   1 
ATOM   3533 C CA  . LEU A 1 450 ? 7.435   84.518 57.766 1.00 36.10 ? 450 LEU A CA  1 
ATOM   3534 C C   . LEU A 1 450 ? 8.486   85.528 58.199 1.00 35.08 ? 450 LEU A C   1 
ATOM   3535 O O   . LEU A 1 450 ? 8.148   86.619 58.614 1.00 33.86 ? 450 LEU A O   1 
ATOM   3536 C CB  . LEU A 1 450 ? 7.015   83.675 58.956 1.00 36.57 ? 450 LEU A CB  1 
ATOM   3537 C CG  . LEU A 1 450 ? 5.832   82.796 58.580 1.00 37.12 ? 450 LEU A CG  1 
ATOM   3538 C CD1 . LEU A 1 450 ? 5.625   81.755 59.638 1.00 40.74 ? 450 LEU A CD1 1 
ATOM   3539 C CD2 . LEU A 1 450 ? 4.598   83.639 58.431 1.00 37.17 ? 450 LEU A CD2 1 
ATOM   3540 N N   . PRO A 1 451 ? 9.775   85.171 58.134 1.00 36.40 ? 451 PRO A N   1 
ATOM   3541 C CA  . PRO A 1 451 ? 10.806  86.135 58.538 1.00 38.79 ? 451 PRO A CA  1 
ATOM   3542 C C   . PRO A 1 451 ? 10.692  87.453 57.762 1.00 40.46 ? 451 PRO A C   1 
ATOM   3543 O O   . PRO A 1 451 ? 11.323  88.460 58.113 1.00 40.22 ? 451 PRO A O   1 
ATOM   3544 C CB  . PRO A 1 451 ? 12.108  85.396 58.228 1.00 37.76 ? 451 PRO A CB  1 
ATOM   3545 C CG  . PRO A 1 451 ? 11.747  83.983 58.558 1.00 37.10 ? 451 PRO A CG  1 
ATOM   3546 C CD  . PRO A 1 451 ? 10.367  83.833 57.938 1.00 37.03 ? 451 PRO A CD  1 
ATOM   3547 N N   . LEU A 1 452 ? 9.875   87.428 56.711 1.00 41.55 ? 452 LEU A N   1 
ATOM   3548 C CA  . LEU A 1 452 ? 9.666   88.591 55.860 1.00 42.61 ? 452 LEU A CA  1 
ATOM   3549 C C   . LEU A 1 452 ? 8.699   89.625 56.420 1.00 43.59 ? 452 LEU A C   1 
ATOM   3550 O O   . LEU A 1 452 ? 8.591   90.719 55.867 1.00 44.64 ? 452 LEU A O   1 
ATOM   3551 C CB  . LEU A 1 452 ? 9.187   88.160 54.476 1.00 42.46 ? 452 LEU A CB  1 
ATOM   3552 C CG  . LEU A 1 452 ? 10.221  88.271 53.357 1.00 42.83 ? 452 LEU A CG  1 
ATOM   3553 C CD1 . LEU A 1 452 ? 11.398  87.354 53.625 1.00 42.43 ? 452 LEU A CD1 1 
ATOM   3554 C CD2 . LEU A 1 452 ? 9.558   87.922 52.042 1.00 43.06 ? 452 LEU A CD2 1 
ATOM   3555 N N   . VAL A 1 453 ? 7.980   89.292 57.489 1.00 43.56 ? 453 VAL A N   1 
ATOM   3556 C CA  . VAL A 1 453 ? 7.070   90.267 58.077 1.00 44.13 ? 453 VAL A CA  1 
ATOM   3557 C C   . VAL A 1 453 ? 7.743   90.800 59.348 1.00 46.55 ? 453 VAL A C   1 
ATOM   3558 O O   . VAL A 1 453 ? 8.156   90.021 60.209 1.00 47.14 ? 453 VAL A O   1 
ATOM   3559 C CB  . VAL A 1 453 ? 5.660   89.656 58.357 1.00 41.48 ? 453 VAL A CB  1 
ATOM   3560 C CG1 . VAL A 1 453 ? 5.634   88.206 58.000 1.00 41.12 ? 453 VAL A CG1 1 
ATOM   3561 C CG2 . VAL A 1 453 ? 5.279   89.844 59.776 1.00 40.13 ? 453 VAL A CG2 1 
ATOM   3562 N N   . LYS A 1 454 ? 7.880   92.130 59.425 1.00 48.68 ? 454 LYS A N   1 
ATOM   3563 C CA  . LYS A 1 454 ? 8.530   92.842 60.541 1.00 49.77 ? 454 LYS A CA  1 
ATOM   3564 C C   . LYS A 1 454 ? 8.028   92.427 61.926 1.00 49.75 ? 454 LYS A C   1 
ATOM   3565 O O   . LYS A 1 454 ? 8.796   91.912 62.755 1.00 49.32 ? 454 LYS A O   1 
ATOM   3566 C CB  . LYS A 1 454 ? 8.332   94.350 60.361 1.00 50.79 ? 454 LYS A CB  1 
ATOM   3567 C CG  . LYS A 1 454 ? 8.085   94.748 58.905 1.00 55.94 ? 454 LYS A CG  1 
ATOM   3568 C CD  . LYS A 1 454 ? 7.586   96.210 58.741 1.00 59.25 ? 454 LYS A CD  1 
ATOM   3569 C CE  . LYS A 1 454 ? 7.059   96.533 57.296 1.00 59.65 ? 454 LYS A CE  1 
ATOM   3570 N NZ  . LYS A 1 454 ? 8.058   96.522 56.159 1.00 57.09 ? 454 LYS A NZ  1 
ATOM   3571 N N   . GLU A 1 455 ? 6.734   92.662 62.143 1.00 50.08 ? 455 GLU A N   1 
ATOM   3572 C CA  . GLU A 1 455 ? 6.017   92.370 63.383 1.00 50.89 ? 455 GLU A CA  1 
ATOM   3573 C C   . GLU A 1 455 ? 6.305   91.033 64.073 1.00 50.67 ? 455 GLU A C   1 
ATOM   3574 O O   . GLU A 1 455 ? 5.925   90.857 65.228 1.00 51.25 ? 455 GLU A O   1 
ATOM   3575 C CB  . GLU A 1 455 ? 4.510   92.475 63.140 1.00 52.39 ? 455 GLU A CB  1 
ATOM   3576 C CG  . GLU A 1 455 ? 4.086   93.782 62.499 1.00 59.51 ? 455 GLU A CG  1 
ATOM   3577 C CD  . GLU A 1 455 ? 4.555   93.931 61.043 1.00 64.12 ? 455 GLU A CD  1 
ATOM   3578 O OE1 . GLU A 1 455 ? 4.647   92.902 60.333 1.00 67.01 ? 455 GLU A OE1 1 
ATOM   3579 O OE2 . GLU A 1 455 ? 4.819   95.079 60.595 1.00 66.27 ? 455 GLU A OE2 1 
ATOM   3580 N N   . LEU A 1 456 ? 6.960   90.092 63.397 1.00 49.72 ? 456 LEU A N   1 
ATOM   3581 C CA  . LEU A 1 456 ? 7.242   88.806 64.024 1.00 48.40 ? 456 LEU A CA  1 
ATOM   3582 C C   . LEU A 1 456 ? 8.628   88.811 64.612 1.00 49.84 ? 456 LEU A C   1 
ATOM   3583 O O   . LEU A 1 456 ? 9.161   87.775 64.989 1.00 50.44 ? 456 LEU A O   1 
ATOM   3584 C CB  . LEU A 1 456 ? 7.093   87.677 63.021 1.00 45.55 ? 456 LEU A CB  1 
ATOM   3585 C CG  . LEU A 1 456 ? 5.760   87.783 62.290 1.00 43.97 ? 456 LEU A CG  1 
ATOM   3586 C CD1 . LEU A 1 456 ? 5.674   86.727 61.222 1.00 44.72 ? 456 LEU A CD1 1 
ATOM   3587 C CD2 . LEU A 1 456 ? 4.627   87.661 63.263 1.00 41.78 ? 456 LEU A CD2 1 
ATOM   3588 N N   . ASN A 1 457 ? 9.206   90.002 64.677 1.00 51.70 ? 457 ASN A N   1 
ATOM   3589 C CA  . ASN A 1 457 ? 10.517  90.212 65.271 1.00 54.45 ? 457 ASN A CA  1 
ATOM   3590 C C   . ASN A 1 457 ? 11.615  89.202 64.920 1.00 52.10 ? 457 ASN A C   1 
ATOM   3591 O O   . ASN A 1 457 ? 12.237  88.633 65.812 1.00 51.35 ? 457 ASN A O   1 
ATOM   3592 C CB  . ASN A 1 457 ? 10.384  90.301 66.814 1.00 61.23 ? 457 ASN A CB  1 
ATOM   3593 C CG  . ASN A 1 457 ? 9.403   91.398 67.274 1.00 69.47 ? 457 ASN A CG  1 
ATOM   3594 O OD1 . ASN A 1 457 ? 8.957   92.197 66.448 1.00 69.79 ? 457 ASN A OD1 1 
ATOM   3595 N ND2 . ASN A 1 457 ? 9.098   91.470 68.583 1.00 78.06 ? 457 ASN A ND2 1 
ATOM   3596 N N   . TYR A 1 458 ? 11.862  88.980 63.633 1.00 49.95 ? 458 TYR A N   1 
ATOM   3597 C CA  . TYR A 1 458 ? 12.940  88.070 63.218 1.00 47.83 ? 458 TYR A CA  1 
ATOM   3598 C C   . TYR A 1 458 ? 14.153  88.941 62.904 1.00 47.02 ? 458 TYR A C   1 
ATOM   3599 O O   . TYR A 1 458 ? 13.990  90.082 62.485 1.00 46.89 ? 458 TYR A O   1 
ATOM   3600 C CB  . TYR A 1 458 ? 12.547  87.289 61.973 1.00 45.73 ? 458 TYR A CB  1 
ATOM   3601 C CG  . TYR A 1 458 ? 11.737  86.054 62.240 1.00 43.08 ? 458 TYR A CG  1 
ATOM   3602 C CD1 . TYR A 1 458 ? 12.328  84.917 62.771 1.00 42.26 ? 458 TYR A CD1 1 
ATOM   3603 C CD2 . TYR A 1 458 ? 10.387  86.001 61.905 1.00 42.83 ? 458 TYR A CD2 1 
ATOM   3604 C CE1 . TYR A 1 458 ? 11.598  83.750 62.952 1.00 42.21 ? 458 TYR A CE1 1 
ATOM   3605 C CE2 . TYR A 1 458 ? 9.646   84.842 62.081 1.00 41.90 ? 458 TYR A CE2 1 
ATOM   3606 C CZ  . TYR A 1 458 ? 10.258  83.719 62.602 1.00 41.69 ? 458 TYR A CZ  1 
ATOM   3607 O OH  . TYR A 1 458 ? 9.536   82.562 62.747 1.00 40.89 ? 458 TYR A OH  1 
ATOM   3608 N N   . THR A 1 459 ? 15.361  88.422 63.088 1.00 46.20 ? 459 THR A N   1 
ATOM   3609 C CA  . THR A 1 459 ? 16.536  89.245 62.831 1.00 46.79 ? 459 THR A CA  1 
ATOM   3610 C C   . THR A 1 459 ? 16.626  89.561 61.357 1.00 47.30 ? 459 THR A C   1 
ATOM   3611 O O   . THR A 1 459 ? 15.781  89.126 60.574 1.00 47.48 ? 459 THR A O   1 
ATOM   3612 C CB  . THR A 1 459 ? 17.843  88.551 63.248 1.00 46.94 ? 459 THR A CB  1 
ATOM   3613 O OG1 . THR A 1 459 ? 18.287  87.686 62.200 1.00 48.29 ? 459 THR A OG1 1 
ATOM   3614 C CG2 . THR A 1 459 ? 17.624  87.723 64.481 1.00 48.49 ? 459 THR A CG2 1 
ATOM   3615 N N   . ALA A 1 460 ? 17.655  90.320 60.986 1.00 47.18 ? 460 ALA A N   1 
ATOM   3616 C CA  . ALA A 1 460 ? 17.875  90.695 59.598 1.00 46.39 ? 460 ALA A CA  1 
ATOM   3617 C C   . ALA A 1 460 ? 18.529  89.572 58.800 1.00 46.53 ? 460 ALA A C   1 
ATOM   3618 O O   . ALA A 1 460 ? 18.166  89.347 57.656 1.00 46.99 ? 460 ALA A O   1 
ATOM   3619 C CB  . ALA A 1 460 ? 18.724  91.936 59.530 1.00 46.71 ? 460 ALA A CB  1 
ATOM   3620 N N   . GLU A 1 461 ? 19.489  88.864 59.380 1.00 46.94 ? 461 GLU A N   1 
ATOM   3621 C CA  . GLU A 1 461 ? 20.121  87.786 58.638 1.00 48.82 ? 461 GLU A CA  1 
ATOM   3622 C C   . GLU A 1 461 ? 19.152  86.633 58.552 1.00 47.73 ? 461 GLU A C   1 
ATOM   3623 O O   . GLU A 1 461 ? 19.371  85.697 57.782 1.00 49.76 ? 461 GLU A O   1 
ATOM   3624 C CB  . GLU A 1 461 ? 21.397  87.274 59.304 1.00 53.02 ? 461 GLU A CB  1 
ATOM   3625 C CG  . GLU A 1 461 ? 22.288  88.327 59.894 1.00 62.19 ? 461 GLU A CG  1 
ATOM   3626 C CD  . GLU A 1 461 ? 21.755  88.835 61.224 1.00 68.39 ? 461 GLU A CD  1 
ATOM   3627 O OE1 . GLU A 1 461 ? 22.071  88.189 62.256 1.00 72.08 ? 461 GLU A OE1 1 
ATOM   3628 O OE2 . GLU A 1 461 ? 21.013  89.856 61.242 1.00 71.05 ? 461 GLU A OE2 1 
ATOM   3629 N N   . GLU A 1 462 ? 18.091  86.677 59.352 1.00 44.98 ? 462 GLU A N   1 
ATOM   3630 C CA  . GLU A 1 462 ? 17.108  85.606 59.323 1.00 42.90 ? 462 GLU A CA  1 
ATOM   3631 C C   . GLU A 1 462 ? 16.184  85.820 58.156 1.00 43.77 ? 462 GLU A C   1 
ATOM   3632 O O   . GLU A 1 462 ? 15.801  84.877 57.476 1.00 44.82 ? 462 GLU A O   1 
ATOM   3633 C CB  . GLU A 1 462 ? 16.332  85.550 60.629 1.00 40.41 ? 462 GLU A CB  1 
ATOM   3634 C CG  . GLU A 1 462 ? 17.031  84.675 61.653 1.00 37.43 ? 462 GLU A CG  1 
ATOM   3635 C CD  . GLU A 1 462 ? 16.401  84.740 63.017 1.00 35.63 ? 462 GLU A CD  1 
ATOM   3636 O OE1 . GLU A 1 462 ? 15.498  85.586 63.212 1.00 34.86 ? 462 GLU A OE1 1 
ATOM   3637 O OE2 . GLU A 1 462 ? 16.819  83.947 63.888 1.00 32.46 ? 462 GLU A OE2 1 
ATOM   3638 N N   . GLU A 1 463 ? 15.834  87.074 57.913 1.00 44.59 ? 463 GLU A N   1 
ATOM   3639 C CA  . GLU A 1 463 ? 14.981  87.400 56.786 1.00 44.26 ? 463 GLU A CA  1 
ATOM   3640 C C   . GLU A 1 463 ? 15.799  87.081 55.542 1.00 41.61 ? 463 GLU A C   1 
ATOM   3641 O O   . GLU A 1 463 ? 15.261  86.684 54.528 1.00 43.41 ? 463 GLU A O   1 
ATOM   3642 C CB  . GLU A 1 463 ? 14.618  88.876 56.803 1.00 48.06 ? 463 GLU A CB  1 
ATOM   3643 C CG  . GLU A 1 463 ? 13.571  89.250 55.792 1.00 53.73 ? 463 GLU A CG  1 
ATOM   3644 C CD  . GLU A 1 463 ? 13.930  90.521 55.059 1.00 57.57 ? 463 GLU A CD  1 
ATOM   3645 O OE1 . GLU A 1 463 ? 15.046  90.562 54.480 1.00 59.69 ? 463 GLU A OE1 1 
ATOM   3646 O OE2 . GLU A 1 463 ? 13.101  91.465 55.061 1.00 59.50 ? 463 GLU A OE2 1 
ATOM   3647 N N   . ALA A 1 464 ? 17.109  87.254 55.623 1.00 37.97 ? 464 ALA A N   1 
ATOM   3648 C CA  . ALA A 1 464 ? 17.977  86.928 54.499 1.00 34.84 ? 464 ALA A CA  1 
ATOM   3649 C C   . ALA A 1 464 ? 17.912  85.430 54.181 1.00 33.30 ? 464 ALA A C   1 
ATOM   3650 O O   . ALA A 1 464 ? 17.754  85.033 53.017 1.00 33.28 ? 464 ALA A O   1 
ATOM   3651 C CB  . ALA A 1 464 ? 19.398  87.310 54.820 1.00 34.33 ? 464 ALA A CB  1 
ATOM   3652 N N   . LEU A 1 465 ? 18.043  84.607 55.221 1.00 31.35 ? 465 LEU A N   1 
ATOM   3653 C CA  . LEU A 1 465 ? 18.010  83.153 55.089 1.00 30.49 ? 465 LEU A CA  1 
ATOM   3654 C C   . LEU A 1 465 ? 16.671  82.609 54.575 1.00 31.71 ? 465 LEU A C   1 
ATOM   3655 O O   . LEU A 1 465 ? 16.642  81.618 53.836 1.00 31.28 ? 465 LEU A O   1 
ATOM   3656 C CB  . LEU A 1 465 ? 18.350  82.506 56.429 1.00 28.67 ? 465 LEU A CB  1 
ATOM   3657 C CG  . LEU A 1 465 ? 18.193  80.987 56.509 1.00 28.01 ? 465 LEU A CG  1 
ATOM   3658 C CD1 . LEU A 1 465 ? 19.064  80.334 55.469 1.00 27.79 ? 465 LEU A CD1 1 
ATOM   3659 C CD2 . LEU A 1 465 ? 18.560  80.497 57.892 1.00 26.45 ? 465 LEU A CD2 1 
ATOM   3660 N N   . SER A 1 466 ? 15.572  83.252 54.966 1.00 32.32 ? 466 SER A N   1 
ATOM   3661 C CA  . SER A 1 466 ? 14.234  82.844 54.538 1.00 33.88 ? 466 SER A CA  1 
ATOM   3662 C C   . SER A 1 466 ? 14.086  82.985 53.013 1.00 35.68 ? 466 SER A C   1 
ATOM   3663 O O   . SER A 1 466 ? 13.507  82.115 52.337 1.00 35.98 ? 466 SER A O   1 
ATOM   3664 C CB  . SER A 1 466 ? 13.173  83.706 55.250 1.00 34.34 ? 466 SER A CB  1 
ATOM   3665 O OG  . SER A 1 466 ? 11.846  83.453 54.785 1.00 32.82 ? 466 SER A OG  1 
ATOM   3666 N N   . ARG A 1 467 ? 14.600  84.092 52.475 1.00 36.63 ? 467 ARG A N   1 
ATOM   3667 C CA  . ARG A 1 467 ? 14.528  84.343 51.044 1.00 36.61 ? 467 ARG A CA  1 
ATOM   3668 C C   . ARG A 1 467 ? 15.462  83.360 50.364 1.00 37.04 ? 467 ARG A C   1 
ATOM   3669 O O   . ARG A 1 467 ? 15.134  82.815 49.305 1.00 36.69 ? 467 ARG A O   1 
ATOM   3670 C CB  . ARG A 1 467 ? 14.950  85.771 50.740 1.00 36.93 ? 467 ARG A CB  1 
ATOM   3671 C CG  . ARG A 1 467 ? 14.007  86.827 51.250 1.00 37.37 ? 467 ARG A CG  1 
ATOM   3672 C CD  . ARG A 1 467 ? 14.570  88.205 50.961 1.00 39.76 ? 467 ARG A CD  1 
ATOM   3673 N NE  . ARG A 1 467 ? 13.689  89.259 51.449 1.00 44.24 ? 467 ARG A NE  1 
ATOM   3674 C CZ  . ARG A 1 467 ? 12.566  89.654 50.847 1.00 46.31 ? 467 ARG A CZ  1 
ATOM   3675 N NH1 . ARG A 1 467 ? 12.177  89.107 49.699 1.00 47.22 ? 467 ARG A NH1 1 
ATOM   3676 N NH2 . ARG A 1 467 ? 11.837  90.622 51.389 1.00 47.51 ? 467 ARG A NH2 1 
ATOM   3677 N N   . ARG A 1 468 ? 16.624  83.135 50.978 1.00 36.93 ? 468 ARG A N   1 
ATOM   3678 C CA  . ARG A 1 468 ? 17.587  82.186 50.443 1.00 38.11 ? 468 ARG A CA  1 
ATOM   3679 C C   . ARG A 1 468 ? 16.902  80.817 50.302 1.00 38.01 ? 468 ARG A C   1 
ATOM   3680 O O   . ARG A 1 468 ? 16.971  80.206 49.233 1.00 39.78 ? 468 ARG A O   1 
ATOM   3681 C CB  . ARG A 1 468 ? 18.809  82.102 51.361 1.00 39.98 ? 468 ARG A CB  1 
ATOM   3682 C CG  . ARG A 1 468 ? 19.960  81.256 50.822 1.00 42.64 ? 468 ARG A CG  1 
ATOM   3683 C CD  . ARG A 1 468 ? 21.311  81.810 51.281 1.00 46.97 ? 468 ARG A CD  1 
ATOM   3684 N NE  . ARG A 1 468 ? 21.815  81.320 52.576 1.00 52.00 ? 468 ARG A NE  1 
ATOM   3685 C CZ  . ARG A 1 468 ? 22.421  80.140 52.763 1.00 55.11 ? 468 ARG A CZ  1 
ATOM   3686 N NH1 . ARG A 1 468 ? 22.593  79.305 51.735 1.00 56.25 ? 468 ARG A NH1 1 
ATOM   3687 N NH2 . ARG A 1 468 ? 22.905  79.804 53.964 1.00 54.48 ? 468 ARG A NH2 1 
ATOM   3688 N N   . ILE A 1 469 ? 16.236  80.349 51.363 1.00 36.37 ? 469 ILE A N   1 
ATOM   3689 C CA  . ILE A 1 469 ? 15.498  79.066 51.358 1.00 35.26 ? 469 ILE A CA  1 
ATOM   3690 C C   . ILE A 1 469 ? 14.396  79.072 50.279 1.00 34.98 ? 469 ILE A C   1 
ATOM   3691 O O   . ILE A 1 469 ? 14.364  78.223 49.376 1.00 34.07 ? 469 ILE A O   1 
ATOM   3692 C CB  . ILE A 1 469 ? 14.766  78.816 52.725 1.00 35.29 ? 469 ILE A CB  1 
ATOM   3693 C CG1 . ILE A 1 469 ? 15.784  78.713 53.866 1.00 34.67 ? 469 ILE A CG1 1 
ATOM   3694 C CG2 . ILE A 1 469 ? 13.834  77.586 52.630 1.00 31.86 ? 469 ILE A CG2 1 
ATOM   3695 C CD1 . ILE A 1 469 ? 16.613  77.469 53.859 1.00 35.08 ? 469 ILE A CD1 1 
ATOM   3696 N N   . MET A 1 470 ? 13.486  80.034 50.415 1.00 33.71 ? 470 MET A N   1 
ATOM   3697 C CA  . MET A 1 470 ? 12.363  80.203 49.512 1.00 33.35 ? 470 MET A CA  1 
ATOM   3698 C C   . MET A 1 470 ? 12.712  80.201 48.040 1.00 33.97 ? 470 MET A C   1 
ATOM   3699 O O   . MET A 1 470 ? 11.862  79.922 47.199 1.00 33.78 ? 470 MET A O   1 
ATOM   3700 C CB  . MET A 1 470 ? 11.651  81.507 49.808 1.00 33.46 ? 470 MET A CB  1 
ATOM   3701 C CG  . MET A 1 470 ? 10.607  81.440 50.870 1.00 33.72 ? 470 MET A CG  1 
ATOM   3702 S SD  . MET A 1 470 ? 9.550   82.880 50.682 1.00 33.34 ? 470 MET A SD  1 
ATOM   3703 C CE  . MET A 1 470 ? 10.555  84.078 51.490 1.00 34.48 ? 470 MET A CE  1 
ATOM   3704 N N   . HIS A 1 471 ? 13.945  80.555 47.711 1.00 34.93 ? 471 HIS A N   1 
ATOM   3705 C CA  . HIS A 1 471 ? 14.335  80.587 46.313 1.00 35.69 ? 471 HIS A CA  1 
ATOM   3706 C C   . HIS A 1 471 ? 14.794  79.196 45.922 1.00 35.07 ? 471 HIS A C   1 
ATOM   3707 O O   . HIS A 1 471 ? 14.386  78.653 44.897 1.00 34.48 ? 471 HIS A O   1 
ATOM   3708 C CB  . HIS A 1 471 ? 15.451  81.593 46.104 1.00 37.48 ? 471 HIS A CB  1 
ATOM   3709 C CG  . HIS A 1 471 ? 15.640  81.979 44.674 1.00 40.04 ? 471 HIS A CG  1 
ATOM   3710 N ND1 . HIS A 1 471 ? 14.626  82.522 43.916 1.00 39.78 ? 471 HIS A ND1 1 
ATOM   3711 C CD2 . HIS A 1 471 ? 16.726  81.911 43.864 1.00 41.31 ? 471 HIS A CD2 1 
ATOM   3712 C CE1 . HIS A 1 471 ? 15.081  82.777 42.701 1.00 41.80 ? 471 HIS A CE1 1 
ATOM   3713 N NE2 . HIS A 1 471 ? 16.352  82.417 42.643 1.00 41.11 ? 471 HIS A NE2 1 
ATOM   3714 N N   . TYR A 1 472 ? 15.662  78.634 46.752 1.00 34.15 ? 472 TYR A N   1 
ATOM   3715 C CA  . TYR A 1 472 ? 16.148  77.283 46.554 1.00 32.84 ? 472 TYR A CA  1 
ATOM   3716 C C   . TYR A 1 472 ? 14.920  76.413 46.276 1.00 31.51 ? 472 TYR A C   1 
ATOM   3717 O O   . TYR A 1 472 ? 14.836  75.682 45.280 1.00 30.53 ? 472 TYR A O   1 
ATOM   3718 C CB  . TYR A 1 472 ? 16.775  76.787 47.842 1.00 33.51 ? 472 TYR A CB  1 
ATOM   3719 C CG  . TYR A 1 472 ? 18.193  77.193 48.084 1.00 35.01 ? 472 TYR A CG  1 
ATOM   3720 C CD1 . TYR A 1 472 ? 19.137  77.146 47.065 1.00 35.36 ? 472 TYR A CD1 1 
ATOM   3721 C CD2 . TYR A 1 472 ? 18.617  77.539 49.364 1.00 37.47 ? 472 TYR A CD2 1 
ATOM   3722 C CE1 . TYR A 1 472 ? 20.482  77.429 47.311 1.00 36.31 ? 472 TYR A CE1 1 
ATOM   3723 C CE2 . TYR A 1 472 ? 19.957  77.829 49.628 1.00 39.18 ? 472 TYR A CE2 1 
ATOM   3724 C CZ  . TYR A 1 472 ? 20.887  77.772 48.593 1.00 38.71 ? 472 TYR A CZ  1 
ATOM   3725 O OH  . TYR A 1 472 ? 22.207  78.084 48.850 1.00 39.60 ? 472 TYR A OH  1 
ATOM   3726 N N   . TRP A 1 473 ? 13.967  76.506 47.193 1.00 29.31 ? 473 TRP A N   1 
ATOM   3727 C CA  . TRP A 1 473 ? 12.758  75.732 47.096 1.00 27.90 ? 473 TRP A CA  1 
ATOM   3728 C C   . TRP A 1 473 ? 11.961  75.977 45.842 1.00 27.32 ? 473 TRP A C   1 
ATOM   3729 O O   . TRP A 1 473 ? 11.456  75.034 45.263 1.00 29.40 ? 473 TRP A O   1 
ATOM   3730 C CB  . TRP A 1 473 ? 11.869  75.995 48.291 1.00 27.57 ? 473 TRP A CB  1 
ATOM   3731 C CG  . TRP A 1 473 ? 11.898  74.945 49.337 1.00 29.52 ? 473 TRP A CG  1 
ATOM   3732 C CD1 . TRP A 1 473 ? 10.817  74.289 49.855 1.00 30.18 ? 473 TRP A CD1 1 
ATOM   3733 C CD2 . TRP A 1 473 ? 13.041  74.483 50.080 1.00 30.25 ? 473 TRP A CD2 1 
ATOM   3734 N NE1 . TRP A 1 473 ? 11.210  73.454 50.880 1.00 30.88 ? 473 TRP A NE1 1 
ATOM   3735 C CE2 . TRP A 1 473 ? 12.568  73.552 51.040 1.00 30.36 ? 473 TRP A CE2 1 
ATOM   3736 C CE3 . TRP A 1 473 ? 14.412  74.761 50.030 1.00 30.29 ? 473 TRP A CE3 1 
ATOM   3737 C CZ2 . TRP A 1 473 ? 13.421  72.900 51.943 1.00 29.15 ? 473 TRP A CZ2 1 
ATOM   3738 C CZ3 . TRP A 1 473 ? 15.263  74.107 50.932 1.00 29.99 ? 473 TRP A CZ3 1 
ATOM   3739 C CH2 . TRP A 1 473 ? 14.759  73.190 51.872 1.00 29.29 ? 473 TRP A CH2 1 
ATOM   3740 N N   . ALA A 1 474 ? 11.834  77.228 45.411 1.00 25.79 ? 474 ALA A N   1 
ATOM   3741 C CA  . ALA A 1 474 ? 11.035  77.520 44.222 1.00 23.45 ? 474 ALA A CA  1 
ATOM   3742 C C   . ALA A 1 474 ? 11.811  77.247 42.952 1.00 22.94 ? 474 ALA A C   1 
ATOM   3743 O O   . ALA A 1 474 ? 11.270  76.728 41.975 1.00 21.81 ? 474 ALA A O   1 
ATOM   3744 C CB  . ALA A 1 474 ? 10.564  78.949 44.248 1.00 21.83 ? 474 ALA A CB  1 
ATOM   3745 N N   . THR A 1 475 ? 13.089  77.594 42.962 1.00 23.82 ? 475 THR A N   1 
ATOM   3746 C CA  . THR A 1 475 ? 13.912  77.358 41.789 1.00 25.12 ? 475 THR A CA  1 
ATOM   3747 C C   . THR A 1 475 ? 13.925  75.856 41.503 1.00 26.61 ? 475 THR A C   1 
ATOM   3748 O O   . THR A 1 475 ? 13.731  75.435 40.361 1.00 27.18 ? 475 THR A O   1 
ATOM   3749 C CB  . THR A 1 475 ? 15.342  77.899 41.996 1.00 23.70 ? 475 THR A CB  1 
ATOM   3750 O OG1 . THR A 1 475 ? 15.289  79.325 42.009 1.00 23.30 ? 475 THR A OG1 1 
ATOM   3751 C CG2 . THR A 1 475 ? 16.265  77.454 40.874 1.00 21.89 ? 475 THR A CG2 1 
ATOM   3752 N N   . PHE A 1 476 ? 14.132  75.050 42.541 1.00 27.11 ? 476 PHE A N   1 
ATOM   3753 C CA  . PHE A 1 476 ? 14.130  73.605 42.374 1.00 27.33 ? 476 PHE A CA  1 
ATOM   3754 C C   . PHE A 1 476 ? 12.815  73.158 41.710 1.00 28.94 ? 476 PHE A C   1 
ATOM   3755 O O   . PHE A 1 476 ? 12.810  72.468 40.677 1.00 27.99 ? 476 PHE A O   1 
ATOM   3756 C CB  . PHE A 1 476 ? 14.253  72.925 43.734 1.00 25.30 ? 476 PHE A CB  1 
ATOM   3757 C CG  . PHE A 1 476 ? 14.010  71.449 43.682 1.00 24.26 ? 476 PHE A CG  1 
ATOM   3758 C CD1 . PHE A 1 476 ? 14.974  70.590 43.153 1.00 24.09 ? 476 PHE A CD1 1 
ATOM   3759 C CD2 . PHE A 1 476 ? 12.790  70.921 44.101 1.00 24.02 ? 476 PHE A CD2 1 
ATOM   3760 C CE1 . PHE A 1 476 ? 14.729  69.219 43.033 1.00 24.09 ? 476 PHE A CE1 1 
ATOM   3761 C CE2 . PHE A 1 476 ? 12.525  69.556 43.991 1.00 24.54 ? 476 PHE A CE2 1 
ATOM   3762 C CZ  . PHE A 1 476 ? 13.499  68.698 43.453 1.00 24.92 ? 476 PHE A CZ  1 
ATOM   3763 N N   . ALA A 1 477 ? 11.711  73.572 42.329 1.00 29.84 ? 477 ALA A N   1 
ATOM   3764 C CA  . ALA A 1 477 ? 10.362  73.255 41.893 1.00 31.35 ? 477 ALA A CA  1 
ATOM   3765 C C   . ALA A 1 477 ? 10.098  73.395 40.408 1.00 33.49 ? 477 ALA A C   1 
ATOM   3766 O O   . ALA A 1 477 ? 9.225   72.705 39.868 1.00 36.45 ? 477 ALA A O   1 
ATOM   3767 C CB  . ALA A 1 477 ? 9.370   74.105 42.654 1.00 29.89 ? 477 ALA A CB  1 
ATOM   3768 N N   . LYS A 1 478 ? 10.827  74.280 39.737 1.00 34.19 ? 478 LYS A N   1 
ATOM   3769 C CA  . LYS A 1 478 ? 10.609  74.490 38.306 1.00 34.09 ? 478 LYS A CA  1 
ATOM   3770 C C   . LYS A 1 478 ? 11.845  74.282 37.467 1.00 33.01 ? 478 LYS A C   1 
ATOM   3771 O O   . LYS A 1 478 ? 11.923  74.723 36.341 1.00 32.87 ? 478 LYS A O   1 
ATOM   3772 C CB  . LYS A 1 478 ? 10.106  75.898 38.081 1.00 35.78 ? 478 LYS A CB  1 
ATOM   3773 C CG  . LYS A 1 478 ? 10.821  76.914 38.922 1.00 37.94 ? 478 LYS A CG  1 
ATOM   3774 C CD  . LYS A 1 478 ? 10.824  78.245 38.216 1.00 42.28 ? 478 LYS A CD  1 
ATOM   3775 C CE  . LYS A 1 478 ? 11.739  78.208 36.965 1.00 44.64 ? 478 LYS A CE  1 
ATOM   3776 N NZ  . LYS A 1 478 ? 11.033  78.207 35.631 1.00 45.23 ? 478 LYS A NZ  1 
ATOM   3777 N N   . THR A 1 479 ? 12.811  73.583 38.018 1.00 33.31 ? 479 THR A N   1 
ATOM   3778 C CA  . THR A 1 479 ? 14.050  73.362 37.321 1.00 32.32 ? 479 THR A CA  1 
ATOM   3779 C C   . THR A 1 479 ? 14.490  71.963 37.605 1.00 32.69 ? 479 THR A C   1 
ATOM   3780 O O   . THR A 1 479 ? 14.895  71.251 36.698 1.00 33.50 ? 479 THR A O   1 
ATOM   3781 C CB  . THR A 1 479 ? 15.089  74.325 37.849 1.00 32.75 ? 479 THR A CB  1 
ATOM   3782 O OG1 . THR A 1 479 ? 14.671  75.647 37.523 1.00 33.61 ? 479 THR A OG1 1 
ATOM   3783 C CG2 . THR A 1 479 ? 16.451  74.051 37.274 1.00 33.05 ? 479 THR A CG2 1 
ATOM   3784 N N   . GLY A 1 480 ? 14.382  71.560 38.867 1.00 32.11 ? 480 GLY A N   1 
ATOM   3785 C CA  . GLY A 1 480 ? 14.823  70.235 39.242 1.00 33.04 ? 480 GLY A CA  1 
ATOM   3786 C C   . GLY A 1 480 ? 16.254  70.415 39.710 1.00 34.44 ? 480 GLY A C   1 
ATOM   3787 O O   . GLY A 1 480 ? 17.060  69.467 39.757 1.00 33.64 ? 480 GLY A O   1 
ATOM   3788 N N   . ASN A 1 481 ? 16.558  71.675 40.023 1.00 35.19 ? 481 ASN A N   1 
ATOM   3789 C CA  . ASN A 1 481 ? 17.860  72.104 40.522 1.00 35.89 ? 481 ASN A CA  1 
ATOM   3790 C C   . ASN A 1 481 ? 17.563  73.383 41.290 1.00 36.68 ? 481 ASN A C   1 
ATOM   3791 O O   . ASN A 1 481 ? 16.835  74.245 40.777 1.00 36.91 ? 481 ASN A O   1 
ATOM   3792 C CB  . ASN A 1 481 ? 18.817  72.411 39.372 1.00 36.06 ? 481 ASN A CB  1 
ATOM   3793 C CG  . ASN A 1 481 ? 20.205  72.783 39.857 1.00 36.57 ? 481 ASN A CG  1 
ATOM   3794 O OD1 . ASN A 1 481 ? 20.353  73.552 40.794 1.00 38.77 ? 481 ASN A OD1 1 
ATOM   3795 N ND2 . ASN A 1 481 ? 21.226  72.245 39.215 1.00 37.53 ? 481 ASN A ND2 1 
ATOM   3796 N N   . PRO A 1 482 ? 18.112  73.520 42.524 1.00 36.87 ? 482 PRO A N   1 
ATOM   3797 C CA  . PRO A 1 482 ? 17.943  74.674 43.422 1.00 37.51 ? 482 PRO A CA  1 
ATOM   3798 C C   . PRO A 1 482 ? 18.730  75.878 42.940 1.00 39.98 ? 482 PRO A C   1 
ATOM   3799 O O   . PRO A 1 482 ? 18.285  77.024 43.051 1.00 40.78 ? 482 PRO A O   1 
ATOM   3800 C CB  . PRO A 1 482 ? 18.505  74.182 44.752 1.00 35.23 ? 482 PRO A CB  1 
ATOM   3801 C CG  . PRO A 1 482 ? 18.691  72.719 44.583 1.00 35.00 ? 482 PRO A CG  1 
ATOM   3802 C CD  . PRO A 1 482 ? 19.001  72.530 43.148 1.00 35.45 ? 482 PRO A CD  1 
ATOM   3803 N N   . ASN A 1 483 ? 19.913  75.584 42.408 1.00 42.87 ? 483 ASN A N   1 
ATOM   3804 C CA  . ASN A 1 483 ? 20.863  76.570 41.907 1.00 45.94 ? 483 ASN A CA  1 
ATOM   3805 C C   . ASN A 1 483 ? 20.458  77.431 40.718 1.00 50.65 ? 483 ASN A C   1 
ATOM   3806 O O   . ASN A 1 483 ? 19.841  76.968 39.755 1.00 51.00 ? 483 ASN A O   1 
ATOM   3807 C CB  . ASN A 1 483 ? 22.168  75.865 41.570 1.00 41.89 ? 483 ASN A CB  1 
ATOM   3808 C CG  . ASN A 1 483 ? 22.741  75.129 42.747 1.00 38.70 ? 483 ASN A CG  1 
ATOM   3809 O OD1 . ASN A 1 483 ? 23.087  75.736 43.749 1.00 37.40 ? 483 ASN A OD1 1 
ATOM   3810 N ND2 . ASN A 1 483 ? 22.843  73.817 42.636 1.00 37.63 ? 483 ASN A ND2 1 
ATOM   3811 N N   . GLU A 1 484 ? 20.839  78.700 40.800 1.00 56.94 ? 484 GLU A N   1 
ATOM   3812 C CA  . GLU A 1 484 ? 20.575  79.660 39.742 1.00 62.85 ? 484 GLU A CA  1 
ATOM   3813 C C   . GLU A 1 484 ? 21.511  79.360 38.577 1.00 66.78 ? 484 GLU A C   1 
ATOM   3814 O O   . GLU A 1 484 ? 22.740  79.305 38.743 1.00 67.17 ? 484 GLU A O   1 
ATOM   3815 C CB  . GLU A 1 484 ? 20.811  81.082 40.250 1.00 64.32 ? 484 GLU A CB  1 
ATOM   3816 C CG  . GLU A 1 484 ? 19.605  81.690 40.916 1.00 66.65 ? 484 GLU A CG  1 
ATOM   3817 C CD  . GLU A 1 484 ? 18.545  82.068 39.905 1.00 67.81 ? 484 GLU A CD  1 
ATOM   3818 O OE1 . GLU A 1 484 ? 18.392  81.335 38.896 1.00 66.96 ? 484 GLU A OE1 1 
ATOM   3819 O OE2 . GLU A 1 484 ? 17.862  83.096 40.127 1.00 69.00 ? 484 GLU A OE2 1 
ATOM   3820 N N   . PRO A 1 485 ? 20.936  79.161 37.380 0.75 70.03 ? 485 PRO A N   1 
ATOM   3821 C CA  . PRO A 1 485 ? 21.656  78.858 36.146 0.75 72.51 ? 485 PRO A CA  1 
ATOM   3822 C C   . PRO A 1 485 ? 23.069  79.395 36.066 0.75 75.25 ? 485 PRO A C   1 
ATOM   3823 O O   . PRO A 1 485 ? 23.940  78.742 35.503 0.75 76.13 ? 485 PRO A O   1 
ATOM   3824 C CB  . PRO A 1 485 ? 20.739  79.428 35.086 0.75 72.04 ? 485 PRO A CB  1 
ATOM   3825 C CG  . PRO A 1 485 ? 19.404  79.016 35.619 0.75 71.82 ? 485 PRO A CG  1 
ATOM   3826 C CD  . PRO A 1 485 ? 19.504  79.369 37.097 0.75 70.91 ? 485 PRO A CD  1 
ATOM   3827 N N   . HIS A 1 486 ? 23.323  80.569 36.624 0.75 78.37 ? 486 HIS A N   1 
ATOM   3828 C CA  . HIS A 1 486 ? 24.682  81.075 36.556 0.75 82.42 ? 486 HIS A CA  1 
ATOM   3829 C C   . HIS A 1 486 ? 25.177  81.752 37.828 0.75 83.61 ? 486 HIS A C   1 
ATOM   3830 O O   . HIS A 1 486 ? 26.380  81.773 38.089 0.75 83.39 ? 486 HIS A O   1 
ATOM   3831 C CB  . HIS A 1 486 ? 24.825  82.028 35.370 0.75 85.08 ? 486 HIS A CB  1 
ATOM   3832 C CG  . HIS A 1 486 ? 26.229  82.143 34.863 0.75 87.54 ? 486 HIS A CG  1 
ATOM   3833 N ND1 . HIS A 1 486 ? 27.295  82.441 35.686 0.75 88.30 ? 486 HIS A ND1 1 
ATOM   3834 C CD2 . HIS A 1 486 ? 26.743  81.991 33.619 0.75 88.28 ? 486 HIS A CD2 1 
ATOM   3835 C CE1 . HIS A 1 486 ? 28.405  82.468 34.971 0.75 89.06 ? 486 HIS A CE1 1 
ATOM   3836 N NE2 . HIS A 1 486 ? 28.098  82.198 33.714 0.75 89.40 ? 486 HIS A NE2 1 
ATOM   3837 N N   . SER A 1 487 ? 24.243  82.295 38.608 0.75 85.19 ? 487 SER A N   1 
ATOM   3838 C CA  . SER A 1 487 ? 24.539  82.988 39.866 0.75 86.49 ? 487 SER A CA  1 
ATOM   3839 C C   . SER A 1 487 ? 25.938  82.784 40.445 0.75 87.20 ? 487 SER A C   1 
ATOM   3840 O O   . SER A 1 487 ? 26.459  81.663 40.502 0.75 87.53 ? 487 SER A O   1 
ATOM   3841 C CB  . SER A 1 487 ? 23.514  82.604 40.933 0.75 86.82 ? 487 SER A CB  1 
ATOM   3842 O OG  . SER A 1 487 ? 23.821  83.222 42.169 0.75 86.58 ? 487 SER A OG  1 
ATOM   3843 N N   . GLN A 1 488 ? 26.518  83.889 40.906 0.75 87.68 ? 488 GLN A N   1 
ATOM   3844 C CA  . GLN A 1 488 ? 27.860  83.907 41.482 0.75 87.41 ? 488 GLN A CA  1 
ATOM   3845 C C   . GLN A 1 488 ? 27.896  83.442 42.935 0.75 86.09 ? 488 GLN A C   1 
ATOM   3846 O O   . GLN A 1 488 ? 28.629  84.000 43.758 0.75 85.28 ? 488 GLN A O   1 
ATOM   3847 C CB  . GLN A 1 488 ? 28.438  85.322 41.383 0.75 89.29 ? 488 GLN A CB  1 
ATOM   3848 C CG  . GLN A 1 488 ? 28.401  85.914 39.974 0.75 91.64 ? 488 GLN A CG  1 
ATOM   3849 C CD  . GLN A 1 488 ? 29.096  85.029 38.948 0.75 93.26 ? 488 GLN A CD  1 
ATOM   3850 O OE1 . GLN A 1 488 ? 28.465  84.519 38.017 0.75 93.81 ? 488 GLN A OE1 1 
ATOM   3851 N NE2 . GLN A 1 488 ? 30.403  84.841 39.118 0.75 94.21 ? 488 GLN A NE2 1 
ATOM   3852 N N   . GLU A 1 489 ? 27.099  82.423 43.247 0.75 84.76 ? 489 GLU A N   1 
ATOM   3853 C CA  . GLU A 1 489 ? 27.053  81.879 44.599 0.75 82.86 ? 489 GLU A CA  1 
ATOM   3854 C C   . GLU A 1 489 ? 27.690  80.508 44.576 0.75 80.83 ? 489 GLU A C   1 
ATOM   3855 O O   . GLU A 1 489 ? 28.032  79.988 43.507 0.75 80.58 ? 489 GLU A O   1 
ATOM   3856 C CB  . GLU A 1 489 ? 25.613  81.728 45.093 0.75 83.65 ? 489 GLU A CB  1 
ATOM   3857 C CG  . GLU A 1 489 ? 24.724  82.909 44.809 0.75 84.95 ? 489 GLU A CG  1 
ATOM   3858 C CD  . GLU A 1 489 ? 25.424  84.224 45.047 0.75 86.16 ? 489 GLU A CD  1 
ATOM   3859 O OE1 . GLU A 1 489 ? 25.971  84.414 46.157 0.75 86.46 ? 489 GLU A OE1 1 
ATOM   3860 O OE2 . GLU A 1 489 ? 25.425  85.063 44.119 0.75 87.02 ? 489 GLU A OE2 1 
ATOM   3861 N N   . SER A 1 490 ? 27.847  79.929 45.763 1.00 78.19 ? 490 SER A N   1 
ATOM   3862 C CA  . SER A 1 490 ? 28.419  78.592 45.892 1.00 74.75 ? 490 SER A CA  1 
ATOM   3863 C C   . SER A 1 490 ? 27.299  77.648 45.448 1.00 71.23 ? 490 SER A C   1 
ATOM   3864 O O   . SER A 1 490 ? 26.117  77.950 45.636 1.00 70.97 ? 490 SER A O   1 
ATOM   3865 C CB  . SER A 1 490 ? 28.814  78.315 47.353 1.00 75.50 ? 490 SER A CB  1 
ATOM   3866 O OG  . SER A 1 490 ? 29.582  79.380 47.905 1.00 75.09 ? 490 SER A OG  1 
ATOM   3867 N N   . LYS A 1 491 ? 27.649  76.515 44.858 1.00 66.51 ? 491 LYS A N   1 
ATOM   3868 C CA  . LYS A 1 491 ? 26.609  75.613 44.403 1.00 62.67 ? 491 LYS A CA  1 
ATOM   3869 C C   . LYS A 1 491 ? 26.184  74.555 45.438 1.00 58.62 ? 491 LYS A C   1 
ATOM   3870 O O   . LYS A 1 491 ? 26.996  74.060 46.218 1.00 58.86 ? 491 LYS A O   1 
ATOM   3871 C CB  . LYS A 1 491 ? 27.046  74.952 43.080 1.00 64.73 ? 491 LYS A CB  1 
ATOM   3872 C CG  . LYS A 1 491 ? 27.356  75.953 41.940 1.00 68.59 ? 491 LYS A CG  1 
ATOM   3873 C CD  . LYS A 1 491 ? 26.127  76.836 41.568 1.00 71.99 ? 491 LYS A CD  1 
ATOM   3874 C CE  . LYS A 1 491 ? 26.466  78.161 40.814 1.00 72.45 ? 491 LYS A CE  1 
ATOM   3875 N NZ  . LYS A 1 491 ? 26.796  78.023 39.360 1.00 72.95 ? 491 LYS A NZ  1 
ATOM   3876 N N   . TRP A 1 492 ? 24.888  74.254 45.464 1.00 52.66 ? 492 TRP A N   1 
ATOM   3877 C CA  . TRP A 1 492 ? 24.334  73.237 46.349 1.00 46.36 ? 492 TRP A CA  1 
ATOM   3878 C C   . TRP A 1 492 ? 24.622  71.985 45.531 1.00 44.10 ? 492 TRP A C   1 
ATOM   3879 O O   . TRP A 1 492 ? 23.872  71.652 44.620 1.00 45.21 ? 492 TRP A O   1 
ATOM   3880 C CB  . TRP A 1 492 ? 22.817  73.439 46.499 1.00 42.90 ? 492 TRP A CB  1 
ATOM   3881 C CG  . TRP A 1 492 ? 22.119  72.447 47.382 1.00 39.77 ? 492 TRP A CG  1 
ATOM   3882 C CD1 . TRP A 1 492 ? 22.550  71.191 47.722 1.00 40.04 ? 492 TRP A CD1 1 
ATOM   3883 C CD2 . TRP A 1 492 ? 20.851  72.616 48.021 1.00 38.75 ? 492 TRP A CD2 1 
ATOM   3884 N NE1 . TRP A 1 492 ? 21.629  70.569 48.536 1.00 38.56 ? 492 TRP A NE1 1 
ATOM   3885 C CE2 . TRP A 1 492 ? 20.577  71.423 48.737 1.00 38.36 ? 492 TRP A CE2 1 
ATOM   3886 C CE3 . TRP A 1 492 ? 19.917  73.658 48.064 1.00 37.59 ? 492 TRP A CE3 1 
ATOM   3887 C CZ2 . TRP A 1 492 ? 19.408  71.250 49.486 1.00 36.92 ? 492 TRP A CZ2 1 
ATOM   3888 C CZ3 . TRP A 1 492 ? 18.747  73.481 48.815 1.00 35.83 ? 492 TRP A CZ3 1 
ATOM   3889 C CH2 . TRP A 1 492 ? 18.509  72.287 49.512 1.00 35.82 ? 492 TRP A CH2 1 
ATOM   3890 N N   . PRO A 1 493 ? 25.719  71.284 45.829 1.00 41.30 ? 493 PRO A N   1 
ATOM   3891 C CA  . PRO A 1 493 ? 26.112  70.067 45.110 1.00 40.68 ? 493 PRO A CA  1 
ATOM   3892 C C   . PRO A 1 493 ? 25.099  68.950 45.098 1.00 39.82 ? 493 PRO A C   1 
ATOM   3893 O O   . PRO A 1 493 ? 24.310  68.818 46.016 1.00 41.25 ? 493 PRO A O   1 
ATOM   3894 C CB  . PRO A 1 493 ? 27.384  69.640 45.827 1.00 40.63 ? 493 PRO A CB  1 
ATOM   3895 C CG  . PRO A 1 493 ? 27.125  70.050 47.196 1.00 40.98 ? 493 PRO A CG  1 
ATOM   3896 C CD  . PRO A 1 493 ? 26.545  71.447 47.029 1.00 40.63 ? 493 PRO A CD  1 
ATOM   3897 N N   . LEU A 1 494 ? 25.129  68.137 44.057 1.00 39.04 ? 494 LEU A N   1 
ATOM   3898 C CA  . LEU A 1 494 ? 24.223  67.010 43.981 1.00 39.47 ? 494 LEU A CA  1 
ATOM   3899 C C   . LEU A 1 494 ? 24.746  65.932 44.916 1.00 40.26 ? 494 LEU A C   1 
ATOM   3900 O O   . LEU A 1 494 ? 25.954  65.804 45.125 1.00 40.57 ? 494 LEU A O   1 
ATOM   3901 C CB  . LEU A 1 494 ? 24.182  66.459 42.564 1.00 40.64 ? 494 LEU A CB  1 
ATOM   3902 C CG  . LEU A 1 494 ? 23.002  66.801 41.658 1.00 40.47 ? 494 LEU A CG  1 
ATOM   3903 C CD1 . LEU A 1 494 ? 23.479  66.734 40.242 1.00 40.09 ? 494 LEU A CD1 1 
ATOM   3904 C CD2 . LEU A 1 494 ? 21.837  65.849 41.880 1.00 40.85 ? 494 LEU A CD2 1 
ATOM   3905 N N   . PHE A 1 495 ? 23.831  65.154 45.474 1.00 41.46 ? 495 PHE A N   1 
ATOM   3906 C CA  . PHE A 1 495 ? 24.183  64.075 46.391 1.00 43.32 ? 495 PHE A CA  1 
ATOM   3907 C C   . PHE A 1 495 ? 24.454  62.842 45.531 1.00 44.86 ? 495 PHE A C   1 
ATOM   3908 O O   . PHE A 1 495 ? 23.598  62.450 44.741 1.00 45.70 ? 495 PHE A O   1 
ATOM   3909 C CB  . PHE A 1 495 ? 22.999  63.824 47.353 1.00 42.51 ? 495 PHE A CB  1 
ATOM   3910 C CG  . PHE A 1 495 ? 23.202  62.679 48.321 1.00 40.86 ? 495 PHE A CG  1 
ATOM   3911 C CD1 . PHE A 1 495 ? 22.997  61.363 47.923 1.00 40.58 ? 495 PHE A CD1 1 
ATOM   3912 C CD2 . PHE A 1 495 ? 23.593  62.916 49.625 1.00 41.11 ? 495 PHE A CD2 1 
ATOM   3913 C CE1 . PHE A 1 495 ? 23.179  60.303 48.804 1.00 39.03 ? 495 PHE A CE1 1 
ATOM   3914 C CE2 . PHE A 1 495 ? 23.779  61.857 50.515 1.00 41.11 ? 495 PHE A CE2 1 
ATOM   3915 C CZ  . PHE A 1 495 ? 23.569  60.547 50.094 1.00 39.83 ? 495 PHE A CZ  1 
ATOM   3916 N N   . THR A 1 496 ? 25.643  62.252 45.669 1.00 46.51 ? 496 THR A N   1 
ATOM   3917 C CA  . THR A 1 496 ? 26.023  61.048 44.914 1.00 48.28 ? 496 THR A CA  1 
ATOM   3918 C C   . THR A 1 496 ? 26.294  59.907 45.887 1.00 49.91 ? 496 THR A C   1 
ATOM   3919 O O   . THR A 1 496 ? 26.690  60.145 47.024 1.00 51.03 ? 496 THR A O   1 
ATOM   3920 C CB  . THR A 1 496 ? 27.317  61.261 44.091 1.00 48.26 ? 496 THR A CB  1 
ATOM   3921 O OG1 . THR A 1 496 ? 28.412  61.557 44.972 1.00 48.83 ? 496 THR A OG1 1 
ATOM   3922 C CG2 . THR A 1 496 ? 27.144  62.399 43.109 1.00 47.83 ? 496 THR A CG2 1 
ATOM   3923 N N   . THR A 1 497 ? 26.099  58.667 45.460 1.00 51.21 ? 497 THR A N   1 
ATOM   3924 C CA  . THR A 1 497 ? 26.361  57.544 46.364 1.00 52.41 ? 497 THR A CA  1 
ATOM   3925 C C   . THR A 1 497 ? 27.858  57.385 46.576 1.00 53.64 ? 497 THR A C   1 
ATOM   3926 O O   . THR A 1 497 ? 28.318  56.582 47.380 1.00 53.34 ? 497 THR A O   1 
ATOM   3927 C CB  . THR A 1 497 ? 25.814  56.265 45.791 1.00 51.18 ? 497 THR A CB  1 
ATOM   3928 O OG1 . THR A 1 497 ? 25.756  56.396 44.368 1.00 51.41 ? 497 THR A OG1 1 
ATOM   3929 C CG2 . THR A 1 497 ? 24.431  55.977 46.360 1.00 50.90 ? 497 THR A CG2 1 
ATOM   3930 N N   . LYS A 1 498 ? 28.613  58.172 45.835 1.00 55.68 ? 498 LYS A N   1 
ATOM   3931 C CA  . LYS A 1 498 ? 30.052  58.146 45.917 1.00 57.89 ? 498 LYS A CA  1 
ATOM   3932 C C   . LYS A 1 498 ? 30.435  58.980 47.121 1.00 58.32 ? 498 LYS A C   1 
ATOM   3933 O O   . LYS A 1 498 ? 30.655  58.465 48.218 1.00 58.31 ? 498 LYS A O   1 
ATOM   3934 C CB  . LYS A 1 498 ? 30.638  58.781 44.657 1.00 60.65 ? 498 LYS A CB  1 
ATOM   3935 C CG  . LYS A 1 498 ? 29.784  58.552 43.401 1.00 63.83 ? 498 LYS A CG  1 
ATOM   3936 C CD  . LYS A 1 498 ? 30.182  59.469 42.233 1.00 65.35 ? 498 LYS A CD  1 
ATOM   3937 C CE  . LYS A 1 498 ? 29.312  59.210 40.993 1.00 66.24 ? 498 LYS A CE  1 
ATOM   3938 N NZ  . LYS A 1 498 ? 29.376  57.793 40.492 1.00 66.44 ? 498 LYS A NZ  1 
ATOM   3939 N N   . GLU A 1 499 ? 30.473  60.286 46.885 1.00 58.80 ? 499 GLU A N   1 
ATOM   3940 C CA  . GLU A 1 499 ? 30.842  61.295 47.869 1.00 59.89 ? 499 GLU A CA  1 
ATOM   3941 C C   . GLU A 1 499 ? 29.717  61.689 48.846 1.00 58.67 ? 499 GLU A C   1 
ATOM   3942 O O   . GLU A 1 499 ? 29.952  61.911 50.038 1.00 58.36 ? 499 GLU A O   1 
ATOM   3943 C CB  . GLU A 1 499 ? 31.321  62.519 47.104 1.00 62.54 ? 499 GLU A CB  1 
ATOM   3944 C CG  . GLU A 1 499 ? 31.591  62.204 45.634 1.00 67.00 ? 499 GLU A CG  1 
ATOM   3945 C CD  . GLU A 1 499 ? 32.070  63.413 44.841 1.00 70.78 ? 499 GLU A CD  1 
ATOM   3946 O OE1 . GLU A 1 499 ? 33.194  63.896 45.129 1.00 71.92 ? 499 GLU A OE1 1 
ATOM   3947 O OE2 . GLU A 1 499 ? 31.323  63.879 43.936 1.00 71.90 ? 499 GLU A OE2 1 
ATOM   3948 N N   . GLN A 1 500 ? 28.496  61.767 48.330 1.00 56.54 ? 500 GLN A N   1 
ATOM   3949 C CA  . GLN A 1 500 ? 27.320  62.138 49.111 1.00 53.13 ? 500 GLN A CA  1 
ATOM   3950 C C   . GLN A 1 500 ? 27.468  63.376 49.943 1.00 50.85 ? 500 GLN A C   1 
ATOM   3951 O O   . GLN A 1 500 ? 27.584  63.324 51.164 1.00 49.21 ? 500 GLN A O   1 
ATOM   3952 C CB  . GLN A 1 500 ? 26.827  60.987 49.988 1.00 52.60 ? 500 GLN A CB  1 
ATOM   3953 C CG  . GLN A 1 500 ? 27.853  60.160 50.681 1.00 52.20 ? 500 GLN A CG  1 
ATOM   3954 C CD  . GLN A 1 500 ? 27.278  58.811 51.042 1.00 53.12 ? 500 GLN A CD  1 
ATOM   3955 O OE1 . GLN A 1 500 ? 26.526  58.667 52.015 1.00 52.89 ? 500 GLN A OE1 1 
ATOM   3956 N NE2 . GLN A 1 500 ? 27.598  57.815 50.232 1.00 53.15 ? 500 GLN A NE2 1 
ATOM   3957 N N   . LYS A 1 501 ? 27.443  64.500 49.243 1.00 49.15 ? 501 LYS A N   1 
ATOM   3958 C CA  . LYS A 1 501 ? 27.555  65.796 49.873 1.00 47.72 ? 501 LYS A CA  1 
ATOM   3959 C C   . LYS A 1 501 ? 26.150  66.312 50.204 1.00 45.44 ? 501 LYS A C   1 
ATOM   3960 O O   . LYS A 1 501 ? 25.163  65.905 49.586 1.00 45.95 ? 501 LYS A O   1 
ATOM   3961 C CB  . LYS A 1 501 ? 28.223  66.788 48.915 1.00 49.15 ? 501 LYS A CB  1 
ATOM   3962 C CG  . LYS A 1 501 ? 29.520  66.347 48.277 1.00 50.47 ? 501 LYS A CG  1 
ATOM   3963 C CD  . LYS A 1 501 ? 30.136  67.570 47.623 1.00 53.32 ? 501 LYS A CD  1 
ATOM   3964 C CE  . LYS A 1 501 ? 31.603  67.375 47.224 1.00 55.59 ? 501 LYS A CE  1 
ATOM   3965 N NZ  . LYS A 1 501 ? 31.809  66.717 45.893 1.00 56.63 ? 501 LYS A NZ  1 
ATOM   3966 N N   . PHE A 1 502 ? 26.064  67.208 51.180 1.00 42.03 ? 502 PHE A N   1 
ATOM   3967 C CA  . PHE A 1 502 ? 24.796  67.829 51.550 1.00 38.46 ? 502 PHE A CA  1 
ATOM   3968 C C   . PHE A 1 502 ? 25.202  69.184 52.072 1.00 37.38 ? 502 PHE A C   1 
ATOM   3969 O O   . PHE A 1 502 ? 26.390  69.479 52.149 1.00 36.96 ? 502 PHE A O   1 
ATOM   3970 C CB  . PHE A 1 502 ? 24.082  67.052 52.643 1.00 35.58 ? 502 PHE A CB  1 
ATOM   3971 C CG  . PHE A 1 502 ? 24.861  66.956 53.914 1.00 34.40 ? 502 PHE A CG  1 
ATOM   3972 C CD1 . PHE A 1 502 ? 25.852  65.994 54.065 1.00 33.45 ? 502 PHE A CD1 1 
ATOM   3973 C CD2 . PHE A 1 502 ? 24.598  67.820 54.974 1.00 33.10 ? 502 PHE A CD2 1 
ATOM   3974 C CE1 . PHE A 1 502 ? 26.558  65.894 55.249 1.00 31.05 ? 502 PHE A CE1 1 
ATOM   3975 C CE2 . PHE A 1 502 ? 25.301  67.724 56.154 1.00 29.91 ? 502 PHE A CE2 1 
ATOM   3976 C CZ  . PHE A 1 502 ? 26.278  66.762 56.291 1.00 30.37 ? 502 PHE A CZ  1 
ATOM   3977 N N   . ILE A 1 503 ? 24.248  70.015 52.449 1.00 36.71 ? 503 ILE A N   1 
ATOM   3978 C CA  . ILE A 1 503 ? 24.657  71.315 52.926 1.00 37.35 ? 503 ILE A CA  1 
ATOM   3979 C C   . ILE A 1 503 ? 24.001  71.820 54.200 1.00 38.90 ? 503 ILE A C   1 
ATOM   3980 O O   . ILE A 1 503 ? 22.967  71.321 54.644 1.00 39.12 ? 503 ILE A O   1 
ATOM   3981 C CB  . ILE A 1 503 ? 24.470  72.364 51.830 1.00 35.64 ? 503 ILE A CB  1 
ATOM   3982 C CG1 . ILE A 1 503 ? 22.995  72.518 51.504 1.00 35.04 ? 503 ILE A CG1 1 
ATOM   3983 C CG2 . ILE A 1 503 ? 25.175  71.927 50.583 1.00 33.76 ? 503 ILE A CG2 1 
ATOM   3984 C CD1 . ILE A 1 503 ? 22.728  73.693 50.626 1.00 35.55 ? 503 ILE A CD1 1 
ATOM   3985 N N   . ASP A 1 504 ? 24.634  72.822 54.787 1.00 40.32 ? 504 ASP A N   1 
ATOM   3986 C CA  . ASP A 1 504 ? 24.135  73.433 55.994 1.00 43.24 ? 504 ASP A CA  1 
ATOM   3987 C C   . ASP A 1 504 ? 23.214  74.593 55.650 1.00 44.47 ? 504 ASP A C   1 
ATOM   3988 O O   . ASP A 1 504 ? 23.580  75.486 54.870 1.00 45.49 ? 504 ASP A O   1 
ATOM   3989 C CB  . ASP A 1 504 ? 25.293  73.980 56.825 1.00 46.53 ? 504 ASP A CB  1 
ATOM   3990 C CG  . ASP A 1 504 ? 25.909  72.946 57.732 1.00 50.16 ? 504 ASP A CG  1 
ATOM   3991 O OD1 . ASP A 1 504 ? 25.376  71.816 57.801 1.00 52.25 ? 504 ASP A OD1 1 
ATOM   3992 O OD2 . ASP A 1 504 ? 26.928  73.271 58.386 1.00 52.43 ? 504 ASP A OD2 1 
ATOM   3993 N N   . LEU A 1 505 ? 22.020  74.586 56.227 1.00 44.42 ? 505 LEU A N   1 
ATOM   3994 C CA  . LEU A 1 505 ? 21.099  75.688 56.019 1.00 44.79 ? 505 LEU A CA  1 
ATOM   3995 C C   . LEU A 1 505 ? 21.083  76.508 57.300 1.00 47.14 ? 505 LEU A C   1 
ATOM   3996 O O   . LEU A 1 505 ? 20.647  76.026 58.345 1.00 48.46 ? 505 LEU A O   1 
ATOM   3997 C CB  . LEU A 1 505 ? 19.705  75.175 55.718 1.00 41.24 ? 505 LEU A CB  1 
ATOM   3998 C CG  . LEU A 1 505 ? 19.333  75.371 54.264 1.00 38.64 ? 505 LEU A CG  1 
ATOM   3999 C CD1 . LEU A 1 505 ? 20.455  74.917 53.381 1.00 37.43 ? 505 LEU A CD1 1 
ATOM   4000 C CD2 . LEU A 1 505 ? 18.086  74.590 53.978 1.00 39.43 ? 505 LEU A CD2 1 
ATOM   4001 N N   . ASN A 1 506 ? 21.595  77.732 57.231 1.00 48.84 ? 506 ASN A N   1 
ATOM   4002 C CA  . ASN A 1 506 ? 21.615  78.604 58.397 1.00 50.82 ? 506 ASN A CA  1 
ATOM   4003 C C   . ASN A 1 506 ? 22.084  79.987 57.998 1.00 51.76 ? 506 ASN A C   1 
ATOM   4004 O O   . ASN A 1 506 ? 22.488  80.185 56.862 1.00 52.79 ? 506 ASN A O   1 
ATOM   4005 C CB  . ASN A 1 506 ? 22.516  78.039 59.500 1.00 51.37 ? 506 ASN A CB  1 
ATOM   4006 C CG  . ASN A 1 506 ? 23.963  77.985 59.098 1.00 52.46 ? 506 ASN A CG  1 
ATOM   4007 O OD1 . ASN A 1 506 ? 24.489  78.924 58.498 1.00 53.42 ? 506 ASN A OD1 1 
ATOM   4008 N ND2 . ASN A 1 506 ? 24.628  76.887 59.441 1.00 53.06 ? 506 ASN A ND2 1 
ATOM   4009 N N   . THR A 1 507 ? 22.040  80.927 58.940 1.00 52.90 ? 507 THR A N   1 
ATOM   4010 C CA  . THR A 1 507 ? 22.417  82.310 58.696 1.00 54.20 ? 507 THR A CA  1 
ATOM   4011 C C   . THR A 1 507 ? 23.805  82.582 58.166 1.00 56.32 ? 507 THR A C   1 
ATOM   4012 O O   . THR A 1 507 ? 24.026  83.642 57.597 1.00 57.04 ? 507 THR A O   1 
ATOM   4013 C CB  . THR A 1 507 ? 22.233  83.169 59.939 1.00 53.72 ? 507 THR A CB  1 
ATOM   4014 O OG1 . THR A 1 507 ? 22.728  82.464 61.080 1.00 54.08 ? 507 THR A OG1 1 
ATOM   4015 C CG2 . THR A 1 507 ? 20.780  83.510 60.132 1.00 52.86 ? 507 THR A CG2 1 
ATOM   4016 N N   . GLU A 1 508 ? 24.755  81.676 58.342 1.00 58.73 ? 508 GLU A N   1 
ATOM   4017 C CA  . GLU A 1 508 ? 26.070  81.962 57.789 1.00 62.79 ? 508 GLU A CA  1 
ATOM   4018 C C   . GLU A 1 508 ? 26.320  81.232 56.473 1.00 64.17 ? 508 GLU A C   1 
ATOM   4019 O O   . GLU A 1 508 ? 25.564  80.335 56.092 1.00 65.25 ? 508 GLU A O   1 
ATOM   4020 C CB  . GLU A 1 508 ? 27.169  81.652 58.798 1.00 65.27 ? 508 GLU A CB  1 
ATOM   4021 C CG  . GLU A 1 508 ? 27.151  80.266 59.341 1.00 71.45 ? 508 GLU A CG  1 
ATOM   4022 C CD  . GLU A 1 508 ? 27.923  80.175 60.649 1.00 75.84 ? 508 GLU A CD  1 
ATOM   4023 O OE1 . GLU A 1 508 ? 29.168  80.350 60.623 1.00 77.97 ? 508 GLU A OE1 1 
ATOM   4024 O OE2 . GLU A 1 508 ? 27.281  79.942 61.707 1.00 78.02 ? 508 GLU A OE2 1 
ATOM   4025 N N   . PRO A 1 509 ? 27.378  81.631 55.746 1.00 65.18 ? 509 PRO A N   1 
ATOM   4026 C CA  . PRO A 1 509 ? 27.785  81.066 54.460 1.00 64.92 ? 509 PRO A CA  1 
ATOM   4027 C C   . PRO A 1 509 ? 27.857  79.556 54.381 1.00 64.84 ? 509 PRO A C   1 
ATOM   4028 O O   . PRO A 1 509 ? 28.645  78.906 55.079 1.00 64.41 ? 509 PRO A O   1 
ATOM   4029 C CB  . PRO A 1 509 ? 29.136  81.715 54.221 1.00 64.90 ? 509 PRO A CB  1 
ATOM   4030 C CG  . PRO A 1 509 ? 28.918  83.061 54.758 1.00 65.56 ? 509 PRO A CG  1 
ATOM   4031 C CD  . PRO A 1 509 ? 28.266  82.753 56.090 1.00 65.92 ? 509 PRO A CD  1 
ATOM   4032 N N   . MET A 1 510 ? 27.019  79.027 53.498 1.00 64.61 ? 510 MET A N   1 
ATOM   4033 C CA  . MET A 1 510 ? 26.912  77.605 53.225 1.00 64.17 ? 510 MET A CA  1 
ATOM   4034 C C   . MET A 1 510 ? 28.253  76.870 53.162 1.00 62.16 ? 510 MET A C   1 
ATOM   4035 O O   . MET A 1 510 ? 29.231  77.376 52.634 1.00 61.46 ? 510 MET A O   1 
ATOM   4036 C CB  . MET A 1 510 ? 26.172  77.422 51.894 1.00 66.27 ? 510 MET A CB  1 
ATOM   4037 C CG  . MET A 1 510 ? 26.340  76.047 51.241 1.00 68.80 ? 510 MET A CG  1 
ATOM   4038 S SD  . MET A 1 510 ? 26.034  76.062 49.441 1.00 69.13 ? 510 MET A SD  1 
ATOM   4039 C CE  . MET A 1 510 ? 24.291  76.379 49.441 1.00 69.89 ? 510 MET A CE  1 
ATOM   4040 N N   . LYS A 1 511 ? 28.280  75.671 53.720 1.00 60.72 ? 511 LYS A N   1 
ATOM   4041 C CA  . LYS A 1 511 ? 29.460  74.825 53.688 1.00 60.14 ? 511 LYS A CA  1 
ATOM   4042 C C   . LYS A 1 511 ? 28.844  73.516 53.257 1.00 58.00 ? 511 LYS A C   1 
ATOM   4043 O O   . LYS A 1 511 ? 27.684  73.253 53.561 1.00 58.27 ? 511 LYS A O   1 
ATOM   4044 C CB  . LYS A 1 511 ? 30.068  74.621 55.076 1.00 62.94 ? 511 LYS A CB  1 
ATOM   4045 C CG  . LYS A 1 511 ? 30.241  75.869 55.927 1.00 68.57 ? 511 LYS A CG  1 
ATOM   4046 C CD  . LYS A 1 511 ? 30.806  75.493 57.320 1.00 72.43 ? 511 LYS A CD  1 
ATOM   4047 C CE  . LYS A 1 511 ? 30.517  76.553 58.413 1.00 74.05 ? 511 LYS A CE  1 
ATOM   4048 N NZ  . LYS A 1 511 ? 31.099  77.907 58.138 1.00 74.49 ? 511 LYS A NZ  1 
ATOM   4049 N N   . VAL A 1 512 ? 29.590  72.689 52.545 1.00 55.14 ? 512 VAL A N   1 
ATOM   4050 C CA  . VAL A 1 512 ? 29.028  71.418 52.143 1.00 52.41 ? 512 VAL A CA  1 
ATOM   4051 C C   . VAL A 1 512 ? 29.784  70.377 52.942 1.00 50.84 ? 512 VAL A C   1 
ATOM   4052 O O   . VAL A 1 512 ? 30.966  70.551 53.206 1.00 50.24 ? 512 VAL A O   1 
ATOM   4053 C CB  . VAL A 1 512 ? 29.185  71.200 50.621 1.00 51.96 ? 512 VAL A CB  1 
ATOM   4054 C CG1 . VAL A 1 512 ? 29.002  72.531 49.901 1.00 51.10 ? 512 VAL A CG1 1 
ATOM   4055 C CG2 . VAL A 1 512 ? 30.520  70.587 50.296 1.00 51.94 ? 512 VAL A CG2 1 
ATOM   4056 N N   . HIS A 1 513 ? 29.105  69.317 53.360 1.00 49.80 ? 513 HIS A N   1 
ATOM   4057 C CA  . HIS A 1 513 ? 29.757  68.273 54.146 1.00 49.21 ? 513 HIS A CA  1 
ATOM   4058 C C   . HIS A 1 513 ? 29.508  66.921 53.484 1.00 48.86 ? 513 HIS A C   1 
ATOM   4059 O O   . HIS A 1 513 ? 28.871  66.845 52.434 1.00 48.19 ? 513 HIS A O   1 
ATOM   4060 C CB  . HIS A 1 513 ? 29.190  68.232 55.573 1.00 50.42 ? 513 HIS A CB  1 
ATOM   4061 C CG  . HIS A 1 513 ? 29.126  69.564 56.265 1.00 49.89 ? 513 HIS A CG  1 
ATOM   4062 N ND1 . HIS A 1 513 ? 30.243  70.217 56.739 1.00 49.68 ? 513 HIS A ND1 1 
ATOM   4063 C CD2 . HIS A 1 513 ? 28.068  70.345 56.595 1.00 49.13 ? 513 HIS A CD2 1 
ATOM   4064 C CE1 . HIS A 1 513 ? 29.876  71.342 57.330 1.00 48.96 ? 513 HIS A CE1 1 
ATOM   4065 N NE2 . HIS A 1 513 ? 28.562  71.443 57.256 1.00 48.08 ? 513 HIS A NE2 1 
ATOM   4066 N N   . GLN A 1 514 ? 29.990  65.854 54.115 1.00 48.83 ? 514 GLN A N   1 
ATOM   4067 C CA  . GLN A 1 514 ? 29.813  64.509 53.581 1.00 49.53 ? 514 GLN A CA  1 
ATOM   4068 C C   . GLN A 1 514 ? 29.304  63.462 54.567 1.00 48.19 ? 514 GLN A C   1 
ATOM   4069 O O   . GLN A 1 514 ? 29.500  63.575 55.771 1.00 47.99 ? 514 GLN A O   1 
ATOM   4070 C CB  . GLN A 1 514 ? 31.126  64.011 53.012 1.00 52.99 ? 514 GLN A CB  1 
ATOM   4071 C CG  . GLN A 1 514 ? 31.315  64.276 51.542 1.00 59.23 ? 514 GLN A CG  1 
ATOM   4072 C CD  . GLN A 1 514 ? 32.686  63.830 51.063 1.00 62.64 ? 514 GLN A CD  1 
ATOM   4073 O OE1 . GLN A 1 514 ? 32.892  63.556 49.872 1.00 64.88 ? 514 GLN A OE1 1 
ATOM   4074 N NE2 . GLN A 1 514 ? 33.639  63.763 51.994 1.00 63.71 ? 514 GLN A NE2 1 
ATOM   4075 N N   . ARG A 1 515 ? 28.652  62.437 54.028 1.00 46.97 ? 515 ARG A N   1 
ATOM   4076 C CA  . ARG A 1 515 ? 28.125  61.318 54.800 1.00 45.18 ? 515 ARG A CA  1 
ATOM   4077 C C   . ARG A 1 515 ? 27.446  61.669 56.115 1.00 43.89 ? 515 ARG A C   1 
ATOM   4078 O O   . ARG A 1 515 ? 27.923  61.252 57.171 1.00 44.47 ? 515 ARG A O   1 
ATOM   4079 C CB  . ARG A 1 515 ? 29.256  60.332 55.073 1.00 46.43 ? 515 ARG A CB  1 
ATOM   4080 C CG  . ARG A 1 515 ? 29.997  59.929 53.814 1.00 50.44 ? 515 ARG A CG  1 
ATOM   4081 C CD  . ARG A 1 515 ? 31.198  59.026 54.080 1.00 54.14 ? 515 ARG A CD  1 
ATOM   4082 N NE  . ARG A 1 515 ? 31.757  58.516 52.827 1.00 59.30 ? 515 ARG A NE  1 
ATOM   4083 C CZ  . ARG A 1 515 ? 32.406  59.261 51.928 1.00 62.69 ? 515 ARG A CZ  1 
ATOM   4084 N NH1 . ARG A 1 515 ? 32.594  60.561 52.146 1.00 63.83 ? 515 ARG A NH1 1 
ATOM   4085 N NH2 . ARG A 1 515 ? 32.851  58.718 50.794 1.00 63.60 ? 515 ARG A NH2 1 
ATOM   4086 N N   . LEU A 1 516 ? 26.332  62.405 56.048 1.00 41.59 ? 516 LEU A N   1 
ATOM   4087 C CA  . LEU A 1 516 ? 25.557  62.818 57.236 1.00 39.32 ? 516 LEU A CA  1 
ATOM   4088 C C   . LEU A 1 516 ? 25.234  61.677 58.229 1.00 39.16 ? 516 LEU A C   1 
ATOM   4089 O O   . LEU A 1 516 ? 24.532  60.735 57.875 1.00 39.43 ? 516 LEU A O   1 
ATOM   4090 C CB  . LEU A 1 516 ? 24.243  63.479 56.780 1.00 36.41 ? 516 LEU A CB  1 
ATOM   4091 C CG  . LEU A 1 516 ? 23.196  63.972 57.792 1.00 33.66 ? 516 LEU A CG  1 
ATOM   4092 C CD1 . LEU A 1 516 ? 23.704  65.188 58.518 1.00 32.04 ? 516 LEU A CD1 1 
ATOM   4093 C CD2 . LEU A 1 516 ? 21.910  64.319 57.076 1.00 31.89 ? 516 LEU A CD2 1 
ATOM   4094 N N   . ARG A 1 517 ? 25.742  61.775 59.463 1.00 38.96 ? 517 ARG A N   1 
ATOM   4095 C CA  . ARG A 1 517 ? 25.513  60.774 60.527 1.00 39.10 ? 517 ARG A CA  1 
ATOM   4096 C C   . ARG A 1 517 ? 25.680  59.350 60.032 1.00 37.94 ? 517 ARG A C   1 
ATOM   4097 O O   . ARG A 1 517 ? 24.830  58.500 60.286 1.00 37.27 ? 517 ARG A O   1 
ATOM   4098 C CB  . ARG A 1 517 ? 24.097  60.902 61.098 1.00 40.95 ? 517 ARG A CB  1 
ATOM   4099 C CG  . ARG A 1 517 ? 23.656  62.318 61.381 1.00 44.72 ? 517 ARG A CG  1 
ATOM   4100 C CD  . ARG A 1 517 ? 24.105  62.804 62.730 1.00 46.50 ? 517 ARG A CD  1 
ATOM   4101 N NE  . ARG A 1 517 ? 23.183  62.366 63.757 1.00 50.49 ? 517 ARG A NE  1 
ATOM   4102 C CZ  . ARG A 1 517 ? 23.576  61.916 64.940 1.00 54.73 ? 517 ARG A CZ  1 
ATOM   4103 N NH1 . ARG A 1 517 ? 24.872  61.845 65.218 1.00 56.21 ? 517 ARG A NH1 1 
ATOM   4104 N NH2 . ARG A 1 517 ? 22.684  61.529 65.844 1.00 56.93 ? 517 ARG A NH2 1 
ATOM   4105 N N   . VAL A 1 518 ? 26.777  59.080 59.341 1.00 37.65 ? 518 VAL A N   1 
ATOM   4106 C CA  . VAL A 1 518 ? 26.996  57.753 58.782 1.00 37.44 ? 518 VAL A CA  1 
ATOM   4107 C C   . VAL A 1 518 ? 27.271  56.627 59.790 1.00 38.28 ? 518 VAL A C   1 
ATOM   4108 O O   . VAL A 1 518 ? 26.726  55.528 59.665 1.00 37.76 ? 518 VAL A O   1 
ATOM   4109 C CB  . VAL A 1 518 ? 28.116  57.805 57.728 1.00 34.90 ? 518 VAL A CB  1 
ATOM   4110 C CG1 . VAL A 1 518 ? 29.382  58.345 58.342 1.00 33.22 ? 518 VAL A CG1 1 
ATOM   4111 C CG2 . VAL A 1 518 ? 28.329  56.440 57.146 1.00 33.02 ? 518 VAL A CG2 1 
ATOM   4112 N N   . GLN A 1 519 ? 28.100  56.898 60.788 1.00 39.50 ? 519 GLN A N   1 
ATOM   4113 C CA  . GLN A 1 519 ? 28.428  55.891 61.795 1.00 41.28 ? 519 GLN A CA  1 
ATOM   4114 C C   . GLN A 1 519 ? 27.179  55.524 62.564 1.00 38.29 ? 519 GLN A C   1 
ATOM   4115 O O   . GLN A 1 519 ? 26.892  54.349 62.760 1.00 38.01 ? 519 GLN A O   1 
ATOM   4116 C CB  . GLN A 1 519 ? 29.491  56.400 62.785 1.00 47.02 ? 519 GLN A CB  1 
ATOM   4117 C CG  . GLN A 1 519 ? 30.226  57.685 62.359 1.00 56.95 ? 519 GLN A CG  1 
ATOM   4118 C CD  . GLN A 1 519 ? 29.267  58.865 62.044 1.00 62.61 ? 519 GLN A CD  1 
ATOM   4119 O OE1 . GLN A 1 519 ? 28.218  59.030 62.694 1.00 64.65 ? 519 GLN A OE1 1 
ATOM   4120 N NE2 . GLN A 1 519 ? 29.635  59.688 61.051 1.00 65.10 ? 519 GLN A NE2 1 
ATOM   4121 N N   . MET A 1 520 ? 26.435  56.535 62.998 1.00 35.77 ? 520 MET A N   1 
ATOM   4122 C CA  . MET A 1 520 ? 25.216  56.300 63.757 1.00 33.56 ? 520 MET A CA  1 
ATOM   4123 C C   . MET A 1 520 ? 24.148  55.623 62.919 1.00 32.02 ? 520 MET A C   1 
ATOM   4124 O O   . MET A 1 520 ? 23.395  54.788 63.414 1.00 32.11 ? 520 MET A O   1 
ATOM   4125 C CB  . MET A 1 520 ? 24.693  57.612 64.334 1.00 33.74 ? 520 MET A CB  1 
ATOM   4126 C CG  . MET A 1 520 ? 25.630  58.201 65.370 1.00 36.77 ? 520 MET A CG  1 
ATOM   4127 S SD  . MET A 1 520 ? 25.665  57.255 66.947 1.00 42.60 ? 520 MET A SD  1 
ATOM   4128 C CE  . MET A 1 520 ? 26.707  55.783 66.585 1.00 41.46 ? 520 MET A CE  1 
ATOM   4129 N N   . CYS A 1 521 ? 24.092  55.949 61.636 1.00 29.84 ? 521 CYS A N   1 
ATOM   4130 C CA  . CYS A 1 521 ? 23.084  55.342 60.810 1.00 26.55 ? 521 CYS A CA  1 
ATOM   4131 C C   . CYS A 1 521 ? 23.413  53.945 60.360 1.00 26.89 ? 521 CYS A C   1 
ATOM   4132 O O   . CYS A 1 521 ? 22.501  53.198 60.037 1.00 27.63 ? 521 CYS A O   1 
ATOM   4133 C CB  . CYS A 1 521 ? 22.766  56.225 59.622 1.00 24.81 ? 521 CYS A CB  1 
ATOM   4134 S SG  . CYS A 1 521 ? 21.725  57.642 60.086 1.00 24.41 ? 521 CYS A SG  1 
ATOM   4135 N N   . VAL A 1 522 ? 24.685  53.555 60.324 1.00 26.39 ? 522 VAL A N   1 
ATOM   4136 C CA  . VAL A 1 522 ? 24.946  52.178 59.907 1.00 26.22 ? 522 VAL A CA  1 
ATOM   4137 C C   . VAL A 1 522 ? 24.400  51.302 61.038 1.00 26.85 ? 522 VAL A C   1 
ATOM   4138 O O   . VAL A 1 522 ? 23.889  50.199 60.795 1.00 28.32 ? 522 VAL A O   1 
ATOM   4139 C CB  . VAL A 1 522 ? 26.456  51.845 59.707 1.00 24.29 ? 522 VAL A CB  1 
ATOM   4140 C CG1 . VAL A 1 522 ? 27.105  52.834 58.803 1.00 23.16 ? 522 VAL A CG1 1 
ATOM   4141 C CG2 . VAL A 1 522 ? 27.153  51.823 61.021 1.00 26.68 ? 522 VAL A CG2 1 
ATOM   4142 N N   . PHE A 1 523 ? 24.494  51.811 62.271 1.00 25.64 ? 523 PHE A N   1 
ATOM   4143 C CA  . PHE A 1 523 ? 24.020  51.088 63.448 1.00 24.09 ? 523 PHE A CA  1 
ATOM   4144 C C   . PHE A 1 523 ? 22.522  50.856 63.336 1.00 25.51 ? 523 PHE A C   1 
ATOM   4145 O O   . PHE A 1 523 ? 22.034  49.728 63.502 1.00 25.58 ? 523 PHE A O   1 
ATOM   4146 C CB  . PHE A 1 523 ? 24.318  51.877 64.723 1.00 21.14 ? 523 PHE A CB  1 
ATOM   4147 C CG  . PHE A 1 523 ? 23.666  51.310 65.947 1.00 20.36 ? 523 PHE A CG  1 
ATOM   4148 C CD1 . PHE A 1 523 ? 24.149  50.154 66.538 1.00 20.41 ? 523 PHE A CD1 1 
ATOM   4149 C CD2 . PHE A 1 523 ? 22.521  51.894 66.474 1.00 20.86 ? 523 PHE A CD2 1 
ATOM   4150 C CE1 . PHE A 1 523 ? 23.496  49.582 67.636 1.00 20.42 ? 523 PHE A CE1 1 
ATOM   4151 C CE2 . PHE A 1 523 ? 21.862  51.329 67.570 1.00 20.96 ? 523 PHE A CE2 1 
ATOM   4152 C CZ  . PHE A 1 523 ? 22.351  50.172 68.148 1.00 20.53 ? 523 PHE A CZ  1 
ATOM   4153 N N   . TRP A 1 524 ? 21.788  51.926 63.047 1.00 26.70 ? 524 TRP A N   1 
ATOM   4154 C CA  . TRP A 1 524 ? 20.340  51.830 62.912 1.00 28.29 ? 524 TRP A CA  1 
ATOM   4155 C C   . TRP A 1 524 ? 19.903  51.063 61.654 1.00 29.15 ? 524 TRP A C   1 
ATOM   4156 O O   . TRP A 1 524 ? 19.093  50.128 61.716 1.00 28.79 ? 524 TRP A O   1 
ATOM   4157 C CB  . TRP A 1 524 ? 19.718  53.231 62.900 1.00 27.77 ? 524 TRP A CB  1 
ATOM   4158 C CG  . TRP A 1 524 ? 19.806  53.921 64.199 1.00 28.14 ? 524 TRP A CG  1 
ATOM   4159 C CD1 . TRP A 1 524 ? 20.605  54.965 64.507 1.00 29.64 ? 524 TRP A CD1 1 
ATOM   4160 C CD2 . TRP A 1 524 ? 19.084  53.599 65.392 1.00 28.75 ? 524 TRP A CD2 1 
ATOM   4161 N NE1 . TRP A 1 524 ? 20.436  55.325 65.824 1.00 29.74 ? 524 TRP A NE1 1 
ATOM   4162 C CE2 . TRP A 1 524 ? 19.503  54.498 66.389 1.00 28.90 ? 524 TRP A CE2 1 
ATOM   4163 C CE3 . TRP A 1 524 ? 18.122  52.639 65.716 1.00 29.81 ? 524 TRP A CE3 1 
ATOM   4164 C CZ2 . TRP A 1 524 ? 18.994  54.469 67.687 1.00 28.77 ? 524 TRP A CZ2 1 
ATOM   4165 C CZ3 . TRP A 1 524 ? 17.614  52.614 67.013 1.00 29.66 ? 524 TRP A CZ3 1 
ATOM   4166 C CH2 . TRP A 1 524 ? 18.052  53.523 67.977 1.00 28.11 ? 524 TRP A CH2 1 
ATOM   4167 N N   . ASN A 1 525 ? 20.460  51.461 60.518 1.00 29.84 ? 525 ASN A N   1 
ATOM   4168 C CA  . ASN A 1 525 ? 20.116  50.853 59.253 1.00 30.56 ? 525 ASN A CA  1 
ATOM   4169 C C   . ASN A 1 525 ? 20.658  49.475 59.001 1.00 31.14 ? 525 ASN A C   1 
ATOM   4170 O O   . ASN A 1 525 ? 20.143  48.779 58.148 1.00 33.02 ? 525 ASN A O   1 
ATOM   4171 C CB  . ASN A 1 525 ? 20.538  51.766 58.111 1.00 31.47 ? 525 ASN A CB  1 
ATOM   4172 C CG  . ASN A 1 525 ? 19.761  53.069 58.101 1.00 32.06 ? 525 ASN A CG  1 
ATOM   4173 O OD1 . ASN A 1 525 ? 18.674  53.157 58.666 1.00 32.22 ? 525 ASN A OD1 1 
ATOM   4174 N ND2 . ASN A 1 525 ? 20.304  54.080 57.446 1.00 32.82 ? 525 ASN A ND2 1 
ATOM   4175 N N   . GLN A 1 526 ? 21.688  49.057 59.714 1.00 31.22 ? 526 GLN A N   1 
ATOM   4176 C CA  . GLN A 1 526 ? 22.197  47.731 59.451 1.00 32.37 ? 526 GLN A CA  1 
ATOM   4177 C C   . GLN A 1 526 ? 22.434  46.861 60.660 1.00 32.15 ? 526 GLN A C   1 
ATOM   4178 O O   . GLN A 1 526 ? 21.822  45.798 60.795 1.00 33.28 ? 526 GLN A O   1 
ATOM   4179 C CB  . GLN A 1 526 ? 23.473  47.823 58.664 1.00 34.41 ? 526 GLN A CB  1 
ATOM   4180 C CG  . GLN A 1 526 ? 23.384  48.797 57.549 1.00 41.99 ? 526 GLN A CG  1 
ATOM   4181 C CD  . GLN A 1 526 ? 24.645  48.785 56.730 1.00 47.31 ? 526 GLN A CD  1 
ATOM   4182 O OE1 . GLN A 1 526 ? 25.010  49.788 56.097 1.00 50.83 ? 526 GLN A OE1 1 
ATOM   4183 N NE2 . GLN A 1 526 ? 25.331  47.637 56.729 1.00 49.19 ? 526 GLN A NE2 1 
ATOM   4184 N N   . PHE A 1 527 ? 23.317  47.291 61.550 1.00 30.49 ? 527 PHE A N   1 
ATOM   4185 C CA  . PHE A 1 527 ? 23.595  46.468 62.710 1.00 28.54 ? 527 PHE A CA  1 
ATOM   4186 C C   . PHE A 1 527 ? 22.392  46.114 63.601 1.00 27.87 ? 527 PHE A C   1 
ATOM   4187 O O   . PHE A 1 527 ? 22.048  44.942 63.729 1.00 27.19 ? 527 PHE A O   1 
ATOM   4188 C CB  . PHE A 1 527 ? 24.690  47.092 63.570 1.00 26.87 ? 527 PHE A CB  1 
ATOM   4189 C CG  . PHE A 1 527 ? 25.085  46.227 64.712 1.00 24.68 ? 527 PHE A CG  1 
ATOM   4190 C CD1 . PHE A 1 527 ? 25.856  45.098 64.495 1.00 24.24 ? 527 PHE A CD1 1 
ATOM   4191 C CD2 . PHE A 1 527 ? 24.588  46.468 65.982 1.00 24.77 ? 527 PHE A CD2 1 
ATOM   4192 C CE1 . PHE A 1 527 ? 26.124  44.210 65.518 1.00 25.25 ? 527 PHE A CE1 1 
ATOM   4193 C CE2 . PHE A 1 527 ? 24.842  45.592 67.016 1.00 25.73 ? 527 PHE A CE2 1 
ATOM   4194 C CZ  . PHE A 1 527 ? 25.614  44.453 66.785 1.00 26.63 ? 527 PHE A CZ  1 
ATOM   4195 N N   . LEU A 1 528 ? 21.753  47.112 64.205 1.00 27.43 ? 528 LEU A N   1 
ATOM   4196 C CA  . LEU A 1 528 ? 20.632  46.855 65.103 1.00 28.54 ? 528 LEU A CA  1 
ATOM   4197 C C   . LEU A 1 528 ? 19.637  45.855 64.511 1.00 29.95 ? 528 LEU A C   1 
ATOM   4198 O O   . LEU A 1 528 ? 19.300  44.837 65.128 1.00 28.86 ? 528 LEU A O   1 
ATOM   4199 C CB  . LEU A 1 528 ? 19.936  48.179 65.459 1.00 28.08 ? 528 LEU A CB  1 
ATOM   4200 C CG  . LEU A 1 528 ? 19.171  48.304 66.792 1.00 27.70 ? 528 LEU A CG  1 
ATOM   4201 C CD1 . LEU A 1 528 ? 17.692  48.092 66.595 1.00 26.68 ? 528 LEU A CD1 1 
ATOM   4202 C CD2 . LEU A 1 528 ? 19.724  47.307 67.793 1.00 27.20 ? 528 LEU A CD2 1 
ATOM   4203 N N   . PRO A 1 529 ? 19.158  46.128 63.292 1.00 31.54 ? 529 PRO A N   1 
ATOM   4204 C CA  . PRO A 1 529 ? 18.201  45.251 62.610 1.00 31.99 ? 529 PRO A CA  1 
ATOM   4205 C C   . PRO A 1 529 ? 18.664  43.795 62.548 1.00 32.58 ? 529 PRO A C   1 
ATOM   4206 O O   . PRO A 1 529 ? 17.896  42.882 62.830 1.00 33.24 ? 529 PRO A O   1 
ATOM   4207 C CB  . PRO A 1 529 ? 18.100  45.877 61.227 1.00 31.85 ? 529 PRO A CB  1 
ATOM   4208 C CG  . PRO A 1 529 ? 18.291  47.339 61.511 1.00 32.13 ? 529 PRO A CG  1 
ATOM   4209 C CD  . PRO A 1 529 ? 19.431  47.338 62.492 1.00 31.86 ? 529 PRO A CD  1 
ATOM   4210 N N   . LYS A 1 530 ? 19.919  43.585 62.169 1.00 32.69 ? 530 LYS A N   1 
ATOM   4211 C CA  . LYS A 1 530 ? 20.470  42.242 62.068 1.00 34.01 ? 530 LYS A CA  1 
ATOM   4212 C C   . LYS A 1 530 ? 20.585  41.562 63.434 1.00 33.85 ? 530 LYS A C   1 
ATOM   4213 O O   . LYS A 1 530 ? 20.513  40.337 63.546 1.00 34.03 ? 530 LYS A O   1 
ATOM   4214 C CB  . LYS A 1 530 ? 21.836  42.326 61.404 1.00 36.76 ? 530 LYS A CB  1 
ATOM   4215 C CG  . LYS A 1 530 ? 22.553  41.006 61.161 1.00 41.27 ? 530 LYS A CG  1 
ATOM   4216 C CD  . LYS A 1 530 ? 23.747  41.266 60.209 1.00 46.75 ? 530 LYS A CD  1 
ATOM   4217 C CE  . LYS A 1 530 ? 24.714  40.067 60.060 1.00 49.22 ? 530 LYS A CE  1 
ATOM   4218 N NZ  . LYS A 1 530 ? 25.922  40.364 59.198 1.00 48.80 ? 530 LYS A NZ  1 
ATOM   4219 N N   . LEU A 1 531 ? 20.752  42.366 64.475 1.00 33.32 ? 531 LEU A N   1 
ATOM   4220 C CA  . LEU A 1 531 ? 20.892  41.848 65.822 1.00 32.15 ? 531 LEU A CA  1 
ATOM   4221 C C   . LEU A 1 531 ? 19.549  41.450 66.385 1.00 33.40 ? 531 LEU A C   1 
ATOM   4222 O O   . LEU A 1 531 ? 19.434  40.394 66.983 1.00 33.35 ? 531 LEU A O   1 
ATOM   4223 C CB  . LEU A 1 531 ? 21.578  42.898 66.705 1.00 31.18 ? 531 LEU A CB  1 
ATOM   4224 C CG  . LEU A 1 531 ? 21.330  43.003 68.215 1.00 30.29 ? 531 LEU A CG  1 
ATOM   4225 C CD1 . LEU A 1 531 ? 21.461  41.669 68.863 1.00 30.78 ? 531 LEU A CD1 1 
ATOM   4226 C CD2 . LEU A 1 531 ? 22.323  43.963 68.826 1.00 29.82 ? 531 LEU A CD2 1 
ATOM   4227 N N   . LEU A 1 532 ? 18.533  42.288 66.201 1.00 35.73 ? 532 LEU A N   1 
ATOM   4228 C CA  . LEU A 1 532 ? 17.191  41.968 66.707 1.00 38.77 ? 532 LEU A CA  1 
ATOM   4229 C C   . LEU A 1 532 ? 16.610  40.795 65.917 1.00 42.05 ? 532 LEU A C   1 
ATOM   4230 O O   . LEU A 1 532 ? 15.710  40.094 66.397 1.00 41.70 ? 532 LEU A O   1 
ATOM   4231 C CB  . LEU A 1 532 ? 16.235  43.156 66.552 1.00 35.96 ? 532 LEU A CB  1 
ATOM   4232 C CG  . LEU A 1 532 ? 16.334  44.412 67.403 1.00 33.78 ? 532 LEU A CG  1 
ATOM   4233 C CD1 . LEU A 1 532 ? 15.534  45.515 66.736 1.00 33.20 ? 532 LEU A CD1 1 
ATOM   4234 C CD2 . LEU A 1 532 ? 15.822  44.137 68.791 1.00 31.82 ? 532 LEU A CD2 1 
ATOM   4235 N N   . ASN A 1 533 ? 17.128  40.607 64.699 1.00 45.99 ? 533 ASN A N   1 
ATOM   4236 C CA  . ASN A 1 533 ? 16.692  39.550 63.785 1.00 49.16 ? 533 ASN A CA  1 
ATOM   4237 C C   . ASN A 1 533 ? 17.195  38.198 64.278 1.00 49.39 ? 533 ASN A C   1 
ATOM   4238 O O   . ASN A 1 533 ? 16.442  37.231 64.320 1.00 48.58 ? 533 ASN A O   1 
ATOM   4239 C CB  . ASN A 1 533 ? 17.216  39.846 62.373 1.00 54.13 ? 533 ASN A CB  1 
ATOM   4240 C CG  . ASN A 1 533 ? 16.393  39.161 61.273 1.00 59.68 ? 533 ASN A CG  1 
ATOM   4241 O OD1 . ASN A 1 533 ? 16.387  37.929 61.152 1.00 62.92 ? 533 ASN A OD1 1 
ATOM   4242 N ND2 . ASN A 1 533 ? 15.693  39.965 60.466 1.00 61.68 ? 533 ASN A ND2 1 
ATOM   4243 N N   . ALA A 1 534 ? 18.473  38.135 64.645 1.00 50.57 ? 534 ALA A N   1 
ATOM   4244 C CA  . ALA A 1 534 ? 19.060  36.911 65.185 1.00 52.23 ? 534 ALA A CA  1 
ATOM   4245 C C   . ALA A 1 534 ? 18.542  36.778 66.631 1.00 54.25 ? 534 ALA A C   1 
ATOM   4246 O O   . ALA A 1 534 ? 18.521  35.686 67.219 1.00 54.24 ? 534 ALA A O   1 
ATOM   4247 C CB  . ALA A 1 534 ? 20.571  37.027 65.171 1.00 50.56 ? 534 ALA A CB  1 
ATOM   4248 N N   . THR A 1 535 ? 18.112  37.931 67.157 1.00 56.46 ? 535 THR A N   1 
ATOM   4249 C CA  . THR A 1 535 ? 17.561  38.156 68.502 1.00 56.60 ? 535 THR A CA  1 
ATOM   4250 C C   . THR A 1 535 ? 18.629  38.176 69.572 1.00 54.54 ? 535 THR A C   1 
ATOM   4251 O O   . THR A 1 535 ? 18.719  39.255 70.179 1.00 52.70 ? 535 THR A O   1 
ATOM   4252 C CB  . THR A 1 535 ? 16.456  37.117 68.911 1.00 59.06 ? 535 THR A CB  1 
ATOM   4253 O OG1 . THR A 1 535 ? 15.343  37.188 67.999 1.00 59.51 ? 535 THR A OG1 1 
ATOM   4254 C CG2 . THR A 1 535 ? 15.942  37.430 70.340 1.00 60.24 ? 535 THR A CG2 1 
HETATM 4255 C C1  . EBW B 2 .   ? 3.646   63.721 68.710 1.00 49.27 ? 601 EBW A C1  1 
HETATM 4256 C C2  . EBW B 2 .   ? 4.551   63.564 69.895 1.00 51.39 ? 601 EBW A C2  1 
HETATM 4257 C C5  . EBW B 2 .   ? 3.819   64.966 67.867 1.00 44.65 ? 601 EBW A C5  1 
HETATM 4258 C C6  . EBW B 2 .   ? 4.030   64.292 71.119 1.00 53.65 ? 601 EBW A C6  1 
HETATM 4259 C C7  . EBW B 2 .   ? 2.819   63.644 71.785 1.00 53.52 ? 601 EBW A C7  1 
HETATM 4260 C C8  . EBW B 2 .   ? 3.015   62.560 72.641 1.00 54.38 ? 601 EBW A C8  1 
HETATM 4261 C C9  . EBW B 2 .   ? 1.971   62.038 73.398 1.00 54.66 ? 601 EBW A C9  1 
HETATM 4262 C C10 . EBW B 2 .   ? 0.683   62.589 73.337 1.00 53.55 ? 601 EBW A C10 1 
HETATM 4263 C C11 . EBW B 2 .   ? 0.471   63.675 72.450 1.00 53.34 ? 601 EBW A C11 1 
HETATM 4264 N N1  . EBW B 2 .   ? 4.266   69.633 63.338 1.00 32.40 ? 601 EBW A N1  1 
HETATM 4265 N N2  . EBW B 2 .   ? -0.437  62.055 74.231 1.00 53.26 ? 601 EBW A N2  1 
HETATM 4266 C C12 . EBW B 2 .   ? 1.531   64.199 71.688 1.00 53.22 ? 601 EBW A C12 1 
HETATM 4267 C C13 . EBW B 2 .   ? 3.338   64.780 66.446 1.00 38.58 ? 601 EBW A C13 1 
HETATM 4268 C C14 . EBW B 2 .   ? 3.546   66.027 65.632 1.00 36.08 ? 601 EBW A C14 1 
HETATM 4269 C C15 . EBW B 2 .   ? 2.741   67.154 65.818 1.00 34.65 ? 601 EBW A C15 1 
HETATM 4270 C C16 . EBW B 2 .   ? 2.964   68.312 65.079 1.00 34.14 ? 601 EBW A C16 1 
HETATM 4271 C C17 . EBW B 2 .   ? 4.001   68.371 64.132 1.00 33.48 ? 601 EBW A C17 1 
HETATM 4272 C C18 . EBW B 2 .   ? 4.794   67.235 63.959 1.00 35.33 ? 601 EBW A C18 1 
HETATM 4273 C C19 . EBW B 2 .   ? 4.566   66.083 64.698 1.00 36.19 ? 601 EBW A C19 1 
HETATM 4274 C C20 . EBW B 2 .   ? 5.251   69.382 62.241 1.00 32.67 ? 601 EBW A C20 1 
HETATM 4275 C C21 . EBW B 2 .   ? 2.998   70.110 62.715 1.00 32.85 ? 601 EBW A C21 1 
HETATM 4276 C C22 . EBW B 2 .   ? 4.793   70.696 64.254 1.00 31.32 ? 601 EBW A C22 1 
HETATM 4277 C C23 . EBW B 2 .   ? 6.071   70.348 64.957 1.00 29.00 ? 601 EBW A C23 1 
HETATM 4278 C C24 . EBW B 2 .   ? -0.749  63.028 75.336 1.00 52.94 ? 601 EBW A C24 1 
HETATM 4279 C C25 . EBW B 2 .   ? -0.056  60.738 74.839 1.00 52.62 ? 601 EBW A C25 1 
HETATM 4280 C C26 . EBW B 2 .   ? -1.662  61.864 73.426 1.00 54.13 ? 601 EBW A C26 1 
HETATM 4281 C C27 . EBW B 2 .   ? 0.408   63.302 76.261 1.00 52.67 ? 601 EBW A C27 1 
HETATM 4282 C C28 . EBW B 2 .   ? 0.715   64.536 76.672 1.00 51.77 ? 601 EBW A C28 1 
HETATM 4283 C C29 . EBW B 2 .   ? 6.136   70.333 66.282 1.00 27.98 ? 601 EBW A C29 1 
HETATM 4284 O O1  . EBW B 2 .   ? 2.896   62.811 68.370 1.00 52.30 ? 601 EBW A O1  1 
HETATM 4285 S S   . SO4 C 3 .   ? 22.041  52.028 53.884 1.00 91.88 ? 602 SO4 A S   1 
HETATM 4286 O O1  . SO4 C 3 .   ? 23.154  52.308 52.952 1.00 91.60 ? 602 SO4 A O1  1 
HETATM 4287 O O2  . SO4 C 3 .   ? 21.651  50.604 53.771 1.00 91.04 ? 602 SO4 A O2  1 
HETATM 4288 O O3  . SO4 C 3 .   ? 22.469  52.311 55.271 1.00 91.30 ? 602 SO4 A O3  1 
HETATM 4289 O O4  . SO4 C 3 .   ? 20.899  52.896 53.535 1.00 91.11 ? 602 SO4 A O4  1 
HETATM 4290 C C1  . NAG D 4 .   ? -19.172 85.159 50.679 1.00 78.19 ? 603 NAG A C1  1 
HETATM 4291 C C2  . NAG D 4 .   ? -18.967 86.683 50.616 1.00 80.77 ? 603 NAG A C2  1 
HETATM 4292 C C3  . NAG D 4 .   ? -19.071 87.326 52.016 1.00 81.48 ? 603 NAG A C3  1 
HETATM 4293 C C4  . NAG D 4 .   ? -18.281 86.562 53.097 1.00 81.39 ? 603 NAG A C4  1 
HETATM 4294 C C5  . NAG D 4 .   ? -18.339 85.013 52.969 1.00 80.82 ? 603 NAG A C5  1 
HETATM 4295 C C6  . NAG D 4 .   ? -19.561 84.345 53.593 1.00 80.16 ? 603 NAG A C6  1 
HETATM 4296 C C7  . NAG D 4 .   ? -17.541 88.083 49.277 1.00 84.54 ? 603 NAG A C7  1 
HETATM 4297 C C8  . NAG D 4 .   ? -16.456 89.079 49.678 1.00 84.38 ? 603 NAG A C8  1 
HETATM 4298 N N2  . NAG D 4 .   ? -17.678 86.995 50.027 1.00 82.85 ? 603 NAG A N2  1 
HETATM 4299 O O3  . NAG D 4 .   ? -20.428 87.458 52.416 1.00 81.74 ? 603 NAG A O3  1 
HETATM 4300 O O4  . NAG D 4 .   ? -16.929 86.995 53.102 1.00 81.99 ? 603 NAG A O4  1 
HETATM 4301 O O5  . NAG D 4 .   ? -18.216 84.562 51.578 1.00 79.94 ? 603 NAG A O5  1 
HETATM 4302 O O6  . NAG D 4 .   ? -19.214 83.656 54.790 1.00 78.46 ? 603 NAG A O6  1 
HETATM 4303 O O7  . NAG D 4 .   ? -18.257 88.306 48.296 1.00 85.57 ? 603 NAG A O7  1 
HETATM 4304 C C1  . NAG E 4 .   ? 18.591  63.200 34.601 1.00 70.42 ? 604 NAG A C1  1 
HETATM 4305 C C2  . NAG E 4 .   ? 20.012  62.647 34.399 1.00 73.73 ? 604 NAG A C2  1 
HETATM 4306 C C3  . NAG E 4 .   ? 20.572  63.151 33.044 1.00 75.54 ? 604 NAG A C3  1 
HETATM 4307 C C4  . NAG E 4 .   ? 19.598  62.854 31.888 1.00 76.02 ? 604 NAG A C4  1 
HETATM 4308 C C5  . NAG E 4 .   ? 18.201  63.398 32.233 1.00 75.28 ? 604 NAG A C5  1 
HETATM 4309 C C6  . NAG E 4 .   ? 17.129  63.089 31.183 1.00 74.46 ? 604 NAG A C6  1 
HETATM 4310 C C7  . NAG E 4 .   ? 20.943  62.383 36.629 1.00 75.42 ? 604 NAG A C7  1 
HETATM 4311 C C8  . NAG E 4 .   ? 20.948  63.191 37.914 1.00 74.24 ? 604 NAG A C8  1 
HETATM 4312 N N2  . NAG E 4 .   ? 20.880  63.074 35.489 1.00 75.38 ? 604 NAG A N2  1 
HETATM 4313 O O3  . NAG E 4 .   ? 21.830  62.544 32.767 1.00 76.84 ? 604 NAG A O3  1 
HETATM 4314 O O4  . NAG E 4 .   ? 20.075  63.461 30.690 1.00 77.40 ? 604 NAG A O4  1 
HETATM 4315 O O5  . NAG E 4 .   ? 17.755  62.833 33.489 1.00 74.24 ? 604 NAG A O5  1 
HETATM 4316 O O6  . NAG E 4 .   ? 16.656  61.749 31.283 1.00 72.42 ? 604 NAG A O6  1 
HETATM 4317 O O7  . NAG E 4 .   ? 20.998  61.149 36.678 1.00 75.93 ? 604 NAG A O7  1 
HETATM 4318 C C1  . NAG F 4 .   ? 8.125   90.581 69.234 1.00 84.56 ? 605 NAG A C1  1 
HETATM 4319 C C2  . NAG F 4 .   ? 6.805   91.338 69.628 1.00 86.83 ? 605 NAG A C2  1 
HETATM 4320 C C3  . NAG F 4 .   ? 5.697   90.369 70.101 1.00 88.01 ? 605 NAG A C3  1 
HETATM 4321 C C4  . NAG F 4 .   ? 5.555   89.176 69.158 1.00 89.04 ? 605 NAG A C4  1 
HETATM 4322 C C5  . NAG F 4 .   ? 6.922   88.498 69.054 1.00 89.52 ? 605 NAG A C5  1 
HETATM 4323 C C6  . NAG F 4 .   ? 6.946   87.186 68.267 1.00 90.39 ? 605 NAG A C6  1 
HETATM 4324 C C7  . NAG F 4 .   ? 6.687   92.086 71.949 1.00 88.98 ? 605 NAG A C7  1 
HETATM 4325 C C8  . NAG F 4 .   ? 5.346   92.639 72.425 1.00 88.66 ? 605 NAG A C8  1 
HETATM 4326 N N2  . NAG F 4 .   ? 7.062   92.315 70.684 1.00 88.15 ? 605 NAG A N2  1 
HETATM 4327 O O3  . NAG F 4 .   ? 4.459   91.054 70.186 1.00 88.22 ? 605 NAG A O3  1 
HETATM 4328 O O4  . NAG F 4 .   ? 4.588   88.270 69.672 1.00 90.20 ? 605 NAG A O4  1 
HETATM 4329 O O5  . NAG F 4 .   ? 7.857   89.410 68.432 1.00 88.01 ? 605 NAG A O5  1 
HETATM 4330 O O6  . NAG F 4 .   ? 5.918   87.138 67.286 1.00 90.88 ? 605 NAG A O6  1 
HETATM 4331 O O7  . NAG F 4 .   ? 7.385   91.455 72.740 1.00 89.70 ? 605 NAG A O7  1 
HETATM 4332 O O   . HOH G 5 .   ? -5.076  70.426 64.320 1.00 44.63 ? 701 HOH A O   1 
HETATM 4333 O O   . HOH G 5 .   ? -7.713  48.553 53.631 1.00 31.26 ? 702 HOH A O   1 
HETATM 4334 O O   . HOH G 5 .   ? -9.012  59.910 65.263 1.00 21.89 ? 703 HOH A O   1 
HETATM 4335 O O   . HOH G 5 .   ? -6.400  46.706 51.662 1.00 27.81 ? 704 HOH A O   1 
HETATM 4336 O O   . HOH G 5 .   ? 21.510  63.522 28.761 1.00 49.36 ? 705 HOH A O   1 
HETATM 4337 O O   . HOH G 5 .   ? 14.724  75.794 70.933 1.00 37.43 ? 706 HOH A O   1 
HETATM 4338 O O   . HOH G 5 .   ? 20.826  72.406 68.910 1.00 31.19 ? 707 HOH A O   1 
HETATM 4339 O O   . HOH G 5 .   ? -2.554  58.156 63.761 1.00 24.53 ? 708 HOH A O   1 
HETATM 4340 O O   . HOH G 5 .   ? 10.295  69.477 60.098 1.00 5.78  ? 709 HOH A O   1 
HETATM 4341 O O   . HOH G 5 .   ? -6.632  63.059 65.915 1.00 20.79 ? 710 HOH A O   1 
HETATM 4342 O O   . HOH G 5 .   ? 4.318   82.013 52.320 1.00 36.25 ? 711 HOH A O   1 
HETATM 4343 O O   . HOH G 5 .   ? -13.953 63.633 57.692 1.00 26.41 ? 712 HOH A O   1 
HETATM 4344 O O   . HOH G 5 .   ? -10.161 71.381 55.533 1.00 28.67 ? 713 HOH A O   1 
HETATM 4345 O O   . HOH G 5 .   ? -2.974  77.238 65.304 1.00 20.84 ? 714 HOH A O   1 
HETATM 4346 O O   . HOH G 5 .   ? 20.802  58.738 37.406 1.00 32.29 ? 715 HOH A O   1 
HETATM 4347 O O   . HOH G 5 .   ? 20.094  86.232 63.217 1.00 20.97 ? 716 HOH A O   1 
HETATM 4348 O O   . HOH G 5 .   ? -13.881 59.012 56.817 1.00 16.32 ? 717 HOH A O   1 
HETATM 4349 O O   . HOH G 5 .   ? 24.659  58.921 56.079 1.00 49.96 ? 718 HOH A O   1 
HETATM 4350 O O   . HOH G 5 .   ? -1.876  71.127 53.379 1.00 14.79 ? 719 HOH A O   1 
HETATM 4351 O O   . HOH G 5 .   ? -9.391  63.523 60.203 1.00 8.56  ? 720 HOH A O   1 
HETATM 4352 O O   . HOH G 5 .   ? 11.194  56.157 68.712 1.00 8.15  ? 721 HOH A O   1 
HETATM 4353 O O   . HOH G 5 .   ? -5.129  60.012 38.312 1.00 45.78 ? 722 HOH A O   1 
HETATM 4354 O O   . HOH G 5 .   ? 3.283   55.231 64.050 1.00 17.59 ? 723 HOH A O   1 
HETATM 4355 O O   . HOH G 5 .   ? -20.110 59.621 60.174 1.00 36.47 ? 724 HOH A O   1 
HETATM 4356 O O   . HOH G 5 .   ? -1.439  73.460 73.933 1.00 18.55 ? 725 HOH A O   1 
HETATM 4357 O O   . HOH G 5 .   ? -24.793 43.665 64.562 1.00 37.47 ? 726 HOH A O   1 
HETATM 4358 O O   . HOH G 5 .   ? -6.704  50.420 61.616 1.00 27.34 ? 727 HOH A O   1 
HETATM 4359 O O   . HOH G 5 .   ? -0.663  78.720 63.133 1.00 25.78 ? 728 HOH A O   1 
HETATM 4360 O O   . HOH G 5 .   ? 7.107   53.157 56.985 1.00 9.19  ? 729 HOH A O   1 
HETATM 4361 O O   . HOH G 5 .   ? 7.985   94.113 49.102 1.00 36.38 ? 730 HOH A O   1 
HETATM 4362 O O   . HOH G 5 .   ? -2.022  58.228 67.037 1.00 7.47  ? 731 HOH A O   1 
HETATM 4363 O O   . HOH G 5 .   ? 3.284   69.883 58.426 1.00 8.08  ? 732 HOH A O   1 
HETATM 4364 O O   . HOH G 5 .   ? 10.131  80.863 65.823 1.00 26.73 ? 733 HOH A O   1 
HETATM 4365 O O   . HOH G 5 .   ? -4.285  57.795 65.467 1.00 21.70 ? 734 HOH A O   1 
HETATM 4366 O O   . HOH G 5 .   ? 19.713  70.306 72.261 1.00 38.23 ? 735 HOH A O   1 
HETATM 4367 O O   . HOH G 5 .   ? -0.771  64.428 59.392 1.00 28.96 ? 736 HOH A O   1 
HETATM 4368 O O   . HOH G 5 .   ? 0.300   70.349 60.588 1.00 22.21 ? 737 HOH A O   1 
HETATM 4369 O O   . HOH G 5 .   ? -19.784 86.138 55.791 1.00 37.81 ? 738 HOH A O   1 
HETATM 4370 O O   . HOH G 5 .   ? 20.978  82.943 54.646 1.00 42.89 ? 739 HOH A O   1 
HETATM 4371 O O   . HOH G 5 .   ? 13.458  69.681 57.702 1.00 34.54 ? 740 HOH A O   1 
HETATM 4372 O O   . HOH G 5 .   ? 17.028  59.310 90.623 1.00 37.26 ? 741 HOH A O   1 
HETATM 4373 O O   . HOH G 5 .   ? -15.118 61.036 58.161 1.00 10.59 ? 742 HOH A O   1 
HETATM 4374 O O   . HOH G 5 .   ? -12.310 64.367 60.136 1.00 14.35 ? 743 HOH A O   1 
HETATM 4375 O O   . HOH G 5 .   ? -0.030  68.917 65.066 1.00 27.88 ? 744 HOH A O   1 
HETATM 4376 O O   . HOH G 5 .   ? 12.956  67.305 34.225 1.00 40.54 ? 745 HOH A O   1 
HETATM 4377 O O   . HOH G 5 .   ? 8.176   76.550 61.766 1.00 10.48 ? 746 HOH A O   1 
HETATM 4378 O O   . HOH G 5 .   ? 2.283   42.068 61.714 1.00 11.72 ? 747 HOH A O   1 
HETATM 4379 O O   . HOH G 5 .   ? 22.906  79.674 62.650 1.00 18.79 ? 748 HOH A O   1 
HETATM 4380 O O   . HOH G 5 .   ? 16.951  37.855 58.271 1.00 21.52 ? 749 HOH A O   1 
HETATM 4381 O O   . HOH G 5 .   ? 0.939   90.580 57.011 1.00 38.55 ? 750 HOH A O   1 
HETATM 4382 O O   . HOH G 5 .   ? 6.779   80.081 65.622 1.00 43.42 ? 751 HOH A O   1 
HETATM 4383 O O   . HOH G 5 .   ? 0.482   67.392 69.943 1.00 39.21 ? 752 HOH A O   1 
HETATM 4384 O O   . HOH G 5 .   ? -18.666 67.418 61.739 1.00 27.59 ? 753 HOH A O   1 
HETATM 4385 O O   . HOH G 5 .   ? 8.265   49.844 66.286 1.00 21.62 ? 754 HOH A O   1 
HETATM 4386 O O   . HOH G 5 .   ? 2.049   91.299 54.941 1.00 24.53 ? 755 HOH A O   1 
HETATM 4387 O O   . HOH G 5 .   ? 4.263   94.982 43.201 1.00 31.95 ? 756 HOH A O   1 
HETATM 4388 O O   . HOH G 5 .   ? 28.162  62.711 61.118 1.00 45.51 ? 757 HOH A O   1 
HETATM 4389 O O   . HOH G 5 .   ? 3.023   52.521 65.256 1.00 14.85 ? 758 HOH A O   1 
HETATM 4390 O O   . HOH G 5 .   ? -9.046  62.136 64.043 1.00 34.96 ? 759 HOH A O   1 
HETATM 4391 O O   . HOH G 5 .   ? 0.079   84.318 58.398 1.00 33.65 ? 760 HOH A O   1 
HETATM 4392 O O   . HOH G 5 .   ? 17.460  41.153 58.155 1.00 11.61 ? 761 HOH A O   1 
HETATM 4393 O O   . HOH G 5 .   ? 13.541  77.965 64.001 1.00 21.18 ? 762 HOH A O   1 
HETATM 4394 O O   . HOH G 5 .   ? -1.921  52.265 43.157 1.00 34.29 ? 763 HOH A O   1 
HETATM 4395 O O   . HOH G 5 .   ? 10.151  65.977 84.549 1.00 47.67 ? 764 HOH A O   1 
HETATM 4396 O O   . HOH G 5 .   ? 0.639   70.984 68.761 1.00 24.37 ? 765 HOH A O   1 
HETATM 4397 O O   . HOH G 5 .   ? 16.258  80.856 74.869 1.00 41.35 ? 766 HOH A O   1 
HETATM 4398 O O   . HOH G 5 .   ? 1.939   84.131 73.551 1.00 45.72 ? 767 HOH A O   1 
HETATM 4399 O O   . HOH G 5 .   ? -2.271  69.967 67.387 1.00 4.89  ? 768 HOH A O   1 
HETATM 4400 O O   . HOH G 5 .   ? -4.151  84.755 53.382 1.00 34.08 ? 769 HOH A O   1 
HETATM 4401 O O   . HOH G 5 .   ? -10.366 53.395 44.004 1.00 33.87 ? 770 HOH A O   1 
HETATM 4402 O O   . HOH G 5 .   ? 3.286   45.789 61.745 1.00 25.19 ? 771 HOH A O   1 
HETATM 4403 O O   . HOH G 5 .   ? 24.288  65.980 86.498 1.00 30.74 ? 772 HOH A O   1 
HETATM 4404 O O   . HOH G 5 .   ? -17.761 90.052 52.074 1.00 53.93 ? 773 HOH A O   1 
HETATM 4405 O O   . HOH G 5 .   ? 21.279  48.394 51.294 1.00 38.52 ? 774 HOH A O   1 
HETATM 4406 O O   . HOH G 5 .   ? -18.949 89.282 54.797 1.00 37.80 ? 775 HOH A O   1 
HETATM 4407 O O   . HOH G 5 .   ? 14.143  40.208 57.498 1.00 53.79 ? 776 HOH A O   1 
HETATM 4408 O O   . HOH G 5 .   ? -4.004  51.652 60.985 1.00 26.83 ? 777 HOH A O   1 
HETATM 4409 O O   . HOH G 5 .   ? -7.345  69.949 58.079 1.00 37.18 ? 778 HOH A O   1 
HETATM 4410 O O   . HOH G 5 .   ? 9.694   77.367 77.855 1.00 48.07 ? 779 HOH A O   1 
HETATM 4411 O O   . HOH G 5 .   ? -5.172  47.906 75.158 1.00 34.97 ? 780 HOH A O   1 
HETATM 4412 O O   . HOH G 5 .   ? 23.018  59.720 34.330 1.00 22.30 ? 781 HOH A O   1 
HETATM 4413 O O   . HOH G 5 .   ? 8.843   51.488 37.413 1.00 25.99 ? 782 HOH A O   1 
HETATM 4414 O O   . HOH G 5 .   ? 15.693  73.537 86.076 1.00 48.19 ? 783 HOH A O   1 
HETATM 4415 O O   . HOH G 5 .   ? 10.990  49.288 37.763 1.00 42.69 ? 784 HOH A O   1 
HETATM 4416 O O   . HOH G 5 .   ? 23.294  58.544 36.630 1.00 31.33 ? 785 HOH A O   1 
HETATM 4417 O O   . HOH G 5 .   ? 24.556  62.269 34.903 1.00 41.84 ? 786 HOH A O   1 
HETATM 4418 O O   . HOH G 5 .   ? 32.196  67.367 57.111 1.00 25.38 ? 787 HOH A O   1 
HETATM 4419 O O   . HOH G 5 .   ? 15.359  48.911 64.099 1.00 34.42 ? 788 HOH A O   1 
HETATM 4420 O O   . HOH G 5 .   ? -10.606 47.473 76.134 1.00 31.03 ? 789 HOH A O   1 
HETATM 4421 O O   . HOH G 5 .   ? 20.692  59.171 32.621 1.00 12.00 ? 790 HOH A O   1 
HETATM 4422 O O   . HOH G 5 .   ? 9.386   56.114 36.368 1.00 37.52 ? 791 HOH A O   1 
HETATM 4423 O O   . HOH G 5 .   ? 10.431  79.536 82.919 1.00 40.50 ? 792 HOH A O   1 
HETATM 4424 O O   . HOH G 5 .   ? -0.652  91.957 55.560 1.00 41.38 ? 793 HOH A O   1 
HETATM 4425 O O   . HOH G 5 .   ? -7.096  51.766 44.934 1.00 51.35 ? 794 HOH A O   1 
HETATM 4426 O O   . HOH G 5 .   ? 16.151  79.068 77.666 1.00 11.66 ? 795 HOH A O   1 
HETATM 4427 O O   . HOH G 5 .   ? 6.005   80.289 80.290 1.00 43.41 ? 796 HOH A O   1 
HETATM 4428 O O   . HOH G 5 .   ? 19.529  55.886 36.345 1.00 41.50 ? 797 HOH A O   1 
HETATM 4429 O O   . HOH G 5 .   ? -1.294  96.288 44.362 1.00 42.72 ? 798 HOH A O   1 
HETATM 4430 O O   . HOH G 5 .   ? 7.342   83.775 66.558 1.00 28.36 ? 799 HOH A O   1 
HETATM 4431 O O   . HOH G 5 .   ? 33.800  69.111 56.370 1.00 38.95 ? 800 HOH A O   1 
HETATM 4432 O O   . HOH G 5 .   ? 30.917  66.811 41.552 1.00 43.29 ? 801 HOH A O   1 
HETATM 4433 O O   . HOH G 5 .   ? 25.058  68.712 85.049 1.00 34.54 ? 802 HOH A O   1 
HETATM 4434 O O   . HOH G 5 .   ? 18.376  93.217 63.430 1.00 25.53 ? 803 HOH A O   1 
HETATM 4435 O O   . HOH G 5 .   ? -4.334  52.211 42.234 1.00 47.40 ? 804 HOH A O   1 
HETATM 4436 O O   . HOH G 5 .   ? 17.754  71.246 85.786 1.00 36.47 ? 805 HOH A O   1 
HETATM 4437 O O   . HOH G 5 .   ? 25.150  49.285 51.417 1.00 57.06 ? 806 HOH A O   1 
HETATM 4438 O O   . HOH G 5 .   ? 26.878  68.864 40.593 1.00 24.90 ? 807 HOH A O   1 
HETATM 4439 O O   . HOH G 5 .   ? 9.467   58.294 86.309 1.00 27.17 ? 808 HOH A O   1 
HETATM 4440 O O   . HOH G 5 .   ? -12.983 77.252 30.877 1.00 19.33 ? 809 HOH A O   1 
HETATM 4441 O O   . HOH G 5 .   ? 5.870   45.825 70.692 1.00 51.80 ? 810 HOH A O   1 
HETATM 4442 O O   . HOH G 5 .   ? -22.742 52.174 75.440 1.00 31.65 ? 811 HOH A O   1 
HETATM 4443 O O   . HOH G 5 .   ? -4.751  86.529 55.312 1.00 30.99 ? 812 HOH A O   1 
HETATM 4444 O O   . HOH G 5 .   ? -5.983  39.286 50.088 1.00 55.32 ? 813 HOH A O   1 
HETATM 4445 O O   . HOH G 5 .   ? -1.285  48.796 76.505 1.00 21.44 ? 814 HOH A O   1 
HETATM 4446 O O   . HOH G 5 .   ? 25.443  60.814 36.558 1.00 19.69 ? 815 HOH A O   1 
HETATM 4447 O O   . HOH G 5 .   ? 26.066  69.772 69.685 1.00 63.55 ? 816 HOH A O   1 
HETATM 4448 O O   . HOH G 5 .   ? 7.079   47.139 67.093 1.00 57.55 ? 817 HOH A O   1 
HETATM 4449 O O   . HOH G 5 .   ? 24.193  60.633 39.803 1.00 8.84  ? 818 HOH A O   1 
HETATM 4450 O O   . HOH G 5 .   ? 5.835   95.600 74.235 1.00 32.83 ? 819 HOH A O   1 
HETATM 4451 O O   . HOH G 5 .   ? 0.727   48.189 77.279 1.00 18.82 ? 820 HOH A O   1 
HETATM 4452 O O   . HOH G 5 .   ? -23.635 81.555 47.791 1.00 48.62 ? 821 HOH A O   1 
HETATM 4453 O O   . HOH G 5 .   ? 4.387   82.603 65.681 1.00 45.32 ? 822 HOH A O   1 
HETATM 4454 O O   . HOH G 5 .   ? 21.385  56.341 34.603 1.00 18.53 ? 823 HOH A O   1 
HETATM 4455 O O   . HOH G 5 .   ? 25.955  64.386 36.429 1.00 14.80 ? 824 HOH A O   1 
HETATM 4456 O O   . HOH G 5 .   ? 28.446  65.976 39.507 1.00 37.35 ? 825 HOH A O   1 
HETATM 4457 O O   . HOH G 5 .   ? 19.476  55.127 33.489 1.00 41.09 ? 826 HOH A O   1 
HETATM 4458 O O   . HOH G 5 .   ? 11.928  38.691 54.332 1.00 69.73 ? 827 HOH A O   1 
HETATM 4459 O O   . HOH G 5 .   ? 21.837  52.581 33.322 1.00 24.14 ? 828 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 603 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   3   HIS HIS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
A 1 538 ASP 538 538 ?   ?   ?   A . n 
A 1 539 GLY 539 539 ?   ?   ?   A . n 
A 1 540 GLU 540 540 ?   ?   ?   A . n 
A 1 541 LEU 541 541 ?   ?   ?   A . n 
A 1 542 SER 542 542 ?   ?   ?   A . n 
A 1 543 SER 543 543 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EBW 1   601 550  EBW EBW A . 
C 3 SO4 1   602 593  SO4 SO4 A . 
D 4 NAG 1   603 900  NAG NAG A . 
E 4 NAG 1   604 901  NAG NAG A . 
F 4 NAG 1   605 902  NAG NAG A . 
G 5 HOH 1   701 2018 HOH HOH A . 
G 5 HOH 2   702 2054 HOH HOH A . 
G 5 HOH 3   703 2073 HOH HOH A . 
G 5 HOH 4   704 2050 HOH HOH A . 
G 5 HOH 5   705 2126 HOH HOH A . 
G 5 HOH 6   706 2098 HOH HOH A . 
G 5 HOH 7   707 2085 HOH HOH A . 
G 5 HOH 8   708 2076 HOH HOH A . 
G 5 HOH 9   709 2058 HOH HOH A . 
G 5 HOH 10  710 2034 HOH HOH A . 
G 5 HOH 11  711 2105 HOH HOH A . 
G 5 HOH 12  712 2027 HOH HOH A . 
G 5 HOH 13  713 2014 HOH HOH A . 
G 5 HOH 14  714 2024 HOH HOH A . 
G 5 HOH 15  715 2127 HOH HOH A . 
G 5 HOH 16  716 2106 HOH HOH A . 
G 5 HOH 17  717 2008 HOH HOH A . 
G 5 HOH 18  718 2112 HOH HOH A . 
G 5 HOH 19  719 2046 HOH HOH A . 
G 5 HOH 20  720 2048 HOH HOH A . 
G 5 HOH 21  721 2092 HOH HOH A . 
G 5 HOH 22  722 2055 HOH HOH A . 
G 5 HOH 23  723 2063 HOH HOH A . 
G 5 HOH 24  724 2007 HOH HOH A . 
G 5 HOH 25  725 2022 HOH HOH A . 
G 5 HOH 26  726 2071 HOH HOH A . 
G 5 HOH 27  727 2066 HOH HOH A . 
G 5 HOH 28  728 2023 HOH HOH A . 
G 5 HOH 29  729 2062 HOH HOH A . 
G 5 HOH 30  730 2002 HOH HOH A . 
G 5 HOH 31  731 2075 HOH HOH A . 
G 5 HOH 32  732 2039 HOH HOH A . 
G 5 HOH 33  733 2104 HOH HOH A . 
G 5 HOH 34  734 2072 HOH HOH A . 
G 5 HOH 35  735 2100 HOH HOH A . 
G 5 HOH 36  736 2047 HOH HOH A . 
G 5 HOH 37  737 2040 HOH HOH A . 
G 5 HOH 38  738 2119 HOH HOH A . 
G 5 HOH 39  739 2108 HOH HOH A . 
G 5 HOH 40  740 2079 HOH HOH A . 
G 5 HOH 41  741 2090 HOH HOH A . 
G 5 HOH 42  742 2006 HOH HOH A . 
G 5 HOH 43  743 2016 HOH HOH A . 
G 5 HOH 44  744 2036 HOH HOH A . 
G 5 HOH 45  745 2061 HOH HOH A . 
G 5 HOH 46  746 2103 HOH HOH A . 
G 5 HOH 47  747 2064 HOH HOH A . 
G 5 HOH 48  748 2097 HOH HOH A . 
G 5 HOH 49  749 2116 HOH HOH A . 
G 5 HOH 50  750 2044 HOH HOH A . 
G 5 HOH 51  751 2102 HOH HOH A . 
G 5 HOH 52  752 2035 HOH HOH A . 
G 5 HOH 53  753 2028 HOH HOH A . 
G 5 HOH 54  754 2095 HOH HOH A . 
G 5 HOH 55  755 2001 HOH HOH A . 
G 5 HOH 56  756 2003 HOH HOH A . 
G 5 HOH 57  757 2113 HOH HOH A . 
G 5 HOH 58  758 2067 HOH HOH A . 
G 5 HOH 59  759 2017 HOH HOH A . 
G 5 HOH 60  760 2038 HOH HOH A . 
G 5 HOH 61  761 2115 HOH HOH A . 
G 5 HOH 62  762 2101 HOH HOH A . 
G 5 HOH 63  763 2059 HOH HOH A . 
G 5 HOH 64  764 2086 HOH HOH A . 
G 5 HOH 65  765 2019 HOH HOH A . 
G 5 HOH 66  766 2099 HOH HOH A . 
G 5 HOH 67  767 2020 HOH HOH A . 
G 5 HOH 68  768 2025 HOH HOH A . 
G 5 HOH 69  769 2041 HOH HOH A . 
G 5 HOH 70  770 2009 HOH HOH A . 
G 5 HOH 71  771 2065 HOH HOH A . 
G 5 HOH 72  772 2096 HOH HOH A . 
G 5 HOH 73  773 2120 HOH HOH A . 
G 5 HOH 74  774 2117 HOH HOH A . 
G 5 HOH 75  775 2121 HOH HOH A . 
G 5 HOH 76  776 2114 HOH HOH A . 
G 5 HOH 77  777 2049 HOH HOH A . 
G 5 HOH 78  778 2015 HOH HOH A . 
G 5 HOH 79  779 2088 HOH HOH A . 
G 5 HOH 80  780 2068 HOH HOH A . 
G 5 HOH 81  781 2124 HOH HOH A . 
G 5 HOH 82  782 2060 HOH HOH A . 
G 5 HOH 83  783 2089 HOH HOH A . 
G 5 HOH 84  784 2077 HOH HOH A . 
G 5 HOH 85  785 2125 HOH HOH A . 
G 5 HOH 86  786 2122 HOH HOH A . 
G 5 HOH 87  787 2111 HOH HOH A . 
G 5 HOH 88  788 2094 HOH HOH A . 
G 5 HOH 89  789 2069 HOH HOH A . 
G 5 HOH 90  790 2123 HOH HOH A . 
G 5 HOH 91  791 2078 HOH HOH A . 
G 5 HOH 92  792 2087 HOH HOH A . 
G 5 HOH 93  793 2042 HOH HOH A . 
G 5 HOH 94  794 2010 HOH HOH A . 
G 5 HOH 95  795 2052 HOH HOH A . 
G 5 HOH 96  796 2029 HOH HOH A . 
G 5 HOH 97  797 2080 HOH HOH A . 
G 5 HOH 98  798 2004 HOH HOH A . 
G 5 HOH 99  799 2013 HOH HOH A . 
G 5 HOH 100 800 2056 HOH HOH A . 
G 5 HOH 101 801 2110 HOH HOH A . 
G 5 HOH 102 802 2045 HOH HOH A . 
G 5 HOH 103 803 2107 HOH HOH A . 
G 5 HOH 104 804 2021 HOH HOH A . 
G 5 HOH 105 805 2037 HOH HOH A . 
G 5 HOH 106 806 2118 HOH HOH A . 
G 5 HOH 107 807 2109 HOH HOH A . 
G 5 HOH 108 808 2091 HOH HOH A . 
G 5 HOH 109 809 2026 HOH HOH A . 
G 5 HOH 110 810 2093 HOH HOH A . 
G 5 HOH 111 811 2070 HOH HOH A . 
G 5 HOH 112 812 2011 HOH HOH A . 
G 5 HOH 113 813 2051 HOH HOH A . 
G 5 HOH 114 814 2074 HOH HOH A . 
G 5 HOH 115 815 2082 HOH HOH A . 
G 5 HOH 116 816 2084 HOH HOH A . 
G 5 HOH 117 817 2043 HOH HOH A . 
G 5 HOH 118 818 2031 HOH HOH A . 
G 5 HOH 119 819 2128 HOH HOH A . 
G 5 HOH 120 820 2005 HOH HOH A . 
G 5 HOH 121 821 2012 HOH HOH A . 
G 5 HOH 122 822 2053 HOH HOH A . 
G 5 HOH 123 823 2081 HOH HOH A . 
G 5 HOH 124 824 2083 HOH HOH A . 
G 5 HOH 125 825 2033 HOH HOH A . 
G 5 HOH 126 826 2030 HOH HOH A . 
G 5 HOH 127 827 2057 HOH HOH A . 
G 5 HOH 128 828 2032 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 457 A ASN 457 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3560  ? 
1 MORE         -29.6 ? 
1 'SSA (A^2)'  41230 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 138.2000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-03 
2 'Structure model' 1 1 2011-09-21 
3 'Structure model' 1 2 2017-07-05 
4 'Structure model' 1 3 2017-07-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' Advisory                    
2  2 'Structure model' 'Atomic model'              
3  2 'Structure model' 'Data collection'           
4  2 'Structure model' 'Derived calculations'      
5  2 'Structure model' 'Non-polymer description'   
6  2 'Structure model' Other                       
7  2 'Structure model' 'Refinement description'    
8  2 'Structure model' 'Structure summary'         
9  2 'Structure model' 'Version format compliance' 
10 3 'Structure model' 'Data collection'           
11 4 'Structure model' Advisory                    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' diffrn_source       
2 4 'Structure model' database_PDB_caveat 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_diffrn_source.type'       
2 4 'Structure model' '_database_PDB_caveat.text' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0   ? 1 
XDS    'data reduction' .     ? 2 
XDS    'data scaling'   .     ? 3 
X-PLOR phasing          3.851 ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     809 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     814 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   3_564 
_pdbx_validate_symm_contact.dist              2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 55.06   -129.98 
2  1 SER A 25  ? ? -98.23  -152.48 
3  1 PRO A 39  ? ? -76.81  48.41   
4  1 PHE A 45  ? ? 87.88   -18.73  
5  1 ALA A 60  ? ? -84.82  46.80   
6  1 CYS A 94  ? ? -144.20 21.35   
7  1 SER A 108 ? ? -172.83 109.91  
8  1 SER A 124 ? ? 166.55  128.78  
9  1 GLU A 140 ? ? 54.27   79.11   
10 1 LEU A 158 ? ? -101.13 78.93   
11 1 HIS A 159 ? ? -23.48  -54.19  
12 1 ALA A 164 ? ? -153.49 70.02   
13 1 ASN A 167 ? ? 52.44   3.49    
14 1 SER A 200 ? ? 65.87   -121.99 
15 1 ARG A 216 ? ? -21.70  -54.02  
16 1 PHE A 288 ? ? 79.97   51.74   
17 1 THR A 317 ? ? -133.28 -155.96 
18 1 VAL A 360 ? ? -116.71 71.54   
19 1 ASP A 380 ? ? -167.00 73.51   
20 1 VAL A 400 ? ? -128.11 -59.73  
21 1 THR A 412 ? ? -57.11  -4.99   
22 1 PHE A 414 ? ? -143.44 -25.08  
23 1 ASN A 424 ? ? -151.59 36.33   
24 1 GLU A 455 ? ? -42.57  -13.81  
25 1 THR A 479 ? ? -141.30 -43.71  
26 1 PRO A 485 ? ? -28.12  -35.42  
27 1 SER A 487 ? ? -14.45  136.63  
28 1 GLN A 488 ? ? -80.40  38.93   
29 1 LYS A 498 ? ? -81.12  -82.33  
30 1 GLN A 500 ? ? 49.41   74.18   
31 1 GLN A 526 ? ? -132.13 -61.19  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     603 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 826 ? 6.08 . 
2 1 O ? A HOH 827 ? 7.31 . 
3 1 O ? A HOH 828 ? 7.48 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
2  1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
3  1 Y 1 A GLN 162 ? CD  ? A GLN 162 CD  
4  1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
5  1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
6  1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
7  1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
8  1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
9  1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
10 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A ALA 536 ? A ALA 536 
4  1 Y 1 A CYS 537 ? A CYS 537 
5  1 Y 1 A ASP 538 ? A ASP 538 
6  1 Y 1 A GLY 539 ? A GLY 539 
7  1 Y 1 A GLU 540 ? A GLU 540 
8  1 Y 1 A LEU 541 ? A LEU 541 
9  1 Y 1 A SER 542 ? A SER 542 
10 1 Y 1 A SER 543 ? A SER 543 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '4-(5-{4-[DIMETHYL(PROP-2-ENYL)AMMONIO]PHENYL}-3-OXOPENTYL)-N,N-DIMETHYL-N-PROP-2-ENYLBENZENAMINIUM' EBW 
3 'SULFATE ION'                                                                                        SO4 
4 N-ACETYL-D-GLUCOSAMINE                                                                               NAG 
5 water                                                                                                HOH 
#