data_1E9H
# 
_entry.id   1E9H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1E9H         
PDBE  EBI-5449     
WWPDB D_1290005449 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1AQ1 unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR STAUROSPORINE'  
PDB 1B38 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2'                                             
PDB 1B39 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2 PHOSPHORYLATED ON THR 160'                   
PDB 1CKP unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR PURVALANOL B'   
PDB 1DM2 unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR HYMENIALDISINE' 
PDB 1E1V unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR NU2058'         
PDB 1E1X unspecified 'HUMAN CYCLIN DEPENDENT KINASE 2 COMPLEXED WITH THE INHIBITOR NU6027'         
PDB 1HCK unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2'                                             
PDB 1HCL unspecified 'HUMAN CYCLIN-DEPENDENT KINASE 2'                                             
PDB 1JSU unspecified 'P27(KIP1)/CYCLIN A/CDK2 COMPLEX'                                             
PDB 1FIN unspecified 'CYCLIN A - CYCLIN-DEPENDENT KINASE 2 COMPLEX'                                
PDB 1JST unspecified 'PHOSPHORYLATED CYCLIN-DEPENDENT KINASE-2 BOUND TO CYCLIN A'                  
PDB 1QMZ unspecified 'PHOSPHORYLATED CDK2-CYCLYIN A-SUBSTRATE PEPTIDE COMPLEX'                     
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1E9H 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Davies, T.G.'   1 
'Tunnah, P.'     2 
'Noble, M.E.M.'  3 
'Endicott, J.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Inhibitor Binding to Active and Inactive Cdk2: The Crystal Structure of Cdk2-Cyclin A/Indirubin-5-Sulphonate' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            9 
_citation.page_first                389 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11377199 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(01)00598-6' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Davies, T.G.'   1 
primary 'Tunnah, P.'     2 
primary 'Meijer, L.'     3 
primary 'Marko, D.'      4 
primary 'Eisenbrand, G.' 5 
primary 'Endicott, J.A.' 6 
primary 'Noble, M.E.'    7 
# 
_cell.entry_id           1E9H 
_cell.length_a           73.801 
_cell.length_b           133.804 
_cell.length_c           150.436 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1E9H 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CELL DIVISION PROTEIN KINASE 2'                                 33873.195 2   2.7.1.37 ? ? 
'PHOSPHORYLATED ON THR 160 CHAINS A AND C ARE ASYMETRIC UNIT COPIES'                            
2 polymer     man 'CYCLIN A3'                                                      29964.713 2   ?        ? ? 
'TRUNCATED FRAGMENT OF CYCLIN A. IN COMPLEX WITH CDK2 CHAINS B AND D ARE ASYMETRIC UNIT COPIES' 
3 non-polymer syn 
;2',3-DIOXO-1,1',2',3-TETRAHYDRO-2,3'-BIINDOLE-5'-SULFONIC ACID
;
342.326   2   ?        ? ? ?                                                                                               
4 water       nat water                                                            18.015    369 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CYCLIN-DEPENDENT KINASE 2, CDK2' 
2 A3                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPD
YKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL
;
;SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLV
FEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY
THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS
FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL
;
A,C ? 
2 'polypeptide(L)' no no  
;VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNLLNL
;
;VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQ
LVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAM
FLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK
NSKYHGVSLLNPPETLNLLNL
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   ASN n 
1 5   PHE n 
1 6   GLN n 
1 7   LYS n 
1 8   VAL n 
1 9   GLU n 
1 10  LYS n 
1 11  ILE n 
1 12  GLY n 
1 13  GLU n 
1 14  GLY n 
1 15  THR n 
1 16  TYR n 
1 17  GLY n 
1 18  VAL n 
1 19  VAL n 
1 20  TYR n 
1 21  LYS n 
1 22  ALA n 
1 23  ARG n 
1 24  ASN n 
1 25  LYS n 
1 26  LEU n 
1 27  THR n 
1 28  GLY n 
1 29  GLU n 
1 30  VAL n 
1 31  VAL n 
1 32  ALA n 
1 33  LEU n 
1 34  LYS n 
1 35  LYS n 
1 36  ILE n 
1 37  ARG n 
1 38  LEU n 
1 39  ASP n 
1 40  THR n 
1 41  GLU n 
1 42  THR n 
1 43  GLU n 
1 44  GLY n 
1 45  VAL n 
1 46  PRO n 
1 47  SER n 
1 48  THR n 
1 49  ALA n 
1 50  ILE n 
1 51  ARG n 
1 52  GLU n 
1 53  ILE n 
1 54  SER n 
1 55  LEU n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  LEU n 
1 60  ASN n 
1 61  HIS n 
1 62  PRO n 
1 63  ASN n 
1 64  ILE n 
1 65  VAL n 
1 66  LYS n 
1 67  LEU n 
1 68  LEU n 
1 69  ASP n 
1 70  VAL n 
1 71  ILE n 
1 72  HIS n 
1 73  THR n 
1 74  GLU n 
1 75  ASN n 
1 76  LYS n 
1 77  LEU n 
1 78  TYR n 
1 79  LEU n 
1 80  VAL n 
1 81  PHE n 
1 82  GLU n 
1 83  PHE n 
1 84  LEU n 
1 85  HIS n 
1 86  GLN n 
1 87  ASP n 
1 88  LEU n 
1 89  LYS n 
1 90  LYS n 
1 91  PHE n 
1 92  MET n 
1 93  ASP n 
1 94  ALA n 
1 95  SER n 
1 96  ALA n 
1 97  LEU n 
1 98  THR n 
1 99  GLY n 
1 100 ILE n 
1 101 PRO n 
1 102 LEU n 
1 103 PRO n 
1 104 LEU n 
1 105 ILE n 
1 106 LYS n 
1 107 SER n 
1 108 TYR n 
1 109 LEU n 
1 110 PHE n 
1 111 GLN n 
1 112 LEU n 
1 113 LEU n 
1 114 GLN n 
1 115 GLY n 
1 116 LEU n 
1 117 ALA n 
1 118 PHE n 
1 119 CYS n 
1 120 HIS n 
1 121 SER n 
1 122 HIS n 
1 123 ARG n 
1 124 VAL n 
1 125 LEU n 
1 126 HIS n 
1 127 ARG n 
1 128 ASP n 
1 129 LEU n 
1 130 LYS n 
1 131 PRO n 
1 132 GLN n 
1 133 ASN n 
1 134 LEU n 
1 135 LEU n 
1 136 ILE n 
1 137 ASN n 
1 138 THR n 
1 139 GLU n 
1 140 GLY n 
1 141 ALA n 
1 142 ILE n 
1 143 LYS n 
1 144 LEU n 
1 145 ALA n 
1 146 ASP n 
1 147 PHE n 
1 148 GLY n 
1 149 LEU n 
1 150 ALA n 
1 151 ARG n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 VAL n 
1 156 PRO n 
1 157 VAL n 
1 158 ARG n 
1 159 THR n 
1 160 TYR n 
1 161 TPO n 
1 162 HIS n 
1 163 GLU n 
1 164 VAL n 
1 165 VAL n 
1 166 THR n 
1 167 LEU n 
1 168 TRP n 
1 169 TYR n 
1 170 ARG n 
1 171 ALA n 
1 172 PRO n 
1 173 GLU n 
1 174 ILE n 
1 175 LEU n 
1 176 LEU n 
1 177 GLY n 
1 178 CYS n 
1 179 LYS n 
1 180 TYR n 
1 181 TYR n 
1 182 SER n 
1 183 THR n 
1 184 ALA n 
1 185 VAL n 
1 186 ASP n 
1 187 ILE n 
1 188 TRP n 
1 189 SER n 
1 190 LEU n 
1 191 GLY n 
1 192 CYS n 
1 193 ILE n 
1 194 PHE n 
1 195 ALA n 
1 196 GLU n 
1 197 MET n 
1 198 VAL n 
1 199 THR n 
1 200 ARG n 
1 201 ARG n 
1 202 ALA n 
1 203 LEU n 
1 204 PHE n 
1 205 PRO n 
1 206 GLY n 
1 207 ASP n 
1 208 SER n 
1 209 GLU n 
1 210 ILE n 
1 211 ASP n 
1 212 GLN n 
1 213 LEU n 
1 214 PHE n 
1 215 ARG n 
1 216 ILE n 
1 217 PHE n 
1 218 ARG n 
1 219 THR n 
1 220 LEU n 
1 221 GLY n 
1 222 THR n 
1 223 PRO n 
1 224 ASP n 
1 225 GLU n 
1 226 VAL n 
1 227 VAL n 
1 228 TRP n 
1 229 PRO n 
1 230 GLY n 
1 231 VAL n 
1 232 THR n 
1 233 SER n 
1 234 MET n 
1 235 PRO n 
1 236 ASP n 
1 237 TYR n 
1 238 LYS n 
1 239 PRO n 
1 240 SER n 
1 241 PHE n 
1 242 PRO n 
1 243 LYS n 
1 244 TRP n 
1 245 ALA n 
1 246 ARG n 
1 247 GLN n 
1 248 ASP n 
1 249 PHE n 
1 250 SER n 
1 251 LYS n 
1 252 VAL n 
1 253 VAL n 
1 254 PRO n 
1 255 PRO n 
1 256 LEU n 
1 257 ASP n 
1 258 GLU n 
1 259 ASP n 
1 260 GLY n 
1 261 ARG n 
1 262 SER n 
1 263 LEU n 
1 264 LEU n 
1 265 SER n 
1 266 GLN n 
1 267 MET n 
1 268 LEU n 
1 269 HIS n 
1 270 TYR n 
1 271 ASP n 
1 272 PRO n 
1 273 ASN n 
1 274 LYS n 
1 275 ARG n 
1 276 ILE n 
1 277 SER n 
1 278 ALA n 
1 279 LYS n 
1 280 ALA n 
1 281 ALA n 
1 282 LEU n 
1 283 ALA n 
1 284 HIS n 
1 285 PRO n 
1 286 PHE n 
1 287 PHE n 
1 288 GLN n 
1 289 ASP n 
1 290 VAL n 
1 291 THR n 
1 292 LYS n 
1 293 PRO n 
1 294 VAL n 
1 295 PRO n 
1 296 HIS n 
1 297 LEU n 
2 1   VAL n 
2 2   PRO n 
2 3   ASP n 
2 4   TYR n 
2 5   HIS n 
2 6   GLU n 
2 7   ASP n 
2 8   ILE n 
2 9   HIS n 
2 10  THR n 
2 11  TYR n 
2 12  LEU n 
2 13  ARG n 
2 14  GLU n 
2 15  MET n 
2 16  GLU n 
2 17  VAL n 
2 18  LYS n 
2 19  CYS n 
2 20  LYS n 
2 21  PRO n 
2 22  LYS n 
2 23  VAL n 
2 24  GLY n 
2 25  TYR n 
2 26  MET n 
2 27  LYS n 
2 28  LYS n 
2 29  GLN n 
2 30  PRO n 
2 31  ASP n 
2 32  ILE n 
2 33  THR n 
2 34  ASN n 
2 35  SER n 
2 36  MET n 
2 37  ARG n 
2 38  ALA n 
2 39  ILE n 
2 40  LEU n 
2 41  VAL n 
2 42  ASP n 
2 43  TRP n 
2 44  LEU n 
2 45  VAL n 
2 46  GLU n 
2 47  VAL n 
2 48  GLY n 
2 49  GLU n 
2 50  GLU n 
2 51  TYR n 
2 52  LYS n 
2 53  LEU n 
2 54  GLN n 
2 55  ASN n 
2 56  GLU n 
2 57  THR n 
2 58  LEU n 
2 59  HIS n 
2 60  LEU n 
2 61  ALA n 
2 62  VAL n 
2 63  ASN n 
2 64  TYR n 
2 65  ILE n 
2 66  ASP n 
2 67  ARG n 
2 68  PHE n 
2 69  LEU n 
2 70  SER n 
2 71  SER n 
2 72  MET n 
2 73  SER n 
2 74  VAL n 
2 75  LEU n 
2 76  ARG n 
2 77  GLY n 
2 78  LYS n 
2 79  LEU n 
2 80  GLN n 
2 81  LEU n 
2 82  VAL n 
2 83  GLY n 
2 84  THR n 
2 85  ALA n 
2 86  ALA n 
2 87  MET n 
2 88  LEU n 
2 89  LEU n 
2 90  ALA n 
2 91  SER n 
2 92  LYS n 
2 93  PHE n 
2 94  GLU n 
2 95  GLU n 
2 96  ILE n 
2 97  TYR n 
2 98  PRO n 
2 99  PRO n 
2 100 GLU n 
2 101 VAL n 
2 102 ALA n 
2 103 GLU n 
2 104 PHE n 
2 105 VAL n 
2 106 TYR n 
2 107 ILE n 
2 108 THR n 
2 109 ASP n 
2 110 ASP n 
2 111 THR n 
2 112 TYR n 
2 113 THR n 
2 114 LYS n 
2 115 LYS n 
2 116 GLN n 
2 117 VAL n 
2 118 LEU n 
2 119 ARG n 
2 120 MET n 
2 121 GLU n 
2 122 HIS n 
2 123 LEU n 
2 124 VAL n 
2 125 LEU n 
2 126 LYS n 
2 127 VAL n 
2 128 LEU n 
2 129 THR n 
2 130 PHE n 
2 131 ASP n 
2 132 LEU n 
2 133 ALA n 
2 134 ALA n 
2 135 PRO n 
2 136 THR n 
2 137 VAL n 
2 138 ASN n 
2 139 GLN n 
2 140 PHE n 
2 141 LEU n 
2 142 THR n 
2 143 GLN n 
2 144 TYR n 
2 145 PHE n 
2 146 LEU n 
2 147 HIS n 
2 148 GLN n 
2 149 GLN n 
2 150 PRO n 
2 151 ALA n 
2 152 ASN n 
2 153 CYS n 
2 154 LYS n 
2 155 VAL n 
2 156 GLU n 
2 157 SER n 
2 158 LEU n 
2 159 ALA n 
2 160 MET n 
2 161 PHE n 
2 162 LEU n 
2 163 GLY n 
2 164 GLU n 
2 165 LEU n 
2 166 SER n 
2 167 LEU n 
2 168 ILE n 
2 169 ASP n 
2 170 ALA n 
2 171 ASP n 
2 172 PRO n 
2 173 TYR n 
2 174 LEU n 
2 175 LYS n 
2 176 TYR n 
2 177 LEU n 
2 178 PRO n 
2 179 SER n 
2 180 VAL n 
2 181 ILE n 
2 182 ALA n 
2 183 GLY n 
2 184 ALA n 
2 185 ALA n 
2 186 PHE n 
2 187 HIS n 
2 188 LEU n 
2 189 ALA n 
2 190 LEU n 
2 191 TYR n 
2 192 THR n 
2 193 VAL n 
2 194 THR n 
2 195 GLY n 
2 196 GLN n 
2 197 SER n 
2 198 TRP n 
2 199 PRO n 
2 200 GLU n 
2 201 SER n 
2 202 LEU n 
2 203 ILE n 
2 204 ARG n 
2 205 LYS n 
2 206 THR n 
2 207 GLY n 
2 208 TYR n 
2 209 THR n 
2 210 LEU n 
2 211 GLU n 
2 212 SER n 
2 213 LEU n 
2 214 LYS n 
2 215 PRO n 
2 216 CYS n 
2 217 LEU n 
2 218 MET n 
2 219 ASP n 
2 220 LEU n 
2 221 HIS n 
2 222 GLN n 
2 223 THR n 
2 224 TYR n 
2 225 LEU n 
2 226 LYS n 
2 227 ALA n 
2 228 PRO n 
2 229 GLN n 
2 230 HIS n 
2 231 ALA n 
2 232 GLN n 
2 233 GLN n 
2 234 SER n 
2 235 ILE n 
2 236 ARG n 
2 237 GLU n 
2 238 LYS n 
2 239 TYR n 
2 240 LYS n 
2 241 ASN n 
2 242 SER n 
2 243 LYS n 
2 244 TYR n 
2 245 HIS n 
2 246 GLY n 
2 247 VAL n 
2 248 SER n 
2 249 LEU n 
2 250 LEU n 
2 251 ASN n 
2 252 PRO n 
2 253 PRO n 
2 254 GLU n 
2 255 THR n 
2 256 LEU n 
2 257 ASN n 
2 258 LEU n 
2 259 LEU n 
2 260 ASN n 
2 261 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1E9H       1 ? ? 1E9H   ? 
2 UNP CDK2_HUMAN 1 ? ? P24941 ? 
3 UNP CGA2_HUMAN 2 ? ? P20248 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1E9H A 1 ? 1   ? 1E9H   0   ? 0   ? 0   0   
2 2 1E9H A 2 ? 297 ? P24941 1   ? 296 ? 1   296 
3 3 1E9H B 1 ? 258 ? P20248 175 ? 432 ? 175 432 
4 1 1E9H C 1 ? 1   ? 1E9H   0   ? 0   ? 0   0   
5 2 1E9H C 2 ? 297 ? P24941 1   ? 296 ? 1   296 
6 3 1E9H D 1 ? 258 ? P20248 175 ? 432 ? 175 432 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1E9H 
_struct_ref_seq_dif.mon_id                       TPO 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      161 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P20248 
_struct_ref_seq_dif.db_mon_id                    THR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          160 
_struct_ref_seq_dif.details                      'modified residue' 
_struct_ref_seq_dif.pdbx_auth_seq_num            160 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                          ?                      'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                         ?                      'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                       ?                      'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                  ?                      'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                         ?                      'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                        ?                      'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                  ?                      'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                          ?                      'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                        ?                      'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                            ?                      'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                       ?                      'C6 H13 N O2' 
131.173 
INR non-polymer         . 
;2',3-DIOXO-1,1',2',3-TETRAHYDRO-2,3'-BIINDOLE-5'-SULFONIC ACID
;
INDIRUBIN-5-SULPHONATE 'C16 H10 N2 O5 S' 342.326 
LEU 'L-peptide linking' y LEUCINE                                                          ?                      'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                           ?                      'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                       ?                      'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                    ?                      'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                          ?                      'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                           ?                      'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                        ?                      'C4 H9 N O3' 
119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                                                 PHOSPHONOTHREONINE     'C4 H10 N O6 P' 
199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                                                       ?                      'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                         ?                      'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                           ?                      'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          1E9H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_percent_sol   57.71 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2000-04-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1E9H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   47127 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.1 
_reflns.pdbx_Rmerge_I_obs            0.10900 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.1000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   90.1 
_reflns_shell.Rmerge_I_obs           0.39000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.900 
_reflns_shell.pdbx_redundancy        2.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1E9H 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     52335 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             100 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    90 
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'UNPUBLISHED STRUCTURE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8938 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         48 
_refine_hist.number_atoms_solvent             369 
_refine_hist.number_atoms_total               9355 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        100 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.459 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.999932 
_struct_ncs_oper.matrix[1][2]   -0.011239 
_struct_ncs_oper.matrix[1][3]   0.003138 
_struct_ncs_oper.matrix[2][1]   0.010826 
_struct_ncs_oper.matrix[2][2]   -0.793178 
_struct_ncs_oper.matrix[2][3]   0.608894 
_struct_ncs_oper.matrix[3][1]   -0.004354 
_struct_ncs_oper.matrix[3][2]   0.608886 
_struct_ncs_oper.matrix[3][3]   0.793246 
_struct_ncs_oper.vector[1]      174.44279 
_struct_ncs_oper.vector[2]      -1.51400 
_struct_ncs_oper.vector[3]      0.70450 
# 
_struct.entry_id                  1E9H 
_struct.title                     
'Thr 160 phosphorylated CDK2 - Human cyclin A3 complex with the inhibitor indirubin-5-sulphonate bound' 
_struct.pdbx_descriptor           'CELL DIVISION PROTEIN KINASE 2 (E.C.2.7.1.37), CYCLIN A3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1E9H 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            
'CELL CYCLE, COMPLEX (PROTEIN KINASE-CYCLIN), KINASES, INHIBITOR, CYCLIN, COMPLEX, PHOSPHORYLATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 46  ? GLU A 58  ? PRO A 45  GLU A 57  1 ? 13 
HELX_P HELX_P2  2  LEU A 88  ? ALA A 94  ? LEU A 87  ALA A 93  1 ? 7  
HELX_P HELX_P3  3  PRO A 101 ? HIS A 122 ? PRO A 100 HIS A 121 1 ? 22 
HELX_P HELX_P4  4  LYS A 130 ? GLN A 132 ? LYS A 129 GLN A 131 5 ? 3  
HELX_P HELX_P5  5  THR A 166 ? ARG A 170 ? THR A 165 ARG A 169 5 ? 5  
HELX_P HELX_P6  6  ALA A 171 ? LEU A 176 ? ALA A 170 LEU A 175 1 ? 6  
HELX_P HELX_P7  7  THR A 183 ? ARG A 200 ? THR A 182 ARG A 199 1 ? 18 
HELX_P HELX_P8  8  SER A 208 ? GLY A 221 ? SER A 207 GLY A 220 1 ? 14 
HELX_P HELX_P9  9  GLY A 230 ? MET A 234 ? GLY A 229 MET A 233 5 ? 5  
HELX_P HELX_P10 10 ASP A 248 ? VAL A 252 ? ASP A 247 VAL A 251 5 ? 5  
HELX_P HELX_P11 11 ASP A 257 ? LEU A 268 ? ASP A 256 LEU A 267 1 ? 12 
HELX_P HELX_P12 12 SER A 277 ? LEU A 282 ? SER A 276 LEU A 281 1 ? 6  
HELX_P HELX_P13 13 ALA A 283 ? GLN A 288 ? ALA A 282 GLN A 287 5 ? 6  
HELX_P HELX_P14 14 TYR B 4   ? LYS B 20  ? TYR B 178 LYS B 194 1 ? 17 
HELX_P HELX_P15 15 TYR B 25  ? GLN B 29  ? TYR B 199 GLN B 203 5 ? 5  
HELX_P HELX_P16 16 THR B 33  ? TYR B 51  ? THR B 207 TYR B 225 1 ? 19 
HELX_P HELX_P17 17 GLN B 54  ? LEU B 69  ? GLN B 228 LEU B 243 1 ? 16 
HELX_P HELX_P18 18 LYS B 78  ? GLU B 95  ? LYS B 252 GLU B 269 1 ? 18 
HELX_P HELX_P19 19 GLU B 100 ? ILE B 107 ? GLU B 274 ILE B 281 1 ? 8  
HELX_P HELX_P20 20 THR B 113 ? LEU B 128 ? THR B 287 LEU B 302 1 ? 16 
HELX_P HELX_P21 21 THR B 136 ? PHE B 145 ? THR B 310 PHE B 319 1 ? 10 
HELX_P HELX_P22 22 LEU B 146 ? GLN B 148 ? LEU B 320 GLN B 322 5 ? 3  
HELX_P HELX_P23 23 ASN B 152 ? ASP B 169 ? ASN B 326 ASP B 343 1 ? 18 
HELX_P HELX_P24 24 ASP B 169 ? LEU B 174 ? ASP B 343 LEU B 348 1 ? 6  
HELX_P HELX_P25 25 LEU B 177 ? GLY B 195 ? LEU B 351 GLY B 369 1 ? 19 
HELX_P HELX_P26 26 PRO B 199 ? GLY B 207 ? PRO B 373 GLY B 381 1 ? 9  
HELX_P HELX_P27 27 THR B 209 ? ALA B 227 ? THR B 383 ALA B 401 1 ? 19 
HELX_P HELX_P28 28 PRO B 228 ? HIS B 230 ? PRO B 402 HIS B 404 5 ? 3  
HELX_P HELX_P29 29 GLN B 233 ? TYR B 239 ? GLN B 407 TYR B 413 1 ? 7  
HELX_P HELX_P30 30 LYS B 240 ? HIS B 245 ? LYS B 414 HIS B 419 5 ? 6  
HELX_P HELX_P31 31 GLY B 246 ? LEU B 250 ? GLY B 420 LEU B 424 5 ? 5  
HELX_P HELX_P32 32 SER C 1   ? GLU C 3   ? SER C 0   GLU C 2   5 ? 3  
HELX_P HELX_P33 33 PRO C 46  ? LYS C 57  ? PRO C 45  LYS C 56  1 ? 12 
HELX_P HELX_P34 34 LEU C 88  ? ALA C 94  ? LEU C 87  ALA C 93  1 ? 7  
HELX_P HELX_P35 35 PRO C 101 ? HIS C 122 ? PRO C 100 HIS C 121 1 ? 22 
HELX_P HELX_P36 36 LYS C 130 ? GLN C 132 ? LYS C 129 GLN C 131 5 ? 3  
HELX_P HELX_P37 37 THR C 166 ? ARG C 170 ? THR C 165 ARG C 169 5 ? 5  
HELX_P HELX_P38 38 ALA C 171 ? LEU C 176 ? ALA C 170 LEU C 175 1 ? 6  
HELX_P HELX_P39 39 THR C 183 ? ARG C 200 ? THR C 182 ARG C 199 1 ? 18 
HELX_P HELX_P40 40 SER C 208 ? GLY C 221 ? SER C 207 GLY C 220 1 ? 14 
HELX_P HELX_P41 41 GLY C 230 ? MET C 234 ? GLY C 229 MET C 233 5 ? 5  
HELX_P HELX_P42 42 ASP C 248 ? VAL C 253 ? ASP C 247 VAL C 252 1 ? 6  
HELX_P HELX_P43 43 ASP C 257 ? LEU C 268 ? ASP C 256 LEU C 267 1 ? 12 
HELX_P HELX_P44 44 SER C 277 ? LEU C 282 ? SER C 276 LEU C 281 1 ? 6  
HELX_P HELX_P45 45 HIS C 284 ? GLN C 288 ? HIS C 283 GLN C 287 5 ? 5  
HELX_P HELX_P46 46 TYR D 4   ? VAL D 17  ? TYR D 178 VAL D 191 1 ? 14 
HELX_P HELX_P47 47 THR D 33  ? TYR D 51  ? THR D 207 TYR D 225 1 ? 19 
HELX_P HELX_P48 48 GLN D 54  ? SER D 70  ? GLN D 228 SER D 244 1 ? 17 
HELX_P HELX_P49 49 LEU D 75  ? GLU D 95  ? LEU D 249 GLU D 269 1 ? 21 
HELX_P HELX_P50 50 GLU D 100 ? ILE D 107 ? GLU D 274 ILE D 281 1 ? 8  
HELX_P HELX_P51 51 THR D 113 ? LEU D 128 ? THR D 287 LEU D 302 1 ? 16 
HELX_P HELX_P52 52 THR D 136 ? LEU D 146 ? THR D 310 LEU D 320 1 ? 11 
HELX_P HELX_P53 53 ASN D 152 ? SER D 166 ? ASN D 326 SER D 340 1 ? 15 
HELX_P HELX_P54 54 PRO D 172 ? TYR D 176 ? PRO D 346 TYR D 350 5 ? 5  
HELX_P HELX_P55 55 LEU D 177 ? THR D 194 ? LEU D 351 THR D 368 1 ? 18 
HELX_P HELX_P56 56 PRO D 199 ? GLY D 207 ? PRO D 373 GLY D 381 1 ? 9  
HELX_P HELX_P57 57 LEU D 213 ? ALA D 227 ? LEU D 387 ALA D 401 1 ? 15 
HELX_P HELX_P58 58 PRO D 228 ? HIS D 230 ? PRO D 402 HIS D 404 5 ? 3  
HELX_P HELX_P59 59 ILE D 235 ? LYS D 240 ? ILE D 409 LYS D 414 1 ? 6  
HELX_P HELX_P60 60 ASN D 241 ? HIS D 245 ? ASN D 415 HIS D 419 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A TYR 160 C ? ? ? 1_555 A TPO 161 N ? ? A TYR 159 A TPO 160 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale2 covale ? ? A TPO 161 C ? ? ? 1_555 A HIS 162 N ? ? A TPO 160 A HIS 161 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale3 covale ? ? C TYR 160 C ? ? ? 1_555 C TPO 161 N ? ? C TYR 159 C TPO 160 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale4 covale ? ? C TPO 161 C ? ? ? 1_555 C HIS 162 N ? ? C TPO 160 C HIS 161 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 155 A . ? VAL 154 A PRO 156 A ? PRO 155 A 1 -0.10 
2 GLN 149 B . ? GLN 323 B PRO 150 B ? PRO 324 B 1 -0.35 
3 ASP 171 B . ? ASP 345 B PRO 172 B ? PRO 346 B 1 0.60  
4 VAL 155 C . ? VAL 154 C PRO 156 C ? PRO 155 C 1 -0.05 
5 GLN 149 D . ? GLN 323 D PRO 150 D ? PRO 324 D 1 -0.48 
6 ASP 171 D . ? ASP 345 D PRO 172 D ? PRO 346 D 1 0.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 2 ? 
D ? 5 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 5   ? GLY A 12  ? PHE A 4   GLY A 11  
A 2 VAL A 19  ? ASN A 24  ? VAL A 18  ASN A 23  
A 3 VAL A 30  ? ARG A 37  ? VAL A 29  ARG A 36  
A 4 LYS A 76  ? GLU A 82  ? LYS A 75  GLU A 81  
A 5 LEU A 67  ? HIS A 72  ? LEU A 66  HIS A 71  
B 1 GLN A 86  ? ASP A 87  ? GLN A 85  ASP A 86  
B 2 LEU A 134 ? ILE A 136 ? LEU A 133 ILE A 135 
B 3 ILE A 142 ? LEU A 144 ? ILE A 141 LEU A 143 
C 1 VAL A 124 ? LEU A 125 ? VAL A 123 LEU A 124 
C 2 ARG A 151 ? ALA A 152 ? ARG A 150 ALA A 151 
D 1 PHE C 5   ? LYS C 10  ? PHE C 4   LYS C 9   
D 2 VAL C 19  ? ASN C 24  ? VAL C 18  ASN C 23  
D 3 VAL C 30  ? ARG C 37  ? VAL C 29  ARG C 36  
D 4 LYS C 76  ? GLU C 82  ? LYS C 75  GLU C 81  
D 5 LEU C 67  ? HIS C 72  ? LEU C 66  HIS C 71  
E 1 GLN C 86  ? ASP C 87  ? GLN C 85  ASP C 86  
E 2 LEU C 134 ? ILE C 136 ? LEU C 133 ILE C 135 
E 3 ILE C 142 ? LEU C 144 ? ILE C 141 LEU C 143 
F 1 VAL C 124 ? LEU C 125 ? VAL C 123 LEU C 124 
F 2 ARG C 151 ? ALA C 152 ? ARG C 150 ALA C 151 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 11  ? N ILE A 10  O VAL A 19  ? O VAL A 18  
A 2 3 N ALA A 22  ? N ALA A 21  O VAL A 31  ? O VAL A 30  
A 3 4 N ILE A 36  ? N ILE A 35  O LEU A 77  ? O LEU A 76  
A 4 5 O VAL A 80  ? O VAL A 79  N LEU A 68  ? N LEU A 67  
B 1 2 N GLN A 86  ? N GLN A 85  O ILE A 136 ? O ILE A 135 
B 2 3 N LEU A 135 ? N LEU A 134 O LYS A 143 ? O LYS A 142 
C 1 2 N LEU A 125 ? N LEU A 124 O ARG A 151 ? O ARG A 150 
D 1 2 N VAL C 8   ? N VAL C 7   O LYS C 21  ? O LYS C 20  
D 2 3 N ALA C 22  ? N ALA C 21  O VAL C 31  ? O VAL C 30  
D 3 4 N ILE C 36  ? N ILE C 35  O LEU C 77  ? O LEU C 76  
D 4 5 O VAL C 80  ? O VAL C 79  N LEU C 68  ? N LEU C 67  
E 1 2 N GLN C 86  ? N GLN C 85  O ILE C 136 ? O ILE C 135 
E 2 3 N LEU C 135 ? N LEU C 134 O LYS C 143 ? O LYS C 142 
F 1 2 N LEU C 125 ? N LEU C 124 O ARG C 151 ? O ARG C 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE INR A1298' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE INR C1298' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ILE A 11  ? ILE A 10  . ? 1_555 ? 
2  AC1 14 VAL A 19  ? VAL A 18  . ? 1_555 ? 
3  AC1 14 ALA A 32  ? ALA A 31  . ? 1_555 ? 
4  AC1 14 LYS A 34  ? LYS A 33  . ? 1_555 ? 
5  AC1 14 PHE A 81  ? PHE A 80  . ? 1_555 ? 
6  AC1 14 GLU A 82  ? GLU A 81  . ? 1_555 ? 
7  AC1 14 PHE A 83  ? PHE A 82  . ? 1_555 ? 
8  AC1 14 LEU A 84  ? LEU A 83  . ? 1_555 ? 
9  AC1 14 HIS A 85  ? HIS A 84  . ? 1_555 ? 
10 AC1 14 GLN A 86  ? GLN A 85  . ? 1_555 ? 
11 AC1 14 LYS A 90  ? LYS A 89  . ? 1_555 ? 
12 AC1 14 LEU A 135 ? LEU A 134 . ? 1_555 ? 
13 AC1 14 ALA A 145 ? ALA A 144 . ? 1_555 ? 
14 AC1 14 ASP A 146 ? ASP A 145 . ? 1_555 ? 
15 AC2 11 ALA C 32  ? ALA C 31  . ? 1_555 ? 
16 AC2 11 LYS C 34  ? LYS C 33  . ? 1_555 ? 
17 AC2 11 PHE C 81  ? PHE C 80  . ? 1_555 ? 
18 AC2 11 GLU C 82  ? GLU C 81  . ? 1_555 ? 
19 AC2 11 PHE C 83  ? PHE C 82  . ? 1_555 ? 
20 AC2 11 LEU C 84  ? LEU C 83  . ? 1_555 ? 
21 AC2 11 HIS C 85  ? HIS C 84  . ? 1_555 ? 
22 AC2 11 GLN C 86  ? GLN C 85  . ? 1_555 ? 
23 AC2 11 ASP C 87  ? ASP C 86  . ? 1_555 ? 
24 AC2 11 LEU C 135 ? LEU C 134 . ? 1_555 ? 
25 AC2 11 ASP C 146 ? ASP C 145 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1E9H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1E9H 
_atom_sites.fract_transf_matrix[1][1]   0.013550 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007474 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006647 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 2   ? 14.874  59.274  42.156  1.00 73.49  ? 1    MET A N   1 
ATOM   2    C CA  . MET A 1 2   ? 13.431  59.003  41.876  1.00 73.64  ? 1    MET A CA  1 
ATOM   3    C C   . MET A 1 2   ? 13.240  58.805  40.374  1.00 72.89  ? 1    MET A C   1 
ATOM   4    O O   . MET A 1 2   ? 12.320  58.120  39.925  1.00 71.20  ? 1    MET A O   1 
ATOM   5    C CB  . MET A 1 2   ? 12.582  60.178  42.359  1.00 73.83  ? 1    MET A CB  1 
ATOM   6    C CG  . MET A 1 2   ? 11.200  59.777  42.824  1.00 74.17  ? 1    MET A CG  1 
ATOM   7    S SD  . MET A 1 2   ? 11.296  58.527  44.120  1.00 76.69  ? 1    MET A SD  1 
ATOM   8    C CE  . MET A 1 2   ? 10.546  57.139  43.297  1.00 75.90  ? 1    MET A CE  1 
ATOM   9    N N   . GLU A 1 3   ? 14.134  59.420  39.611  1.00 73.17  ? 2    GLU A N   1 
ATOM   10   C CA  . GLU A 1 3   ? 14.121  59.339  38.163  1.00 72.64  ? 2    GLU A CA  1 
ATOM   11   C C   . GLU A 1 3   ? 14.469  57.923  37.721  1.00 70.27  ? 2    GLU A C   1 
ATOM   12   O O   . GLU A 1 3   ? 13.775  57.340  36.895  1.00 70.67  ? 2    GLU A O   1 
ATOM   13   C CB  . GLU A 1 3   ? 15.135  60.342  37.588  1.00 76.02  ? 2    GLU A CB  1 
ATOM   14   C CG  . GLU A 1 3   ? 15.289  60.355  36.056  1.00 81.65  ? 2    GLU A CG  1 
ATOM   15   C CD  . GLU A 1 3   ? 16.446  59.485  35.542  1.00 85.15  ? 2    GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 3   ? 16.175  58.461  34.866  1.00 85.65  ? 2    GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 3   ? 17.625  59.829  35.809  1.00 85.61  ? 2    GLU A OE2 1 
ATOM   18   N N   . ASN A 1 4   ? 15.526  57.360  38.298  1.00 67.51  ? 3    ASN A N   1 
ATOM   19   C CA  . ASN A 1 4   ? 15.981  56.025  37.918  1.00 66.10  ? 3    ASN A CA  1 
ATOM   20   C C   . ASN A 1 4   ? 15.149  54.833  38.389  1.00 64.54  ? 3    ASN A C   1 
ATOM   21   O O   . ASN A 1 4   ? 15.632  53.701  38.384  1.00 64.33  ? 3    ASN A O   1 
ATOM   22   C CB  . ASN A 1 4   ? 17.437  55.836  38.351  1.00 64.45  ? 3    ASN A CB  1 
ATOM   23   C CG  . ASN A 1 4   ? 18.347  56.915  37.798  1.00 64.91  ? 3    ASN A CG  1 
ATOM   24   O OD1 . ASN A 1 4   ? 18.330  57.202  36.597  1.00 64.56  ? 3    ASN A OD1 1 
ATOM   25   N ND2 . ASN A 1 4   ? 19.149  57.521  38.672  1.00 62.18  ? 3    ASN A ND2 1 
ATOM   26   N N   . PHE A 1 5   ? 13.903  55.078  38.780  1.00 63.55  ? 4    PHE A N   1 
ATOM   27   C CA  . PHE A 1 5   ? 13.035  53.995  39.234  1.00 61.90  ? 4    PHE A CA  1 
ATOM   28   C C   . PHE A 1 5   ? 11.913  53.710  38.254  1.00 61.75  ? 4    PHE A C   1 
ATOM   29   O O   . PHE A 1 5   ? 11.375  54.617  37.625  1.00 60.53  ? 4    PHE A O   1 
ATOM   30   C CB  . PHE A 1 5   ? 12.415  54.314  40.598  1.00 61.27  ? 4    PHE A CB  1 
ATOM   31   C CG  . PHE A 1 5   ? 13.365  54.181  41.745  1.00 61.66  ? 4    PHE A CG  1 
ATOM   32   C CD1 . PHE A 1 5   ? 14.050  52.995  41.960  1.00 62.54  ? 4    PHE A CD1 1 
ATOM   33   C CD2 . PHE A 1 5   ? 13.570  55.241  42.620  1.00 62.53  ? 4    PHE A CD2 1 
ATOM   34   C CE1 . PHE A 1 5   ? 14.927  52.865  43.032  1.00 63.36  ? 4    PHE A CE1 1 
ATOM   35   C CE2 . PHE A 1 5   ? 14.444  55.121  43.694  1.00 62.04  ? 4    PHE A CE2 1 
ATOM   36   C CZ  . PHE A 1 5   ? 15.123  53.933  43.900  1.00 62.55  ? 4    PHE A CZ  1 
ATOM   37   N N   . GLN A 1 6   ? 11.565  52.435  38.137  1.00 62.71  ? 5    GLN A N   1 
ATOM   38   C CA  . GLN A 1 6   ? 10.490  52.008  37.261  1.00 63.42  ? 5    GLN A CA  1 
ATOM   39   C C   . GLN A 1 6   ? 9.516   51.232  38.125  1.00 63.93  ? 5    GLN A C   1 
ATOM   40   O O   . GLN A 1 6   ? 9.749   50.066  38.432  1.00 64.35  ? 5    GLN A O   1 
ATOM   41   C CB  . GLN A 1 6   ? 11.022  51.100  36.156  1.00 65.77  ? 5    GLN A CB  1 
ATOM   42   C CG  . GLN A 1 6   ? 9.947   50.623  35.200  1.00 69.47  ? 5    GLN A CG  1 
ATOM   43   C CD  . GLN A 1 6   ? 9.898   51.443  33.923  1.00 73.03  ? 5    GLN A CD  1 
ATOM   44   O OE1 . GLN A 1 6   ? 10.625  51.164  32.962  1.00 74.27  ? 5    GLN A OE1 1 
ATOM   45   N NE2 . GLN A 1 6   ? 9.048   52.474  33.909  1.00 74.54  ? 5    GLN A NE2 1 
ATOM   46   N N   . LYS A 1 7   ? 8.428   51.874  38.532  1.00 65.35  ? 6    LYS A N   1 
ATOM   47   C CA  . LYS A 1 7   ? 7.448   51.194  39.368  1.00 66.59  ? 6    LYS A CA  1 
ATOM   48   C C   . LYS A 1 7   ? 6.890   49.978  38.650  1.00 65.60  ? 6    LYS A C   1 
ATOM   49   O O   . LYS A 1 7   ? 6.614   50.017  37.457  1.00 65.69  ? 6    LYS A O   1 
ATOM   50   C CB  . LYS A 1 7   ? 6.355   52.176  39.796  1.00 68.18  ? 6    LYS A CB  1 
ATOM   51   C CG  . LYS A 1 7   ? 6.923   53.209  40.774  1.00 71.69  ? 6    LYS A CG  1 
ATOM   52   C CD  . LYS A 1 7   ? 6.034   54.413  41.018  1.00 74.44  ? 6    LYS A CD  1 
ATOM   53   C CE  . LYS A 1 7   ? 6.841   55.501  41.735  1.00 76.93  ? 6    LYS A CE  1 
ATOM   54   N NZ  . LYS A 1 7   ? 6.116   56.799  41.880  1.00 77.21  ? 6    LYS A NZ  1 
ATOM   55   N N   . VAL A 1 8   ? 6.763   48.884  39.387  1.00 65.51  ? 7    VAL A N   1 
ATOM   56   C CA  . VAL A 1 8   ? 6.280   47.633  38.828  1.00 65.95  ? 7    VAL A CA  1 
ATOM   57   C C   . VAL A 1 8   ? 4.827   47.302  39.164  1.00 67.46  ? 7    VAL A C   1 
ATOM   58   O O   . VAL A 1 8   ? 4.072   46.905  38.282  1.00 68.37  ? 7    VAL A O   1 
ATOM   59   C CB  . VAL A 1 8   ? 7.189   46.462  39.273  1.00 65.74  ? 7    VAL A CB  1 
ATOM   60   C CG1 . VAL A 1 8   ? 6.677   45.147  38.711  1.00 65.06  ? 7    VAL A CG1 1 
ATOM   61   C CG2 . VAL A 1 8   ? 8.615   46.718  38.812  1.00 64.13  ? 7    VAL A CG2 1 
ATOM   62   N N   . GLU A 1 9   ? 4.430   47.453  40.425  1.00 68.48  ? 8    GLU A N   1 
ATOM   63   C CA  . GLU A 1 9   ? 3.052   47.155  40.813  1.00 69.90  ? 8    GLU A CA  1 
ATOM   64   C C   . GLU A 1 9   ? 2.790   47.471  42.292  1.00 71.29  ? 8    GLU A C   1 
ATOM   65   O O   . GLU A 1 9   ? 3.671   47.285  43.132  1.00 71.07  ? 8    GLU A O   1 
ATOM   66   C CB  . GLU A 1 9   ? 2.748   45.674  40.527  1.00 68.92  ? 8    GLU A CB  1 
ATOM   67   C CG  . GLU A 1 9   ? 2.925   44.734  41.721  1.00 70.82  ? 8    GLU A CG  1 
ATOM   68   C CD  . GLU A 1 9   ? 3.392   43.333  41.329  1.00 71.09  ? 8    GLU A CD  1 
ATOM   69   O OE1 . GLU A 1 9   ? 2.924   42.810  40.294  1.00 72.04  ? 8    GLU A OE1 1 
ATOM   70   O OE2 . GLU A 1 9   ? 4.223   42.750  42.068  1.00 70.58  ? 8    GLU A OE2 1 
ATOM   71   N N   . LYS A 1 10  ? 1.592   47.966  42.608  1.00 72.39  ? 9    LYS A N   1 
ATOM   72   C CA  . LYS A 1 10  ? 1.250   48.254  43.997  1.00 73.54  ? 9    LYS A CA  1 
ATOM   73   C C   . LYS A 1 10  ? 1.432   46.938  44.736  1.00 73.82  ? 9    LYS A C   1 
ATOM   74   O O   . LYS A 1 10  ? 1.268   45.872  44.153  1.00 74.02  ? 9    LYS A O   1 
ATOM   75   C CB  . LYS A 1 10  ? -0.201  48.716  44.125  1.00 75.74  ? 9    LYS A CB  1 
ATOM   76   C CG  . LYS A 1 10  ? -0.682  48.833  45.574  1.00 78.93  ? 9    LYS A CG  1 
ATOM   77   C CD  . LYS A 1 10  ? -2.136  49.299  45.667  1.00 80.72  ? 9    LYS A CD  1 
ATOM   78   C CE  . LYS A 1 10  ? -2.606  49.414  47.119  1.00 81.73  ? 9    LYS A CE  1 
ATOM   79   N NZ  . LYS A 1 10  ? -3.982  50.001  47.235  1.00 82.92  ? 9    LYS A NZ  1 
ATOM   80   N N   . ILE A 1 11  ? 1.754   47.003  46.019  1.00 75.32  ? 10   ILE A N   1 
ATOM   81   C CA  . ILE A 1 11  ? 1.990   45.784  46.778  1.00 76.62  ? 10   ILE A CA  1 
ATOM   82   C C   . ILE A 1 11  ? 1.276   45.702  48.121  1.00 78.18  ? 10   ILE A C   1 
ATOM   83   O O   . ILE A 1 11  ? 0.825   44.629  48.519  1.00 78.48  ? 10   ILE A O   1 
ATOM   84   C CB  . ILE A 1 11  ? 3.504   45.598  46.977  1.00 76.40  ? 10   ILE A CB  1 
ATOM   85   C CG1 . ILE A 1 11  ? 4.045   44.663  45.903  1.00 77.18  ? 10   ILE A CG1 1 
ATOM   86   C CG2 . ILE A 1 11  ? 3.803   45.099  48.355  1.00 76.34  ? 10   ILE A CG2 1 
ATOM   87   C CD1 . ILE A 1 11  ? 5.543   44.505  45.956  1.00 79.27  ? 10   ILE A CD1 1 
ATOM   88   N N   . GLY A 1 12  ? 1.185   46.830  48.818  1.00 79.74  ? 11   GLY A N   1 
ATOM   89   C CA  . GLY A 1 12  ? 0.523   46.860  50.112  1.00 82.10  ? 11   GLY A CA  1 
ATOM   90   C C   . GLY A 1 12  ? 0.048   48.268  50.407  1.00 84.12  ? 11   GLY A C   1 
ATOM   91   O O   . GLY A 1 12  ? -0.061  49.079  49.492  1.00 84.13  ? 11   GLY A O   1 
ATOM   92   N N   . GLU A 1 13  ? -0.239  48.573  51.669  1.00 85.94  ? 12   GLU A N   1 
ATOM   93   C CA  . GLU A 1 13  ? -0.692  49.915  52.012  1.00 88.50  ? 12   GLU A CA  1 
ATOM   94   C C   . GLU A 1 13  ? -0.150  50.497  53.311  1.00 89.59  ? 12   GLU A C   1 
ATOM   95   O O   . GLU A 1 13  ? -0.342  49.934  54.391  1.00 89.63  ? 12   GLU A O   1 
ATOM   96   C CB  . GLU A 1 13  ? -2.222  49.981  52.049  1.00 88.68  ? 12   GLU A CB  1 
ATOM   97   C CG  . GLU A 1 13  ? -2.857  50.379  50.725  1.00 90.20  ? 12   GLU A CG  1 
ATOM   98   C CD  . GLU A 1 13  ? -4.181  51.108  50.909  1.00 91.17  ? 12   GLU A CD  1 
ATOM   99   O OE1 . GLU A 1 13  ? -4.194  52.156  51.593  1.00 91.27  ? 12   GLU A OE1 1 
ATOM   100  O OE2 . GLU A 1 13  ? -5.206  50.640  50.371  1.00 91.25  ? 12   GLU A OE2 1 
ATOM   101  N N   . GLY A 1 14  ? 0.537   51.631  53.186  1.00 90.59  ? 13   GLY A N   1 
ATOM   102  C CA  . GLY A 1 14  ? 1.056   52.317  54.352  1.00 91.42  ? 13   GLY A CA  1 
ATOM   103  C C   . GLY A 1 14  ? -0.135  53.110  54.847  1.00 92.13  ? 13   GLY A C   1 
ATOM   104  O O   . GLY A 1 14  ? -1.218  53.002  54.271  1.00 92.22  ? 13   GLY A O   1 
ATOM   105  N N   . THR A 1 15  ? 0.026   53.903  55.897  1.00 92.60  ? 14   THR A N   1 
ATOM   106  C CA  . THR A 1 15  ? -1.112  54.669  56.384  1.00 93.17  ? 14   THR A CA  1 
ATOM   107  C C   . THR A 1 15  ? -1.041  56.107  55.879  1.00 92.87  ? 14   THR A C   1 
ATOM   108  O O   . THR A 1 15  ? -1.986  56.885  56.033  1.00 92.18  ? 14   THR A O   1 
ATOM   109  C CB  . THR A 1 15  ? -1.177  54.646  57.914  1.00 94.19  ? 14   THR A CB  1 
ATOM   110  O OG1 . THR A 1 15  ? -0.844  53.330  58.380  1.00 94.64  ? 14   THR A OG1 1 
ATOM   111  C CG2 . THR A 1 15  ? -2.590  54.996  58.385  1.00 93.76  ? 14   THR A CG2 1 
ATOM   112  N N   . TYR A 1 16  ? 0.096   56.450  55.280  1.00 92.61  ? 15   TYR A N   1 
ATOM   113  C CA  . TYR A 1 16  ? 0.308   57.773  54.700  1.00 92.63  ? 15   TYR A CA  1 
ATOM   114  C C   . TYR A 1 16  ? 0.811   57.530  53.288  1.00 92.25  ? 15   TYR A C   1 
ATOM   115  O O   . TYR A 1 16  ? 1.393   58.415  52.657  1.00 92.48  ? 15   TYR A O   1 
ATOM   116  C CB  . TYR A 1 16  ? 1.361   58.574  55.474  1.00 92.53  ? 15   TYR A CB  1 
ATOM   117  C CG  . TYR A 1 16  ? 1.032   58.802  56.930  1.00 92.68  ? 15   TYR A CG  1 
ATOM   118  C CD1 . TYR A 1 16  ? 1.090   57.752  57.847  1.00 92.35  ? 15   TYR A CD1 1 
ATOM   119  C CD2 . TYR A 1 16  ? 0.664   60.065  57.393  1.00 92.24  ? 15   TYR A CD2 1 
ATOM   120  C CE1 . TYR A 1 16  ? 0.792   57.950  59.187  1.00 92.25  ? 15   TYR A CE1 1 
ATOM   121  C CE2 . TYR A 1 16  ? 0.361   60.275  58.734  1.00 92.40  ? 15   TYR A CE2 1 
ATOM   122  C CZ  . TYR A 1 16  ? 0.428   59.210  59.625  1.00 92.44  ? 15   TYR A CZ  1 
ATOM   123  O OH  . TYR A 1 16  ? 0.128   59.399  60.953  1.00 92.64  ? 15   TYR A OH  1 
ATOM   124  N N   . GLY A 1 17  ? 0.592   56.312  52.803  1.00 90.72  ? 16   GLY A N   1 
ATOM   125  C CA  . GLY A 1 17  ? 1.034   55.974  51.467  1.00 88.70  ? 16   GLY A CA  1 
ATOM   126  C C   . GLY A 1 17  ? 0.661   54.581  51.000  1.00 86.88  ? 16   GLY A C   1 
ATOM   127  O O   . GLY A 1 17  ? -0.477  54.124  51.158  1.00 87.64  ? 16   GLY A O   1 
ATOM   128  N N   . VAL A 1 18  ? 1.638   53.907  50.407  1.00 83.74  ? 17   VAL A N   1 
ATOM   129  C CA  . VAL A 1 18  ? 1.446   52.567  49.876  1.00 79.53  ? 17   VAL A CA  1 
ATOM   130  C C   . VAL A 1 18  ? 2.849   51.990  49.820  1.00 75.37  ? 17   VAL A C   1 
ATOM   131  O O   . VAL A 1 18  ? 3.795   52.605  50.303  1.00 74.41  ? 17   VAL A O   1 
ATOM   132  C CB  . VAL A 1 18  ? 0.887   52.614  48.411  1.00 81.05  ? 17   VAL A CB  1 
ATOM   133  C CG1 . VAL A 1 18  ? -0.001  51.412  48.138  1.00 81.40  ? 17   VAL A CG1 1 
ATOM   134  C CG2 . VAL A 1 18  ? 0.129   53.916  48.160  1.00 80.33  ? 17   VAL A CG2 1 
ATOM   135  N N   . VAL A 1 19  ? 2.976   50.808  49.238  1.00 71.19  ? 18   VAL A N   1 
ATOM   136  C CA  . VAL A 1 19  ? 4.274   50.185  49.057  1.00 67.17  ? 18   VAL A CA  1 
ATOM   137  C C   . VAL A 1 19  ? 4.233   49.661  47.635  1.00 63.91  ? 18   VAL A C   1 
ATOM   138  O O   . VAL A 1 19  ? 3.326   48.924  47.277  1.00 62.54  ? 18   VAL A O   1 
ATOM   139  C CB  . VAL A 1 19  ? 4.515   49.023  50.040  1.00 66.71  ? 18   VAL A CB  1 
ATOM   140  C CG1 . VAL A 1 19  ? 5.810   48.323  49.695  1.00 67.44  ? 18   VAL A CG1 1 
ATOM   141  C CG2 . VAL A 1 19  ? 4.600   49.551  51.457  1.00 66.87  ? 18   VAL A CG2 1 
ATOM   142  N N   . TYR A 1 20  ? 5.196   50.069  46.818  1.00 62.04  ? 19   TYR A N   1 
ATOM   143  C CA  . TYR A 1 20  ? 5.246   49.626  45.433  1.00 61.16  ? 19   TYR A CA  1 
ATOM   144  C C   . TYR A 1 20  ? 6.494   48.823  45.112  1.00 58.61  ? 19   TYR A C   1 
ATOM   145  O O   . TYR A 1 20  ? 7.577   49.097  45.630  1.00 58.18  ? 19   TYR A O   1 
ATOM   146  C CB  . TYR A 1 20  ? 5.231   50.809  44.469  1.00 64.41  ? 19   TYR A CB  1 
ATOM   147  C CG  . TYR A 1 20  ? 4.029   51.710  44.539  1.00 69.76  ? 19   TYR A CG  1 
ATOM   148  C CD1 . TYR A 1 20  ? 3.823   52.549  45.634  1.00 72.23  ? 19   TYR A CD1 1 
ATOM   149  C CD2 . TYR A 1 20  ? 3.125   51.770  43.476  1.00 71.50  ? 19   TYR A CD2 1 
ATOM   150  C CE1 . TYR A 1 20  ? 2.747   53.434  45.665  1.00 74.60  ? 19   TYR A CE1 1 
ATOM   151  C CE2 . TYR A 1 20  ? 2.047   52.647  43.495  1.00 73.41  ? 19   TYR A CE2 1 
ATOM   152  C CZ  . TYR A 1 20  ? 1.866   53.478  44.591  1.00 74.72  ? 19   TYR A CZ  1 
ATOM   153  O OH  . TYR A 1 20  ? 0.823   54.373  44.607  1.00 76.50  ? 19   TYR A OH  1 
ATOM   154  N N   . LYS A 1 21  ? 6.337   47.833  44.246  1.00 55.11  ? 20   LYS A N   1 
ATOM   155  C CA  . LYS A 1 21  ? 7.474   47.051  43.808  1.00 52.54  ? 20   LYS A CA  1 
ATOM   156  C C   . LYS A 1 21  ? 8.009   47.925  42.694  1.00 52.00  ? 20   LYS A C   1 
ATOM   157  O O   . LYS A 1 21  ? 7.240   48.430  41.884  1.00 52.51  ? 20   LYS A O   1 
ATOM   158  C CB  . LYS A 1 21  ? 7.027   45.704  43.250  1.00 49.53  ? 20   LYS A CB  1 
ATOM   159  C CG  . LYS A 1 21  ? 8.124   44.934  42.555  1.00 50.27  ? 20   LYS A CG  1 
ATOM   160  C CD  . LYS A 1 21  ? 7.713   43.490  42.325  1.00 49.12  ? 20   LYS A CD  1 
ATOM   161  C CE  . LYS A 1 21  ? 8.837   42.675  41.716  1.00 46.59  ? 20   LYS A CE  1 
ATOM   162  N NZ  . LYS A 1 21  ? 8.432   41.246  41.592  1.00 48.40  ? 20   LYS A NZ  1 
ATOM   163  N N   . ALA A 1 22  ? 9.314   48.143  42.665  1.00 51.42  ? 21   ALA A N   1 
ATOM   164  C CA  . ALA A 1 22  ? 9.894   48.978  41.624  1.00 50.93  ? 21   ALA A CA  1 
ATOM   165  C C   . ALA A 1 22  ? 11.261  48.427  41.304  1.00 50.06  ? 21   ALA A C   1 
ATOM   166  O O   . ALA A 1 22  ? 11.792  47.625  42.063  1.00 49.39  ? 21   ALA A O   1 
ATOM   167  C CB  . ALA A 1 22  ? 10.007  50.427  42.102  1.00 49.66  ? 21   ALA A CB  1 
ATOM   168  N N   . ARG A 1 23  ? 11.821  48.843  40.176  1.00 50.53  ? 22   ARG A N   1 
ATOM   169  C CA  . ARG A 1 23  ? 13.140  48.382  39.791  1.00 52.29  ? 22   ARG A CA  1 
ATOM   170  C C   . ARG A 1 23  ? 14.052  49.495  39.346  1.00 50.87  ? 22   ARG A C   1 
ATOM   171  O O   . ARG A 1 23  ? 13.755  50.231  38.411  1.00 51.55  ? 22   ARG A O   1 
ATOM   172  C CB  . ARG A 1 23  ? 13.062  47.325  38.685  1.00 57.01  ? 22   ARG A CB  1 
ATOM   173  C CG  . ARG A 1 23  ? 12.041  47.582  37.601  1.00 63.24  ? 22   ARG A CG  1 
ATOM   174  C CD  . ARG A 1 23  ? 12.343  46.735  36.364  1.00 68.29  ? 22   ARG A CD  1 
ATOM   175  N NE  . ARG A 1 23  ? 13.295  47.411  35.480  1.00 73.38  ? 22   ARG A NE  1 
ATOM   176  C CZ  . ARG A 1 23  ? 12.952  48.258  34.507  1.00 74.00  ? 22   ARG A CZ  1 
ATOM   177  N NH1 . ARG A 1 23  ? 11.673  48.529  34.276  1.00 72.47  ? 22   ARG A NH1 1 
ATOM   178  N NH2 . ARG A 1 23  ? 13.894  48.848  33.776  1.00 73.73  ? 22   ARG A NH2 1 
ATOM   179  N N   . ASN A 1 24  ? 15.172  49.613  40.041  1.00 49.11  ? 23   ASN A N   1 
ATOM   180  C CA  . ASN A 1 24  ? 16.170  50.612  39.725  1.00 48.53  ? 23   ASN A CA  1 
ATOM   181  C C   . ASN A 1 24  ? 16.582  50.382  38.261  1.00 49.27  ? 23   ASN A C   1 
ATOM   182  O O   . ASN A 1 24  ? 17.167  49.353  37.937  1.00 48.08  ? 23   ASN A O   1 
ATOM   183  C CB  . ASN A 1 24  ? 17.350  50.423  40.675  1.00 45.93  ? 23   ASN A CB  1 
ATOM   184  C CG  . ASN A 1 24  ? 18.412  51.470  40.498  1.00 44.22  ? 23   ASN A CG  1 
ATOM   185  O OD1 . ASN A 1 24  ? 19.016  51.584  39.432  1.00 43.30  ? 23   ASN A OD1 1 
ATOM   186  N ND2 . ASN A 1 24  ? 18.655  52.242  41.546  1.00 42.69  ? 23   ASN A ND2 1 
ATOM   187  N N   . LYS A 1 25  ? 16.265  51.337  37.386  1.00 49.85  ? 24   LYS A N   1 
ATOM   188  C CA  . LYS A 1 25  ? 16.570  51.230  35.952  1.00 50.41  ? 24   LYS A CA  1 
ATOM   189  C C   . LYS A 1 25  ? 18.031  50.995  35.568  1.00 50.78  ? 24   LYS A C   1 
ATOM   190  O O   . LYS A 1 25  ? 18.310  50.253  34.630  1.00 53.26  ? 24   LYS A O   1 
ATOM   191  C CB  . LYS A 1 25  ? 16.126  52.488  35.206  1.00 51.61  ? 24   LYS A CB  1 
ATOM   192  C CG  . LYS A 1 25  ? 14.647  52.812  35.177  1.00 53.55  ? 24   LYS A CG  1 
ATOM   193  C CD  . LYS A 1 25  ? 14.499  54.233  34.630  1.00 53.55  ? 24   LYS A CD  1 
ATOM   194  C CE  . LYS A 1 25  ? 13.071  54.596  34.258  1.00 54.22  ? 24   LYS A CE  1 
ATOM   195  N NZ  . LYS A 1 25  ? 12.996  55.999  33.723  1.00 55.66  ? 24   LYS A NZ  1 
ATOM   196  N N   . LEU A 1 26  ? 18.958  51.642  36.268  1.00 50.21  ? 25   LEU A N   1 
ATOM   197  C CA  . LEU A 1 26  ? 20.382  51.523  35.951  1.00 48.56  ? 25   LEU A CA  1 
ATOM   198  C C   . LEU A 1 26  ? 21.103  50.331  36.568  1.00 48.01  ? 25   LEU A C   1 
ATOM   199  O O   . LEU A 1 26  ? 21.906  49.692  35.900  1.00 49.32  ? 25   LEU A O   1 
ATOM   200  C CB  . LEU A 1 26  ? 21.112  52.805  36.355  1.00 47.65  ? 25   LEU A CB  1 
ATOM   201  C CG  . LEU A 1 26  ? 20.573  54.111  35.766  1.00 47.26  ? 25   LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 26  ? 21.080  55.260  36.598  1.00 46.97  ? 25   LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 26  ? 20.985  54.264  34.309  1.00 45.57  ? 25   LEU A CD2 1 
ATOM   204  N N   . THR A 1 27  ? 20.837  50.039  37.839  1.00 46.78  ? 26   THR A N   1 
ATOM   205  C CA  . THR A 1 27  ? 21.494  48.914  38.506  1.00 43.91  ? 26   THR A CA  1 
ATOM   206  C C   . THR A 1 27  ? 20.724  47.599  38.333  1.00 43.68  ? 26   THR A C   1 
ATOM   207  O O   . THR A 1 27  ? 21.288  46.514  38.493  1.00 45.33  ? 26   THR A O   1 
ATOM   208  C CB  . THR A 1 27  ? 21.675  49.181  40.015  1.00 42.51  ? 26   THR A CB  1 
ATOM   209  O OG1 . THR A 1 27  ? 20.426  48.996  40.693  1.00 41.47  ? 26   THR A OG1 1 
ATOM   210  C CG2 . THR A 1 27  ? 22.156  50.596  40.245  1.00 40.68  ? 26   THR A CG2 1 
ATOM   211  N N   . GLY A 1 28  ? 19.440  47.697  38.004  1.00 42.38  ? 27   GLY A N   1 
ATOM   212  C CA  . GLY A 1 28  ? 18.630  46.505  37.811  1.00 41.03  ? 27   GLY A CA  1 
ATOM   213  C C   . GLY A 1 28  ? 18.016  45.977  39.090  1.00 39.90  ? 27   GLY A C   1 
ATOM   214  O O   . GLY A 1 28  ? 17.215  45.045  39.076  1.00 40.21  ? 27   GLY A O   1 
ATOM   215  N N   . GLU A 1 29  ? 18.383  46.588  40.205  1.00 39.76  ? 28   GLU A N   1 
ATOM   216  C CA  . GLU A 1 29  ? 17.882  46.171  41.504  1.00 40.37  ? 28   GLU A CA  1 
ATOM   217  C C   . GLU A 1 29  ? 16.370  46.369  41.667  1.00 41.18  ? 28   GLU A C   1 
ATOM   218  O O   . GLU A 1 29  ? 15.822  47.413  41.320  1.00 43.84  ? 28   GLU A O   1 
ATOM   219  C CB  . GLU A 1 29  ? 18.654  46.928  42.597  1.00 38.45  ? 28   GLU A CB  1 
ATOM   220  C CG  . GLU A 1 29  ? 18.222  46.655  44.035  1.00 37.27  ? 28   GLU A CG  1 
ATOM   221  C CD  . GLU A 1 29  ? 18.917  47.577  45.036  1.00 37.64  ? 28   GLU A CD  1 
ATOM   222  O OE1 . GLU A 1 29  ? 19.163  48.756  44.685  1.00 37.50  ? 28   GLU A OE1 1 
ATOM   223  O OE2 . GLU A 1 29  ? 19.202  47.134  46.172  1.00 35.21  ? 28   GLU A OE2 1 
ATOM   224  N N   . VAL A 1 30  ? 15.694  45.346  42.176  1.00 41.72  ? 29   VAL A N   1 
ATOM   225  C CA  . VAL A 1 30  ? 14.257  45.431  42.429  1.00 41.14  ? 29   VAL A CA  1 
ATOM   226  C C   . VAL A 1 30  ? 14.105  45.942  43.866  1.00 41.52  ? 29   VAL A C   1 
ATOM   227  O O   . VAL A 1 30  ? 14.747  45.430  44.793  1.00 41.57  ? 29   VAL A O   1 
ATOM   228  C CB  . VAL A 1 30  ? 13.568  44.045  42.318  1.00 39.96  ? 29   VAL A CB  1 
ATOM   229  C CG1 . VAL A 1 30  ? 12.129  44.129  42.814  1.00 42.03  ? 29   VAL A CG1 1 
ATOM   230  C CG2 . VAL A 1 30  ? 13.590  43.571  40.888  1.00 39.83  ? 29   VAL A CG2 1 
ATOM   231  N N   . VAL A 1 31  ? 13.262  46.951  44.054  1.00 40.66  ? 30   VAL A N   1 
ATOM   232  C CA  . VAL A 1 31  ? 13.071  47.516  45.382  1.00 39.16  ? 30   VAL A CA  1 
ATOM   233  C C   . VAL A 1 31  ? 11.607  47.667  45.769  1.00 39.74  ? 30   VAL A C   1 
ATOM   234  O O   . VAL A 1 31  ? 10.704  47.437  44.966  1.00 39.44  ? 30   VAL A O   1 
ATOM   235  C CB  . VAL A 1 31  ? 13.722  48.913  45.485  1.00 36.27  ? 30   VAL A CB  1 
ATOM   236  C CG1 . VAL A 1 31  ? 15.148  48.858  44.988  1.00 35.19  ? 30   VAL A CG1 1 
ATOM   237  C CG2 . VAL A 1 31  ? 12.914  49.926  44.688  1.00 32.97  ? 30   VAL A CG2 1 
ATOM   238  N N   . ALA A 1 32  ? 11.397  48.061  47.019  1.00 40.87  ? 31   ALA A N   1 
ATOM   239  C CA  . ALA A 1 32  ? 10.068  48.315  47.552  1.00 41.67  ? 31   ALA A CA  1 
ATOM   240  C C   . ALA A 1 32  ? 10.041  49.788  47.993  1.00 42.83  ? 31   ALA A C   1 
ATOM   241  O O   . ALA A 1 32  ? 10.841  50.219  48.830  1.00 41.88  ? 31   ALA A O   1 
ATOM   242  C CB  . ALA A 1 32  ? 9.797   47.406  48.727  1.00 38.88  ? 31   ALA A CB  1 
ATOM   243  N N   . LEU A 1 33  ? 9.132   50.561  47.411  1.00 45.25  ? 32   LEU A N   1 
ATOM   244  C CA  . LEU A 1 33  ? 9.010   51.977  47.743  1.00 47.03  ? 32   LEU A CA  1 
ATOM   245  C C   . LEU A 1 33  ? 7.775   52.216  48.589  1.00 48.10  ? 32   LEU A C   1 
ATOM   246  O O   . LEU A 1 33  ? 6.676   51.814  48.219  1.00 49.84  ? 32   LEU A O   1 
ATOM   247  C CB  . LEU A 1 33  ? 8.921   52.824  46.469  1.00 45.94  ? 32   LEU A CB  1 
ATOM   248  C CG  . LEU A 1 33  ? 10.071  52.715  45.462  1.00 46.89  ? 32   LEU A CG  1 
ATOM   249  C CD1 . LEU A 1 33  ? 9.717   53.462  44.187  1.00 45.69  ? 32   LEU A CD1 1 
ATOM   250  C CD2 . LEU A 1 33  ? 11.349  53.266  46.070  1.00 48.35  ? 32   LEU A CD2 1 
ATOM   251  N N   . LYS A 1 34  ? 7.967   52.862  49.731  1.00 48.77  ? 33   LYS A N   1 
ATOM   252  C CA  . LYS A 1 34  ? 6.875   53.186  50.637  1.00 50.02  ? 33   LYS A CA  1 
ATOM   253  C C   . LYS A 1 34  ? 6.773   54.708  50.706  1.00 53.07  ? 33   LYS A C   1 
ATOM   254  O O   . LYS A 1 34  ? 7.589   55.353  51.368  1.00 53.76  ? 33   LYS A O   1 
ATOM   255  C CB  . LYS A 1 34  ? 7.162   52.629  52.032  1.00 46.49  ? 33   LYS A CB  1 
ATOM   256  C CG  . LYS A 1 34  ? 6.419   53.373  53.128  1.00 44.99  ? 33   LYS A CG  1 
ATOM   257  C CD  . LYS A 1 34  ? 6.824   52.933  54.517  1.00 42.99  ? 33   LYS A CD  1 
ATOM   258  C CE  . LYS A 1 34  ? 6.169   51.631  54.910  1.00 41.39  ? 33   LYS A CE  1 
ATOM   259  N NZ  . LYS A 1 34  ? 6.418   51.374  56.349  1.00 39.81  ? 33   LYS A NZ  1 
ATOM   260  N N   . LYS A 1 35  ? 5.784   55.287  50.029  1.00 57.15  ? 34   LYS A N   1 
ATOM   261  C CA  . LYS A 1 35  ? 5.638   56.743  50.029  1.00 61.56  ? 34   LYS A CA  1 
ATOM   262  C C   . LYS A 1 35  ? 4.867   57.266  51.233  1.00 62.88  ? 34   LYS A C   1 
ATOM   263  O O   . LYS A 1 35  ? 3.818   56.733  51.593  1.00 62.74  ? 34   LYS A O   1 
ATOM   264  C CB  . LYS A 1 35  ? 4.974   57.231  48.727  1.00 62.88  ? 34   LYS A CB  1 
ATOM   265  C CG  . LYS A 1 35  ? 3.469   57.007  48.625  1.00 66.89  ? 34   LYS A CG  1 
ATOM   266  C CD  . LYS A 1 35  ? 2.961   57.327  47.220  1.00 69.19  ? 34   LYS A CD  1 
ATOM   267  C CE  . LYS A 1 35  ? 1.437   57.204  47.104  1.00 71.27  ? 34   LYS A CE  1 
ATOM   268  N NZ  . LYS A 1 35  ? 0.726   58.444  47.544  1.00 71.93  ? 34   LYS A NZ  1 
ATOM   269  N N   . ILE A 1 36  ? 5.414   58.306  51.859  1.00 65.58  ? 35   ILE A N   1 
ATOM   270  C CA  . ILE A 1 36  ? 4.795   58.943  53.020  1.00 67.89  ? 35   ILE A CA  1 
ATOM   271  C C   . ILE A 1 36  ? 4.365   60.359  52.627  1.00 70.08  ? 35   ILE A C   1 
ATOM   272  O O   . ILE A 1 36  ? 5.183   61.167  52.182  1.00 68.46  ? 35   ILE A O   1 
ATOM   273  C CB  . ILE A 1 36  ? 5.779   58.990  54.239  1.00 66.83  ? 35   ILE A CB  1 
ATOM   274  C CG1 . ILE A 1 36  ? 5.581   57.761  55.136  1.00 66.04  ? 35   ILE A CG1 1 
ATOM   275  C CG2 . ILE A 1 36  ? 5.548   60.231  55.068  1.00 65.76  ? 35   ILE A CG2 1 
ATOM   276  C CD1 . ILE A 1 36  ? 6.098   56.463  54.563  1.00 64.59  ? 35   ILE A CD1 1 
ATOM   277  N N   . ARG A 1 37  ? 3.073   60.638  52.792  1.00 74.54  ? 36   ARG A N   1 
ATOM   278  C CA  . ARG A 1 37  ? 2.476   61.936  52.449  1.00 78.37  ? 36   ARG A CA  1 
ATOM   279  C C   . ARG A 1 37  ? 2.774   63.039  53.467  1.00 79.30  ? 36   ARG A C   1 
ATOM   280  O O   . ARG A 1 37  ? 2.543   62.857  54.661  1.00 79.55  ? 36   ARG A O   1 
ATOM   281  C CB  . ARG A 1 37  ? 0.954   61.793  52.325  1.00 80.74  ? 36   ARG A CB  1 
ATOM   282  C CG  . ARG A 1 37  ? 0.466   60.735  51.336  1.00 83.38  ? 36   ARG A CG  1 
ATOM   283  C CD  . ARG A 1 37  ? -1.048  60.560  51.450  1.00 84.76  ? 36   ARG A CD  1 
ATOM   284  N NE  . ARG A 1 37  ? -1.594  59.553  50.540  1.00 87.37  ? 36   ARG A NE  1 
ATOM   285  C CZ  . ARG A 1 37  ? -1.487  59.595  49.214  1.00 88.98  ? 36   ARG A CZ  1 
ATOM   286  N NH1 . ARG A 1 37  ? -0.844  60.600  48.625  1.00 89.40  ? 36   ARG A NH1 1 
ATOM   287  N NH2 . ARG A 1 37  ? -2.040  58.641  48.470  1.00 89.46  ? 36   ARG A NH2 1 
ATOM   288  N N   . LEU A 1 38  ? 3.264   64.184  52.989  1.00 81.13  ? 37   LEU A N   1 
ATOM   289  C CA  . LEU A 1 38  ? 3.583   65.327  53.859  1.00 82.85  ? 37   LEU A CA  1 
ATOM   290  C C   . LEU A 1 38  ? 2.586   66.484  53.630  1.00 84.69  ? 37   LEU A C   1 
ATOM   291  O O   . LEU A 1 38  ? 1.505   66.502  54.231  1.00 85.17  ? 37   LEU A O   1 
ATOM   292  C CB  . LEU A 1 38  ? 5.023   65.806  53.598  1.00 80.94  ? 37   LEU A CB  1 
ATOM   293  C CG  . LEU A 1 38  ? 6.182   64.806  53.737  1.00 79.10  ? 37   LEU A CG  1 
ATOM   294  C CD1 . LEU A 1 38  ? 7.492   65.554  53.592  1.00 77.39  ? 37   LEU A CD1 1 
ATOM   295  C CD2 . LEU A 1 38  ? 6.135   64.097  55.087  1.00 78.11  ? 37   LEU A CD2 1 
ATOM   296  N N   . ASP A 1 39  ? 2.975   67.454  52.793  1.00 86.54  ? 38   ASP A N   1 
ATOM   297  C CA  . ASP A 1 39  ? 2.135   68.603  52.404  1.00 87.29  ? 38   ASP A CA  1 
ATOM   298  C C   . ASP A 1 39  ? 2.086   69.922  53.193  1.00 87.64  ? 38   ASP A C   1 
ATOM   299  O O   . ASP A 1 39  ? 1.127   70.683  53.040  1.00 88.24  ? 38   ASP A O   1 
ATOM   300  C CB  . ASP A 1 39  ? 0.690   68.132  52.187  1.00 87.26  ? 38   ASP A CB  1 
ATOM   301  C CG  . ASP A 1 39  ? 0.559   67.196  51.005  1.00 87.30  ? 38   ASP A CG  1 
ATOM   302  O OD1 . ASP A 1 39  ? 0.975   67.590  49.896  1.00 87.10  ? 38   ASP A OD1 1 
ATOM   303  O OD2 . ASP A 1 39  ? 0.042   66.072  51.183  1.00 87.37  ? 38   ASP A OD2 1 
ATOM   304  N N   . THR A 1 40  ? 3.095   70.217  54.009  1.00 87.57  ? 39   THR A N   1 
ATOM   305  C CA  . THR A 1 40  ? 3.103   71.470  54.775  1.00 87.50  ? 39   THR A CA  1 
ATOM   306  C C   . THR A 1 40  ? 1.789   71.665  55.551  1.00 87.21  ? 39   THR A C   1 
ATOM   307  O O   . THR A 1 40  ? 0.997   70.728  55.687  1.00 87.92  ? 39   THR A O   1 
ATOM   308  C CB  . THR A 1 40  ? 3.319   72.706  53.840  1.00 87.97  ? 39   THR A CB  1 
ATOM   309  O OG1 . THR A 1 40  ? 4.463   72.490  53.001  1.00 88.15  ? 39   THR A OG1 1 
ATOM   310  C CG2 . THR A 1 40  ? 3.555   73.969  54.662  1.00 87.14  ? 39   THR A CG2 1 
ATOM   311  N N   . GLU A 1 41  ? 1.571   72.887  56.041  1.00 85.97  ? 40   GLU A N   1 
ATOM   312  C CA  . GLU A 1 41  ? 0.389   73.269  56.823  1.00 84.78  ? 40   GLU A CA  1 
ATOM   313  C C   . GLU A 1 41  ? -0.474  72.123  57.346  1.00 82.87  ? 40   GLU A C   1 
ATOM   314  O O   . GLU A 1 41  ? -1.639  71.968  56.973  1.00 82.74  ? 40   GLU A O   1 
ATOM   315  C CB  . GLU A 1 41  ? -0.485  74.266  56.043  1.00 85.89  ? 40   GLU A CB  1 
ATOM   316  C CG  . GLU A 1 41  ? -1.809  74.679  56.736  1.00 85.60  ? 40   GLU A CG  1 
ATOM   317  C CD  . GLU A 1 41  ? -1.681  74.901  58.244  1.00 85.37  ? 40   GLU A CD  1 
ATOM   318  O OE1 . GLU A 1 41  ? -1.673  73.907  59.005  1.00 84.01  ? 40   GLU A OE1 1 
ATOM   319  O OE2 . GLU A 1 41  ? -1.589  76.074  58.668  1.00 85.59  ? 40   GLU A OE2 1 
ATOM   320  N N   . THR A 1 42  ? 0.128   71.318  58.210  1.00 79.57  ? 41   THR A N   1 
ATOM   321  C CA  . THR A 1 42  ? -0.544  70.210  58.861  1.00 75.51  ? 41   THR A CA  1 
ATOM   322  C C   . THR A 1 42  ? 0.315   70.016  60.106  1.00 72.83  ? 41   THR A C   1 
ATOM   323  O O   . THR A 1 42  ? 0.390   70.929  60.928  1.00 73.15  ? 41   THR A O   1 
ATOM   324  C CB  . THR A 1 42  ? -0.619  68.941  57.952  1.00 75.42  ? 41   THR A CB  1 
ATOM   325  O OG1 . THR A 1 42  ? -1.500  67.988  58.554  1.00 75.77  ? 41   THR A OG1 1 
ATOM   326  C CG2 . THR A 1 42  ? 0.740   68.301  57.748  1.00 75.81  ? 41   THR A CG2 1 
ATOM   327  N N   . GLU A 1 43  ? 0.984   68.881  60.261  1.00 68.13  ? 42   GLU A N   1 
ATOM   328  C CA  . GLU A 1 43  ? 1.811   68.708  61.444  1.00 63.70  ? 42   GLU A CA  1 
ATOM   329  C C   . GLU A 1 43  ? 3.257   68.341  61.142  1.00 60.53  ? 42   GLU A C   1 
ATOM   330  O O   . GLU A 1 43  ? 4.001   67.929  62.031  1.00 58.75  ? 42   GLU A O   1 
ATOM   331  C CB  . GLU A 1 43  ? 1.174   67.682  62.383  1.00 64.03  ? 42   GLU A CB  1 
ATOM   332  C CG  . GLU A 1 43  ? -0.051  68.220  63.112  1.00 64.87  ? 42   GLU A CG  1 
ATOM   333  C CD  . GLU A 1 43  ? 0.289   69.368  64.053  1.00 66.86  ? 42   GLU A CD  1 
ATOM   334  O OE1 . GLU A 1 43  ? 0.969   69.117  65.073  1.00 67.32  ? 42   GLU A OE1 1 
ATOM   335  O OE2 . GLU A 1 43  ? -0.113  70.521  63.771  1.00 66.82  ? 42   GLU A OE2 1 
ATOM   336  N N   . GLY A 1 44  ? 3.662   68.522  59.890  1.00 56.53  ? 43   GLY A N   1 
ATOM   337  C CA  . GLY A 1 44  ? 5.025   68.196  59.518  1.00 52.83  ? 43   GLY A CA  1 
ATOM   338  C C   . GLY A 1 44  ? 5.219   66.703  59.324  1.00 49.01  ? 43   GLY A C   1 
ATOM   339  O O   . GLY A 1 44  ? 4.270   65.980  59.035  1.00 48.65  ? 43   GLY A O   1 
ATOM   340  N N   . VAL A 1 45  ? 6.446   66.230  59.496  1.00 45.52  ? 44   VAL A N   1 
ATOM   341  C CA  . VAL A 1 45  ? 6.712   64.819  59.306  1.00 44.24  ? 44   VAL A CA  1 
ATOM   342  C C   . VAL A 1 45  ? 6.144   63.976  60.444  1.00 43.08  ? 44   VAL A C   1 
ATOM   343  O O   . VAL A 1 45  ? 6.422   64.221  61.621  1.00 41.11  ? 44   VAL A O   1 
ATOM   344  C CB  . VAL A 1 45  ? 8.228   64.549  59.169  1.00 44.02  ? 44   VAL A CB  1 
ATOM   345  C CG1 . VAL A 1 45  ? 8.465   63.119  58.673  1.00 43.67  ? 44   VAL A CG1 1 
ATOM   346  C CG2 . VAL A 1 45  ? 8.847   65.552  58.208  1.00 42.99  ? 44   VAL A CG2 1 
ATOM   347  N N   . PRO A 1 46  ? 5.329   62.968  60.097  1.00 42.85  ? 45   PRO A N   1 
ATOM   348  C CA  . PRO A 1 46  ? 4.691   62.051  61.051  1.00 42.79  ? 45   PRO A CA  1 
ATOM   349  C C   . PRO A 1 46  ? 5.728   61.456  61.990  1.00 42.26  ? 45   PRO A C   1 
ATOM   350  O O   . PRO A 1 46  ? 6.777   60.995  61.543  1.00 43.50  ? 45   PRO A O   1 
ATOM   351  C CB  . PRO A 1 46  ? 4.064   61.002  60.143  1.00 41.81  ? 45   PRO A CB  1 
ATOM   352  C CG  . PRO A 1 46  ? 3.697   61.796  58.940  1.00 42.88  ? 45   PRO A CG  1 
ATOM   353  C CD  . PRO A 1 46  ? 4.935   62.636  58.718  1.00 42.99  ? 45   PRO A CD  1 
ATOM   354  N N   . SER A 1 47  ? 5.440   61.462  63.288  1.00 41.95  ? 46   SER A N   1 
ATOM   355  C CA  . SER A 1 47  ? 6.388   60.935  64.264  1.00 41.44  ? 46   SER A CA  1 
ATOM   356  C C   . SER A 1 47  ? 6.641   59.456  64.025  1.00 41.75  ? 46   SER A C   1 
ATOM   357  O O   . SER A 1 47  ? 7.701   58.938  64.387  1.00 43.96  ? 46   SER A O   1 
ATOM   358  C CB  . SER A 1 47  ? 5.875   61.140  65.685  1.00 38.87  ? 46   SER A CB  1 
ATOM   359  O OG  . SER A 1 47  ? 4.889   60.182  65.981  1.00 43.52  ? 46   SER A OG  1 
ATOM   360  N N   . THR A 1 48  ? 5.676   58.773  63.413  1.00 39.55  ? 47   THR A N   1 
ATOM   361  C CA  . THR A 1 48  ? 5.851   57.357  63.141  1.00 37.72  ? 47   THR A CA  1 
ATOM   362  C C   . THR A 1 48  ? 6.921   57.165  62.070  1.00 39.27  ? 47   THR A C   1 
ATOM   363  O O   . THR A 1 48  ? 7.585   56.132  62.025  1.00 40.62  ? 47   THR A O   1 
ATOM   364  C CB  . THR A 1 48  ? 4.536   56.687  62.683  1.00 36.96  ? 47   THR A CB  1 
ATOM   365  O OG1 . THR A 1 48  ? 3.961   57.450  61.624  1.00 37.61  ? 47   THR A OG1 1 
ATOM   366  C CG2 . THR A 1 48  ? 3.542   56.592  63.834  1.00 33.68  ? 47   THR A CG2 1 
ATOM   367  N N   . ALA A 1 49  ? 7.094   58.157  61.202  1.00 38.75  ? 48   ALA A N   1 
ATOM   368  C CA  . ALA A 1 49  ? 8.114   58.058  60.164  1.00 37.77  ? 48   ALA A CA  1 
ATOM   369  C C   . ALA A 1 49  ? 9.457   58.451  60.791  1.00 38.79  ? 48   ALA A C   1 
ATOM   370  O O   . ALA A 1 49  ? 10.494  57.847  60.491  1.00 38.98  ? 48   ALA A O   1 
ATOM   371  C CB  . ALA A 1 49  ? 7.777   58.972  58.995  1.00 35.73  ? 48   ALA A CB  1 
ATOM   372  N N   . ILE A 1 50  ? 9.430   59.458  61.665  1.00 36.83  ? 49   ILE A N   1 
ATOM   373  C CA  . ILE A 1 50  ? 10.639  59.905  62.347  1.00 36.67  ? 49   ILE A CA  1 
ATOM   374  C C   . ILE A 1 50  ? 11.275  58.700  63.042  1.00 36.79  ? 49   ILE A C   1 
ATOM   375  O O   . ILE A 1 50  ? 12.476  58.459  62.926  1.00 37.95  ? 49   ILE A O   1 
ATOM   376  C CB  . ILE A 1 50  ? 10.335  60.967  63.440  1.00 36.18  ? 49   ILE A CB  1 
ATOM   377  C CG1 . ILE A 1 50  ? 9.839   62.275  62.813  1.00 36.81  ? 49   ILE A CG1 1 
ATOM   378  C CG2 . ILE A 1 50  ? 11.565  61.195  64.284  1.00 35.22  ? 49   ILE A CG2 1 
ATOM   379  C CD1 . ILE A 1 50  ? 10.848  62.999  61.971  1.00 37.01  ? 49   ILE A CD1 1 
ATOM   380  N N   . ARG A 1 51  ? 10.461  57.945  63.770  1.00 35.77  ? 50   ARG A N   1 
ATOM   381  C CA  . ARG A 1 51  ? 10.959  56.778  64.484  1.00 35.78  ? 50   ARG A CA  1 
ATOM   382  C C   . ARG A 1 51  ? 11.358  55.664  63.531  1.00 34.82  ? 50   ARG A C   1 
ATOM   383  O O   . ARG A 1 51  ? 12.434  55.073  63.654  1.00 33.29  ? 50   ARG A O   1 
ATOM   384  C CB  . ARG A 1 51  ? 9.894   56.259  65.452  1.00 37.72  ? 50   ARG A CB  1 
ATOM   385  C CG  . ARG A 1 51  ? 9.646   57.172  66.628  1.00 36.60  ? 50   ARG A CG  1 
ATOM   386  C CD  . ARG A 1 51  ? 8.534   56.656  67.489  1.00 33.42  ? 50   ARG A CD  1 
ATOM   387  N NE  . ARG A 1 51  ? 8.442   57.399  68.742  1.00 34.12  ? 50   ARG A NE  1 
ATOM   388  C CZ  . ARG A 1 51  ? 7.432   57.272  69.594  1.00 32.37  ? 50   ARG A CZ  1 
ATOM   389  N NH1 . ARG A 1 51  ? 6.441   56.439  69.317  1.00 32.99  ? 50   ARG A NH1 1 
ATOM   390  N NH2 . ARG A 1 51  ? 7.407   57.968  70.719  1.00 30.95  ? 50   ARG A NH2 1 
ATOM   391  N N   . GLU A 1 52  ? 10.485  55.383  62.576  1.00 34.86  ? 51   GLU A N   1 
ATOM   392  C CA  . GLU A 1 52  ? 10.759  54.328  61.618  1.00 36.70  ? 51   GLU A CA  1 
ATOM   393  C C   . GLU A 1 52  ? 12.104  54.519  60.920  1.00 35.33  ? 51   GLU A C   1 
ATOM   394  O O   . GLU A 1 52  ? 12.894  53.586  60.819  1.00 32.15  ? 51   GLU A O   1 
ATOM   395  C CB  . GLU A 1 52  ? 9.648   54.255  60.564  1.00 38.52  ? 51   GLU A CB  1 
ATOM   396  C CG  . GLU A 1 52  ? 9.687   52.971  59.748  1.00 43.29  ? 51   GLU A CG  1 
ATOM   397  C CD  . GLU A 1 52  ? 8.552   52.855  58.747  1.00 46.37  ? 51   GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 52  ? 7.417   53.279  59.057  1.00 50.31  ? 51   GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 52  ? 8.793   52.320  57.648  1.00 48.09  ? 51   GLU A OE2 1 
ATOM   400  N N   . ILE A 1 53  ? 12.366  55.734  60.452  1.00 35.30  ? 52   ILE A N   1 
ATOM   401  C CA  . ILE A 1 53  ? 13.595  56.001  59.728  1.00 34.87  ? 52   ILE A CA  1 
ATOM   402  C C   . ILE A 1 53  ? 14.843  56.011  60.592  1.00 35.85  ? 52   ILE A C   1 
ATOM   403  O O   . ILE A 1 53  ? 15.817  55.335  60.270  1.00 37.73  ? 52   ILE A O   1 
ATOM   404  C CB  . ILE A 1 53  ? 13.474  57.316  58.929  1.00 35.43  ? 52   ILE A CB  1 
ATOM   405  C CG1 . ILE A 1 53  ? 12.295  57.202  57.952  1.00 35.99  ? 52   ILE A CG1 1 
ATOM   406  C CG2 . ILE A 1 53  ? 14.762  57.587  58.153  1.00 36.39  ? 52   ILE A CG2 1 
ATOM   407  C CD1 . ILE A 1 53  ? 11.963  58.470  57.221  1.00 34.73  ? 52   ILE A CD1 1 
ATOM   408  N N   . SER A 1 54  ? 14.827  56.752  61.694  1.00 37.69  ? 53   SER A N   1 
ATOM   409  C CA  . SER A 1 54  ? 16.003  56.796  62.561  1.00 38.54  ? 53   SER A CA  1 
ATOM   410  C C   . SER A 1 54  ? 16.325  55.431  63.162  1.00 38.19  ? 53   SER A C   1 
ATOM   411  O O   . SER A 1 54  ? 17.479  55.008  63.153  1.00 40.68  ? 53   SER A O   1 
ATOM   412  C CB  . SER A 1 54  ? 15.848  57.852  63.673  1.00 37.12  ? 53   SER A CB  1 
ATOM   413  O OG  . SER A 1 54  ? 14.610  57.738  64.343  1.00 39.03  ? 53   SER A OG  1 
ATOM   414  N N   . LEU A 1 55  ? 15.320  54.725  63.663  1.00 37.13  ? 54   LEU A N   1 
ATOM   415  C CA  . LEU A 1 55  ? 15.575  53.415  64.248  1.00 37.72  ? 54   LEU A CA  1 
ATOM   416  C C   . LEU A 1 55  ? 16.034  52.383  63.229  1.00 37.25  ? 54   LEU A C   1 
ATOM   417  O O   . LEU A 1 55  ? 16.975  51.631  63.477  1.00 37.19  ? 54   LEU A O   1 
ATOM   418  C CB  . LEU A 1 55  ? 14.329  52.909  64.973  1.00 36.13  ? 54   LEU A CB  1 
ATOM   419  C CG  . LEU A 1 55  ? 13.993  53.737  66.214  1.00 35.08  ? 54   LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 55  ? 12.755  53.177  66.902  1.00 34.85  ? 54   LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 55  ? 15.186  53.726  67.159  1.00 33.18  ? 54   LEU A CD2 1 
ATOM   422  N N   . LEU A 1 56  ? 15.382  52.369  62.073  1.00 38.84  ? 55   LEU A N   1 
ATOM   423  C CA  . LEU A 1 56  ? 15.703  51.414  61.018  1.00 39.48  ? 55   LEU A CA  1 
ATOM   424  C C   . LEU A 1 56  ? 17.112  51.623  60.481  1.00 41.15  ? 55   LEU A C   1 
ATOM   425  O O   . LEU A 1 56  ? 17.814  50.663  60.183  1.00 42.10  ? 55   LEU A O   1 
ATOM   426  C CB  . LEU A 1 56  ? 14.660  51.513  59.902  1.00 37.59  ? 55   LEU A CB  1 
ATOM   427  C CG  . LEU A 1 56  ? 14.227  50.225  59.193  1.00 38.01  ? 55   LEU A CG  1 
ATOM   428  C CD1 . LEU A 1 56  ? 14.289  49.026  60.146  1.00 32.77  ? 55   LEU A CD1 1 
ATOM   429  C CD2 . LEU A 1 56  ? 12.827  50.423  58.629  1.00 33.54  ? 55   LEU A CD2 1 
ATOM   430  N N   . LYS A 1 57  ? 17.533  52.873  60.355  1.00 44.76  ? 56   LYS A N   1 
ATOM   431  C CA  . LYS A 1 57  ? 18.892  53.149  59.892  1.00 48.05  ? 56   LYS A CA  1 
ATOM   432  C C   . LYS A 1 57  ? 19.890  52.507  60.872  1.00 50.40  ? 56   LYS A C   1 
ATOM   433  O O   . LYS A 1 57  ? 21.021  52.155  60.519  1.00 51.32  ? 56   LYS A O   1 
ATOM   434  C CB  . LYS A 1 57  ? 19.139  54.654  59.853  1.00 46.48  ? 56   LYS A CB  1 
ATOM   435  C CG  . LYS A 1 57  ? 18.349  55.397  58.796  1.00 48.45  ? 56   LYS A CG  1 
ATOM   436  C CD  . LYS A 1 57  ? 18.885  56.815  58.605  1.00 49.16  ? 56   LYS A CD  1 
ATOM   437  C CE  . LYS A 1 57  ? 20.359  56.813  58.199  1.00 49.14  ? 56   LYS A CE  1 
ATOM   438  N NZ  . LYS A 1 57  ? 20.832  58.146  57.731  1.00 49.53  ? 56   LYS A NZ  1 
ATOM   439  N N   . GLU A 1 58  ? 19.430  52.355  62.107  1.00 50.78  ? 57   GLU A N   1 
ATOM   440  C CA  . GLU A 1 58  ? 20.203  51.808  63.206  1.00 49.90  ? 57   GLU A CA  1 
ATOM   441  C C   . GLU A 1 58  ? 20.102  50.281  63.279  1.00 50.92  ? 57   GLU A C   1 
ATOM   442  O O   . GLU A 1 58  ? 20.666  49.647  64.173  1.00 51.72  ? 57   GLU A O   1 
ATOM   443  C CB  . GLU A 1 58  ? 19.661  52.421  64.489  1.00 50.58  ? 57   GLU A CB  1 
ATOM   444  C CG  . GLU A 1 58  ? 20.544  52.310  65.686  1.00 52.07  ? 57   GLU A CG  1 
ATOM   445  C CD  . GLU A 1 58  ? 20.700  53.643  66.369  1.00 51.98  ? 57   GLU A CD  1 
ATOM   446  O OE1 . GLU A 1 58  ? 21.303  53.696  67.459  1.00 54.94  ? 57   GLU A OE1 1 
ATOM   447  O OE2 . GLU A 1 58  ? 20.219  54.642  65.804  1.00 51.66  ? 57   GLU A OE2 1 
ATOM   448  N N   . LEU A 1 59  ? 19.398  49.683  62.328  1.00 49.02  ? 58   LEU A N   1 
ATOM   449  C CA  . LEU A 1 59  ? 19.218  48.247  62.360  1.00 45.33  ? 58   LEU A CA  1 
ATOM   450  C C   . LEU A 1 59  ? 19.653  47.511  61.104  1.00 45.03  ? 58   LEU A C   1 
ATOM   451  O O   . LEU A 1 59  ? 18.844  47.233  60.222  1.00 47.30  ? 58   LEU A O   1 
ATOM   452  C CB  . LEU A 1 59  ? 17.752  47.936  62.666  1.00 42.42  ? 58   LEU A CB  1 
ATOM   453  C CG  . LEU A 1 59  ? 17.252  48.459  64.014  1.00 40.66  ? 58   LEU A CG  1 
ATOM   454  C CD1 . LEU A 1 59  ? 15.788  48.096  64.201  1.00 37.12  ? 58   LEU A CD1 1 
ATOM   455  C CD2 . LEU A 1 59  ? 18.099  47.862  65.133  1.00 39.71  ? 58   LEU A CD2 1 
ATOM   456  N N   . ASN A 1 60  ? 20.935  47.191  61.032  1.00 42.85  ? 59   ASN A N   1 
ATOM   457  C CA  . ASN A 1 60  ? 21.461  46.465  59.898  1.00 44.18  ? 59   ASN A CA  1 
ATOM   458  C C   . ASN A 1 60  ? 21.587  45.008  60.342  1.00 43.09  ? 59   ASN A C   1 
ATOM   459  O O   . ASN A 1 60  ? 22.382  44.677  61.224  1.00 41.23  ? 59   ASN A O   1 
ATOM   460  C CB  . ASN A 1 60  ? 22.827  47.018  59.501  1.00 50.07  ? 59   ASN A CB  1 
ATOM   461  C CG  . ASN A 1 60  ? 23.220  46.644  58.079  1.00 55.10  ? 59   ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 60  ? 24.329  46.946  57.630  1.00 58.30  ? 59   ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 60  ? 22.305  45.992  57.359  1.00 57.27  ? 59   ASN A ND2 1 
ATOM   464  N N   . HIS A 1 61  ? 20.782  44.147  59.734  1.00 40.71  ? 60   HIS A N   1 
ATOM   465  C CA  . HIS A 1 61  ? 20.775  42.739  60.069  1.00 38.24  ? 60   HIS A CA  1 
ATOM   466  C C   . HIS A 1 61  ? 20.018  41.974  58.967  1.00 37.88  ? 60   HIS A C   1 
ATOM   467  O O   . HIS A 1 61  ? 19.040  42.474  58.415  1.00 38.40  ? 60   HIS A O   1 
ATOM   468  C CB  . HIS A 1 61  ? 20.100  42.547  61.432  1.00 38.04  ? 60   HIS A CB  1 
ATOM   469  C CG  . HIS A 1 61  ? 20.100  41.129  61.904  1.00 39.15  ? 60   HIS A CG  1 
ATOM   470  N ND1 . HIS A 1 61  ? 21.092  40.610  62.709  1.00 41.18  ? 60   HIS A ND1 1 
ATOM   471  C CD2 . HIS A 1 61  ? 19.264  40.102  61.629  1.00 37.61  ? 60   HIS A CD2 1 
ATOM   472  C CE1 . HIS A 1 61  ? 20.869  39.324  62.907  1.00 38.55  ? 60   HIS A CE1 1 
ATOM   473  N NE2 . HIS A 1 61  ? 19.766  38.991  62.262  1.00 40.76  ? 60   HIS A NE2 1 
ATOM   474  N N   . PRO A 1 62  ? 20.472  40.752  58.634  1.00 35.64  ? 61   PRO A N   1 
ATOM   475  C CA  . PRO A 1 62  ? 19.878  39.891  57.605  1.00 32.96  ? 61   PRO A CA  1 
ATOM   476  C C   . PRO A 1 62  ? 18.411  39.556  57.845  1.00 34.15  ? 61   PRO A C   1 
ATOM   477  O O   . PRO A 1 62  ? 17.695  39.154  56.917  1.00 33.86  ? 61   PRO A O   1 
ATOM   478  C CB  . PRO A 1 62  ? 20.744  38.638  57.659  1.00 33.22  ? 61   PRO A CB  1 
ATOM   479  C CG  . PRO A 1 62  ? 22.057  39.138  58.172  1.00 34.28  ? 61   PRO A CG  1 
ATOM   480  C CD  . PRO A 1 62  ? 21.641  40.094  59.247  1.00 34.93  ? 61   PRO A CD  1 
ATOM   481  N N   . ASN A 1 63  ? 17.965  39.711  59.088  1.00 31.79  ? 62   ASN A N   1 
ATOM   482  C CA  . ASN A 1 63  ? 16.589  39.396  59.411  1.00 30.48  ? 62   ASN A CA  1 
ATOM   483  C C   . ASN A 1 63  ? 15.711  40.600  59.664  1.00 30.57  ? 62   ASN A C   1 
ATOM   484  O O   . ASN A 1 63  ? 14.600  40.455  60.154  1.00 29.50  ? 62   ASN A O   1 
ATOM   485  C CB  . ASN A 1 63  ? 16.548  38.454  60.596  1.00 31.84  ? 62   ASN A CB  1 
ATOM   486  C CG  . ASN A 1 63  ? 17.322  37.197  60.336  1.00 33.56  ? 62   ASN A CG  1 
ATOM   487  O OD1 . ASN A 1 63  ? 18.164  36.799  61.133  1.00 37.30  ? 62   ASN A OD1 1 
ATOM   488  N ND2 . ASN A 1 63  ? 17.049  36.560  59.208  1.00 35.19  ? 62   ASN A ND2 1 
ATOM   489  N N   . ILE A 1 64  ? 16.220  41.784  59.328  1.00 30.28  ? 63   ILE A N   1 
ATOM   490  C CA  . ILE A 1 64  ? 15.468  43.029  59.456  1.00 28.93  ? 63   ILE A CA  1 
ATOM   491  C C   . ILE A 1 64  ? 15.490  43.670  58.062  1.00 29.80  ? 63   ILE A C   1 
ATOM   492  O O   . ILE A 1 64  ? 16.565  43.886  57.522  1.00 30.66  ? 63   ILE A O   1 
ATOM   493  C CB  . ILE A 1 64  ? 16.139  43.999  60.459  1.00 29.40  ? 63   ILE A CB  1 
ATOM   494  C CG1 . ILE A 1 64  ? 16.194  43.356  61.855  1.00 28.76  ? 63   ILE A CG1 1 
ATOM   495  C CG2 . ILE A 1 64  ? 15.388  45.347  60.470  1.00 24.92  ? 63   ILE A CG2 1 
ATOM   496  C CD1 . ILE A 1 64  ? 16.729  44.277  62.960  1.00 26.62  ? 63   ILE A CD1 1 
ATOM   497  N N   . VAL A 1 65  ? 14.331  43.952  57.463  1.00 30.80  ? 64   VAL A N   1 
ATOM   498  C CA  . VAL A 1 65  ? 14.324  44.577  56.138  1.00 31.57  ? 64   VAL A CA  1 
ATOM   499  C C   . VAL A 1 65  ? 15.332  45.690  56.079  1.00 33.51  ? 64   VAL A C   1 
ATOM   500  O O   . VAL A 1 65  ? 15.501  46.439  57.041  1.00 35.17  ? 64   VAL A O   1 
ATOM   501  C CB  . VAL A 1 65  ? 12.985  45.239  55.757  1.00 30.84  ? 64   VAL A CB  1 
ATOM   502  C CG1 . VAL A 1 65  ? 12.133  44.272  55.021  1.00 30.42  ? 64   VAL A CG1 1 
ATOM   503  C CG2 . VAL A 1 65  ? 12.293  45.773  56.987  1.00 32.44  ? 64   VAL A CG2 1 
ATOM   504  N N   . LYS A 1 66  ? 15.969  45.829  54.928  1.00 33.00  ? 65   LYS A N   1 
ATOM   505  C CA  . LYS A 1 66  ? 16.959  46.859  54.769  1.00 34.14  ? 65   LYS A CA  1 
ATOM   506  C C   . LYS A 1 66  ? 16.397  48.112  54.105  1.00 32.95  ? 65   LYS A C   1 
ATOM   507  O O   . LYS A 1 66  ? 15.758  48.040  53.058  1.00 32.58  ? 65   LYS A O   1 
ATOM   508  C CB  . LYS A 1 66  ? 18.122  46.301  53.960  1.00 37.34  ? 65   LYS A CB  1 
ATOM   509  C CG  . LYS A 1 66  ? 19.493  46.719  54.445  1.00 38.17  ? 65   LYS A CG  1 
ATOM   510  C CD  . LYS A 1 66  ? 19.972  47.969  53.748  1.00 42.12  ? 65   LYS A CD  1 
ATOM   511  C CE  . LYS A 1 66  ? 21.496  47.991  53.682  1.00 43.22  ? 65   LYS A CE  1 
ATOM   512  N NZ  . LYS A 1 66  ? 22.032  46.761  53.006  1.00 46.15  ? 65   LYS A NZ  1 
ATOM   513  N N   . LEU A 1 67  ? 16.625  49.251  54.753  1.00 32.77  ? 66   LEU A N   1 
ATOM   514  C CA  . LEU A 1 67  ? 16.210  50.552  54.247  1.00 33.10  ? 66   LEU A CA  1 
ATOM   515  C C   . LEU A 1 67  ? 17.391  51.003  53.400  1.00 35.42  ? 66   LEU A C   1 
ATOM   516  O O   . LEU A 1 67  ? 18.487  51.248  53.914  1.00 35.79  ? 66   LEU A O   1 
ATOM   517  C CB  . LEU A 1 67  ? 15.988  51.522  55.407  1.00 33.49  ? 66   LEU A CB  1 
ATOM   518  C CG  . LEU A 1 67  ? 15.633  52.986  55.129  1.00 32.35  ? 66   LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 67  ? 14.331  53.101  54.350  1.00 29.28  ? 66   LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 67  ? 15.521  53.695  56.456  1.00 31.87  ? 66   LEU A CD2 1 
ATOM   521  N N   . LEU A 1 68  ? 17.166  51.096  52.096  1.00 36.93  ? 67   LEU A N   1 
ATOM   522  C CA  . LEU A 1 68  ? 18.217  51.462  51.161  1.00 37.04  ? 67   LEU A CA  1 
ATOM   523  C C   . LEU A 1 68  ? 18.395  52.956  50.983  1.00 40.46  ? 67   LEU A C   1 
ATOM   524  O O   . LEU A 1 68  ? 19.511  53.424  50.756  1.00 41.02  ? 67   LEU A O   1 
ATOM   525  C CB  . LEU A 1 68  ? 17.939  50.806  49.812  1.00 32.81  ? 67   LEU A CB  1 
ATOM   526  C CG  . LEU A 1 68  ? 17.879  49.283  49.892  1.00 32.52  ? 67   LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 68  ? 17.495  48.722  48.547  1.00 32.64  ? 67   LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 68  ? 19.227  48.738  50.348  1.00 31.89  ? 67   LEU A CD2 1 
ATOM   529  N N   . ASP A 1 69  ? 17.298  53.703  51.093  1.00 43.48  ? 68   ASP A N   1 
ATOM   530  C CA  . ASP A 1 69  ? 17.355  55.142  50.923  1.00 45.19  ? 68   ASP A CA  1 
ATOM   531  C C   . ASP A 1 69  ? 16.059  55.828  51.347  1.00 45.47  ? 68   ASP A C   1 
ATOM   532  O O   . ASP A 1 69  ? 15.007  55.193  51.470  1.00 43.68  ? 68   ASP A O   1 
ATOM   533  C CB  . ASP A 1 69  ? 17.668  55.463  49.455  1.00 48.79  ? 68   ASP A CB  1 
ATOM   534  C CG  . ASP A 1 69  ? 18.317  56.825  49.277  1.00 51.06  ? 68   ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 69  ? 18.557  57.512  50.293  1.00 53.69  ? 68   ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 69  ? 18.594  57.205  48.123  1.00 51.21  ? 68   ASP A OD2 1 
ATOM   537  N N   . VAL A 1 70  ? 16.167  57.135  51.575  1.00 46.13  ? 69   VAL A N   1 
ATOM   538  C CA  . VAL A 1 70  ? 15.049  57.983  51.980  1.00 47.55  ? 69   VAL A CA  1 
ATOM   539  C C   . VAL A 1 70  ? 15.015  59.130  50.989  1.00 50.55  ? 69   VAL A C   1 
ATOM   540  O O   . VAL A 1 70  ? 15.838  60.035  51.070  1.00 49.16  ? 69   VAL A O   1 
ATOM   541  C CB  . VAL A 1 70  ? 15.269  58.609  53.389  1.00 45.41  ? 69   VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 70  ? 14.181  59.633  53.680  1.00 43.62  ? 69   VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 70  ? 15.279  57.541  54.452  1.00 42.46  ? 69   VAL A CG2 1 
ATOM   544  N N   . ILE A 1 71  ? 14.095  59.090  50.036  1.00 55.58  ? 70   ILE A N   1 
ATOM   545  C CA  . ILE A 1 71  ? 14.008  60.177  49.073  1.00 60.80  ? 70   ILE A CA  1 
ATOM   546  C C   . ILE A 1 71  ? 13.081  61.220  49.671  1.00 64.53  ? 70   ILE A C   1 
ATOM   547  O O   . ILE A 1 71  ? 11.857  61.072  49.705  1.00 63.91  ? 70   ILE A O   1 
ATOM   548  C CB  . ILE A 1 71  ? 13.521  59.686  47.697  1.00 61.47  ? 70   ILE A CB  1 
ATOM   549  C CG1 . ILE A 1 71  ? 14.631  58.837  47.058  1.00 60.40  ? 70   ILE A CG1 1 
ATOM   550  C CG2 . ILE A 1 71  ? 13.165  60.876  46.811  1.00 60.06  ? 70   ILE A CG2 1 
ATOM   551  C CD1 . ILE A 1 71  ? 14.319  58.322  45.674  1.00 63.01  ? 70   ILE A CD1 1 
ATOM   552  N N   . HIS A 1 72  ? 13.726  62.270  50.161  1.00 69.63  ? 71   HIS A N   1 
ATOM   553  C CA  . HIS A 1 72  ? 13.103  63.386  50.854  1.00 75.24  ? 71   HIS A CA  1 
ATOM   554  C C   . HIS A 1 72  ? 12.735  64.568  49.960  1.00 77.82  ? 71   HIS A C   1 
ATOM   555  O O   . HIS A 1 72  ? 13.611  65.239  49.415  1.00 78.78  ? 71   HIS A O   1 
ATOM   556  C CB  . HIS A 1 72  ? 14.078  63.861  51.933  1.00 77.25  ? 71   HIS A CB  1 
ATOM   557  C CG  . HIS A 1 72  ? 13.440  64.628  53.044  1.00 80.00  ? 71   HIS A CG  1 
ATOM   558  N ND1 . HIS A 1 72  ? 14.169  65.412  53.911  1.00 81.35  ? 71   HIS A ND1 1 
ATOM   559  C CD2 . HIS A 1 72  ? 12.156  64.689  53.467  1.00 81.39  ? 71   HIS A CD2 1 
ATOM   560  C CE1 . HIS A 1 72  ? 13.361  65.922  54.824  1.00 82.15  ? 71   HIS A CE1 1 
ATOM   561  N NE2 . HIS A 1 72  ? 12.134  65.498  54.577  1.00 82.50  ? 71   HIS A NE2 1 
ATOM   562  N N   . THR A 1 73  ? 11.442  64.829  49.820  1.00 79.93  ? 72   THR A N   1 
ATOM   563  C CA  . THR A 1 73  ? 10.982  65.958  49.019  1.00 82.32  ? 72   THR A CA  1 
ATOM   564  C C   . THR A 1 73  ? 10.021  66.775  49.887  1.00 83.67  ? 72   THR A C   1 
ATOM   565  O O   . THR A 1 73  ? 9.470   66.261  50.860  1.00 84.27  ? 72   THR A O   1 
ATOM   566  C CB  . THR A 1 73  ? 10.273  65.484  47.712  1.00 81.52  ? 72   THR A CB  1 
ATOM   567  O OG1 . THR A 1 73  ? 11.192  64.721  46.920  1.00 79.86  ? 72   THR A OG1 1 
ATOM   568  C CG2 . THR A 1 73  ? 9.799   66.676  46.891  1.00 81.52  ? 72   THR A CG2 1 
ATOM   569  N N   . GLU A 1 74  ? 9.838   68.048  49.545  1.00 85.06  ? 73   GLU A N   1 
ATOM   570  C CA  . GLU A 1 74  ? 8.951   68.935  50.297  1.00 85.70  ? 73   GLU A CA  1 
ATOM   571  C C   . GLU A 1 74  ? 7.500   68.441  50.344  1.00 84.77  ? 73   GLU A C   1 
ATOM   572  O O   . GLU A 1 74  ? 6.833   68.555  51.378  1.00 84.85  ? 73   GLU A O   1 
ATOM   573  C CB  . GLU A 1 74  ? 8.982   70.335  49.682  1.00 87.70  ? 73   GLU A CB  1 
ATOM   574  C CG  . GLU A 1 74  ? 8.192   71.383  50.455  1.00 91.12  ? 73   GLU A CG  1 
ATOM   575  C CD  . GLU A 1 74  ? 8.019   72.671  49.665  1.00 93.33  ? 73   GLU A CD  1 
ATOM   576  O OE1 . GLU A 1 74  ? 7.198   72.691  48.718  1.00 93.89  ? 73   GLU A OE1 1 
ATOM   577  O OE2 . GLU A 1 74  ? 8.714   73.662  49.986  1.00 94.67  ? 73   GLU A OE2 1 
ATOM   578  N N   . ASN A 1 75  ? 7.027   67.892  49.223  1.00 83.06  ? 74   ASN A N   1 
ATOM   579  C CA  . ASN A 1 75  ? 5.654   67.391  49.088  1.00 81.13  ? 74   ASN A CA  1 
ATOM   580  C C   . ASN A 1 75  ? 5.439   66.025  49.733  1.00 78.61  ? 74   ASN A C   1 
ATOM   581  O O   . ASN A 1 75  ? 4.426   65.785  50.394  1.00 77.64  ? 74   ASN A O   1 
ATOM   582  C CB  . ASN A 1 75  ? 5.269   67.286  47.606  1.00 82.92  ? 74   ASN A CB  1 
ATOM   583  C CG  . ASN A 1 75  ? 6.062   68.234  46.721  1.00 84.04  ? 74   ASN A CG  1 
ATOM   584  O OD1 . ASN A 1 75  ? 7.274   68.070  46.540  1.00 83.69  ? 74   ASN A OD1 1 
ATOM   585  N ND2 . ASN A 1 75  ? 5.380   69.234  46.162  1.00 83.96  ? 74   ASN A ND2 1 
ATOM   586  N N   . LYS A 1 76  ? 6.376   65.114  49.502  1.00 75.68  ? 75   LYS A N   1 
ATOM   587  C CA  . LYS A 1 76  ? 6.275   63.783  50.080  1.00 73.26  ? 75   LYS A CA  1 
ATOM   588  C C   . LYS A 1 76  ? 7.635   63.178  50.405  1.00 69.47  ? 75   LYS A C   1 
ATOM   589  O O   . LYS A 1 76  ? 8.678   63.699  50.015  1.00 68.70  ? 75   LYS A O   1 
ATOM   590  C CB  . LYS A 1 76  ? 5.459   62.849  49.170  1.00 73.41  ? 75   LYS A CB  1 
ATOM   591  C CG  . LYS A 1 76  ? 5.802   62.892  47.685  1.00 75.16  ? 75   LYS A CG  1 
ATOM   592  C CD  . LYS A 1 76  ? 4.543   63.202  46.862  1.00 76.58  ? 75   LYS A CD  1 
ATOM   593  C CE  . LYS A 1 76  ? 4.432   62.346  45.602  1.00 77.40  ? 75   LYS A CE  1 
ATOM   594  N NZ  . LYS A 1 76  ? 5.546   62.579  44.638  1.00 78.66  ? 75   LYS A NZ  1 
ATOM   595  N N   . LEU A 1 77  ? 7.606   62.075  51.139  1.00 65.49  ? 76   LEU A N   1 
ATOM   596  C CA  . LEU A 1 77  ? 8.817   61.400  51.567  1.00 62.23  ? 76   LEU A CA  1 
ATOM   597  C C   . LEU A 1 77  ? 8.757   59.919  51.178  1.00 59.38  ? 76   LEU A C   1 
ATOM   598  O O   . LEU A 1 77  ? 7.854   59.184  51.587  1.00 57.18  ? 76   LEU A O   1 
ATOM   599  C CB  . LEU A 1 77  ? 8.948   61.608  53.080  1.00 62.37  ? 76   LEU A CB  1 
ATOM   600  C CG  . LEU A 1 77  ? 9.973   60.939  53.981  1.00 60.95  ? 76   LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 77  ? 10.646  61.978  54.847  1.00 61.47  ? 76   LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 77  ? 9.258   59.921  54.847  1.00 62.11  ? 76   LEU A CD2 1 
ATOM   603  N N   . TYR A 1 78  ? 9.726   59.505  50.367  1.00 56.45  ? 77   TYR A N   1 
ATOM   604  C CA  . TYR A 1 78  ? 9.812   58.132  49.867  1.00 54.28  ? 77   TYR A CA  1 
ATOM   605  C C   . TYR A 1 78  ? 10.840  57.268  50.583  1.00 50.77  ? 77   TYR A C   1 
ATOM   606  O O   . TYR A 1 78  ? 12.019  57.621  50.647  1.00 49.72  ? 77   TYR A O   1 
ATOM   607  C CB  . TYR A 1 78  ? 10.181  58.145  48.382  1.00 56.34  ? 77   TYR A CB  1 
ATOM   608  C CG  . TYR A 1 78  ? 9.058   58.468  47.436  1.00 57.99  ? 77   TYR A CG  1 
ATOM   609  C CD1 . TYR A 1 78  ? 8.128   57.494  47.079  1.00 60.16  ? 77   TYR A CD1 1 
ATOM   610  C CD2 . TYR A 1 78  ? 8.953   59.728  46.855  1.00 58.95  ? 77   TYR A CD2 1 
ATOM   611  C CE1 . TYR A 1 78  ? 7.120   57.760  46.157  1.00 62.35  ? 77   TYR A CE1 1 
ATOM   612  C CE2 . TYR A 1 78  ? 7.949   60.012  45.932  1.00 62.20  ? 77   TYR A CE2 1 
ATOM   613  C CZ  . TYR A 1 78  ? 7.033   59.020  45.584  1.00 63.45  ? 77   TYR A CZ  1 
ATOM   614  O OH  . TYR A 1 78  ? 6.034   59.277  44.664  1.00 64.14  ? 77   TYR A OH  1 
ATOM   615  N N   . LEU A 1 79  ? 10.407  56.127  51.105  1.00 47.30  ? 78   LEU A N   1 
ATOM   616  C CA  . LEU A 1 79  ? 11.353  55.234  51.762  1.00 44.85  ? 78   LEU A CA  1 
ATOM   617  C C   . LEU A 1 79  ? 11.664  54.094  50.791  1.00 43.71  ? 78   LEU A C   1 
ATOM   618  O O   . LEU A 1 79  ? 10.756  53.407  50.324  1.00 43.52  ? 78   LEU A O   1 
ATOM   619  C CB  . LEU A 1 79  ? 10.779  54.654  53.065  1.00 42.28  ? 78   LEU A CB  1 
ATOM   620  C CG  . LEU A 1 79  ? 10.141  55.540  54.137  1.00 40.20  ? 78   LEU A CG  1 
ATOM   621  C CD1 . LEU A 1 79  ? 10.513  54.955  55.465  1.00 37.84  ? 78   LEU A CD1 1 
ATOM   622  C CD2 . LEU A 1 79  ? 10.602  56.977  54.059  1.00 38.43  ? 78   LEU A CD2 1 
ATOM   623  N N   . VAL A 1 80  ? 12.943  53.903  50.479  1.00 42.23  ? 79   VAL A N   1 
ATOM   624  C CA  . VAL A 1 80  ? 13.349  52.833  49.574  1.00 41.33  ? 79   VAL A CA  1 
ATOM   625  C C   . VAL A 1 80  ? 13.878  51.641  50.380  1.00 39.46  ? 79   VAL A C   1 
ATOM   626  O O   . VAL A 1 80  ? 14.862  51.761  51.110  1.00 37.22  ? 79   VAL A O   1 
ATOM   627  C CB  . VAL A 1 80  ? 14.436  53.313  48.588  1.00 42.38  ? 79   VAL A CB  1 
ATOM   628  C CG1 . VAL A 1 80  ? 14.706  52.234  47.555  1.00 42.05  ? 79   VAL A CG1 1 
ATOM   629  C CG2 . VAL A 1 80  ? 13.988  54.600  47.904  1.00 40.23  ? 79   VAL A CG2 1 
ATOM   630  N N   . PHE A 1 81  ? 13.207  50.499  50.229  1.00 39.45  ? 80   PHE A N   1 
ATOM   631  C CA  . PHE A 1 81  ? 13.540  49.259  50.936  1.00 37.69  ? 80   PHE A CA  1 
ATOM   632  C C   . PHE A 1 81  ? 13.926  48.098  50.024  1.00 36.63  ? 80   PHE A C   1 
ATOM   633  O O   . PHE A 1 81  ? 13.614  48.086  48.831  1.00 36.67  ? 80   PHE A O   1 
ATOM   634  C CB  . PHE A 1 81  ? 12.337  48.757  51.743  1.00 38.32  ? 80   PHE A CB  1 
ATOM   635  C CG  . PHE A 1 81  ? 11.998  49.576  52.944  1.00 38.30  ? 80   PHE A CG  1 
ATOM   636  C CD1 . PHE A 1 81  ? 11.007  50.545  52.881  1.00 35.92  ? 80   PHE A CD1 1 
ATOM   637  C CD2 . PHE A 1 81  ? 12.618  49.323  54.166  1.00 38.90  ? 80   PHE A CD2 1 
ATOM   638  C CE1 . PHE A 1 81  ? 10.631  51.246  54.017  1.00 37.37  ? 80   PHE A CE1 1 
ATOM   639  C CE2 . PHE A 1 81  ? 12.246  50.020  55.310  1.00 38.59  ? 80   PHE A CE2 1 
ATOM   640  C CZ  . PHE A 1 81  ? 11.248  50.984  55.234  1.00 36.90  ? 80   PHE A CZ  1 
ATOM   641  N N   . GLU A 1 82  ? 14.559  47.091  50.616  1.00 34.97  ? 81   GLU A N   1 
ATOM   642  C CA  . GLU A 1 82  ? 14.918  45.899  49.869  1.00 34.73  ? 81   GLU A CA  1 
ATOM   643  C C   . GLU A 1 82  ? 13.595  45.204  49.548  1.00 34.18  ? 81   GLU A C   1 
ATOM   644  O O   . GLU A 1 82  ? 12.621  45.343  50.288  1.00 33.15  ? 81   GLU A O   1 
ATOM   645  C CB  . GLU A 1 82  ? 15.797  44.987  50.708  1.00 35.13  ? 81   GLU A CB  1 
ATOM   646  C CG  . GLU A 1 82  ? 15.127  44.361  51.905  1.00 37.37  ? 81   GLU A CG  1 
ATOM   647  C CD  . GLU A 1 82  ? 16.066  43.404  52.622  1.00 38.60  ? 81   GLU A CD  1 
ATOM   648  O OE1 . GLU A 1 82  ? 16.801  42.685  51.922  1.00 36.84  ? 81   GLU A OE1 1 
ATOM   649  O OE2 . GLU A 1 82  ? 16.069  43.360  53.870  1.00 42.20  ? 81   GLU A OE2 1 
ATOM   650  N N   . PHE A 1 83  ? 13.549  44.455  48.453  1.00 32.65  ? 82   PHE A N   1 
ATOM   651  C CA  . PHE A 1 83  ? 12.312  43.807  48.078  1.00 31.34  ? 82   PHE A CA  1 
ATOM   652  C C   . PHE A 1 83  ? 12.188  42.355  48.509  1.00 33.19  ? 82   PHE A C   1 
ATOM   653  O O   . PHE A 1 83  ? 13.159  41.614  48.499  1.00 31.46  ? 82   PHE A O   1 
ATOM   654  C CB  . PHE A 1 83  ? 12.116  43.895  46.558  1.00 31.57  ? 82   PHE A CB  1 
ATOM   655  C CG  . PHE A 1 83  ? 10.885  43.167  46.065  1.00 32.13  ? 82   PHE A CG  1 
ATOM   656  C CD1 . PHE A 1 83  ? 9.627   43.760  46.147  1.00 30.08  ? 82   PHE A CD1 1 
ATOM   657  C CD2 . PHE A 1 83  ? 10.977  41.853  45.590  1.00 29.24  ? 82   PHE A CD2 1 
ATOM   658  C CE1 . PHE A 1 83  ? 8.477   43.052  45.767  1.00 29.86  ? 82   PHE A CE1 1 
ATOM   659  C CE2 . PHE A 1 83  ? 9.838   41.148  45.213  1.00 28.14  ? 82   PHE A CE2 1 
ATOM   660  C CZ  . PHE A 1 83  ? 8.587   41.750  45.303  1.00 25.94  ? 82   PHE A CZ  1 
ATOM   661  N N   . LEU A 1 84  ? 10.983  41.962  48.908  1.00 34.88  ? 83   LEU A N   1 
ATOM   662  C CA  . LEU A 1 84  ? 10.729  40.577  49.271  1.00 39.12  ? 83   LEU A CA  1 
ATOM   663  C C   . LEU A 1 84  ? 9.434   40.124  48.621  1.00 41.89  ? 83   LEU A C   1 
ATOM   664  O O   . LEU A 1 84  ? 8.457   40.863  48.542  1.00 43.14  ? 83   LEU A O   1 
ATOM   665  C CB  . LEU A 1 84  ? 10.687  40.365  50.787  1.00 37.57  ? 83   LEU A CB  1 
ATOM   666  C CG  . LEU A 1 84  ? 12.097  40.177  51.365  1.00 37.68  ? 83   LEU A CG  1 
ATOM   667  C CD1 . LEU A 1 84  ? 12.687  41.545  51.656  1.00 35.45  ? 83   LEU A CD1 1 
ATOM   668  C CD2 . LEU A 1 84  ? 12.064  39.336  52.640  1.00 37.19  ? 83   LEU A CD2 1 
ATOM   669  N N   . HIS A 1 85  ? 9.458   38.889  48.147  1.00 44.97  ? 84   HIS A N   1 
ATOM   670  C CA  . HIS A 1 85  ? 8.353   38.273  47.441  1.00 48.47  ? 84   HIS A CA  1 
ATOM   671  C C   . HIS A 1 85  ? 6.989   38.171  48.116  1.00 48.88  ? 84   HIS A C   1 
ATOM   672  O O   . HIS A 1 85  ? 5.959   38.226  47.438  1.00 49.67  ? 84   HIS A O   1 
ATOM   673  C CB  . HIS A 1 85  ? 8.805   36.883  46.995  1.00 51.46  ? 84   HIS A CB  1 
ATOM   674  C CG  . HIS A 1 85  ? 10.101  36.898  46.246  1.00 55.35  ? 84   HIS A CG  1 
ATOM   675  N ND1 . HIS A 1 85  ? 10.193  37.297  44.929  1.00 56.01  ? 84   HIS A ND1 1 
ATOM   676  C CD2 . HIS A 1 85  ? 11.365  36.627  46.647  1.00 54.34  ? 84   HIS A CD2 1 
ATOM   677  C CE1 . HIS A 1 85  ? 11.458  37.272  44.552  1.00 56.22  ? 84   HIS A CE1 1 
ATOM   678  N NE2 . HIS A 1 85  ? 12.190  36.869  45.576  1.00 56.63  ? 84   HIS A NE2 1 
ATOM   679  N N   . GLN A 1 86  ? 6.957   38.045  49.434  1.00 48.23  ? 85   GLN A N   1 
ATOM   680  C CA  . GLN A 1 86  ? 5.672   37.867  50.098  1.00 47.11  ? 85   GLN A CA  1 
ATOM   681  C C   . GLN A 1 86  ? 5.764   38.119  51.596  1.00 45.33  ? 85   GLN A C   1 
ATOM   682  O O   . GLN A 1 86  ? 6.849   38.374  52.125  1.00 45.79  ? 85   GLN A O   1 
ATOM   683  C CB  . GLN A 1 86  ? 5.230   36.423  49.847  1.00 50.06  ? 85   GLN A CB  1 
ATOM   684  C CG  . GLN A 1 86  ? 3.941   35.992  50.487  1.00 55.33  ? 85   GLN A CG  1 
ATOM   685  C CD  . GLN A 1 86  ? 2.740   36.350  49.649  1.00 58.77  ? 85   GLN A CD  1 
ATOM   686  O OE1 . GLN A 1 86  ? 1.659   35.810  49.853  1.00 61.80  ? 85   GLN A OE1 1 
ATOM   687  N NE2 . GLN A 1 86  ? 2.920   37.263  48.693  1.00 60.66  ? 85   GLN A NE2 1 
ATOM   688  N N   . ASP A 1 87  ? 4.621   38.052  52.273  1.00 43.01  ? 86   ASP A N   1 
ATOM   689  C CA  . ASP A 1 87  ? 4.584   38.214  53.722  1.00 42.16  ? 86   ASP A CA  1 
ATOM   690  C C   . ASP A 1 87  ? 4.018   36.923  54.341  1.00 41.47  ? 86   ASP A C   1 
ATOM   691  O O   . ASP A 1 87  ? 3.337   36.150  53.668  1.00 38.26  ? 86   ASP A O   1 
ATOM   692  C CB  . ASP A 1 87  ? 3.760   39.445  54.130  1.00 41.83  ? 86   ASP A CB  1 
ATOM   693  C CG  . ASP A 1 87  ? 2.263   39.207  54.078  1.00 42.78  ? 86   ASP A CG  1 
ATOM   694  O OD1 . ASP A 1 87  ? 1.770   38.343  54.822  1.00 45.37  ? 86   ASP A OD1 1 
ATOM   695  O OD2 . ASP A 1 87  ? 1.574   39.893  53.303  1.00 41.83  ? 86   ASP A OD2 1 
ATOM   696  N N   . LEU A 1 88  ? 4.306   36.702  55.623  1.00 41.90  ? 87   LEU A N   1 
ATOM   697  C CA  . LEU A 1 88  ? 3.887   35.491  56.324  1.00 43.47  ? 87   LEU A CA  1 
ATOM   698  C C   . LEU A 1 88  ? 2.396   35.115  56.362  1.00 46.18  ? 87   LEU A C   1 
ATOM   699  O O   . LEU A 1 88  ? 2.082   33.925  56.320  1.00 46.56  ? 87   LEU A O   1 
ATOM   700  C CB  . LEU A 1 88  ? 4.445   35.505  57.753  1.00 39.70  ? 87   LEU A CB  1 
ATOM   701  C CG  . LEU A 1 88  ? 4.435   34.169  58.501  1.00 39.46  ? 87   LEU A CG  1 
ATOM   702  C CD1 . LEU A 1 88  ? 5.190   33.118  57.697  1.00 38.00  ? 87   LEU A CD1 1 
ATOM   703  C CD2 . LEU A 1 88  ? 5.063   34.342  59.881  1.00 38.12  ? 87   LEU A CD2 1 
ATOM   704  N N   . LYS A 1 89  ? 1.482   36.085  56.450  1.00 48.56  ? 88   LYS A N   1 
ATOM   705  C CA  . LYS A 1 89  ? 0.050   35.763  56.491  1.00 51.42  ? 88   LYS A CA  1 
ATOM   706  C C   . LYS A 1 89  ? -0.362  35.093  55.214  1.00 53.63  ? 88   LYS A C   1 
ATOM   707  O O   . LYS A 1 89  ? -0.919  33.986  55.195  1.00 53.35  ? 88   LYS A O   1 
ATOM   708  C CB  . LYS A 1 89  ? -0.817  37.004  56.623  1.00 51.74  ? 88   LYS A CB  1 
ATOM   709  C CG  . LYS A 1 89  ? -2.141  36.674  57.284  1.00 56.98  ? 88   LYS A CG  1 
ATOM   710  C CD  . LYS A 1 89  ? -3.248  37.675  56.992  1.00 62.25  ? 88   LYS A CD  1 
ATOM   711  C CE  . LYS A 1 89  ? -4.143  37.934  58.215  1.00 65.21  ? 88   LYS A CE  1 
ATOM   712  N NZ  . LYS A 1 89  ? -4.981  39.140  57.921  1.00 67.11  ? 88   LYS A NZ  1 
ATOM   713  N N   . LYS A 1 90  ? -0.114  35.835  54.147  1.00 55.31  ? 89   LYS A N   1 
ATOM   714  C CA  . LYS A 1 90  ? -0.407  35.397  52.813  1.00 59.29  ? 89   LYS A CA  1 
ATOM   715  C C   . LYS A 1 90  ? 0.132   33.990  52.642  1.00 59.82  ? 89   LYS A C   1 
ATOM   716  O O   . LYS A 1 90  ? -0.625  33.073  52.336  1.00 61.91  ? 89   LYS A O   1 
ATOM   717  C CB  . LYS A 1 90  ? 0.249   36.354  51.835  1.00 61.96  ? 89   LYS A CB  1 
ATOM   718  C CG  . LYS A 1 90  ? -0.522  37.632  51.587  1.00 64.16  ? 89   LYS A CG  1 
ATOM   719  C CD  . LYS A 1 90  ? 0.387   38.662  50.929  1.00 67.63  ? 89   LYS A CD  1 
ATOM   720  C CE  . LYS A 1 90  ? -0.226  39.270  49.670  1.00 69.57  ? 89   LYS A CE  1 
ATOM   721  N NZ  . LYS A 1 90  ? -0.219  38.326  48.504  1.00 70.48  ? 89   LYS A NZ  1 
ATOM   722  N N   . PHE A 1 91  ? 1.432   33.816  52.869  1.00 60.50  ? 90   PHE A N   1 
ATOM   723  C CA  . PHE A 1 91  ? 2.071   32.507  52.734  1.00 60.96  ? 90   PHE A CA  1 
ATOM   724  C C   . PHE A 1 91  ? 1.403   31.443  53.583  1.00 62.97  ? 90   PHE A C   1 
ATOM   725  O O   . PHE A 1 91  ? 1.291   30.289  53.168  1.00 63.70  ? 90   PHE A O   1 
ATOM   726  C CB  . PHE A 1 91  ? 3.545   32.579  53.122  1.00 58.44  ? 90   PHE A CB  1 
ATOM   727  C CG  . PHE A 1 91  ? 4.240   31.246  53.096  1.00 54.75  ? 90   PHE A CG  1 
ATOM   728  C CD1 . PHE A 1 91  ? 4.536   30.622  51.893  1.00 53.07  ? 90   PHE A CD1 1 
ATOM   729  C CD2 . PHE A 1 91  ? 4.588   30.611  54.281  1.00 54.56  ? 90   PHE A CD2 1 
ATOM   730  C CE1 . PHE A 1 91  ? 5.171   29.383  51.868  1.00 52.05  ? 90   PHE A CE1 1 
ATOM   731  C CE2 . PHE A 1 91  ? 5.221   29.373  54.271  1.00 54.71  ? 90   PHE A CE2 1 
ATOM   732  C CZ  . PHE A 1 91  ? 5.514   28.757  53.058  1.00 53.77  ? 90   PHE A CZ  1 
ATOM   733  N N   . MET A 1 92  ? 0.987   31.822  54.786  1.00 65.61  ? 91   MET A N   1 
ATOM   734  C CA  . MET A 1 92  ? 0.315   30.886  55.673  1.00 68.16  ? 91   MET A CA  1 
ATOM   735  C C   . MET A 1 92  ? -0.996  30.438  55.029  1.00 69.98  ? 91   MET A C   1 
ATOM   736  O O   . MET A 1 92  ? -1.342  29.260  55.082  1.00 71.25  ? 91   MET A O   1 
ATOM   737  C CB  . MET A 1 92  ? 0.067   31.534  57.039  1.00 67.76  ? 91   MET A CB  1 
ATOM   738  C CG  . MET A 1 92  ? 1.111   31.148  58.079  1.00 68.52  ? 91   MET A CG  1 
ATOM   739  S SD  . MET A 1 92  ? 1.221   32.269  59.492  1.00 71.34  ? 91   MET A SD  1 
ATOM   740  C CE  . MET A 1 92  ? -0.199  31.795  60.453  1.00 69.90  ? 91   MET A CE  1 
ATOM   741  N N   . ASP A 1 93  ? -1.710  31.370  54.402  1.00 71.53  ? 92   ASP A N   1 
ATOM   742  C CA  . ASP A 1 93  ? -2.969  31.043  53.741  1.00 73.00  ? 92   ASP A CA  1 
ATOM   743  C C   . ASP A 1 93  ? -2.728  30.074  52.589  1.00 73.62  ? 92   ASP A C   1 
ATOM   744  O O   . ASP A 1 93  ? -3.428  29.073  52.448  1.00 74.81  ? 92   ASP A O   1 
ATOM   745  C CB  . ASP A 1 93  ? -3.647  32.299  53.183  1.00 74.42  ? 92   ASP A CB  1 
ATOM   746  C CG  . ASP A 1 93  ? -3.945  33.337  54.250  1.00 75.47  ? 92   ASP A CG  1 
ATOM   747  O OD1 . ASP A 1 93  ? -4.227  32.944  55.404  1.00 76.01  ? 92   ASP A OD1 1 
ATOM   748  O OD2 . ASP A 1 93  ? -3.912  34.548  53.924  1.00 75.61  ? 92   ASP A OD2 1 
ATOM   749  N N   . ALA A 1 94  ? -1.737  30.381  51.760  1.00 73.92  ? 93   ALA A N   1 
ATOM   750  C CA  . ALA A 1 94  ? -1.411  29.541  50.611  1.00 74.36  ? 93   ALA A CA  1 
ATOM   751  C C   . ALA A 1 94  ? -1.038  28.125  51.029  1.00 75.13  ? 93   ALA A C   1 
ATOM   752  O O   . ALA A 1 94  ? -0.935  27.230  50.190  1.00 75.09  ? 93   ALA A O   1 
ATOM   753  C CB  . ALA A 1 94  ? -0.272  30.163  49.820  1.00 74.38  ? 93   ALA A CB  1 
ATOM   754  N N   . SER A 1 95  ? -0.828  27.934  52.329  1.00 76.23  ? 94   SER A N   1 
ATOM   755  C CA  . SER A 1 95  ? -0.471  26.626  52.878  1.00 76.84  ? 94   SER A CA  1 
ATOM   756  C C   . SER A 1 95  ? -1.616  26.066  53.719  1.00 77.87  ? 94   SER A C   1 
ATOM   757  O O   . SER A 1 95  ? -1.613  24.888  54.083  1.00 77.11  ? 94   SER A O   1 
ATOM   758  C CB  . SER A 1 95  ? 0.783   26.738  53.749  1.00 74.99  ? 94   SER A CB  1 
ATOM   759  O OG  . SER A 1 95  ? 1.903   27.121  52.981  1.00 72.83  ? 94   SER A OG  1 
ATOM   760  N N   . ALA A 1 96  ? -2.591  26.927  54.008  1.00 79.63  ? 95   ALA A N   1 
ATOM   761  C CA  . ALA A 1 96  ? -3.762  26.584  54.820  1.00 81.05  ? 95   ALA A CA  1 
ATOM   762  C C   . ALA A 1 96  ? -4.262  25.153  54.662  1.00 81.59  ? 95   ALA A C   1 
ATOM   763  O O   . ALA A 1 96  ? -4.775  24.568  55.613  1.00 82.92  ? 95   ALA A O   1 
ATOM   764  C CB  . ALA A 1 96  ? -4.902  27.560  54.532  1.00 80.46  ? 95   ALA A CB  1 
ATOM   765  N N   . LEU A 1 97  ? -4.119  24.588  53.469  1.00 81.52  ? 96   LEU A N   1 
ATOM   766  C CA  . LEU A 1 97  ? -4.579  23.227  53.240  1.00 81.66  ? 96   LEU A CA  1 
ATOM   767  C C   . LEU A 1 97  ? -3.493  22.170  53.435  1.00 81.19  ? 96   LEU A C   1 
ATOM   768  O O   . LEU A 1 97  ? -3.783  21.052  53.866  1.00 81.75  ? 96   LEU A O   1 
ATOM   769  C CB  . LEU A 1 97  ? -5.183  23.099  51.832  1.00 82.19  ? 96   LEU A CB  1 
ATOM   770  C CG  . LEU A 1 97  ? -6.701  22.880  51.736  1.00 81.94  ? 96   LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 97  ? -7.080  21.538  52.373  1.00 79.77  ? 96   LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 97  ? -7.432  24.037  52.425  1.00 81.79  ? 96   LEU A CD2 1 
ATOM   773  N N   . THR A 1 98  ? -2.244  22.516  53.136  1.00 80.64  ? 97   THR A N   1 
ATOM   774  C CA  . THR A 1 98  ? -1.158  21.546  53.271  1.00 79.95  ? 97   THR A CA  1 
ATOM   775  C C   . THR A 1 98  ? -0.294  21.626  54.521  1.00 77.82  ? 97   THR A C   1 
ATOM   776  O O   . THR A 1 98  ? 0.318   20.633  54.916  1.00 77.37  ? 97   THR A O   1 
ATOM   777  C CB  . THR A 1 98  ? -0.236  21.581  52.043  1.00 80.95  ? 97   THR A CB  1 
ATOM   778  O OG1 . THR A 1 98  ? -0.403  20.359  51.317  1.00 82.58  ? 97   THR A OG1 1 
ATOM   779  C CG2 . THR A 1 98  ? 1.237   21.744  52.455  1.00 81.93  ? 97   THR A CG2 1 
ATOM   780  N N   . GLY A 1 99  ? -0.230  22.803  55.129  1.00 76.04  ? 98   GLY A N   1 
ATOM   781  C CA  . GLY A 1 99  ? 0.566   22.961  56.333  1.00 72.72  ? 98   GLY A CA  1 
ATOM   782  C C   . GLY A 1 99  ? 1.993   23.405  56.070  1.00 69.86  ? 98   GLY A C   1 
ATOM   783  O O   . GLY A 1 99  ? 2.523   23.240  54.963  1.00 70.07  ? 98   GLY A O   1 
ATOM   784  N N   . ILE A 1 100 ? 2.611   23.977  57.099  1.00 65.53  ? 99   ILE A N   1 
ATOM   785  C CA  . ILE A 1 100 ? 3.983   24.450  57.010  1.00 61.88  ? 99   ILE A CA  1 
ATOM   786  C C   . ILE A 1 100 ? 4.904   23.406  57.633  1.00 59.60  ? 99   ILE A C   1 
ATOM   787  O O   . ILE A 1 100 ? 4.753   23.059  58.801  1.00 60.49  ? 99   ILE A O   1 
ATOM   788  C CB  . ILE A 1 100 ? 4.148   25.793  57.766  1.00 61.78  ? 99   ILE A CB  1 
ATOM   789  C CG1 . ILE A 1 100 ? 3.170   26.823  57.203  1.00 61.52  ? 99   ILE A CG1 1 
ATOM   790  C CG2 . ILE A 1 100 ? 5.572   26.305  57.636  1.00 59.77  ? 99   ILE A CG2 1 
ATOM   791  C CD1 . ILE A 1 100 ? 3.094   28.087  58.006  1.00 62.70  ? 99   ILE A CD1 1 
ATOM   792  N N   . PRO A 1 101 ? 5.861   22.881  56.852  1.00 57.55  ? 100  PRO A N   1 
ATOM   793  C CA  . PRO A 1 101 ? 6.827   21.870  57.301  1.00 56.52  ? 100  PRO A CA  1 
ATOM   794  C C   . PRO A 1 101 ? 7.682   22.374  58.459  1.00 56.68  ? 100  PRO A C   1 
ATOM   795  O O   . PRO A 1 101 ? 8.199   23.488  58.400  1.00 57.61  ? 100  PRO A O   1 
ATOM   796  C CB  . PRO A 1 101 ? 7.665   21.627  56.049  1.00 55.85  ? 100  PRO A CB  1 
ATOM   797  C CG  . PRO A 1 101 ? 6.702   21.875  54.948  1.00 53.42  ? 100  PRO A CG  1 
ATOM   798  C CD  . PRO A 1 101 ? 5.998   23.120  55.406  1.00 55.22  ? 100  PRO A CD  1 
ATOM   799  N N   . LEU A 1 102 ? 7.847   21.559  59.500  1.00 56.97  ? 101  LEU A N   1 
ATOM   800  C CA  . LEU A 1 102 ? 8.654   21.963  60.658  1.00 55.67  ? 101  LEU A CA  1 
ATOM   801  C C   . LEU A 1 102 ? 9.984   22.560  60.251  1.00 54.08  ? 101  LEU A C   1 
ATOM   802  O O   . LEU A 1 102 ? 10.463  23.505  60.876  1.00 52.75  ? 101  LEU A O   1 
ATOM   803  C CB  . LEU A 1 102 ? 8.946   20.788  61.588  1.00 55.89  ? 101  LEU A CB  1 
ATOM   804  C CG  . LEU A 1 102 ? 8.024   20.612  62.783  1.00 57.88  ? 101  LEU A CG  1 
ATOM   805  C CD1 . LEU A 1 102 ? 6.945   19.583  62.436  1.00 59.69  ? 101  LEU A CD1 1 
ATOM   806  C CD2 . LEU A 1 102 ? 8.843   20.149  63.986  1.00 58.40  ? 101  LEU A CD2 1 
ATOM   807  N N   . PRO A 1 103 ? 10.621  22.001  59.213  1.00 52.84  ? 102  PRO A N   1 
ATOM   808  C CA  . PRO A 1 103 ? 11.900  22.612  58.858  1.00 52.02  ? 102  PRO A CA  1 
ATOM   809  C C   . PRO A 1 103 ? 11.709  24.116  58.675  1.00 50.04  ? 102  PRO A C   1 
ATOM   810  O O   . PRO A 1 103 ? 12.396  24.918  59.308  1.00 49.89  ? 102  PRO A O   1 
ATOM   811  C CB  . PRO A 1 103 ? 12.277  21.887  57.564  1.00 52.28  ? 102  PRO A CB  1 
ATOM   812  C CG  . PRO A 1 103 ? 11.715  20.519  57.788  1.00 50.76  ? 102  PRO A CG  1 
ATOM   813  C CD  . PRO A 1 103 ? 10.340  20.834  58.358  1.00 51.23  ? 102  PRO A CD  1 
ATOM   814  N N   . LEU A 1 104 ? 10.740  24.491  57.847  1.00 47.67  ? 103  LEU A N   1 
ATOM   815  C CA  . LEU A 1 104 ? 10.491  25.898  57.595  1.00 45.82  ? 103  LEU A CA  1 
ATOM   816  C C   . LEU A 1 104 ? 10.051  26.622  58.860  1.00 42.68  ? 103  LEU A C   1 
ATOM   817  O O   . LEU A 1 104 ? 10.574  27.680  59.179  1.00 43.16  ? 103  LEU A O   1 
ATOM   818  C CB  . LEU A 1 104 ? 9.459   26.063  56.483  1.00 47.57  ? 103  LEU A CB  1 
ATOM   819  C CG  . LEU A 1 104 ? 9.559   27.401  55.738  1.00 47.98  ? 103  LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 104 ? 10.990  27.632  55.287  1.00 45.76  ? 103  LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 104 ? 8.611   27.396  54.539  1.00 48.64  ? 103  LEU A CD2 1 
ATOM   822  N N   . ILE A 1 105 ? 9.099   26.053  59.585  1.00 40.41  ? 104  ILE A N   1 
ATOM   823  C CA  . ILE A 1 105 ? 8.636   26.665  60.829  1.00 40.55  ? 104  ILE A CA  1 
ATOM   824  C C   . ILE A 1 105 ? 9.819   26.930  61.759  1.00 41.19  ? 104  ILE A C   1 
ATOM   825  O O   . ILE A 1 105 ? 9.932   28.005  62.358  1.00 40.98  ? 104  ILE A O   1 
ATOM   826  C CB  . ILE A 1 105 ? 7.636   25.750  61.574  1.00 37.92  ? 104  ILE A CB  1 
ATOM   827  C CG1 . ILE A 1 105 ? 6.324   25.670  60.794  1.00 37.85  ? 104  ILE A CG1 1 
ATOM   828  C CG2 . ILE A 1 105 ? 7.394   26.267  62.989  1.00 38.29  ? 104  ILE A CG2 1 
ATOM   829  C CD1 . ILE A 1 105 ? 5.275   24.741  61.420  1.00 36.17  ? 104  ILE A CD1 1 
ATOM   830  N N   . LYS A 1 106 ? 10.702  25.943  61.866  1.00 42.17  ? 105  LYS A N   1 
ATOM   831  C CA  . LYS A 1 106 ? 11.870  26.049  62.734  1.00 42.69  ? 105  LYS A CA  1 
ATOM   832  C C   . LYS A 1 106 ? 12.814  27.136  62.234  1.00 40.80  ? 105  LYS A C   1 
ATOM   833  O O   . LYS A 1 106 ? 13.230  28.010  62.992  1.00 40.17  ? 105  LYS A O   1 
ATOM   834  C CB  . LYS A 1 106 ? 12.597  24.698  62.807  1.00 43.15  ? 105  LYS A CB  1 
ATOM   835  C CG  . LYS A 1 106 ? 13.479  24.553  64.032  1.00 44.61  ? 105  LYS A CG  1 
ATOM   836  C CD  . LYS A 1 106 ? 14.031  23.147  64.197  1.00 45.47  ? 105  LYS A CD  1 
ATOM   837  C CE  . LYS A 1 106 ? 12.942  22.141  64.522  1.00 46.07  ? 105  LYS A CE  1 
ATOM   838  N NZ  . LYS A 1 106 ? 13.542  20.846  64.977  1.00 47.69  ? 105  LYS A NZ  1 
ATOM   839  N N   . SER A 1 107 ? 13.132  27.082  60.946  1.00 39.63  ? 106  SER A N   1 
ATOM   840  C CA  . SER A 1 107 ? 14.016  28.061  60.330  1.00 37.12  ? 106  SER A CA  1 
ATOM   841  C C   . SER A 1 107 ? 13.482  29.486  60.497  1.00 36.33  ? 106  SER A C   1 
ATOM   842  O O   . SER A 1 107 ? 14.224  30.383  60.896  1.00 37.28  ? 106  SER A O   1 
ATOM   843  C CB  . SER A 1 107 ? 14.188  27.738  58.838  1.00 38.07  ? 106  SER A CB  1 
ATOM   844  O OG  . SER A 1 107 ? 14.968  28.721  58.168  1.00 38.37  ? 106  SER A OG  1 
ATOM   845  N N   . TYR A 1 108 ? 12.199  29.696  60.198  1.00 34.10  ? 107  TYR A N   1 
ATOM   846  C CA  . TYR A 1 108 ? 11.612  31.023  60.315  1.00 31.95  ? 107  TYR A CA  1 
ATOM   847  C C   . TYR A 1 108 ? 11.670  31.549  61.730  1.00 32.82  ? 107  TYR A C   1 
ATOM   848  O O   . TYR A 1 108 ? 12.087  32.686  61.957  1.00 33.23  ? 107  TYR A O   1 
ATOM   849  C CB  . TYR A 1 108 ? 10.174  31.026  59.820  1.00 31.65  ? 107  TYR A CB  1 
ATOM   850  C CG  . TYR A 1 108 ? 10.053  31.012  58.310  1.00 31.45  ? 107  TYR A CG  1 
ATOM   851  C CD1 . TYR A 1 108 ? 11.160  31.268  57.490  1.00 28.92  ? 107  TYR A CD1 1 
ATOM   852  C CD2 . TYR A 1 108 ? 8.823   30.782  57.700  1.00 30.80  ? 107  TYR A CD2 1 
ATOM   853  C CE1 . TYR A 1 108 ? 11.032  31.299  56.110  1.00 29.08  ? 107  TYR A CE1 1 
ATOM   854  C CE2 . TYR A 1 108 ? 8.688   30.810  56.318  1.00 29.41  ? 107  TYR A CE2 1 
ATOM   855  C CZ  . TYR A 1 108 ? 9.787   31.070  55.536  1.00 31.19  ? 107  TYR A CZ  1 
ATOM   856  O OH  . TYR A 1 108 ? 9.622   31.132  54.177  1.00 35.23  ? 107  TYR A OH  1 
ATOM   857  N N   . LEU A 1 109 ? 11.262  30.722  62.685  1.00 32.40  ? 108  LEU A N   1 
ATOM   858  C CA  . LEU A 1 109 ? 11.304  31.124  64.086  1.00 31.87  ? 108  LEU A CA  1 
ATOM   859  C C   . LEU A 1 109 ? 12.745  31.459  64.498  1.00 32.14  ? 108  LEU A C   1 
ATOM   860  O O   . LEU A 1 109 ? 13.007  32.482  65.146  1.00 34.10  ? 108  LEU A O   1 
ATOM   861  C CB  . LEU A 1 109 ? 10.771  30.006  64.972  1.00 29.81  ? 108  LEU A CB  1 
ATOM   862  C CG  . LEU A 1 109 ? 10.784  30.399  66.441  1.00 29.55  ? 108  LEU A CG  1 
ATOM   863  C CD1 . LEU A 1 109 ? 9.822   31.549  66.634  1.00 30.62  ? 108  LEU A CD1 1 
ATOM   864  C CD2 . LEU A 1 109 ? 10.405  29.208  67.313  1.00 32.08  ? 108  LEU A CD2 1 
ATOM   865  N N   . PHE A 1 110 ? 13.676  30.590  64.118  1.00 29.57  ? 109  PHE A N   1 
ATOM   866  C CA  . PHE A 1 110 ? 15.088  30.794  64.434  1.00 29.21  ? 109  PHE A CA  1 
ATOM   867  C C   . PHE A 1 110 ? 15.539  32.185  63.957  1.00 29.81  ? 109  PHE A C   1 
ATOM   868  O O   . PHE A 1 110 ? 16.057  32.986  64.744  1.00 29.49  ? 109  PHE A O   1 
ATOM   869  C CB  . PHE A 1 110 ? 15.930  29.699  63.763  1.00 25.26  ? 109  PHE A CB  1 
ATOM   870  C CG  . PHE A 1 110 ? 17.338  29.619  64.266  1.00 23.33  ? 109  PHE A CG  1 
ATOM   871  C CD1 . PHE A 1 110 ? 17.594  29.508  65.630  1.00 20.55  ? 109  PHE A CD1 1 
ATOM   872  C CD2 . PHE A 1 110 ? 18.414  29.627  63.374  1.00 22.49  ? 109  PHE A CD2 1 
ATOM   873  C CE1 . PHE A 1 110 ? 18.902  29.405  66.108  1.00 24.06  ? 109  PHE A CE1 1 
ATOM   874  C CE2 . PHE A 1 110 ? 19.733  29.525  63.838  1.00 23.06  ? 109  PHE A CE2 1 
ATOM   875  C CZ  . PHE A 1 110 ? 19.977  29.414  65.211  1.00 24.54  ? 109  PHE A CZ  1 
ATOM   876  N N   . GLN A 1 111 ? 15.329  32.462  62.668  1.00 31.74  ? 110  GLN A N   1 
ATOM   877  C CA  . GLN A 1 111 ? 15.688  33.750  62.066  1.00 30.40  ? 110  GLN A CA  1 
ATOM   878  C C   . GLN A 1 111 ? 14.994  34.901  62.796  1.00 32.85  ? 110  GLN A C   1 
ATOM   879  O O   . GLN A 1 111 ? 15.642  35.876  63.219  1.00 33.32  ? 110  GLN A O   1 
ATOM   880  C CB  . GLN A 1 111 ? 15.302  33.767  60.585  1.00 27.73  ? 110  GLN A CB  1 
ATOM   881  C CG  . GLN A 1 111 ? 15.982  32.679  59.741  1.00 28.97  ? 110  GLN A CG  1 
ATOM   882  C CD  . GLN A 1 111 ? 15.648  32.778  58.252  1.00 30.40  ? 110  GLN A CD  1 
ATOM   883  O OE1 . GLN A 1 111 ? 15.737  33.850  57.654  1.00 31.76  ? 110  GLN A OE1 1 
ATOM   884  N NE2 . GLN A 1 111 ? 15.267  31.657  57.651  1.00 31.06  ? 110  GLN A NE2 1 
ATOM   885  N N   . LEU A 1 112 ? 13.677  34.789  62.954  1.00 32.25  ? 111  LEU A N   1 
ATOM   886  C CA  . LEU A 1 112 ? 12.922  35.825  63.640  1.00 31.96  ? 111  LEU A CA  1 
ATOM   887  C C   . LEU A 1 112 ? 13.538  36.114  65.007  1.00 32.04  ? 111  LEU A C   1 
ATOM   888  O O   . LEU A 1 112 ? 13.694  37.268  65.391  1.00 30.18  ? 111  LEU A O   1 
ATOM   889  C CB  . LEU A 1 112 ? 11.457  35.404  63.793  1.00 33.87  ? 111  LEU A CB  1 
ATOM   890  C CG  . LEU A 1 112 ? 10.655  35.260  62.490  1.00 34.57  ? 111  LEU A CG  1 
ATOM   891  C CD1 . LEU A 1 112 ? 9.260   34.751  62.809  1.00 35.22  ? 111  LEU A CD1 1 
ATOM   892  C CD2 . LEU A 1 112 ? 10.572  36.608  61.768  1.00 36.49  ? 111  LEU A CD2 1 
ATOM   893  N N   . LEU A 1 113 ? 13.896  35.074  65.754  1.00 32.92  ? 112  LEU A N   1 
ATOM   894  C CA  . LEU A 1 113 ? 14.503  35.315  67.064  1.00 33.17  ? 112  LEU A CA  1 
ATOM   895  C C   . LEU A 1 113 ? 15.819  36.076  66.923  1.00 32.75  ? 112  LEU A C   1 
ATOM   896  O O   . LEU A 1 113 ? 16.230  36.787  67.839  1.00 33.08  ? 112  LEU A O   1 
ATOM   897  C CB  . LEU A 1 113 ? 14.765  34.003  67.792  1.00 30.60  ? 112  LEU A CB  1 
ATOM   898  C CG  . LEU A 1 113 ? 13.533  33.269  68.292  1.00 30.95  ? 112  LEU A CG  1 
ATOM   899  C CD1 . LEU A 1 113 ? 13.868  31.779  68.431  1.00 24.44  ? 112  LEU A CD1 1 
ATOM   900  C CD2 . LEU A 1 113 ? 13.067  33.909  69.608  1.00 26.56  ? 112  LEU A CD2 1 
ATOM   901  N N   . GLN A 1 114 ? 16.482  35.919  65.781  1.00 30.61  ? 113  GLN A N   1 
ATOM   902  C CA  . GLN A 1 114 ? 17.746  36.603  65.570  1.00 32.01  ? 113  GLN A CA  1 
ATOM   903  C C   . GLN A 1 114 ? 17.514  38.087  65.331  1.00 32.35  ? 113  GLN A C   1 
ATOM   904  O O   . GLN A 1 114 ? 18.193  38.927  65.921  1.00 33.96  ? 113  GLN A O   1 
ATOM   905  C CB  . GLN A 1 114 ? 18.507  35.994  64.387  1.00 29.41  ? 113  GLN A CB  1 
ATOM   906  C CG  . GLN A 1 114 ? 19.075  34.617  64.672  1.00 31.78  ? 113  GLN A CG  1 
ATOM   907  C CD  . GLN A 1 114 ? 19.966  34.110  63.552  1.00 33.28  ? 113  GLN A CD  1 
ATOM   908  O OE1 . GLN A 1 114 ? 21.000  34.703  63.244  1.00 37.71  ? 113  GLN A OE1 1 
ATOM   909  N NE2 . GLN A 1 114 ? 19.566  33.008  62.934  1.00 34.00  ? 113  GLN A NE2 1 
ATOM   910  N N   . GLY A 1 115 ? 16.550  38.401  64.466  1.00 32.28  ? 114  GLY A N   1 
ATOM   911  C CA  . GLY A 1 115 ? 16.245  39.784  64.170  1.00 29.68  ? 114  GLY A CA  1 
ATOM   912  C C   . GLY A 1 115 ? 15.838  40.553  65.410  1.00 30.20  ? 114  GLY A C   1 
ATOM   913  O O   . GLY A 1 115 ? 16.218  41.709  65.583  1.00 31.56  ? 114  GLY A O   1 
ATOM   914  N N   . LEU A 1 116 ? 15.082  39.897  66.283  1.00 29.88  ? 115  LEU A N   1 
ATOM   915  C CA  . LEU A 1 116 ? 14.582  40.503  67.513  1.00 29.80  ? 115  LEU A CA  1 
ATOM   916  C C   . LEU A 1 116 ? 15.687  40.708  68.536  1.00 31.23  ? 115  LEU A C   1 
ATOM   917  O O   . LEU A 1 116 ? 15.775  41.773  69.165  1.00 32.39  ? 115  LEU A O   1 
ATOM   918  C CB  . LEU A 1 116 ? 13.486  39.619  68.091  1.00 30.07  ? 115  LEU A CB  1 
ATOM   919  C CG  . LEU A 1 116 ? 12.307  40.272  68.805  1.00 29.92  ? 115  LEU A CG  1 
ATOM   920  C CD1 . LEU A 1 116 ? 11.821  41.482  68.041  1.00 26.94  ? 115  LEU A CD1 1 
ATOM   921  C CD2 . LEU A 1 116 ? 11.197  39.235  68.920  1.00 27.11  ? 115  LEU A CD2 1 
ATOM   922  N N   . ALA A 1 117 ? 16.528  39.693  68.711  1.00 29.57  ? 116  ALA A N   1 
ATOM   923  C CA  . ALA A 1 117 ? 17.645  39.808  69.647  1.00 30.53  ? 116  ALA A CA  1 
ATOM   924  C C   . ALA A 1 117 ? 18.466  41.021  69.223  1.00 30.46  ? 116  ALA A C   1 
ATOM   925  O O   . ALA A 1 117 ? 18.969  41.770  70.074  1.00 30.86  ? 116  ALA A O   1 
ATOM   926  C CB  . ALA A 1 117 ? 18.522  38.553  69.612  1.00 28.06  ? 116  ALA A CB  1 
ATOM   927  N N   . PHE A 1 118 ? 18.594  41.215  67.908  1.00 28.50  ? 117  PHE A N   1 
ATOM   928  C CA  . PHE A 1 118 ? 19.353  42.343  67.397  1.00 30.39  ? 117  PHE A CA  1 
ATOM   929  C C   . PHE A 1 118 ? 18.660  43.669  67.805  1.00 32.61  ? 117  PHE A C   1 
ATOM   930  O O   . PHE A 1 118 ? 19.310  44.563  68.359  1.00 32.08  ? 117  PHE A O   1 
ATOM   931  C CB  . PHE A 1 118 ? 19.500  42.244  65.874  1.00 30.24  ? 117  PHE A CB  1 
ATOM   932  C CG  . PHE A 1 118 ? 20.536  43.194  65.301  1.00 31.28  ? 117  PHE A CG  1 
ATOM   933  C CD1 . PHE A 1 118 ? 21.892  42.870  65.333  1.00 28.37  ? 117  PHE A CD1 1 
ATOM   934  C CD2 . PHE A 1 118 ? 20.159  44.438  64.783  1.00 30.78  ? 117  PHE A CD2 1 
ATOM   935  C CE1 . PHE A 1 118 ? 22.862  43.765  64.865  1.00 26.04  ? 117  PHE A CE1 1 
ATOM   936  C CE2 . PHE A 1 118 ? 21.124  45.339  64.312  1.00 29.26  ? 117  PHE A CE2 1 
ATOM   937  C CZ  . PHE A 1 118 ? 22.482  44.997  64.355  1.00 26.27  ? 117  PHE A CZ  1 
ATOM   938  N N   . CYS A 1 119 ? 17.352  43.781  67.538  1.00 32.10  ? 118  CYS A N   1 
ATOM   939  C CA  . CYS A 1 119 ? 16.561  44.968  67.898  1.00 33.54  ? 118  CYS A CA  1 
ATOM   940  C C   . CYS A 1 119 ? 16.702  45.283  69.375  1.00 32.86  ? 118  CYS A C   1 
ATOM   941  O O   . CYS A 1 119 ? 16.902  46.435  69.752  1.00 35.69  ? 118  CYS A O   1 
ATOM   942  C CB  . CYS A 1 119 ? 15.063  44.760  67.625  1.00 32.67  ? 118  CYS A CB  1 
ATOM   943  S SG  . CYS A 1 119 ? 14.580  44.710  65.913  1.00 40.45  ? 118  CYS A SG  1 
ATOM   944  N N   . HIS A 1 120 ? 16.565  44.256  70.209  1.00 32.93  ? 119  HIS A N   1 
ATOM   945  C CA  . HIS A 1 120 ? 16.660  44.438  71.646  1.00 34.10  ? 119  HIS A CA  1 
ATOM   946  C C   . HIS A 1 120 ? 18.090  44.778  72.071  1.00 35.13  ? 119  HIS A C   1 
ATOM   947  O O   . HIS A 1 120 ? 18.297  45.509  73.041  1.00 36.31  ? 119  HIS A O   1 
ATOM   948  C CB  . HIS A 1 120 ? 16.157  43.185  72.372  1.00 35.58  ? 119  HIS A CB  1 
ATOM   949  C CG  . HIS A 1 120 ? 14.723  42.848  72.082  1.00 38.07  ? 119  HIS A CG  1 
ATOM   950  N ND1 . HIS A 1 120 ? 13.821  43.768  71.584  1.00 38.35  ? 119  HIS A ND1 1 
ATOM   951  C CD2 . HIS A 1 120 ? 14.035  41.691  72.227  1.00 37.22  ? 119  HIS A CD2 1 
ATOM   952  C CE1 . HIS A 1 120 ? 12.643  43.192  71.431  1.00 35.34  ? 119  HIS A CE1 1 
ATOM   953  N NE2 . HIS A 1 120 ? 12.746  41.932  71.814  1.00 40.54  ? 119  HIS A NE2 1 
ATOM   954  N N   . SER A 1 121 ? 19.074  44.252  71.347  1.00 33.57  ? 120  SER A N   1 
ATOM   955  C CA  . SER A 1 121 ? 20.463  44.551  71.654  1.00 33.25  ? 120  SER A CA  1 
ATOM   956  C C   . SER A 1 121 ? 20.751  46.005  71.332  1.00 33.08  ? 120  SER A C   1 
ATOM   957  O O   . SER A 1 121 ? 21.746  46.555  71.777  1.00 34.12  ? 120  SER A O   1 
ATOM   958  C CB  . SER A 1 121 ? 21.409  43.671  70.837  1.00 31.65  ? 120  SER A CB  1 
ATOM   959  O OG  . SER A 1 121 ? 21.709  42.472  71.522  1.00 35.16  ? 120  SER A OG  1 
ATOM   960  N N   . HIS A 1 122 ? 19.886  46.626  70.538  1.00 33.05  ? 121  HIS A N   1 
ATOM   961  C CA  . HIS A 1 122 ? 20.093  48.020  70.176  1.00 34.06  ? 121  HIS A CA  1 
ATOM   962  C C   . HIS A 1 122 ? 18.996  48.902  70.729  1.00 33.15  ? 121  HIS A C   1 
ATOM   963  O O   . HIS A 1 122 ? 18.677  49.933  70.157  1.00 34.19  ? 121  HIS A O   1 
ATOM   964  C CB  . HIS A 1 122 ? 20.205  48.159  68.655  1.00 33.97  ? 121  HIS A CB  1 
ATOM   965  C CG  . HIS A 1 122 ? 21.370  47.412  68.091  1.00 37.14  ? 121  HIS A CG  1 
ATOM   966  N ND1 . HIS A 1 122 ? 21.349  46.048  67.888  1.00 37.81  ? 121  HIS A ND1 1 
ATOM   967  C CD2 . HIS A 1 122 ? 22.632  47.814  67.806  1.00 37.62  ? 121  HIS A CD2 1 
ATOM   968  C CE1 . HIS A 1 122 ? 22.548  45.644  67.509  1.00 39.79  ? 121  HIS A CE1 1 
ATOM   969  N NE2 . HIS A 1 122 ? 23.345  46.695  67.452  1.00 37.74  ? 121  HIS A NE2 1 
ATOM   970  N N   . ARG A 1 123 ? 18.453  48.481  71.865  1.00 32.13  ? 122  ARG A N   1 
ATOM   971  C CA  . ARG A 1 123 ? 17.389  49.177  72.564  1.00 31.82  ? 122  ARG A CA  1 
ATOM   972  C C   . ARG A 1 123 ? 16.216  49.597  71.683  1.00 32.48  ? 122  ARG A C   1 
ATOM   973  O O   . ARG A 1 123 ? 15.796  50.748  71.689  1.00 34.14  ? 122  ARG A O   1 
ATOM   974  C CB  . ARG A 1 123 ? 17.962  50.378  73.336  1.00 30.80  ? 122  ARG A CB  1 
ATOM   975  C CG  . ARG A 1 123 ? 18.838  51.327  72.538  1.00 29.82  ? 122  ARG A CG  1 
ATOM   976  C CD  . ARG A 1 123 ? 18.063  52.550  72.147  1.00 30.58  ? 122  ARG A CD  1 
ATOM   977  N NE  . ARG A 1 123 ? 18.903  53.544  71.485  1.00 35.72  ? 122  ARG A NE  1 
ATOM   978  C CZ  . ARG A 1 123 ? 19.263  53.515  70.202  1.00 34.87  ? 122  ARG A CZ  1 
ATOM   979  N NH1 . ARG A 1 123 ? 18.861  52.534  69.407  1.00 31.74  ? 122  ARG A NH1 1 
ATOM   980  N NH2 . ARG A 1 123 ? 20.026  54.482  69.709  1.00 33.70  ? 122  ARG A NH2 1 
ATOM   981  N N   . VAL A 1 124 ? 15.678  48.648  70.930  1.00 32.37  ? 123  VAL A N   1 
ATOM   982  C CA  . VAL A 1 124 ? 14.541  48.937  70.075  1.00 31.99  ? 123  VAL A CA  1 
ATOM   983  C C   . VAL A 1 124 ? 13.412  47.931  70.285  1.00 32.97  ? 123  VAL A C   1 
ATOM   984  O O   . VAL A 1 124 ? 13.612  46.717  70.203  1.00 32.93  ? 123  VAL A O   1 
ATOM   985  C CB  . VAL A 1 124 ? 14.963  48.965  68.579  1.00 31.88  ? 123  VAL A CB  1 
ATOM   986  C CG1 . VAL A 1 124 ? 13.746  49.050  67.670  1.00 27.60  ? 123  VAL A CG1 1 
ATOM   987  C CG2 . VAL A 1 124 ? 15.871  50.170  68.332  1.00 30.69  ? 123  VAL A CG2 1 
ATOM   988  N N   . LEU A 1 125 ? 12.226  48.451  70.590  1.00 32.86  ? 124  LEU A N   1 
ATOM   989  C CA  . LEU A 1 125 ? 11.047  47.616  70.783  1.00 32.06  ? 124  LEU A CA  1 
ATOM   990  C C   . LEU A 1 125 ? 10.270  47.716  69.486  1.00 32.09  ? 124  LEU A C   1 
ATOM   991  O O   . LEU A 1 125 ? 9.972   48.815  69.034  1.00 34.06  ? 124  LEU A O   1 
ATOM   992  C CB  . LEU A 1 125 ? 10.194  48.147  71.938  1.00 31.72  ? 124  LEU A CB  1 
ATOM   993  C CG  . LEU A 1 125 ? 10.809  48.155  73.343  1.00 31.80  ? 124  LEU A CG  1 
ATOM   994  C CD1 . LEU A 1 125 ? 9.786   48.706  74.314  1.00 34.43  ? 124  LEU A CD1 1 
ATOM   995  C CD2 . LEU A 1 125 ? 11.211  46.743  73.765  1.00 30.27  ? 124  LEU A CD2 1 
ATOM   996  N N   . HIS A 1 126 ? 9.958   46.583  68.872  1.00 31.92  ? 125  HIS A N   1 
ATOM   997  C CA  . HIS A 1 126 ? 9.221   46.603  67.613  1.00 32.04  ? 125  HIS A CA  1 
ATOM   998  C C   . HIS A 1 126 ? 7.762   46.943  67.896  1.00 32.95  ? 125  HIS A C   1 
ATOM   999  O O   . HIS A 1 126 ? 7.178   47.803  67.238  1.00 34.29  ? 125  HIS A O   1 
ATOM   1000 C CB  . HIS A 1 126 ? 9.340   45.247  66.911  1.00 30.99  ? 125  HIS A CB  1 
ATOM   1001 C CG  . HIS A 1 126 ? 8.683   45.207  65.565  1.00 31.24  ? 125  HIS A CG  1 
ATOM   1002 N ND1 . HIS A 1 126 ? 7.313   45.155  65.407  1.00 30.60  ? 125  HIS A ND1 1 
ATOM   1003 C CD2 . HIS A 1 126 ? 9.208   45.233  64.316  1.00 27.80  ? 125  HIS A CD2 1 
ATOM   1004 C CE1 . HIS A 1 126 ? 7.025   45.149  64.116  1.00 29.91  ? 125  HIS A CE1 1 
ATOM   1005 N NE2 . HIS A 1 126 ? 8.157   45.196  63.433  1.00 27.82  ? 125  HIS A NE2 1 
ATOM   1006 N N   . ARG A 1 127 ? 7.187   46.250  68.877  1.00 32.78  ? 126  ARG A N   1 
ATOM   1007 C CA  . ARG A 1 127 ? 5.813   46.466  69.337  1.00 33.08  ? 126  ARG A CA  1 
ATOM   1008 C C   . ARG A 1 127 ? 4.629   46.269  68.384  1.00 32.99  ? 126  ARG A C   1 
ATOM   1009 O O   . ARG A 1 127 ? 3.547   46.789  68.635  1.00 33.18  ? 126  ARG A O   1 
ATOM   1010 C CB  . ARG A 1 127 ? 5.702   47.853  69.979  1.00 31.63  ? 126  ARG A CB  1 
ATOM   1011 C CG  . ARG A 1 127 ? 6.655   48.062  71.152  1.00 32.82  ? 126  ARG A CG  1 
ATOM   1012 C CD  . ARG A 1 127 ? 6.372   49.363  71.906  1.00 29.90  ? 126  ARG A CD  1 
ATOM   1013 N NE  . ARG A 1 127 ? 6.299   50.506  71.009  1.00 27.57  ? 126  ARG A NE  1 
ATOM   1014 C CZ  . ARG A 1 127 ? 6.034   51.747  71.403  1.00 30.19  ? 126  ARG A CZ  1 
ATOM   1015 N NH1 . ARG A 1 127 ? 5.820   52.003  72.689  1.00 28.01  ? 126  ARG A NH1 1 
ATOM   1016 N NH2 . ARG A 1 127 ? 5.979   52.731  70.512  1.00 27.98  ? 126  ARG A NH2 1 
ATOM   1017 N N   . ASP A 1 128 ? 4.821   45.534  67.297  1.00 32.22  ? 127  ASP A N   1 
ATOM   1018 C CA  . ASP A 1 128 ? 3.722   45.268  66.387  1.00 30.81  ? 127  ASP A CA  1 
ATOM   1019 C C   . ASP A 1 128 ? 4.056   44.060  65.526  1.00 31.03  ? 127  ASP A C   1 
ATOM   1020 O O   . ASP A 1 128 ? 3.745   44.022  64.339  1.00 29.95  ? 127  ASP A O   1 
ATOM   1021 C CB  . ASP A 1 128 ? 3.403   46.494  65.520  1.00 32.51  ? 127  ASP A CB  1 
ATOM   1022 C CG  . ASP A 1 128 ? 2.063   46.354  64.764  1.00 38.04  ? 127  ASP A CG  1 
ATOM   1023 O OD1 . ASP A 1 128 ? 1.078   45.837  65.349  1.00 39.31  ? 127  ASP A OD1 1 
ATOM   1024 O OD2 . ASP A 1 128 ? 1.991   46.770  63.586  1.00 40.20  ? 127  ASP A OD2 1 
ATOM   1025 N N   . LEU A 1 129 ? 4.695   43.066  66.138  1.00 31.22  ? 128  LEU A N   1 
ATOM   1026 C CA  . LEU A 1 129 ? 5.065   41.849  65.431  1.00 32.31  ? 128  LEU A CA  1 
ATOM   1027 C C   . LEU A 1 129 ? 3.816   41.038  65.186  1.00 32.66  ? 128  LEU A C   1 
ATOM   1028 O O   . LEU A 1 129 ? 3.135   40.632  66.116  1.00 34.39  ? 128  LEU A O   1 
ATOM   1029 C CB  . LEU A 1 129 ? 6.020   41.005  66.258  1.00 33.94  ? 128  LEU A CB  1 
ATOM   1030 C CG  . LEU A 1 129 ? 7.407   41.523  66.607  1.00 35.47  ? 128  LEU A CG  1 
ATOM   1031 C CD1 . LEU A 1 129 ? 8.215   40.372  67.190  1.00 36.98  ? 128  LEU A CD1 1 
ATOM   1032 C CD2 . LEU A 1 129 ? 8.075   42.051  65.363  1.00 36.50  ? 128  LEU A CD2 1 
ATOM   1033 N N   . LYS A 1 130 ? 3.513   40.797  63.923  1.00 31.48  ? 129  LYS A N   1 
ATOM   1034 C CA  . LYS A 1 130 ? 2.334   40.018  63.528  1.00 33.46  ? 129  LYS A CA  1 
ATOM   1035 C C   . LYS A 1 130 ? 2.724   39.455  62.163  1.00 34.05  ? 129  LYS A C   1 
ATOM   1036 O O   . LYS A 1 130 ? 3.556   40.047  61.474  1.00 35.44  ? 129  LYS A O   1 
ATOM   1037 C CB  . LYS A 1 130 ? 1.085   40.927  63.448  1.00 33.65  ? 129  LYS A CB  1 
ATOM   1038 C CG  . LYS A 1 130 ? 1.040   41.848  62.244  1.00 31.84  ? 129  LYS A CG  1 
ATOM   1039 C CD  . LYS A 1 130 ? -0.225  42.652  62.229  1.00 29.92  ? 129  LYS A CD  1 
ATOM   1040 C CE  . LYS A 1 130 ? -0.005  44.024  62.801  1.00 30.58  ? 129  LYS A CE  1 
ATOM   1041 N NZ  . LYS A 1 130 ? -1.264  44.809  62.631  1.00 32.17  ? 129  LYS A NZ  1 
ATOM   1042 N N   . PRO A 1 131 ? 2.106   38.343  61.728  1.00 35.57  ? 130  PRO A N   1 
ATOM   1043 C CA  . PRO A 1 131 ? 2.413   37.696  60.447  1.00 36.41  ? 130  PRO A CA  1 
ATOM   1044 C C   . PRO A 1 131 ? 2.373   38.581  59.189  1.00 38.12  ? 130  PRO A C   1 
ATOM   1045 O O   . PRO A 1 131 ? 3.016   38.289  58.158  1.00 38.70  ? 130  PRO A O   1 
ATOM   1046 C CB  . PRO A 1 131 ? 1.389   36.628  60.386  1.00 35.92  ? 130  PRO A CB  1 
ATOM   1047 C CG  . PRO A 1 131 ? 1.098   36.335  61.647  1.00 34.78  ? 130  PRO A CG  1 
ATOM   1048 C CD  . PRO A 1 131 ? 0.990   37.629  62.362  1.00 34.21  ? 130  PRO A CD  1 
ATOM   1049 N N   . GLN A 1 132 ? 1.644   39.683  59.270  1.00 37.80  ? 131  GLN A N   1 
ATOM   1050 C CA  . GLN A 1 132 ? 1.579   40.543  58.103  1.00 38.00  ? 131  GLN A CA  1 
ATOM   1051 C C   . GLN A 1 132 ? 2.807   41.397  58.024  1.00 37.31  ? 131  GLN A C   1 
ATOM   1052 O O   . GLN A 1 132 ? 3.168   41.844  56.951  1.00 36.78  ? 131  GLN A O   1 
ATOM   1053 C CB  . GLN A 1 132 ? 0.343   41.462  58.080  1.00 41.84  ? 131  GLN A CB  1 
ATOM   1054 C CG  . GLN A 1 132 ? -0.538  41.436  59.307  1.00 46.72  ? 131  GLN A CG  1 
ATOM   1055 C CD  . GLN A 1 132 ? -1.145  40.074  59.530  1.00 48.03  ? 131  GLN A CD  1 
ATOM   1056 O OE1 . GLN A 1 132 ? -1.123  39.537  60.639  1.00 47.43  ? 131  GLN A OE1 1 
ATOM   1057 N NE2 . GLN A 1 132 ? -1.693  39.502  58.470  1.00 50.24  ? 131  GLN A NE2 1 
ATOM   1058 N N   . ASN A 1 133 ? 3.444   41.621  59.168  1.00 34.89  ? 132  ASN A N   1 
ATOM   1059 C CA  . ASN A 1 133 ? 4.639   42.448  59.224  1.00 33.35  ? 132  ASN A CA  1 
ATOM   1060 C C   . ASN A 1 133 ? 5.940   41.666  59.092  1.00 35.22  ? 132  ASN A C   1 
ATOM   1061 O O   . ASN A 1 133 ? 7.025   42.181  59.385  1.00 37.42  ? 132  ASN A O   1 
ATOM   1062 C CB  . ASN A 1 133 ? 4.670   43.268  60.515  1.00 29.10  ? 132  ASN A CB  1 
ATOM   1063 C CG  . ASN A 1 133 ? 3.584   44.320  60.559  1.00 26.84  ? 132  ASN A CG  1 
ATOM   1064 O OD1 . ASN A 1 133 ? 3.205   44.860  59.527  1.00 27.43  ? 132  ASN A OD1 1 
ATOM   1065 N ND2 . ASN A 1 133 ? 3.093   44.631  61.755  1.00 24.37  ? 132  ASN A ND2 1 
ATOM   1066 N N   . LEU A 1 134 ? 5.825   40.410  58.671  1.00 35.73  ? 133  LEU A N   1 
ATOM   1067 C CA  . LEU A 1 134 ? 6.995   39.568  58.457  1.00 33.43  ? 133  LEU A CA  1 
ATOM   1068 C C   . LEU A 1 134 ? 7.042   39.261  56.965  1.00 34.10  ? 133  LEU A C   1 
ATOM   1069 O O   . LEU A 1 134 ? 6.037   38.867  56.377  1.00 34.53  ? 133  LEU A O   1 
ATOM   1070 C CB  . LEU A 1 134 ? 6.885   38.284  59.278  1.00 32.75  ? 133  LEU A CB  1 
ATOM   1071 C CG  . LEU A 1 134 ? 6.683   38.575  60.773  1.00 34.19  ? 133  LEU A CG  1 
ATOM   1072 C CD1 . LEU A 1 134 ? 6.643   37.267  61.600  1.00 30.45  ? 133  LEU A CD1 1 
ATOM   1073 C CD2 . LEU A 1 134 ? 7.804   39.493  61.242  1.00 32.88  ? 133  LEU A CD2 1 
ATOM   1074 N N   . LEU A 1 135 ? 8.203   39.465  56.355  1.00 34.11  ? 134  LEU A N   1 
ATOM   1075 C CA  . LEU A 1 135 ? 8.393   39.237  54.920  1.00 34.05  ? 134  LEU A CA  1 
ATOM   1076 C C   . LEU A 1 135 ? 9.275   38.019  54.646  1.00 32.62  ? 134  LEU A C   1 
ATOM   1077 O O   . LEU A 1 135 ? 10.214  37.755  55.378  1.00 33.51  ? 134  LEU A O   1 
ATOM   1078 C CB  . LEU A 1 135 ? 9.053   40.475  54.296  1.00 34.84  ? 134  LEU A CB  1 
ATOM   1079 C CG  . LEU A 1 135 ? 8.366   41.829  54.503  1.00 35.44  ? 134  LEU A CG  1 
ATOM   1080 C CD1 . LEU A 1 135 ? 9.275   42.946  54.022  1.00 31.51  ? 134  LEU A CD1 1 
ATOM   1081 C CD2 . LEU A 1 135 ? 7.037   41.855  53.753  1.00 33.28  ? 134  LEU A CD2 1 
ATOM   1082 N N   . ILE A 1 136 ? 8.979   37.282  53.585  1.00 32.82  ? 135  ILE A N   1 
ATOM   1083 C CA  . ILE A 1 136 ? 9.776   36.109  53.229  1.00 33.73  ? 135  ILE A CA  1 
ATOM   1084 C C   . ILE A 1 136 ? 10.138  36.175  51.756  1.00 35.73  ? 135  ILE A C   1 
ATOM   1085 O O   . ILE A 1 136 ? 9.329   36.603  50.941  1.00 37.80  ? 135  ILE A O   1 
ATOM   1086 C CB  . ILE A 1 136 ? 9.003   34.782  53.447  1.00 32.61  ? 135  ILE A CB  1 
ATOM   1087 C CG1 . ILE A 1 136 ? 7.607   34.896  52.827  1.00 32.57  ? 135  ILE A CG1 1 
ATOM   1088 C CG2 . ILE A 1 136 ? 8.941   34.425  54.927  1.00 31.27  ? 135  ILE A CG2 1 
ATOM   1089 C CD1 . ILE A 1 136 ? 6.718   33.709  53.107  1.00 31.73  ? 135  ILE A CD1 1 
ATOM   1090 N N   . ASN A 1 137 ? 11.354  35.774  51.409  1.00 37.89  ? 136  ASN A N   1 
ATOM   1091 C CA  . ASN A 1 137 ? 11.733  35.767  50.013  1.00 40.17  ? 136  ASN A CA  1 
ATOM   1092 C C   . ASN A 1 137 ? 11.834  34.306  49.558  1.00 44.22  ? 136  ASN A C   1 
ATOM   1093 O O   . ASN A 1 137 ? 11.633  33.372  50.347  1.00 43.32  ? 136  ASN A O   1 
ATOM   1094 C CB  . ASN A 1 137 ? 13.051  36.518  49.776  1.00 39.59  ? 136  ASN A CB  1 
ATOM   1095 C CG  . ASN A 1 137 ? 14.235  35.861  50.440  1.00 39.62  ? 136  ASN A CG  1 
ATOM   1096 O OD1 . ASN A 1 137 ? 14.271  34.647  50.623  1.00 39.06  ? 136  ASN A OD1 1 
ATOM   1097 N ND2 . ASN A 1 137 ? 15.232  36.665  50.784  1.00 40.70  ? 136  ASN A ND2 1 
ATOM   1098 N N   . THR A 1 138 ? 12.132  34.113  48.281  1.00 47.27  ? 137  THR A N   1 
ATOM   1099 C CA  . THR A 1 138 ? 12.215  32.781  47.715  1.00 49.95  ? 137  THR A CA  1 
ATOM   1100 C C   . THR A 1 138 ? 13.417  31.981  48.184  1.00 50.50  ? 137  THR A C   1 
ATOM   1101 O O   . THR A 1 138 ? 13.560  30.822  47.813  1.00 51.37  ? 137  THR A O   1 
ATOM   1102 C CB  . THR A 1 138 ? 12.234  32.862  46.178  1.00 51.60  ? 137  THR A CB  1 
ATOM   1103 O OG1 . THR A 1 138 ? 13.289  33.734  45.758  1.00 52.96  ? 137  THR A OG1 1 
ATOM   1104 C CG2 . THR A 1 138 ? 10.914  33.406  45.662  1.00 51.39  ? 137  THR A CG2 1 
ATOM   1105 N N   . GLU A 1 139 ? 14.256  32.587  49.021  1.00 51.35  ? 138  GLU A N   1 
ATOM   1106 C CA  . GLU A 1 139 ? 15.472  31.933  49.515  1.00 52.52  ? 138  GLU A CA  1 
ATOM   1107 C C   . GLU A 1 139 ? 15.426  31.302  50.903  1.00 50.88  ? 138  GLU A C   1 
ATOM   1108 O O   . GLU A 1 139 ? 16.427  30.750  51.357  1.00 51.67  ? 138  GLU A O   1 
ATOM   1109 C CB  . GLU A 1 139 ? 16.629  32.923  49.511  1.00 55.42  ? 138  GLU A CB  1 
ATOM   1110 C CG  . GLU A 1 139 ? 17.911  32.356  48.976  1.00 60.27  ? 138  GLU A CG  1 
ATOM   1111 C CD  . GLU A 1 139 ? 17.849  32.197  47.481  1.00 63.42  ? 138  GLU A CD  1 
ATOM   1112 O OE1 . GLU A 1 139 ? 17.399  33.167  46.826  1.00 64.21  ? 138  GLU A OE1 1 
ATOM   1113 O OE2 . GLU A 1 139 ? 18.245  31.120  46.970  1.00 64.53  ? 138  GLU A OE2 1 
ATOM   1114 N N   . GLY A 1 140 ? 14.298  31.395  51.589  1.00 48.05  ? 139  GLY A N   1 
ATOM   1115 C CA  . GLY A 1 140 ? 14.222  30.809  52.914  1.00 47.56  ? 139  GLY A CA  1 
ATOM   1116 C C   . GLY A 1 140 ? 14.414  31.872  53.972  1.00 47.08  ? 139  GLY A C   1 
ATOM   1117 O O   . GLY A 1 140 ? 14.444  31.593  55.177  1.00 48.06  ? 139  GLY A O   1 
ATOM   1118 N N   . ALA A 1 141 ? 14.552  33.107  53.511  1.00 44.69  ? 140  ALA A N   1 
ATOM   1119 C CA  . ALA A 1 141 ? 14.729  34.229  54.413  1.00 41.47  ? 140  ALA A CA  1 
ATOM   1120 C C   . ALA A 1 141 ? 13.384  34.757  54.884  1.00 40.67  ? 140  ALA A C   1 
ATOM   1121 O O   . ALA A 1 141 ? 12.387  34.678  54.167  1.00 39.62  ? 140  ALA A O   1 
ATOM   1122 C CB  . ALA A 1 141 ? 15.490  35.335  53.718  1.00 39.09  ? 140  ALA A CB  1 
ATOM   1123 N N   . ILE A 1 142 ? 13.373  35.278  56.109  1.00 39.68  ? 141  ILE A N   1 
ATOM   1124 C CA  . ILE A 1 142 ? 12.196  35.886  56.706  1.00 37.24  ? 141  ILE A CA  1 
ATOM   1125 C C   . ILE A 1 142 ? 12.684  37.083  57.523  1.00 36.02  ? 141  ILE A C   1 
ATOM   1126 O O   . ILE A 1 142 ? 13.689  36.991  58.232  1.00 35.56  ? 141  ILE A O   1 
ATOM   1127 C CB  . ILE A 1 142 ? 11.445  34.899  57.609  1.00 37.83  ? 141  ILE A CB  1 
ATOM   1128 C CG1 . ILE A 1 142 ? 10.255  35.611  58.272  1.00 36.47  ? 141  ILE A CG1 1 
ATOM   1129 C CG2 . ILE A 1 142 ? 12.391  34.326  58.629  1.00 38.03  ? 141  ILE A CG2 1 
ATOM   1130 C CD1 . ILE A 1 142 ? 9.251   34.690  58.925  1.00 33.31  ? 141  ILE A CD1 1 
ATOM   1131 N N   . LYS A 1 143 ? 11.973  38.203  57.420  1.00 36.04  ? 142  LYS A N   1 
ATOM   1132 C CA  . LYS A 1 143 ? 12.382  39.408  58.116  1.00 33.27  ? 142  LYS A CA  1 
ATOM   1133 C C   . LYS A 1 143 ? 11.338  40.306  58.725  1.00 33.07  ? 142  LYS A C   1 
ATOM   1134 O O   . LYS A 1 143 ? 10.205  40.404  58.267  1.00 34.36  ? 142  LYS A O   1 
ATOM   1135 C CB  . LYS A 1 143 ? 13.213  40.261  57.182  1.00 30.40  ? 142  LYS A CB  1 
ATOM   1136 C CG  . LYS A 1 143 ? 14.409  39.555  56.586  1.00 31.26  ? 142  LYS A CG  1 
ATOM   1137 C CD  . LYS A 1 143 ? 15.168  40.432  55.544  1.00 28.35  ? 142  LYS A CD  1 
ATOM   1138 C CE  . LYS A 1 143 ? 15.930  39.575  54.510  1.00 30.41  ? 142  LYS A CE  1 
ATOM   1139 N NZ  . LYS A 1 143 ? 17.092  40.129  53.805  1.00 27.51  ? 142  LYS A NZ  1 
ATOM   1140 N N   . LEU A 1 144 ? 11.778  40.993  59.761  1.00 31.15  ? 143  LEU A N   1 
ATOM   1141 C CA  . LEU A 1 144 ? 10.941  41.919  60.444  1.00 31.86  ? 143  LEU A CA  1 
ATOM   1142 C C   . LEU A 1 144 ? 10.766  43.134  59.540  1.00 31.94  ? 143  LEU A C   1 
ATOM   1143 O O   . LEU A 1 144 ? 11.740  43.636  58.957  1.00 29.67  ? 143  LEU A O   1 
ATOM   1144 C CB  . LEU A 1 144 ? 11.597  42.348  61.758  1.00 31.85  ? 143  LEU A CB  1 
ATOM   1145 C CG  . LEU A 1 144 ? 12.079  41.283  62.734  1.00 29.83  ? 143  LEU A CG  1 
ATOM   1146 C CD1 . LEU A 1 144 ? 11.906  41.812  64.131  1.00 31.63  ? 143  LEU A CD1 1 
ATOM   1147 C CD2 . LEU A 1 144 ? 11.286  40.024  62.587  1.00 34.25  ? 143  LEU A CD2 1 
ATOM   1148 N N   . ALA A 1 145 ? 9.520   43.583  59.414  1.00 30.63  ? 144  ALA A N   1 
ATOM   1149 C CA  . ALA A 1 145 ? 9.201   44.774  58.641  1.00 31.12  ? 144  ALA A CA  1 
ATOM   1150 C C   . ALA A 1 145 ? 8.288   45.657  59.473  1.00 31.83  ? 144  ALA A C   1 
ATOM   1151 O O   . ALA A 1 145 ? 7.958   45.336  60.617  1.00 33.51  ? 144  ALA A O   1 
ATOM   1152 C CB  . ALA A 1 145 ? 8.526   44.409  57.334  1.00 31.95  ? 144  ALA A CB  1 
ATOM   1153 N N   . ASP A 1 146 ? 7.901   46.784  58.887  1.00 33.42  ? 145  ASP A N   1 
ATOM   1154 C CA  . ASP A 1 146 ? 7.022   47.757  59.511  1.00 32.90  ? 145  ASP A CA  1 
ATOM   1155 C C   . ASP A 1 146 ? 7.452   48.208  60.908  1.00 31.47  ? 145  ASP A C   1 
ATOM   1156 O O   . ASP A 1 146 ? 6.902   47.767  61.909  1.00 29.20  ? 145  ASP A O   1 
ATOM   1157 C CB  . ASP A 1 146 ? 5.592   47.205  59.572  1.00 34.85  ? 145  ASP A CB  1 
ATOM   1158 C CG  . ASP A 1 146 ? 4.532   48.312  59.659  1.00 39.38  ? 145  ASP A CG  1 
ATOM   1159 O OD1 . ASP A 1 146 ? 4.759   49.338  60.354  1.00 39.28  ? 145  ASP A OD1 1 
ATOM   1160 O OD2 . ASP A 1 146 ? 3.459   48.143  59.034  1.00 39.27  ? 145  ASP A OD2 1 
ATOM   1161 N N   . PHE A 1 147 ? 8.418   49.112  60.979  1.00 33.16  ? 146  PHE A N   1 
ATOM   1162 C CA  . PHE A 1 147 ? 8.859   49.610  62.277  1.00 33.06  ? 146  PHE A CA  1 
ATOM   1163 C C   . PHE A 1 147 ? 8.116   50.903  62.590  1.00 35.71  ? 146  PHE A C   1 
ATOM   1164 O O   . PHE A 1 147 ? 8.670   51.839  63.163  1.00 36.73  ? 146  PHE A O   1 
ATOM   1165 C CB  . PHE A 1 147 ? 10.378  49.825  62.289  1.00 29.92  ? 146  PHE A CB  1 
ATOM   1166 C CG  . PHE A 1 147 ? 11.165  48.550  62.450  1.00 26.82  ? 146  PHE A CG  1 
ATOM   1167 C CD1 . PHE A 1 147 ? 11.195  47.605  61.446  1.00 25.11  ? 146  PHE A CD1 1 
ATOM   1168 C CD2 . PHE A 1 147 ? 11.810  48.267  63.642  1.00 28.81  ? 146  PHE A CD2 1 
ATOM   1169 C CE1 . PHE A 1 147 ? 11.846  46.396  61.625  1.00 27.89  ? 146  PHE A CE1 1 
ATOM   1170 C CE2 . PHE A 1 147 ? 12.465  47.054  63.830  1.00 29.73  ? 146  PHE A CE2 1 
ATOM   1171 C CZ  . PHE A 1 147 ? 12.481  46.117  62.819  1.00 28.13  ? 146  PHE A CZ  1 
ATOM   1172 N N   . GLY A 1 148 ? 6.840   50.931  62.214  1.00 37.40  ? 147  GLY A N   1 
ATOM   1173 C CA  . GLY A 1 148 ? 6.011   52.099  62.440  1.00 38.10  ? 147  GLY A CA  1 
ATOM   1174 C C   . GLY A 1 148 ? 5.528   52.298  63.872  1.00 40.53  ? 147  GLY A C   1 
ATOM   1175 O O   . GLY A 1 148 ? 5.133   53.414  64.224  1.00 42.62  ? 147  GLY A O   1 
ATOM   1176 N N   . LEU A 1 149 ? 5.529   51.243  64.690  1.00 37.32  ? 148  LEU A N   1 
ATOM   1177 C CA  . LEU A 1 149 ? 5.103   51.374  66.079  1.00 35.43  ? 148  LEU A CA  1 
ATOM   1178 C C   . LEU A 1 149 ? 6.281   51.245  67.031  1.00 35.12  ? 148  LEU A C   1 
ATOM   1179 O O   . LEU A 1 149 ? 6.107   51.297  68.253  1.00 35.42  ? 148  LEU A O   1 
ATOM   1180 C CB  . LEU A 1 149 ? 4.062   50.320  66.447  1.00 36.96  ? 148  LEU A CB  1 
ATOM   1181 C CG  . LEU A 1 149 ? 2.653   50.448  65.866  1.00 39.98  ? 148  LEU A CG  1 
ATOM   1182 C CD1 . LEU A 1 149 ? 2.119   51.860  66.119  1.00 40.94  ? 148  LEU A CD1 1 
ATOM   1183 C CD2 . LEU A 1 149 ? 2.692   50.143  64.373  1.00 42.20  ? 148  LEU A CD2 1 
ATOM   1184 N N   . ALA A 1 150 ? 7.474   51.079  66.460  1.00 33.14  ? 149  ALA A N   1 
ATOM   1185 C CA  . ALA A 1 150 ? 8.718   50.921  67.222  1.00 31.58  ? 149  ALA A CA  1 
ATOM   1186 C C   . ALA A 1 150 ? 9.158   52.146  68.016  1.00 31.71  ? 149  ALA A C   1 
ATOM   1187 O O   . ALA A 1 150 ? 8.749   53.268  67.725  1.00 33.52  ? 149  ALA A O   1 
ATOM   1188 C CB  . ALA A 1 150 ? 9.831   50.519  66.284  1.00 27.97  ? 149  ALA A CB  1 
ATOM   1189 N N   . ARG A 1 151 ? 9.993   51.925  69.027  1.00 31.44  ? 150  ARG A N   1 
ATOM   1190 C CA  . ARG A 1 151 ? 10.525  53.032  69.822  1.00 31.61  ? 150  ARG A CA  1 
ATOM   1191 C C   . ARG A 1 151 ? 11.859  52.688  70.524  1.00 31.90  ? 150  ARG A C   1 
ATOM   1192 O O   . ARG A 1 151 ? 12.124  51.536  70.899  1.00 32.16  ? 150  ARG A O   1 
ATOM   1193 C CB  . ARG A 1 151 ? 9.467   53.523  70.838  1.00 29.07  ? 150  ARG A CB  1 
ATOM   1194 C CG  . ARG A 1 151 ? 9.644   53.085  72.299  1.00 30.23  ? 150  ARG A CG  1 
ATOM   1195 C CD  . ARG A 1 151 ? 9.876   54.293  73.220  1.00 29.77  ? 150  ARG A CD  1 
ATOM   1196 N NE  . ARG A 1 151 ? 8.703   55.156  73.357  1.00 33.01  ? 150  ARG A NE  1 
ATOM   1197 C CZ  . ARG A 1 151 ? 8.750   56.439  73.721  1.00 33.21  ? 150  ARG A CZ  1 
ATOM   1198 N NH1 . ARG A 1 151 ? 9.914   57.018  73.988  1.00 35.13  ? 150  ARG A NH1 1 
ATOM   1199 N NH2 . ARG A 1 151 ? 7.637   57.153  73.807  1.00 28.74  ? 150  ARG A NH2 1 
ATOM   1200 N N   . ALA A 1 152 ? 12.724  53.680  70.663  1.00 29.97  ? 151  ALA A N   1 
ATOM   1201 C CA  . ALA A 1 152 ? 13.982  53.438  71.345  1.00 31.04  ? 151  ALA A CA  1 
ATOM   1202 C C   . ALA A 1 152 ? 13.601  53.413  72.812  1.00 31.37  ? 151  ALA A C   1 
ATOM   1203 O O   . ALA A 1 152 ? 12.747  54.181  73.228  1.00 34.67  ? 151  ALA A O   1 
ATOM   1204 C CB  . ALA A 1 152 ? 14.963  54.570  71.073  1.00 29.64  ? 151  ALA A CB  1 
ATOM   1205 N N   . PHE A 1 153 ? 14.199  52.530  73.600  1.00 30.98  ? 152  PHE A N   1 
ATOM   1206 C CA  . PHE A 1 153 ? 13.863  52.500  75.014  1.00 29.67  ? 152  PHE A CA  1 
ATOM   1207 C C   . PHE A 1 153 ? 15.102  52.699  75.861  1.00 28.57  ? 152  PHE A C   1 
ATOM   1208 O O   . PHE A 1 153 ? 16.213  52.619  75.361  1.00 30.23  ? 152  PHE A O   1 
ATOM   1209 C CB  . PHE A 1 153 ? 13.145  51.195  75.386  1.00 28.45  ? 152  PHE A CB  1 
ATOM   1210 C CG  . PHE A 1 153 ? 14.021  49.969  75.368  1.00 26.28  ? 152  PHE A CG  1 
ATOM   1211 C CD1 . PHE A 1 153 ? 14.039  49.120  74.265  1.00 23.19  ? 152  PHE A CD1 1 
ATOM   1212 C CD2 . PHE A 1 153 ? 14.782  49.631  76.492  1.00 25.50  ? 152  PHE A CD2 1 
ATOM   1213 C CE1 . PHE A 1 153 ? 14.795  47.950  74.287  1.00 21.13  ? 152  PHE A CE1 1 
ATOM   1214 C CE2 . PHE A 1 153 ? 15.534  48.474  76.523  1.00 18.93  ? 152  PHE A CE2 1 
ATOM   1215 C CZ  . PHE A 1 153 ? 15.542  47.629  75.421  1.00 20.69  ? 152  PHE A CZ  1 
ATOM   1216 N N   . GLY A 1 154 ? 14.909  52.979  77.142  1.00 30.55  ? 153  GLY A N   1 
ATOM   1217 C CA  . GLY A 1 154 ? 16.039  53.208  78.024  1.00 31.38  ? 153  GLY A CA  1 
ATOM   1218 C C   . GLY A 1 154 ? 16.216  52.097  79.041  1.00 33.89  ? 153  GLY A C   1 
ATOM   1219 O O   . GLY A 1 154 ? 15.377  51.193  79.145  1.00 33.82  ? 153  GLY A O   1 
ATOM   1220 N N   . VAL A 1 155 ? 17.313  52.161  79.788  1.00 33.88  ? 154  VAL A N   1 
ATOM   1221 C CA  . VAL A 1 155 ? 17.622  51.161  80.801  1.00 35.69  ? 154  VAL A CA  1 
ATOM   1222 C C   . VAL A 1 155 ? 17.756  51.853  82.141  1.00 37.66  ? 154  VAL A C   1 
ATOM   1223 O O   . VAL A 1 155 ? 18.729  52.555  82.365  1.00 40.11  ? 154  VAL A O   1 
ATOM   1224 C CB  . VAL A 1 155 ? 18.974  50.448  80.507  1.00 34.78  ? 154  VAL A CB  1 
ATOM   1225 C CG1 . VAL A 1 155 ? 19.384  49.592  81.706  1.00 31.53  ? 154  VAL A CG1 1 
ATOM   1226 C CG2 . VAL A 1 155 ? 18.859  49.573  79.246  1.00 36.05  ? 154  VAL A CG2 1 
ATOM   1227 N N   . PRO A 1 156 ? 16.796  51.656  83.058  1.00 38.86  ? 155  PRO A N   1 
ATOM   1228 C CA  . PRO A 1 156 ? 15.596  50.826  82.909  1.00 38.73  ? 155  PRO A CA  1 
ATOM   1229 C C   . PRO A 1 156 ? 14.553  51.543  82.048  1.00 38.19  ? 155  PRO A C   1 
ATOM   1230 O O   . PRO A 1 156 ? 14.751  52.691  81.652  1.00 39.13  ? 155  PRO A O   1 
ATOM   1231 C CB  . PRO A 1 156 ? 15.134  50.646  84.348  1.00 36.64  ? 155  PRO A CB  1 
ATOM   1232 C CG  . PRO A 1 156 ? 15.450  51.987  84.945  1.00 36.11  ? 155  PRO A CG  1 
ATOM   1233 C CD  . PRO A 1 156 ? 16.842  52.271  84.401  1.00 38.43  ? 155  PRO A CD  1 
ATOM   1234 N N   . VAL A 1 157 ? 13.449  50.873  81.752  1.00 36.23  ? 156  VAL A N   1 
ATOM   1235 C CA  . VAL A 1 157 ? 12.413  51.492  80.935  1.00 37.37  ? 156  VAL A CA  1 
ATOM   1236 C C   . VAL A 1 157 ? 11.537  52.410  81.778  1.00 38.71  ? 156  VAL A C   1 
ATOM   1237 O O   . VAL A 1 157 ? 11.469  52.285  83.006  1.00 39.38  ? 156  VAL A O   1 
ATOM   1238 C CB  . VAL A 1 157 ? 11.481  50.435  80.297  1.00 37.48  ? 156  VAL A CB  1 
ATOM   1239 C CG1 . VAL A 1 157 ? 12.274  49.484  79.407  1.00 34.91  ? 156  VAL A CG1 1 
ATOM   1240 C CG2 . VAL A 1 157 ? 10.755  49.666  81.389  1.00 36.10  ? 156  VAL A CG2 1 
ATOM   1241 N N   . ARG A 1 158 ? 10.888  53.358  81.123  1.00 38.50  ? 157  ARG A N   1 
ATOM   1242 C CA  . ARG A 1 158 ? 9.968   54.219  81.835  1.00 39.84  ? 157  ARG A CA  1 
ATOM   1243 C C   . ARG A 1 158 ? 8.641   53.975  81.118  1.00 39.96  ? 157  ARG A C   1 
ATOM   1244 O O   . ARG A 1 158 ? 8.599   53.217  80.144  1.00 39.22  ? 157  ARG A O   1 
ATOM   1245 C CB  . ARG A 1 158 ? 10.400  55.693  81.781  1.00 40.52  ? 157  ARG A CB  1 
ATOM   1246 C CG  . ARG A 1 158 ? 10.381  56.340  80.421  1.00 42.52  ? 157  ARG A CG  1 
ATOM   1247 C CD  . ARG A 1 158 ? 10.286  57.864  80.535  1.00 42.40  ? 157  ARG A CD  1 
ATOM   1248 N NE  . ARG A 1 158 ? 9.706   58.409  79.313  1.00 43.46  ? 157  ARG A NE  1 
ATOM   1249 C CZ  . ARG A 1 158 ? 10.405  58.776  78.246  1.00 43.15  ? 157  ARG A CZ  1 
ATOM   1250 N NH1 . ARG A 1 158 ? 11.732  58.683  78.240  1.00 39.44  ? 157  ARG A NH1 1 
ATOM   1251 N NH2 . ARG A 1 158 ? 9.765   59.197  77.165  1.00 44.08  ? 157  ARG A NH2 1 
ATOM   1252 N N   . THR A 1 159 ? 7.561   54.581  81.600  1.00 40.20  ? 158  THR A N   1 
ATOM   1253 C CA  . THR A 1 159 ? 6.251   54.381  80.994  1.00 38.64  ? 158  THR A CA  1 
ATOM   1254 C C   . THR A 1 159 ? 6.176   54.868  79.567  1.00 37.94  ? 158  THR A C   1 
ATOM   1255 O O   . THR A 1 159 ? 6.465   56.026  79.298  1.00 38.18  ? 158  THR A O   1 
ATOM   1256 C CB  . THR A 1 159 ? 5.148   55.125  81.766  1.00 40.73  ? 158  THR A CB  1 
ATOM   1257 O OG1 . THR A 1 159 ? 5.147   54.701  83.133  1.00 44.36  ? 158  THR A OG1 1 
ATOM   1258 C CG2 . THR A 1 159 ? 3.775   54.839  81.142  1.00 38.04  ? 158  THR A CG2 1 
ATOM   1259 N N   . TYR A 1 160 ? 5.774   53.985  78.659  1.00 38.43  ? 159  TYR A N   1 
ATOM   1260 C CA  . TYR A 1 160 ? 5.610   54.353  77.254  1.00 38.47  ? 159  TYR A CA  1 
ATOM   1261 C C   . TYR A 1 160 ? 4.134   54.243  76.883  1.00 39.34  ? 159  TYR A C   1 
ATOM   1262 O O   . TYR A 1 160 ? 3.275   54.039  77.739  1.00 40.44  ? 159  TYR A O   1 
ATOM   1263 C CB  . TYR A 1 160 ? 6.422   53.448  76.325  1.00 37.21  ? 159  TYR A CB  1 
ATOM   1264 C CG  . TYR A 1 160 ? 7.892   53.399  76.657  1.00 37.38  ? 159  TYR A CG  1 
ATOM   1265 C CD1 . TYR A 1 160 ? 8.609   54.568  76.921  1.00 34.56  ? 159  TYR A CD1 1 
ATOM   1266 C CD2 . TYR A 1 160 ? 8.558   52.185  76.749  1.00 34.31  ? 159  TYR A CD2 1 
ATOM   1267 C CE1 . TYR A 1 160 ? 9.946   54.518  77.276  1.00 33.83  ? 159  TYR A CE1 1 
ATOM   1268 C CE2 . TYR A 1 160 ? 9.899   52.128  77.102  1.00 33.56  ? 159  TYR A CE2 1 
ATOM   1269 C CZ  . TYR A 1 160 ? 10.583  53.291  77.366  1.00 33.33  ? 159  TYR A CZ  1 
ATOM   1270 O OH  . TYR A 1 160 ? 11.904  53.222  77.732  1.00 35.39  ? 159  TYR A OH  1 
HETATM 1271 N N   . TPO A 1 161 ? 3.866   54.370  75.593  1.00 39.63  ? 160  TPO A N   1 
HETATM 1272 C CA  . TPO A 1 161 ? 2.527   54.321  75.039  1.00 40.64  ? 160  TPO A CA  1 
HETATM 1273 C CB  . TPO A 1 161 ? 2.607   54.481  73.505  1.00 40.07  ? 160  TPO A CB  1 
HETATM 1274 C CG2 . TPO A 1 161 ? 1.216   54.558  72.903  1.00 36.79  ? 160  TPO A CG2 1 
HETATM 1275 O OG1 . TPO A 1 161 ? 3.316   55.690  73.198  1.00 38.51  ? 160  TPO A OG1 1 
HETATM 1276 P P   . TPO A 1 161 ? 4.682   55.669  72.505  1.00 37.43  ? 160  TPO A P   1 
HETATM 1277 O O1P . TPO A 1 161 ? 5.230   57.069  72.503  1.00 37.01  ? 160  TPO A O1P 1 
HETATM 1278 O O2P . TPO A 1 161 ? 5.495   54.658  73.289  1.00 34.97  ? 160  TPO A O2P 1 
HETATM 1279 O O3P . TPO A 1 161 ? 4.314   55.216  71.156  1.00 33.48  ? 160  TPO A O3P 1 
HETATM 1280 C C   . TPO A 1 161 ? 1.802   53.010  75.352  1.00 43.78  ? 160  TPO A C   1 
HETATM 1281 O O   . TPO A 1 161 ? 2.344   51.924  75.141  1.00 43.08  ? 160  TPO A O   1 
ATOM   1282 N N   . HIS A 1 162 ? 0.566   53.119  75.840  1.00 46.84  ? 161  HIS A N   1 
ATOM   1283 C CA  . HIS A 1 162 ? -0.226  51.936  76.154  1.00 48.49  ? 161  HIS A CA  1 
ATOM   1284 C C   . HIS A 1 162 ? -0.965  51.367  74.947  1.00 48.50  ? 161  HIS A C   1 
ATOM   1285 O O   . HIS A 1 162 ? -1.106  50.148  74.808  1.00 48.26  ? 161  HIS A O   1 
ATOM   1286 C CB  . HIS A 1 162 ? -1.251  52.221  77.251  1.00 50.13  ? 161  HIS A CB  1 
ATOM   1287 C CG  . HIS A 1 162 ? -2.260  51.125  77.399  1.00 58.02  ? 161  HIS A CG  1 
ATOM   1288 N ND1 . HIS A 1 162 ? -3.319  50.970  76.527  1.00 60.29  ? 161  HIS A ND1 1 
ATOM   1289 C CD2 . HIS A 1 162 ? -2.313  50.069  78.248  1.00 58.91  ? 161  HIS A CD2 1 
ATOM   1290 C CE1 . HIS A 1 162 ? -3.977  49.865  76.830  1.00 62.10  ? 161  HIS A CE1 1 
ATOM   1291 N NE2 . HIS A 1 162 ? -3.387  49.299  77.870  1.00 60.75  ? 161  HIS A NE2 1 
ATOM   1292 N N   . GLU A 1 163 ? -1.455  52.253  74.090  1.00 50.03  ? 162  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 163 ? -2.194  51.855  72.893  1.00 51.75  ? 162  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 163 ? -1.193  51.166  71.972  1.00 50.22  ? 162  GLU A C   1 
ATOM   1295 O O   . GLU A 1 163 ? -0.869  51.691  70.902  1.00 51.29  ? 162  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 163 ? -2.771  53.102  72.207  1.00 55.06  ? 162  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 163 ? -3.700  53.968  73.078  1.00 59.52  ? 162  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 163 ? -2.989  54.671  74.238  1.00 62.42  ? 162  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 163 ? -2.048  55.454  73.974  1.00 63.71  ? 162  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 163 ? -3.376  54.450  75.413  1.00 62.29  ? 162  GLU A OE2 1 
ATOM   1301 N N   . VAL A 1 164 ? -0.739  49.974  72.366  1.00 47.42  ? 163  VAL A N   1 
ATOM   1302 C CA  . VAL A 1 164 ? 0.298   49.289  71.606  1.00 43.76  ? 163  VAL A CA  1 
ATOM   1303 C C   . VAL A 1 164 ? 0.159   47.783  71.356  1.00 41.12  ? 163  VAL A C   1 
ATOM   1304 O O   . VAL A 1 164 ? -0.321  47.033  72.203  1.00 41.97  ? 163  VAL A O   1 
ATOM   1305 C CB  . VAL A 1 164 ? 1.666   49.615  72.281  1.00 45.15  ? 163  VAL A CB  1 
ATOM   1306 C CG1 . VAL A 1 164 ? 2.359   48.360  72.764  1.00 45.17  ? 163  VAL A CG1 1 
ATOM   1307 C CG2 . VAL A 1 164 ? 2.527   50.417  71.329  1.00 46.09  ? 163  VAL A CG2 1 
ATOM   1308 N N   . VAL A 1 165 ? 0.596   47.359  70.172  1.00 37.08  ? 164  VAL A N   1 
ATOM   1309 C CA  . VAL A 1 165 ? 0.551   45.962  69.729  1.00 35.18  ? 164  VAL A CA  1 
ATOM   1310 C C   . VAL A 1 165 ? -0.848  45.496  69.344  1.00 35.01  ? 164  VAL A C   1 
ATOM   1311 O O   . VAL A 1 165 ? -1.813  45.700  70.073  1.00 34.36  ? 164  VAL A O   1 
ATOM   1312 C CB  . VAL A 1 165 ? 1.092   44.957  70.784  1.00 34.94  ? 164  VAL A CB  1 
ATOM   1313 C CG1 . VAL A 1 165 ? 1.153   43.573  70.162  1.00 33.19  ? 164  VAL A CG1 1 
ATOM   1314 C CG2 . VAL A 1 165 ? 2.490   45.363  71.277  1.00 35.28  ? 164  VAL A CG2 1 
ATOM   1315 N N   . THR A 1 166 ? -0.944  44.874  68.176  1.00 33.98  ? 165  THR A N   1 
ATOM   1316 C CA  . THR A 1 166 ? -2.204  44.364  67.680  1.00 32.09  ? 165  THR A CA  1 
ATOM   1317 C C   . THR A 1 166 ? -2.763  43.425  68.729  1.00 32.91  ? 165  THR A C   1 
ATOM   1318 O O   . THR A 1 166 ? -2.064  42.549  69.238  1.00 33.34  ? 165  THR A O   1 
ATOM   1319 C CB  . THR A 1 166 ? -2.003  43.614  66.351  1.00 32.83  ? 165  THR A CB  1 
ATOM   1320 O OG1 . THR A 1 166 ? -1.533  44.537  65.368  1.00 34.93  ? 165  THR A OG1 1 
ATOM   1321 C CG2 . THR A 1 166 ? -3.294  43.005  65.869  1.00 31.29  ? 165  THR A CG2 1 
ATOM   1322 N N   . LEU A 1 167 ? -4.037  43.622  69.041  1.00 32.90  ? 166  LEU A N   1 
ATOM   1323 C CA  . LEU A 1 167 ? -4.736  42.840  70.045  1.00 32.10  ? 166  LEU A CA  1 
ATOM   1324 C C   . LEU A 1 167 ? -4.419  41.340  70.085  1.00 31.10  ? 166  LEU A C   1 
ATOM   1325 O O   . LEU A 1 167 ? -4.128  40.802  71.147  1.00 31.50  ? 166  LEU A O   1 
ATOM   1326 C CB  . LEU A 1 167 ? -6.245  43.043  69.891  1.00 31.23  ? 166  LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 167 ? -7.103  42.424  70.989  1.00 32.02  ? 166  LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 167 ? -6.787  43.132  72.294  1.00 33.15  ? 166  LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 167 ? -8.571  42.541  70.648  1.00 30.09  ? 166  LEU A CD2 1 
ATOM   1330 N N   . TRP A 1 168 ? -4.468  40.667  68.946  1.00 30.06  ? 167  TRP A N   1 
ATOM   1331 C CA  . TRP A 1 168 ? -4.213  39.229  68.927  1.00 32.99  ? 167  TRP A CA  1 
ATOM   1332 C C   . TRP A 1 168 ? -2.824  38.796  69.348  1.00 34.23  ? 167  TRP A C   1 
ATOM   1333 O O   . TRP A 1 168 ? -2.627  37.646  69.749  1.00 33.97  ? 167  TRP A O   1 
ATOM   1334 C CB  . TRP A 1 168 ? -4.456  38.660  67.539  1.00 35.07  ? 167  TRP A CB  1 
ATOM   1335 C CG  . TRP A 1 168 ? -5.871  38.506  67.174  1.00 36.28  ? 167  TRP A CG  1 
ATOM   1336 C CD1 . TRP A 1 168 ? -6.973  38.859  67.915  1.00 35.19  ? 167  TRP A CD1 1 
ATOM   1337 C CD2 . TRP A 1 168 ? -6.361  37.924  65.970  1.00 37.14  ? 167  TRP A CD2 1 
ATOM   1338 N NE1 . TRP A 1 168 ? -8.117  38.525  67.236  1.00 36.49  ? 167  TRP A NE1 1 
ATOM   1339 C CE2 . TRP A 1 168 ? -7.772  37.948  66.039  1.00 36.73  ? 167  TRP A CE2 1 
ATOM   1340 C CE3 . TRP A 1 168 ? -5.743  37.380  64.837  1.00 36.17  ? 167  TRP A CE3 1 
ATOM   1341 C CZ2 . TRP A 1 168 ? -8.576  37.445  65.019  1.00 37.11  ? 167  TRP A CZ2 1 
ATOM   1342 C CZ3 . TRP A 1 168 ? -6.540  36.880  63.826  1.00 38.54  ? 167  TRP A CZ3 1 
ATOM   1343 C CH2 . TRP A 1 168 ? -7.946  36.915  63.925  1.00 37.56  ? 167  TRP A CH2 1 
ATOM   1344 N N   . TYR A 1 169 ? -1.862  39.705  69.239  1.00 32.57  ? 168  TYR A N   1 
ATOM   1345 C CA  . TYR A 1 169 ? -0.487  39.388  69.582  1.00 32.53  ? 168  TYR A CA  1 
ATOM   1346 C C   . TYR A 1 169 ? -0.010  40.245  70.748  1.00 33.82  ? 168  TYR A C   1 
ATOM   1347 O O   . TYR A 1 169 ? 1.194   40.332  70.994  1.00 34.17  ? 168  TYR A O   1 
ATOM   1348 C CB  . TYR A 1 169 ? 0.399   39.605  68.348  1.00 30.20  ? 168  TYR A CB  1 
ATOM   1349 C CG  . TYR A 1 169 ? -0.118  38.876  67.118  1.00 29.85  ? 168  TYR A CG  1 
ATOM   1350 C CD1 . TYR A 1 169 ? 0.125   37.513  66.935  1.00 32.00  ? 168  TYR A CD1 1 
ATOM   1351 C CD2 . TYR A 1 169 ? -0.929  39.524  66.187  1.00 29.30  ? 168  TYR A CD2 1 
ATOM   1352 C CE1 . TYR A 1 169 ? -0.430  36.820  65.862  1.00 30.52  ? 168  TYR A CE1 1 
ATOM   1353 C CE2 . TYR A 1 169 ? -1.492  38.839  65.121  1.00 26.52  ? 168  TYR A CE2 1 
ATOM   1354 C CZ  . TYR A 1 169 ? -1.242  37.490  64.962  1.00 30.21  ? 168  TYR A CZ  1 
ATOM   1355 O OH  . TYR A 1 169 ? -1.813  36.801  63.911  1.00 30.27  ? 168  TYR A OH  1 
ATOM   1356 N N   . ARG A 1 170 ? -0.960  40.854  71.469  1.00 33.08  ? 169  ARG A N   1 
ATOM   1357 C CA  . ARG A 1 170 ? -0.648  41.721  72.621  1.00 34.18  ? 169  ARG A CA  1 
ATOM   1358 C C   . ARG A 1 170 ? -0.497  40.954  73.922  1.00 33.77  ? 169  ARG A C   1 
ATOM   1359 O O   . ARG A 1 170 ? -1.367  40.176  74.296  1.00 34.56  ? 169  ARG A O   1 
ATOM   1360 C CB  . ARG A 1 170 ? -1.726  42.788  72.837  1.00 31.31  ? 169  ARG A CB  1 
ATOM   1361 C CG  . ARG A 1 170 ? -1.353  43.847  73.874  1.00 31.87  ? 169  ARG A CG  1 
ATOM   1362 C CD  . ARG A 1 170 ? -2.565  44.730  74.057  1.00 35.06  ? 169  ARG A CD  1 
ATOM   1363 N NE  . ARG A 1 170 ? -2.879  45.292  72.747  1.00 34.68  ? 169  ARG A NE  1 
ATOM   1364 C CZ  . ARG A 1 170 ? -3.967  45.982  72.427  1.00 31.94  ? 169  ARG A CZ  1 
ATOM   1365 N NH1 . ARG A 1 170 ? -4.894  46.233  73.329  1.00 30.83  ? 169  ARG A NH1 1 
ATOM   1366 N NH2 . ARG A 1 170 ? -4.145  46.371  71.173  1.00 31.88  ? 169  ARG A NH2 1 
ATOM   1367 N N   . ALA A 1 171 ? 0.596   41.227  74.622  1.00 34.83  ? 170  ALA A N   1 
ATOM   1368 C CA  . ALA A 1 171 ? 0.927   40.577  75.889  1.00 36.73  ? 170  ALA A CA  1 
ATOM   1369 C C   . ALA A 1 171 ? 0.071   40.978  77.099  1.00 35.85  ? 170  ALA A C   1 
ATOM   1370 O O   . ALA A 1 171 ? -0.383  42.116  77.215  1.00 37.80  ? 170  ALA A O   1 
ATOM   1371 C CB  . ALA A 1 171 ? 2.406   40.815  76.210  1.00 33.86  ? 170  ALA A CB  1 
ATOM   1372 N N   . PRO A 1 172 ? -0.113  40.043  78.043  1.00 35.82  ? 171  PRO A N   1 
ATOM   1373 C CA  . PRO A 1 172 ? -0.908  40.280  79.246  1.00 34.56  ? 171  PRO A CA  1 
ATOM   1374 C C   . PRO A 1 172 ? -0.510  41.487  80.059  1.00 33.48  ? 171  PRO A C   1 
ATOM   1375 O O   . PRO A 1 172 ? -1.376  42.145  80.630  1.00 35.38  ? 171  PRO A O   1 
ATOM   1376 C CB  . PRO A 1 172 ? -0.759  38.973  80.031  1.00 33.89  ? 171  PRO A CB  1 
ATOM   1377 C CG  . PRO A 1 172 ? 0.557   38.453  79.578  1.00 36.25  ? 171  PRO A CG  1 
ATOM   1378 C CD  . PRO A 1 172 ? 0.502   38.706  78.092  1.00 37.55  ? 171  PRO A CD  1 
ATOM   1379 N N   . GLU A 1 173 ? 0.782   41.789  80.126  1.00 31.75  ? 172  GLU A N   1 
ATOM   1380 C CA  . GLU A 1 173 ? 1.207   42.943  80.913  1.00 30.96  ? 172  GLU A CA  1 
ATOM   1381 C C   . GLU A 1 173 ? 0.721   44.248  80.289  1.00 30.02  ? 172  GLU A C   1 
ATOM   1382 O O   . GLU A 1 173 ? 0.626   45.273  80.962  1.00 30.22  ? 172  GLU A O   1 
ATOM   1383 C CB  . GLU A 1 173 ? 2.732   42.965  81.102  1.00 29.91  ? 172  GLU A CB  1 
ATOM   1384 C CG  . GLU A 1 173 ? 3.562   42.957  79.827  1.00 30.63  ? 172  GLU A CG  1 
ATOM   1385 C CD  . GLU A 1 173 ? 3.892   41.558  79.345  1.00 33.49  ? 172  GLU A CD  1 
ATOM   1386 O OE1 . GLU A 1 173 ? 5.007   41.370  78.800  1.00 34.97  ? 172  GLU A OE1 1 
ATOM   1387 O OE2 . GLU A 1 173 ? 3.045   40.652  79.498  1.00 30.87  ? 172  GLU A OE2 1 
ATOM   1388 N N   . ILE A 1 174 ? 0.416   44.231  79.000  1.00 31.09  ? 173  ILE A N   1 
ATOM   1389 C CA  . ILE A 1 174 ? -0.108  45.453  78.395  1.00 34.85  ? 173  ILE A CA  1 
ATOM   1390 C C   . ILE A 1 174 ? -1.628  45.450  78.655  1.00 35.51  ? 173  ILE A C   1 
ATOM   1391 O O   . ILE A 1 174 ? -2.192  46.448  79.099  1.00 35.13  ? 173  ILE A O   1 
ATOM   1392 C CB  . ILE A 1 174 ? 0.151   45.508  76.880  1.00 34.85  ? 173  ILE A CB  1 
ATOM   1393 C CG1 . ILE A 1 174 ? 1.655   45.643  76.604  1.00 32.81  ? 173  ILE A CG1 1 
ATOM   1394 C CG2 . ILE A 1 174 ? -0.606  46.679  76.283  1.00 33.88  ? 173  ILE A CG2 1 
ATOM   1395 C CD1 . ILE A 1 174 ? 2.045   45.374  75.150  1.00 30.78  ? 173  ILE A CD1 1 
ATOM   1396 N N   . LEU A 1 175 ? -2.271  44.307  78.407  1.00 35.30  ? 174  LEU A N   1 
ATOM   1397 C CA  . LEU A 1 175 ? -3.712  44.160  78.623  1.00 34.47  ? 174  LEU A CA  1 
ATOM   1398 C C   . LEU A 1 175 ? -4.092  44.457  80.064  1.00 34.48  ? 174  LEU A C   1 
ATOM   1399 O O   . LEU A 1 175 ? -5.183  44.970  80.321  1.00 33.41  ? 174  LEU A O   1 
ATOM   1400 C CB  . LEU A 1 175 ? -4.180  42.742  78.268  1.00 30.63  ? 174  LEU A CB  1 
ATOM   1401 C CG  . LEU A 1 175 ? -3.999  42.331  76.810  1.00 28.95  ? 174  LEU A CG  1 
ATOM   1402 C CD1 . LEU A 1 175 ? -4.313  40.851  76.626  1.00 27.08  ? 174  LEU A CD1 1 
ATOM   1403 C CD2 . LEU A 1 175 ? -4.888  43.197  75.954  1.00 28.01  ? 174  LEU A CD2 1 
ATOM   1404 N N   . LEU A 1 176 ? -3.197  44.144  81.001  1.00 33.05  ? 175  LEU A N   1 
ATOM   1405 C CA  . LEU A 1 176 ? -3.488  44.390  82.412  1.00 35.40  ? 175  LEU A CA  1 
ATOM   1406 C C   . LEU A 1 176 ? -3.080  45.771  82.895  1.00 37.05  ? 175  LEU A C   1 
ATOM   1407 O O   . LEU A 1 176 ? -3.271  46.099  84.063  1.00 38.80  ? 175  LEU A O   1 
ATOM   1408 C CB  . LEU A 1 176 ? -2.848  43.321  83.307  1.00 32.98  ? 175  LEU A CB  1 
ATOM   1409 C CG  . LEU A 1 176 ? -3.476  41.931  83.194  1.00 32.97  ? 175  LEU A CG  1 
ATOM   1410 C CD1 . LEU A 1 176 ? -2.852  41.014  84.207  1.00 29.61  ? 175  LEU A CD1 1 
ATOM   1411 C CD2 . LEU A 1 176 ? -4.999  42.021  83.404  1.00 33.76  ? 175  LEU A CD2 1 
ATOM   1412 N N   . GLY A 1 177 ? -2.514  46.573  81.999  1.00 38.09  ? 176  GLY A N   1 
ATOM   1413 C CA  . GLY A 1 177 ? -2.128  47.924  82.361  1.00 39.57  ? 176  GLY A CA  1 
ATOM   1414 C C   . GLY A 1 177 ? -0.869  48.147  83.180  1.00 41.74  ? 176  GLY A C   1 
ATOM   1415 O O   . GLY A 1 177 ? -0.768  49.161  83.871  1.00 41.78  ? 176  GLY A O   1 
ATOM   1416 N N   . CYS A 1 178 ? 0.090   47.225  83.126  1.00 43.48  ? 177  CYS A N   1 
ATOM   1417 C CA  . CYS A 1 178 ? 1.334   47.414  83.869  1.00 45.64  ? 177  CYS A CA  1 
ATOM   1418 C C   . CYS A 1 178 ? 1.916   48.742  83.385  1.00 46.00  ? 177  CYS A C   1 
ATOM   1419 O O   . CYS A 1 178 ? 1.956   49.007  82.179  1.00 44.86  ? 177  CYS A O   1 
ATOM   1420 C CB  . CYS A 1 178 ? 2.315   46.276  83.582  1.00 46.97  ? 177  CYS A CB  1 
ATOM   1421 S SG  . CYS A 1 178 ? 3.854   46.341  84.571  1.00 54.59  ? 177  CYS A SG  1 
ATOM   1422 N N   . LYS A 1 179 ? 2.358   49.582  84.311  1.00 46.07  ? 178  LYS A N   1 
ATOM   1423 C CA  . LYS A 1 179 ? 2.898   50.877  83.919  1.00 49.11  ? 178  LYS A CA  1 
ATOM   1424 C C   . LYS A 1 179 ? 4.272   50.802  83.253  1.00 47.68  ? 178  LYS A C   1 
ATOM   1425 O O   . LYS A 1 179 ? 4.761   51.785  82.710  1.00 47.95  ? 178  LYS A O   1 
ATOM   1426 C CB  . LYS A 1 179 ? 2.946   51.817  85.128  1.00 52.63  ? 178  LYS A CB  1 
ATOM   1427 C CG  . LYS A 1 179 ? 4.051   51.529  86.138  1.00 58.88  ? 178  LYS A CG  1 
ATOM   1428 C CD  . LYS A 1 179 ? 3.885   52.412  87.377  1.00 63.34  ? 178  LYS A CD  1 
ATOM   1429 C CE  . LYS A 1 179 ? 3.698   53.891  87.006  1.00 65.22  ? 178  LYS A CE  1 
ATOM   1430 N NZ  . LYS A 1 179 ? 3.402   54.750  88.199  1.00 66.51  ? 178  LYS A NZ  1 
ATOM   1431 N N   . TYR A 1 180 ? 4.893   49.635  83.298  1.00 46.91  ? 179  TYR A N   1 
ATOM   1432 C CA  . TYR A 1 180 ? 6.195   49.449  82.677  1.00 47.79  ? 179  TYR A CA  1 
ATOM   1433 C C   . TYR A 1 180 ? 6.183   48.156  81.894  1.00 45.99  ? 179  TYR A C   1 
ATOM   1434 O O   . TYR A 1 180 ? 5.895   47.101  82.447  1.00 48.70  ? 179  TYR A O   1 
ATOM   1435 C CB  . TYR A 1 180 ? 7.310   49.353  83.725  1.00 50.58  ? 179  TYR A CB  1 
ATOM   1436 C CG  . TYR A 1 180 ? 7.517   50.589  84.577  1.00 55.65  ? 179  TYR A CG  1 
ATOM   1437 C CD1 . TYR A 1 180 ? 7.787   51.829  83.994  1.00 57.42  ? 179  TYR A CD1 1 
ATOM   1438 C CD2 . TYR A 1 180 ? 7.470   50.513  85.971  1.00 56.40  ? 179  TYR A CD2 1 
ATOM   1439 C CE1 . TYR A 1 180 ? 8.003   52.960  84.779  1.00 59.30  ? 179  TYR A CE1 1 
ATOM   1440 C CE2 . TYR A 1 180 ? 7.686   51.636  86.761  1.00 58.55  ? 179  TYR A CE2 1 
ATOM   1441 C CZ  . TYR A 1 180 ? 7.951   52.855  86.159  1.00 60.00  ? 179  TYR A CZ  1 
ATOM   1442 O OH  . TYR A 1 180 ? 8.165   53.971  86.934  1.00 62.63  ? 179  TYR A OH  1 
ATOM   1443 N N   . TYR A 1 181 ? 6.477   48.235  80.605  1.00 43.05  ? 180  TYR A N   1 
ATOM   1444 C CA  . TYR A 1 181 ? 6.540   47.041  79.790  1.00 38.28  ? 180  TYR A CA  1 
ATOM   1445 C C   . TYR A 1 181 ? 7.797   47.172  78.971  1.00 36.84  ? 180  TYR A C   1 
ATOM   1446 O O   . TYR A 1 181 ? 8.235   48.284  78.695  1.00 37.26  ? 180  TYR A O   1 
ATOM   1447 C CB  . TYR A 1 181 ? 5.310   46.916  78.890  1.00 38.23  ? 180  TYR A CB  1 
ATOM   1448 C CG  . TYR A 1 181 ? 5.209   47.920  77.764  1.00 38.21  ? 180  TYR A CG  1 
ATOM   1449 C CD1 . TYR A 1 181 ? 5.921   47.745  76.586  1.00 37.74  ? 180  TYR A CD1 1 
ATOM   1450 C CD2 . TYR A 1 181 ? 4.369   49.027  77.866  1.00 38.60  ? 180  TYR A CD2 1 
ATOM   1451 C CE1 . TYR A 1 181 ? 5.800   48.638  75.532  1.00 38.90  ? 180  TYR A CE1 1 
ATOM   1452 C CE2 . TYR A 1 181 ? 4.242   49.934  76.819  1.00 38.72  ? 180  TYR A CE2 1 
ATOM   1453 C CZ  . TYR A 1 181 ? 4.959   49.731  75.654  1.00 39.20  ? 180  TYR A CZ  1 
ATOM   1454 O OH  . TYR A 1 181 ? 4.835   50.615  74.608  1.00 38.68  ? 180  TYR A OH  1 
ATOM   1455 N N   . SER A 1 182 ? 8.389   46.042  78.603  1.00 36.06  ? 181  SER A N   1 
ATOM   1456 C CA  . SER A 1 182 ? 9.606   46.065  77.820  1.00 35.10  ? 181  SER A CA  1 
ATOM   1457 C C   . SER A 1 182 ? 9.668   45.024  76.713  1.00 34.82  ? 181  SER A C   1 
ATOM   1458 O O   . SER A 1 182 ? 8.660   44.687  76.089  1.00 34.38  ? 181  SER A O   1 
ATOM   1459 C CB  . SER A 1 182 ? 10.830  45.905  78.728  1.00 35.79  ? 181  SER A CB  1 
ATOM   1460 O OG  . SER A 1 182 ? 12.018  46.286  78.040  1.00 38.12  ? 181  SER A OG  1 
ATOM   1461 N N   . THR A 1 183 ? 10.883  44.528  76.492  1.00 33.45  ? 182  THR A N   1 
ATOM   1462 C CA  . THR A 1 183 ? 11.206  43.566  75.452  1.00 31.39  ? 182  THR A CA  1 
ATOM   1463 C C   . THR A 1 183 ? 10.392  42.283  75.462  1.00 30.59  ? 182  THR A C   1 
ATOM   1464 O O   . THR A 1 183 ? 10.200  41.655  74.417  1.00 29.66  ? 182  THR A O   1 
ATOM   1465 C CB  . THR A 1 183 ? 12.726  43.225  75.504  1.00 33.49  ? 182  THR A CB  1 
ATOM   1466 O OG1 . THR A 1 183 ? 13.093  42.858  76.843  1.00 33.95  ? 182  THR A OG1 1 
ATOM   1467 C CG2 . THR A 1 183 ? 13.564  44.436  75.086  1.00 31.49  ? 182  THR A CG2 1 
ATOM   1468 N N   . ALA A 1 184 ? 9.913   41.892  76.636  1.00 29.38  ? 183  ALA A N   1 
ATOM   1469 C CA  . ALA A 1 184 ? 9.129   40.678  76.753  1.00 27.91  ? 183  ALA A CA  1 
ATOM   1470 C C   . ALA A 1 184 ? 7.859   40.729  75.915  1.00 28.55  ? 183  ALA A C   1 
ATOM   1471 O O   . ALA A 1 184 ? 7.344   39.677  75.537  1.00 29.06  ? 183  ALA A O   1 
ATOM   1472 C CB  . ALA A 1 184 ? 8.786   40.412  78.218  1.00 28.55  ? 183  ALA A CB  1 
ATOM   1473 N N   . VAL A 1 185 ? 7.355   41.933  75.612  1.00 26.85  ? 184  VAL A N   1 
ATOM   1474 C CA  . VAL A 1 185 ? 6.129   42.027  74.817  1.00 29.43  ? 184  VAL A CA  1 
ATOM   1475 C C   . VAL A 1 185 ? 6.367   41.570  73.383  1.00 30.30  ? 184  VAL A C   1 
ATOM   1476 O O   . VAL A 1 185 ? 5.451   41.084  72.723  1.00 32.17  ? 184  VAL A O   1 
ATOM   1477 C CB  . VAL A 1 185 ? 5.497   43.476  74.791  1.00 28.38  ? 184  VAL A CB  1 
ATOM   1478 C CG1 . VAL A 1 185 ? 5.331   44.008  76.201  1.00 24.18  ? 184  VAL A CG1 1 
ATOM   1479 C CG2 . VAL A 1 185 ? 6.323   44.408  73.935  1.00 28.65  ? 184  VAL A CG2 1 
ATOM   1480 N N   . ASP A 1 186 ? 7.590   41.722  72.893  1.00 32.14  ? 185  ASP A N   1 
ATOM   1481 C CA  . ASP A 1 186 ? 7.869   41.275  71.535  1.00 34.44  ? 185  ASP A CA  1 
ATOM   1482 C C   . ASP A 1 186 ? 7.981   39.755  71.529  1.00 34.53  ? 185  ASP A C   1 
ATOM   1483 O O   . ASP A 1 186 ? 7.702   39.114  70.509  1.00 35.79  ? 185  ASP A O   1 
ATOM   1484 C CB  . ASP A 1 186 ? 9.157   41.909  70.972  1.00 34.20  ? 185  ASP A CB  1 
ATOM   1485 C CG  . ASP A 1 186 ? 8.941   43.335  70.449  1.00 36.52  ? 185  ASP A CG  1 
ATOM   1486 O OD1 . ASP A 1 186 ? 7.853   43.623  69.906  1.00 39.22  ? 185  ASP A OD1 1 
ATOM   1487 O OD2 . ASP A 1 186 ? 9.864   44.167  70.559  1.00 35.61  ? 185  ASP A OD2 1 
ATOM   1488 N N   . ILE A 1 187 ? 8.386   39.182  72.667  1.00 32.88  ? 186  ILE A N   1 
ATOM   1489 C CA  . ILE A 1 187 ? 8.521   37.733  72.773  1.00 31.51  ? 186  ILE A CA  1 
ATOM   1490 C C   . ILE A 1 187 ? 7.132   37.118  72.783  1.00 31.97  ? 186  ILE A C   1 
ATOM   1491 O O   . ILE A 1 187 ? 6.889   36.097  72.133  1.00 29.65  ? 186  ILE A O   1 
ATOM   1492 C CB  . ILE A 1 187 ? 9.295   37.297  74.054  1.00 32.91  ? 186  ILE A CB  1 
ATOM   1493 C CG1 . ILE A 1 187 ? 10.780  37.680  73.943  1.00 29.39  ? 186  ILE A CG1 1 
ATOM   1494 C CG2 . ILE A 1 187 ? 9.212   35.777  74.224  1.00 33.25  ? 186  ILE A CG2 1 
ATOM   1495 C CD1 . ILE A 1 187 ? 11.501  36.999  72.787  1.00 27.96  ? 186  ILE A CD1 1 
ATOM   1496 N N   . TRP A 1 188 ? 6.213   37.755  73.507  1.00 33.69  ? 187  TRP A N   1 
ATOM   1497 C CA  . TRP A 1 188 ? 4.843   37.263  73.558  1.00 32.24  ? 187  TRP A CA  1 
ATOM   1498 C C   . TRP A 1 188 ? 4.333   37.143  72.129  1.00 31.78  ? 187  TRP A C   1 
ATOM   1499 O O   . TRP A 1 188 ? 3.808   36.098  71.730  1.00 32.22  ? 187  TRP A O   1 
ATOM   1500 C CB  . TRP A 1 188 ? 3.946   38.211  74.359  1.00 32.34  ? 187  TRP A CB  1 
ATOM   1501 C CG  . TRP A 1 188 ? 2.531   37.700  74.482  1.00 37.27  ? 187  TRP A CG  1 
ATOM   1502 C CD1 . TRP A 1 188 ? 1.533   37.804  73.550  1.00 37.49  ? 187  TRP A CD1 1 
ATOM   1503 C CD2 . TRP A 1 188 ? 2.014   36.863  75.525  1.00 37.73  ? 187  TRP A CD2 1 
ATOM   1504 N NE1 . TRP A 1 188 ? 0.441   37.070  73.942  1.00 37.74  ? 187  TRP A NE1 1 
ATOM   1505 C CE2 . TRP A 1 188 ? 0.710   36.483  75.150  1.00 38.77  ? 187  TRP A CE2 1 
ATOM   1506 C CE3 . TRP A 1 188 ? 2.532   36.393  76.741  1.00 38.03  ? 187  TRP A CE3 1 
ATOM   1507 C CZ2 . TRP A 1 188 ? -0.084  35.651  75.945  1.00 40.40  ? 187  TRP A CZ2 1 
ATOM   1508 C CZ3 . TRP A 1 188 ? 1.748   35.571  77.530  1.00 37.81  ? 187  TRP A CZ3 1 
ATOM   1509 C CH2 . TRP A 1 188 ? 0.453   35.206  77.130  1.00 40.32  ? 187  TRP A CH2 1 
ATOM   1510 N N   . SER A 1 189 ? 4.507   38.208  71.352  1.00 31.07  ? 188  SER A N   1 
ATOM   1511 C CA  . SER A 1 189 ? 4.058   38.203  69.964  1.00 32.57  ? 188  SER A CA  1 
ATOM   1512 C C   . SER A 1 189 ? 4.652   37.017  69.218  1.00 33.33  ? 188  SER A C   1 
ATOM   1513 O O   . SER A 1 189 ? 3.929   36.296  68.528  1.00 34.54  ? 188  SER A O   1 
ATOM   1514 C CB  . SER A 1 189 ? 4.436   39.514  69.251  1.00 31.81  ? 188  SER A CB  1 
ATOM   1515 O OG  . SER A 1 189 ? 3.841   40.639  69.877  1.00 28.50  ? 188  SER A OG  1 
ATOM   1516 N N   . LEU A 1 190 ? 5.959   36.796  69.371  1.00 34.67  ? 189  LEU A N   1 
ATOM   1517 C CA  . LEU A 1 190 ? 6.615   35.683  68.684  1.00 34.59  ? 189  LEU A CA  1 
ATOM   1518 C C   . LEU A 1 190 ? 6.109   34.321  69.104  1.00 33.27  ? 189  LEU A C   1 
ATOM   1519 O O   . LEU A 1 190 ? 6.061   33.406  68.291  1.00 33.69  ? 189  LEU A O   1 
ATOM   1520 C CB  . LEU A 1 190 ? 8.131   35.742  68.850  1.00 35.73  ? 189  LEU A CB  1 
ATOM   1521 C CG  . LEU A 1 190 ? 8.829   36.507  67.721  1.00 39.61  ? 189  LEU A CG  1 
ATOM   1522 C CD1 . LEU A 1 190 ? 10.346  36.269  67.802  1.00 40.09  ? 189  LEU A CD1 1 
ATOM   1523 C CD2 . LEU A 1 190 ? 8.289   36.022  66.368  1.00 38.54  ? 189  LEU A CD2 1 
ATOM   1524 N N   . GLY A 1 191 ? 5.734   34.182  70.369  1.00 32.86  ? 190  GLY A N   1 
ATOM   1525 C CA  . GLY A 1 191 ? 5.206   32.911  70.826  1.00 34.60  ? 190  GLY A CA  1 
ATOM   1526 C C   . GLY A 1 191 ? 3.860   32.660  70.151  1.00 36.48  ? 190  GLY A C   1 
ATOM   1527 O O   . GLY A 1 191 ? 3.546   31.529  69.769  1.00 36.99  ? 190  GLY A O   1 
ATOM   1528 N N   . CYS A 1 192 ? 3.066   33.722  69.992  1.00 35.62  ? 191  CYS A N   1 
ATOM   1529 C CA  . CYS A 1 192 ? 1.763   33.604  69.343  1.00 33.87  ? 191  CYS A CA  1 
ATOM   1530 C C   . CYS A 1 192 ? 1.928   33.254  67.867  1.00 33.66  ? 191  CYS A C   1 
ATOM   1531 O O   . CYS A 1 192 ? 1.129   32.501  67.304  1.00 33.39  ? 191  CYS A O   1 
ATOM   1532 C CB  . CYS A 1 192 ? 0.981   34.911  69.469  1.00 32.68  ? 191  CYS A CB  1 
ATOM   1533 S SG  . CYS A 1 192 ? 0.486   35.318  71.153  1.00 34.32  ? 191  CYS A SG  1 
ATOM   1534 N N   . ILE A 1 193 ? 2.967   33.805  67.244  1.00 32.96  ? 192  ILE A N   1 
ATOM   1535 C CA  . ILE A 1 193 ? 3.228   33.544  65.836  1.00 33.62  ? 192  ILE A CA  1 
ATOM   1536 C C   . ILE A 1 193 ? 3.779   32.131  65.641  1.00 35.55  ? 192  ILE A C   1 
ATOM   1537 O O   . ILE A 1 193 ? 3.488   31.476  64.642  1.00 36.89  ? 192  ILE A O   1 
ATOM   1538 C CB  . ILE A 1 193 ? 4.232   34.556  65.251  1.00 30.27  ? 192  ILE A CB  1 
ATOM   1539 C CG1 . ILE A 1 193 ? 3.690   35.975  65.428  1.00 28.96  ? 192  ILE A CG1 1 
ATOM   1540 C CG2 . ILE A 1 193 ? 4.456   34.267  63.779  1.00 28.49  ? 192  ILE A CG2 1 
ATOM   1541 C CD1 . ILE A 1 193 ? 4.544   37.050  64.808  1.00 26.55  ? 192  ILE A CD1 1 
ATOM   1542 N N   . PHE A 1 194 ? 4.584   31.679  66.596  1.00 35.78  ? 193  PHE A N   1 
ATOM   1543 C CA  . PHE A 1 194 ? 5.164   30.340  66.552  1.00 35.50  ? 193  PHE A CA  1 
ATOM   1544 C C   . PHE A 1 194 ? 3.978   29.395  66.607  1.00 36.91  ? 193  PHE A C   1 
ATOM   1545 O O   . PHE A 1 194 ? 3.821   28.521  65.742  1.00 36.45  ? 193  PHE A O   1 
ATOM   1546 C CB  . PHE A 1 194 ? 6.096   30.137  67.762  1.00 33.45  ? 193  PHE A CB  1 
ATOM   1547 C CG  . PHE A 1 194 ? 6.660   28.746  67.890  1.00 30.49  ? 193  PHE A CG  1 
ATOM   1548 C CD1 . PHE A 1 194 ? 6.733   27.888  66.788  1.00 29.10  ? 193  PHE A CD1 1 
ATOM   1549 C CD2 . PHE A 1 194 ? 7.121   28.290  69.127  1.00 28.01  ? 193  PHE A CD2 1 
ATOM   1550 C CE1 . PHE A 1 194 ? 7.250   26.599  66.920  1.00 25.45  ? 193  PHE A CE1 1 
ATOM   1551 C CE2 . PHE A 1 194 ? 7.644   27.003  69.271  1.00 23.50  ? 193  PHE A CE2 1 
ATOM   1552 C CZ  . PHE A 1 194 ? 7.706   26.157  68.168  1.00 23.50  ? 193  PHE A CZ  1 
ATOM   1553 N N   . ALA A 1 195 ? 3.128   29.600  67.615  1.00 37.68  ? 194  ALA A N   1 
ATOM   1554 C CA  . ALA A 1 195 ? 1.930   28.781  67.795  1.00 36.88  ? 194  ALA A CA  1 
ATOM   1555 C C   . ALA A 1 195 ? 1.114   28.815  66.510  1.00 37.79  ? 194  ALA A C   1 
ATOM   1556 O O   . ALA A 1 195 ? 0.721   27.781  65.981  1.00 39.63  ? 194  ALA A O   1 
ATOM   1557 C CB  . ALA A 1 195 ? 1.099   29.313  68.957  1.00 32.36  ? 194  ALA A CB  1 
ATOM   1558 N N   . GLU A 1 196 ? 0.897   30.016  65.992  1.00 39.87  ? 195  GLU A N   1 
ATOM   1559 C CA  . GLU A 1 196 ? 0.109   30.183  64.784  1.00 40.60  ? 195  GLU A CA  1 
ATOM   1560 C C   . GLU A 1 196 ? 0.666   29.451  63.578  1.00 41.29  ? 195  GLU A C   1 
ATOM   1561 O O   . GLU A 1 196 ? -0.103  28.950  62.772  1.00 42.27  ? 195  GLU A O   1 
ATOM   1562 C CB  . GLU A 1 196 ? -0.062  31.677  64.445  1.00 41.13  ? 195  GLU A CB  1 
ATOM   1563 C CG  . GLU A 1 196 ? -1.329  31.987  63.638  1.00 38.18  ? 195  GLU A CG  1 
ATOM   1564 C CD  . GLU A 1 196 ? -1.564  33.475  63.403  1.00 38.98  ? 195  GLU A CD  1 
ATOM   1565 O OE1 . GLU A 1 196 ? -1.359  34.271  64.339  1.00 35.23  ? 195  GLU A OE1 1 
ATOM   1566 O OE2 . GLU A 1 196 ? -1.982  33.847  62.283  1.00 39.64  ? 195  GLU A OE2 1 
ATOM   1567 N N   . MET A 1 197 ? 1.986   29.376  63.439  1.00 43.69  ? 196  MET A N   1 
ATOM   1568 C CA  . MET A 1 197 ? 2.550   28.702  62.268  1.00 45.88  ? 196  MET A CA  1 
ATOM   1569 C C   . MET A 1 197 ? 2.298   27.208  62.298  1.00 49.19  ? 196  MET A C   1 
ATOM   1570 O O   . MET A 1 197 ? 2.169   26.575  61.250  1.00 48.75  ? 196  MET A O   1 
ATOM   1571 C CB  . MET A 1 197 ? 4.059   28.939  62.150  1.00 45.34  ? 196  MET A CB  1 
ATOM   1572 C CG  . MET A 1 197 ? 4.469   30.327  61.697  1.00 44.14  ? 196  MET A CG  1 
ATOM   1573 S SD  . MET A 1 197 ? 6.224   30.393  61.262  1.00 45.16  ? 196  MET A SD  1 
ATOM   1574 C CE  . MET A 1 197 ? 6.962   30.396  62.851  1.00 42.20  ? 196  MET A CE  1 
ATOM   1575 N N   . VAL A 1 198 ? 2.223   26.655  63.504  1.00 51.87  ? 197  VAL A N   1 
ATOM   1576 C CA  . VAL A 1 198 ? 2.008   25.228  63.685  1.00 55.44  ? 197  VAL A CA  1 
ATOM   1577 C C   . VAL A 1 198 ? 0.589   24.767  63.358  1.00 57.63  ? 197  VAL A C   1 
ATOM   1578 O O   . VAL A 1 198 ? 0.383   23.971  62.432  1.00 57.53  ? 197  VAL A O   1 
ATOM   1579 C CB  . VAL A 1 198 ? 2.338   24.798  65.134  1.00 55.48  ? 197  VAL A CB  1 
ATOM   1580 C CG1 . VAL A 1 198 ? 2.083   23.307  65.304  1.00 54.15  ? 197  VAL A CG1 1 
ATOM   1581 C CG2 . VAL A 1 198 ? 3.786   25.128  65.454  1.00 54.70  ? 197  VAL A CG2 1 
ATOM   1582 N N   . THR A 1 199 ? -0.376  25.267  64.131  1.00 58.89  ? 198  THR A N   1 
ATOM   1583 C CA  . THR A 1 199 ? -1.787  24.911  63.970  1.00 58.81  ? 198  THR A CA  1 
ATOM   1584 C C   . THR A 1 199 ? -2.461  25.590  62.780  1.00 59.50  ? 198  THR A C   1 
ATOM   1585 O O   . THR A 1 199 ? -3.450  25.090  62.249  1.00 61.66  ? 198  THR A O   1 
ATOM   1586 C CB  . THR A 1 199 ? -2.600  25.274  65.228  1.00 57.49  ? 198  THR A CB  1 
ATOM   1587 O OG1 . THR A 1 199 ? -2.541  26.687  65.437  1.00 54.44  ? 198  THR A OG1 1 
ATOM   1588 C CG2 . THR A 1 199 ? -2.052  24.562  66.452  1.00 57.07  ? 198  THR A CG2 1 
ATOM   1589 N N   . ARG A 1 200 ? -1.932  26.736  62.378  1.00 60.02  ? 199  ARG A N   1 
ATOM   1590 C CA  . ARG A 1 200 ? -2.476  27.498  61.257  1.00 60.50  ? 199  ARG A CA  1 
ATOM   1591 C C   . ARG A 1 200 ? -3.608  28.476  61.588  1.00 59.30  ? 199  ARG A C   1 
ATOM   1592 O O   . ARG A 1 200 ? -4.207  29.057  60.685  1.00 59.12  ? 199  ARG A O   1 
ATOM   1593 C CB  . ARG A 1 200 ? -2.925  26.562  60.136  1.00 60.36  ? 199  ARG A CB  1 
ATOM   1594 C CG  . ARG A 1 200 ? -1.824  26.231  59.149  1.00 62.97  ? 199  ARG A CG  1 
ATOM   1595 C CD  . ARG A 1 200 ? -2.335  26.386  57.727  1.00 63.55  ? 199  ARG A CD  1 
ATOM   1596 N NE  . ARG A 1 200 ? -2.152  25.170  56.938  1.00 66.32  ? 199  ARG A NE  1 
ATOM   1597 C CZ  . ARG A 1 200 ? -2.596  23.965  57.293  1.00 67.32  ? 199  ARG A CZ  1 
ATOM   1598 N NH1 . ARG A 1 200 ? -2.384  22.917  56.507  1.00 67.45  ? 199  ARG A NH1 1 
ATOM   1599 N NH2 . ARG A 1 200 ? -3.247  23.799  58.437  1.00 69.09  ? 199  ARG A NH2 1 
ATOM   1600 N N   . ARG A 1 201 ? -3.901  28.667  62.872  1.00 57.89  ? 200  ARG A N   1 
ATOM   1601 C CA  . ARG A 1 201 ? -4.943  29.612  63.255  1.00 56.03  ? 200  ARG A CA  1 
ATOM   1602 C C   . ARG A 1 201 ? -4.668  30.310  64.586  1.00 53.34  ? 200  ARG A C   1 
ATOM   1603 O O   . ARG A 1 201 ? -4.556  29.670  65.629  1.00 54.46  ? 200  ARG A O   1 
ATOM   1604 C CB  . ARG A 1 201 ? -6.313  28.929  63.277  1.00 58.53  ? 200  ARG A CB  1 
ATOM   1605 C CG  . ARG A 1 201 ? -6.453  27.739  64.198  1.00 63.16  ? 200  ARG A CG  1 
ATOM   1606 C CD  . ARG A 1 201 ? -7.830  27.118  63.999  1.00 68.28  ? 200  ARG A CD  1 
ATOM   1607 N NE  . ARG A 1 201 ? -8.074  25.958  64.852  1.00 72.43  ? 200  ARG A NE  1 
ATOM   1608 C CZ  . ARG A 1 201 ? -9.225  25.291  64.890  1.00 74.50  ? 200  ARG A CZ  1 
ATOM   1609 N NH1 . ARG A 1 201 ? -10.241 25.667  64.122  1.00 74.65  ? 200  ARG A NH1 1 
ATOM   1610 N NH2 . ARG A 1 201 ? -9.368  24.253  65.704  1.00 77.70  ? 200  ARG A NH2 1 
ATOM   1611 N N   . ALA A 1 202 ? -4.565  31.634  64.521  1.00 48.57  ? 201  ALA A N   1 
ATOM   1612 C CA  . ALA A 1 202 ? -4.285  32.496  65.668  1.00 43.86  ? 201  ALA A CA  1 
ATOM   1613 C C   . ALA A 1 202 ? -4.527  31.866  67.025  1.00 41.80  ? 201  ALA A C   1 
ATOM   1614 O O   . ALA A 1 202 ? -5.611  31.387  67.316  1.00 43.18  ? 201  ALA A O   1 
ATOM   1615 C CB  . ALA A 1 202 ? -5.083  33.795  65.550  1.00 40.57  ? 201  ALA A CB  1 
ATOM   1616 N N   . LEU A 1 203 ? -3.505  31.891  67.866  1.00 42.37  ? 202  LEU A N   1 
ATOM   1617 C CA  . LEU A 1 203 ? -3.593  31.323  69.201  1.00 40.97  ? 202  LEU A CA  1 
ATOM   1618 C C   . LEU A 1 203 ? -4.687  31.953  70.063  1.00 39.28  ? 202  LEU A C   1 
ATOM   1619 O O   . LEU A 1 203 ? -5.496  31.236  70.624  1.00 41.94  ? 202  LEU A O   1 
ATOM   1620 C CB  . LEU A 1 203 ? -2.242  31.440  69.904  1.00 39.66  ? 202  LEU A CB  1 
ATOM   1621 C CG  . LEU A 1 203 ? -2.065  30.531  71.122  1.00 42.83  ? 202  LEU A CG  1 
ATOM   1622 C CD1 . LEU A 1 203 ? -2.165  29.072  70.685  1.00 40.62  ? 202  LEU A CD1 1 
ATOM   1623 C CD2 . LEU A 1 203 ? -0.713  30.802  71.779  1.00 41.02  ? 202  LEU A CD2 1 
ATOM   1624 N N   . PHE A 1 204 ? -4.706  33.277  70.182  1.00 39.46  ? 203  PHE A N   1 
ATOM   1625 C CA  . PHE A 1 204 ? -5.718  33.970  70.996  1.00 41.10  ? 203  PHE A CA  1 
ATOM   1626 C C   . PHE A 1 204 ? -6.434  35.036  70.170  1.00 41.84  ? 203  PHE A C   1 
ATOM   1627 O O   . PHE A 1 204 ? -6.068  36.205  70.235  1.00 43.47  ? 203  PHE A O   1 
ATOM   1628 C CB  . PHE A 1 204 ? -5.078  34.686  72.191  1.00 39.98  ? 203  PHE A CB  1 
ATOM   1629 C CG  . PHE A 1 204 ? -4.203  33.815  73.042  1.00 42.09  ? 203  PHE A CG  1 
ATOM   1630 C CD1 . PHE A 1 204 ? -4.710  32.679  73.657  1.00 41.73  ? 203  PHE A CD1 1 
ATOM   1631 C CD2 . PHE A 1 204 ? -2.869  34.152  73.251  1.00 41.69  ? 203  PHE A CD2 1 
ATOM   1632 C CE1 . PHE A 1 204 ? -3.903  31.895  74.469  1.00 41.65  ? 203  PHE A CE1 1 
ATOM   1633 C CE2 . PHE A 1 204 ? -2.057  33.374  74.058  1.00 40.60  ? 203  PHE A CE2 1 
ATOM   1634 C CZ  . PHE A 1 204 ? -2.574  32.244  74.669  1.00 41.48  ? 203  PHE A CZ  1 
ATOM   1635 N N   . PRO A 1 205 ? -7.481  34.663  69.417  1.00 41.92  ? 204  PRO A N   1 
ATOM   1636 C CA  . PRO A 1 205 ? -8.168  35.675  68.612  1.00 42.42  ? 204  PRO A CA  1 
ATOM   1637 C C   . PRO A 1 205 ? -9.345  36.387  69.267  1.00 45.10  ? 204  PRO A C   1 
ATOM   1638 O O   . PRO A 1 205 ? -10.447 36.369  68.736  1.00 46.77  ? 204  PRO A O   1 
ATOM   1639 C CB  . PRO A 1 205 ? -8.594  34.884  67.395  1.00 42.69  ? 204  PRO A CB  1 
ATOM   1640 C CG  . PRO A 1 205 ? -9.012  33.588  68.016  1.00 41.53  ? 204  PRO A CG  1 
ATOM   1641 C CD  . PRO A 1 205 ? -7.925  33.307  69.040  1.00 41.93  ? 204  PRO A CD  1 
ATOM   1642 N N   . GLY A 1 206 ? -9.121  37.025  70.409  1.00 46.77  ? 205  GLY A N   1 
ATOM   1643 C CA  . GLY A 1 206 ? -10.212 37.729  71.061  1.00 48.03  ? 205  GLY A CA  1 
ATOM   1644 C C   . GLY A 1 206 ? -10.663 38.882  70.194  1.00 49.60  ? 205  GLY A C   1 
ATOM   1645 O O   . GLY A 1 206 ? -10.067 39.127  69.142  1.00 50.47  ? 205  GLY A O   1 
ATOM   1646 N N   . ASP A 1 207 ? -11.718 39.582  70.601  1.00 50.64  ? 206  ASP A N   1 
ATOM   1647 C CA  . ASP A 1 207 ? -12.184 40.729  69.821  1.00 51.69  ? 206  ASP A CA  1 
ATOM   1648 C C   . ASP A 1 207 ? -12.381 41.952  70.711  1.00 48.13  ? 206  ASP A C   1 
ATOM   1649 O O   . ASP A 1 207 ? -12.929 42.966  70.288  1.00 47.88  ? 206  ASP A O   1 
ATOM   1650 C CB  . ASP A 1 207 ? -13.476 40.396  69.060  1.00 55.39  ? 206  ASP A CB  1 
ATOM   1651 C CG  . ASP A 1 207 ? -14.563 39.872  69.961  1.00 60.83  ? 206  ASP A CG  1 
ATOM   1652 O OD1 . ASP A 1 207 ? -14.920 40.579  70.934  1.00 63.39  ? 206  ASP A OD1 1 
ATOM   1653 O OD2 . ASP A 1 207 ? -15.060 38.754  69.693  1.00 62.24  ? 206  ASP A OD2 1 
ATOM   1654 N N   . SER A 1 208 ? -11.909 41.835  71.947  1.00 44.06  ? 207  SER A N   1 
ATOM   1655 C CA  . SER A 1 208 ? -11.978 42.905  72.928  1.00 39.84  ? 207  SER A CA  1 
ATOM   1656 C C   . SER A 1 208 ? -10.894 42.589  73.938  1.00 38.21  ? 207  SER A C   1 
ATOM   1657 O O   . SER A 1 208 ? -10.488 41.439  74.083  1.00 36.51  ? 207  SER A O   1 
ATOM   1658 C CB  . SER A 1 208 ? -13.338 42.932  73.620  1.00 37.79  ? 207  SER A CB  1 
ATOM   1659 O OG  . SER A 1 208 ? -13.454 41.877  74.556  1.00 39.86  ? 207  SER A OG  1 
ATOM   1660 N N   . GLU A 1 209 ? -10.420 43.598  74.644  1.00 38.17  ? 208  GLU A N   1 
ATOM   1661 C CA  . GLU A 1 209 ? -9.367  43.359  75.608  1.00 40.77  ? 208  GLU A CA  1 
ATOM   1662 C C   . GLU A 1 209 ? -9.736  42.319  76.654  1.00 40.34  ? 208  GLU A C   1 
ATOM   1663 O O   . GLU A 1 209 ? -8.957  41.405  76.924  1.00 40.92  ? 208  GLU A O   1 
ATOM   1664 C CB  . GLU A 1 209 ? -8.956  44.673  76.253  1.00 43.18  ? 208  GLU A CB  1 
ATOM   1665 C CG  . GLU A 1 209 ? -8.053  45.479  75.343  1.00 49.44  ? 208  GLU A CG  1 
ATOM   1666 C CD  . GLU A 1 209 ? -7.864  46.902  75.801  1.00 52.68  ? 208  GLU A CD  1 
ATOM   1667 O OE1 . GLU A 1 209 ? -7.558  47.113  76.997  1.00 53.27  ? 208  GLU A OE1 1 
ATOM   1668 O OE2 . GLU A 1 209 ? -8.016  47.807  74.948  1.00 55.49  ? 208  GLU A OE2 1 
ATOM   1669 N N   . ILE A 1 210 ? -10.924 42.439  77.230  1.00 38.89  ? 209  ILE A N   1 
ATOM   1670 C CA  . ILE A 1 210 ? -11.349 41.485  78.235  1.00 38.79  ? 209  ILE A CA  1 
ATOM   1671 C C   . ILE A 1 210 ? -11.520 40.092  77.613  1.00 38.04  ? 209  ILE A C   1 
ATOM   1672 O O   . ILE A 1 210 ? -11.264 39.077  78.262  1.00 38.69  ? 209  ILE A O   1 
ATOM   1673 C CB  . ILE A 1 210 ? -12.666 41.932  78.897  1.00 40.51  ? 209  ILE A CB  1 
ATOM   1674 C CG1 . ILE A 1 210 ? -12.832 41.230  80.245  1.00 42.10  ? 209  ILE A CG1 1 
ATOM   1675 C CG2 . ILE A 1 210 ? -13.843 41.628  77.983  1.00 42.10  ? 209  ILE A CG2 1 
ATOM   1676 C CD1 . ILE A 1 210 ? -11.840 41.698  81.283  1.00 42.89  ? 209  ILE A CD1 1 
ATOM   1677 N N   . ASP A 1 211 ? -11.938 40.034  76.351  1.00 36.70  ? 210  ASP A N   1 
ATOM   1678 C CA  . ASP A 1 211 ? -12.117 38.746  75.687  1.00 34.31  ? 210  ASP A CA  1 
ATOM   1679 C C   . ASP A 1 211 ? -10.764 38.130  75.344  1.00 34.50  ? 210  ASP A C   1 
ATOM   1680 O O   . ASP A 1 211 ? -10.603 36.908  75.315  1.00 35.05  ? 210  ASP A O   1 
ATOM   1681 C CB  . ASP A 1 211 ? -12.940 38.911  74.413  1.00 34.09  ? 210  ASP A CB  1 
ATOM   1682 C CG  . ASP A 1 211 ? -13.086 37.608  73.656  1.00 37.74  ? 210  ASP A CG  1 
ATOM   1683 O OD1 . ASP A 1 211 ? -13.267 36.572  74.346  1.00 38.47  ? 210  ASP A OD1 1 
ATOM   1684 O OD2 . ASP A 1 211 ? -13.025 37.618  72.394  1.00 34.93  ? 210  ASP A OD2 1 
ATOM   1685 N N   . GLN A 1 212 ? -9.793  38.996  75.081  1.00 34.29  ? 211  GLN A N   1 
ATOM   1686 C CA  . GLN A 1 212 ? -8.439  38.574  74.748  1.00 31.43  ? 211  GLN A CA  1 
ATOM   1687 C C   . GLN A 1 212 ? -7.778  37.990  75.993  1.00 30.77  ? 211  GLN A C   1 
ATOM   1688 O O   . GLN A 1 212 ? -7.066  36.988  75.919  1.00 30.79  ? 211  GLN A O   1 
ATOM   1689 C CB  . GLN A 1 212 ? -7.634  39.774  74.250  1.00 30.10  ? 211  GLN A CB  1 
ATOM   1690 C CG  . GLN A 1 212 ? -6.263  39.440  73.718  1.00 29.83  ? 211  GLN A CG  1 
ATOM   1691 C CD  . GLN A 1 212 ? -6.305  38.606  72.448  1.00 30.08  ? 211  GLN A CD  1 
ATOM   1692 O OE1 . GLN A 1 212 ? -7.206  38.746  71.622  1.00 32.55  ? 211  GLN A OE1 1 
ATOM   1693 N NE2 . GLN A 1 212 ? -5.316  37.751  72.279  1.00 29.12  ? 211  GLN A NE2 1 
ATOM   1694 N N   . LEU A 1 213 ? -8.019  38.624  77.135  1.00 29.90  ? 212  LEU A N   1 
ATOM   1695 C CA  . LEU A 1 213 ? -7.449  38.160  78.391  1.00 31.50  ? 212  LEU A CA  1 
ATOM   1696 C C   . LEU A 1 213 ? -7.973  36.798  78.764  1.00 32.49  ? 212  LEU A C   1 
ATOM   1697 O O   . LEU A 1 213 ? -7.210  35.883  79.057  1.00 34.06  ? 212  LEU A O   1 
ATOM   1698 C CB  . LEU A 1 213 ? -7.780  39.109  79.528  1.00 29.46  ? 212  LEU A CB  1 
ATOM   1699 C CG  . LEU A 1 213 ? -6.908  40.331  79.696  1.00 31.65  ? 212  LEU A CG  1 
ATOM   1700 C CD1 . LEU A 1 213 ? -7.212  40.903  81.072  1.00 34.09  ? 212  LEU A CD1 1 
ATOM   1701 C CD2 . LEU A 1 213 ? -5.418  39.962  79.581  1.00 32.18  ? 212  LEU A CD2 1 
ATOM   1702 N N   . PHE A 1 214 ? -9.295  36.688  78.770  1.00 34.44  ? 213  PHE A N   1 
ATOM   1703 C CA  . PHE A 1 214 ? -9.961  35.459  79.117  1.00 32.00  ? 213  PHE A CA  1 
ATOM   1704 C C   . PHE A 1 214 ? -9.552  34.323  78.204  1.00 33.12  ? 213  PHE A C   1 
ATOM   1705 O O   . PHE A 1 214 ? -9.421  33.182  78.656  1.00 34.37  ? 213  PHE A O   1 
ATOM   1706 C CB  . PHE A 1 214 ? -11.470 35.673  79.086  1.00 30.72  ? 213  PHE A CB  1 
ATOM   1707 C CG  . PHE A 1 214 ? -11.998 36.434  80.277  1.00 28.81  ? 213  PHE A CG  1 
ATOM   1708 C CD1 . PHE A 1 214 ? -11.129 36.974  81.217  1.00 27.54  ? 213  PHE A CD1 1 
ATOM   1709 C CD2 . PHE A 1 214 ? -13.365 36.622  80.449  1.00 26.85  ? 213  PHE A CD2 1 
ATOM   1710 C CE1 . PHE A 1 214 ? -11.613 37.691  82.309  1.00 26.56  ? 213  PHE A CE1 1 
ATOM   1711 C CE2 . PHE A 1 214 ? -13.855 37.338  81.538  1.00 26.63  ? 213  PHE A CE2 1 
ATOM   1712 C CZ  . PHE A 1 214 ? -12.983 37.874  82.468  1.00 24.78  ? 213  PHE A CZ  1 
ATOM   1713 N N   . ARG A 1 215 ? -9.355  34.622  76.926  1.00 32.73  ? 214  ARG A N   1 
ATOM   1714 C CA  . ARG A 1 215 ? -8.930  33.588  75.987  1.00 35.78  ? 214  ARG A CA  1 
ATOM   1715 C C   . ARG A 1 215 ? -7.510  33.157  76.338  1.00 36.57  ? 214  ARG A C   1 
ATOM   1716 O O   . ARG A 1 215 ? -7.106  32.025  76.057  1.00 38.49  ? 214  ARG A O   1 
ATOM   1717 C CB  . ARG A 1 215 ? -8.989  34.106  74.554  1.00 38.00  ? 214  ARG A CB  1 
ATOM   1718 C CG  . ARG A 1 215 ? -10.378 34.058  73.971  1.00 41.44  ? 214  ARG A CG  1 
ATOM   1719 C CD  . ARG A 1 215 ? -10.602 35.140  72.928  1.00 45.74  ? 214  ARG A CD  1 
ATOM   1720 N NE  . ARG A 1 215 ? -11.635 34.747  71.980  1.00 47.48  ? 214  ARG A NE  1 
ATOM   1721 C CZ  . ARG A 1 215 ? -11.492 33.738  71.130  1.00 51.97  ? 214  ARG A CZ  1 
ATOM   1722 N NH1 . ARG A 1 215 ? -10.363 33.043  71.116  1.00 55.97  ? 214  ARG A NH1 1 
ATOM   1723 N NH2 . ARG A 1 215 ? -12.475 33.404  70.311  1.00 55.18  ? 214  ARG A NH2 1 
ATOM   1724 N N   . ILE A 1 216 ? -6.759  34.068  76.956  1.00 35.23  ? 215  ILE A N   1 
ATOM   1725 C CA  . ILE A 1 216 ? -5.398  33.777  77.389  1.00 35.31  ? 215  ILE A CA  1 
ATOM   1726 C C   . ILE A 1 216 ? -5.478  32.972  78.692  1.00 34.87  ? 215  ILE A C   1 
ATOM   1727 O O   . ILE A 1 216 ? -4.821  31.938  78.839  1.00 33.07  ? 215  ILE A O   1 
ATOM   1728 C CB  . ILE A 1 216 ? -4.572  35.085  77.625  1.00 33.78  ? 215  ILE A CB  1 
ATOM   1729 C CG1 . ILE A 1 216 ? -4.085  35.644  76.289  1.00 36.30  ? 215  ILE A CG1 1 
ATOM   1730 C CG2 . ILE A 1 216 ? -3.377  34.807  78.498  1.00 32.65  ? 215  ILE A CG2 1 
ATOM   1731 C CD1 . ILE A 1 216 ? -3.441  37.015  76.388  1.00 34.87  ? 215  ILE A CD1 1 
ATOM   1732 N N   . PHE A 1 217 ? -6.289  33.451  79.631  1.00 35.03  ? 216  PHE A N   1 
ATOM   1733 C CA  . PHE A 1 217 ? -6.450  32.770  80.916  1.00 35.47  ? 216  PHE A CA  1 
ATOM   1734 C C   . PHE A 1 217 ? -6.962  31.339  80.744  1.00 34.27  ? 216  PHE A C   1 
ATOM   1735 O O   . PHE A 1 217 ? -6.624  30.455  81.532  1.00 35.30  ? 216  PHE A O   1 
ATOM   1736 C CB  . PHE A 1 217 ? -7.446  33.509  81.822  1.00 34.08  ? 216  PHE A CB  1 
ATOM   1737 C CG  . PHE A 1 217 ? -6.964  34.834  82.332  1.00 34.25  ? 216  PHE A CG  1 
ATOM   1738 C CD1 . PHE A 1 217 ? -5.660  35.271  82.096  1.00 31.84  ? 216  PHE A CD1 1 
ATOM   1739 C CD2 . PHE A 1 217 ? -7.831  35.654  83.060  1.00 31.79  ? 216  PHE A CD2 1 
ATOM   1740 C CE1 . PHE A 1 217 ? -5.228  36.508  82.577  1.00 30.87  ? 216  PHE A CE1 1 
ATOM   1741 C CE2 . PHE A 1 217 ? -7.410  36.889  83.544  1.00 31.35  ? 216  PHE A CE2 1 
ATOM   1742 C CZ  . PHE A 1 217 ? -6.109  37.318  83.303  1.00 32.41  ? 216  PHE A CZ  1 
ATOM   1743 N N   . ARG A 1 218 ? -7.785  31.100  79.732  1.00 31.14  ? 217  ARG A N   1 
ATOM   1744 C CA  . ARG A 1 218 ? -8.313  29.761  79.577  1.00 31.02  ? 217  ARG A CA  1 
ATOM   1745 C C   . ARG A 1 218 ? -7.308  28.791  79.003  1.00 33.25  ? 217  ARG A C   1 
ATOM   1746 O O   . ARG A 1 218 ? -7.567  27.591  78.946  1.00 36.72  ? 217  ARG A O   1 
ATOM   1747 C CB  . ARG A 1 218 ? -9.591  29.767  78.733  1.00 29.95  ? 217  ARG A CB  1 
ATOM   1748 C CG  . ARG A 1 218 ? -10.826 30.245  79.497  1.00 29.66  ? 217  ARG A CG  1 
ATOM   1749 C CD  . ARG A 1 218 ? -12.120 29.903  78.784  1.00 26.81  ? 217  ARG A CD  1 
ATOM   1750 N NE  . ARG A 1 218 ? -12.287 30.617  77.517  1.00 29.47  ? 217  ARG A NE  1 
ATOM   1751 C CZ  . ARG A 1 218 ? -12.680 31.890  77.400  1.00 28.70  ? 217  ARG A CZ  1 
ATOM   1752 N NH1 . ARG A 1 218 ? -12.799 32.435  76.192  1.00 23.36  ? 217  ARG A NH1 1 
ATOM   1753 N NH2 . ARG A 1 218 ? -12.960 32.618  78.480  1.00 25.97  ? 217  ARG A NH2 1 
ATOM   1754 N N   . THR A 1 219 ? -6.158  29.291  78.573  1.00 33.55  ? 218  THR A N   1 
ATOM   1755 C CA  . THR A 1 219 ? -5.147  28.402  78.018  1.00 34.33  ? 218  THR A CA  1 
ATOM   1756 C C   . THR A 1 219 ? -4.011  28.203  78.997  1.00 35.33  ? 218  THR A C   1 
ATOM   1757 O O   . THR A 1 219 ? -3.590  27.072  79.238  1.00 38.42  ? 218  THR A O   1 
ATOM   1758 C CB  . THR A 1 219 ? -4.559  28.930  76.698  1.00 32.87  ? 218  THR A CB  1 
ATOM   1759 O OG1 . THR A 1 219 ? -5.569  28.920  75.683  1.00 35.04  ? 218  THR A OG1 1 
ATOM   1760 C CG2 . THR A 1 219 ? -3.421  28.059  76.252  1.00 29.50  ? 218  THR A CG2 1 
ATOM   1761 N N   . LEU A 1 220 ? -3.540  29.299  79.582  1.00 34.61  ? 219  LEU A N   1 
ATOM   1762 C CA  . LEU A 1 220 ? -2.421  29.251  80.516  1.00 36.14  ? 219  LEU A CA  1 
ATOM   1763 C C   . LEU A 1 220 ? -2.866  29.349  81.971  1.00 37.67  ? 219  LEU A C   1 
ATOM   1764 O O   . LEU A 1 220 ? -2.032  29.349  82.883  1.00 38.24  ? 219  LEU A O   1 
ATOM   1765 C CB  . LEU A 1 220 ? -1.454  30.401  80.218  1.00 35.53  ? 219  LEU A CB  1 
ATOM   1766 C CG  . LEU A 1 220 ? -1.215  30.822  78.762  1.00 34.47  ? 219  LEU A CG  1 
ATOM   1767 C CD1 . LEU A 1 220 ? -0.308  32.051  78.753  1.00 35.10  ? 219  LEU A CD1 1 
ATOM   1768 C CD2 . LEU A 1 220 ? -0.590  29.688  77.963  1.00 34.45  ? 219  LEU A CD2 1 
ATOM   1769 N N   . GLY A 1 221 ? -4.175  29.444  82.184  1.00 36.18  ? 220  GLY A N   1 
ATOM   1770 C CA  . GLY A 1 221 ? -4.697  29.562  83.530  1.00 36.80  ? 220  GLY A CA  1 
ATOM   1771 C C   . GLY A 1 221 ? -4.716  31.005  84.003  1.00 39.41  ? 220  GLY A C   1 
ATOM   1772 O O   . GLY A 1 221 ? -3.933  31.837  83.541  1.00 40.75  ? 220  GLY A O   1 
ATOM   1773 N N   . THR A 1 222 ? -5.629  31.319  84.913  1.00 39.61  ? 221  THR A N   1 
ATOM   1774 C CA  . THR A 1 222 ? -5.704  32.667  85.442  1.00 39.91  ? 221  THR A CA  1 
ATOM   1775 C C   . THR A 1 222 ? -4.500  32.781  86.355  1.00 42.47  ? 221  THR A C   1 
ATOM   1776 O O   . THR A 1 222 ? -4.300  31.936  87.220  1.00 43.37  ? 221  THR A O   1 
ATOM   1777 C CB  . THR A 1 222 ? -6.983  32.886  86.261  1.00 38.11  ? 221  THR A CB  1 
ATOM   1778 O OG1 . THR A 1 222 ? -8.118  32.525  85.466  1.00 38.31  ? 221  THR A OG1 1 
ATOM   1779 C CG2 . THR A 1 222 ? -7.103  34.341  86.690  1.00 32.86  ? 221  THR A CG2 1 
ATOM   1780 N N   . PRO A 1 223 ? -3.681  33.828  86.171  1.00 44.61  ? 222  PRO A N   1 
ATOM   1781 C CA  . PRO A 1 223 ? -2.475  34.078  86.964  1.00 44.82  ? 222  PRO A CA  1 
ATOM   1782 C C   . PRO A 1 223 ? -2.740  34.480  88.411  1.00 44.49  ? 222  PRO A C   1 
ATOM   1783 O O   . PRO A 1 223 ? -3.742  35.116  88.714  1.00 42.66  ? 222  PRO A O   1 
ATOM   1784 C CB  . PRO A 1 223 ? -1.792  35.197  86.181  1.00 45.21  ? 222  PRO A CB  1 
ATOM   1785 C CG  . PRO A 1 223 ? -2.960  36.006  85.716  1.00 45.27  ? 222  PRO A CG  1 
ATOM   1786 C CD  . PRO A 1 223 ? -3.904  34.929  85.213  1.00 45.63  ? 222  PRO A CD  1 
ATOM   1787 N N   . ASP A 1 224 ? -1.825  34.096  89.292  1.00 46.44  ? 223  ASP A N   1 
ATOM   1788 C CA  . ASP A 1 224 ? -1.905  34.431  90.711  1.00 48.97  ? 223  ASP A CA  1 
ATOM   1789 C C   . ASP A 1 224 ? -0.514  34.843  91.206  1.00 50.53  ? 223  ASP A C   1 
ATOM   1790 O O   . ASP A 1 224 ? 0.489   34.672  90.500  1.00 50.42  ? 223  ASP A O   1 
ATOM   1791 C CB  . ASP A 1 224 ? -2.412  33.241  91.541  1.00 49.53  ? 223  ASP A CB  1 
ATOM   1792 C CG  . ASP A 1 224 ? -1.614  31.964  91.299  1.00 51.68  ? 223  ASP A CG  1 
ATOM   1793 O OD1 . ASP A 1 224 ? -0.388  32.047  91.056  1.00 52.23  ? 223  ASP A OD1 1 
ATOM   1794 O OD2 . ASP A 1 224 ? -2.213  30.869  91.367  1.00 52.96  ? 223  ASP A OD2 1 
ATOM   1795 N N   . GLU A 1 225 ? -0.463  35.372  92.424  1.00 50.72  ? 224  GLU A N   1 
ATOM   1796 C CA  . GLU A 1 225 ? 0.784   35.821  93.027  1.00 50.59  ? 224  GLU A CA  1 
ATOM   1797 C C   . GLU A 1 225 ? 1.871   34.746  93.054  1.00 52.82  ? 224  GLU A C   1 
ATOM   1798 O O   . GLU A 1 225 ? 3.064   35.057  93.145  1.00 53.80  ? 224  GLU A O   1 
ATOM   1799 C CB  . GLU A 1 225 ? 0.512   36.318  94.437  1.00 48.61  ? 224  GLU A CB  1 
ATOM   1800 C CG  . GLU A 1 225 ? -0.492  37.456  94.493  1.00 47.45  ? 224  GLU A CG  1 
ATOM   1801 C CD  . GLU A 1 225 ? 0.022   38.730  93.851  1.00 46.54  ? 224  GLU A CD  1 
ATOM   1802 O OE1 . GLU A 1 225 ? 1.175   39.121  94.136  1.00 45.73  ? 224  GLU A OE1 1 
ATOM   1803 O OE2 . GLU A 1 225 ? -0.733  39.346  93.073  1.00 45.89  ? 224  GLU A OE2 1 
ATOM   1804 N N   . VAL A 1 226 ? 1.472   33.482  92.989  1.00 51.90  ? 225  VAL A N   1 
ATOM   1805 C CA  . VAL A 1 226 ? 2.455   32.412  92.978  1.00 51.66  ? 225  VAL A CA  1 
ATOM   1806 C C   . VAL A 1 226 ? 3.154   32.437  91.626  1.00 52.17  ? 225  VAL A C   1 
ATOM   1807 O O   . VAL A 1 226 ? 4.361   32.660  91.536  1.00 52.63  ? 225  VAL A O   1 
ATOM   1808 C CB  . VAL A 1 226 ? 1.804   31.012  93.154  1.00 51.92  ? 225  VAL A CB  1 
ATOM   1809 C CG1 . VAL A 1 226 ? 2.844   29.933  92.931  1.00 50.63  ? 225  VAL A CG1 1 
ATOM   1810 C CG2 . VAL A 1 226 ? 1.192   30.877  94.545  1.00 49.91  ? 225  VAL A CG2 1 
ATOM   1811 N N   . VAL A 1 227 ? 2.373   32.233  90.572  1.00 51.77  ? 226  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 227 ? 2.895   32.179  89.206  1.00 52.03  ? 226  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 227 ? 3.503   33.484  88.654  1.00 51.89  ? 226  VAL A C   1 
ATOM   1814 O O   . VAL A 1 227 ? 4.480   33.457  87.908  1.00 53.06  ? 226  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 227 ? 1.786   31.697  88.242  1.00 51.32  ? 226  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 227 ? 1.030   32.877  87.682  1.00 52.55  ? 226  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 227 ? 2.385   30.850  87.138  1.00 52.07  ? 226  VAL A CG2 1 
ATOM   1818 N N   . TRP A 1 228 ? 2.923   34.621  89.031  1.00 49.83  ? 227  TRP A N   1 
ATOM   1819 C CA  . TRP A 1 228 ? 3.370   35.938  88.566  1.00 48.67  ? 227  TRP A CA  1 
ATOM   1820 C C   . TRP A 1 228 ? 3.282   36.903  89.720  1.00 48.65  ? 227  TRP A C   1 
ATOM   1821 O O   . TRP A 1 228 ? 2.250   37.479  89.913  1.00 49.77  ? 227  TRP A O   1 
ATOM   1822 C CB  . TRP A 1 228 ? 2.443   36.402  87.435  1.00 47.40  ? 227  TRP A CB  1 
ATOM   1823 C CG  . TRP A 1 228 ? 2.752   37.743  86.804  1.00 46.24  ? 227  TRP A CG  1 
ATOM   1824 C CD1 . TRP A 1 228 ? 3.640   38.680  87.245  1.00 45.42  ? 227  TRP A CD1 1 
ATOM   1825 C CD2 . TRP A 1 228 ? 2.095   38.318  85.659  1.00 45.06  ? 227  TRP A CD2 1 
ATOM   1826 N NE1 . TRP A 1 228 ? 3.570   39.802  86.454  1.00 45.30  ? 227  TRP A NE1 1 
ATOM   1827 C CE2 . TRP A 1 228 ? 2.633   39.609  85.475  1.00 44.38  ? 227  TRP A CE2 1 
ATOM   1828 C CE3 . TRP A 1 228 ? 1.099   37.867  84.777  1.00 45.01  ? 227  TRP A CE3 1 
ATOM   1829 C CZ2 . TRP A 1 228 ? 2.214   40.460  84.446  1.00 41.89  ? 227  TRP A CZ2 1 
ATOM   1830 C CZ3 . TRP A 1 228 ? 0.677   38.721  83.746  1.00 43.13  ? 227  TRP A CZ3 1 
ATOM   1831 C CH2 . TRP A 1 228 ? 1.239   40.001  83.596  1.00 42.95  ? 227  TRP A CH2 1 
ATOM   1832 N N   . PRO A 1 229 ? 4.362   37.064  90.512  1.00 48.93  ? 228  PRO A N   1 
ATOM   1833 C CA  . PRO A 1 229 ? 4.283   37.996  91.635  1.00 48.34  ? 228  PRO A CA  1 
ATOM   1834 C C   . PRO A 1 229 ? 3.894   39.383  91.164  1.00 48.19  ? 228  PRO A C   1 
ATOM   1835 O O   . PRO A 1 229 ? 4.508   39.937  90.253  1.00 48.66  ? 228  PRO A O   1 
ATOM   1836 C CB  . PRO A 1 229 ? 5.686   37.949  92.216  1.00 47.88  ? 228  PRO A CB  1 
ATOM   1837 C CG  . PRO A 1 229 ? 6.061   36.529  91.981  1.00 46.91  ? 228  PRO A CG  1 
ATOM   1838 C CD  . PRO A 1 229 ? 5.631   36.310  90.571  1.00 48.79  ? 228  PRO A CD  1 
ATOM   1839 N N   . GLY A 1 230 ? 2.834   39.914  91.770  1.00 49.61  ? 229  GLY A N   1 
ATOM   1840 C CA  . GLY A 1 230 ? 2.344   41.238  91.425  1.00 48.50  ? 229  GLY A CA  1 
ATOM   1841 C C   . GLY A 1 230 ? 1.025   41.472  90.675  1.00 48.53  ? 229  GLY A C   1 
ATOM   1842 O O   . GLY A 1 230 ? 0.569   42.613  90.696  1.00 51.05  ? 229  GLY A O   1 
ATOM   1843 N N   . VAL A 1 231 ? 0.424   40.448  90.038  1.00 46.82  ? 230  VAL A N   1 
ATOM   1844 C CA  . VAL A 1 231 ? -0.825  40.570  89.259  1.00 45.73  ? 230  VAL A CA  1 
ATOM   1845 C C   . VAL A 1 231 ? -1.952  41.222  90.007  1.00 45.55  ? 230  VAL A C   1 
ATOM   1846 O O   . VAL A 1 231 ? -2.430  42.283  89.620  1.00 47.19  ? 230  VAL A O   1 
ATOM   1847 C CB  . VAL A 1 231 ? -1.419  39.190  88.729  1.00 44.98  ? 230  VAL A CB  1 
ATOM   1848 C CG1 . VAL A 1 231 ? -0.848  38.829  87.353  1.00 44.38  ? 230  VAL A CG1 1 
ATOM   1849 C CG2 . VAL A 1 231 ? -1.211  38.073  89.754  1.00 42.15  ? 230  VAL A CG2 1 
ATOM   1850 N N   . THR A 1 232 ? -2.382  40.581  91.083  1.00 45.92  ? 231  THR A N   1 
ATOM   1851 C CA  . THR A 1 232 ? -3.498  41.101  91.842  1.00 46.83  ? 231  THR A CA  1 
ATOM   1852 C C   . THR A 1 232 ? -3.385  42.584  92.148  1.00 47.48  ? 231  THR A C   1 
ATOM   1853 O O   . THR A 1 232 ? -4.350  43.186  92.606  1.00 48.36  ? 231  THR A O   1 
ATOM   1854 C CB  . THR A 1 232 ? -3.691  40.332  93.147  1.00 46.43  ? 231  THR A CB  1 
ATOM   1855 O OG1 . THR A 1 232 ? -2.544  40.511  93.983  1.00 50.22  ? 231  THR A OG1 1 
ATOM   1856 C CG2 . THR A 1 232 ? -3.887  38.855  92.858  1.00 45.40  ? 231  THR A CG2 1 
ATOM   1857 N N   . SER A 1 233 ? -2.225  43.184  91.889  1.00 47.16  ? 232  SER A N   1 
ATOM   1858 C CA  . SER A 1 233 ? -2.055  44.614  92.149  1.00 47.34  ? 232  SER A CA  1 
ATOM   1859 C C   . SER A 1 233 ? -2.050  45.481  90.897  1.00 45.90  ? 232  SER A C   1 
ATOM   1860 O O   . SER A 1 233 ? -2.165  46.697  90.983  1.00 45.77  ? 232  SER A O   1 
ATOM   1861 C CB  . SER A 1 233 ? -0.768  44.873  92.937  1.00 48.92  ? 232  SER A CB  1 
ATOM   1862 O OG  . SER A 1 233 ? -1.016  44.845  94.331  1.00 53.08  ? 232  SER A OG  1 
ATOM   1863 N N   . MET A 1 234 ? -1.930  44.865  89.732  1.00 44.94  ? 233  MET A N   1 
ATOM   1864 C CA  . MET A 1 234 ? -1.900  45.638  88.508  1.00 46.72  ? 233  MET A CA  1 
ATOM   1865 C C   . MET A 1 234 ? -3.104  46.564  88.309  1.00 48.03  ? 233  MET A C   1 
ATOM   1866 O O   . MET A 1 234 ? -4.181  46.358  88.880  1.00 49.34  ? 233  MET A O   1 
ATOM   1867 C CB  . MET A 1 234 ? -1.703  44.697  87.331  1.00 47.85  ? 233  MET A CB  1 
ATOM   1868 C CG  . MET A 1 234 ? -0.402  43.932  87.478  1.00 50.94  ? 233  MET A CG  1 
ATOM   1869 S SD  . MET A 1 234 ? 0.245   43.249  85.958  1.00 57.78  ? 233  MET A SD  1 
ATOM   1870 C CE  . MET A 1 234 ? -0.254  41.590  86.135  1.00 56.51  ? 233  MET A CE  1 
ATOM   1871 N N   . PRO A 1 235 ? -2.928  47.623  87.508  1.00 47.66  ? 234  PRO A N   1 
ATOM   1872 C CA  . PRO A 1 235 ? -4.009  48.577  87.258  1.00 47.06  ? 234  PRO A CA  1 
ATOM   1873 C C   . PRO A 1 235 ? -5.311  48.003  86.713  1.00 47.83  ? 234  PRO A C   1 
ATOM   1874 O O   . PRO A 1 235 ? -6.393  48.354  87.186  1.00 49.43  ? 234  PRO A O   1 
ATOM   1875 C CB  . PRO A 1 235 ? -3.365  49.574  86.303  1.00 46.66  ? 234  PRO A CB  1 
ATOM   1876 C CG  . PRO A 1 235 ? -1.923  49.558  86.728  1.00 46.28  ? 234  PRO A CG  1 
ATOM   1877 C CD  . PRO A 1 235 ? -1.669  48.087  86.894  1.00 47.08  ? 234  PRO A CD  1 
ATOM   1878 N N   . ASP A 1 236 ? -5.226  47.118  85.730  1.00 47.34  ? 235  ASP A N   1 
ATOM   1879 C CA  . ASP A 1 236 ? -6.447  46.572  85.157  1.00 46.95  ? 235  ASP A CA  1 
ATOM   1880 C C   . ASP A 1 236 ? -6.819  45.165  85.589  1.00 46.51  ? 235  ASP A C   1 
ATOM   1881 O O   . ASP A 1 236 ? -7.641  44.513  84.942  1.00 45.08  ? 235  ASP A O   1 
ATOM   1882 C CB  . ASP A 1 236 ? -6.394  46.651  83.635  1.00 45.55  ? 235  ASP A CB  1 
ATOM   1883 C CG  . ASP A 1 236 ? -6.144  48.059  83.145  1.00 45.19  ? 235  ASP A CG  1 
ATOM   1884 O OD1 . ASP A 1 236 ? -6.659  49.009  83.766  1.00 41.88  ? 235  ASP A OD1 1 
ATOM   1885 O OD2 . ASP A 1 236 ? -5.436  48.213  82.132  1.00 47.84  ? 235  ASP A OD2 1 
ATOM   1886 N N   . TYR A 1 237 ? -6.218  44.699  86.679  1.00 45.80  ? 236  TYR A N   1 
ATOM   1887 C CA  . TYR A 1 237 ? -6.546  43.381  87.193  1.00 46.70  ? 236  TYR A CA  1 
ATOM   1888 C C   . TYR A 1 237 ? -7.855  43.521  87.987  1.00 47.03  ? 236  TYR A C   1 
ATOM   1889 O O   . TYR A 1 237 ? -8.123  44.572  88.582  1.00 46.78  ? 236  TYR A O   1 
ATOM   1890 C CB  . TYR A 1 237 ? -5.418  42.850  88.090  1.00 46.29  ? 236  TYR A CB  1 
ATOM   1891 C CG  . TYR A 1 237 ? -5.800  41.614  88.883  1.00 49.97  ? 236  TYR A CG  1 
ATOM   1892 C CD1 . TYR A 1 237 ? -6.458  41.728  90.108  1.00 51.34  ? 236  TYR A CD1 1 
ATOM   1893 C CD2 . TYR A 1 237 ? -5.564  40.330  88.382  1.00 50.21  ? 236  TYR A CD2 1 
ATOM   1894 C CE1 . TYR A 1 237 ? -6.875  40.605  90.810  1.00 51.14  ? 236  TYR A CE1 1 
ATOM   1895 C CE2 . TYR A 1 237 ? -5.982  39.196  89.080  1.00 50.61  ? 236  TYR A CE2 1 
ATOM   1896 C CZ  . TYR A 1 237 ? -6.638  39.347  90.290  1.00 51.97  ? 236  TYR A CZ  1 
ATOM   1897 O OH  . TYR A 1 237 ? -7.082  38.248  90.985  1.00 55.51  ? 236  TYR A OH  1 
ATOM   1898 N N   . LYS A 1 238 ? -8.675  42.471  87.969  1.00 46.09  ? 237  LYS A N   1 
ATOM   1899 C CA  . LYS A 1 238 ? -9.948  42.470  88.686  1.00 45.08  ? 237  LYS A CA  1 
ATOM   1900 C C   . LYS A 1 238 ? -10.096 41.165  89.422  1.00 43.01  ? 237  LYS A C   1 
ATOM   1901 O O   . LYS A 1 238 ? -10.041 40.095  88.816  1.00 42.66  ? 237  LYS A O   1 
ATOM   1902 C CB  . LYS A 1 238 ? -11.120 42.608  87.724  1.00 47.63  ? 237  LYS A CB  1 
ATOM   1903 C CG  . LYS A 1 238 ? -11.098 43.866  86.909  1.00 52.42  ? 237  LYS A CG  1 
ATOM   1904 C CD  . LYS A 1 238 ? -11.224 45.095  87.782  1.00 56.11  ? 237  LYS A CD  1 
ATOM   1905 C CE  . LYS A 1 238 ? -11.114 46.317  86.912  1.00 59.40  ? 237  LYS A CE  1 
ATOM   1906 N NZ  . LYS A 1 238 ? -11.998 46.131  85.713  1.00 64.53  ? 237  LYS A NZ  1 
ATOM   1907 N N   . PRO A 1 239 ? -10.297 41.232  90.742  1.00 41.84  ? 238  PRO A N   1 
ATOM   1908 C CA  . PRO A 1 239 ? -10.457 40.036  91.569  1.00 42.35  ? 238  PRO A CA  1 
ATOM   1909 C C   . PRO A 1 239 ? -11.665 39.208  91.126  1.00 44.08  ? 238  PRO A C   1 
ATOM   1910 O O   . PRO A 1 239 ? -11.797 38.036  91.484  1.00 44.84  ? 238  PRO A O   1 
ATOM   1911 C CB  . PRO A 1 239 ? -10.610 40.608  92.970  1.00 42.39  ? 238  PRO A CB  1 
ATOM   1912 C CG  . PRO A 1 239 ? -11.295 41.904  92.713  1.00 42.62  ? 238  PRO A CG  1 
ATOM   1913 C CD  . PRO A 1 239 ? -10.537 42.451  91.530  1.00 40.92  ? 238  PRO A CD  1 
ATOM   1914 N N   . SER A 1 240 ? -12.542 39.811  90.336  1.00 42.13  ? 239  SER A N   1 
ATOM   1915 C CA  . SER A 1 240 ? -13.699 39.086  89.848  1.00 43.40  ? 239  SER A CA  1 
ATOM   1916 C C   . SER A 1 240 ? -13.315 38.127  88.725  1.00 42.57  ? 239  SER A C   1 
ATOM   1917 O O   . SER A 1 240 ? -14.120 37.294  88.332  1.00 44.53  ? 239  SER A O   1 
ATOM   1918 C CB  . SER A 1 240 ? -14.751 40.053  89.318  1.00 41.92  ? 239  SER A CB  1 
ATOM   1919 O OG  . SER A 1 240 ? -14.287 40.667  88.128  1.00 40.04  ? 239  SER A OG  1 
ATOM   1920 N N   . PHE A 1 241 ? -12.103 38.253  88.197  1.00 42.27  ? 240  PHE A N   1 
ATOM   1921 C CA  . PHE A 1 241 ? -11.673 37.392  87.101  1.00 43.04  ? 240  PHE A CA  1 
ATOM   1922 C C   . PHE A 1 241 ? -11.965 35.921  87.354  1.00 42.60  ? 240  PHE A C   1 
ATOM   1923 O O   . PHE A 1 241 ? -11.689 35.391  88.439  1.00 41.58  ? 240  PHE A O   1 
ATOM   1924 C CB  . PHE A 1 241 ? -10.166 37.511  86.834  1.00 45.09  ? 240  PHE A CB  1 
ATOM   1925 C CG  . PHE A 1 241 ? -9.748  38.761  86.103  1.00 46.62  ? 240  PHE A CG  1 
ATOM   1926 C CD1 . PHE A 1 241 ? -10.608 39.415  85.234  1.00 47.75  ? 240  PHE A CD1 1 
ATOM   1927 C CD2 . PHE A 1 241 ? -8.450  39.248  86.246  1.00 47.39  ? 240  PHE A CD2 1 
ATOM   1928 C CE1 . PHE A 1 241 ? -10.177 40.536  84.518  1.00 48.29  ? 240  PHE A CE1 1 
ATOM   1929 C CE2 . PHE A 1 241 ? -8.014  40.360  85.536  1.00 46.42  ? 240  PHE A CE2 1 
ATOM   1930 C CZ  . PHE A 1 241 ? -8.875  41.005  84.673  1.00 46.23  ? 240  PHE A CZ  1 
ATOM   1931 N N   . PRO A 1 242 ? -12.540 35.239  86.354  1.00 41.81  ? 241  PRO A N   1 
ATOM   1932 C CA  . PRO A 1 242 ? -12.831 33.814  86.535  1.00 42.76  ? 241  PRO A CA  1 
ATOM   1933 C C   . PRO A 1 242 ? -11.484 33.092  86.689  1.00 43.18  ? 241  PRO A C   1 
ATOM   1934 O O   . PRO A 1 242 ? -10.522 33.407  85.981  1.00 42.67  ? 241  PRO A O   1 
ATOM   1935 C CB  . PRO A 1 242 ? -13.555 33.447  85.240  1.00 40.75  ? 241  PRO A CB  1 
ATOM   1936 C CG  . PRO A 1 242 ? -14.237 34.736  84.869  1.00 39.30  ? 241  PRO A CG  1 
ATOM   1937 C CD  . PRO A 1 242 ? -13.172 35.756  85.129  1.00 39.37  ? 241  PRO A CD  1 
ATOM   1938 N N   . LYS A 1 243 ? -11.404 32.148  87.620  1.00 42.56  ? 242  LYS A N   1 
ATOM   1939 C CA  . LYS A 1 243 ? -10.159 31.430  87.834  1.00 43.93  ? 242  LYS A CA  1 
ATOM   1940 C C   . LYS A 1 243 ? -10.131 30.138  87.040  1.00 43.47  ? 242  LYS A C   1 
ATOM   1941 O O   . LYS A 1 243 ? -10.697 29.139  87.458  1.00 45.28  ? 242  LYS A O   1 
ATOM   1942 C CB  . LYS A 1 243 ? -9.966  31.145  89.325  1.00 44.86  ? 242  LYS A CB  1 
ATOM   1943 C CG  . LYS A 1 243 ? -9.569  32.376  90.121  1.00 49.07  ? 242  LYS A CG  1 
ATOM   1944 C CD  . LYS A 1 243 ? -9.824  32.219  91.616  1.00 52.99  ? 242  LYS A CD  1 
ATOM   1945 C CE  . LYS A 1 243 ? -9.630  33.560  92.338  1.00 55.06  ? 242  LYS A CE  1 
ATOM   1946 N NZ  . LYS A 1 243 ? -10.188 33.585  93.732  1.00 56.45  ? 242  LYS A NZ  1 
ATOM   1947 N N   . TRP A 1 244 ? -9.482  30.169  85.884  1.00 42.67  ? 243  TRP A N   1 
ATOM   1948 C CA  . TRP A 1 244 ? -9.380  28.987  85.041  1.00 42.66  ? 243  TRP A CA  1 
ATOM   1949 C C   . TRP A 1 244 ? -8.113  28.228  85.387  1.00 44.41  ? 243  TRP A C   1 
ATOM   1950 O O   . TRP A 1 244 ? -7.120  28.819  85.800  1.00 42.46  ? 243  TRP A O   1 
ATOM   1951 C CB  . TRP A 1 244 ? -9.340  29.379  83.566  1.00 41.73  ? 243  TRP A CB  1 
ATOM   1952 C CG  . TRP A 1 244 ? -10.676 29.704  82.967  1.00 42.19  ? 243  TRP A CG  1 
ATOM   1953 C CD1 . TRP A 1 244 ? -11.613 28.819  82.517  1.00 38.87  ? 243  TRP A CD1 1 
ATOM   1954 C CD2 . TRP A 1 244 ? -11.214 31.013  82.731  1.00 42.63  ? 243  TRP A CD2 1 
ATOM   1955 N NE1 . TRP A 1 244 ? -12.697 29.493  82.010  1.00 40.16  ? 243  TRP A NE1 1 
ATOM   1956 C CE2 . TRP A 1 244 ? -12.481 30.841  82.129  1.00 40.98  ? 243  TRP A CE2 1 
ATOM   1957 C CE3 . TRP A 1 244 ? -10.747 32.315  82.969  1.00 41.81  ? 243  TRP A CE3 1 
ATOM   1958 C CZ2 . TRP A 1 244 ? -13.289 31.921  81.759  1.00 41.27  ? 243  TRP A CZ2 1 
ATOM   1959 C CZ3 . TRP A 1 244 ? -11.551 33.392  82.599  1.00 43.45  ? 243  TRP A CZ3 1 
ATOM   1960 C CH2 . TRP A 1 244 ? -12.811 33.185  81.999  1.00 43.01  ? 243  TRP A CH2 1 
ATOM   1961 N N   . ALA A 1 245 ? -8.155  26.912  85.219  1.00 46.52  ? 244  ALA A N   1 
ATOM   1962 C CA  . ALA A 1 245 ? -7.002  26.073  85.509  1.00 48.32  ? 244  ALA A CA  1 
ATOM   1963 C C   . ALA A 1 245 ? -6.095  26.022  84.290  1.00 50.16  ? 244  ALA A C   1 
ATOM   1964 O O   . ALA A 1 245 ? -6.558  26.151  83.157  1.00 51.42  ? 244  ALA A O   1 
ATOM   1965 C CB  . ALA A 1 245 ? -7.457  24.686  85.874  1.00 47.52  ? 244  ALA A CB  1 
ATOM   1966 N N   . ARG A 1 246 ? -4.802  25.836  84.521  1.00 52.06  ? 245  ARG A N   1 
ATOM   1967 C CA  . ARG A 1 246 ? -3.852  25.776  83.425  1.00 53.65  ? 245  ARG A CA  1 
ATOM   1968 C C   . ARG A 1 246 ? -4.051  24.537  82.564  1.00 54.94  ? 245  ARG A C   1 
ATOM   1969 O O   . ARG A 1 246 ? -4.140  23.415  83.064  1.00 53.25  ? 245  ARG A O   1 
ATOM   1970 C CB  . ARG A 1 246 ? -2.424  25.792  83.957  1.00 55.56  ? 245  ARG A CB  1 
ATOM   1971 C CG  . ARG A 1 246 ? -1.385  25.799  82.850  1.00 59.55  ? 245  ARG A CG  1 
ATOM   1972 C CD  . ARG A 1 246 ? 0.030   25.688  83.402  1.00 62.59  ? 245  ARG A CD  1 
ATOM   1973 N NE  . ARG A 1 246 ? 1.026   25.689  82.334  1.00 65.50  ? 245  ARG A NE  1 
ATOM   1974 C CZ  . ARG A 1 246 ? 1.366   26.760  81.623  1.00 67.34  ? 245  ARG A CZ  1 
ATOM   1975 N NH1 . ARG A 1 246 ? 0.795   27.938  81.862  1.00 67.22  ? 245  ARG A NH1 1 
ATOM   1976 N NH2 . ARG A 1 246 ? 2.279   26.650  80.667  1.00 68.78  ? 245  ARG A NH2 1 
ATOM   1977 N N   . GLN A 1 247 ? -4.118  24.754  81.259  1.00 57.73  ? 246  GLN A N   1 
ATOM   1978 C CA  . GLN A 1 247 ? -4.298  23.669  80.304  1.00 59.46  ? 246  GLN A CA  1 
ATOM   1979 C C   . GLN A 1 247 ? -2.889  23.129  79.967  1.00 58.87  ? 246  GLN A C   1 
ATOM   1980 O O   . GLN A 1 247 ? -2.003  23.886  79.558  1.00 59.37  ? 246  GLN A O   1 
ATOM   1981 C CB  . GLN A 1 247 ? -5.016  24.222  79.054  1.00 62.35  ? 246  GLN A CB  1 
ATOM   1982 C CG  . GLN A 1 247 ? -5.923  23.242  78.287  1.00 68.19  ? 246  GLN A CG  1 
ATOM   1983 C CD  . GLN A 1 247 ? -7.152  23.930  77.666  1.00 72.63  ? 246  GLN A CD  1 
ATOM   1984 O OE1 . GLN A 1 247 ? -7.066  25.062  77.184  1.00 75.55  ? 246  GLN A OE1 1 
ATOM   1985 N NE2 . GLN A 1 247 ? -8.294  23.238  77.672  1.00 72.79  ? 246  GLN A NE2 1 
ATOM   1986 N N   . ASP A 1 248 ? -2.682  21.829  80.179  1.00 55.69  ? 247  ASP A N   1 
ATOM   1987 C CA  . ASP A 1 248 ? -1.407  21.170  79.891  1.00 51.76  ? 247  ASP A CA  1 
ATOM   1988 C C   . ASP A 1 248 ? -0.965  21.525  78.462  1.00 47.15  ? 247  ASP A C   1 
ATOM   1989 O O   . ASP A 1 248 ? -1.720  21.378  77.502  1.00 45.53  ? 247  ASP A O   1 
ATOM   1990 C CB  . ASP A 1 248 ? -1.585  19.653  80.149  1.00 54.20  ? 247  ASP A CB  1 
ATOM   1991 C CG  . ASP A 1 248 ? -1.103  18.770  79.016  1.00 57.27  ? 247  ASP A CG  1 
ATOM   1992 O OD1 . ASP A 1 248 ? -1.444  17.567  79.037  1.00 58.68  ? 247  ASP A OD1 1 
ATOM   1993 O OD2 . ASP A 1 248 ? -0.383  19.244  78.117  1.00 61.49  ? 247  ASP A OD2 1 
ATOM   1994 N N   . PHE A 1 249 ? 0.272   21.992  78.336  1.00 43.60  ? 248  PHE A N   1 
ATOM   1995 C CA  . PHE A 1 249 ? 0.810   22.451  77.058  1.00 42.45  ? 248  PHE A CA  1 
ATOM   1996 C C   . PHE A 1 249 ? 0.770   21.586  75.795  1.00 41.22  ? 248  PHE A C   1 
ATOM   1997 O O   . PHE A 1 249 ? 0.766   22.128  74.686  1.00 40.47  ? 248  PHE A O   1 
ATOM   1998 C CB  . PHE A 1 249 ? 2.236   22.976  77.250  1.00 41.71  ? 248  PHE A CB  1 
ATOM   1999 C CG  . PHE A 1 249 ? 2.371   24.436  76.944  1.00 43.94  ? 248  PHE A CG  1 
ATOM   2000 C CD1 . PHE A 1 249 ? 1.970   25.399  77.871  1.00 43.52  ? 248  PHE A CD1 1 
ATOM   2001 C CD2 . PHE A 1 249 ? 2.840   24.857  75.701  1.00 43.47  ? 248  PHE A CD2 1 
ATOM   2002 C CE1 . PHE A 1 249 ? 2.035   26.759  77.560  1.00 41.62  ? 248  PHE A CE1 1 
ATOM   2003 C CE2 . PHE A 1 249 ? 2.906   26.212  75.384  1.00 42.13  ? 248  PHE A CE2 1 
ATOM   2004 C CZ  . PHE A 1 249 ? 2.502   27.163  76.318  1.00 41.82  ? 248  PHE A CZ  1 
ATOM   2005 N N   . SER A 1 250 ? 0.749   20.267  75.924  1.00 40.29  ? 249  SER A N   1 
ATOM   2006 C CA  . SER A 1 250 ? 0.702   19.451  74.719  1.00 41.71  ? 249  SER A CA  1 
ATOM   2007 C C   . SER A 1 250 ? -0.646  19.595  74.009  1.00 41.66  ? 249  SER A C   1 
ATOM   2008 O O   . SER A 1 250 ? -0.785  19.215  72.855  1.00 43.15  ? 249  SER A O   1 
ATOM   2009 C CB  . SER A 1 250 ? 0.997   17.974  75.032  1.00 41.12  ? 249  SER A CB  1 
ATOM   2010 O OG  . SER A 1 250 ? -0.024  17.381  75.807  1.00 43.65  ? 249  SER A OG  1 
ATOM   2011 N N   . LYS A 1 251 ? -1.641  20.155  74.683  1.00 42.47  ? 250  LYS A N   1 
ATOM   2012 C CA  . LYS A 1 251 ? -2.937  20.331  74.034  1.00 44.34  ? 250  LYS A CA  1 
ATOM   2013 C C   . LYS A 1 251 ? -3.060  21.700  73.342  1.00 44.12  ? 250  LYS A C   1 
ATOM   2014 O O   . LYS A 1 251 ? -3.934  21.900  72.498  1.00 46.01  ? 250  LYS A O   1 
ATOM   2015 C CB  . LYS A 1 251 ? -4.085  20.164  75.041  1.00 45.59  ? 250  LYS A CB  1 
ATOM   2016 C CG  . LYS A 1 251 ? -4.633  18.739  75.180  1.00 49.19  ? 250  LYS A CG  1 
ATOM   2017 C CD  . LYS A 1 251 ? -3.754  17.861  76.057  1.00 51.56  ? 250  LYS A CD  1 
ATOM   2018 C CE  . LYS A 1 251 ? -4.507  16.635  76.594  1.00 52.10  ? 250  LYS A CE  1 
ATOM   2019 N NZ  . LYS A 1 251 ? -5.538  16.968  77.646  1.00 53.41  ? 250  LYS A NZ  1 
ATOM   2020 N N   . VAL A 1 252 ? -2.193  22.640  73.694  1.00 41.70  ? 251  VAL A N   1 
ATOM   2021 C CA  . VAL A 1 252 ? -2.238  23.961  73.089  1.00 41.84  ? 251  VAL A CA  1 
ATOM   2022 C C   . VAL A 1 252 ? -1.765  23.919  71.640  1.00 43.12  ? 251  VAL A C   1 
ATOM   2023 O O   . VAL A 1 252 ? -2.333  24.589  70.772  1.00 44.50  ? 251  VAL A O   1 
ATOM   2024 C CB  . VAL A 1 252 ? -1.372  24.951  73.873  1.00 41.94  ? 251  VAL A CB  1 
ATOM   2025 C CG1 . VAL A 1 252 ? -1.406  26.315  73.206  1.00 40.59  ? 251  VAL A CG1 1 
ATOM   2026 C CG2 . VAL A 1 252 ? -1.867  25.038  75.308  1.00 39.16  ? 251  VAL A CG2 1 
ATOM   2027 N N   . VAL A 1 253 ? -0.712  23.152  71.381  1.00 42.22  ? 252  VAL A N   1 
ATOM   2028 C CA  . VAL A 1 253 ? -0.178  23.006  70.024  1.00 41.25  ? 252  VAL A CA  1 
ATOM   2029 C C   . VAL A 1 253 ? 0.263   21.552  69.906  1.00 39.92  ? 252  VAL A C   1 
ATOM   2030 O O   . VAL A 1 253 ? 1.451   21.242  69.853  1.00 41.12  ? 252  VAL A O   1 
ATOM   2031 C CB  . VAL A 1 253 ? 1.036   23.932  69.772  1.00 41.01  ? 252  VAL A CB  1 
ATOM   2032 C CG1 . VAL A 1 253 ? 1.258   24.086  68.286  1.00 41.55  ? 252  VAL A CG1 1 
ATOM   2033 C CG2 . VAL A 1 253 ? 0.806   25.290  70.396  1.00 43.50  ? 252  VAL A CG2 1 
ATOM   2034 N N   . PRO A 1 254 ? -0.706  20.635  69.860  1.00 39.38  ? 253  PRO A N   1 
ATOM   2035 C CA  . PRO A 1 254 ? -0.450  19.195  69.759  1.00 37.91  ? 253  PRO A CA  1 
ATOM   2036 C C   . PRO A 1 254 ? 0.603   18.655  68.787  1.00 37.69  ? 253  PRO A C   1 
ATOM   2037 O O   . PRO A 1 254 ? 1.329   17.729  69.129  1.00 39.23  ? 253  PRO A O   1 
ATOM   2038 C CB  . PRO A 1 254 ? -1.848  18.599  69.523  1.00 37.52  ? 253  PRO A CB  1 
ATOM   2039 C CG  . PRO A 1 254 ? -2.743  19.798  69.225  1.00 37.15  ? 253  PRO A CG  1 
ATOM   2040 C CD  . PRO A 1 254 ? -2.150  20.914  69.984  1.00 38.41  ? 253  PRO A CD  1 
ATOM   2041 N N   . PRO A 1 255 ? 0.714   19.220  67.577  1.00 37.91  ? 254  PRO A N   1 
ATOM   2042 C CA  . PRO A 1 255 ? 1.706   18.726  66.610  1.00 37.88  ? 254  PRO A CA  1 
ATOM   2043 C C   . PRO A 1 255 ? 3.147   18.997  67.018  1.00 39.50  ? 254  PRO A C   1 
ATOM   2044 O O   . PRO A 1 255 ? 4.077   18.584  66.330  1.00 40.02  ? 254  PRO A O   1 
ATOM   2045 C CB  . PRO A 1 255 ? 1.364   19.489  65.331  1.00 37.56  ? 254  PRO A CB  1 
ATOM   2046 C CG  . PRO A 1 255 ? -0.055  19.931  65.534  1.00 37.36  ? 254  PRO A CG  1 
ATOM   2047 C CD  . PRO A 1 255 ? -0.097  20.291  66.982  1.00 37.27  ? 254  PRO A CD  1 
ATOM   2048 N N   . LEU A 1 256 ? 3.324   19.689  68.139  1.00 41.56  ? 255  LEU A N   1 
ATOM   2049 C CA  . LEU A 1 256 ? 4.646   20.078  68.615  1.00 42.27  ? 255  LEU A CA  1 
ATOM   2050 C C   . LEU A 1 256 ? 5.405   19.027  69.426  1.00 44.42  ? 255  LEU A C   1 
ATOM   2051 O O   . LEU A 1 256 ? 4.860   18.424  70.359  1.00 43.80  ? 255  LEU A O   1 
ATOM   2052 C CB  . LEU A 1 256 ? 4.514   21.369  69.432  1.00 41.36  ? 255  LEU A CB  1 
ATOM   2053 C CG  . LEU A 1 256 ? 5.426   22.567  69.139  1.00 42.53  ? 255  LEU A CG  1 
ATOM   2054 C CD1 . LEU A 1 256 ? 5.448   22.888  67.653  1.00 40.10  ? 255  LEU A CD1 1 
ATOM   2055 C CD2 . LEU A 1 256 ? 4.936   23.762  69.934  1.00 38.15  ? 255  LEU A CD2 1 
ATOM   2056 N N   . ASP A 1 257 ? 6.676   18.825  69.070  1.00 46.44  ? 256  ASP A N   1 
ATOM   2057 C CA  . ASP A 1 257 ? 7.526   17.867  69.772  1.00 48.02  ? 256  ASP A CA  1 
ATOM   2058 C C   . ASP A 1 257 ? 7.783   18.398  71.176  1.00 47.80  ? 256  ASP A C   1 
ATOM   2059 O O   . ASP A 1 257 ? 7.317   19.478  71.526  1.00 50.80  ? 256  ASP A O   1 
ATOM   2060 C CB  . ASP A 1 257 ? 8.851   17.646  69.006  1.00 51.44  ? 256  ASP A CB  1 
ATOM   2061 C CG  . ASP A 1 257 ? 9.754   18.897  68.962  1.00 55.45  ? 256  ASP A CG  1 
ATOM   2062 O OD1 . ASP A 1 257 ? 10.335  19.174  67.884  1.00 56.29  ? 256  ASP A OD1 1 
ATOM   2063 O OD2 . ASP A 1 257 ? 9.907   19.586  69.995  1.00 53.86  ? 256  ASP A OD2 1 
ATOM   2064 N N   . GLU A 1 258 ? 8.516   17.647  71.982  1.00 48.01  ? 257  GLU A N   1 
ATOM   2065 C CA  . GLU A 1 258 ? 8.811   18.070  73.349  1.00 48.61  ? 257  GLU A CA  1 
ATOM   2066 C C   . GLU A 1 258 ? 9.665   19.341  73.431  1.00 46.91  ? 257  GLU A C   1 
ATOM   2067 O O   . GLU A 1 258 ? 9.604   20.079  74.416  1.00 47.07  ? 257  GLU A O   1 
ATOM   2068 C CB  . GLU A 1 258 ? 9.529   16.948  74.091  1.00 50.53  ? 257  GLU A CB  1 
ATOM   2069 C CG  . GLU A 1 258 ? 9.808   17.242  75.552  1.00 53.37  ? 257  GLU A CG  1 
ATOM   2070 C CD  . GLU A 1 258 ? 10.934  16.376  76.082  1.00 57.96  ? 257  GLU A CD  1 
ATOM   2071 O OE1 . GLU A 1 258 ? 11.075  16.254  77.324  1.00 59.53  ? 257  GLU A OE1 1 
ATOM   2072 O OE2 . GLU A 1 258 ? 11.682  15.825  75.241  1.00 57.85  ? 257  GLU A OE2 1 
ATOM   2073 N N   . ASP A 1 259 ? 10.484  19.584  72.417  1.00 44.39  ? 258  ASP A N   1 
ATOM   2074 C CA  . ASP A 1 259 ? 11.315  20.781  72.427  1.00 44.38  ? 258  ASP A CA  1 
ATOM   2075 C C   . ASP A 1 259 ? 10.454  22.006  72.120  1.00 41.58  ? 258  ASP A C   1 
ATOM   2076 O O   . ASP A 1 259 ? 10.549  23.038  72.800  1.00 38.58  ? 258  ASP A O   1 
ATOM   2077 C CB  . ASP A 1 259 ? 12.460  20.663  71.408  1.00 44.46  ? 258  ASP A CB  1 
ATOM   2078 C CG  . ASP A 1 259 ? 13.589  19.774  71.902  1.00 44.96  ? 258  ASP A CG  1 
ATOM   2079 O OD1 . ASP A 1 259 ? 13.976  19.917  73.082  1.00 43.48  ? 258  ASP A OD1 1 
ATOM   2080 O OD2 . ASP A 1 259 ? 14.095  18.943  71.116  1.00 44.36  ? 258  ASP A OD2 1 
ATOM   2081 N N   . GLY A 1 260 ? 9.615   21.872  71.096  1.00 39.30  ? 259  GLY A N   1 
ATOM   2082 C CA  . GLY A 1 260 ? 8.730   22.953  70.717  1.00 37.01  ? 259  GLY A CA  1 
ATOM   2083 C C   . GLY A 1 260 ? 7.940   23.380  71.933  1.00 35.84  ? 259  GLY A C   1 
ATOM   2084 O O   . GLY A 1 260 ? 7.851   24.567  72.242  1.00 35.43  ? 259  GLY A O   1 
ATOM   2085 N N   . ARG A 1 261 ? 7.386   22.406  72.645  1.00 34.01  ? 260  ARG A N   1 
ATOM   2086 C CA  . ARG A 1 261 ? 6.599   22.713  73.825  1.00 34.63  ? 260  ARG A CA  1 
ATOM   2087 C C   . ARG A 1 261 ? 7.380   23.515  74.840  1.00 33.95  ? 260  ARG A C   1 
ATOM   2088 O O   . ARG A 1 261 ? 6.884   24.513  75.359  1.00 35.16  ? 260  ARG A O   1 
ATOM   2089 C CB  . ARG A 1 261 ? 6.068   21.429  74.475  1.00 36.13  ? 260  ARG A CB  1 
ATOM   2090 C CG  . ARG A 1 261 ? 5.014   20.709  73.652  1.00 35.05  ? 260  ARG A CG  1 
ATOM   2091 C CD  . ARG A 1 261 ? 4.166   19.789  74.520  1.00 36.65  ? 260  ARG A CD  1 
ATOM   2092 N NE  . ARG A 1 261 ? 4.887   18.624  75.029  1.00 37.06  ? 260  ARG A NE  1 
ATOM   2093 C CZ  . ARG A 1 261 ? 5.358   17.635  74.273  1.00 37.18  ? 260  ARG A CZ  1 
ATOM   2094 N NH1 . ARG A 1 261 ? 5.199   17.654  72.950  1.00 38.51  ? 260  ARG A NH1 1 
ATOM   2095 N NH2 . ARG A 1 261 ? 5.962   16.608  74.849  1.00 35.71  ? 260  ARG A NH2 1 
ATOM   2096 N N   . SER A 1 262 ? 8.600   23.076  75.126  1.00 35.29  ? 261  SER A N   1 
ATOM   2097 C CA  . SER A 1 262 ? 9.452   23.760  76.088  1.00 36.20  ? 261  SER A CA  1 
ATOM   2098 C C   . SER A 1 262 ? 9.723   25.206  75.658  1.00 36.58  ? 261  SER A C   1 
ATOM   2099 O O   . SER A 1 262 ? 9.574   26.135  76.454  1.00 37.82  ? 261  SER A O   1 
ATOM   2100 C CB  . SER A 1 262 ? 10.784  23.005  76.248  1.00 39.31  ? 261  SER A CB  1 
ATOM   2101 O OG  . SER A 1 262 ? 11.640  23.634  77.204  1.00 40.09  ? 261  SER A OG  1 
ATOM   2102 N N   . LEU A 1 263 ? 10.118  25.396  74.401  1.00 35.19  ? 262  LEU A N   1 
ATOM   2103 C CA  . LEU A 1 263 ? 10.406  26.734  73.896  1.00 34.03  ? 262  LEU A CA  1 
ATOM   2104 C C   . LEU A 1 263 ? 9.168   27.631  73.942  1.00 35.65  ? 262  LEU A C   1 
ATOM   2105 O O   . LEU A 1 263 ? 9.206   28.723  74.510  1.00 34.94  ? 262  LEU A O   1 
ATOM   2106 C CB  . LEU A 1 263 ? 10.944  26.655  72.460  1.00 31.20  ? 262  LEU A CB  1 
ATOM   2107 C CG  . LEU A 1 263 ? 11.230  27.956  71.690  1.00 28.34  ? 262  LEU A CG  1 
ATOM   2108 C CD1 . LEU A 1 263 ? 12.077  28.908  72.518  1.00 24.85  ? 262  LEU A CD1 1 
ATOM   2109 C CD2 . LEU A 1 263 ? 11.899  27.613  70.374  1.00 24.06  ? 262  LEU A CD2 1 
ATOM   2110 N N   . LEU A 1 264 ? 8.072   27.163  73.352  1.00 36.05  ? 263  LEU A N   1 
ATOM   2111 C CA  . LEU A 1 264 ? 6.842   27.942  73.330  1.00 36.23  ? 263  LEU A CA  1 
ATOM   2112 C C   . LEU A 1 264 ? 6.403   28.315  74.728  1.00 36.15  ? 263  LEU A C   1 
ATOM   2113 O O   . LEU A 1 264 ? 6.043   29.464  74.983  1.00 35.33  ? 263  LEU A O   1 
ATOM   2114 C CB  . LEU A 1 264 ? 5.719   27.169  72.643  1.00 36.28  ? 263  LEU A CB  1 
ATOM   2115 C CG  . LEU A 1 264 ? 4.381   27.908  72.504  1.00 36.57  ? 263  LEU A CG  1 
ATOM   2116 C CD1 . LEU A 1 264 ? 4.556   29.129  71.615  1.00 33.82  ? 263  LEU A CD1 1 
ATOM   2117 C CD2 . LEU A 1 264 ? 3.344   26.964  71.898  1.00 35.73  ? 263  LEU A CD2 1 
ATOM   2118 N N   . SER A 1 265 ? 6.438   27.347  75.639  1.00 35.84  ? 264  SER A N   1 
ATOM   2119 C CA  . SER A 1 265 ? 6.020   27.616  77.015  1.00 36.21  ? 264  SER A CA  1 
ATOM   2120 C C   . SER A 1 265 ? 6.859   28.726  77.631  1.00 33.76  ? 264  SER A C   1 
ATOM   2121 O O   . SER A 1 265 ? 6.363   29.528  78.418  1.00 34.91  ? 264  SER A O   1 
ATOM   2122 C CB  . SER A 1 265 ? 6.122   26.353  77.880  1.00 35.07  ? 264  SER A CB  1 
ATOM   2123 O OG  . SER A 1 265 ? 7.471   26.058  78.187  1.00 41.38  ? 264  SER A OG  1 
ATOM   2124 N N   . GLN A 1 266 ? 8.131   28.782  77.269  1.00 33.68  ? 265  GLN A N   1 
ATOM   2125 C CA  . GLN A 1 266 ? 8.992   29.813  77.825  1.00 34.61  ? 265  GLN A CA  1 
ATOM   2126 C C   . GLN A 1 266 ? 8.736   31.198  77.236  1.00 33.31  ? 265  GLN A C   1 
ATOM   2127 O O   . GLN A 1 266 ? 8.918   32.216  77.918  1.00 33.72  ? 265  GLN A O   1 
ATOM   2128 C CB  . GLN A 1 266 ? 10.444  29.398  77.656  1.00 37.12  ? 265  GLN A CB  1 
ATOM   2129 C CG  . GLN A 1 266 ? 10.722  28.095  78.382  1.00 42.09  ? 265  GLN A CG  1 
ATOM   2130 C CD  . GLN A 1 266 ? 12.188  27.753  78.451  1.00 44.29  ? 265  GLN A CD  1 
ATOM   2131 O OE1 . GLN A 1 266 ? 12.749  27.151  77.532  1.00 46.00  ? 265  GLN A OE1 1 
ATOM   2132 N NE2 . GLN A 1 266 ? 12.827  28.148  79.547  1.00 46.92  ? 265  GLN A NE2 1 
ATOM   2133 N N   . MET A 1 267 ? 8.293   31.229  75.980  1.00 31.78  ? 266  MET A N   1 
ATOM   2134 C CA  . MET A 1 267 ? 7.977   32.479  75.296  1.00 30.74  ? 266  MET A CA  1 
ATOM   2135 C C   . MET A 1 267 ? 6.624   33.031  75.735  1.00 33.20  ? 266  MET A C   1 
ATOM   2136 O O   . MET A 1 267 ? 6.328   34.208  75.514  1.00 34.26  ? 266  MET A O   1 
ATOM   2137 C CB  . MET A 1 267 ? 7.932   32.264  73.795  1.00 28.77  ? 266  MET A CB  1 
ATOM   2138 C CG  . MET A 1 267 ? 9.120   31.557  73.240  1.00 26.97  ? 266  MET A CG  1 
ATOM   2139 S SD  . MET A 1 267 ? 9.133   31.814  71.480  1.00 32.14  ? 266  MET A SD  1 
ATOM   2140 C CE  . MET A 1 267 ? 9.107   30.217  70.904  1.00 32.10  ? 266  MET A CE  1 
ATOM   2141 N N   . LEU A 1 268 ? 5.803   32.181  76.351  1.00 34.01  ? 267  LEU A N   1 
ATOM   2142 C CA  . LEU A 1 268 ? 4.479   32.592  76.814  1.00 35.25  ? 267  LEU A CA  1 
ATOM   2143 C C   . LEU A 1 268 ? 4.398   32.639  78.339  1.00 36.56  ? 267  LEU A C   1 
ATOM   2144 O O   . LEU A 1 268 ? 3.339   32.423  78.929  1.00 37.13  ? 267  LEU A O   1 
ATOM   2145 C CB  . LEU A 1 268 ? 3.407   31.634  76.290  1.00 33.65  ? 267  LEU A CB  1 
ATOM   2146 C CG  . LEU A 1 268 ? 3.265   31.435  74.787  1.00 32.94  ? 267  LEU A CG  1 
ATOM   2147 C CD1 . LEU A 1 268 ? 2.145   30.454  74.528  1.00 32.04  ? 267  LEU A CD1 1 
ATOM   2148 C CD2 . LEU A 1 268 ? 2.995   32.760  74.113  1.00 33.53  ? 267  LEU A CD2 1 
ATOM   2149 N N   . HIS A 1 269 ? 5.513   32.911  78.989  1.00 36.20  ? 268  HIS A N   1 
ATOM   2150 C CA  . HIS A 1 269 ? 5.481   32.976  80.431  1.00 38.51  ? 268  HIS A CA  1 
ATOM   2151 C C   . HIS A 1 269 ? 4.687   34.201  80.884  1.00 39.64  ? 268  HIS A C   1 
ATOM   2152 O O   . HIS A 1 269 ? 4.806   35.283  80.310  1.00 40.03  ? 268  HIS A O   1 
ATOM   2153 C CB  . HIS A 1 269 ? 6.894   33.063  80.979  1.00 40.13  ? 268  HIS A CB  1 
ATOM   2154 C CG  . HIS A 1 269 ? 7.094   32.256  82.214  1.00 46.58  ? 268  HIS A CG  1 
ATOM   2155 N ND1 . HIS A 1 269 ? 7.335   30.899  82.177  1.00 48.20  ? 268  HIS A ND1 1 
ATOM   2156 C CD2 . HIS A 1 269 ? 7.016   32.595  83.523  1.00 48.37  ? 268  HIS A CD2 1 
ATOM   2157 C CE1 . HIS A 1 269 ? 7.395   30.437  83.414  1.00 51.43  ? 268  HIS A CE1 1 
ATOM   2158 N NE2 . HIS A 1 269 ? 7.204   31.445  84.249  1.00 50.53  ? 268  HIS A NE2 1 
ATOM   2159 N N   . TYR A 1 270 ? 3.875   34.046  81.917  1.00 39.88  ? 269  TYR A N   1 
ATOM   2160 C CA  . TYR A 1 270 ? 3.121   35.182  82.397  1.00 40.22  ? 269  TYR A CA  1 
ATOM   2161 C C   . TYR A 1 270 ? 4.063   36.281  82.887  1.00 41.30  ? 269  TYR A C   1 
ATOM   2162 O O   . TYR A 1 270 ? 4.112   37.366  82.297  1.00 41.24  ? 269  TYR A O   1 
ATOM   2163 C CB  . TYR A 1 270 ? 2.161   34.755  83.507  1.00 40.54  ? 269  TYR A CB  1 
ATOM   2164 C CG  . TYR A 1 270 ? 0.791   34.361  82.997  1.00 43.44  ? 269  TYR A CG  1 
ATOM   2165 C CD1 . TYR A 1 270 ? -0.109  35.323  82.524  1.00 44.75  ? 269  TYR A CD1 1 
ATOM   2166 C CD2 . TYR A 1 270 ? 0.388   33.028  82.986  1.00 43.80  ? 269  TYR A CD2 1 
ATOM   2167 C CE1 . TYR A 1 270 ? -1.381  34.960  82.060  1.00 45.10  ? 269  TYR A CE1 1 
ATOM   2168 C CE2 . TYR A 1 270 ? -0.870  32.657  82.520  1.00 45.10  ? 269  TYR A CE2 1 
ATOM   2169 C CZ  . TYR A 1 270 ? -1.748  33.622  82.063  1.00 45.13  ? 269  TYR A CZ  1 
ATOM   2170 O OH  . TYR A 1 270 ? -2.987  33.238  81.614  1.00 45.71  ? 269  TYR A OH  1 
ATOM   2171 N N   . ASP A 1 271 ? 4.810   35.999  83.953  1.00 41.12  ? 270  ASP A N   1 
ATOM   2172 C CA  . ASP A 1 271 ? 5.748   36.966  84.529  1.00 42.96  ? 270  ASP A CA  1 
ATOM   2173 C C   . ASP A 1 271 ? 6.794   37.407  83.503  1.00 42.94  ? 270  ASP A C   1 
ATOM   2174 O O   . ASP A 1 271 ? 7.684   36.638  83.152  1.00 44.46  ? 270  ASP A O   1 
ATOM   2175 C CB  . ASP A 1 271 ? 6.461   36.350  85.733  1.00 43.23  ? 270  ASP A CB  1 
ATOM   2176 C CG  . ASP A 1 271 ? 7.269   37.364  86.507  1.00 44.59  ? 270  ASP A CG  1 
ATOM   2177 O OD1 . ASP A 1 271 ? 7.497   38.472  85.975  1.00 43.29  ? 270  ASP A OD1 1 
ATOM   2178 O OD2 . ASP A 1 271 ? 7.683   37.049  87.646  1.00 46.50  ? 270  ASP A OD2 1 
ATOM   2179 N N   . PRO A 1 272 ? 6.708   38.659  83.020  1.00 42.85  ? 271  PRO A N   1 
ATOM   2180 C CA  . PRO A 1 272 ? 7.677   39.144  82.028  1.00 43.03  ? 271  PRO A CA  1 
ATOM   2181 C C   . PRO A 1 272 ? 9.158   39.053  82.414  1.00 43.39  ? 271  PRO A C   1 
ATOM   2182 O O   . PRO A 1 272 ? 10.026  39.159  81.555  1.00 44.75  ? 271  PRO A O   1 
ATOM   2183 C CB  . PRO A 1 272 ? 7.212   40.581  81.751  1.00 39.45  ? 271  PRO A CB  1 
ATOM   2184 C CG  . PRO A 1 272 ? 6.522   40.971  82.988  1.00 39.76  ? 271  PRO A CG  1 
ATOM   2185 C CD  . PRO A 1 272 ? 5.766   39.727  83.395  1.00 41.82  ? 271  PRO A CD  1 
ATOM   2186 N N   . ASN A 1 273 ? 9.457   38.846  83.691  1.00 44.72  ? 272  ASN A N   1 
ATOM   2187 C CA  . ASN A 1 273 ? 10.850  38.723  84.104  1.00 46.62  ? 272  ASN A CA  1 
ATOM   2188 C C   . ASN A 1 273 ? 11.352  37.299  83.916  1.00 46.40  ? 272  ASN A C   1 
ATOM   2189 O O   . ASN A 1 273 ? 12.556  37.055  83.935  1.00 47.68  ? 272  ASN A O   1 
ATOM   2190 C CB  . ASN A 1 273 ? 11.025  39.093  85.567  1.00 49.24  ? 272  ASN A CB  1 
ATOM   2191 C CG  . ASN A 1 273 ? 10.561  40.474  85.865  1.00 52.47  ? 272  ASN A CG  1 
ATOM   2192 O OD1 . ASN A 1 273 ? 10.916  41.417  85.162  1.00 54.14  ? 272  ASN A OD1 1 
ATOM   2193 N ND2 . ASN A 1 273 ? 9.760   40.618  86.921  1.00 56.15  ? 272  ASN A ND2 1 
ATOM   2194 N N   . LYS A 1 274 ? 10.433  36.355  83.749  1.00 45.07  ? 273  LYS A N   1 
ATOM   2195 C CA  . LYS A 1 274 ? 10.829  34.972  83.571  1.00 43.13  ? 273  LYS A CA  1 
ATOM   2196 C C   . LYS A 1 274 ? 10.666  34.552  82.131  1.00 41.11  ? 273  LYS A C   1 
ATOM   2197 O O   . LYS A 1 274 ? 11.169  33.499  81.747  1.00 41.88  ? 273  LYS A O   1 
ATOM   2198 C CB  . LYS A 1 274 ? 9.989   34.031  84.438  1.00 45.63  ? 273  LYS A CB  1 
ATOM   2199 C CG  . LYS A 1 274 ? 9.425   34.658  85.700  1.00 53.38  ? 273  LYS A CG  1 
ATOM   2200 C CD  . LYS A 1 274 ? 10.515  35.257  86.584  1.00 56.11  ? 273  LYS A CD  1 
ATOM   2201 C CE  . LYS A 1 274 ? 11.455  34.186  87.122  1.00 56.99  ? 273  LYS A CE  1 
ATOM   2202 N NZ  . LYS A 1 274 ? 12.516  34.781  87.987  1.00 58.16  ? 273  LYS A NZ  1 
ATOM   2203 N N   . ARG A 1 275 ? 9.972   35.334  81.310  1.00 37.10  ? 274  ARG A N   1 
ATOM   2204 C CA  . ARG A 1 275 ? 9.840   34.851  79.950  1.00 36.61  ? 274  ARG A CA  1 
ATOM   2205 C C   . ARG A 1 275 ? 11.100  35.067  79.121  1.00 35.80  ? 274  ARG A C   1 
ATOM   2206 O O   . ARG A 1 275 ? 11.669  36.162  79.021  1.00 37.06  ? 274  ARG A O   1 
ATOM   2207 C CB  . ARG A 1 275 ? 8.546   35.361  79.289  1.00 35.55  ? 274  ARG A CB  1 
ATOM   2208 C CG  . ARG A 1 275 ? 8.578   36.520  78.352  1.00 35.27  ? 274  ARG A CG  1 
ATOM   2209 C CD  . ARG A 1 275 ? 7.208   36.608  77.640  1.00 34.37  ? 274  ARG A CD  1 
ATOM   2210 N NE  . ARG A 1 275 ? 6.102   36.874  78.560  1.00 29.80  ? 274  ARG A NE  1 
ATOM   2211 C CZ  . ARG A 1 275 ? 5.503   38.050  78.687  1.00 30.34  ? 274  ARG A CZ  1 
ATOM   2212 N NH1 . ARG A 1 275 ? 5.886   39.080  77.948  1.00 31.78  ? 274  ARG A NH1 1 
ATOM   2213 N NH2 . ARG A 1 275 ? 4.540   38.207  79.578  1.00 31.75  ? 274  ARG A NH2 1 
ATOM   2214 N N   . ILE A 1 276 ? 11.561  33.952  78.584  1.00 32.06  ? 275  ILE A N   1 
ATOM   2215 C CA  . ILE A 1 276 ? 12.767  33.893  77.803  1.00 30.14  ? 275  ILE A CA  1 
ATOM   2216 C C   . ILE A 1 276 ? 13.009  35.052  76.848  1.00 30.23  ? 275  ILE A C   1 
ATOM   2217 O O   . ILE A 1 276 ? 12.092  35.561  76.215  1.00 28.52  ? 275  ILE A O   1 
ATOM   2218 C CB  . ILE A 1 276 ? 12.816  32.553  77.043  1.00 29.50  ? 275  ILE A CB  1 
ATOM   2219 C CG1 . ILE A 1 276 ? 14.254  32.239  76.639  1.00 27.39  ? 275  ILE A CG1 1 
ATOM   2220 C CG2 . ILE A 1 276 ? 11.898  32.596  75.835  1.00 24.61  ? 275  ILE A CG2 1 
ATOM   2221 C CD1 . ILE A 1 276 ? 14.439  30.808  76.234  1.00 28.06  ? 275  ILE A CD1 1 
ATOM   2222 N N   . SER A 1 277 ? 14.275  35.460  76.772  1.00 32.73  ? 276  SER A N   1 
ATOM   2223 C CA  . SER A 1 277 ? 14.722  36.537  75.893  1.00 32.24  ? 276  SER A CA  1 
ATOM   2224 C C   . SER A 1 277 ? 15.070  35.915  74.535  1.00 32.86  ? 276  SER A C   1 
ATOM   2225 O O   . SER A 1 277 ? 15.325  34.709  74.444  1.00 34.17  ? 276  SER A O   1 
ATOM   2226 C CB  . SER A 1 277 ? 15.973  37.195  76.466  1.00 33.36  ? 276  SER A CB  1 
ATOM   2227 O OG  . SER A 1 277 ? 17.129  36.422  76.158  1.00 37.82  ? 276  SER A OG  1 
ATOM   2228 N N   . ALA A 1 278 ? 15.105  36.722  73.483  1.00 30.71  ? 277  ALA A N   1 
ATOM   2229 C CA  . ALA A 1 278 ? 15.423  36.169  72.176  1.00 31.39  ? 277  ALA A CA  1 
ATOM   2230 C C   . ALA A 1 278 ? 16.817  35.563  72.129  1.00 31.31  ? 277  ALA A C   1 
ATOM   2231 O O   . ALA A 1 278 ? 17.024  34.552  71.449  1.00 33.17  ? 277  ALA A O   1 
ATOM   2232 C CB  . ALA A 1 278 ? 15.273  37.230  71.099  1.00 32.18  ? 277  ALA A CB  1 
ATOM   2233 N N   . LYS A 1 279 ? 17.769  36.167  72.842  1.00 31.35  ? 278  LYS A N   1 
ATOM   2234 C CA  . LYS A 1 279 ? 19.146  35.655  72.865  1.00 31.99  ? 278  LYS A CA  1 
ATOM   2235 C C   . LYS A 1 279 ? 19.178  34.223  73.362  1.00 32.69  ? 278  LYS A C   1 
ATOM   2236 O O   . LYS A 1 279 ? 19.611  33.311  72.650  1.00 31.72  ? 278  LYS A O   1 
ATOM   2237 C CB  . LYS A 1 279 ? 20.038  36.487  73.788  1.00 32.63  ? 278  LYS A CB  1 
ATOM   2238 C CG  . LYS A 1 279 ? 20.503  37.780  73.214  1.00 36.96  ? 278  LYS A CG  1 
ATOM   2239 C CD  . LYS A 1 279 ? 21.705  38.318  73.982  1.00 41.14  ? 278  LYS A CD  1 
ATOM   2240 C CE  . LYS A 1 279 ? 21.311  38.853  75.334  1.00 42.04  ? 278  LYS A CE  1 
ATOM   2241 N NZ  . LYS A 1 279 ? 22.447  39.589  75.931  1.00 43.16  ? 278  LYS A NZ  1 
ATOM   2242 N N   . ALA A 1 280 ? 18.725  34.050  74.603  1.00 32.30  ? 279  ALA A N   1 
ATOM   2243 C CA  . ALA A 1 280 ? 18.687  32.747  75.241  1.00 33.07  ? 279  ALA A CA  1 
ATOM   2244 C C   . ALA A 1 280 ? 17.942  31.727  74.375  1.00 34.04  ? 279  ALA A C   1 
ATOM   2245 O O   . ALA A 1 280 ? 18.413  30.609  74.172  1.00 35.67  ? 279  ALA A O   1 
ATOM   2246 C CB  . ALA A 1 280 ? 18.032  32.862  76.600  1.00 30.10  ? 279  ALA A CB  1 
ATOM   2247 N N   . ALA A 1 281 ? 16.793  32.125  73.844  1.00 34.08  ? 280  ALA A N   1 
ATOM   2248 C CA  . ALA A 1 281 ? 15.998  31.232  73.015  1.00 33.87  ? 280  ALA A CA  1 
ATOM   2249 C C   . ALA A 1 281 ? 16.795  30.624  71.856  1.00 34.00  ? 280  ALA A C   1 
ATOM   2250 O O   . ALA A 1 281 ? 16.560  29.479  71.471  1.00 35.84  ? 280  ALA A O   1 
ATOM   2251 C CB  . ALA A 1 281 ? 14.772  31.972  72.489  1.00 32.27  ? 280  ALA A CB  1 
ATOM   2252 N N   . LEU A 1 282 ? 17.740  31.380  71.307  1.00 33.90  ? 281  LEU A N   1 
ATOM   2253 C CA  . LEU A 1 282 ? 18.562  30.897  70.194  1.00 33.31  ? 281  LEU A CA  1 
ATOM   2254 C C   . LEU A 1 282 ? 19.354  29.628  70.515  1.00 33.97  ? 281  LEU A C   1 
ATOM   2255 O O   . LEU A 1 282 ? 19.769  28.907  69.604  1.00 34.16  ? 281  LEU A O   1 
ATOM   2256 C CB  . LEU A 1 282 ? 19.556  31.976  69.767  1.00 32.62  ? 281  LEU A CB  1 
ATOM   2257 C CG  . LEU A 1 282 ? 19.032  33.273  69.165  1.00 33.17  ? 281  LEU A CG  1 
ATOM   2258 C CD1 . LEU A 1 282 ? 20.173  34.287  69.014  1.00 30.36  ? 281  LEU A CD1 1 
ATOM   2259 C CD2 . LEU A 1 282 ? 18.408  32.953  67.827  1.00 33.39  ? 281  LEU A CD2 1 
ATOM   2260 N N   . ALA A 1 283 ? 19.573  29.359  71.799  1.00 32.81  ? 282  ALA A N   1 
ATOM   2261 C CA  . ALA A 1 283 ? 20.354  28.189  72.193  1.00 33.90  ? 282  ALA A CA  1 
ATOM   2262 C C   . ALA A 1 283 ? 19.501  26.994  72.549  1.00 35.33  ? 282  ALA A C   1 
ATOM   2263 O O   . ALA A 1 283 ? 20.021  25.894  72.748  1.00 38.09  ? 282  ALA A O   1 
ATOM   2264 C CB  . ALA A 1 283 ? 21.252  28.534  73.359  1.00 33.59  ? 282  ALA A CB  1 
ATOM   2265 N N   . HIS A 1 284 ? 18.194  27.215  72.622  1.00 35.53  ? 283  HIS A N   1 
ATOM   2266 C CA  . HIS A 1 284 ? 17.232  26.170  72.962  1.00 34.00  ? 283  HIS A CA  1 
ATOM   2267 C C   . HIS A 1 284 ? 17.339  24.945  72.053  1.00 33.55  ? 283  HIS A C   1 
ATOM   2268 O O   . HIS A 1 284 ? 17.427  25.068  70.831  1.00 35.28  ? 283  HIS A O   1 
ATOM   2269 C CB  . HIS A 1 284 ? 15.805  26.740  72.895  1.00 32.63  ? 283  HIS A CB  1 
ATOM   2270 C CG  . HIS A 1 284 ? 14.787  25.890  73.586  1.00 30.14  ? 283  HIS A CG  1 
ATOM   2271 N ND1 . HIS A 1 284 ? 14.348  24.689  73.070  1.00 28.50  ? 283  HIS A ND1 1 
ATOM   2272 C CD2 . HIS A 1 284 ? 14.209  26.013  74.805  1.00 26.97  ? 283  HIS A CD2 1 
ATOM   2273 C CE1 . HIS A 1 284 ? 13.552  24.106  73.949  1.00 28.43  ? 283  HIS A CE1 1 
ATOM   2274 N NE2 . HIS A 1 284 ? 13.452  24.888  75.010  1.00 25.43  ? 283  HIS A NE2 1 
ATOM   2275 N N   . PRO A 1 285 ? 17.311  23.746  72.645  1.00 32.91  ? 284  PRO A N   1 
ATOM   2276 C CA  . PRO A 1 285 ? 17.401  22.447  71.959  1.00 33.64  ? 284  PRO A CA  1 
ATOM   2277 C C   . PRO A 1 285 ? 16.525  22.323  70.710  1.00 34.49  ? 284  PRO A C   1 
ATOM   2278 O O   . PRO A 1 285 ? 16.852  21.602  69.771  1.00 36.31  ? 284  PRO A O   1 
ATOM   2279 C CB  . PRO A 1 285 ? 16.983  21.456  73.040  1.00 32.24  ? 284  PRO A CB  1 
ATOM   2280 C CG  . PRO A 1 285 ? 17.476  22.098  74.273  1.00 35.39  ? 284  PRO A CG  1 
ATOM   2281 C CD  . PRO A 1 285 ? 17.091  23.559  74.086  1.00 32.77  ? 284  PRO A CD  1 
ATOM   2282 N N   . PHE A 1 286 ? 15.404  23.020  70.701  1.00 34.79  ? 285  PHE A N   1 
ATOM   2283 C CA  . PHE A 1 286 ? 14.512  22.972  69.558  1.00 36.57  ? 285  PHE A CA  1 
ATOM   2284 C C   . PHE A 1 286 ? 15.216  23.272  68.217  1.00 37.56  ? 285  PHE A C   1 
ATOM   2285 O O   . PHE A 1 286 ? 14.800  22.788  67.168  1.00 38.85  ? 285  PHE A O   1 
ATOM   2286 C CB  . PHE A 1 286 ? 13.369  23.961  69.793  1.00 36.69  ? 285  PHE A CB  1 
ATOM   2287 C CG  . PHE A 1 286 ? 12.330  23.973  68.710  1.00 37.76  ? 285  PHE A CG  1 
ATOM   2288 C CD1 . PHE A 1 286 ? 11.456  22.905  68.554  1.00 35.02  ? 285  PHE A CD1 1 
ATOM   2289 C CD2 . PHE A 1 286 ? 12.199  25.085  67.868  1.00 40.03  ? 285  PHE A CD2 1 
ATOM   2290 C CE1 . PHE A 1 286 ? 10.461  22.933  67.586  1.00 34.65  ? 285  PHE A CE1 1 
ATOM   2291 C CE2 . PHE A 1 286 ? 11.202  25.130  66.889  1.00 38.26  ? 285  PHE A CE2 1 
ATOM   2292 C CZ  . PHE A 1 286 ? 10.330  24.049  66.750  1.00 39.06  ? 285  PHE A CZ  1 
ATOM   2293 N N   . PHE A 1 287 ? 16.298  24.043  68.253  1.00 38.91  ? 286  PHE A N   1 
ATOM   2294 C CA  . PHE A 1 287 ? 17.006  24.417  67.024  1.00 40.57  ? 286  PHE A CA  1 
ATOM   2295 C C   . PHE A 1 287 ? 18.212  23.582  66.615  1.00 42.76  ? 286  PHE A C   1 
ATOM   2296 O O   . PHE A 1 287 ? 18.797  23.830  65.557  1.00 41.14  ? 286  PHE A O   1 
ATOM   2297 C CB  . PHE A 1 287 ? 17.458  25.878  67.104  1.00 35.48  ? 286  PHE A CB  1 
ATOM   2298 C CG  . PHE A 1 287 ? 16.349  26.833  67.364  1.00 34.67  ? 286  PHE A CG  1 
ATOM   2299 C CD1 . PHE A 1 287 ? 15.316  26.984  66.445  1.00 33.27  ? 286  PHE A CD1 1 
ATOM   2300 C CD2 . PHE A 1 287 ? 16.318  27.578  68.541  1.00 34.82  ? 286  PHE A CD2 1 
ATOM   2301 C CE1 . PHE A 1 287 ? 14.269  27.862  66.695  1.00 31.64  ? 286  PHE A CE1 1 
ATOM   2302 C CE2 . PHE A 1 287 ? 15.275  28.456  68.798  1.00 31.03  ? 286  PHE A CE2 1 
ATOM   2303 C CZ  . PHE A 1 287 ? 14.247  28.597  67.871  1.00 32.36  ? 286  PHE A CZ  1 
ATOM   2304 N N   . GLN A 1 288 ? 18.579  22.593  67.422  1.00 47.28  ? 287  GLN A N   1 
ATOM   2305 C CA  . GLN A 1 288 ? 19.756  21.786  67.115  1.00 51.99  ? 287  GLN A CA  1 
ATOM   2306 C C   . GLN A 1 288 ? 19.813  21.229  65.696  1.00 52.08  ? 287  GLN A C   1 
ATOM   2307 O O   . GLN A 1 288 ? 20.897  20.990  65.169  1.00 52.94  ? 287  GLN A O   1 
ATOM   2308 C CB  . GLN A 1 288 ? 19.919  20.656  68.143  1.00 55.43  ? 287  GLN A CB  1 
ATOM   2309 C CG  . GLN A 1 288 ? 18.866  19.551  68.110  1.00 63.78  ? 287  GLN A CG  1 
ATOM   2310 C CD  . GLN A 1 288 ? 18.991  18.614  69.312  1.00 67.52  ? 287  GLN A CD  1 
ATOM   2311 O OE1 . GLN A 1 288 ? 20.096  18.383  69.816  1.00 70.87  ? 287  GLN A OE1 1 
ATOM   2312 N NE2 . GLN A 1 288 ? 17.863  18.067  69.771  1.00 66.86  ? 287  GLN A NE2 1 
ATOM   2313 N N   . ASP A 1 289 ? 18.659  21.063  65.061  1.00 52.50  ? 288  ASP A N   1 
ATOM   2314 C CA  . ASP A 1 289 ? 18.608  20.519  63.706  1.00 54.53  ? 288  ASP A CA  1 
ATOM   2315 C C   . ASP A 1 289 ? 18.152  21.535  62.654  1.00 54.80  ? 288  ASP A C   1 
ATOM   2316 O O   . ASP A 1 289 ? 17.865  21.172  61.506  1.00 54.15  ? 288  ASP A O   1 
ATOM   2317 C CB  . ASP A 1 289 ? 17.659  19.325  63.691  1.00 57.75  ? 288  ASP A CB  1 
ATOM   2318 C CG  . ASP A 1 289 ? 16.273  19.686  64.202  1.00 61.19  ? 288  ASP A CG  1 
ATOM   2319 O OD1 . ASP A 1 289 ? 15.332  19.769  63.381  1.00 63.85  ? 288  ASP A OD1 1 
ATOM   2320 O OD2 . ASP A 1 289 ? 16.128  19.901  65.428  1.00 62.58  ? 288  ASP A OD2 1 
ATOM   2321 N N   . VAL A 1 290 ? 18.093  22.805  63.043  1.00 52.85  ? 289  VAL A N   1 
ATOM   2322 C CA  . VAL A 1 290 ? 17.646  23.854  62.140  1.00 52.24  ? 289  VAL A CA  1 
ATOM   2323 C C   . VAL A 1 290 ? 18.470  23.981  60.853  1.00 52.88  ? 289  VAL A C   1 
ATOM   2324 O O   . VAL A 1 290 ? 19.671  23.719  60.829  1.00 51.96  ? 289  VAL A O   1 
ATOM   2325 C CB  . VAL A 1 290 ? 17.627  25.227  62.871  1.00 52.24  ? 289  VAL A CB  1 
ATOM   2326 C CG1 . VAL A 1 290 ? 19.051  25.720  63.110  1.00 51.22  ? 289  VAL A CG1 1 
ATOM   2327 C CG2 . VAL A 1 290 ? 16.824  26.238  62.070  1.00 51.20  ? 289  VAL A CG2 1 
ATOM   2328 N N   . THR A 1 291 ? 17.799  24.375  59.779  1.00 54.43  ? 290  THR A N   1 
ATOM   2329 C CA  . THR A 1 291 ? 18.436  24.593  58.480  1.00 56.91  ? 290  THR A CA  1 
ATOM   2330 C C   . THR A 1 291 ? 17.692  25.748  57.852  1.00 56.92  ? 290  THR A C   1 
ATOM   2331 O O   . THR A 1 291 ? 16.660  26.171  58.369  1.00 58.11  ? 290  THR A O   1 
ATOM   2332 C CB  . THR A 1 291 ? 18.280  23.392  57.521  1.00 58.44  ? 290  THR A CB  1 
ATOM   2333 O OG1 . THR A 1 291 ? 16.939  22.889  57.596  1.00 59.81  ? 290  THR A OG1 1 
ATOM   2334 C CG2 . THR A 1 291 ? 19.281  22.290  57.853  1.00 60.23  ? 290  THR A CG2 1 
ATOM   2335 N N   . LYS A 1 292 ? 18.214  26.267  56.750  1.00 56.36  ? 291  LYS A N   1 
ATOM   2336 C CA  . LYS A 1 292 ? 17.538  27.347  56.056  1.00 56.40  ? 291  LYS A CA  1 
ATOM   2337 C C   . LYS A 1 292 ? 16.953  26.707  54.809  1.00 58.60  ? 291  LYS A C   1 
ATOM   2338 O O   . LYS A 1 292 ? 17.463  26.891  53.707  1.00 58.38  ? 291  LYS A O   1 
ATOM   2339 C CB  . LYS A 1 292 ? 18.522  28.463  55.690  1.00 53.61  ? 291  LYS A CB  1 
ATOM   2340 C CG  . LYS A 1 292 ? 17.886  29.692  55.036  1.00 49.94  ? 291  LYS A CG  1 
ATOM   2341 C CD  . LYS A 1 292 ? 18.809  30.897  55.156  1.00 47.69  ? 291  LYS A CD  1 
ATOM   2342 C CE  . LYS A 1 292 ? 18.243  32.132  54.483  1.00 48.18  ? 291  LYS A CE  1 
ATOM   2343 N NZ  . LYS A 1 292 ? 18.941  33.376  54.948  1.00 45.29  ? 291  LYS A NZ  1 
ATOM   2344 N N   . PRO A 1 293 ? 15.877  25.923  54.979  1.00 60.53  ? 292  PRO A N   1 
ATOM   2345 C CA  . PRO A 1 293 ? 15.207  25.240  53.878  1.00 63.92  ? 292  PRO A CA  1 
ATOM   2346 C C   . PRO A 1 293 ? 14.855  26.228  52.785  1.00 68.25  ? 292  PRO A C   1 
ATOM   2347 O O   . PRO A 1 293 ? 15.730  26.775  52.130  1.00 70.26  ? 292  PRO A O   1 
ATOM   2348 C CB  . PRO A 1 293 ? 13.953  24.672  54.527  1.00 63.40  ? 292  PRO A CB  1 
ATOM   2349 C CG  . PRO A 1 293 ? 14.320  24.536  55.962  1.00 63.39  ? 292  PRO A CG  1 
ATOM   2350 C CD  . PRO A 1 293 ? 15.076  25.806  56.205  1.00 61.84  ? 292  PRO A CD  1 
ATOM   2351 N N   . VAL A 1 294 ? 13.563  26.476  52.615  1.00 71.57  ? 293  VAL A N   1 
ATOM   2352 C CA  . VAL A 1 294 ? 13.101  27.371  51.581  1.00 75.39  ? 293  VAL A CA  1 
ATOM   2353 C C   . VAL A 1 294 ? 11.561  27.402  51.643  1.00 78.34  ? 293  VAL A C   1 
ATOM   2354 O O   . VAL A 1 294 ? 10.915  26.471  52.146  1.00 78.38  ? 293  VAL A O   1 
ATOM   2355 C CB  . VAL A 1 294 ? 13.526  26.819  50.219  1.00 73.73  ? 293  VAL A CB  1 
ATOM   2356 C CG1 . VAL A 1 294 ? 12.490  25.821  49.766  1.00 74.27  ? 293  VAL A CG1 1 
ATOM   2357 C CG2 . VAL A 1 294 ? 13.780  27.928  49.221  1.00 73.65  ? 293  VAL A CG2 1 
ATOM   2358 N N   . PRO A 1 295 ? 10.963  28.486  51.134  1.00 81.20  ? 294  PRO A N   1 
ATOM   2359 C CA  . PRO A 1 295 ? 9.510   28.596  51.142  1.00 84.31  ? 294  PRO A CA  1 
ATOM   2360 C C   . PRO A 1 295 ? 8.906   27.612  50.163  1.00 87.62  ? 294  PRO A C   1 
ATOM   2361 O O   . PRO A 1 295 ? 9.614   26.859  49.475  1.00 87.90  ? 294  PRO A O   1 
ATOM   2362 C CB  . PRO A 1 295 ? 9.269   30.035  50.738  1.00 83.08  ? 294  PRO A CB  1 
ATOM   2363 C CG  . PRO A 1 295 ? 10.396  30.312  49.807  1.00 83.18  ? 294  PRO A CG  1 
ATOM   2364 C CD  . PRO A 1 295 ? 11.584  29.662  50.503  1.00 81.67  ? 294  PRO A CD  1 
ATOM   2365 N N   . HIS A 1 296 ? 7.580   27.682  50.077  1.00 92.21  ? 295  HIS A N   1 
ATOM   2366 C CA  . HIS A 1 296 ? 6.830   26.774  49.195  1.00 94.79  ? 295  HIS A CA  1 
ATOM   2367 C C   . HIS A 1 296 ? 6.142   27.271  47.955  1.00 95.05  ? 295  HIS A C   1 
ATOM   2368 O O   . HIS A 1 296 ? 5.161   26.585  47.457  1.00 95.31  ? 295  HIS A O   1 
ATOM   2369 C CB  . HIS A 1 296 ? 5.799   25.991  49.967  1.00 97.73  ? 295  HIS A CB  1 
ATOM   2370 C CG  . HIS A 1 296 ? 6.403   25.138  51.006  1.00 99.84  ? 295  HIS A CG  1 
ATOM   2371 N ND1 . HIS A 1 296 ? 5.877   23.917  51.337  1.00 100.89 ? 295  HIS A ND1 1 
ATOM   2372 C CD2 . HIS A 1 296 ? 7.490   25.321  51.792  1.00 101.21 ? 295  HIS A CD2 1 
ATOM   2373 C CE1 . HIS A 1 296 ? 6.613   23.376  52.289  1.00 102.66 ? 295  HIS A CE1 1 
ATOM   2374 N NE2 . HIS A 1 296 ? 7.598   24.207  52.584  1.00 102.72 ? 295  HIS A NE2 1 
ATOM   2375 N N   . LEU A 1 297 ? 6.694   28.419  47.489  1.00 95.78  ? 296  LEU A N   1 
ATOM   2376 C CA  . LEU A 1 297 ? 6.257   29.174  46.274  1.00 96.25  ? 296  LEU A CA  1 
ATOM   2377 C C   . LEU A 1 297 ? 7.112   28.970  45.015  1.00 96.54  ? 296  LEU A C   1 
ATOM   2378 O O   . LEU A 1 297 ? 6.538   28.471  44.050  1.00 96.23  ? 296  LEU A O   1 
ATOM   2379 C CB  . LEU A 1 297 ? 6.019   30.728  46.499  1.00 95.36  ? 296  LEU A CB  1 
ATOM   2380 C CG  . LEU A 1 297 ? 5.661   31.546  45.242  1.00 95.09  ? 296  LEU A CG  1 
ATOM   2381 C CD1 . LEU A 1 297 ? 4.894   32.788  45.619  1.00 95.63  ? 296  LEU A CD1 1 
ATOM   2382 C CD2 . LEU A 1 297 ? 6.970   31.888  44.535  1.00 94.31  ? 296  LEU A CD2 1 
ATOM   2383 O OXT . LEU A 1 297 ? 8.318   29.231  44.980  1.00 98.47  ? 296  LEU A OXT 1 
ATOM   2384 N N   . VAL B 2 1   ? 14.308  42.584  84.537  1.00 83.80  ? 175  VAL B N   1 
ATOM   2385 C CA  . VAL B 2 1   ? 14.667  42.097  83.169  1.00 84.04  ? 175  VAL B CA  1 
ATOM   2386 C C   . VAL B 2 1   ? 15.967  42.794  82.722  1.00 81.80  ? 175  VAL B C   1 
ATOM   2387 O O   . VAL B 2 1   ? 15.940  43.788  81.980  1.00 81.68  ? 175  VAL B O   1 
ATOM   2388 C CB  . VAL B 2 1   ? 13.527  42.407  82.137  1.00 86.14  ? 175  VAL B CB  1 
ATOM   2389 C CG1 . VAL B 2 1   ? 13.694  41.530  80.885  1.00 87.87  ? 175  VAL B CG1 1 
ATOM   2390 C CG2 . VAL B 2 1   ? 12.140  42.215  82.781  1.00 86.81  ? 175  VAL B CG2 1 
ATOM   2391 N N   . PRO B 2 2   ? 17.123  42.290  83.195  1.00 78.86  ? 176  PRO B N   1 
ATOM   2392 C CA  . PRO B 2 2   ? 18.428  42.860  82.852  1.00 75.47  ? 176  PRO B CA  1 
ATOM   2393 C C   . PRO B 2 2   ? 19.296  41.989  81.937  1.00 71.97  ? 176  PRO B C   1 
ATOM   2394 O O   . PRO B 2 2   ? 20.499  41.890  82.151  1.00 71.12  ? 176  PRO B O   1 
ATOM   2395 C CB  . PRO B 2 2   ? 19.087  43.068  84.225  1.00 75.67  ? 176  PRO B CB  1 
ATOM   2396 C CG  . PRO B 2 2   ? 18.169  42.298  85.237  1.00 77.89  ? 176  PRO B CG  1 
ATOM   2397 C CD  . PRO B 2 2   ? 17.251  41.457  84.397  1.00 78.92  ? 176  PRO B CD  1 
ATOM   2398 N N   . ASP B 2 3   ? 18.705  41.385  80.909  1.00 68.44  ? 177  ASP B N   1 
ATOM   2399 C CA  . ASP B 2 3   ? 19.467  40.524  79.995  1.00 63.73  ? 177  ASP B CA  1 
ATOM   2400 C C   . ASP B 2 3   ? 20.160  41.273  78.859  1.00 59.24  ? 177  ASP B C   1 
ATOM   2401 O O   . ASP B 2 3   ? 21.038  40.715  78.193  1.00 56.53  ? 177  ASP B O   1 
ATOM   2402 C CB  . ASP B 2 3   ? 18.561  39.457  79.362  1.00 65.71  ? 177  ASP B CB  1 
ATOM   2403 C CG  . ASP B 2 3   ? 17.763  38.681  80.383  1.00 68.04  ? 177  ASP B CG  1 
ATOM   2404 O OD1 . ASP B 2 3   ? 18.382  38.123  81.313  1.00 69.66  ? 177  ASP B OD1 1 
ATOM   2405 O OD2 . ASP B 2 3   ? 16.518  38.627  80.251  1.00 69.72  ? 177  ASP B OD2 1 
ATOM   2406 N N   . TYR B 2 4   ? 19.762  42.523  78.632  1.00 53.29  ? 178  TYR B N   1 
ATOM   2407 C CA  . TYR B 2 4   ? 20.325  43.310  77.539  1.00 48.54  ? 178  TYR B CA  1 
ATOM   2408 C C   . TYR B 2 4   ? 21.084  44.540  78.001  1.00 47.83  ? 178  TYR B C   1 
ATOM   2409 O O   . TYR B 2 4   ? 21.651  45.264  77.190  1.00 48.30  ? 178  TYR B O   1 
ATOM   2410 C CB  . TYR B 2 4   ? 19.205  43.743  76.583  1.00 46.23  ? 178  TYR B CB  1 
ATOM   2411 C CG  . TYR B 2 4   ? 18.632  42.628  75.750  1.00 40.16  ? 178  TYR B CG  1 
ATOM   2412 C CD1 . TYR B 2 4   ? 19.314  42.150  74.636  1.00 40.21  ? 178  TYR B CD1 1 
ATOM   2413 C CD2 . TYR B 2 4   ? 17.437  42.016  76.103  1.00 38.37  ? 178  TYR B CD2 1 
ATOM   2414 C CE1 . TYR B 2 4   ? 18.822  41.083  73.891  1.00 37.94  ? 178  TYR B CE1 1 
ATOM   2415 C CE2 . TYR B 2 4   ? 16.933  40.942  75.370  1.00 37.25  ? 178  TYR B CE2 1 
ATOM   2416 C CZ  . TYR B 2 4   ? 17.632  40.479  74.263  1.00 39.01  ? 178  TYR B CZ  1 
ATOM   2417 O OH  . TYR B 2 4   ? 17.150  39.406  73.531  1.00 39.60  ? 178  TYR B OH  1 
ATOM   2418 N N   . HIS B 2 5   ? 21.086  44.775  79.304  1.00 47.56  ? 179  HIS B N   1 
ATOM   2419 C CA  . HIS B 2 5   ? 21.763  45.929  79.873  1.00 46.99  ? 179  HIS B CA  1 
ATOM   2420 C C   . HIS B 2 5   ? 23.151  46.191  79.292  1.00 46.99  ? 179  HIS B C   1 
ATOM   2421 O O   . HIS B 2 5   ? 23.440  47.303  78.833  1.00 44.59  ? 179  HIS B O   1 
ATOM   2422 C CB  . HIS B 2 5   ? 21.865  45.771  81.390  1.00 48.45  ? 179  HIS B CB  1 
ATOM   2423 C CG  . HIS B 2 5   ? 20.627  46.185  82.129  1.00 50.12  ? 179  HIS B CG  1 
ATOM   2424 N ND1 . HIS B 2 5   ? 19.358  45.983  81.631  1.00 50.18  ? 179  HIS B ND1 1 
ATOM   2425 C CD2 . HIS B 2 5   ? 20.466  46.728  83.360  1.00 50.54  ? 179  HIS B CD2 1 
ATOM   2426 C CE1 . HIS B 2 5   ? 18.468  46.379  82.523  1.00 48.97  ? 179  HIS B CE1 1 
ATOM   2427 N NE2 . HIS B 2 5   ? 19.113  46.834  83.581  1.00 50.87  ? 179  HIS B NE2 1 
ATOM   2428 N N   . GLU B 2 6   ? 24.009  45.175  79.303  1.00 45.75  ? 180  GLU B N   1 
ATOM   2429 C CA  . GLU B 2 6   ? 25.358  45.355  78.792  1.00 44.56  ? 180  GLU B CA  1 
ATOM   2430 C C   . GLU B 2 6   ? 25.478  45.526  77.286  1.00 42.59  ? 180  GLU B C   1 
ATOM   2431 O O   . GLU B 2 6   ? 26.344  46.271  76.814  1.00 43.34  ? 180  GLU B O   1 
ATOM   2432 C CB  . GLU B 2 6   ? 26.263  44.228  79.280  1.00 47.79  ? 180  GLU B CB  1 
ATOM   2433 C CG  . GLU B 2 6   ? 26.600  44.347  80.770  1.00 54.83  ? 180  GLU B CG  1 
ATOM   2434 C CD  . GLU B 2 6   ? 26.579  45.801  81.284  1.00 58.71  ? 180  GLU B CD  1 
ATOM   2435 O OE1 . GLU B 2 6   ? 27.186  46.693  80.643  1.00 58.55  ? 180  GLU B OE1 1 
ATOM   2436 O OE2 . GLU B 2 6   ? 25.953  46.050  82.342  1.00 62.21  ? 180  GLU B OE2 1 
ATOM   2437 N N   . ASP B 2 7   ? 24.625  44.852  76.527  1.00 39.16  ? 181  ASP B N   1 
ATOM   2438 C CA  . ASP B 2 7   ? 24.669  44.994  75.081  1.00 36.47  ? 181  ASP B CA  1 
ATOM   2439 C C   . ASP B 2 7   ? 24.289  46.430  74.748  1.00 35.94  ? 181  ASP B C   1 
ATOM   2440 O O   . ASP B 2 7   ? 24.793  47.022  73.800  1.00 38.00  ? 181  ASP B O   1 
ATOM   2441 C CB  . ASP B 2 7   ? 23.667  44.065  74.398  1.00 36.56  ? 181  ASP B CB  1 
ATOM   2442 C CG  . ASP B 2 7   ? 24.003  42.609  74.576  1.00 37.18  ? 181  ASP B CG  1 
ATOM   2443 O OD1 . ASP B 2 7   ? 25.207  42.289  74.576  1.00 40.89  ? 181  ASP B OD1 1 
ATOM   2444 O OD2 . ASP B 2 7   ? 23.067  41.783  74.695  1.00 37.75  ? 181  ASP B OD2 1 
ATOM   2445 N N   . ILE B 2 8   ? 23.392  46.986  75.545  1.00 32.82  ? 182  ILE B N   1 
ATOM   2446 C CA  . ILE B 2 8   ? 22.911  48.339  75.323  1.00 29.37  ? 182  ILE B CA  1 
ATOM   2447 C C   . ILE B 2 8   ? 23.921  49.383  75.803  1.00 31.05  ? 182  ILE B C   1 
ATOM   2448 O O   . ILE B 2 8   ? 24.166  50.387  75.120  1.00 28.69  ? 182  ILE B O   1 
ATOM   2449 C CB  . ILE B 2 8   ? 21.547  48.520  76.028  1.00 25.08  ? 182  ILE B CB  1 
ATOM   2450 C CG1 . ILE B 2 8   ? 20.543  47.530  75.422  1.00 26.93  ? 182  ILE B CG1 1 
ATOM   2451 C CG2 . ILE B 2 8   ? 21.080  49.948  75.922  1.00 25.68  ? 182  ILE B CG2 1 
ATOM   2452 C CD1 . ILE B 2 8   ? 19.166  47.517  76.069  1.00 24.87  ? 182  ILE B CD1 1 
ATOM   2453 N N   . HIS B 2 9   ? 24.506  49.148  76.974  1.00 29.94  ? 183  HIS B N   1 
ATOM   2454 C CA  . HIS B 2 9   ? 25.489  50.076  77.506  1.00 30.72  ? 183  HIS B CA  1 
ATOM   2455 C C   . HIS B 2 9   ? 26.654  50.178  76.524  1.00 30.14  ? 183  HIS B C   1 
ATOM   2456 O O   . HIS B 2 9   ? 27.216  51.251  76.317  1.00 29.17  ? 183  HIS B O   1 
ATOM   2457 C CB  . HIS B 2 9   ? 26.021  49.602  78.859  1.00 33.10  ? 183  HIS B CB  1 
ATOM   2458 C CG  . HIS B 2 9   ? 27.099  50.482  79.409  1.00 34.30  ? 183  HIS B CG  1 
ATOM   2459 N ND1 . HIS B 2 9   ? 26.845  51.744  79.901  1.00 34.02  ? 183  HIS B ND1 1 
ATOM   2460 C CD2 . HIS B 2 9   ? 28.441  50.311  79.481  1.00 33.71  ? 183  HIS B CD2 1 
ATOM   2461 C CE1 . HIS B 2 9   ? 27.985  52.313  80.251  1.00 34.86  ? 183  HIS B CE1 1 
ATOM   2462 N NE2 . HIS B 2 9   ? 28.969  51.465  80.006  1.00 33.59  ? 183  HIS B NE2 1 
ATOM   2463 N N   . THR B 2 10  ? 27.009  49.046  75.931  1.00 29.11  ? 184  THR B N   1 
ATOM   2464 C CA  . THR B 2 10  ? 28.084  49.004  74.953  1.00 28.64  ? 184  THR B CA  1 
ATOM   2465 C C   . THR B 2 10  ? 27.685  49.718  73.669  1.00 27.45  ? 184  THR B C   1 
ATOM   2466 O O   . THR B 2 10  ? 28.463  50.498  73.129  1.00 30.72  ? 184  THR B O   1 
ATOM   2467 C CB  . THR B 2 10  ? 28.481  47.549  74.639  1.00 29.69  ? 184  THR B CB  1 
ATOM   2468 O OG1 . THR B 2 10  ? 29.283  47.044  75.713  1.00 28.19  ? 184  THR B OG1 1 
ATOM   2469 C CG2 . THR B 2 10  ? 29.252  47.460  73.332  1.00 29.86  ? 184  THR B CG2 1 
ATOM   2470 N N   . TYR B 2 11  ? 26.478  49.464  73.183  1.00 26.02  ? 185  TYR B N   1 
ATOM   2471 C CA  . TYR B 2 11  ? 26.019  50.114  71.967  1.00 27.27  ? 185  TYR B CA  1 
ATOM   2472 C C   . TYR B 2 11  ? 25.920  51.650  72.101  1.00 29.46  ? 185  TYR B C   1 
ATOM   2473 O O   . TYR B 2 11  ? 26.247  52.384  71.166  1.00 28.88  ? 185  TYR B O   1 
ATOM   2474 C CB  . TYR B 2 11  ? 24.669  49.560  71.546  1.00 26.75  ? 185  TYR B CB  1 
ATOM   2475 C CG  . TYR B 2 11  ? 24.191  50.149  70.240  1.00 30.55  ? 185  TYR B CG  1 
ATOM   2476 C CD1 . TYR B 2 11  ? 24.940  49.986  69.076  1.00 31.52  ? 185  TYR B CD1 1 
ATOM   2477 C CD2 . TYR B 2 11  ? 23.011  50.896  70.169  1.00 28.67  ? 185  TYR B CD2 1 
ATOM   2478 C CE1 . TYR B 2 11  ? 24.540  50.543  67.870  1.00 30.33  ? 185  TYR B CE1 1 
ATOM   2479 C CE2 . TYR B 2 11  ? 22.601  51.467  68.958  1.00 31.35  ? 185  TYR B CE2 1 
ATOM   2480 C CZ  . TYR B 2 11  ? 23.381  51.282  67.815  1.00 32.65  ? 185  TYR B CZ  1 
ATOM   2481 O OH  . TYR B 2 11  ? 23.039  51.857  66.618  1.00 34.21  ? 185  TYR B OH  1 
ATOM   2482 N N   . LEU B 2 12  ? 25.473  52.131  73.258  1.00 30.53  ? 186  LEU B N   1 
ATOM   2483 C CA  . LEU B 2 12  ? 25.342  53.571  73.482  1.00 30.96  ? 186  LEU B CA  1 
ATOM   2484 C C   . LEU B 2 12  ? 26.724  54.196  73.545  1.00 32.83  ? 186  LEU B C   1 
ATOM   2485 O O   . LEU B 2 12  ? 26.924  55.325  73.107  1.00 32.71  ? 186  LEU B O   1 
ATOM   2486 C CB  . LEU B 2 12  ? 24.615  53.852  74.795  1.00 30.15  ? 186  LEU B CB  1 
ATOM   2487 C CG  . LEU B 2 12  ? 23.211  53.315  75.058  1.00 28.79  ? 186  LEU B CG  1 
ATOM   2488 C CD1 . LEU B 2 12  ? 22.837  53.617  76.496  1.00 29.10  ? 186  LEU B CD1 1 
ATOM   2489 C CD2 . LEU B 2 12  ? 22.227  53.934  74.101  1.00 27.35  ? 186  LEU B CD2 1 
ATOM   2490 N N   . ARG B 2 13  ? 27.673  53.445  74.103  1.00 35.10  ? 187  ARG B N   1 
ATOM   2491 C CA  . ARG B 2 13  ? 29.061  53.890  74.236  1.00 34.91  ? 187  ARG B CA  1 
ATOM   2492 C C   . ARG B 2 13  ? 29.693  54.089  72.873  1.00 35.58  ? 187  ARG B C   1 
ATOM   2493 O O   . ARG B 2 13  ? 30.567  54.932  72.694  1.00 39.20  ? 187  ARG B O   1 
ATOM   2494 C CB  . ARG B 2 13  ? 29.877  52.857  75.016  1.00 33.07  ? 187  ARG B CB  1 
ATOM   2495 C CG  . ARG B 2 13  ? 29.928  53.078  76.515  1.00 30.91  ? 187  ARG B CG  1 
ATOM   2496 C CD  . ARG B 2 13  ? 30.758  54.302  76.848  1.00 31.44  ? 187  ARG B CD  1 
ATOM   2497 N NE  . ARG B 2 13  ? 31.574  54.072  78.034  1.00 32.45  ? 187  ARG B NE  1 
ATOM   2498 C CZ  . ARG B 2 13  ? 32.894  53.922  78.037  1.00 30.88  ? 187  ARG B CZ  1 
ATOM   2499 N NH1 . ARG B 2 13  ? 33.514  53.712  79.186  1.00 35.88  ? 187  ARG B NH1 1 
ATOM   2500 N NH2 . ARG B 2 13  ? 33.602  53.995  76.917  1.00 29.95  ? 187  ARG B NH2 1 
ATOM   2501 N N   . GLU B 2 14  ? 29.259  53.288  71.915  1.00 37.80  ? 188  GLU B N   1 
ATOM   2502 C CA  . GLU B 2 14  ? 29.776  53.383  70.558  1.00 39.13  ? 188  GLU B CA  1 
ATOM   2503 C C   . GLU B 2 14  ? 29.136  54.577  69.856  1.00 37.62  ? 188  GLU B C   1 
ATOM   2504 O O   . GLU B 2 14  ? 29.795  55.329  69.153  1.00 34.86  ? 188  GLU B O   1 
ATOM   2505 C CB  . GLU B 2 14  ? 29.441  52.099  69.789  1.00 41.50  ? 188  GLU B CB  1 
ATOM   2506 C CG  . GLU B 2 14  ? 29.957  52.060  68.367  1.00 47.13  ? 188  GLU B CG  1 
ATOM   2507 C CD  . GLU B 2 14  ? 29.320  50.947  67.550  1.00 54.49  ? 188  GLU B CD  1 
ATOM   2508 O OE1 . GLU B 2 14  ? 29.057  49.862  68.130  1.00 57.43  ? 188  GLU B OE1 1 
ATOM   2509 O OE2 . GLU B 2 14  ? 29.096  51.152  66.330  1.00 56.14  ? 188  GLU B OE2 1 
ATOM   2510 N N   . MET B 2 15  ? 27.834  54.729  70.065  1.00 39.11  ? 189  MET B N   1 
ATOM   2511 C CA  . MET B 2 15  ? 27.058  55.781  69.450  1.00 38.81  ? 189  MET B CA  1 
ATOM   2512 C C   . MET B 2 15  ? 27.350  57.181  69.951  1.00 38.81  ? 189  MET B C   1 
ATOM   2513 O O   . MET B 2 15  ? 27.394  58.129  69.163  1.00 39.00  ? 189  MET B O   1 
ATOM   2514 C CB  . MET B 2 15  ? 25.588  55.469  69.638  1.00 42.66  ? 189  MET B CB  1 
ATOM   2515 C CG  . MET B 2 15  ? 25.185  54.170  68.997  1.00 47.93  ? 189  MET B CG  1 
ATOM   2516 S SD  . MET B 2 15  ? 25.543  54.239  67.257  1.00 53.56  ? 189  MET B SD  1 
ATOM   2517 C CE  . MET B 2 15  ? 24.023  55.030  66.673  1.00 50.62  ? 189  MET B CE  1 
ATOM   2518 N N   . GLU B 2 16  ? 27.544  57.319  71.259  1.00 38.38  ? 190  GLU B N   1 
ATOM   2519 C CA  . GLU B 2 16  ? 27.820  58.625  71.831  1.00 37.17  ? 190  GLU B CA  1 
ATOM   2520 C C   . GLU B 2 16  ? 29.043  59.249  71.149  1.00 38.59  ? 190  GLU B C   1 
ATOM   2521 O O   . GLU B 2 16  ? 29.167  60.474  71.073  1.00 39.64  ? 190  GLU B O   1 
ATOM   2522 C CB  . GLU B 2 16  ? 28.016  58.524  73.351  1.00 33.06  ? 190  GLU B CB  1 
ATOM   2523 C CG  . GLU B 2 16  ? 29.428  58.301  73.811  1.00 35.06  ? 190  GLU B CG  1 
ATOM   2524 C CD  . GLU B 2 16  ? 29.561  58.356  75.329  1.00 36.93  ? 190  GLU B CD  1 
ATOM   2525 O OE1 . GLU B 2 16  ? 28.846  59.152  75.974  1.00 36.03  ? 190  GLU B OE1 1 
ATOM   2526 O OE2 . GLU B 2 16  ? 30.397  57.611  75.879  1.00 38.49  ? 190  GLU B OE2 1 
ATOM   2527 N N   . VAL B 2 17  ? 29.941  58.417  70.635  1.00 37.30  ? 191  VAL B N   1 
ATOM   2528 C CA  . VAL B 2 17  ? 31.106  58.954  69.948  1.00 39.61  ? 191  VAL B CA  1 
ATOM   2529 C C   . VAL B 2 17  ? 30.701  59.327  68.520  1.00 43.18  ? 191  VAL B C   1 
ATOM   2530 O O   . VAL B 2 17  ? 31.105  60.365  67.996  1.00 46.08  ? 191  VAL B O   1 
ATOM   2531 C CB  . VAL B 2 17  ? 32.269  57.937  69.934  1.00 37.71  ? 191  VAL B CB  1 
ATOM   2532 C CG1 . VAL B 2 17  ? 33.351  58.388  68.991  1.00 34.58  ? 191  VAL B CG1 1 
ATOM   2533 C CG2 . VAL B 2 17  ? 32.844  57.808  71.322  1.00 36.64  ? 191  VAL B CG2 1 
ATOM   2534 N N   . LYS B 2 18  ? 29.875  58.496  67.899  1.00 44.09  ? 192  LYS B N   1 
ATOM   2535 C CA  . LYS B 2 18  ? 29.422  58.768  66.546  1.00 45.68  ? 192  LYS B CA  1 
ATOM   2536 C C   . LYS B 2 18  ? 28.396  59.910  66.469  1.00 46.80  ? 192  LYS B C   1 
ATOM   2537 O O   . LYS B 2 18  ? 28.232  60.524  65.416  1.00 47.43  ? 192  LYS B O   1 
ATOM   2538 C CB  . LYS B 2 18  ? 28.817  57.499  65.923  1.00 46.48  ? 192  LYS B CB  1 
ATOM   2539 C CG  . LYS B 2 18  ? 29.811  56.377  65.639  1.00 45.84  ? 192  LYS B CG  1 
ATOM   2540 C CD  . LYS B 2 18  ? 29.173  55.291  64.779  1.00 46.95  ? 192  LYS B CD  1 
ATOM   2541 C CE  . LYS B 2 18  ? 30.191  54.248  64.282  1.00 49.13  ? 192  LYS B CE  1 
ATOM   2542 N NZ  . LYS B 2 18  ? 30.513  53.172  65.277  1.00 48.81  ? 192  LYS B NZ  1 
ATOM   2543 N N   . CYS B 2 19  ? 27.698  60.190  67.568  1.00 46.91  ? 193  CYS B N   1 
ATOM   2544 C CA  . CYS B 2 19  ? 26.688  61.258  67.568  1.00 48.16  ? 193  CYS B CA  1 
ATOM   2545 C C   . CYS B 2 19  ? 27.201  62.590  68.093  1.00 47.41  ? 193  CYS B C   1 
ATOM   2546 O O   . CYS B 2 19  ? 26.589  63.627  67.879  1.00 49.12  ? 193  CYS B O   1 
ATOM   2547 C CB  . CYS B 2 19  ? 25.453  60.840  68.381  1.00 47.36  ? 193  CYS B CB  1 
ATOM   2548 S SG  . CYS B 2 19  ? 24.379  59.637  67.546  1.00 49.67  ? 193  CYS B SG  1 
ATOM   2549 N N   . LYS B 2 20  ? 28.329  62.546  68.785  1.00 48.44  ? 194  LYS B N   1 
ATOM   2550 C CA  . LYS B 2 20  ? 28.963  63.730  69.353  1.00 48.15  ? 194  LYS B CA  1 
ATOM   2551 C C   . LYS B 2 20  ? 29.201  64.867  68.348  1.00 47.61  ? 194  LYS B C   1 
ATOM   2552 O O   . LYS B 2 20  ? 29.641  64.628  67.222  1.00 47.11  ? 194  LYS B O   1 
ATOM   2553 C CB  . LYS B 2 20  ? 30.299  63.314  69.977  1.00 49.49  ? 194  LYS B CB  1 
ATOM   2554 C CG  . LYS B 2 20  ? 31.228  64.459  70.258  1.00 51.92  ? 194  LYS B CG  1 
ATOM   2555 C CD  . LYS B 2 20  ? 31.758  64.390  71.673  1.00 55.04  ? 194  LYS B CD  1 
ATOM   2556 C CE  . LYS B 2 20  ? 32.414  65.702  72.040  1.00 56.84  ? 194  LYS B CE  1 
ATOM   2557 N NZ  . LYS B 2 20  ? 31.517  66.845  71.677  1.00 56.92  ? 194  LYS B NZ  1 
ATOM   2558 N N   . PRO B 2 21  ? 28.892  66.120  68.737  1.00 46.86  ? 195  PRO B N   1 
ATOM   2559 C CA  . PRO B 2 21  ? 29.101  67.264  67.841  1.00 46.96  ? 195  PRO B CA  1 
ATOM   2560 C C   . PRO B 2 21  ? 30.543  67.779  67.907  1.00 46.22  ? 195  PRO B C   1 
ATOM   2561 O O   . PRO B 2 21  ? 31.316  67.383  68.778  1.00 45.03  ? 195  PRO B O   1 
ATOM   2562 C CB  . PRO B 2 21  ? 28.098  68.286  68.354  1.00 46.69  ? 195  PRO B CB  1 
ATOM   2563 C CG  . PRO B 2 21  ? 28.102  68.022  69.811  1.00 47.00  ? 195  PRO B CG  1 
ATOM   2564 C CD  . PRO B 2 21  ? 28.045  66.514  69.876  1.00 45.34  ? 195  PRO B CD  1 
ATOM   2565 N N   . LYS B 2 22  ? 30.890  68.666  66.981  1.00 48.79  ? 196  LYS B N   1 
ATOM   2566 C CA  . LYS B 2 22  ? 32.237  69.243  66.893  1.00 50.73  ? 196  LYS B CA  1 
ATOM   2567 C C   . LYS B 2 22  ? 32.576  70.170  68.072  1.00 50.19  ? 196  LYS B C   1 
ATOM   2568 O O   . LYS B 2 22  ? 31.975  71.229  68.234  1.00 49.53  ? 196  LYS B O   1 
ATOM   2569 C CB  . LYS B 2 22  ? 32.364  69.999  65.569  1.00 53.31  ? 196  LYS B CB  1 
ATOM   2570 C CG  . LYS B 2 22  ? 33.793  70.248  65.099  1.00 59.11  ? 196  LYS B CG  1 
ATOM   2571 C CD  . LYS B 2 22  ? 33.826  70.618  63.611  1.00 61.00  ? 196  LYS B CD  1 
ATOM   2572 C CE  . LYS B 2 22  ? 32.995  69.627  62.779  1.00 62.97  ? 196  LYS B CE  1 
ATOM   2573 N NZ  . LYS B 2 22  ? 33.213  68.198  63.184  1.00 63.03  ? 196  LYS B NZ  1 
ATOM   2574 N N   . VAL B 2 23  ? 33.555  69.755  68.874  1.00 51.07  ? 197  VAL B N   1 
ATOM   2575 C CA  . VAL B 2 23  ? 34.009  70.475  70.070  1.00 52.80  ? 197  VAL B CA  1 
ATOM   2576 C C   . VAL B 2 23  ? 34.147  71.996  69.985  1.00 53.32  ? 197  VAL B C   1 
ATOM   2577 O O   . VAL B 2 23  ? 33.849  72.702  70.952  1.00 55.15  ? 197  VAL B O   1 
ATOM   2578 C CB  . VAL B 2 23  ? 35.376  69.936  70.562  1.00 54.19  ? 197  VAL B CB  1 
ATOM   2579 C CG1 . VAL B 2 23  ? 35.617  70.363  72.008  1.00 52.26  ? 197  VAL B CG1 1 
ATOM   2580 C CG2 . VAL B 2 23  ? 35.425  68.430  70.424  1.00 56.60  ? 197  VAL B CG2 1 
ATOM   2581 N N   . GLY B 2 24  ? 34.621  72.508  68.856  1.00 52.09  ? 198  GLY B N   1 
ATOM   2582 C CA  . GLY B 2 24  ? 34.777  73.947  68.749  1.00 51.39  ? 198  GLY B CA  1 
ATOM   2583 C C   . GLY B 2 24  ? 34.087  74.538  67.541  1.00 51.43  ? 198  GLY B C   1 
ATOM   2584 O O   . GLY B 2 24  ? 34.720  75.244  66.756  1.00 51.57  ? 198  GLY B O   1 
ATOM   2585 N N   . TYR B 2 25  ? 32.795  74.258  67.388  1.00 50.17  ? 199  TYR B N   1 
ATOM   2586 C CA  . TYR B 2 25  ? 32.049  74.771  66.251  1.00 50.50  ? 199  TYR B CA  1 
ATOM   2587 C C   . TYR B 2 25  ? 31.685  76.231  66.453  1.00 51.90  ? 199  TYR B C   1 
ATOM   2588 O O   . TYR B 2 25  ? 31.566  76.988  65.488  1.00 51.39  ? 199  TYR B O   1 
ATOM   2589 C CB  . TYR B 2 25  ? 30.773  73.942  66.024  1.00 49.90  ? 199  TYR B CB  1 
ATOM   2590 C CG  . TYR B 2 25  ? 29.650  74.176  67.015  1.00 48.18  ? 199  TYR B CG  1 
ATOM   2591 C CD1 . TYR B 2 25  ? 28.895  75.356  66.989  1.00 47.57  ? 199  TYR B CD1 1 
ATOM   2592 C CD2 . TYR B 2 25  ? 29.331  73.212  67.971  1.00 49.52  ? 199  TYR B CD2 1 
ATOM   2593 C CE1 . TYR B 2 25  ? 27.854  75.571  67.888  1.00 48.32  ? 199  TYR B CE1 1 
ATOM   2594 C CE2 . TYR B 2 25  ? 28.289  73.411  68.879  1.00 50.14  ? 199  TYR B CE2 1 
ATOM   2595 C CZ  . TYR B 2 25  ? 27.555  74.596  68.833  1.00 51.07  ? 199  TYR B CZ  1 
ATOM   2596 O OH  . TYR B 2 25  ? 26.537  74.803  69.744  1.00 50.29  ? 199  TYR B OH  1 
ATOM   2597 N N   . MET B 2 26  ? 31.508  76.615  67.714  1.00 53.28  ? 200  MET B N   1 
ATOM   2598 C CA  . MET B 2 26  ? 31.135  77.982  68.062  1.00 54.91  ? 200  MET B CA  1 
ATOM   2599 C C   . MET B 2 26  ? 32.191  78.959  67.565  1.00 56.00  ? 200  MET B C   1 
ATOM   2600 O O   . MET B 2 26  ? 31.875  79.964  66.925  1.00 55.09  ? 200  MET B O   1 
ATOM   2601 C CB  . MET B 2 26  ? 30.966  78.111  69.577  1.00 53.69  ? 200  MET B CB  1 
ATOM   2602 C CG  . MET B 2 26  ? 30.151  79.317  69.993  1.00 52.40  ? 200  MET B CG  1 
ATOM   2603 S SD  . MET B 2 26  ? 28.494  79.282  69.287  1.00 53.39  ? 200  MET B SD  1 
ATOM   2604 C CE  . MET B 2 26  ? 27.639  78.310  70.513  1.00 52.25  ? 200  MET B CE  1 
ATOM   2605 N N   . LYS B 2 27  ? 33.447  78.644  67.864  1.00 57.73  ? 201  LYS B N   1 
ATOM   2606 C CA  . LYS B 2 27  ? 34.573  79.459  67.443  1.00 59.27  ? 201  LYS B CA  1 
ATOM   2607 C C   . LYS B 2 27  ? 34.458  79.801  65.959  1.00 59.38  ? 201  LYS B C   1 
ATOM   2608 O O   . LYS B 2 27  ? 34.949  80.842  65.513  1.00 61.19  ? 201  LYS B O   1 
ATOM   2609 C CB  . LYS B 2 27  ? 35.877  78.701  67.730  1.00 61.93  ? 201  LYS B CB  1 
ATOM   2610 C CG  . LYS B 2 27  ? 37.050  78.991  66.785  1.00 67.24  ? 201  LYS B CG  1 
ATOM   2611 C CD  . LYS B 2 27  ? 37.057  78.033  65.583  1.00 69.89  ? 201  LYS B CD  1 
ATOM   2612 C CE  . LYS B 2 27  ? 38.294  78.210  64.700  1.00 70.69  ? 201  LYS B CE  1 
ATOM   2613 N NZ  . LYS B 2 27  ? 38.375  79.573  64.095  1.00 70.88  ? 201  LYS B NZ  1 
ATOM   2614 N N   . LYS B 2 28  ? 33.789  78.932  65.204  1.00 57.58  ? 202  LYS B N   1 
ATOM   2615 C CA  . LYS B 2 28  ? 33.626  79.127  63.770  1.00 55.45  ? 202  LYS B CA  1 
ATOM   2616 C C   . LYS B 2 28  ? 32.311  79.764  63.362  1.00 54.18  ? 202  LYS B C   1 
ATOM   2617 O O   . LYS B 2 28  ? 32.141  80.110  62.196  1.00 53.31  ? 202  LYS B O   1 
ATOM   2618 C CB  . LYS B 2 28  ? 33.796  77.798  63.024  1.00 55.88  ? 202  LYS B CB  1 
ATOM   2619 C CG  . LYS B 2 28  ? 35.226  77.285  62.991  1.00 58.03  ? 202  LYS B CG  1 
ATOM   2620 C CD  . LYS B 2 28  ? 35.613  76.791  61.594  1.00 61.19  ? 202  LYS B CD  1 
ATOM   2621 C CE  . LYS B 2 28  ? 35.462  77.886  60.520  1.00 62.74  ? 202  LYS B CE  1 
ATOM   2622 N NZ  . LYS B 2 28  ? 36.411  79.038  60.677  1.00 62.78  ? 202  LYS B NZ  1 
ATOM   2623 N N   . GLN B 2 29  ? 31.371  79.901  64.294  1.00 53.20  ? 203  GLN B N   1 
ATOM   2624 C CA  . GLN B 2 29  ? 30.101  80.535  63.953  1.00 54.22  ? 203  GLN B CA  1 
ATOM   2625 C C   . GLN B 2 29  ? 30.399  82.034  63.879  1.00 54.95  ? 203  GLN B C   1 
ATOM   2626 O O   . GLN B 2 29  ? 30.930  82.618  64.826  1.00 53.28  ? 203  GLN B O   1 
ATOM   2627 C CB  . GLN B 2 29  ? 29.022  80.234  65.012  1.00 54.31  ? 203  GLN B CB  1 
ATOM   2628 C CG  . GLN B 2 29  ? 28.374  78.837  64.921  1.00 51.35  ? 203  GLN B CG  1 
ATOM   2629 C CD  . GLN B 2 29  ? 27.276  78.735  63.865  1.00 50.38  ? 203  GLN B CD  1 
ATOM   2630 O OE1 . GLN B 2 29  ? 26.931  79.715  63.212  1.00 48.96  ? 203  GLN B OE1 1 
ATOM   2631 N NE2 . GLN B 2 29  ? 26.715  77.539  63.708  1.00 48.63  ? 203  GLN B NE2 1 
ATOM   2632 N N   . PRO B 2 30  ? 30.072  82.671  62.740  1.00 55.98  ? 204  PRO B N   1 
ATOM   2633 C CA  . PRO B 2 30  ? 30.322  84.103  62.551  1.00 56.35  ? 204  PRO B CA  1 
ATOM   2634 C C   . PRO B 2 30  ? 29.393  85.050  63.299  1.00 56.03  ? 204  PRO B C   1 
ATOM   2635 O O   . PRO B 2 30  ? 29.790  86.157  63.647  1.00 57.77  ? 204  PRO B O   1 
ATOM   2636 C CB  . PRO B 2 30  ? 30.197  84.267  61.040  1.00 55.41  ? 204  PRO B CB  1 
ATOM   2637 C CG  . PRO B 2 30  ? 29.075  83.331  60.718  1.00 55.72  ? 204  PRO B CG  1 
ATOM   2638 C CD  . PRO B 2 30  ? 29.442  82.090  61.536  1.00 55.94  ? 204  PRO B CD  1 
ATOM   2639 N N   . ASP B 2 31  ? 28.169  84.615  63.567  1.00 55.10  ? 205  ASP B N   1 
ATOM   2640 C CA  . ASP B 2 31  ? 27.206  85.485  64.223  1.00 53.42  ? 205  ASP B CA  1 
ATOM   2641 C C   . ASP B 2 31  ? 26.792  85.150  65.657  1.00 52.03  ? 205  ASP B C   1 
ATOM   2642 O O   . ASP B 2 31  ? 26.521  86.066  66.446  1.00 52.73  ? 205  ASP B O   1 
ATOM   2643 C CB  . ASP B 2 31  ? 25.963  85.597  63.332  1.00 55.32  ? 205  ASP B CB  1 
ATOM   2644 C CG  . ASP B 2 31  ? 24.963  86.612  63.841  1.00 58.47  ? 205  ASP B CG  1 
ATOM   2645 O OD1 . ASP B 2 31  ? 25.357  87.462  64.666  1.00 59.71  ? 205  ASP B OD1 1 
ATOM   2646 O OD2 . ASP B 2 31  ? 23.788  86.570  63.404  1.00 59.13  ? 205  ASP B OD2 1 
ATOM   2647 N N   . ILE B 2 32  ? 26.748  83.865  66.011  1.00 48.97  ? 206  ILE B N   1 
ATOM   2648 C CA  . ILE B 2 32  ? 26.319  83.494  67.356  1.00 45.56  ? 206  ILE B CA  1 
ATOM   2649 C C   . ILE B 2 32  ? 27.424  83.127  68.331  1.00 44.86  ? 206  ILE B C   1 
ATOM   2650 O O   . ILE B 2 32  ? 28.537  82.797  67.932  1.00 44.54  ? 206  ILE B O   1 
ATOM   2651 C CB  . ILE B 2 32  ? 25.265  82.374  67.309  1.00 45.23  ? 206  ILE B CB  1 
ATOM   2652 C CG1 . ILE B 2 32  ? 25.856  81.099  66.709  1.00 45.19  ? 206  ILE B CG1 1 
ATOM   2653 C CG2 . ILE B 2 32  ? 24.074  82.835  66.466  1.00 45.76  ? 206  ILE B CG2 1 
ATOM   2654 C CD1 . ILE B 2 32  ? 24.800  80.031  66.395  1.00 40.99  ? 206  ILE B CD1 1 
ATOM   2655 N N   . THR B 2 33  ? 27.090  83.203  69.617  1.00 44.60  ? 207  THR B N   1 
ATOM   2656 C CA  . THR B 2 33  ? 28.014  82.937  70.723  1.00 43.53  ? 207  THR B CA  1 
ATOM   2657 C C   . THR B 2 33  ? 27.508  81.857  71.672  1.00 42.65  ? 207  THR B C   1 
ATOM   2658 O O   . THR B 2 33  ? 26.364  81.421  71.586  1.00 43.38  ? 207  THR B O   1 
ATOM   2659 C CB  . THR B 2 33  ? 28.177  84.184  71.598  1.00 44.05  ? 207  THR B CB  1 
ATOM   2660 O OG1 . THR B 2 33  ? 26.873  84.616  72.020  1.00 44.91  ? 207  THR B OG1 1 
ATOM   2661 C CG2 . THR B 2 33  ? 28.852  85.304  70.839  1.00 45.13  ? 207  THR B CG2 1 
ATOM   2662 N N   . ASN B 2 34  ? 28.361  81.469  72.612  1.00 41.88  ? 208  ASN B N   1 
ATOM   2663 C CA  . ASN B 2 34  ? 27.986  80.476  73.599  1.00 41.71  ? 208  ASN B CA  1 
ATOM   2664 C C   . ASN B 2 34  ? 26.910  81.059  74.488  1.00 41.38  ? 208  ASN B C   1 
ATOM   2665 O O   . ASN B 2 34  ? 25.965  80.376  74.873  1.00 43.85  ? 208  ASN B O   1 
ATOM   2666 C CB  . ASN B 2 34  ? 29.197  80.078  74.440  1.00 42.47  ? 208  ASN B CB  1 
ATOM   2667 C CG  . ASN B 2 34  ? 30.142  79.163  73.693  1.00 42.56  ? 208  ASN B CG  1 
ATOM   2668 O OD1 . ASN B 2 34  ? 29.707  78.315  72.916  1.00 43.13  ? 208  ASN B OD1 1 
ATOM   2669 N ND2 . ASN B 2 34  ? 31.439  79.317  73.935  1.00 43.88  ? 208  ASN B ND2 1 
ATOM   2670 N N   . SER B 2 35  ? 27.063  82.339  74.801  1.00 43.83  ? 209  SER B N   1 
ATOM   2671 C CA  . SER B 2 35  ? 26.121  83.072  75.637  1.00 43.47  ? 209  SER B CA  1 
ATOM   2672 C C   . SER B 2 35  ? 24.702  83.008  75.073  1.00 43.17  ? 209  SER B C   1 
ATOM   2673 O O   . SER B 2 35  ? 23.748  82.764  75.806  1.00 43.85  ? 209  SER B O   1 
ATOM   2674 C CB  . SER B 2 35  ? 26.571  84.529  75.754  1.00 43.13  ? 209  SER B CB  1 
ATOM   2675 O OG  . SER B 2 35  ? 25.581  85.309  76.401  1.00 48.23  ? 209  SER B OG  1 
ATOM   2676 N N   . MET B 2 36  ? 24.570  83.234  73.768  1.00 44.48  ? 210  MET B N   1 
ATOM   2677 C CA  . MET B 2 36  ? 23.270  83.185  73.099  1.00 44.63  ? 210  MET B CA  1 
ATOM   2678 C C   . MET B 2 36  ? 22.698  81.767  73.140  1.00 45.49  ? 210  MET B C   1 
ATOM   2679 O O   . MET B 2 36  ? 21.482  81.576  73.272  1.00 45.87  ? 210  MET B O   1 
ATOM   2680 C CB  . MET B 2 36  ? 23.415  83.628  71.647  1.00 45.75  ? 210  MET B CB  1 
ATOM   2681 C CG  . MET B 2 36  ? 23.816  85.081  71.481  1.00 46.27  ? 210  MET B CG  1 
ATOM   2682 S SD  . MET B 2 36  ? 24.166  85.485  69.763  1.00 48.59  ? 210  MET B SD  1 
ATOM   2683 C CE  . MET B 2 36  ? 22.690  84.791  68.992  1.00 46.08  ? 210  MET B CE  1 
ATOM   2684 N N   . ARG B 2 37  ? 23.587  80.782  73.015  1.00 44.86  ? 211  ARG B N   1 
ATOM   2685 C CA  . ARG B 2 37  ? 23.216  79.376  73.051  1.00 44.18  ? 211  ARG B CA  1 
ATOM   2686 C C   . ARG B 2 37  ? 22.685  79.068  74.441  1.00 45.45  ? 211  ARG B C   1 
ATOM   2687 O O   . ARG B 2 37  ? 21.634  78.432  74.589  1.00 46.33  ? 211  ARG B O   1 
ATOM   2688 C CB  . ARG B 2 37  ? 24.440  78.507  72.755  1.00 46.06  ? 211  ARG B CB  1 
ATOM   2689 C CG  . ARG B 2 37  ? 24.247  77.025  73.018  1.00 47.32  ? 211  ARG B CG  1 
ATOM   2690 C CD  . ARG B 2 37  ? 25.507  76.226  72.717  1.00 47.05  ? 211  ARG B CD  1 
ATOM   2691 N NE  . ARG B 2 37  ? 25.301  74.808  72.986  1.00 47.77  ? 211  ARG B NE  1 
ATOM   2692 C CZ  . ARG B 2 37  ? 25.102  74.291  74.195  1.00 49.15  ? 211  ARG B CZ  1 
ATOM   2693 N NH1 . ARG B 2 37  ? 25.091  75.066  75.268  1.00 48.94  ? 211  ARG B NH1 1 
ATOM   2694 N NH2 . ARG B 2 37  ? 24.883  72.991  74.330  1.00 51.32  ? 211  ARG B NH2 1 
ATOM   2695 N N   . ALA B 2 38  ? 23.417  79.530  75.456  1.00 44.81  ? 212  ALA B N   1 
ATOM   2696 C CA  . ALA B 2 38  ? 23.028  79.324  76.850  1.00 44.29  ? 212  ALA B CA  1 
ATOM   2697 C C   . ALA B 2 38  ? 21.597  79.815  77.059  1.00 44.37  ? 212  ALA B C   1 
ATOM   2698 O O   . ALA B 2 38  ? 20.767  79.130  77.661  1.00 44.67  ? 212  ALA B O   1 
ATOM   2699 C CB  . ALA B 2 38  ? 23.978  80.071  77.775  1.00 42.93  ? 212  ALA B CB  1 
ATOM   2700 N N   . ILE B 2 39  ? 21.310  81.008  76.554  1.00 43.70  ? 213  ILE B N   1 
ATOM   2701 C CA  . ILE B 2 39  ? 19.971  81.567  76.673  1.00 42.80  ? 213  ILE B CA  1 
ATOM   2702 C C   . ILE B 2 39  ? 18.961  80.649  75.995  1.00 42.82  ? 213  ILE B C   1 
ATOM   2703 O O   . ILE B 2 39  ? 17.840  80.493  76.475  1.00 43.87  ? 213  ILE B O   1 
ATOM   2704 C CB  . ILE B 2 39  ? 19.901  82.972  76.031  1.00 42.46  ? 213  ILE B CB  1 
ATOM   2705 C CG1 . ILE B 2 39  ? 20.851  83.918  76.776  1.00 40.26  ? 213  ILE B CG1 1 
ATOM   2706 C CG2 . ILE B 2 39  ? 18.463  83.486  76.049  1.00 38.08  ? 213  ILE B CG2 1 
ATOM   2707 C CD1 . ILE B 2 39  ? 21.055  85.254  76.105  1.00 41.93  ? 213  ILE B CD1 1 
ATOM   2708 N N   . LEU B 2 40  ? 19.369  80.028  74.889  1.00 43.16  ? 214  LEU B N   1 
ATOM   2709 C CA  . LEU B 2 40  ? 18.492  79.122  74.138  1.00 43.17  ? 214  LEU B CA  1 
ATOM   2710 C C   . LEU B 2 40  ? 18.102  77.829  74.869  1.00 43.69  ? 214  LEU B C   1 
ATOM   2711 O O   . LEU B 2 40  ? 16.935  77.418  74.847  1.00 41.90  ? 214  LEU B O   1 
ATOM   2712 C CB  . LEU B 2 40  ? 19.131  78.744  72.802  1.00 39.82  ? 214  LEU B CB  1 
ATOM   2713 C CG  . LEU B 2 40  ? 18.279  77.766  71.988  1.00 38.92  ? 214  LEU B CG  1 
ATOM   2714 C CD1 . LEU B 2 40  ? 16.914  78.392  71.707  1.00 34.42  ? 214  LEU B CD1 1 
ATOM   2715 C CD2 . LEU B 2 40  ? 18.999  77.400  70.696  1.00 38.68  ? 214  LEU B CD2 1 
ATOM   2716 N N   . VAL B 2 41  ? 19.079  77.178  75.490  1.00 44.69  ? 215  VAL B N   1 
ATOM   2717 C CA  . VAL B 2 41  ? 18.800  75.938  76.203  1.00 45.62  ? 215  VAL B CA  1 
ATOM   2718 C C   . VAL B 2 41  ? 18.014  76.254  77.462  1.00 45.88  ? 215  VAL B C   1 
ATOM   2719 O O   . VAL B 2 41  ? 17.108  75.504  77.844  1.00 44.90  ? 215  VAL B O   1 
ATOM   2720 C CB  . VAL B 2 41  ? 20.091  75.197  76.612  1.00 44.97  ? 215  VAL B CB  1 
ATOM   2721 C CG1 . VAL B 2 41  ? 19.728  73.925  77.354  1.00 46.07  ? 215  VAL B CG1 1 
ATOM   2722 C CG2 . VAL B 2 41  ? 20.927  74.874  75.381  1.00 43.13  ? 215  VAL B CG2 1 
ATOM   2723 N N   . ASP B 2 42  ? 18.376  77.370  78.095  1.00 46.07  ? 216  ASP B N   1 
ATOM   2724 C CA  . ASP B 2 42  ? 17.729  77.831  79.317  1.00 46.00  ? 216  ASP B CA  1 
ATOM   2725 C C   . ASP B 2 42  ? 16.244  77.988  79.049  1.00 44.87  ? 216  ASP B C   1 
ATOM   2726 O O   . ASP B 2 42  ? 15.401  77.616  79.867  1.00 44.00  ? 216  ASP B O   1 
ATOM   2727 C CB  . ASP B 2 42  ? 18.300  79.181  79.733  1.00 49.68  ? 216  ASP B CB  1 
ATOM   2728 C CG  . ASP B 2 42  ? 17.735  79.668  81.047  1.00 52.24  ? 216  ASP B CG  1 
ATOM   2729 O OD1 . ASP B 2 42  ? 17.782  80.888  81.304  1.00 55.30  ? 216  ASP B OD1 1 
ATOM   2730 O OD2 . ASP B 2 42  ? 17.257  78.830  81.829  1.00 53.65  ? 216  ASP B OD2 1 
ATOM   2731 N N   . TRP B 2 43  ? 15.942  78.549  77.885  1.00 43.20  ? 217  TRP B N   1 
ATOM   2732 C CA  . TRP B 2 43  ? 14.572  78.772  77.466  1.00 41.90  ? 217  TRP B CA  1 
ATOM   2733 C C   . TRP B 2 43  ? 13.890  77.449  77.165  1.00 42.28  ? 217  TRP B C   1 
ATOM   2734 O O   . TRP B 2 43  ? 12.715  77.258  77.485  1.00 44.86  ? 217  TRP B O   1 
ATOM   2735 C CB  . TRP B 2 43  ? 14.547  79.672  76.231  1.00 40.99  ? 217  TRP B CB  1 
ATOM   2736 C CG  . TRP B 2 43  ? 13.207  79.809  75.652  1.00 39.13  ? 217  TRP B CG  1 
ATOM   2737 C CD1 . TRP B 2 43  ? 12.144  80.432  76.212  1.00 40.13  ? 217  TRP B CD1 1 
ATOM   2738 C CD2 . TRP B 2 43  ? 12.750  79.256  74.411  1.00 41.57  ? 217  TRP B CD2 1 
ATOM   2739 N NE1 . TRP B 2 43  ? 11.036  80.305  75.404  1.00 43.57  ? 217  TRP B NE1 1 
ATOM   2740 C CE2 . TRP B 2 43  ? 11.381  79.587  74.288  1.00 43.32  ? 217  TRP B CE2 1 
ATOM   2741 C CE3 . TRP B 2 43  ? 13.362  78.510  73.393  1.00 39.96  ? 217  TRP B CE3 1 
ATOM   2742 C CZ2 . TRP B 2 43  ? 10.608  79.197  73.183  1.00 41.81  ? 217  TRP B CZ2 1 
ATOM   2743 C CZ3 . TRP B 2 43  ? 12.595  78.121  72.294  1.00 39.24  ? 217  TRP B CZ3 1 
ATOM   2744 C CH2 . TRP B 2 43  ? 11.232  78.466  72.200  1.00 41.78  ? 217  TRP B CH2 1 
ATOM   2745 N N   . LEU B 2 44  ? 14.620  76.530  76.542  1.00 42.37  ? 218  LEU B N   1 
ATOM   2746 C CA  . LEU B 2 44  ? 14.053  75.224  76.230  1.00 41.12  ? 218  LEU B CA  1 
ATOM   2747 C C   . LEU B 2 44  ? 13.745  74.463  77.511  1.00 41.13  ? 218  LEU B C   1 
ATOM   2748 O O   . LEU B 2 44  ? 12.842  73.627  77.546  1.00 41.89  ? 218  LEU B O   1 
ATOM   2749 C CB  . LEU B 2 44  ? 15.015  74.419  75.363  1.00 39.94  ? 218  LEU B CB  1 
ATOM   2750 C CG  . LEU B 2 44  ? 15.091  74.873  73.904  1.00 38.50  ? 218  LEU B CG  1 
ATOM   2751 C CD1 . LEU B 2 44  ? 16.132  74.032  73.165  1.00 33.81  ? 218  LEU B CD1 1 
ATOM   2752 C CD2 . LEU B 2 44  ? 13.705  74.752  73.256  1.00 32.21  ? 218  LEU B CD2 1 
ATOM   2753 N N   . VAL B 2 45  ? 14.502  74.753  78.564  1.00 41.81  ? 219  VAL B N   1 
ATOM   2754 C CA  . VAL B 2 45  ? 14.281  74.102  79.846  1.00 42.77  ? 219  VAL B CA  1 
ATOM   2755 C C   . VAL B 2 45  ? 12.902  74.486  80.349  1.00 43.86  ? 219  VAL B C   1 
ATOM   2756 O O   . VAL B 2 45  ? 12.096  73.611  80.664  1.00 46.51  ? 219  VAL B O   1 
ATOM   2757 C CB  . VAL B 2 45  ? 15.330  74.508  80.906  1.00 42.71  ? 219  VAL B CB  1 
ATOM   2758 C CG1 . VAL B 2 45  ? 15.033  73.804  82.219  1.00 42.71  ? 219  VAL B CG1 1 
ATOM   2759 C CG2 . VAL B 2 45  ? 16.721  74.148  80.429  1.00 41.09  ? 219  VAL B CG2 1 
ATOM   2760 N N   . GLU B 2 46  ? 12.609  75.782  80.411  1.00 44.48  ? 220  GLU B N   1 
ATOM   2761 C CA  . GLU B 2 46  ? 11.289  76.185  80.885  1.00 45.97  ? 220  GLU B CA  1 
ATOM   2762 C C   . GLU B 2 46  ? 10.175  75.795  79.925  1.00 44.05  ? 220  GLU B C   1 
ATOM   2763 O O   . GLU B 2 46  ? 9.041   75.593  80.348  1.00 41.90  ? 220  GLU B O   1 
ATOM   2764 C CB  . GLU B 2 46  ? 11.226  77.684  81.205  1.00 47.22  ? 220  GLU B CB  1 
ATOM   2765 C CG  . GLU B 2 46  ? 12.016  78.598  80.314  1.00 53.23  ? 220  GLU B CG  1 
ATOM   2766 C CD  . GLU B 2 46  ? 11.952  80.043  80.804  1.00 58.27  ? 220  GLU B CD  1 
ATOM   2767 O OE1 . GLU B 2 46  ? 11.778  80.241  82.034  1.00 58.95  ? 220  GLU B OE1 1 
ATOM   2768 O OE2 . GLU B 2 46  ? 12.084  80.976  79.971  1.00 59.59  ? 220  GLU B OE2 1 
ATOM   2769 N N   . VAL B 2 47  ? 10.493  75.685  78.637  1.00 43.66  ? 221  VAL B N   1 
ATOM   2770 C CA  . VAL B 2 47  ? 9.492   75.266  77.659  1.00 42.79  ? 221  VAL B CA  1 
ATOM   2771 C C   . VAL B 2 47  ? 9.161   73.800  77.927  1.00 43.66  ? 221  VAL B C   1 
ATOM   2772 O O   . VAL B 2 47  ? 7.995   73.420  77.933  1.00 45.26  ? 221  VAL B O   1 
ATOM   2773 C CB  . VAL B 2 47  ? 10.003  75.402  76.212  1.00 42.15  ? 221  VAL B CB  1 
ATOM   2774 C CG1 . VAL B 2 47  ? 9.050   74.705  75.258  1.00 39.18  ? 221  VAL B CG1 1 
ATOM   2775 C CG2 . VAL B 2 47  ? 10.141  76.876  75.846  1.00 41.31  ? 221  VAL B CG2 1 
ATOM   2776 N N   . GLY B 2 48  ? 10.184  72.977  78.144  1.00 43.28  ? 222  GLY B N   1 
ATOM   2777 C CA  . GLY B 2 48  ? 9.934   71.579  78.430  1.00 46.15  ? 222  GLY B CA  1 
ATOM   2778 C C   . GLY B 2 48  ? 9.207   71.491  79.761  1.00 49.41  ? 222  GLY B C   1 
ATOM   2779 O O   . GLY B 2 48  ? 8.468   70.536  80.042  1.00 48.61  ? 222  GLY B O   1 
ATOM   2780 N N   . GLU B 2 49  ? 9.416   72.518  80.577  1.00 51.47  ? 223  GLU B N   1 
ATOM   2781 C CA  . GLU B 2 49  ? 8.810   72.614  81.901  1.00 54.35  ? 223  GLU B CA  1 
ATOM   2782 C C   . GLU B 2 49  ? 7.330   73.000  81.807  1.00 54.35  ? 223  GLU B C   1 
ATOM   2783 O O   . GLU B 2 49  ? 6.486   72.445  82.509  1.00 53.84  ? 223  GLU B O   1 
ATOM   2784 C CB  . GLU B 2 49  ? 9.559   73.664  82.727  1.00 56.97  ? 223  GLU B CB  1 
ATOM   2785 C CG  . GLU B 2 49  ? 9.386   73.538  84.224  1.00 59.80  ? 223  GLU B CG  1 
ATOM   2786 C CD  . GLU B 2 49  ? 10.037  72.285  84.762  1.00 64.03  ? 223  GLU B CD  1 
ATOM   2787 O OE1 . GLU B 2 49  ? 9.933   72.036  85.986  1.00 66.58  ? 223  GLU B OE1 1 
ATOM   2788 O OE2 . GLU B 2 49  ? 10.655  71.549  83.958  1.00 65.72  ? 223  GLU B OE2 1 
ATOM   2789 N N   . GLU B 2 50  ? 7.025   73.956  80.935  1.00 54.60  ? 224  GLU B N   1 
ATOM   2790 C CA  . GLU B 2 50  ? 5.659   74.426  80.760  1.00 54.84  ? 224  GLU B CA  1 
ATOM   2791 C C   . GLU B 2 50  ? 4.772   73.345  80.159  1.00 54.00  ? 224  GLU B C   1 
ATOM   2792 O O   . GLU B 2 50  ? 3.585   73.269  80.462  1.00 53.95  ? 224  GLU B O   1 
ATOM   2793 C CB  . GLU B 2 50  ? 5.633   75.667  79.858  1.00 57.39  ? 224  GLU B CB  1 
ATOM   2794 C CG  . GLU B 2 50  ? 4.299   76.432  79.861  1.00 63.41  ? 224  GLU B CG  1 
ATOM   2795 C CD  . GLU B 2 50  ? 4.132   77.348  81.075  1.00 65.97  ? 224  GLU B CD  1 
ATOM   2796 O OE1 . GLU B 2 50  ? 4.855   78.370  81.160  1.00 66.95  ? 224  GLU B OE1 1 
ATOM   2797 O OE2 . GLU B 2 50  ? 3.281   77.043  81.944  1.00 66.64  ? 224  GLU B OE2 1 
ATOM   2798 N N   . TYR B 2 51  ? 5.345   72.501  79.311  1.00 52.91  ? 225  TYR B N   1 
ATOM   2799 C CA  . TYR B 2 51  ? 4.560   71.458  78.674  1.00 51.29  ? 225  TYR B CA  1 
ATOM   2800 C C   . TYR B 2 51  ? 4.701   70.073  79.272  1.00 49.55  ? 225  TYR B C   1 
ATOM   2801 O O   . TYR B 2 51  ? 4.154   69.109  78.743  1.00 46.49  ? 225  TYR B O   1 
ATOM   2802 C CB  . TYR B 2 51  ? 4.865   71.408  77.179  1.00 52.39  ? 225  TYR B CB  1 
ATOM   2803 C CG  . TYR B 2 51  ? 4.329   72.608  76.437  1.00 53.88  ? 225  TYR B CG  1 
ATOM   2804 C CD1 . TYR B 2 51  ? 5.021   73.818  76.438  1.00 53.11  ? 225  TYR B CD1 1 
ATOM   2805 C CD2 . TYR B 2 51  ? 3.110   72.542  75.757  1.00 52.82  ? 225  TYR B CD2 1 
ATOM   2806 C CE1 . TYR B 2 51  ? 4.516   74.933  75.778  1.00 54.10  ? 225  TYR B CE1 1 
ATOM   2807 C CE2 . TYR B 2 51  ? 2.597   73.652  75.096  1.00 53.90  ? 225  TYR B CE2 1 
ATOM   2808 C CZ  . TYR B 2 51  ? 3.305   74.845  75.108  1.00 54.00  ? 225  TYR B CZ  1 
ATOM   2809 O OH  . TYR B 2 51  ? 2.813   75.946  74.442  1.00 55.57  ? 225  TYR B OH  1 
ATOM   2810 N N   . LYS B 2 52  ? 5.431   69.974  80.375  1.00 49.70  ? 226  LYS B N   1 
ATOM   2811 C CA  . LYS B 2 52  ? 5.607   68.689  81.038  1.00 50.01  ? 226  LYS B CA  1 
ATOM   2812 C C   . LYS B 2 52  ? 6.254   67.655  80.115  1.00 49.00  ? 226  LYS B C   1 
ATOM   2813 O O   . LYS B 2 52  ? 5.764   66.535  79.985  1.00 49.80  ? 226  LYS B O   1 
ATOM   2814 C CB  . LYS B 2 52  ? 4.243   68.186  81.519  1.00 50.74  ? 226  LYS B CB  1 
ATOM   2815 C CG  . LYS B 2 52  ? 3.500   69.220  82.347  1.00 52.63  ? 226  LYS B CG  1 
ATOM   2816 C CD  . LYS B 2 52  ? 1.990   69.043  82.283  1.00 56.27  ? 226  LYS B CD  1 
ATOM   2817 C CE  . LYS B 2 52  ? 1.440   68.420  83.565  1.00 59.14  ? 226  LYS B CE  1 
ATOM   2818 N NZ  . LYS B 2 52  ? 1.797   69.232  84.771  1.00 59.93  ? 226  LYS B NZ  1 
ATOM   2819 N N   . LEU B 2 53  ? 7.357   68.035  79.475  1.00 47.42  ? 227  LEU B N   1 
ATOM   2820 C CA  . LEU B 2 53  ? 8.064   67.128  78.577  1.00 43.37  ? 227  LEU B CA  1 
ATOM   2821 C C   . LEU B 2 53  ? 9.075   66.344  79.383  1.00 40.99  ? 227  LEU B C   1 
ATOM   2822 O O   . LEU B 2 53  ? 9.450   66.763  80.474  1.00 39.77  ? 227  LEU B O   1 
ATOM   2823 C CB  . LEU B 2 53  ? 8.785   67.917  77.481  1.00 41.94  ? 227  LEU B CB  1 
ATOM   2824 C CG  . LEU B 2 53  ? 7.879   68.834  76.662  1.00 41.22  ? 227  LEU B CG  1 
ATOM   2825 C CD1 . LEU B 2 53  ? 8.666   69.481  75.530  1.00 39.87  ? 227  LEU B CD1 1 
ATOM   2826 C CD2 . LEU B 2 53  ? 6.705   68.011  76.129  1.00 40.37  ? 227  LEU B CD2 1 
ATOM   2827 N N   . GLN B 2 54  ? 9.503   65.200  78.861  1.00 39.94  ? 228  GLN B N   1 
ATOM   2828 C CA  . GLN B 2 54  ? 10.498  64.389  79.549  1.00 39.18  ? 228  GLN B CA  1 
ATOM   2829 C C   . GLN B 2 54  ? 11.839  65.119  79.552  1.00 39.09  ? 228  GLN B C   1 
ATOM   2830 O O   . GLN B 2 54  ? 12.115  65.914  78.658  1.00 37.31  ? 228  GLN B O   1 
ATOM   2831 C CB  . GLN B 2 54  ? 10.685  63.044  78.843  1.00 39.96  ? 228  GLN B CB  1 
ATOM   2832 C CG  . GLN B 2 54  ? 9.548   62.066  79.005  1.00 41.29  ? 228  GLN B CG  1 
ATOM   2833 C CD  . GLN B 2 54  ? 9.282   61.731  80.451  1.00 41.97  ? 228  GLN B CD  1 
ATOM   2834 O OE1 . GLN B 2 54  ? 10.202  61.426  81.216  1.00 40.62  ? 228  GLN B OE1 1 
ATOM   2835 N NE2 . GLN B 2 54  ? 8.012   61.781  80.838  1.00 42.34  ? 228  GLN B NE2 1 
ATOM   2836 N N   . ASN B 2 55  ? 12.665  64.860  80.562  1.00 39.50  ? 229  ASN B N   1 
ATOM   2837 C CA  . ASN B 2 55  ? 13.985  65.478  80.618  1.00 40.84  ? 229  ASN B CA  1 
ATOM   2838 C C   . ASN B 2 55  ? 14.796  64.903  79.464  1.00 40.34  ? 229  ASN B C   1 
ATOM   2839 O O   . ASN B 2 55  ? 15.698  65.556  78.938  1.00 40.70  ? 229  ASN B O   1 
ATOM   2840 C CB  . ASN B 2 55  ? 14.713  65.159  81.936  1.00 42.24  ? 229  ASN B CB  1 
ATOM   2841 C CG  . ASN B 2 55  ? 14.120  65.877  83.125  1.00 44.38  ? 229  ASN B CG  1 
ATOM   2842 O OD1 . ASN B 2 55  ? 13.618  66.993  83.008  1.00 44.58  ? 229  ASN B OD1 1 
ATOM   2843 N ND2 . ASN B 2 55  ? 14.194  65.247  84.287  1.00 47.14  ? 229  ASN B ND2 1 
ATOM   2844 N N   . GLU B 2 56  ? 14.474  63.665  79.089  1.00 38.36  ? 230  GLU B N   1 
ATOM   2845 C CA  . GLU B 2 56  ? 15.162  62.988  78.000  1.00 36.86  ? 230  GLU B CA  1 
ATOM   2846 C C   . GLU B 2 56  ? 14.978  63.738  76.689  1.00 35.50  ? 230  GLU B C   1 
ATOM   2847 O O   . GLU B 2 56  ? 15.860  63.735  75.828  1.00 35.04  ? 230  GLU B O   1 
ATOM   2848 C CB  . GLU B 2 56  ? 14.648  61.562  77.858  1.00 35.27  ? 230  GLU B CB  1 
ATOM   2849 C CG  . GLU B 2 56  ? 15.199  60.824  76.653  1.00 34.33  ? 230  GLU B CG  1 
ATOM   2850 C CD  . GLU B 2 56  ? 16.718  60.750  76.652  1.00 38.88  ? 230  GLU B CD  1 
ATOM   2851 O OE1 . GLU B 2 56  ? 17.360  61.093  77.682  1.00 35.93  ? 230  GLU B OE1 1 
ATOM   2852 O OE2 . GLU B 2 56  ? 17.271  60.339  75.611  1.00 39.71  ? 230  GLU B OE2 1 
ATOM   2853 N N   . THR B 2 57  ? 13.827  64.384  76.562  1.00 35.01  ? 231  THR B N   1 
ATOM   2854 C CA  . THR B 2 57  ? 13.476  65.172  75.385  1.00 35.05  ? 231  THR B CA  1 
ATOM   2855 C C   . THR B 2 57  ? 14.294  66.467  75.337  1.00 34.24  ? 231  THR B C   1 
ATOM   2856 O O   . THR B 2 57  ? 14.609  66.971  74.261  1.00 33.41  ? 231  THR B O   1 
ATOM   2857 C CB  . THR B 2 57  ? 11.988  65.531  75.412  1.00 36.29  ? 231  THR B CB  1 
ATOM   2858 O OG1 . THR B 2 57  ? 11.227  64.340  75.636  1.00 38.02  ? 231  THR B OG1 1 
ATOM   2859 C CG2 . THR B 2 57  ? 11.558  66.159  74.098  1.00 38.52  ? 231  THR B CG2 1 
ATOM   2860 N N   . LEU B 2 58  ? 14.634  66.992  76.510  1.00 32.96  ? 232  LEU B N   1 
ATOM   2861 C CA  . LEU B 2 58  ? 15.426  68.211  76.613  1.00 33.47  ? 232  LEU B CA  1 
ATOM   2862 C C   . LEU B 2 58  ? 16.832  67.901  76.097  1.00 34.01  ? 232  LEU B C   1 
ATOM   2863 O O   . LEU B 2 58  ? 17.361  68.617  75.230  1.00 33.25  ? 232  LEU B O   1 
ATOM   2864 C CB  . LEU B 2 58  ? 15.517  68.667  78.077  1.00 33.48  ? 232  LEU B CB  1 
ATOM   2865 C CG  . LEU B 2 58  ? 15.847  70.122  78.458  1.00 35.51  ? 232  LEU B CG  1 
ATOM   2866 C CD1 . LEU B 2 58  ? 16.509  70.139  79.838  1.00 34.24  ? 232  LEU B CD1 1 
ATOM   2867 C CD2 . LEU B 2 58  ? 16.767  70.757  77.450  1.00 35.14  ? 232  LEU B CD2 1 
ATOM   2868 N N   . HIS B 2 59  ? 17.431  66.834  76.636  1.00 33.17  ? 233  HIS B N   1 
ATOM   2869 C CA  . HIS B 2 59  ? 18.785  66.428  76.245  1.00 32.53  ? 233  HIS B CA  1 
ATOM   2870 C C   . HIS B 2 59  ? 18.880  66.104  74.766  1.00 32.17  ? 233  HIS B C   1 
ATOM   2871 O O   . HIS B 2 59  ? 19.877  66.434  74.134  1.00 35.55  ? 233  HIS B O   1 
ATOM   2872 C CB  . HIS B 2 59  ? 19.266  65.207  77.037  1.00 34.02  ? 233  HIS B CB  1 
ATOM   2873 C CG  . HIS B 2 59  ? 19.670  65.505  78.451  1.00 33.70  ? 233  HIS B CG  1 
ATOM   2874 N ND1 . HIS B 2 59  ? 18.762  65.827  79.438  1.00 32.28  ? 233  HIS B ND1 1 
ATOM   2875 C CD2 . HIS B 2 59  ? 20.883  65.485  79.051  1.00 32.35  ? 233  HIS B CD2 1 
ATOM   2876 C CE1 . HIS B 2 59  ? 19.397  65.989  80.583  1.00 29.10  ? 233  HIS B CE1 1 
ATOM   2877 N NE2 . HIS B 2 59  ? 20.685  65.788  80.376  1.00 32.80  ? 233  HIS B NE2 1 
ATOM   2878 N N   . LEU B 2 60  ? 17.868  65.440  74.212  1.00 31.22  ? 234  LEU B N   1 
ATOM   2879 C CA  . LEU B 2 60  ? 17.900  65.120  72.790  1.00 28.84  ? 234  LEU B CA  1 
ATOM   2880 C C   . LEU B 2 60  ? 17.970  66.434  72.044  1.00 28.62  ? 234  LEU B C   1 
ATOM   2881 O O   . LEU B 2 60  ? 18.914  66.667  71.295  1.00 29.60  ? 234  LEU B O   1 
ATOM   2882 C CB  . LEU B 2 60  ? 16.661  64.332  72.363  1.00 26.36  ? 234  LEU B CB  1 
ATOM   2883 C CG  . LEU B 2 60  ? 16.633  62.857  72.797  1.00 26.37  ? 234  LEU B CG  1 
ATOM   2884 C CD1 . LEU B 2 60  ? 15.316  62.215  72.372  1.00 22.65  ? 234  LEU B CD1 1 
ATOM   2885 C CD2 . LEU B 2 60  ? 17.814  62.114  72.184  1.00 23.88  ? 234  LEU B CD2 1 
ATOM   2886 N N   . ALA B 2 61  ? 16.992  67.302  72.284  1.00 28.06  ? 235  ALA B N   1 
ATOM   2887 C CA  . ALA B 2 61  ? 16.936  68.623  71.647  1.00 28.95  ? 235  ALA B CA  1 
ATOM   2888 C C   . ALA B 2 61  ? 18.285  69.339  71.634  1.00 28.04  ? 235  ALA B C   1 
ATOM   2889 O O   . ALA B 2 61  ? 18.715  69.828  70.601  1.00 31.18  ? 235  ALA B O   1 
ATOM   2890 C CB  . ALA B 2 61  ? 15.886  69.497  72.336  1.00 28.49  ? 235  ALA B CB  1 
ATOM   2891 N N   . VAL B 2 62  ? 18.959  69.407  72.770  1.00 28.62  ? 236  VAL B N   1 
ATOM   2892 C CA  . VAL B 2 62  ? 20.259  70.055  72.798  1.00 29.37  ? 236  VAL B CA  1 
ATOM   2893 C C   . VAL B 2 62  ? 21.274  69.325  71.900  1.00 31.15  ? 236  VAL B C   1 
ATOM   2894 O O   . VAL B 2 62  ? 22.113  69.968  71.259  1.00 32.82  ? 236  VAL B O   1 
ATOM   2895 C CB  . VAL B 2 62  ? 20.811  70.146  74.243  1.00 29.46  ? 236  VAL B CB  1 
ATOM   2896 C CG1 . VAL B 2 62  ? 22.141  70.892  74.242  1.00 30.71  ? 236  VAL B CG1 1 
ATOM   2897 C CG2 . VAL B 2 62  ? 19.816  70.871  75.141  1.00 28.32  ? 236  VAL B CG2 1 
ATOM   2898 N N   . ASN B 2 63  ? 21.204  67.992  71.857  1.00 29.63  ? 237  ASN B N   1 
ATOM   2899 C CA  . ASN B 2 63  ? 22.106  67.198  71.016  1.00 28.94  ? 237  ASN B CA  1 
ATOM   2900 C C   . ASN B 2 63  ? 21.900  67.548  69.542  1.00 28.90  ? 237  ASN B C   1 
ATOM   2901 O O   . ASN B 2 63  ? 22.858  67.675  68.776  1.00 28.14  ? 237  ASN B O   1 
ATOM   2902 C CB  . ASN B 2 63  ? 21.863  65.689  71.211  1.00 28.20  ? 237  ASN B CB  1 
ATOM   2903 C CG  . ASN B 2 63  ? 22.629  64.835  70.197  1.00 27.16  ? 237  ASN B CG  1 
ATOM   2904 O OD1 . ASN B 2 63  ? 22.123  64.494  69.123  1.00 26.10  ? 237  ASN B OD1 1 
ATOM   2905 N ND2 . ASN B 2 63  ? 23.867  64.517  70.528  1.00 27.52  ? 237  ASN B ND2 1 
ATOM   2906 N N   . TYR B 2 64  ? 20.640  67.697  69.157  1.00 28.45  ? 238  TYR B N   1 
ATOM   2907 C CA  . TYR B 2 64  ? 20.301  68.039  67.789  1.00 31.16  ? 238  TYR B CA  1 
ATOM   2908 C C   . TYR B 2 64  ? 20.786  69.450  67.458  1.00 33.82  ? 238  TYR B C   1 
ATOM   2909 O O   . TYR B 2 64  ? 21.285  69.703  66.357  1.00 35.90  ? 238  TYR B O   1 
ATOM   2910 C CB  . TYR B 2 64  ? 18.787  67.999  67.573  1.00 30.49  ? 238  TYR B CB  1 
ATOM   2911 C CG  . TYR B 2 64  ? 18.103  66.695  67.903  1.00 28.73  ? 238  TYR B CG  1 
ATOM   2912 C CD1 . TYR B 2 64  ? 18.827  65.503  68.056  1.00 29.66  ? 238  TYR B CD1 1 
ATOM   2913 C CD2 . TYR B 2 64  ? 16.712  66.637  67.991  1.00 28.73  ? 238  TYR B CD2 1 
ATOM   2914 C CE1 . TYR B 2 64  ? 18.167  64.282  68.283  1.00 28.12  ? 238  TYR B CE1 1 
ATOM   2915 C CE2 . TYR B 2 64  ? 16.047  65.433  68.216  1.00 26.17  ? 238  TYR B CE2 1 
ATOM   2916 C CZ  . TYR B 2 64  ? 16.773  64.268  68.358  1.00 27.20  ? 238  TYR B CZ  1 
ATOM   2917 O OH  . TYR B 2 64  ? 16.096  63.093  68.553  1.00 27.60  ? 238  TYR B OH  1 
ATOM   2918 N N   . ILE B 2 65  ? 20.626  70.371  68.404  1.00 33.39  ? 239  ILE B N   1 
ATOM   2919 C CA  . ILE B 2 65  ? 21.034  71.748  68.178  1.00 32.64  ? 239  ILE B CA  1 
ATOM   2920 C C   . ILE B 2 65  ? 22.525  71.822  67.917  1.00 34.26  ? 239  ILE B C   1 
ATOM   2921 O O   . ILE B 2 65  ? 22.966  72.369  66.902  1.00 33.52  ? 239  ILE B O   1 
ATOM   2922 C CB  . ILE B 2 65  ? 20.699  72.639  69.387  1.00 32.67  ? 239  ILE B CB  1 
ATOM   2923 C CG1 . ILE B 2 65  ? 19.180  72.735  69.561  1.00 30.18  ? 239  ILE B CG1 1 
ATOM   2924 C CG2 . ILE B 2 65  ? 21.298  74.031  69.188  1.00 32.32  ? 239  ILE B CG2 1 
ATOM   2925 C CD1 . ILE B 2 65  ? 18.757  73.274  70.912  1.00 27.41  ? 239  ILE B CD1 1 
ATOM   2926 N N   . ASP B 2 66  ? 23.301  71.253  68.831  1.00 35.95  ? 240  ASP B N   1 
ATOM   2927 C CA  . ASP B 2 66  ? 24.740  71.274  68.696  1.00 36.01  ? 240  ASP B CA  1 
ATOM   2928 C C   . ASP B 2 66  ? 25.249  70.560  67.449  1.00 38.49  ? 240  ASP B C   1 
ATOM   2929 O O   . ASP B 2 66  ? 26.288  70.942  66.893  1.00 41.20  ? 240  ASP B O   1 
ATOM   2930 C CB  . ASP B 2 66  ? 25.385  70.685  69.942  1.00 36.01  ? 240  ASP B CB  1 
ATOM   2931 C CG  . ASP B 2 66  ? 25.168  71.549  71.155  1.00 36.15  ? 240  ASP B CG  1 
ATOM   2932 O OD1 . ASP B 2 66  ? 25.011  72.776  70.979  1.00 36.99  ? 240  ASP B OD1 1 
ATOM   2933 O OD2 . ASP B 2 66  ? 25.171  71.016  72.278  1.00 35.63  ? 240  ASP B OD2 1 
ATOM   2934 N N   . ARG B 2 67  ? 24.535  69.526  67.009  1.00 35.92  ? 241  ARG B N   1 
ATOM   2935 C CA  . ARG B 2 67  ? 24.946  68.805  65.820  1.00 33.85  ? 241  ARG B CA  1 
ATOM   2936 C C   . ARG B 2 67  ? 24.600  69.620  64.590  1.00 34.89  ? 241  ARG B C   1 
ATOM   2937 O O   . ARG B 2 67  ? 25.342  69.617  63.621  1.00 36.76  ? 241  ARG B O   1 
ATOM   2938 C CB  . ARG B 2 67  ? 24.270  67.434  65.757  1.00 33.43  ? 241  ARG B CB  1 
ATOM   2939 C CG  . ARG B 2 67  ? 25.060  66.344  66.471  1.00 34.08  ? 241  ARG B CG  1 
ATOM   2940 C CD  . ARG B 2 67  ? 24.225  65.117  66.738  1.00 31.92  ? 241  ARG B CD  1 
ATOM   2941 N NE  . ARG B 2 67  ? 23.875  64.418  65.513  1.00 33.33  ? 241  ARG B NE  1 
ATOM   2942 C CZ  . ARG B 2 67  ? 22.781  63.682  65.376  1.00 30.44  ? 241  ARG B CZ  1 
ATOM   2943 N NH1 . ARG B 2 67  ? 21.941  63.563  66.392  1.00 31.56  ? 241  ARG B NH1 1 
ATOM   2944 N NH2 . ARG B 2 67  ? 22.524  63.074  64.231  1.00 30.09  ? 241  ARG B NH2 1 
ATOM   2945 N N   . PHE B 2 68  ? 23.475  70.327  64.635  1.00 36.05  ? 242  PHE B N   1 
ATOM   2946 C CA  . PHE B 2 68  ? 23.047  71.153  63.510  1.00 36.89  ? 242  PHE B CA  1 
ATOM   2947 C C   . PHE B 2 68  ? 24.014  72.321  63.346  1.00 39.80  ? 242  PHE B C   1 
ATOM   2948 O O   . PHE B 2 68  ? 24.428  72.654  62.231  1.00 41.47  ? 242  PHE B O   1 
ATOM   2949 C CB  . PHE B 2 68  ? 21.635  71.692  63.750  1.00 35.02  ? 242  PHE B CB  1 
ATOM   2950 C CG  . PHE B 2 68  ? 21.027  72.369  62.543  1.00 36.30  ? 242  PHE B CG  1 
ATOM   2951 C CD1 . PHE B 2 68  ? 20.523  71.622  61.490  1.00 33.28  ? 242  PHE B CD1 1 
ATOM   2952 C CD2 . PHE B 2 68  ? 20.988  73.764  62.447  1.00 37.66  ? 242  PHE B CD2 1 
ATOM   2953 C CE1 . PHE B 2 68  ? 19.997  72.245  60.370  1.00 32.58  ? 242  PHE B CE1 1 
ATOM   2954 C CE2 . PHE B 2 68  ? 20.460  74.393  61.321  1.00 32.97  ? 242  PHE B CE2 1 
ATOM   2955 C CZ  . PHE B 2 68  ? 19.968  73.631  60.288  1.00 32.92  ? 242  PHE B CZ  1 
ATOM   2956 N N   . LEU B 2 69  ? 24.373  72.938  64.468  1.00 40.02  ? 243  LEU B N   1 
ATOM   2957 C CA  . LEU B 2 69  ? 25.292  74.068  64.460  1.00 38.45  ? 243  LEU B CA  1 
ATOM   2958 C C   . LEU B 2 69  ? 26.743  73.625  64.263  1.00 39.40  ? 243  LEU B C   1 
ATOM   2959 O O   . LEU B 2 69  ? 27.658  74.454  64.266  1.00 40.76  ? 243  LEU B O   1 
ATOM   2960 C CB  . LEU B 2 69  ? 25.166  74.873  65.765  1.00 37.24  ? 243  LEU B CB  1 
ATOM   2961 C CG  . LEU B 2 69  ? 23.793  75.457  66.145  1.00 34.11  ? 243  LEU B CG  1 
ATOM   2962 C CD1 . LEU B 2 69  ? 23.921  76.224  67.449  1.00 32.09  ? 243  LEU B CD1 1 
ATOM   2963 C CD2 . LEU B 2 69  ? 23.270  76.369  65.047  1.00 32.62  ? 243  LEU B CD2 1 
ATOM   2964 N N   . SER B 2 70  ? 26.960  72.322  64.099  1.00 39.43  ? 244  SER B N   1 
ATOM   2965 C CA  . SER B 2 70  ? 28.312  71.807  63.878  1.00 40.12  ? 244  SER B CA  1 
ATOM   2966 C C   . SER B 2 70  ? 28.686  71.926  62.400  1.00 40.21  ? 244  SER B C   1 
ATOM   2967 O O   . SER B 2 70  ? 29.868  71.975  62.052  1.00 39.25  ? 244  SER B O   1 
ATOM   2968 C CB  . SER B 2 70  ? 28.413  70.336  64.296  1.00 41.31  ? 244  SER B CB  1 
ATOM   2969 O OG  . SER B 2 70  ? 28.772  70.190  65.659  1.00 43.55  ? 244  SER B OG  1 
ATOM   2970 N N   . SER B 2 71  ? 27.670  71.970  61.540  1.00 40.06  ? 245  SER B N   1 
ATOM   2971 C CA  . SER B 2 71  ? 27.880  72.076  60.102  1.00 40.74  ? 245  SER B CA  1 
ATOM   2972 C C   . SER B 2 71  ? 27.116  73.232  59.448  1.00 42.13  ? 245  SER B C   1 
ATOM   2973 O O   . SER B 2 71  ? 27.228  73.457  58.238  1.00 44.40  ? 245  SER B O   1 
ATOM   2974 C CB  . SER B 2 71  ? 27.486  70.762  59.421  1.00 39.84  ? 245  SER B CB  1 
ATOM   2975 O OG  . SER B 2 71  ? 26.110  70.482  59.610  1.00 39.42  ? 245  SER B OG  1 
ATOM   2976 N N   . MET B 2 72  ? 26.346  73.973  60.235  1.00 41.57  ? 246  MET B N   1 
ATOM   2977 C CA  . MET B 2 72  ? 25.583  75.086  59.684  1.00 40.61  ? 246  MET B CA  1 
ATOM   2978 C C   . MET B 2 72  ? 25.778  76.373  60.482  1.00 39.87  ? 246  MET B C   1 
ATOM   2979 O O   . MET B 2 72  ? 25.562  76.405  61.694  1.00 39.92  ? 246  MET B O   1 
ATOM   2980 C CB  . MET B 2 72  ? 24.097  74.729  59.663  1.00 39.12  ? 246  MET B CB  1 
ATOM   2981 C CG  . MET B 2 72  ? 23.779  73.404  58.998  1.00 39.54  ? 246  MET B CG  1 
ATOM   2982 S SD  . MET B 2 72  ? 23.751  73.453  57.197  1.00 40.08  ? 246  MET B SD  1 
ATOM   2983 C CE  . MET B 2 72  ? 22.037  73.831  56.868  1.00 32.51  ? 246  MET B CE  1 
ATOM   2984 N N   . SER B 2 73  ? 26.203  77.436  59.812  1.00 40.54  ? 247  SER B N   1 
ATOM   2985 C CA  . SER B 2 73  ? 26.360  78.706  60.510  1.00 38.89  ? 247  SER B CA  1 
ATOM   2986 C C   . SER B 2 73  ? 24.976  79.325  60.495  1.00 38.51  ? 247  SER B C   1 
ATOM   2987 O O   . SER B 2 73  ? 24.294  79.299  59.474  1.00 37.13  ? 247  SER B O   1 
ATOM   2988 C CB  . SER B 2 73  ? 27.371  79.602  59.806  1.00 37.24  ? 247  SER B CB  1 
ATOM   2989 O OG  . SER B 2 73  ? 27.093  79.679  58.435  1.00 41.17  ? 247  SER B OG  1 
ATOM   2990 N N   . VAL B 2 74  ? 24.552  79.838  61.646  1.00 40.25  ? 248  VAL B N   1 
ATOM   2991 C CA  . VAL B 2 74  ? 23.228  80.441  61.789  1.00 41.40  ? 248  VAL B CA  1 
ATOM   2992 C C   . VAL B 2 74  ? 23.298  81.897  62.277  1.00 42.93  ? 248  VAL B C   1 
ATOM   2993 O O   . VAL B 2 74  ? 24.165  82.256  63.082  1.00 43.83  ? 248  VAL B O   1 
ATOM   2994 C CB  . VAL B 2 74  ? 22.363  79.614  62.786  1.00 40.82  ? 248  VAL B CB  1 
ATOM   2995 C CG1 . VAL B 2 74  ? 20.918  80.085  62.759  1.00 43.54  ? 248  VAL B CG1 1 
ATOM   2996 C CG2 . VAL B 2 74  ? 22.418  78.140  62.423  1.00 42.61  ? 248  VAL B CG2 1 
ATOM   2997 N N   . LEU B 2 75  ? 22.396  82.735  61.777  1.00 44.03  ? 249  LEU B N   1 
ATOM   2998 C CA  . LEU B 2 75  ? 22.354  84.134  62.200  1.00 45.92  ? 249  LEU B CA  1 
ATOM   2999 C C   . LEU B 2 75  ? 21.616  84.205  63.536  1.00 47.53  ? 249  LEU B C   1 
ATOM   3000 O O   . LEU B 2 75  ? 20.692  83.426  63.789  1.00 47.54  ? 249  LEU B O   1 
ATOM   3001 C CB  . LEU B 2 75  ? 21.642  85.002  61.156  1.00 44.64  ? 249  LEU B CB  1 
ATOM   3002 C CG  . LEU B 2 75  ? 22.436  85.234  59.866  1.00 45.31  ? 249  LEU B CG  1 
ATOM   3003 C CD1 . LEU B 2 75  ? 21.646  86.119  58.910  1.00 44.72  ? 249  LEU B CD1 1 
ATOM   3004 C CD2 . LEU B 2 75  ? 23.763  85.877  60.208  1.00 43.20  ? 249  LEU B CD2 1 
ATOM   3005 N N   . ARG B 2 76  ? 22.021  85.139  64.389  1.00 48.28  ? 250  ARG B N   1 
ATOM   3006 C CA  . ARG B 2 76  ? 21.408  85.278  65.704  1.00 48.30  ? 250  ARG B CA  1 
ATOM   3007 C C   . ARG B 2 76  ? 19.890  85.368  65.682  1.00 46.54  ? 250  ARG B C   1 
ATOM   3008 O O   . ARG B 2 76  ? 19.234  85.062  66.671  1.00 48.30  ? 250  ARG B O   1 
ATOM   3009 C CB  . ARG B 2 76  ? 21.990  86.487  66.435  1.00 51.18  ? 250  ARG B CB  1 
ATOM   3010 C CG  . ARG B 2 76  ? 21.667  87.830  65.821  1.00 55.62  ? 250  ARG B CG  1 
ATOM   3011 C CD  . ARG B 2 76  ? 22.465  88.915  66.522  1.00 57.71  ? 250  ARG B CD  1 
ATOM   3012 N NE  . ARG B 2 76  ? 23.898  88.732  66.316  1.00 61.38  ? 250  ARG B NE  1 
ATOM   3013 C CZ  . ARG B 2 76  ? 24.845  89.357  67.011  1.00 63.60  ? 250  ARG B CZ  1 
ATOM   3014 N NH1 . ARG B 2 76  ? 24.512  90.216  67.968  1.00 64.04  ? 250  ARG B NH1 1 
ATOM   3015 N NH2 . ARG B 2 76  ? 26.128  89.119  66.753  1.00 64.25  ? 250  ARG B NH2 1 
ATOM   3016 N N   . GLY B 2 77  ? 19.321  85.774  64.558  1.00 44.97  ? 251  GLY B N   1 
ATOM   3017 C CA  . GLY B 2 77  ? 17.878  85.874  64.487  1.00 42.49  ? 251  GLY B CA  1 
ATOM   3018 C C   . GLY B 2 77  ? 17.204  84.560  64.160  1.00 43.66  ? 251  GLY B C   1 
ATOM   3019 O O   . GLY B 2 77  ? 15.976  84.469  64.167  1.00 43.48  ? 251  GLY B O   1 
ATOM   3020 N N   . LYS B 2 78  ? 17.994  83.530  63.882  1.00 44.26  ? 252  LYS B N   1 
ATOM   3021 C CA  . LYS B 2 78  ? 17.425  82.234  63.534  1.00 45.94  ? 252  LYS B CA  1 
ATOM   3022 C C   . LYS B 2 78  ? 17.727  81.152  64.553  1.00 46.02  ? 252  LYS B C   1 
ATOM   3023 O O   . LYS B 2 78  ? 17.171  80.057  64.479  1.00 45.16  ? 252  LYS B O   1 
ATOM   3024 C CB  . LYS B 2 78  ? 17.924  81.781  62.154  1.00 47.22  ? 252  LYS B CB  1 
ATOM   3025 C CG  . LYS B 2 78  ? 17.414  82.616  60.992  1.00 46.20  ? 252  LYS B CG  1 
ATOM   3026 C CD  . LYS B 2 78  ? 15.911  82.488  60.843  1.00 47.73  ? 252  LYS B CD  1 
ATOM   3027 C CE  . LYS B 2 78  ? 15.407  83.324  59.681  1.00 48.08  ? 252  LYS B CE  1 
ATOM   3028 N NZ  . LYS B 2 78  ? 15.863  84.747  59.836  1.00 53.59  ? 252  LYS B NZ  1 
ATOM   3029 N N   . LEU B 2 79  ? 18.602  81.454  65.506  1.00 46.09  ? 253  LEU B N   1 
ATOM   3030 C CA  . LEU B 2 79  ? 18.955  80.470  66.521  1.00 46.59  ? 253  LEU B CA  1 
ATOM   3031 C C   . LEU B 2 79  ? 17.706  79.875  67.171  1.00 47.95  ? 253  LEU B C   1 
ATOM   3032 O O   . LEU B 2 79  ? 17.620  78.661  67.373  1.00 49.77  ? 253  LEU B O   1 
ATOM   3033 C CB  . LEU B 2 79  ? 19.848  81.100  67.593  1.00 43.92  ? 253  LEU B CB  1 
ATOM   3034 C CG  . LEU B 2 79  ? 20.352  80.184  68.712  1.00 43.48  ? 253  LEU B CG  1 
ATOM   3035 C CD1 . LEU B 2 79  ? 20.992  78.933  68.124  1.00 42.88  ? 253  LEU B CD1 1 
ATOM   3036 C CD2 . LEU B 2 79  ? 21.357  80.937  69.560  1.00 41.20  ? 253  LEU B CD2 1 
ATOM   3037 N N   . GLN B 2 80  ? 16.729  80.722  67.476  1.00 46.96  ? 254  GLN B N   1 
ATOM   3038 C CA  . GLN B 2 80  ? 15.515  80.248  68.118  1.00 46.44  ? 254  GLN B CA  1 
ATOM   3039 C C   . GLN B 2 80  ? 14.657  79.396  67.188  1.00 46.95  ? 254  GLN B C   1 
ATOM   3040 O O   . GLN B 2 80  ? 13.895  78.540  67.649  1.00 47.53  ? 254  GLN B O   1 
ATOM   3041 C CB  . GLN B 2 80  ? 14.691  81.422  68.641  1.00 48.67  ? 254  GLN B CB  1 
ATOM   3042 C CG  . GLN B 2 80  ? 13.953  81.093  69.926  1.00 51.56  ? 254  GLN B CG  1 
ATOM   3043 C CD  . GLN B 2 80  ? 12.610  81.772  70.026  1.00 52.88  ? 254  GLN B CD  1 
ATOM   3044 O OE1 . GLN B 2 80  ? 11.873  81.575  70.993  1.00 54.58  ? 254  GLN B OE1 1 
ATOM   3045 N NE2 . GLN B 2 80  ? 12.278  82.574  69.025  1.00 55.45  ? 254  GLN B NE2 1 
ATOM   3046 N N   . LEU B 2 81  ? 14.764  79.632  65.883  1.00 44.48  ? 255  LEU B N   1 
ATOM   3047 C CA  . LEU B 2 81  ? 13.987  78.849  64.936  1.00 42.45  ? 255  LEU B CA  1 
ATOM   3048 C C   . LEU B 2 81  ? 14.549  77.429  64.880  1.00 42.05  ? 255  LEU B C   1 
ATOM   3049 O O   . LEU B 2 81  ? 13.816  76.461  64.682  1.00 42.26  ? 255  LEU B O   1 
ATOM   3050 C CB  . LEU B 2 81  ? 14.028  79.481  63.544  1.00 42.66  ? 255  LEU B CB  1 
ATOM   3051 C CG  . LEU B 2 81  ? 13.326  78.652  62.455  1.00 44.12  ? 255  LEU B CG  1 
ATOM   3052 C CD1 . LEU B 2 81  ? 11.885  78.341  62.880  1.00 42.92  ? 255  LEU B CD1 1 
ATOM   3053 C CD2 . LEU B 2 81  ? 13.346  79.412  61.142  1.00 42.94  ? 255  LEU B CD2 1 
ATOM   3054 N N   . VAL B 2 82  ? 15.858  77.314  65.060  1.00 41.70  ? 256  VAL B N   1 
ATOM   3055 C CA  . VAL B 2 82  ? 16.513  76.016  65.047  1.00 42.40  ? 256  VAL B CA  1 
ATOM   3056 C C   . VAL B 2 82  ? 16.176  75.266  66.332  1.00 43.69  ? 256  VAL B C   1 
ATOM   3057 O O   . VAL B 2 82  ? 15.832  74.085  66.302  1.00 42.99  ? 256  VAL B O   1 
ATOM   3058 C CB  . VAL B 2 82  ? 18.029  76.176  64.922  1.00 40.11  ? 256  VAL B CB  1 
ATOM   3059 C CG1 . VAL B 2 82  ? 18.719  74.829  65.084  1.00 39.87  ? 256  VAL B CG1 1 
ATOM   3060 C CG2 . VAL B 2 82  ? 18.355  76.786  63.576  1.00 38.71  ? 256  VAL B CG2 1 
ATOM   3061 N N   . GLY B 2 83  ? 16.251  75.974  67.456  1.00 44.96  ? 257  GLY B N   1 
ATOM   3062 C CA  . GLY B 2 83  ? 15.948  75.366  68.740  1.00 45.20  ? 257  GLY B CA  1 
ATOM   3063 C C   . GLY B 2 83  ? 14.504  74.910  68.848  1.00 44.74  ? 257  GLY B C   1 
ATOM   3064 O O   . GLY B 2 83  ? 14.205  73.939  69.534  1.00 45.77  ? 257  GLY B O   1 
ATOM   3065 N N   . THR B 2 84  ? 13.599  75.607  68.175  1.00 44.35  ? 258  THR B N   1 
ATOM   3066 C CA  . THR B 2 84  ? 12.198  75.228  68.231  1.00 42.90  ? 258  THR B CA  1 
ATOM   3067 C C   . THR B 2 84  ? 11.978  73.940  67.447  1.00 42.25  ? 258  THR B C   1 
ATOM   3068 O O   . THR B 2 84  ? 11.313  73.030  67.934  1.00 43.20  ? 258  THR B O   1 
ATOM   3069 C CB  . THR B 2 84  ? 11.289  76.360  67.686  1.00 42.11  ? 258  THR B CB  1 
ATOM   3070 O OG1 . THR B 2 84  ? 11.521  77.546  68.455  1.00 44.88  ? 258  THR B OG1 1 
ATOM   3071 C CG2 . THR B 2 84  ? 9.811   75.992  67.800  1.00 36.38  ? 258  THR B CG2 1 
ATOM   3072 N N   . ALA B 2 85  ? 12.544  73.853  66.244  1.00 41.49  ? 259  ALA B N   1 
ATOM   3073 C CA  . ALA B 2 85  ? 12.385  72.647  65.426  1.00 39.84  ? 259  ALA B CA  1 
ATOM   3074 C C   . ALA B 2 85  ? 13.025  71.446  66.135  1.00 38.39  ? 259  ALA B C   1 
ATOM   3075 O O   . ALA B 2 85  ? 12.458  70.349  66.170  1.00 37.99  ? 259  ALA B O   1 
ATOM   3076 C CB  . ALA B 2 85  ? 13.016  72.850  64.044  1.00 37.73  ? 259  ALA B CB  1 
ATOM   3077 N N   . ALA B 2 86  ? 14.199  71.673  66.708  1.00 35.51  ? 260  ALA B N   1 
ATOM   3078 C CA  . ALA B 2 86  ? 14.911  70.637  67.421  1.00 36.07  ? 260  ALA B CA  1 
ATOM   3079 C C   . ALA B 2 86  ? 14.071  70.107  68.586  1.00 38.19  ? 260  ALA B C   1 
ATOM   3080 O O   . ALA B 2 86  ? 14.089  68.910  68.882  1.00 38.73  ? 260  ALA B O   1 
ATOM   3081 C CB  . ALA B 2 86  ? 16.232  71.181  67.925  1.00 36.28  ? 260  ALA B CB  1 
ATOM   3082 N N   . MET B 2 87  ? 13.329  70.996  69.242  1.00 39.40  ? 261  MET B N   1 
ATOM   3083 C CA  . MET B 2 87  ? 12.479  70.595  70.365  1.00 39.51  ? 261  MET B CA  1 
ATOM   3084 C C   . MET B 2 87  ? 11.269  69.823  69.887  1.00 37.78  ? 261  MET B C   1 
ATOM   3085 O O   . MET B 2 87  ? 10.821  68.885  70.540  1.00 40.27  ? 261  MET B O   1 
ATOM   3086 C CB  . MET B 2 87  ? 11.994  71.805  71.152  1.00 40.33  ? 261  MET B CB  1 
ATOM   3087 C CG  . MET B 2 87  ? 11.481  71.429  72.516  1.00 42.62  ? 261  MET B CG  1 
ATOM   3088 S SD  . MET B 2 87  ? 12.806  70.662  73.456  1.00 44.70  ? 261  MET B SD  1 
ATOM   3089 C CE  . MET B 2 87  ? 12.269  70.916  75.136  1.00 44.34  ? 261  MET B CE  1 
ATOM   3090 N N   . LEU B 2 88  ? 10.734  70.231  68.745  1.00 36.97  ? 262  LEU B N   1 
ATOM   3091 C CA  . LEU B 2 88  ? 9.570   69.574  68.163  1.00 35.25  ? 262  LEU B CA  1 
ATOM   3092 C C   . LEU B 2 88  ? 9.973   68.157  67.721  1.00 35.29  ? 262  LEU B C   1 
ATOM   3093 O O   . LEU B 2 88  ? 9.231   67.195  67.935  1.00 34.49  ? 262  LEU B O   1 
ATOM   3094 C CB  . LEU B 2 88  ? 9.067   70.411  66.976  1.00 35.27  ? 262  LEU B CB  1 
ATOM   3095 C CG  . LEU B 2 88  ? 8.105   69.838  65.926  1.00 36.31  ? 262  LEU B CG  1 
ATOM   3096 C CD1 . LEU B 2 88  ? 6.771   69.442  66.545  1.00 35.57  ? 262  LEU B CD1 1 
ATOM   3097 C CD2 . LEU B 2 88  ? 7.901   70.884  64.858  1.00 34.00  ? 262  LEU B CD2 1 
ATOM   3098 N N   . LEU B 2 89  ? 11.153  68.025  67.115  1.00 33.21  ? 263  LEU B N   1 
ATOM   3099 C CA  . LEU B 2 89  ? 11.612  66.714  66.680  1.00 32.27  ? 263  LEU B CA  1 
ATOM   3100 C C   . LEU B 2 89  ? 11.887  65.810  67.884  1.00 31.92  ? 263  LEU B C   1 
ATOM   3101 O O   . LEU B 2 89  ? 11.593  64.625  67.845  1.00 31.12  ? 263  LEU B O   1 
ATOM   3102 C CB  . LEU B 2 89  ? 12.868  66.836  65.814  1.00 30.84  ? 263  LEU B CB  1 
ATOM   3103 C CG  . LEU B 2 89  ? 12.700  67.252  64.353  1.00 28.55  ? 263  LEU B CG  1 
ATOM   3104 C CD1 . LEU B 2 89  ? 14.063  67.491  63.745  1.00 30.83  ? 263  LEU B CD1 1 
ATOM   3105 C CD2 . LEU B 2 89  ? 11.978  66.178  63.586  1.00 30.29  ? 263  LEU B CD2 1 
ATOM   3106 N N   . ALA B 2 90  ? 12.446  66.366  68.953  1.00 33.04  ? 264  ALA B N   1 
ATOM   3107 C CA  . ALA B 2 90  ? 12.715  65.570  70.146  1.00 33.90  ? 264  ALA B CA  1 
ATOM   3108 C C   . ALA B 2 90  ? 11.402  65.015  70.712  1.00 35.55  ? 264  ALA B C   1 
ATOM   3109 O O   . ALA B 2 90  ? 11.325  63.858  71.122  1.00 38.62  ? 264  ALA B O   1 
ATOM   3110 C CB  . ALA B 2 90  ? 13.419  66.419  71.198  1.00 33.10  ? 264  ALA B CB  1 
ATOM   3111 N N   . SER B 2 91  ? 10.367  65.844  70.723  1.00 35.70  ? 265  SER B N   1 
ATOM   3112 C CA  . SER B 2 91  ? 9.069   65.439  71.236  1.00 34.53  ? 265  SER B CA  1 
ATOM   3113 C C   . SER B 2 91  ? 8.418   64.393  70.330  1.00 35.96  ? 265  SER B C   1 
ATOM   3114 O O   . SER B 2 91  ? 7.816   63.432  70.815  1.00 37.49  ? 265  SER B O   1 
ATOM   3115 C CB  . SER B 2 91  ? 8.166   66.666  71.360  1.00 34.96  ? 265  SER B CB  1 
ATOM   3116 O OG  . SER B 2 91  ? 8.894   67.756  71.913  1.00 33.38  ? 265  SER B OG  1 
ATOM   3117 N N   . LYS B 2 92  ? 8.531   64.572  69.016  1.00 34.95  ? 266  LYS B N   1 
ATOM   3118 C CA  . LYS B 2 92  ? 7.954   63.603  68.097  1.00 33.04  ? 266  LYS B CA  1 
ATOM   3119 C C   . LYS B 2 92  ? 8.636   62.243  68.235  1.00 34.34  ? 266  LYS B C   1 
ATOM   3120 O O   . LYS B 2 92  ? 8.035   61.207  67.963  1.00 35.71  ? 266  LYS B O   1 
ATOM   3121 C CB  . LYS B 2 92  ? 8.082   64.085  66.661  1.00 33.46  ? 266  LYS B CB  1 
ATOM   3122 C CG  . LYS B 2 92  ? 6.979   65.016  66.214  1.00 34.61  ? 266  LYS B CG  1 
ATOM   3123 C CD  . LYS B 2 92  ? 7.073   65.266  64.714  1.00 35.11  ? 266  LYS B CD  1 
ATOM   3124 C CE  . LYS B 2 92  ? 6.109   66.345  64.252  1.00 33.11  ? 266  LYS B CE  1 
ATOM   3125 N NZ  . LYS B 2 92  ? 6.392   66.687  62.834  1.00 34.50  ? 266  LYS B NZ  1 
ATOM   3126 N N   . PHE B 2 93  ? 9.892   62.255  68.670  1.00 33.67  ? 267  PHE B N   1 
ATOM   3127 C CA  . PHE B 2 93  ? 10.674  61.041  68.847  1.00 32.35  ? 267  PHE B CA  1 
ATOM   3128 C C   . PHE B 2 93  ? 10.494  60.396  70.220  1.00 33.29  ? 267  PHE B C   1 
ATOM   3129 O O   . PHE B 2 93  ? 10.215  59.198  70.310  1.00 36.37  ? 267  PHE B O   1 
ATOM   3130 C CB  . PHE B 2 93  ? 12.168  61.346  68.646  1.00 31.64  ? 267  PHE B CB  1 
ATOM   3131 C CG  . PHE B 2 93  ? 13.072  60.131  68.770  1.00 31.44  ? 267  PHE B CG  1 
ATOM   3132 C CD1 . PHE B 2 93  ? 13.317  59.311  67.670  1.00 29.11  ? 267  PHE B CD1 1 
ATOM   3133 C CD2 . PHE B 2 93  ? 13.659  59.800  69.994  1.00 30.56  ? 267  PHE B CD2 1 
ATOM   3134 C CE1 . PHE B 2 93  ? 14.128  58.184  67.788  1.00 27.64  ? 267  PHE B CE1 1 
ATOM   3135 C CE2 . PHE B 2 93  ? 14.474  58.668  70.121  1.00 27.63  ? 267  PHE B CE2 1 
ATOM   3136 C CZ  . PHE B 2 93  ? 14.707  57.863  69.020  1.00 27.73  ? 267  PHE B CZ  1 
ATOM   3137 N N   . GLU B 2 94  ? 10.640  61.195  71.275  1.00 31.83  ? 268  GLU B N   1 
ATOM   3138 C CA  . GLU B 2 94  ? 10.579  60.719  72.663  1.00 33.23  ? 268  GLU B CA  1 
ATOM   3139 C C   . GLU B 2 94  ? 9.258   60.739  73.464  1.00 35.61  ? 268  GLU B C   1 
ATOM   3140 O O   . GLU B 2 94  ? 9.070   59.915  74.353  1.00 36.77  ? 268  GLU B O   1 
ATOM   3141 C CB  . GLU B 2 94  ? 11.633  61.480  73.467  1.00 31.13  ? 268  GLU B CB  1 
ATOM   3142 C CG  . GLU B 2 94  ? 11.963  60.900  74.818  1.00 32.16  ? 268  GLU B CG  1 
ATOM   3143 C CD  . GLU B 2 94  ? 12.502  59.485  74.724  1.00 34.94  ? 268  GLU B CD  1 
ATOM   3144 O OE1 . GLU B 2 94  ? 12.924  59.072  73.627  1.00 33.75  ? 268  GLU B OE1 1 
ATOM   3145 O OE2 . GLU B 2 94  ? 12.508  58.780  75.753  1.00 37.46  ? 268  GLU B OE2 1 
ATOM   3146 N N   . GLU B 2 95  ? 8.360   61.674  73.161  1.00 38.25  ? 269  GLU B N   1 
ATOM   3147 C CA  . GLU B 2 95  ? 7.095   61.826  73.886  1.00 37.13  ? 269  GLU B CA  1 
ATOM   3148 C C   . GLU B 2 95  ? 5.972   60.897  73.479  1.00 38.71  ? 269  GLU B C   1 
ATOM   3149 O O   . GLU B 2 95  ? 5.901   60.457  72.332  1.00 41.48  ? 269  GLU B O   1 
ATOM   3150 C CB  . GLU B 2 95  ? 6.569   63.252  73.726  1.00 35.89  ? 269  GLU B CB  1 
ATOM   3151 C CG  . GLU B 2 95  ? 7.416   64.326  74.328  1.00 36.30  ? 269  GLU B CG  1 
ATOM   3152 C CD  . GLU B 2 95  ? 7.640   64.119  75.800  1.00 38.02  ? 269  GLU B CD  1 
ATOM   3153 O OE1 . GLU B 2 95  ? 6.752   63.543  76.455  1.00 40.77  ? 269  GLU B OE1 1 
ATOM   3154 O OE2 . GLU B 2 95  ? 8.694   64.548  76.314  1.00 37.79  ? 269  GLU B OE2 1 
ATOM   3155 N N   . ILE B 2 96  ? 5.076   60.618  74.425  1.00 40.06  ? 270  ILE B N   1 
ATOM   3156 C CA  . ILE B 2 96  ? 3.911   59.784  74.144  1.00 40.95  ? 270  ILE B CA  1 
ATOM   3157 C C   . ILE B 2 96  ? 2.886   60.746  73.552  1.00 41.52  ? 270  ILE B C   1 
ATOM   3158 O O   . ILE B 2 96  ? 2.192   60.410  72.592  1.00 42.41  ? 270  ILE B O   1 
ATOM   3159 C CB  . ILE B 2 96  ? 3.286   59.149  75.411  1.00 40.91  ? 270  ILE B CB  1 
ATOM   3160 C CG1 . ILE B 2 96  ? 4.285   58.225  76.107  1.00 41.68  ? 270  ILE B CG1 1 
ATOM   3161 C CG2 . ILE B 2 96  ? 2.057   58.336  75.011  1.00 41.13  ? 270  ILE B CG2 1 
ATOM   3162 C CD1 . ILE B 2 96  ? 3.731   57.535  77.346  1.00 38.77  ? 270  ILE B CD1 1 
ATOM   3163 N N   . TYR B 2 97  ? 2.800   61.942  74.136  1.00 40.56  ? 271  TYR B N   1 
ATOM   3164 C CA  . TYR B 2 97  ? 1.883   62.973  73.649  1.00 41.91  ? 271  TYR B CA  1 
ATOM   3165 C C   . TYR B 2 97  ? 2.686   64.231  73.323  1.00 41.14  ? 271  TYR B C   1 
ATOM   3166 O O   . TYR B 2 97  ? 2.844   65.131  74.153  1.00 40.62  ? 271  TYR B O   1 
ATOM   3167 C CB  . TYR B 2 97  ? 0.800   63.301  74.686  1.00 40.40  ? 271  TYR B CB  1 
ATOM   3168 C CG  . TYR B 2 97  ? -0.068  62.119  75.080  1.00 43.93  ? 271  TYR B CG  1 
ATOM   3169 C CD1 . TYR B 2 97  ? -0.892  61.485  74.146  1.00 42.96  ? 271  TYR B CD1 1 
ATOM   3170 C CD2 . TYR B 2 97  ? -0.056  61.623  76.391  1.00 44.73  ? 271  TYR B CD2 1 
ATOM   3171 C CE1 . TYR B 2 97  ? -1.680  60.388  74.506  1.00 42.91  ? 271  TYR B CE1 1 
ATOM   3172 C CE2 . TYR B 2 97  ? -0.839  60.523  76.761  1.00 44.14  ? 271  TYR B CE2 1 
ATOM   3173 C CZ  . TYR B 2 97  ? -1.646  59.910  75.813  1.00 44.51  ? 271  TYR B CZ  1 
ATOM   3174 O OH  . TYR B 2 97  ? -2.399  58.805  76.161  1.00 46.09  ? 271  TYR B OH  1 
ATOM   3175 N N   . PRO B 2 98  ? 3.223   64.299  72.103  1.00 40.37  ? 272  PRO B N   1 
ATOM   3176 C CA  . PRO B 2 98  ? 3.995   65.487  71.750  1.00 40.77  ? 272  PRO B CA  1 
ATOM   3177 C C   . PRO B 2 98  ? 3.091   66.679  71.459  1.00 42.61  ? 272  PRO B C   1 
ATOM   3178 O O   . PRO B 2 98  ? 2.119   66.563  70.697  1.00 44.27  ? 272  PRO B O   1 
ATOM   3179 C CB  . PRO B 2 98  ? 4.776   65.034  70.520  1.00 40.56  ? 272  PRO B CB  1 
ATOM   3180 C CG  . PRO B 2 98  ? 3.855   64.046  69.878  1.00 39.83  ? 272  PRO B CG  1 
ATOM   3181 C CD  . PRO B 2 98  ? 3.287   63.276  71.041  1.00 38.59  ? 272  PRO B CD  1 
ATOM   3182 N N   . PRO B 2 99  ? 3.381   67.837  72.076  1.00 42.17  ? 273  PRO B N   1 
ATOM   3183 C CA  . PRO B 2 99  ? 2.548   69.013  71.819  1.00 43.17  ? 273  PRO B CA  1 
ATOM   3184 C C   . PRO B 2 99  ? 2.546   69.297  70.315  1.00 45.11  ? 273  PRO B C   1 
ATOM   3185 O O   . PRO B 2 99  ? 3.568   69.138  69.647  1.00 44.10  ? 273  PRO B O   1 
ATOM   3186 C CB  . PRO B 2 99  ? 3.233   70.104  72.637  1.00 41.74  ? 273  PRO B CB  1 
ATOM   3187 C CG  . PRO B 2 99  ? 4.658   69.652  72.699  1.00 43.56  ? 273  PRO B CG  1 
ATOM   3188 C CD  . PRO B 2 99  ? 4.517   68.181  72.946  1.00 41.84  ? 273  PRO B CD  1 
ATOM   3189 N N   . GLU B 2 100 ? 1.402   69.698  69.770  1.00 48.35  ? 274  GLU B N   1 
ATOM   3190 C CA  . GLU B 2 100 ? 1.349   69.949  68.338  1.00 49.97  ? 274  GLU B CA  1 
ATOM   3191 C C   . GLU B 2 100 ? 2.072   71.213  67.898  1.00 47.66  ? 274  GLU B C   1 
ATOM   3192 O O   . GLU B 2 100 ? 2.389   72.083  68.711  1.00 44.75  ? 274  GLU B O   1 
ATOM   3193 C CB  . GLU B 2 100 ? -0.103  69.923  67.808  1.00 53.08  ? 274  GLU B CB  1 
ATOM   3194 C CG  . GLU B 2 100 ? -1.222  70.247  68.795  1.00 58.96  ? 274  GLU B CG  1 
ATOM   3195 C CD  . GLU B 2 100 ? -2.610  69.895  68.231  1.00 63.60  ? 274  GLU B CD  1 
ATOM   3196 O OE1 . GLU B 2 100 ? -3.276  68.983  68.778  1.00 65.11  ? 274  GLU B OE1 1 
ATOM   3197 O OE2 . GLU B 2 100 ? -3.034  70.522  67.233  1.00 65.13  ? 274  GLU B OE2 1 
ATOM   3198 N N   . VAL B 2 101 ? 2.343   71.272  66.595  1.00 47.51  ? 275  VAL B N   1 
ATOM   3199 C CA  . VAL B 2 101 ? 3.062   72.369  65.948  1.00 47.60  ? 275  VAL B CA  1 
ATOM   3200 C C   . VAL B 2 101 ? 2.652   73.774  66.375  1.00 48.71  ? 275  VAL B C   1 
ATOM   3201 O O   . VAL B 2 101 ? 3.508   74.649  66.534  1.00 48.26  ? 275  VAL B O   1 
ATOM   3202 C CB  . VAL B 2 101 ? 2.933   72.274  64.407  1.00 45.77  ? 275  VAL B CB  1 
ATOM   3203 C CG1 . VAL B 2 101 ? 3.903   73.222  63.740  1.00 42.56  ? 275  VAL B CG1 1 
ATOM   3204 C CG2 . VAL B 2 101 ? 3.183   70.855  63.958  1.00 47.41  ? 275  VAL B CG2 1 
ATOM   3205 N N   . ALA B 2 102 ? 1.352   73.994  66.550  1.00 49.66  ? 276  ALA B N   1 
ATOM   3206 C CA  . ALA B 2 102 ? 0.857   75.306  66.946  1.00 50.92  ? 276  ALA B CA  1 
ATOM   3207 C C   . ALA B 2 102 ? 1.416   75.722  68.300  1.00 52.43  ? 276  ALA B C   1 
ATOM   3208 O O   . ALA B 2 102 ? 1.699   76.903  68.521  1.00 53.40  ? 276  ALA B O   1 
ATOM   3209 C CB  . ALA B 2 102 ? -0.659  75.310  66.978  1.00 50.12  ? 276  ALA B CB  1 
ATOM   3210 N N   . GLU B 2 103 ? 1.583   74.759  69.202  1.00 52.63  ? 277  GLU B N   1 
ATOM   3211 C CA  . GLU B 2 103 ? 2.122   75.058  70.523  1.00 53.94  ? 277  GLU B CA  1 
ATOM   3212 C C   . GLU B 2 103 ? 3.516   75.637  70.372  1.00 54.46  ? 277  GLU B C   1 
ATOM   3213 O O   . GLU B 2 103 ? 3.881   76.594  71.062  1.00 56.30  ? 277  GLU B O   1 
ATOM   3214 C CB  . GLU B 2 103 ? 2.227   73.796  71.379  1.00 55.94  ? 277  GLU B CB  1 
ATOM   3215 C CG  . GLU B 2 103 ? 0.951   73.001  71.517  1.00 60.59  ? 277  GLU B CG  1 
ATOM   3216 C CD  . GLU B 2 103 ? -0.208  73.835  72.015  1.00 62.90  ? 277  GLU B CD  1 
ATOM   3217 O OE1 . GLU B 2 103 ? 0.033   74.936  72.564  1.00 60.99  ? 277  GLU B OE1 1 
ATOM   3218 O OE2 . GLU B 2 103 ? -1.364  73.374  71.862  1.00 67.25  ? 277  GLU B OE2 1 
ATOM   3219 N N   . PHE B 2 104 ? 4.288   75.037  69.466  1.00 52.56  ? 278  PHE B N   1 
ATOM   3220 C CA  . PHE B 2 104 ? 5.663   75.445  69.219  1.00 49.94  ? 278  PHE B CA  1 
ATOM   3221 C C   . PHE B 2 104 ? 5.793   76.776  68.515  1.00 49.68  ? 278  PHE B C   1 
ATOM   3222 O O   . PHE B 2 104 ? 6.823   77.436  68.625  1.00 50.08  ? 278  PHE B O   1 
ATOM   3223 C CB  . PHE B 2 104 ? 6.394   74.357  68.435  1.00 47.39  ? 278  PHE B CB  1 
ATOM   3224 C CG  . PHE B 2 104 ? 6.766   73.172  69.271  1.00 46.25  ? 278  PHE B CG  1 
ATOM   3225 C CD1 . PHE B 2 104 ? 7.830   73.246  70.164  1.00 43.70  ? 278  PHE B CD1 1 
ATOM   3226 C CD2 . PHE B 2 104 ? 6.024   71.996  69.208  1.00 45.97  ? 278  PHE B CD2 1 
ATOM   3227 C CE1 . PHE B 2 104 ? 8.150   72.173  70.982  1.00 42.16  ? 278  PHE B CE1 1 
ATOM   3228 C CE2 . PHE B 2 104 ? 6.338   70.911  70.028  1.00 44.99  ? 278  PHE B CE2 1 
ATOM   3229 C CZ  . PHE B 2 104 ? 7.406   71.004  70.917  1.00 42.63  ? 278  PHE B CZ  1 
ATOM   3230 N N   . VAL B 2 105 ? 4.762   77.167  67.778  1.00 48.99  ? 279  VAL B N   1 
ATOM   3231 C CA  . VAL B 2 105 ? 4.795   78.454  67.100  1.00 48.57  ? 279  VAL B CA  1 
ATOM   3232 C C   . VAL B 2 105 ? 4.430   79.470  68.173  1.00 49.30  ? 279  VAL B C   1 
ATOM   3233 O O   . VAL B 2 105 ? 5.062   80.514  68.312  1.00 48.45  ? 279  VAL B O   1 
ATOM   3234 C CB  . VAL B 2 105 ? 3.758   78.533  65.962  1.00 46.98  ? 279  VAL B CB  1 
ATOM   3235 C CG1 . VAL B 2 105 ? 3.841   79.898  65.276  1.00 42.83  ? 279  VAL B CG1 1 
ATOM   3236 C CG2 . VAL B 2 105 ? 3.991   77.408  64.973  1.00 44.31  ? 279  VAL B CG2 1 
ATOM   3237 N N   . TYR B 2 106 ? 3.408   79.127  68.946  1.00 51.38  ? 280  TYR B N   1 
ATOM   3238 C CA  . TYR B 2 106 ? 2.932   79.977  70.018  1.00 54.53  ? 280  TYR B CA  1 
ATOM   3239 C C   . TYR B 2 106 ? 4.033   80.362  71.006  1.00 55.97  ? 280  TYR B C   1 
ATOM   3240 O O   . TYR B 2 106 ? 4.190   81.541  71.332  1.00 56.65  ? 280  TYR B O   1 
ATOM   3241 C CB  . TYR B 2 106 ? 1.791   79.288  70.767  1.00 55.41  ? 280  TYR B CB  1 
ATOM   3242 C CG  . TYR B 2 106 ? 1.321   80.065  71.975  1.00 58.04  ? 280  TYR B CG  1 
ATOM   3243 C CD1 . TYR B 2 106 ? 0.632   81.269  71.829  1.00 58.36  ? 280  TYR B CD1 1 
ATOM   3244 C CD2 . TYR B 2 106 ? 1.596   79.615  73.266  1.00 58.48  ? 280  TYR B CD2 1 
ATOM   3245 C CE1 . TYR B 2 106 ? 0.231   82.002  72.936  1.00 58.25  ? 280  TYR B CE1 1 
ATOM   3246 C CE2 . TYR B 2 106 ? 1.201   80.342  74.376  1.00 57.94  ? 280  TYR B CE2 1 
ATOM   3247 C CZ  . TYR B 2 106 ? 0.520   81.534  74.204  1.00 58.73  ? 280  TYR B CZ  1 
ATOM   3248 O OH  . TYR B 2 106 ? 0.126   82.259  75.302  1.00 60.94  ? 280  TYR B OH  1 
ATOM   3249 N N   . ILE B 2 107 ? 4.797   79.382  71.482  1.00 56.88  ? 281  ILE B N   1 
ATOM   3250 C CA  . ILE B 2 107 ? 5.861   79.671  72.442  1.00 58.78  ? 281  ILE B CA  1 
ATOM   3251 C C   . ILE B 2 107 ? 6.901   80.665  71.921  1.00 58.66  ? 281  ILE B C   1 
ATOM   3252 O O   . ILE B 2 107 ? 7.729   81.166  72.680  1.00 57.54  ? 281  ILE B O   1 
ATOM   3253 C CB  . ILE B 2 107 ? 6.580   78.378  72.910  1.00 59.34  ? 281  ILE B CB  1 
ATOM   3254 C CG1 . ILE B 2 107 ? 7.218   77.664  71.721  1.00 60.14  ? 281  ILE B CG1 1 
ATOM   3255 C CG2 . ILE B 2 107 ? 5.588   77.462  73.615  1.00 59.49  ? 281  ILE B CG2 1 
ATOM   3256 C CD1 . ILE B 2 107 ? 8.047   76.458  72.119  1.00 62.33  ? 281  ILE B CD1 1 
ATOM   3257 N N   . THR B 2 108 ? 6.858   80.954  70.627  1.00 60.31  ? 282  THR B N   1 
ATOM   3258 C CA  . THR B 2 108 ? 7.790   81.913  70.048  1.00 63.33  ? 282  THR B CA  1 
ATOM   3259 C C   . THR B 2 108 ? 7.046   83.239  69.900  1.00 66.16  ? 282  THR B C   1 
ATOM   3260 O O   . THR B 2 108 ? 7.529   84.160  69.239  1.00 66.92  ? 282  THR B O   1 
ATOM   3261 C CB  . THR B 2 108 ? 8.273   81.470  68.644  1.00 62.60  ? 282  THR B CB  1 
ATOM   3262 O OG1 . THR B 2 108 ? 7.322   81.873  67.654  1.00 60.29  ? 282  THR B OG1 1 
ATOM   3263 C CG2 . THR B 2 108 ? 8.414   79.962  68.580  1.00 62.58  ? 282  THR B CG2 1 
ATOM   3264 N N   . ASP B 2 109 ? 5.879   83.326  70.541  1.00 68.48  ? 283  ASP B N   1 
ATOM   3265 C CA  . ASP B 2 109 ? 5.014   84.502  70.459  1.00 71.30  ? 283  ASP B CA  1 
ATOM   3266 C C   . ASP B 2 109 ? 5.082   85.014  69.030  1.00 71.26  ? 283  ASP B C   1 
ATOM   3267 O O   . ASP B 2 109 ? 5.329   86.192  68.769  1.00 70.44  ? 283  ASP B O   1 
ATOM   3268 C CB  . ASP B 2 109 ? 5.437   85.612  71.426  1.00 74.28  ? 283  ASP B CB  1 
ATOM   3269 C CG  . ASP B 2 109 ? 4.298   86.605  71.699  1.00 78.71  ? 283  ASP B CG  1 
ATOM   3270 O OD1 . ASP B 2 109 ? 3.473   86.836  70.782  1.00 80.03  ? 283  ASP B OD1 1 
ATOM   3271 O OD2 . ASP B 2 109 ? 4.224   87.156  72.823  1.00 81.25  ? 283  ASP B OD2 1 
ATOM   3272 N N   . ASP B 2 110 ? 4.888   84.083  68.107  1.00 71.85  ? 284  ASP B N   1 
ATOM   3273 C CA  . ASP B 2 110 ? 4.910   84.375  66.690  1.00 71.53  ? 284  ASP B CA  1 
ATOM   3274 C C   . ASP B 2 110 ? 6.141   85.134  66.214  1.00 69.56  ? 284  ASP B C   1 
ATOM   3275 O O   . ASP B 2 110 ? 6.030   86.163  65.551  1.00 70.62  ? 284  ASP B O   1 
ATOM   3276 C CB  . ASP B 2 110 ? 3.632   85.113  66.315  1.00 74.12  ? 284  ASP B CB  1 
ATOM   3277 C CG  . ASP B 2 110 ? 2.400   84.273  66.571  1.00 77.43  ? 284  ASP B CG  1 
ATOM   3278 O OD1 . ASP B 2 110 ? 2.166   83.307  65.804  1.00 77.81  ? 284  ASP B OD1 1 
ATOM   3279 O OD2 . ASP B 2 110 ? 1.680   84.568  67.553  1.00 79.98  ? 284  ASP B OD2 1 
ATOM   3280 N N   . THR B 2 111 ? 7.315   84.623  66.567  1.00 66.52  ? 285  THR B N   1 
ATOM   3281 C CA  . THR B 2 111 ? 8.565   85.217  66.122  1.00 63.16  ? 285  THR B CA  1 
ATOM   3282 C C   . THR B 2 111 ? 8.779   84.585  64.749  1.00 61.16  ? 285  THR B C   1 
ATOM   3283 O O   . THR B 2 111 ? 9.555   85.084  63.931  1.00 61.55  ? 285  THR B O   1 
ATOM   3284 C CB  . THR B 2 111 ? 9.740   84.832  67.042  1.00 63.88  ? 285  THR B CB  1 
ATOM   3285 O OG1 . THR B 2 111 ? 9.470   85.273  68.375  1.00 65.18  ? 285  THR B OG1 1 
ATOM   3286 C CG2 . THR B 2 111 ? 11.027  85.477  66.566  1.00 63.65  ? 285  THR B CG2 1 
ATOM   3287 N N   . TYR B 2 112 ? 8.059   83.484  64.518  1.00 57.12  ? 286  TYR B N   1 
ATOM   3288 C CA  . TYR B 2 112 ? 8.114   82.716  63.275  1.00 53.08  ? 286  TYR B CA  1 
ATOM   3289 C C   . TYR B 2 112 ? 6.733   82.149  62.957  1.00 53.32  ? 286  TYR B C   1 
ATOM   3290 O O   . TYR B 2 112 ? 5.890   82.009  63.842  1.00 52.94  ? 286  TYR B O   1 
ATOM   3291 C CB  . TYR B 2 112 ? 9.076   81.538  63.415  1.00 48.65  ? 286  TYR B CB  1 
ATOM   3292 C CG  . TYR B 2 112 ? 10.432  81.896  63.935  1.00 42.84  ? 286  TYR B CG  1 
ATOM   3293 C CD1 . TYR B 2 112 ? 11.372  82.509  63.112  1.00 43.33  ? 286  TYR B CD1 1 
ATOM   3294 C CD2 . TYR B 2 112 ? 10.785  81.612  65.249  1.00 42.19  ? 286  TYR B CD2 1 
ATOM   3295 C CE1 . TYR B 2 112 ? 12.639  82.828  63.582  1.00 41.56  ? 286  TYR B CE1 1 
ATOM   3296 C CE2 . TYR B 2 112 ? 12.047  81.927  65.736  1.00 42.77  ? 286  TYR B CE2 1 
ATOM   3297 C CZ  . TYR B 2 112 ? 12.971  82.530  64.895  1.00 42.66  ? 286  TYR B CZ  1 
ATOM   3298 O OH  . TYR B 2 112 ? 14.240  82.787  65.350  1.00 46.31  ? 286  TYR B OH  1 
ATOM   3299 N N   . THR B 2 113 ? 6.519   81.803  61.691  1.00 53.78  ? 287  THR B N   1 
ATOM   3300 C CA  . THR B 2 113 ? 5.249   81.242  61.253  1.00 54.26  ? 287  THR B CA  1 
ATOM   3301 C C   . THR B 2 113 ? 5.314   79.724  61.344  1.00 55.35  ? 287  THR B C   1 
ATOM   3302 O O   . THR B 2 113 ? 6.403   79.156  61.429  1.00 55.39  ? 287  THR B O   1 
ATOM   3303 C CB  . THR B 2 113 ? 4.946   81.599  59.787  1.00 53.98  ? 287  THR B CB  1 
ATOM   3304 O OG1 . THR B 2 113 ? 5.896   80.950  58.936  1.00 52.55  ? 287  THR B OG1 1 
ATOM   3305 C CG2 . THR B 2 113 ? 5.018   83.095  59.573  1.00 53.27  ? 287  THR B CG2 1 
ATOM   3306 N N   . LYS B 2 114 ? 4.149   79.077  61.325  1.00 56.22  ? 288  LYS B N   1 
ATOM   3307 C CA  . LYS B 2 114 ? 4.081   77.621  61.374  1.00 56.85  ? 288  LYS B CA  1 
ATOM   3308 C C   . LYS B 2 114 ? 4.911   77.062  60.218  1.00 57.44  ? 288  LYS B C   1 
ATOM   3309 O O   . LYS B 2 114 ? 5.587   76.039  60.359  1.00 57.52  ? 288  LYS B O   1 
ATOM   3310 C CB  . LYS B 2 114 ? 2.624   77.151  61.256  1.00 57.33  ? 288  LYS B CB  1 
ATOM   3311 C CG  . LYS B 2 114 ? 2.471   75.683  60.848  1.00 60.05  ? 288  LYS B CG  1 
ATOM   3312 C CD  . LYS B 2 114 ? 1.023   75.203  60.885  1.00 62.09  ? 288  LYS B CD  1 
ATOM   3313 C CE  . LYS B 2 114 ? 0.560   74.905  62.315  1.00 64.52  ? 288  LYS B CE  1 
ATOM   3314 N NZ  . LYS B 2 114 ? -0.861  74.417  62.355  1.00 66.87  ? 288  LYS B NZ  1 
ATOM   3315 N N   . LYS B 2 115 ? 4.856   77.757  59.083  1.00 57.62  ? 289  LYS B N   1 
ATOM   3316 C CA  . LYS B 2 115 ? 5.586   77.381  57.875  1.00 57.33  ? 289  LYS B CA  1 
ATOM   3317 C C   . LYS B 2 115 ? 7.084   77.302  58.162  1.00 55.84  ? 289  LYS B C   1 
ATOM   3318 O O   . LYS B 2 115 ? 7.754   76.346  57.783  1.00 56.96  ? 289  LYS B O   1 
ATOM   3319 C CB  . LYS B 2 115 ? 5.332   78.416  56.769  1.00 60.33  ? 289  LYS B CB  1 
ATOM   3320 C CG  . LYS B 2 115 ? 5.877   78.043  55.393  1.00 64.32  ? 289  LYS B CG  1 
ATOM   3321 C CD  . LYS B 2 115 ? 4.996   77.003  54.697  1.00 70.14  ? 289  LYS B CD  1 
ATOM   3322 C CE  . LYS B 2 115 ? 5.725   76.327  53.517  1.00 72.35  ? 289  LYS B CE  1 
ATOM   3323 N NZ  . LYS B 2 115 ? 4.862   75.420  52.687  1.00 71.77  ? 289  LYS B NZ  1 
ATOM   3324 N N   . GLN B 2 116 ? 7.606   78.315  58.836  1.00 53.64  ? 290  GLN B N   1 
ATOM   3325 C CA  . GLN B 2 116 ? 9.023   78.353  59.161  1.00 52.64  ? 290  GLN B CA  1 
ATOM   3326 C C   . GLN B 2 116 ? 9.437   77.211  60.083  1.00 51.13  ? 290  GLN B C   1 
ATOM   3327 O O   . GLN B 2 116 ? 10.556  76.711  59.995  1.00 49.54  ? 290  GLN B O   1 
ATOM   3328 C CB  . GLN B 2 116 ? 9.369   79.693  59.809  1.00 51.61  ? 290  GLN B CB  1 
ATOM   3329 C CG  . GLN B 2 116 ? 9.290   80.873  58.858  1.00 52.09  ? 290  GLN B CG  1 
ATOM   3330 C CD  . GLN B 2 116 ? 9.457   82.196  59.572  1.00 52.46  ? 290  GLN B CD  1 
ATOM   3331 O OE1 . GLN B 2 116 ? 8.551   82.658  60.271  1.00 53.92  ? 290  GLN B OE1 1 
ATOM   3332 N NE2 . GLN B 2 116 ? 10.622  82.809  59.412  1.00 51.94  ? 290  GLN B NE2 1 
ATOM   3333 N N   . VAL B 2 117 ? 8.540   76.808  60.975  1.00 50.28  ? 291  VAL B N   1 
ATOM   3334 C CA  . VAL B 2 117 ? 8.843   75.727  61.900  1.00 50.45  ? 291  VAL B CA  1 
ATOM   3335 C C   . VAL B 2 117 ? 8.947   74.432  61.114  1.00 48.89  ? 291  VAL B C   1 
ATOM   3336 O O   . VAL B 2 117 ? 9.925   73.688  61.235  1.00 48.97  ? 291  VAL B O   1 
ATOM   3337 C CB  . VAL B 2 117 ? 7.742   75.569  62.972  1.00 51.50  ? 291  VAL B CB  1 
ATOM   3338 C CG1 . VAL B 2 117 ? 8.004   74.316  63.797  1.00 51.39  ? 291  VAL B CG1 1 
ATOM   3339 C CG2 . VAL B 2 117 ? 7.712   76.793  63.877  1.00 49.60  ? 291  VAL B CG2 1 
ATOM   3340 N N   . LEU B 2 118 ? 7.936   74.191  60.290  1.00 46.54  ? 292  LEU B N   1 
ATOM   3341 C CA  . LEU B 2 118 ? 7.873   72.998  59.471  1.00 46.41  ? 292  LEU B CA  1 
ATOM   3342 C C   . LEU B 2 118 ? 9.021   72.854  58.490  1.00 46.37  ? 292  LEU B C   1 
ATOM   3343 O O   . LEU B 2 118 ? 9.501   71.741  58.267  1.00 46.04  ? 292  LEU B O   1 
ATOM   3344 C CB  . LEU B 2 118 ? 6.533   72.950  58.735  1.00 48.03  ? 292  LEU B CB  1 
ATOM   3345 C CG  . LEU B 2 118 ? 5.494   72.021  59.381  1.00 50.19  ? 292  LEU B CG  1 
ATOM   3346 C CD1 . LEU B 2 118 ? 5.531   72.147  60.904  1.00 52.23  ? 292  LEU B CD1 1 
ATOM   3347 C CD2 . LEU B 2 118 ? 4.118   72.342  58.845  1.00 49.56  ? 292  LEU B CD2 1 
ATOM   3348 N N   . ARG B 2 119 ? 9.473   73.965  57.912  1.00 46.06  ? 293  ARG B N   1 
ATOM   3349 C CA  . ARG B 2 119 ? 10.575  73.909  56.956  1.00 46.74  ? 293  ARG B CA  1 
ATOM   3350 C C   . ARG B 2 119 ? 11.892  73.683  57.676  1.00 45.67  ? 293  ARG B C   1 
ATOM   3351 O O   . ARG B 2 119 ? 12.770  72.974  57.177  1.00 47.39  ? 293  ARG B O   1 
ATOM   3352 C CB  . ARG B 2 119 ? 10.666  75.195  56.124  1.00 49.93  ? 293  ARG B CB  1 
ATOM   3353 C CG  . ARG B 2 119 ? 9.405   75.532  55.358  1.00 54.13  ? 293  ARG B CG  1 
ATOM   3354 C CD  . ARG B 2 119 ? 9.703   76.327  54.102  1.00 58.79  ? 293  ARG B CD  1 
ATOM   3355 N NE  . ARG B 2 119 ? 8.604   77.234  53.781  1.00 65.19  ? 293  ARG B NE  1 
ATOM   3356 C CZ  . ARG B 2 119 ? 8.334   77.701  52.565  1.00 66.32  ? 293  ARG B CZ  1 
ATOM   3357 N NH1 . ARG B 2 119 ? 9.084   77.347  51.528  1.00 67.73  ? 293  ARG B NH1 1 
ATOM   3358 N NH2 . ARG B 2 119 ? 7.306   78.522  52.388  1.00 66.37  ? 293  ARG B NH2 1 
ATOM   3359 N N   . MET B 2 120 ? 12.036  74.289  58.849  1.00 43.35  ? 294  MET B N   1 
ATOM   3360 C CA  . MET B 2 120 ? 13.252  74.121  59.620  1.00 39.91  ? 294  MET B CA  1 
ATOM   3361 C C   . MET B 2 120 ? 13.309  72.654  60.046  1.00 38.96  ? 294  MET B C   1 
ATOM   3362 O O   . MET B 2 120 ? 14.379  72.060  60.097  1.00 36.49  ? 294  MET B O   1 
ATOM   3363 C CB  . MET B 2 120 ? 13.238  75.041  60.839  1.00 40.08  ? 294  MET B CB  1 
ATOM   3364 C CG  . MET B 2 120 ? 14.521  74.997  61.659  1.00 39.82  ? 294  MET B CG  1 
ATOM   3365 S SD  . MET B 2 120 ? 15.990  75.224  60.636  1.00 40.13  ? 294  MET B SD  1 
ATOM   3366 C CE  . MET B 2 120 ? 16.107  77.045  60.563  1.00 42.44  ? 294  MET B CE  1 
ATOM   3367 N N   . GLU B 2 121 ? 12.150  72.069  60.338  1.00 38.75  ? 295  GLU B N   1 
ATOM   3368 C CA  . GLU B 2 121 ? 12.107  70.668  60.736  1.00 39.82  ? 295  GLU B CA  1 
ATOM   3369 C C   . GLU B 2 121 ? 12.729  69.845  59.616  1.00 40.70  ? 295  GLU B C   1 
ATOM   3370 O O   . GLU B 2 121 ? 13.664  69.068  59.841  1.00 41.04  ? 295  GLU B O   1 
ATOM   3371 C CB  . GLU B 2 121 ? 10.660  70.207  60.971  1.00 38.96  ? 295  GLU B CB  1 
ATOM   3372 C CG  . GLU B 2 121 ? 10.537  68.745  61.425  1.00 37.04  ? 295  GLU B CG  1 
ATOM   3373 C CD  . GLU B 2 121 ? 9.091   68.271  61.562  1.00 37.69  ? 295  GLU B CD  1 
ATOM   3374 O OE1 . GLU B 2 121 ? 8.400   68.137  60.532  1.00 38.46  ? 295  GLU B OE1 1 
ATOM   3375 O OE2 . GLU B 2 121 ? 8.639   68.031  62.701  1.00 38.15  ? 295  GLU B OE2 1 
ATOM   3376 N N   . HIS B 2 122 ? 12.200  70.038  58.410  1.00 42.38  ? 296  HIS B N   1 
ATOM   3377 C CA  . HIS B 2 122 ? 12.655  69.345  57.211  1.00 42.36  ? 296  HIS B CA  1 
ATOM   3378 C C   . HIS B 2 122 ? 14.157  69.542  57.061  1.00 41.30  ? 296  HIS B C   1 
ATOM   3379 O O   . HIS B 2 122 ? 14.905  68.591  56.854  1.00 41.97  ? 296  HIS B O   1 
ATOM   3380 C CB  . HIS B 2 122 ? 11.953  69.932  55.995  1.00 48.29  ? 296  HIS B CB  1 
ATOM   3381 C CG  . HIS B 2 122 ? 11.488  68.916  54.996  1.00 53.73  ? 296  HIS B CG  1 
ATOM   3382 N ND1 . HIS B 2 122 ? 10.367  68.137  55.190  1.00 55.36  ? 296  HIS B ND1 1 
ATOM   3383 C CD2 . HIS B 2 122 ? 11.959  68.598  53.766  1.00 55.19  ? 296  HIS B CD2 1 
ATOM   3384 C CE1 . HIS B 2 122 ? 10.165  67.386  54.121  1.00 56.38  ? 296  HIS B CE1 1 
ATOM   3385 N NE2 . HIS B 2 122 ? 11.117  67.646  53.243  1.00 57.77  ? 296  HIS B NE2 1 
ATOM   3386 N N   . LEU B 2 123 ? 14.605  70.784  57.169  1.00 38.88  ? 297  LEU B N   1 
ATOM   3387 C CA  . LEU B 2 123 ? 16.025  71.059  57.031  1.00 38.04  ? 297  LEU B CA  1 
ATOM   3388 C C   . LEU B 2 123 ? 16.879  70.335  58.075  1.00 36.97  ? 297  LEU B C   1 
ATOM   3389 O O   . LEU B 2 123 ? 17.859  69.696  57.708  1.00 38.84  ? 297  LEU B O   1 
ATOM   3390 C CB  . LEU B 2 123 ? 16.277  72.571  57.073  1.00 36.78  ? 297  LEU B CB  1 
ATOM   3391 C CG  . LEU B 2 123 ? 17.721  73.071  56.967  1.00 36.47  ? 297  LEU B CG  1 
ATOM   3392 C CD1 . LEU B 2 123 ? 18.412  72.459  55.769  1.00 33.73  ? 297  LEU B CD1 1 
ATOM   3393 C CD2 . LEU B 2 123 ? 17.706  74.586  56.864  1.00 36.85  ? 297  LEU B CD2 1 
ATOM   3394 N N   . VAL B 2 124 ? 16.512  70.434  59.356  1.00 35.90  ? 298  VAL B N   1 
ATOM   3395 C CA  . VAL B 2 124 ? 17.243  69.777  60.456  1.00 35.12  ? 298  VAL B CA  1 
ATOM   3396 C C   . VAL B 2 124 ? 17.319  68.248  60.280  1.00 36.23  ? 298  VAL B C   1 
ATOM   3397 O O   . VAL B 2 124 ? 18.353  67.627  60.538  1.00 34.61  ? 298  VAL B O   1 
ATOM   3398 C CB  . VAL B 2 124 ? 16.580  70.092  61.832  1.00 35.66  ? 298  VAL B CB  1 
ATOM   3399 C CG1 . VAL B 2 124 ? 17.196  69.243  62.928  1.00 32.49  ? 298  VAL B CG1 1 
ATOM   3400 C CG2 . VAL B 2 124 ? 16.744  71.575  62.170  1.00 31.90  ? 298  VAL B CG2 1 
ATOM   3401 N N   . LEU B 2 125 ? 16.213  67.645  59.857  1.00 37.68  ? 299  LEU B N   1 
ATOM   3402 C CA  . LEU B 2 125 ? 16.183  66.208  59.610  1.00 39.72  ? 299  LEU B CA  1 
ATOM   3403 C C   . LEU B 2 125 ? 17.232  65.852  58.546  1.00 40.68  ? 299  LEU B C   1 
ATOM   3404 O O   . LEU B 2 125 ? 17.901  64.819  58.634  1.00 42.24  ? 299  LEU B O   1 
ATOM   3405 C CB  . LEU B 2 125 ? 14.795  65.778  59.122  1.00 40.41  ? 299  LEU B CB  1 
ATOM   3406 C CG  . LEU B 2 125 ? 13.712  65.477  60.151  1.00 39.73  ? 299  LEU B CG  1 
ATOM   3407 C CD1 . LEU B 2 125 ? 12.357  65.416  59.470  1.00 40.50  ? 299  LEU B CD1 1 
ATOM   3408 C CD2 . LEU B 2 125 ? 14.025  64.158  60.826  1.00 39.90  ? 299  LEU B CD2 1 
ATOM   3409 N N   . LYS B 2 126 ? 17.364  66.702  57.535  1.00 38.96  ? 300  LYS B N   1 
ATOM   3410 C CA  . LYS B 2 126 ? 18.344  66.473  56.493  1.00 40.60  ? 300  LYS B CA  1 
ATOM   3411 C C   . LYS B 2 126 ? 19.759  66.638  57.017  1.00 39.83  ? 300  LYS B C   1 
ATOM   3412 O O   . LYS B 2 126 ? 20.619  65.783  56.814  1.00 40.62  ? 300  LYS B O   1 
ATOM   3413 C CB  . LYS B 2 126 ? 18.153  67.449  55.340  1.00 44.77  ? 300  LYS B CB  1 
ATOM   3414 C CG  . LYS B 2 126 ? 16.972  67.152  54.446  1.00 51.08  ? 300  LYS B CG  1 
ATOM   3415 C CD  . LYS B 2 126 ? 17.091  67.933  53.143  1.00 54.60  ? 300  LYS B CD  1 
ATOM   3416 C CE  . LYS B 2 126 ? 15.753  67.982  52.432  1.00 57.12  ? 300  LYS B CE  1 
ATOM   3417 N NZ  . LYS B 2 126 ? 14.728  68.645  53.297  1.00 55.89  ? 300  LYS B NZ  1 
ATOM   3418 N N   . VAL B 2 127 ? 20.013  67.750  57.683  1.00 37.14  ? 301  VAL B N   1 
ATOM   3419 C CA  . VAL B 2 127 ? 21.348  67.980  58.188  1.00 37.42  ? 301  VAL B CA  1 
ATOM   3420 C C   . VAL B 2 127 ? 21.784  66.886  59.153  1.00 36.32  ? 301  VAL B C   1 
ATOM   3421 O O   . VAL B 2 127 ? 22.974  66.580  59.257  1.00 36.33  ? 301  VAL B O   1 
ATOM   3422 C CB  . VAL B 2 127 ? 21.454  69.345  58.864  1.00 35.99  ? 301  VAL B CB  1 
ATOM   3423 C CG1 . VAL B 2 127 ? 22.855  69.543  59.409  1.00 34.72  ? 301  VAL B CG1 1 
ATOM   3424 C CG2 . VAL B 2 127 ? 21.123  70.422  57.856  1.00 37.53  ? 301  VAL B CG2 1 
ATOM   3425 N N   . LEU B 2 128 ? 20.827  66.293  59.855  1.00 34.48  ? 302  LEU B N   1 
ATOM   3426 C CA  . LEU B 2 128 ? 21.153  65.223  60.787  1.00 34.86  ? 302  LEU B CA  1 
ATOM   3427 C C   . LEU B 2 128 ? 20.978  63.851  60.112  1.00 35.28  ? 302  LEU B C   1 
ATOM   3428 O O   . LEU B 2 128 ? 21.183  62.818  60.744  1.00 34.10  ? 302  LEU B O   1 
ATOM   3429 C CB  . LEU B 2 128 ? 20.260  65.323  62.035  1.00 33.93  ? 302  LEU B CB  1 
ATOM   3430 C CG  . LEU B 2 128 ? 20.363  66.603  62.888  1.00 31.75  ? 302  LEU B CG  1 
ATOM   3431 C CD1 . LEU B 2 128 ? 19.387  66.532  64.047  1.00 29.88  ? 302  LEU B CD1 1 
ATOM   3432 C CD2 . LEU B 2 128 ? 21.778  66.764  63.415  1.00 31.16  ? 302  LEU B CD2 1 
ATOM   3433 N N   . THR B 2 129 ? 20.633  63.871  58.820  1.00 36.04  ? 303  THR B N   1 
ATOM   3434 C CA  . THR B 2 129 ? 20.373  62.671  58.007  1.00 37.91  ? 303  THR B CA  1 
ATOM   3435 C C   . THR B 2 129 ? 19.480  61.674  58.735  1.00 38.31  ? 303  THR B C   1 
ATOM   3436 O O   . THR B 2 129 ? 19.719  60.470  58.713  1.00 38.58  ? 303  THR B O   1 
ATOM   3437 C CB  . THR B 2 129 ? 21.679  61.936  57.542  1.00 39.38  ? 303  THR B CB  1 
ATOM   3438 O OG1 . THR B 2 129 ? 22.466  61.538  58.671  1.00 40.84  ? 303  THR B OG1 1 
ATOM   3439 C CG2 . THR B 2 129 ? 22.502  62.839  56.649  1.00 39.88  ? 303  THR B CG2 1 
ATOM   3440 N N   . PHE B 2 130 ? 18.448  62.204  59.385  1.00 38.37  ? 304  PHE B N   1 
ATOM   3441 C CA  . PHE B 2 130 ? 17.491  61.400  60.120  1.00 37.11  ? 304  PHE B CA  1 
ATOM   3442 C C   . PHE B 2 130 ? 18.064  60.576  61.259  1.00 36.07  ? 304  PHE B C   1 
ATOM   3443 O O   . PHE B 2 130 ? 17.407  59.653  61.720  1.00 40.16  ? 304  PHE B O   1 
ATOM   3444 C CB  . PHE B 2 130 ? 16.759  60.473  59.157  1.00 37.93  ? 304  PHE B CB  1 
ATOM   3445 C CG  . PHE B 2 130 ? 15.486  61.047  58.607  1.00 39.23  ? 304  PHE B CG  1 
ATOM   3446 C CD1 . PHE B 2 130 ? 14.290  60.913  59.310  1.00 37.88  ? 304  PHE B CD1 1 
ATOM   3447 C CD2 . PHE B 2 130 ? 15.475  61.694  57.369  1.00 39.35  ? 304  PHE B CD2 1 
ATOM   3448 C CE1 . PHE B 2 130 ? 13.105  61.407  58.783  1.00 40.50  ? 304  PHE B CE1 1 
ATOM   3449 C CE2 . PHE B 2 130 ? 14.294  62.195  56.833  1.00 38.74  ? 304  PHE B CE2 1 
ATOM   3450 C CZ  . PHE B 2 130 ? 13.106  62.051  57.536  1.00 39.63  ? 304  PHE B CZ  1 
ATOM   3451 N N   . ASP B 2 131 ? 19.267  60.887  61.718  1.00 33.19  ? 305  ASP B N   1 
ATOM   3452 C CA  . ASP B 2 131 ? 19.849  60.121  62.819  1.00 34.41  ? 305  ASP B CA  1 
ATOM   3453 C C   . ASP B 2 131 ? 19.463  60.775  64.120  1.00 32.25  ? 305  ASP B C   1 
ATOM   3454 O O   . ASP B 2 131 ? 20.213  61.593  64.654  1.00 33.21  ? 305  ASP B O   1 
ATOM   3455 C CB  . ASP B 2 131 ? 21.376  60.062  62.708  1.00 36.07  ? 305  ASP B CB  1 
ATOM   3456 C CG  . ASP B 2 131 ? 21.843  59.482  61.379  1.00 39.83  ? 305  ASP B CG  1 
ATOM   3457 O OD1 . ASP B 2 131 ? 21.217  58.514  60.888  1.00 42.52  ? 305  ASP B OD1 1 
ATOM   3458 O OD2 . ASP B 2 131 ? 22.844  59.988  60.830  1.00 40.98  ? 305  ASP B OD2 1 
ATOM   3459 N N   . LEU B 2 132 ? 18.300  60.401  64.637  1.00 28.82  ? 306  LEU B N   1 
ATOM   3460 C CA  . LEU B 2 132 ? 17.786  61.003  65.860  1.00 29.14  ? 306  LEU B CA  1 
ATOM   3461 C C   . LEU B 2 132 ? 17.919  60.231  67.181  1.00 29.32  ? 306  LEU B C   1 
ATOM   3462 O O   . LEU B 2 132 ? 17.753  60.815  68.254  1.00 27.10  ? 306  LEU B O   1 
ATOM   3463 C CB  . LEU B 2 132 ? 16.320  61.378  65.643  1.00 29.25  ? 306  LEU B CB  1 
ATOM   3464 C CG  . LEU B 2 132 ? 16.030  62.346  64.496  1.00 27.92  ? 306  LEU B CG  1 
ATOM   3465 C CD1 . LEU B 2 132 ? 14.560  62.639  64.508  1.00 28.10  ? 306  LEU B CD1 1 
ATOM   3466 C CD2 . LEU B 2 132 ? 16.832  63.633  64.645  1.00 24.87  ? 306  LEU B CD2 1 
ATOM   3467 N N   . ALA B 2 133 ? 18.215  58.936  67.105  1.00 29.42  ? 307  ALA B N   1 
ATOM   3468 C CA  . ALA B 2 133 ? 18.355  58.109  68.298  1.00 29.54  ? 307  ALA B CA  1 
ATOM   3469 C C   . ALA B 2 133 ? 19.738  58.278  68.922  1.00 30.99  ? 307  ALA B C   1 
ATOM   3470 O O   . ALA B 2 133 ? 20.518  57.324  69.012  1.00 34.50  ? 307  ALA B O   1 
ATOM   3471 C CB  . ALA B 2 133 ? 18.111  56.635  67.950  1.00 26.88  ? 307  ALA B CB  1 
ATOM   3472 N N   . ALA B 2 134 ? 20.029  59.490  69.366  1.00 28.58  ? 308  ALA B N   1 
ATOM   3473 C CA  . ALA B 2 134 ? 21.307  59.793  69.975  1.00 31.02  ? 308  ALA B CA  1 
ATOM   3474 C C   . ALA B 2 134 ? 21.376  59.467  71.465  1.00 31.34  ? 308  ALA B C   1 
ATOM   3475 O O   . ALA B 2 134 ? 20.405  59.617  72.199  1.00 32.79  ? 308  ALA B O   1 
ATOM   3476 C CB  . ALA B 2 134 ? 21.638  61.284  69.759  1.00 30.97  ? 308  ALA B CB  1 
ATOM   3477 N N   . PRO B 2 135 ? 22.544  59.011  71.931  1.00 31.23  ? 309  PRO B N   1 
ATOM   3478 C CA  . PRO B 2 135 ? 22.672  58.695  73.359  1.00 30.53  ? 309  PRO B CA  1 
ATOM   3479 C C   . PRO B 2 135 ? 22.760  60.030  74.085  1.00 31.05  ? 309  PRO B C   1 
ATOM   3480 O O   . PRO B 2 135 ? 23.238  61.002  73.510  1.00 33.96  ? 309  PRO B O   1 
ATOM   3481 C CB  . PRO B 2 135 ? 23.989  57.922  73.431  1.00 25.92  ? 309  PRO B CB  1 
ATOM   3482 C CG  . PRO B 2 135 ? 24.126  57.357  72.059  1.00 27.91  ? 309  PRO B CG  1 
ATOM   3483 C CD  . PRO B 2 135 ? 23.682  58.478  71.168  1.00 28.00  ? 309  PRO B CD  1 
ATOM   3484 N N   . THR B 2 136 ? 22.309  60.085  75.331  1.00 31.80  ? 310  THR B N   1 
ATOM   3485 C CA  . THR B 2 136 ? 22.352  61.324  76.116  1.00 33.09  ? 310  THR B CA  1 
ATOM   3486 C C   . THR B 2 136 ? 22.900  61.073  77.515  1.00 33.38  ? 310  THR B C   1 
ATOM   3487 O O   . THR B 2 136 ? 23.071  59.926  77.930  1.00 34.82  ? 310  THR B O   1 
ATOM   3488 C CB  . THR B 2 136 ? 20.942  61.938  76.299  1.00 34.11  ? 310  THR B CB  1 
ATOM   3489 O OG1 . THR B 2 136 ? 20.096  60.997  76.980  1.00 35.88  ? 310  THR B OG1 1 
ATOM   3490 C CG2 . THR B 2 136 ? 20.326  62.278  74.958  1.00 35.41  ? 310  THR B CG2 1 
ATOM   3491 N N   . VAL B 2 137 ? 23.159  62.152  78.245  1.00 33.31  ? 311  VAL B N   1 
ATOM   3492 C CA  . VAL B 2 137 ? 23.647  62.039  79.609  1.00 33.90  ? 311  VAL B CA  1 
ATOM   3493 C C   . VAL B 2 137 ? 22.563  61.383  80.446  1.00 34.41  ? 311  VAL B C   1 
ATOM   3494 O O   . VAL B 2 137 ? 22.845  60.678  81.417  1.00 35.15  ? 311  VAL B O   1 
ATOM   3495 C CB  . VAL B 2 137 ? 23.950  63.419  80.216  1.00 35.90  ? 311  VAL B CB  1 
ATOM   3496 C CG1 . VAL B 2 137 ? 24.334  63.266  81.695  1.00 34.43  ? 311  VAL B CG1 1 
ATOM   3497 C CG2 . VAL B 2 137 ? 25.076  64.091  79.426  1.00 33.93  ? 311  VAL B CG2 1 
ATOM   3498 N N   . ASN B 2 138 ? 21.316  61.617  80.051  1.00 34.77  ? 312  ASN B N   1 
ATOM   3499 C CA  . ASN B 2 138 ? 20.172  61.061  80.756  1.00 33.29  ? 312  ASN B CA  1 
ATOM   3500 C C   . ASN B 2 138 ? 20.142  59.536  80.628  1.00 31.72  ? 312  ASN B C   1 
ATOM   3501 O O   . ASN B 2 138 ? 19.877  58.836  81.601  1.00 30.92  ? 312  ASN B O   1 
ATOM   3502 C CB  . ASN B 2 138 ? 18.878  61.677  80.213  1.00 35.06  ? 312  ASN B CB  1 
ATOM   3503 C CG  . ASN B 2 138 ? 17.640  61.143  80.909  1.00 38.75  ? 312  ASN B CG  1 
ATOM   3504 O OD1 . ASN B 2 138 ? 17.411  61.411  82.092  1.00 41.70  ? 312  ASN B OD1 1 
ATOM   3505 N ND2 . ASN B 2 138 ? 16.840  60.372  80.179  1.00 36.94  ? 312  ASN B ND2 1 
ATOM   3506 N N   . GLN B 2 139 ? 20.416  59.021  79.435  1.00 30.81  ? 313  GLN B N   1 
ATOM   3507 C CA  . GLN B 2 139 ? 20.427  57.571  79.233  1.00 30.29  ? 313  GLN B CA  1 
ATOM   3508 C C   . GLN B 2 139 ? 21.502  56.870  80.070  1.00 31.49  ? 313  GLN B C   1 
ATOM   3509 O O   . GLN B 2 139 ? 21.308  55.739  80.514  1.00 33.02  ? 313  GLN B O   1 
ATOM   3510 C CB  . GLN B 2 139 ? 20.630  57.243  77.755  1.00 27.11  ? 313  GLN B CB  1 
ATOM   3511 C CG  . GLN B 2 139 ? 19.366  57.389  76.932  1.00 28.77  ? 313  GLN B CG  1 
ATOM   3512 C CD  . GLN B 2 139 ? 19.642  57.496  75.455  1.00 29.60  ? 313  GLN B CD  1 
ATOM   3513 O OE1 . GLN B 2 139 ? 20.144  56.559  74.835  1.00 30.84  ? 313  GLN B OE1 1 
ATOM   3514 N NE2 . GLN B 2 139 ? 19.329  58.651  74.879  1.00 30.41  ? 313  GLN B NE2 1 
ATOM   3515 N N   . PHE B 2 140 ? 22.632  57.538  80.294  1.00 32.61  ? 314  PHE B N   1 
ATOM   3516 C CA  . PHE B 2 140 ? 23.699  56.938  81.084  1.00 33.61  ? 314  PHE B CA  1 
ATOM   3517 C C   . PHE B 2 140 ? 23.401  57.036  82.578  1.00 35.71  ? 314  PHE B C   1 
ATOM   3518 O O   . PHE B 2 140 ? 23.524  56.033  83.301  1.00 37.06  ? 314  PHE B O   1 
ATOM   3519 C CB  . PHE B 2 140 ? 25.058  57.573  80.732  1.00 30.55  ? 314  PHE B CB  1 
ATOM   3520 C CG  . PHE B 2 140 ? 25.644  57.062  79.425  1.00 29.88  ? 314  PHE B CG  1 
ATOM   3521 C CD1 . PHE B 2 140 ? 26.088  55.731  79.309  1.00 27.85  ? 314  PHE B CD1 1 
ATOM   3522 C CD2 . PHE B 2 140 ? 25.681  57.871  78.291  1.00 27.43  ? 314  PHE B CD2 1 
ATOM   3523 C CE1 . PHE B 2 140 ? 26.546  55.218  78.084  1.00 20.39  ? 314  PHE B CE1 1 
ATOM   3524 C CE2 . PHE B 2 140 ? 26.140  57.359  77.066  1.00 26.19  ? 314  PHE B CE2 1 
ATOM   3525 C CZ  . PHE B 2 140 ? 26.570  56.027  76.969  1.00 19.54  ? 314  PHE B CZ  1 
ATOM   3526 N N   . LEU B 2 141 ? 22.977  58.217  83.034  1.00 34.25  ? 315  LEU B N   1 
ATOM   3527 C CA  . LEU B 2 141 ? 22.655  58.424  84.451  1.00 35.32  ? 315  LEU B CA  1 
ATOM   3528 C C   . LEU B 2 141 ? 21.660  57.387  84.947  1.00 37.03  ? 315  LEU B C   1 
ATOM   3529 O O   . LEU B 2 141 ? 21.829  56.788  86.009  1.00 38.86  ? 315  LEU B O   1 
ATOM   3530 C CB  . LEU B 2 141 ? 22.070  59.825  84.679  1.00 33.87  ? 315  LEU B CB  1 
ATOM   3531 C CG  . LEU B 2 141 ? 23.053  60.983  84.861  1.00 31.31  ? 315  LEU B CG  1 
ATOM   3532 C CD1 . LEU B 2 141 ? 22.284  62.283  85.018  1.00 31.65  ? 315  LEU B CD1 1 
ATOM   3533 C CD2 . LEU B 2 141 ? 23.921  60.729  86.080  1.00 29.81  ? 315  LEU B CD2 1 
ATOM   3534 N N   . THR B 2 142 ? 20.613  57.198  84.158  1.00 38.50  ? 316  THR B N   1 
ATOM   3535 C CA  . THR B 2 142 ? 19.559  56.244  84.449  1.00 38.42  ? 316  THR B CA  1 
ATOM   3536 C C   . THR B 2 142 ? 20.152  54.838  84.673  1.00 39.64  ? 316  THR B C   1 
ATOM   3537 O O   . THR B 2 142 ? 19.654  54.059  85.484  1.00 40.47  ? 316  THR B O   1 
ATOM   3538 C CB  . THR B 2 142 ? 18.518  56.287  83.277  1.00 38.09  ? 316  THR B CB  1 
ATOM   3539 O OG1 . THR B 2 142 ? 17.238  56.654  83.788  1.00 37.84  ? 316  THR B OG1 1 
ATOM   3540 C CG2 . THR B 2 142 ? 18.406  54.986  82.566  1.00 37.34  ? 316  THR B CG2 1 
ATOM   3541 N N   . GLN B 2 143 ? 21.233  54.524  83.969  1.00 40.40  ? 317  GLN B N   1 
ATOM   3542 C CA  . GLN B 2 143 ? 21.881  53.224  84.115  1.00 39.92  ? 317  GLN B CA  1 
ATOM   3543 C C   . GLN B 2 143 ? 22.783  53.157  85.343  1.00 40.13  ? 317  GLN B C   1 
ATOM   3544 O O   . GLN B 2 143 ? 22.856  52.132  86.021  1.00 39.86  ? 317  GLN B O   1 
ATOM   3545 C CB  . GLN B 2 143 ? 22.723  52.928  82.895  1.00 40.90  ? 317  GLN B CB  1 
ATOM   3546 C CG  . GLN B 2 143 ? 21.973  52.367  81.749  1.00 41.94  ? 317  GLN B CG  1 
ATOM   3547 C CD  . GLN B 2 143 ? 22.921  51.902  80.688  1.00 43.42  ? 317  GLN B CD  1 
ATOM   3548 O OE1 . GLN B 2 143 ? 23.271  52.659  79.789  1.00 44.98  ? 317  GLN B OE1 1 
ATOM   3549 N NE2 . GLN B 2 143 ? 23.373  50.651  80.800  1.00 45.45  ? 317  GLN B NE2 1 
ATOM   3550 N N   . TYR B 2 144 ? 23.485  54.253  85.611  1.00 39.55  ? 318  TYR B N   1 
ATOM   3551 C CA  . TYR B 2 144 ? 24.381  54.318  86.749  1.00 38.61  ? 318  TYR B CA  1 
ATOM   3552 C C   . TYR B 2 144 ? 23.565  54.201  88.036  1.00 40.11  ? 318  TYR B C   1 
ATOM   3553 O O   . TYR B 2 144 ? 24.058  53.716  89.058  1.00 42.98  ? 318  TYR B O   1 
ATOM   3554 C CB  . TYR B 2 144 ? 25.181  55.634  86.708  1.00 36.71  ? 318  TYR B CB  1 
ATOM   3555 C CG  . TYR B 2 144 ? 26.129  55.752  85.520  1.00 34.62  ? 318  TYR B CG  1 
ATOM   3556 C CD1 . TYR B 2 144 ? 26.270  54.704  84.605  1.00 33.03  ? 318  TYR B CD1 1 
ATOM   3557 C CD2 . TYR B 2 144 ? 26.894  56.903  85.318  1.00 32.88  ? 318  TYR B CD2 1 
ATOM   3558 C CE1 . TYR B 2 144 ? 27.143  54.791  83.522  1.00 31.81  ? 318  TYR B CE1 1 
ATOM   3559 C CE2 . TYR B 2 144 ? 27.780  57.003  84.231  1.00 32.47  ? 318  TYR B CE2 1 
ATOM   3560 C CZ  . TYR B 2 144 ? 27.901  55.940  83.333  1.00 33.24  ? 318  TYR B CZ  1 
ATOM   3561 O OH  . TYR B 2 144 ? 28.779  56.004  82.252  1.00 30.66  ? 318  TYR B OH  1 
ATOM   3562 N N   . PHE B 2 145 ? 22.306  54.626  87.978  1.00 39.43  ? 319  PHE B N   1 
ATOM   3563 C CA  . PHE B 2 145 ? 21.422  54.558  89.140  1.00 37.92  ? 319  PHE B CA  1 
ATOM   3564 C C   . PHE B 2 145 ? 21.179  53.133  89.639  1.00 38.33  ? 319  PHE B C   1 
ATOM   3565 O O   . PHE B 2 145 ? 21.025  52.913  90.835  1.00 38.06  ? 319  PHE B O   1 
ATOM   3566 C CB  . PHE B 2 145 ? 20.071  55.205  88.829  1.00 34.57  ? 319  PHE B CB  1 
ATOM   3567 C CG  . PHE B 2 145 ? 20.134  56.687  88.635  1.00 33.03  ? 319  PHE B CG  1 
ATOM   3568 C CD1 . PHE B 2 145 ? 21.281  57.403  88.964  1.00 31.07  ? 319  PHE B CD1 1 
ATOM   3569 C CD2 . PHE B 2 145 ? 19.028  57.381  88.151  1.00 31.01  ? 319  PHE B CD2 1 
ATOM   3570 C CE1 . PHE B 2 145 ? 21.322  58.780  88.815  1.00 29.50  ? 319  PHE B CE1 1 
ATOM   3571 C CE2 . PHE B 2 145 ? 19.063  58.761  88.001  1.00 28.59  ? 319  PHE B CE2 1 
ATOM   3572 C CZ  . PHE B 2 145 ? 20.209  59.461  88.333  1.00 27.84  ? 319  PHE B CZ  1 
ATOM   3573 N N   . LEU B 2 146 ? 21.135  52.162  88.731  1.00 38.64  ? 320  LEU B N   1 
ATOM   3574 C CA  . LEU B 2 146 ? 20.896  50.789  89.151  1.00 39.61  ? 320  LEU B CA  1 
ATOM   3575 C C   . LEU B 2 146 ? 22.010  50.265  90.037  1.00 42.00  ? 320  LEU B C   1 
ATOM   3576 O O   . LEU B 2 146 ? 21.868  49.227  90.668  1.00 41.75  ? 320  LEU B O   1 
ATOM   3577 C CB  . LEU B 2 146 ? 20.724  49.875  87.938  1.00 34.69  ? 320  LEU B CB  1 
ATOM   3578 C CG  . LEU B 2 146 ? 19.536  50.256  87.061  1.00 34.10  ? 320  LEU B CG  1 
ATOM   3579 C CD1 . LEU B 2 146 ? 19.493  49.369  85.827  1.00 32.27  ? 320  LEU B CD1 1 
ATOM   3580 C CD2 . LEU B 2 146 ? 18.254  50.146  87.869  1.00 30.75  ? 320  LEU B CD2 1 
ATOM   3581 N N   . HIS B 2 147 ? 23.119  50.990  90.092  1.00 46.82  ? 321  HIS B N   1 
ATOM   3582 C CA  . HIS B 2 147 ? 24.245  50.566  90.907  1.00 52.33  ? 321  HIS B CA  1 
ATOM   3583 C C   . HIS B 2 147 ? 24.236  51.177  92.299  1.00 56.95  ? 321  HIS B C   1 
ATOM   3584 O O   . HIS B 2 147 ? 25.259  51.203  92.986  1.00 58.62  ? 321  HIS B O   1 
ATOM   3585 C CB  . HIS B 2 147 ? 25.546  50.913  90.198  1.00 53.53  ? 321  HIS B CB  1 
ATOM   3586 C CG  . HIS B 2 147 ? 25.858  50.007  89.051  1.00 54.91  ? 321  HIS B CG  1 
ATOM   3587 N ND1 . HIS B 2 147 ? 26.729  48.945  89.160  1.00 52.82  ? 321  HIS B ND1 1 
ATOM   3588 C CD2 . HIS B 2 147 ? 25.383  49.980  87.783  1.00 54.79  ? 321  HIS B CD2 1 
ATOM   3589 C CE1 . HIS B 2 147 ? 26.779  48.303  88.007  1.00 54.87  ? 321  HIS B CE1 1 
ATOM   3590 N NE2 . HIS B 2 147 ? 25.971  48.911  87.155  1.00 55.12  ? 321  HIS B NE2 1 
ATOM   3591 N N   . GLN B 2 148 ? 23.075  51.656  92.724  1.00 60.67  ? 322  GLN B N   1 
ATOM   3592 C CA  . GLN B 2 148 ? 22.960  52.271  94.030  1.00 63.87  ? 322  GLN B CA  1 
ATOM   3593 C C   . GLN B 2 148 ? 22.312  51.318  95.018  1.00 66.87  ? 322  GLN B C   1 
ATOM   3594 O O   . GLN B 2 148 ? 21.217  50.796  94.777  1.00 67.43  ? 322  GLN B O   1 
ATOM   3595 C CB  . GLN B 2 148 ? 22.141  53.546  93.926  1.00 65.57  ? 322  GLN B CB  1 
ATOM   3596 C CG  . GLN B 2 148 ? 22.684  54.686  94.750  1.00 67.73  ? 322  GLN B CG  1 
ATOM   3597 C CD  . GLN B 2 148 ? 21.798  55.903  94.662  1.00 69.03  ? 322  GLN B CD  1 
ATOM   3598 O OE1 . GLN B 2 148 ? 22.005  56.890  95.372  1.00 70.45  ? 322  GLN B OE1 1 
ATOM   3599 N NE2 . GLN B 2 148 ? 20.797  55.842  93.783  1.00 68.14  ? 322  GLN B NE2 1 
ATOM   3600 N N   . GLN B 2 149 ? 22.998  51.103  96.136  1.00 68.58  ? 323  GLN B N   1 
ATOM   3601 C CA  . GLN B 2 149 ? 22.532  50.206  97.187  1.00 70.65  ? 323  GLN B CA  1 
ATOM   3602 C C   . GLN B 2 149 ? 22.268  50.964  98.494  1.00 70.39  ? 323  GLN B C   1 
ATOM   3603 O O   . GLN B 2 149 ? 23.192  51.257  99.254  1.00 72.21  ? 323  GLN B O   1 
ATOM   3604 C CB  . GLN B 2 149 ? 23.581  49.090  97.383  1.00 72.57  ? 323  GLN B CB  1 
ATOM   3605 C CG  . GLN B 2 149 ? 23.629  48.391  98.743  1.00 75.13  ? 323  GLN B CG  1 
ATOM   3606 C CD  . GLN B 2 149 ? 22.301  47.783  99.170  1.00 78.38  ? 323  GLN B CD  1 
ATOM   3607 O OE1 . GLN B 2 149 ? 21.477  47.397  98.333  1.00 78.70  ? 323  GLN B OE1 1 
ATOM   3608 N NE2 . GLN B 2 149 ? 22.095  47.679  100.485 1.00 79.30  ? 323  GLN B NE2 1 
ATOM   3609 N N   . PRO B 2 150 ? 21.001  51.336  98.748  1.00 69.39  ? 324  PRO B N   1 
ATOM   3610 C CA  . PRO B 2 150 ? 19.832  51.097  97.894  1.00 67.66  ? 324  PRO B CA  1 
ATOM   3611 C C   . PRO B 2 150 ? 19.498  52.393  97.156  1.00 65.33  ? 324  PRO B C   1 
ATOM   3612 O O   . PRO B 2 150 ? 20.147  53.421  97.376  1.00 63.37  ? 324  PRO B O   1 
ATOM   3613 C CB  . PRO B 2 150 ? 18.760  50.726  98.900  1.00 67.57  ? 324  PRO B CB  1 
ATOM   3614 C CG  . PRO B 2 150 ? 19.035  51.718  99.983  1.00 68.15  ? 324  PRO B CG  1 
ATOM   3615 C CD  . PRO B 2 150 ? 20.567  51.728  100.102 1.00 69.02  ? 324  PRO B CD  1 
ATOM   3616 N N   . ALA B 2 151 ? 18.491  52.346  96.293  1.00 62.68  ? 325  ALA B N   1 
ATOM   3617 C CA  . ALA B 2 151 ? 18.102  53.530  95.542  1.00 61.01  ? 325  ALA B CA  1 
ATOM   3618 C C   . ALA B 2 151 ? 18.090  54.763  96.453  1.00 59.58  ? 325  ALA B C   1 
ATOM   3619 O O   . ALA B 2 151 ? 17.831  54.664  97.650  1.00 58.92  ? 325  ALA B O   1 
ATOM   3620 C CB  . ALA B 2 151 ? 16.731  53.321  94.922  1.00 59.47  ? 325  ALA B CB  1 
ATOM   3621 N N   . ASN B 2 152 ? 18.409  55.923  95.901  1.00 58.35  ? 326  ASN B N   1 
ATOM   3622 C CA  . ASN B 2 152 ? 18.372  57.119  96.713  1.00 57.49  ? 326  ASN B CA  1 
ATOM   3623 C C   . ASN B 2 152 ? 17.815  58.306  95.975  1.00 57.16  ? 326  ASN B C   1 
ATOM   3624 O O   . ASN B 2 152 ? 18.531  59.049  95.304  1.00 55.92  ? 326  ASN B O   1 
ATOM   3625 C CB  . ASN B 2 152 ? 19.734  57.480  97.281  1.00 56.53  ? 326  ASN B CB  1 
ATOM   3626 C CG  . ASN B 2 152 ? 19.627  58.527  98.373  1.00 56.54  ? 326  ASN B CG  1 
ATOM   3627 O OD1 . ASN B 2 152 ? 19.216  59.663  98.127  1.00 58.12  ? 326  ASN B OD1 1 
ATOM   3628 N ND2 . ASN B 2 152 ? 19.975  58.143  99.594  1.00 56.32  ? 326  ASN B ND2 1 
ATOM   3629 N N   . CYS B 2 153 ? 16.507  58.446  96.130  1.00 58.10  ? 327  CYS B N   1 
ATOM   3630 C CA  . CYS B 2 153 ? 15.701  59.509  95.562  1.00 59.95  ? 327  CYS B CA  1 
ATOM   3631 C C   . CYS B 2 153 ? 16.469  60.814  95.386  1.00 57.28  ? 327  CYS B C   1 
ATOM   3632 O O   . CYS B 2 153 ? 16.474  61.404  94.309  1.00 56.49  ? 327  CYS B O   1 
ATOM   3633 C CB  . CYS B 2 153 ? 14.497  59.713  96.482  1.00 64.38  ? 327  CYS B CB  1 
ATOM   3634 S SG  . CYS B 2 153 ? 14.817  59.061  98.180  1.00 74.38  ? 327  CYS B SG  1 
ATOM   3635 N N   . LYS B 2 154 ? 17.129  61.264  96.443  1.00 56.18  ? 328  LYS B N   1 
ATOM   3636 C CA  . LYS B 2 154 ? 17.875  62.510  96.369  1.00 54.89  ? 328  LYS B CA  1 
ATOM   3637 C C   . LYS B 2 154 ? 19.111  62.443  95.478  1.00 52.64  ? 328  LYS B C   1 
ATOM   3638 O O   . LYS B 2 154 ? 19.405  63.386  94.738  1.00 51.62  ? 328  LYS B O   1 
ATOM   3639 C CB  . LYS B 2 154 ? 18.262  62.981  97.775  1.00 56.06  ? 328  LYS B CB  1 
ATOM   3640 C CG  . LYS B 2 154 ? 17.074  63.461  98.592  1.00 58.24  ? 328  LYS B CG  1 
ATOM   3641 C CD  . LYS B 2 154 ? 17.396  64.741  99.356  1.00 60.27  ? 328  LYS B CD  1 
ATOM   3642 C CE  . LYS B 2 154 ? 18.365  64.490  100.512 1.00 62.43  ? 328  LYS B CE  1 
ATOM   3643 N NZ  . LYS B 2 154 ? 17.740  63.692  101.623 1.00 63.65  ? 328  LYS B NZ  1 
ATOM   3644 N N   . VAL B 2 155 ? 19.845  61.340  95.544  1.00 49.68  ? 329  VAL B N   1 
ATOM   3645 C CA  . VAL B 2 155 ? 21.033  61.221  94.716  1.00 47.91  ? 329  VAL B CA  1 
ATOM   3646 C C   . VAL B 2 155 ? 20.636  61.303  93.241  1.00 46.62  ? 329  VAL B C   1 
ATOM   3647 O O   . VAL B 2 155 ? 21.222  62.074  92.483  1.00 48.02  ? 329  VAL B O   1 
ATOM   3648 C CB  . VAL B 2 155 ? 21.797  59.893  95.007  1.00 47.24  ? 329  VAL B CB  1 
ATOM   3649 C CG1 . VAL B 2 155 ? 22.840  59.624  93.932  1.00 46.17  ? 329  VAL B CG1 1 
ATOM   3650 C CG2 . VAL B 2 155 ? 22.485  59.983  96.359  1.00 44.60  ? 329  VAL B CG2 1 
ATOM   3651 N N   . GLU B 2 156 ? 19.626  60.533  92.845  1.00 44.00  ? 330  GLU B N   1 
ATOM   3652 C CA  . GLU B 2 156 ? 19.176  60.533  91.458  1.00 41.86  ? 330  GLU B CA  1 
ATOM   3653 C C   . GLU B 2 156 ? 18.848  61.974  91.054  1.00 41.86  ? 330  GLU B C   1 
ATOM   3654 O O   . GLU B 2 156 ? 19.485  62.551  90.170  1.00 42.65  ? 330  GLU B O   1 
ATOM   3655 C CB  . GLU B 2 156 ? 17.958  59.603  91.296  1.00 39.70  ? 330  GLU B CB  1 
ATOM   3656 C CG  . GLU B 2 156 ? 18.024  58.375  92.216  1.00 40.62  ? 330  GLU B CG  1 
ATOM   3657 C CD  . GLU B 2 156 ? 17.340  57.115  91.679  1.00 43.62  ? 330  GLU B CD  1 
ATOM   3658 O OE1 . GLU B 2 156 ? 16.180  57.179  91.215  1.00 44.48  ? 330  GLU B OE1 1 
ATOM   3659 O OE2 . GLU B 2 156 ? 17.969  56.033  91.748  1.00 46.02  ? 330  GLU B OE2 1 
ATOM   3660 N N   . SER B 2 157 ? 17.879  62.576  91.723  1.00 41.76  ? 331  SER B N   1 
ATOM   3661 C CA  . SER B 2 157 ? 17.516  63.949  91.412  1.00 39.56  ? 331  SER B CA  1 
ATOM   3662 C C   . SER B 2 157 ? 18.693  64.912  91.357  1.00 38.14  ? 331  SER B C   1 
ATOM   3663 O O   . SER B 2 157 ? 18.716  65.808  90.523  1.00 38.06  ? 331  SER B O   1 
ATOM   3664 C CB  . SER B 2 157 ? 16.489  64.456  92.415  1.00 38.79  ? 331  SER B CB  1 
ATOM   3665 O OG  . SER B 2 157 ? 15.238  63.831  92.199  1.00 41.74  ? 331  SER B OG  1 
ATOM   3666 N N   . LEU B 2 158 ? 19.681  64.752  92.227  1.00 39.62  ? 332  LEU B N   1 
ATOM   3667 C CA  . LEU B 2 158 ? 20.806  65.693  92.187  1.00 40.37  ? 332  LEU B CA  1 
ATOM   3668 C C   . LEU B 2 158 ? 21.669  65.423  90.971  1.00 39.36  ? 332  LEU B C   1 
ATOM   3669 O O   . LEU B 2 158 ? 22.181  66.356  90.346  1.00 39.70  ? 332  LEU B O   1 
ATOM   3670 C CB  . LEU B 2 158 ? 21.665  65.617  93.457  1.00 40.71  ? 332  LEU B CB  1 
ATOM   3671 C CG  . LEU B 2 158 ? 22.718  66.735  93.564  1.00 42.25  ? 332  LEU B CG  1 
ATOM   3672 C CD1 . LEU B 2 158 ? 22.038  68.104  93.549  1.00 37.10  ? 332  LEU B CD1 1 
ATOM   3673 C CD2 . LEU B 2 158 ? 23.544  66.556  94.828  1.00 40.51  ? 332  LEU B CD2 1 
ATOM   3674 N N   . ALA B 2 159 ? 21.818  64.146  90.637  1.00 37.87  ? 333  ALA B N   1 
ATOM   3675 C CA  . ALA B 2 159 ? 22.606  63.750  89.477  1.00 38.68  ? 333  ALA B CA  1 
ATOM   3676 C C   . ALA B 2 159 ? 21.968  64.318  88.213  1.00 38.93  ? 333  ALA B C   1 
ATOM   3677 O O   . ALA B 2 159 ? 22.660  64.816  87.328  1.00 39.69  ? 333  ALA B O   1 
ATOM   3678 C CB  . ALA B 2 159 ? 22.688  62.220  89.384  1.00 38.53  ? 333  ALA B CB  1 
ATOM   3679 N N   . MET B 2 160 ? 20.647  64.234  88.126  1.00 38.88  ? 334  MET B N   1 
ATOM   3680 C CA  . MET B 2 160 ? 19.952  64.757  86.966  1.00 41.04  ? 334  MET B CA  1 
ATOM   3681 C C   . MET B 2 160 ? 20.121  66.264  86.916  1.00 41.74  ? 334  MET B C   1 
ATOM   3682 O O   . MET B 2 160 ? 20.372  66.830  85.855  1.00 43.56  ? 334  MET B O   1 
ATOM   3683 C CB  . MET B 2 160 ? 18.473  64.400  87.028  1.00 42.09  ? 334  MET B CB  1 
ATOM   3684 C CG  . MET B 2 160 ? 18.191  62.941  86.761  1.00 45.61  ? 334  MET B CG  1 
ATOM   3685 S SD  . MET B 2 160 ? 16.469  62.560  87.098  1.00 55.22  ? 334  MET B SD  1 
ATOM   3686 C CE  . MET B 2 160 ? 15.687  63.190  85.607  1.00 50.61  ? 334  MET B CE  1 
ATOM   3687 N N   . PHE B 2 161 ? 19.983  66.910  88.068  1.00 41.46  ? 335  PHE B N   1 
ATOM   3688 C CA  . PHE B 2 161 ? 20.139  68.353  88.157  1.00 42.01  ? 335  PHE B CA  1 
ATOM   3689 C C   . PHE B 2 161 ? 21.501  68.780  87.610  1.00 42.82  ? 335  PHE B C   1 
ATOM   3690 O O   . PHE B 2 161 ? 21.590  69.686  86.772  1.00 44.58  ? 335  PHE B O   1 
ATOM   3691 C CB  . PHE B 2 161 ? 19.988  68.792  89.613  1.00 43.70  ? 335  PHE B CB  1 
ATOM   3692 C CG  . PHE B 2 161 ? 20.407  70.208  89.871  1.00 43.98  ? 335  PHE B CG  1 
ATOM   3693 C CD1 . PHE B 2 161 ? 19.813  71.264  89.188  1.00 42.91  ? 335  PHE B CD1 1 
ATOM   3694 C CD2 . PHE B 2 161 ? 21.405  70.485  90.804  1.00 45.47  ? 335  PHE B CD2 1 
ATOM   3695 C CE1 . PHE B 2 161 ? 20.208  72.583  89.428  1.00 44.41  ? 335  PHE B CE1 1 
ATOM   3696 C CE2 . PHE B 2 161 ? 21.814  71.809  91.055  1.00 46.92  ? 335  PHE B CE2 1 
ATOM   3697 C CZ  . PHE B 2 161 ? 21.212  72.859  90.364  1.00 45.55  ? 335  PHE B CZ  1 
ATOM   3698 N N   . LEU B 2 162 ? 22.562  68.128  88.077  1.00 40.32  ? 336  LEU B N   1 
ATOM   3699 C CA  . LEU B 2 162 ? 23.903  68.459  87.612  1.00 39.96  ? 336  LEU B CA  1 
ATOM   3700 C C   . LEU B 2 162 ? 24.060  68.166  86.119  1.00 39.77  ? 336  LEU B C   1 
ATOM   3701 O O   . LEU B 2 162 ? 24.627  68.972  85.380  1.00 41.78  ? 336  LEU B O   1 
ATOM   3702 C CB  . LEU B 2 162 ? 24.959  67.683  88.414  1.00 38.90  ? 336  LEU B CB  1 
ATOM   3703 C CG  . LEU B 2 162 ? 25.048  67.929  89.928  1.00 37.58  ? 336  LEU B CG  1 
ATOM   3704 C CD1 . LEU B 2 162 ? 26.050  66.955  90.536  1.00 36.50  ? 336  LEU B CD1 1 
ATOM   3705 C CD2 . LEU B 2 162 ? 25.462  69.381  90.209  1.00 35.84  ? 336  LEU B CD2 1 
ATOM   3706 N N   . GLY B 2 163 ? 23.566  67.015  85.676  1.00 38.11  ? 337  GLY B N   1 
ATOM   3707 C CA  . GLY B 2 163 ? 23.661  66.684  84.268  1.00 37.11  ? 337  GLY B CA  1 
ATOM   3708 C C   . GLY B 2 163 ? 23.024  67.782  83.432  1.00 38.58  ? 337  GLY B C   1 
ATOM   3709 O O   . GLY B 2 163 ? 23.580  68.199  82.419  1.00 37.19  ? 337  GLY B O   1 
ATOM   3710 N N   . GLU B 2 164 ? 21.858  68.260  83.859  1.00 39.00  ? 338  GLU B N   1 
ATOM   3711 C CA  . GLU B 2 164 ? 21.164  69.320  83.136  1.00 40.48  ? 338  GLU B CA  1 
ATOM   3712 C C   . GLU B 2 164 ? 21.940  70.627  83.140  1.00 40.18  ? 338  GLU B C   1 
ATOM   3713 O O   . GLU B 2 164 ? 21.906  71.381  82.165  1.00 39.37  ? 338  GLU B O   1 
ATOM   3714 C CB  . GLU B 2 164 ? 19.764  69.554  83.717  1.00 42.88  ? 338  GLU B CB  1 
ATOM   3715 C CG  . GLU B 2 164 ? 18.662  68.872  82.911  1.00 45.49  ? 338  GLU B CG  1 
ATOM   3716 C CD  . GLU B 2 164 ? 17.268  69.170  83.422  1.00 45.23  ? 338  GLU B CD  1 
ATOM   3717 O OE1 . GLU B 2 164 ? 16.884  70.359  83.466  1.00 44.59  ? 338  GLU B OE1 1 
ATOM   3718 O OE2 . GLU B 2 164 ? 16.555  68.205  83.768  1.00 45.44  ? 338  GLU B OE2 1 
ATOM   3719 N N   . LEU B 2 165 ? 22.642  70.912  84.228  1.00 39.33  ? 339  LEU B N   1 
ATOM   3720 C CA  . LEU B 2 165 ? 23.403  72.143  84.253  1.00 38.93  ? 339  LEU B CA  1 
ATOM   3721 C C   . LEU B 2 165 ? 24.431  72.144  83.120  1.00 37.56  ? 339  LEU B C   1 
ATOM   3722 O O   . LEU B 2 165 ? 24.721  73.189  82.539  1.00 37.73  ? 339  LEU B O   1 
ATOM   3723 C CB  . LEU B 2 165 ? 24.092  72.345  85.612  1.00 38.35  ? 339  LEU B CB  1 
ATOM   3724 C CG  . LEU B 2 165 ? 23.189  72.795  86.770  1.00 39.53  ? 339  LEU B CG  1 
ATOM   3725 C CD1 . LEU B 2 165 ? 24.046  73.029  88.001  1.00 37.83  ? 339  LEU B CD1 1 
ATOM   3726 C CD2 . LEU B 2 165 ? 22.421  74.078  86.396  1.00 36.57  ? 339  LEU B CD2 1 
ATOM   3727 N N   . SER B 2 166 ? 24.957  70.975  82.777  1.00 35.67  ? 340  SER B N   1 
ATOM   3728 C CA  . SER B 2 166 ? 25.955  70.918  81.722  1.00 35.71  ? 340  SER B CA  1 
ATOM   3729 C C   . SER B 2 166 ? 25.411  71.246  80.324  1.00 37.90  ? 340  SER B C   1 
ATOM   3730 O O   . SER B 2 166 ? 26.176  71.629  79.437  1.00 39.87  ? 340  SER B O   1 
ATOM   3731 C CB  . SER B 2 166 ? 26.634  69.549  81.710  1.00 33.10  ? 340  SER B CB  1 
ATOM   3732 O OG  . SER B 2 166 ? 25.992  68.669  80.808  1.00 34.01  ? 340  SER B OG  1 
ATOM   3733 N N   . LEU B 2 167 ? 24.103  71.108  80.113  1.00 38.92  ? 341  LEU B N   1 
ATOM   3734 C CA  . LEU B 2 167 ? 23.530  71.409  78.802  1.00 38.29  ? 341  LEU B CA  1 
ATOM   3735 C C   . LEU B 2 167 ? 23.698  72.894  78.482  1.00 40.56  ? 341  LEU B C   1 
ATOM   3736 O O   . LEU B 2 167 ? 23.911  73.280  77.333  1.00 42.32  ? 341  LEU B O   1 
ATOM   3737 C CB  . LEU B 2 167 ? 22.037  71.081  78.760  1.00 36.26  ? 341  LEU B CB  1 
ATOM   3738 C CG  . LEU B 2 167 ? 21.494  69.711  79.153  1.00 37.11  ? 341  LEU B CG  1 
ATOM   3739 C CD1 . LEU B 2 167 ? 20.003  69.684  78.893  1.00 35.78  ? 341  LEU B CD1 1 
ATOM   3740 C CD2 . LEU B 2 167 ? 22.175  68.623  78.365  1.00 38.48  ? 341  LEU B CD2 1 
ATOM   3741 N N   . ILE B 2 168 ? 23.619  73.724  79.514  1.00 41.37  ? 342  ILE B N   1 
ATOM   3742 C CA  . ILE B 2 168 ? 23.712  75.167  79.354  1.00 42.29  ? 342  ILE B CA  1 
ATOM   3743 C C   . ILE B 2 168 ? 25.045  75.766  78.900  1.00 43.17  ? 342  ILE B C   1 
ATOM   3744 O O   . ILE B 2 168 ? 25.051  76.745  78.161  1.00 46.03  ? 342  ILE B O   1 
ATOM   3745 C CB  . ILE B 2 168 ? 23.285  75.877  80.663  1.00 42.86  ? 342  ILE B CB  1 
ATOM   3746 C CG1 . ILE B 2 168 ? 21.842  75.503  81.023  1.00 39.67  ? 342  ILE B CG1 1 
ATOM   3747 C CG2 . ILE B 2 168 ? 23.421  77.392  80.508  1.00 45.02  ? 342  ILE B CG2 1 
ATOM   3748 C CD1 . ILE B 2 168 ? 20.796  75.966  80.023  1.00 38.34  ? 342  ILE B CD1 1 
ATOM   3749 N N   . ASP B 2 169 ? 26.169  75.196  79.313  1.00 43.01  ? 343  ASP B N   1 
ATOM   3750 C CA  . ASP B 2 169 ? 27.464  75.768  78.944  1.00 43.06  ? 343  ASP B CA  1 
ATOM   3751 C C   . ASP B 2 169 ? 28.337  74.948  77.986  1.00 43.62  ? 343  ASP B C   1 
ATOM   3752 O O   . ASP B 2 169 ? 29.132  74.110  78.432  1.00 42.79  ? 343  ASP B O   1 
ATOM   3753 C CB  . ASP B 2 169 ? 28.259  76.052  80.224  1.00 45.00  ? 343  ASP B CB  1 
ATOM   3754 C CG  . ASP B 2 169 ? 27.455  76.839  81.251  1.00 48.54  ? 343  ASP B CG  1 
ATOM   3755 O OD1 . ASP B 2 169 ? 27.065  77.986  80.934  1.00 50.08  ? 343  ASP B OD1 1 
ATOM   3756 O OD2 . ASP B 2 169 ? 27.212  76.315  82.367  1.00 47.17  ? 343  ASP B OD2 1 
ATOM   3757 N N   . ALA B 2 170 ? 28.212  75.201  76.682  1.00 42.96  ? 344  ALA B N   1 
ATOM   3758 C CA  . ALA B 2 170 ? 29.014  74.485  75.684  1.00 44.05  ? 344  ALA B CA  1 
ATOM   3759 C C   . ALA B 2 170 ? 30.477  74.429  76.136  1.00 46.80  ? 344  ALA B C   1 
ATOM   3760 O O   . ALA B 2 170 ? 31.167  73.423  75.955  1.00 48.08  ? 344  ALA B O   1 
ATOM   3761 C CB  . ALA B 2 170 ? 28.906  75.172  74.332  1.00 43.83  ? 344  ALA B CB  1 
ATOM   3762 N N   . ASP B 2 171 ? 30.948  75.525  76.715  1.00 48.89  ? 345  ASP B N   1 
ATOM   3763 C CA  . ASP B 2 171 ? 32.303  75.600  77.243  1.00 50.02  ? 345  ASP B CA  1 
ATOM   3764 C C   . ASP B 2 171 ? 32.080  75.492  78.749  1.00 50.15  ? 345  ASP B C   1 
ATOM   3765 O O   . ASP B 2 171 ? 31.417  76.341  79.340  1.00 51.26  ? 345  ASP B O   1 
ATOM   3766 C CB  . ASP B 2 171 ? 32.936  76.953  76.922  1.00 52.12  ? 345  ASP B CB  1 
ATOM   3767 C CG  . ASP B 2 171 ? 34.440  76.961  77.141  1.00 56.41  ? 345  ASP B CG  1 
ATOM   3768 O OD1 . ASP B 2 171 ? 34.910  76.415  78.168  1.00 57.85  ? 345  ASP B OD1 1 
ATOM   3769 O OD2 . ASP B 2 171 ? 35.155  77.524  76.282  1.00 58.40  ? 345  ASP B OD2 1 
ATOM   3770 N N   . PRO B 2 172 ? 32.681  74.489  79.402  1.00 49.45  ? 346  PRO B N   1 
ATOM   3771 C CA  . PRO B 2 172 ? 33.559  73.460  78.844  1.00 49.80  ? 346  PRO B CA  1 
ATOM   3772 C C   . PRO B 2 172 ? 32.928  72.128  78.432  1.00 49.62  ? 346  PRO B C   1 
ATOM   3773 O O   . PRO B 2 172 ? 33.592  71.309  77.807  1.00 51.71  ? 346  PRO B O   1 
ATOM   3774 C CB  . PRO B 2 172 ? 34.546  73.248  79.975  1.00 49.25  ? 346  PRO B CB  1 
ATOM   3775 C CG  . PRO B 2 172 ? 33.607  73.240  81.164  1.00 48.02  ? 346  PRO B CG  1 
ATOM   3776 C CD  . PRO B 2 172 ? 32.668  74.411  80.877  1.00 47.54  ? 346  PRO B CD  1 
ATOM   3777 N N   . TYR B 2 173 ? 31.658  71.914  78.750  1.00 48.47  ? 347  TYR B N   1 
ATOM   3778 C CA  . TYR B 2 173 ? 31.018  70.624  78.491  1.00 47.78  ? 347  TYR B CA  1 
ATOM   3779 C C   . TYR B 2 173 ? 30.943  69.967  77.115  1.00 47.18  ? 347  TYR B C   1 
ATOM   3780 O O   . TYR B 2 173 ? 30.689  68.772  77.032  1.00 47.62  ? 347  TYR B O   1 
ATOM   3781 C CB  . TYR B 2 173 ? 29.647  70.635  79.165  1.00 46.33  ? 347  TYR B CB  1 
ATOM   3782 C CG  . TYR B 2 173 ? 29.827  70.929  80.630  1.00 45.62  ? 347  TYR B CG  1 
ATOM   3783 C CD1 . TYR B 2 173 ? 30.492  70.026  81.456  1.00 44.09  ? 347  TYR B CD1 1 
ATOM   3784 C CD2 . TYR B 2 173 ? 29.461  72.167  81.163  1.00 45.91  ? 347  TYR B CD2 1 
ATOM   3785 C CE1 . TYR B 2 173 ? 30.801  70.344  82.770  1.00 45.31  ? 347  TYR B CE1 1 
ATOM   3786 C CE2 . TYR B 2 173 ? 29.765  72.503  82.478  1.00 45.63  ? 347  TYR B CE2 1 
ATOM   3787 C CZ  . TYR B 2 173 ? 30.438  71.587  83.280  1.00 46.40  ? 347  TYR B CZ  1 
ATOM   3788 O OH  . TYR B 2 173 ? 30.751  71.913  84.585  1.00 43.96  ? 347  TYR B OH  1 
ATOM   3789 N N   . LEU B 2 174 ? 31.180  70.700  76.037  1.00 47.09  ? 348  LEU B N   1 
ATOM   3790 C CA  . LEU B 2 174 ? 31.134  70.063  74.725  1.00 46.07  ? 348  LEU B CA  1 
ATOM   3791 C C   . LEU B 2 174 ? 32.389  69.218  74.497  1.00 46.23  ? 348  LEU B C   1 
ATOM   3792 O O   . LEU B 2 174 ? 32.502  68.533  73.489  1.00 47.24  ? 348  LEU B O   1 
ATOM   3793 C CB  . LEU B 2 174 ? 31.036  71.115  73.624  1.00 46.84  ? 348  LEU B CB  1 
ATOM   3794 C CG  . LEU B 2 174 ? 29.872  71.003  72.641  1.00 46.53  ? 348  LEU B CG  1 
ATOM   3795 C CD1 . LEU B 2 174 ? 28.562  71.022  73.383  1.00 43.62  ? 348  LEU B CD1 1 
ATOM   3796 C CD2 . LEU B 2 174 ? 29.945  72.168  71.669  1.00 47.49  ? 348  LEU B CD2 1 
ATOM   3797 N N   . LYS B 2 175 ? 33.330  69.256  75.432  1.00 44.71  ? 349  LYS B N   1 
ATOM   3798 C CA  . LYS B 2 175 ? 34.560  68.495  75.263  1.00 44.59  ? 349  LYS B CA  1 
ATOM   3799 C C   . LYS B 2 175 ? 34.574  67.182  76.039  1.00 42.95  ? 349  LYS B C   1 
ATOM   3800 O O   . LYS B 2 175 ? 35.610  66.525  76.137  1.00 42.34  ? 349  LYS B O   1 
ATOM   3801 C CB  . LYS B 2 175 ? 35.779  69.366  75.631  1.00 44.59  ? 349  LYS B CB  1 
ATOM   3802 C CG  . LYS B 2 175 ? 35.932  69.714  77.096  1.00 46.78  ? 349  LYS B CG  1 
ATOM   3803 C CD  . LYS B 2 175 ? 37.003  70.789  77.316  1.00 49.42  ? 349  LYS B CD  1 
ATOM   3804 C CE  . LYS B 2 175 ? 37.279  70.972  78.822  1.00 55.08  ? 349  LYS B CE  1 
ATOM   3805 N NZ  . LYS B 2 175 ? 37.968  72.257  79.207  1.00 55.11  ? 349  LYS B NZ  1 
ATOM   3806 N N   . TYR B 2 176 ? 33.415  66.811  76.578  1.00 41.58  ? 350  TYR B N   1 
ATOM   3807 C CA  . TYR B 2 176 ? 33.242  65.569  77.339  1.00 40.32  ? 350  TYR B CA  1 
ATOM   3808 C C   . TYR B 2 176 ? 32.132  64.748  76.693  1.00 38.91  ? 350  TYR B C   1 
ATOM   3809 O O   . TYR B 2 176 ? 31.165  65.314  76.167  1.00 39.24  ? 350  TYR B O   1 
ATOM   3810 C CB  . TYR B 2 176 ? 32.823  65.860  78.790  1.00 40.71  ? 350  TYR B CB  1 
ATOM   3811 C CG  . TYR B 2 176 ? 33.854  66.598  79.603  1.00 42.85  ? 350  TYR B CG  1 
ATOM   3812 C CD1 . TYR B 2 176 ? 35.063  65.992  79.943  1.00 42.81  ? 350  TYR B CD1 1 
ATOM   3813 C CD2 . TYR B 2 176 ? 33.641  67.921  79.997  1.00 44.54  ? 350  TYR B CD2 1 
ATOM   3814 C CE1 . TYR B 2 176 ? 36.039  66.680  80.651  1.00 43.68  ? 350  TYR B CE1 1 
ATOM   3815 C CE2 . TYR B 2 176 ? 34.616  68.626  80.705  1.00 45.98  ? 350  TYR B CE2 1 
ATOM   3816 C CZ  . TYR B 2 176 ? 35.811  67.997  81.026  1.00 46.62  ? 350  TYR B CZ  1 
ATOM   3817 O OH  . TYR B 2 176 ? 36.785  68.683  81.705  1.00 46.60  ? 350  TYR B OH  1 
ATOM   3818 N N   . LEU B 2 177 ? 32.267  63.424  76.723  1.00 35.27  ? 351  LEU B N   1 
ATOM   3819 C CA  . LEU B 2 177 ? 31.223  62.568  76.170  1.00 32.25  ? 351  LEU B CA  1 
ATOM   3820 C C   . LEU B 2 177 ? 30.126  62.474  77.227  1.00 32.37  ? 351  LEU B C   1 
ATOM   3821 O O   . LEU B 2 177 ? 30.397  62.565  78.438  1.00 31.42  ? 351  LEU B O   1 
ATOM   3822 C CB  . LEU B 2 177 ? 31.755  61.171  75.845  1.00 30.01  ? 351  LEU B CB  1 
ATOM   3823 C CG  . LEU B 2 177 ? 32.563  60.996  74.557  1.00 29.98  ? 351  LEU B CG  1 
ATOM   3824 C CD1 . LEU B 2 177 ? 33.032  59.558  74.471  1.00 27.94  ? 351  LEU B CD1 1 
ATOM   3825 C CD2 . LEU B 2 177 ? 31.727  61.349  73.340  1.00 26.49  ? 351  LEU B CD2 1 
ATOM   3826 N N   . PRO B 2 178 ? 28.869  62.301  76.788  1.00 30.85  ? 352  PRO B N   1 
ATOM   3827 C CA  . PRO B 2 178 ? 27.749  62.204  77.725  1.00 30.28  ? 352  PRO B CA  1 
ATOM   3828 C C   . PRO B 2 178 ? 27.897  61.168  78.830  1.00 31.56  ? 352  PRO B C   1 
ATOM   3829 O O   . PRO B 2 178 ? 27.463  61.406  79.957  1.00 32.20  ? 352  PRO B O   1 
ATOM   3830 C CB  . PRO B 2 178 ? 26.542  61.950  76.813  1.00 30.91  ? 352  PRO B CB  1 
ATOM   3831 C CG  . PRO B 2 178 ? 27.123  61.493  75.523  1.00 31.42  ? 352  PRO B CG  1 
ATOM   3832 C CD  . PRO B 2 178 ? 28.396  62.279  75.397  1.00 29.84  ? 352  PRO B CD  1 
ATOM   3833 N N   . SER B 2 179 ? 28.519  60.032  78.520  1.00 32.38  ? 353  SER B N   1 
ATOM   3834 C CA  . SER B 2 179 ? 28.714  58.985  79.515  1.00 32.14  ? 353  SER B CA  1 
ATOM   3835 C C   . SER B 2 179 ? 29.653  59.457  80.625  1.00 32.81  ? 353  SER B C   1 
ATOM   3836 O O   . SER B 2 179 ? 29.532  59.042  81.780  1.00 32.47  ? 353  SER B O   1 
ATOM   3837 C CB  . SER B 2 179 ? 29.281  57.726  78.853  1.00 34.94  ? 353  SER B CB  1 
ATOM   3838 O OG  . SER B 2 179 ? 30.547  57.968  78.264  1.00 35.95  ? 353  SER B OG  1 
ATOM   3839 N N   . VAL B 2 180 ? 30.589  60.334  80.271  1.00 33.68  ? 354  VAL B N   1 
ATOM   3840 C CA  . VAL B 2 180 ? 31.538  60.865  81.244  1.00 33.57  ? 354  VAL B CA  1 
ATOM   3841 C C   . VAL B 2 180 ? 30.908  61.939  82.123  1.00 33.54  ? 354  VAL B C   1 
ATOM   3842 O O   . VAL B 2 180 ? 31.067  61.909  83.343  1.00 35.81  ? 354  VAL B O   1 
ATOM   3843 C CB  . VAL B 2 180 ? 32.793  61.408  80.540  1.00 34.72  ? 354  VAL B CB  1 
ATOM   3844 C CG1 . VAL B 2 180 ? 33.636  62.227  81.511  1.00 32.81  ? 354  VAL B CG1 1 
ATOM   3845 C CG2 . VAL B 2 180 ? 33.605  60.227  79.991  1.00 29.93  ? 354  VAL B CG2 1 
ATOM   3846 N N   . ILE B 2 181 ? 30.194  62.885  81.522  1.00 33.56  ? 355  ILE B N   1 
ATOM   3847 C CA  . ILE B 2 181 ? 29.506  63.915  82.313  1.00 33.71  ? 355  ILE B CA  1 
ATOM   3848 C C   . ILE B 2 181 ? 28.585  63.203  83.321  1.00 34.94  ? 355  ILE B C   1 
ATOM   3849 O O   . ILE B 2 181 ? 28.448  63.609  84.480  1.00 34.35  ? 355  ILE B O   1 
ATOM   3850 C CB  . ILE B 2 181 ? 28.627  64.809  81.423  1.00 32.27  ? 355  ILE B CB  1 
ATOM   3851 C CG1 . ILE B 2 181 ? 29.510  65.648  80.495  1.00 30.91  ? 355  ILE B CG1 1 
ATOM   3852 C CG2 . ILE B 2 181 ? 27.704  65.666  82.299  1.00 29.08  ? 355  ILE B CG2 1 
ATOM   3853 C CD1 . ILE B 2 181 ? 28.745  66.275  79.342  1.00 28.99  ? 355  ILE B CD1 1 
ATOM   3854 N N   . ALA B 2 182 ? 27.956  62.133  82.850  1.00 34.56  ? 356  ALA B N   1 
ATOM   3855 C CA  . ALA B 2 182 ? 27.058  61.335  83.670  1.00 36.33  ? 356  ALA B CA  1 
ATOM   3856 C C   . ALA B 2 182 ? 27.769  60.744  84.885  1.00 36.87  ? 356  ALA B C   1 
ATOM   3857 O O   . ALA B 2 182 ? 27.202  60.696  85.974  1.00 39.17  ? 356  ALA B O   1 
ATOM   3858 C CB  . ALA B 2 182 ? 26.446  60.210  82.826  1.00 35.61  ? 356  ALA B CB  1 
ATOM   3859 N N   . GLY B 2 183 ? 29.005  60.283  84.694  1.00 37.20  ? 357  GLY B N   1 
ATOM   3860 C CA  . GLY B 2 183 ? 29.755  59.706  85.795  1.00 34.17  ? 357  GLY B CA  1 
ATOM   3861 C C   . GLY B 2 183 ? 30.112  60.761  86.816  1.00 34.55  ? 357  GLY B C   1 
ATOM   3862 O O   . GLY B 2 183 ? 29.974  60.557  88.027  1.00 33.21  ? 357  GLY B O   1 
ATOM   3863 N N   . ALA B 2 184 ? 30.571  61.906  86.323  1.00 35.17  ? 358  ALA B N   1 
ATOM   3864 C CA  . ALA B 2 184 ? 30.940  62.993  87.210  1.00 35.51  ? 358  ALA B CA  1 
ATOM   3865 C C   . ALA B 2 184 ? 29.722  63.443  88.004  1.00 35.03  ? 358  ALA B C   1 
ATOM   3866 O O   . ALA B 2 184 ? 29.796  63.595  89.218  1.00 35.30  ? 358  ALA B O   1 
ATOM   3867 C CB  . ALA B 2 184 ? 31.510  64.156  86.413  1.00 35.81  ? 358  ALA B CB  1 
ATOM   3868 N N   . ALA B 2 185 ? 28.602  63.642  87.316  1.00 35.09  ? 359  ALA B N   1 
ATOM   3869 C CA  . ALA B 2 185 ? 27.371  64.088  87.968  1.00 35.95  ? 359  ALA B CA  1 
ATOM   3870 C C   . ALA B 2 185 ? 26.842  63.087  88.995  1.00 36.60  ? 359  ALA B C   1 
ATOM   3871 O O   . ALA B 2 185 ? 26.334  63.479  90.042  1.00 37.73  ? 359  ALA B O   1 
ATOM   3872 C CB  . ALA B 2 185 ? 26.302  64.389  86.921  1.00 34.63  ? 359  ALA B CB  1 
ATOM   3873 N N   . PHE B 2 186 ? 26.965  61.796  88.706  1.00 37.67  ? 360  PHE B N   1 
ATOM   3874 C CA  . PHE B 2 186 ? 26.501  60.778  89.641  1.00 38.78  ? 360  PHE B CA  1 
ATOM   3875 C C   . PHE B 2 186 ? 27.380  60.732  90.882  1.00 40.33  ? 360  PHE B C   1 
ATOM   3876 O O   . PHE B 2 186 ? 26.879  60.635  91.999  1.00 39.19  ? 360  PHE B O   1 
ATOM   3877 C CB  . PHE B 2 186 ? 26.498  59.404  88.986  1.00 38.85  ? 360  PHE B CB  1 
ATOM   3878 C CG  . PHE B 2 186 ? 25.931  58.328  89.857  1.00 40.09  ? 360  PHE B CG  1 
ATOM   3879 C CD1 . PHE B 2 186 ? 24.676  58.481  90.441  1.00 40.99  ? 360  PHE B CD1 1 
ATOM   3880 C CD2 . PHE B 2 186 ? 26.626  57.145  90.066  1.00 39.40  ? 360  PHE B CD2 1 
ATOM   3881 C CE1 . PHE B 2 186 ? 24.123  57.467  91.219  1.00 40.25  ? 360  PHE B CE1 1 
ATOM   3882 C CE2 . PHE B 2 186 ? 26.079  56.127  90.841  1.00 39.96  ? 360  PHE B CE2 1 
ATOM   3883 C CZ  . PHE B 2 186 ? 24.826  56.288  91.416  1.00 39.51  ? 360  PHE B CZ  1 
ATOM   3884 N N   . HIS B 2 187 ? 28.693  60.793  90.684  1.00 41.25  ? 361  HIS B N   1 
ATOM   3885 C CA  . HIS B 2 187 ? 29.613  60.770  91.812  1.00 43.24  ? 361  HIS B CA  1 
ATOM   3886 C C   . HIS B 2 187 ? 29.409  61.984  92.698  1.00 44.14  ? 361  HIS B C   1 
ATOM   3887 O O   . HIS B 2 187 ? 29.340  61.865  93.921  1.00 44.86  ? 361  HIS B O   1 
ATOM   3888 C CB  . HIS B 2 187 ? 31.070  60.778  91.349  1.00 45.41  ? 361  HIS B CB  1 
ATOM   3889 C CG  . HIS B 2 187 ? 32.040  61.004  92.466  1.00 46.27  ? 361  HIS B CG  1 
ATOM   3890 N ND1 . HIS B 2 187 ? 32.447  59.996  93.316  1.00 48.23  ? 361  HIS B ND1 1 
ATOM   3891 C CD2 . HIS B 2 187 ? 32.601  62.142  92.939  1.00 46.48  ? 361  HIS B CD2 1 
ATOM   3892 C CE1 . HIS B 2 187 ? 33.213  60.504  94.265  1.00 46.91  ? 361  HIS B CE1 1 
ATOM   3893 N NE2 . HIS B 2 187 ? 33.321  61.804  94.060  1.00 47.57  ? 361  HIS B NE2 1 
ATOM   3894 N N   . LEU B 2 188 ? 29.346  63.156  92.070  1.00 44.70  ? 362  LEU B N   1 
ATOM   3895 C CA  . LEU B 2 188 ? 29.174  64.413  92.786  1.00 43.98  ? 362  LEU B CA  1 
ATOM   3896 C C   . LEU B 2 188 ? 27.809  64.453  93.446  1.00 44.71  ? 362  LEU B C   1 
ATOM   3897 O O   . LEU B 2 188 ? 27.641  65.058  94.507  1.00 46.32  ? 362  LEU B O   1 
ATOM   3898 C CB  . LEU B 2 188 ? 29.341  65.593  91.822  1.00 44.44  ? 362  LEU B CB  1 
ATOM   3899 C CG  . LEU B 2 188 ? 29.338  67.036  92.339  1.00 42.79  ? 362  LEU B CG  1 
ATOM   3900 C CD1 . LEU B 2 188 ? 30.236  67.168  93.553  1.00 40.41  ? 362  LEU B CD1 1 
ATOM   3901 C CD2 . LEU B 2 188 ? 29.803  67.966  91.221  1.00 40.94  ? 362  LEU B CD2 1 
ATOM   3902 N N   . ALA B 2 189 ? 26.829  63.809  92.826  1.00 43.66  ? 363  ALA B N   1 
ATOM   3903 C CA  . ALA B 2 189 ? 25.503  63.780  93.415  1.00 45.66  ? 363  ALA B CA  1 
ATOM   3904 C C   . ALA B 2 189 ? 25.614  62.926  94.668  1.00 46.74  ? 363  ALA B C   1 
ATOM   3905 O O   . ALA B 2 189 ? 25.289  63.351  95.775  1.00 48.03  ? 363  ALA B O   1 
ATOM   3906 C CB  . ALA B 2 189 ? 24.505  63.159  92.444  1.00 45.54  ? 363  ALA B CB  1 
ATOM   3907 N N   . LEU B 2 190 ? 26.107  61.714  94.464  1.00 47.84  ? 364  LEU B N   1 
ATOM   3908 C CA  . LEU B 2 190 ? 26.281  60.726  95.510  1.00 48.38  ? 364  LEU B CA  1 
ATOM   3909 C C   . LEU B 2 190 ? 27.066  61.255  96.705  1.00 50.76  ? 364  LEU B C   1 
ATOM   3910 O O   . LEU B 2 190 ? 26.579  61.245  97.832  1.00 51.40  ? 364  LEU B O   1 
ATOM   3911 C CB  . LEU B 2 190 ? 26.979  59.519  94.901  1.00 47.24  ? 364  LEU B CB  1 
ATOM   3912 C CG  . LEU B 2 190 ? 27.067  58.210  95.658  1.00 47.92  ? 364  LEU B CG  1 
ATOM   3913 C CD1 . LEU B 2 190 ? 25.744  57.894  96.317  1.00 49.16  ? 364  LEU B CD1 1 
ATOM   3914 C CD2 . LEU B 2 190 ? 27.450  57.126  94.674  1.00 48.31  ? 364  LEU B CD2 1 
ATOM   3915 N N   . TYR B 2 191 ? 28.280  61.721  96.443  1.00 52.88  ? 365  TYR B N   1 
ATOM   3916 C CA  . TYR B 2 191 ? 29.159  62.254  97.474  1.00 54.60  ? 365  TYR B CA  1 
ATOM   3917 C C   . TYR B 2 191 ? 28.489  63.340  98.311  1.00 54.65  ? 365  TYR B C   1 
ATOM   3918 O O   . TYR B 2 191 ? 28.561  63.328  99.544  1.00 54.25  ? 365  TYR B O   1 
ATOM   3919 C CB  . TYR B 2 191 ? 30.410  62.817  96.813  1.00 57.83  ? 365  TYR B CB  1 
ATOM   3920 C CG  . TYR B 2 191 ? 31.412  63.422  97.766  1.00 60.72  ? 365  TYR B CG  1 
ATOM   3921 C CD1 . TYR B 2 191 ? 32.046  62.642  98.734  1.00 61.09  ? 365  TYR B CD1 1 
ATOM   3922 C CD2 . TYR B 2 191 ? 31.767  64.764  97.662  1.00 61.23  ? 365  TYR B CD2 1 
ATOM   3923 C CE1 . TYR B 2 191 ? 33.017  63.187  99.570  1.00 63.90  ? 365  TYR B CE1 1 
ATOM   3924 C CE2 . TYR B 2 191 ? 32.736  65.320  98.492  1.00 63.09  ? 365  TYR B CE2 1 
ATOM   3925 C CZ  . TYR B 2 191 ? 33.359  64.529  99.441  1.00 63.96  ? 365  TYR B CZ  1 
ATOM   3926 O OH  . TYR B 2 191 ? 34.335  65.080  100.244 1.00 66.59  ? 365  TYR B OH  1 
ATOM   3927 N N   . THR B 2 192 ? 27.847  64.282  97.632  1.00 53.06  ? 366  THR B N   1 
ATOM   3928 C CA  . THR B 2 192 ? 27.160  65.380  98.294  1.00 52.50  ? 366  THR B CA  1 
ATOM   3929 C C   . THR B 2 192 ? 26.060  64.901  99.243  1.00 52.65  ? 366  THR B C   1 
ATOM   3930 O O   . THR B 2 192 ? 25.991  65.309  100.400 1.00 52.42  ? 366  THR B O   1 
ATOM   3931 C CB  . THR B 2 192 ? 26.533  66.303  97.252  1.00 51.72  ? 366  THR B CB  1 
ATOM   3932 O OG1 . THR B 2 192 ? 27.561  66.790  96.387  1.00 52.32  ? 366  THR B OG1 1 
ATOM   3933 C CG2 . THR B 2 192 ? 25.835  67.475  97.911  1.00 51.49  ? 366  THR B CG2 1 
ATOM   3934 N N   . VAL B 2 193 ? 25.209  64.020  98.744  1.00 53.24  ? 367  VAL B N   1 
ATOM   3935 C CA  . VAL B 2 193 ? 24.095  63.506  99.522  1.00 53.60  ? 367  VAL B CA  1 
ATOM   3936 C C   . VAL B 2 193 ? 24.409  62.443  100.580 1.00 54.77  ? 367  VAL B C   1 
ATOM   3937 O O   . VAL B 2 193 ? 23.861  62.496  101.682 1.00 55.65  ? 367  VAL B O   1 
ATOM   3938 C CB  . VAL B 2 193 ? 23.007  62.965  98.576  1.00 52.18  ? 367  VAL B CB  1 
ATOM   3939 C CG1 . VAL B 2 193 ? 21.899  62.295  99.367  1.00 50.60  ? 367  VAL B CG1 1 
ATOM   3940 C CG2 . VAL B 2 193 ? 22.455  64.108  97.738  1.00 50.98  ? 367  VAL B CG2 1 
ATOM   3941 N N   . THR B 2 194 ? 25.279  61.485  100.265 1.00 54.20  ? 368  THR B N   1 
ATOM   3942 C CA  . THR B 2 194 ? 25.593  60.420  101.223 1.00 53.20  ? 368  THR B CA  1 
ATOM   3943 C C   . THR B 2 194 ? 27.041  60.328  101.698 1.00 53.85  ? 368  THR B C   1 
ATOM   3944 O O   . THR B 2 194 ? 27.330  59.658  102.692 1.00 54.39  ? 368  THR B O   1 
ATOM   3945 C CB  . THR B 2 194 ? 25.226  59.046  100.654 1.00 52.03  ? 368  THR B CB  1 
ATOM   3946 O OG1 . THR B 2 194 ? 26.042  58.774  99.509  1.00 51.51  ? 368  THR B OG1 1 
ATOM   3947 C CG2 . THR B 2 194 ? 23.763  59.009  100.255 1.00 50.88  ? 368  THR B CG2 1 
ATOM   3948 N N   . GLY B 2 195 ? 27.948  60.987  100.988 1.00 52.99  ? 369  GLY B N   1 
ATOM   3949 C CA  . GLY B 2 195 ? 29.346  60.930  101.361 1.00 52.25  ? 369  GLY B CA  1 
ATOM   3950 C C   . GLY B 2 195 ? 30.060  59.829  100.599 1.00 51.28  ? 369  GLY B C   1 
ATOM   3951 O O   . GLY B 2 195 ? 31.286  59.739  100.625 1.00 52.93  ? 369  GLY B O   1 
ATOM   3952 N N   . GLN B 2 196 ? 29.290  58.992  99.914  1.00 49.68  ? 370  GLN B N   1 
ATOM   3953 C CA  . GLN B 2 196 ? 29.841  57.886  99.139  1.00 49.39  ? 370  GLN B CA  1 
ATOM   3954 C C   . GLN B 2 196 ? 30.497  58.347  97.827  1.00 48.53  ? 370  GLN B C   1 
ATOM   3955 O O   . GLN B 2 196 ? 30.355  59.509  97.424  1.00 47.11  ? 370  GLN B O   1 
ATOM   3956 C CB  . GLN B 2 196 ? 28.733  56.874  98.841  1.00 51.86  ? 370  GLN B CB  1 
ATOM   3957 C CG  . GLN B 2 196 ? 28.248  56.109  100.051 1.00 52.24  ? 370  GLN B CG  1 
ATOM   3958 C CD  . GLN B 2 196 ? 26.855  55.546  99.854  1.00 55.09  ? 370  GLN B CD  1 
ATOM   3959 O OE1 . GLN B 2 196 ? 26.515  54.493  100.395 1.00 56.65  ? 370  GLN B OE1 1 
ATOM   3960 N NE2 . GLN B 2 196 ? 26.034  56.256  99.091  1.00 55.80  ? 370  GLN B NE2 1 
ATOM   3961 N N   . SER B 2 197 ? 31.190  57.419  97.161  1.00 46.88  ? 371  SER B N   1 
ATOM   3962 C CA  . SER B 2 197 ? 31.897  57.713  95.914  1.00 46.78  ? 371  SER B CA  1 
ATOM   3963 C C   . SER B 2 197 ? 31.643  56.700  94.817  1.00 45.67  ? 371  SER B C   1 
ATOM   3964 O O   . SER B 2 197 ? 31.209  55.584  95.092  1.00 45.42  ? 371  SER B O   1 
ATOM   3965 C CB  . SER B 2 197 ? 33.407  57.755  96.158  1.00 46.79  ? 371  SER B CB  1 
ATOM   3966 O OG  . SER B 2 197 ? 33.751  58.784  97.060  1.00 51.46  ? 371  SER B OG  1 
ATOM   3967 N N   . TRP B 2 198 ? 31.939  57.112  93.579  1.00 44.92  ? 372  TRP B N   1 
ATOM   3968 C CA  . TRP B 2 198 ? 31.809  56.279  92.380  1.00 43.91  ? 372  TRP B CA  1 
ATOM   3969 C C   . TRP B 2 198 ? 31.938  54.826  92.812  1.00 43.34  ? 372  TRP B C   1 
ATOM   3970 O O   . TRP B 2 198 ? 32.991  54.408  93.284  1.00 44.47  ? 372  TRP B O   1 
ATOM   3971 C CB  . TRP B 2 198 ? 32.934  56.634  91.406  1.00 45.21  ? 372  TRP B CB  1 
ATOM   3972 C CG  . TRP B 2 198 ? 32.794  56.065  90.031  1.00 44.80  ? 372  TRP B CG  1 
ATOM   3973 C CD1 . TRP B 2 198 ? 33.683  55.254  89.388  1.00 45.35  ? 372  TRP B CD1 1 
ATOM   3974 C CD2 . TRP B 2 198 ? 31.730  56.307  89.105  1.00 44.65  ? 372  TRP B CD2 1 
ATOM   3975 N NE1 . TRP B 2 198 ? 33.241  54.976  88.114  1.00 46.25  ? 372  TRP B NE1 1 
ATOM   3976 C CE2 . TRP B 2 198 ? 32.045  55.611  87.914  1.00 44.39  ? 372  TRP B CE2 1 
ATOM   3977 C CE3 . TRP B 2 198 ? 30.543  57.046  89.162  1.00 41.72  ? 372  TRP B CE3 1 
ATOM   3978 C CZ2 . TRP B 2 198 ? 31.213  55.636  86.788  1.00 42.21  ? 372  TRP B CZ2 1 
ATOM   3979 C CZ3 . TRP B 2 198 ? 29.717  57.069  88.041  1.00 41.56  ? 372  TRP B CZ3 1 
ATOM   3980 C CH2 . TRP B 2 198 ? 30.058  56.368  86.871  1.00 40.68  ? 372  TRP B CH2 1 
ATOM   3981 N N   . PRO B 2 199 ? 30.865  54.041  92.669  1.00 43.31  ? 373  PRO B N   1 
ATOM   3982 C CA  . PRO B 2 199 ? 30.894  52.629  93.068  1.00 44.30  ? 373  PRO B CA  1 
ATOM   3983 C C   . PRO B 2 199 ? 31.882  51.706  92.378  1.00 44.53  ? 373  PRO B C   1 
ATOM   3984 O O   . PRO B 2 199 ? 32.163  51.836  91.192  1.00 43.79  ? 373  PRO B O   1 
ATOM   3985 C CB  . PRO B 2 199 ? 29.447  52.170  92.851  1.00 43.76  ? 373  PRO B CB  1 
ATOM   3986 C CG  . PRO B 2 199 ? 28.958  53.069  91.761  1.00 43.57  ? 373  PRO B CG  1 
ATOM   3987 C CD  . PRO B 2 199 ? 29.532  54.412  92.160  1.00 43.11  ? 373  PRO B CD  1 
ATOM   3988 N N   . GLU B 2 200 ? 32.401  50.760  93.153  1.00 46.80  ? 374  GLU B N   1 
ATOM   3989 C CA  . GLU B 2 200 ? 33.327  49.758  92.643  1.00 48.19  ? 374  GLU B CA  1 
ATOM   3990 C C   . GLU B 2 200 ? 32.676  49.093  91.430  1.00 46.61  ? 374  GLU B C   1 
ATOM   3991 O O   . GLU B 2 200 ? 33.338  48.850  90.419  1.00 46.68  ? 374  GLU B O   1 
ATOM   3992 C CB  . GLU B 2 200 ? 33.607  48.717  93.742  1.00 52.66  ? 374  GLU B CB  1 
ATOM   3993 C CG  . GLU B 2 200 ? 34.089  47.332  93.276  1.00 55.50  ? 374  GLU B CG  1 
ATOM   3994 C CD  . GLU B 2 200 ? 35.333  47.389  92.403  1.00 58.45  ? 374  GLU B CD  1 
ATOM   3995 O OE1 . GLU B 2 200 ? 36.123  48.350  92.554  1.00 58.66  ? 374  GLU B OE1 1 
ATOM   3996 O OE2 . GLU B 2 200 ? 35.527  46.464  91.577  1.00 59.63  ? 374  GLU B OE2 1 
ATOM   3997 N N   . SER B 2 201 ? 31.372  48.825  91.533  1.00 43.36  ? 375  SER B N   1 
ATOM   3998 C CA  . SER B 2 201 ? 30.626  48.180  90.457  1.00 41.22  ? 375  SER B CA  1 
ATOM   3999 C C   . SER B 2 201 ? 30.573  48.977  89.140  1.00 39.90  ? 375  SER B C   1 
ATOM   4000 O O   . SER B 2 201 ? 30.455  48.396  88.057  1.00 37.48  ? 375  SER B O   1 
ATOM   4001 C CB  . SER B 2 201 ? 29.206  47.822  90.939  1.00 41.10  ? 375  SER B CB  1 
ATOM   4002 O OG  . SER B 2 201 ? 28.508  48.933  91.479  1.00 41.50  ? 375  SER B OG  1 
ATOM   4003 N N   . LEU B 2 202 ? 30.676  50.300  89.220  1.00 37.78  ? 376  LEU B N   1 
ATOM   4004 C CA  . LEU B 2 202 ? 30.644  51.111  88.010  1.00 37.39  ? 376  LEU B CA  1 
ATOM   4005 C C   . LEU B 2 202 ? 31.995  51.208  87.304  1.00 38.01  ? 376  LEU B C   1 
ATOM   4006 O O   . LEU B 2 202 ? 32.055  51.510  86.111  1.00 38.11  ? 376  LEU B O   1 
ATOM   4007 C CB  . LEU B 2 202 ? 30.124  52.509  88.319  1.00 36.85  ? 376  LEU B CB  1 
ATOM   4008 C CG  . LEU B 2 202 ? 28.600  52.582  88.405  1.00 37.26  ? 376  LEU B CG  1 
ATOM   4009 C CD1 . LEU B 2 202 ? 28.188  54.036  88.650  1.00 37.37  ? 376  LEU B CD1 1 
ATOM   4010 C CD2 . LEU B 2 202 ? 27.978  52.050  87.116  1.00 34.03  ? 376  LEU B CD2 1 
ATOM   4011 N N   . ILE B 2 203 ? 33.082  50.966  88.029  1.00 37.28  ? 377  ILE B N   1 
ATOM   4012 C CA  . ILE B 2 203 ? 34.390  51.004  87.393  1.00 37.82  ? 377  ILE B CA  1 
ATOM   4013 C C   . ILE B 2 203 ? 34.420  49.781  86.489  1.00 37.10  ? 377  ILE B C   1 
ATOM   4014 O O   . ILE B 2 203 ? 34.858  49.833  85.339  1.00 34.81  ? 377  ILE B O   1 
ATOM   4015 C CB  . ILE B 2 203 ? 35.534  50.897  88.422  1.00 38.01  ? 377  ILE B CB  1 
ATOM   4016 C CG1 . ILE B 2 203 ? 35.373  51.968  89.504  1.00 39.63  ? 377  ILE B CG1 1 
ATOM   4017 C CG2 . ILE B 2 203 ? 36.872  51.119  87.730  1.00 38.86  ? 377  ILE B CG2 1 
ATOM   4018 C CD1 . ILE B 2 203 ? 36.366  51.836  90.625  1.00 37.95  ? 377  ILE B CD1 1 
ATOM   4019 N N   . ARG B 2 204 ? 33.914  48.677  87.022  1.00 40.20  ? 378  ARG B N   1 
ATOM   4020 C CA  . ARG B 2 204 ? 33.871  47.422  86.284  1.00 42.51  ? 378  ARG B CA  1 
ATOM   4021 C C   . ARG B 2 204 ? 32.995  47.552  85.052  1.00 41.80  ? 378  ARG B C   1 
ATOM   4022 O O   . ARG B 2 204 ? 33.367  47.110  83.976  1.00 44.43  ? 378  ARG B O   1 
ATOM   4023 C CB  . ARG B 2 204 ? 33.335  46.287  87.167  1.00 44.18  ? 378  ARG B CB  1 
ATOM   4024 C CG  . ARG B 2 204 ? 34.216  45.937  88.350  1.00 48.01  ? 378  ARG B CG  1 
ATOM   4025 C CD  . ARG B 2 204 ? 33.734  44.660  89.027  1.00 50.79  ? 378  ARG B CD  1 
ATOM   4026 N NE  . ARG B 2 204 ? 32.786  44.885  90.118  1.00 54.34  ? 378  ARG B NE  1 
ATOM   4027 C CZ  . ARG B 2 204 ? 31.543  44.407  90.144  1.00 56.37  ? 378  ARG B CZ  1 
ATOM   4028 N NH1 . ARG B 2 204 ? 30.753  44.650  91.184  1.00 56.65  ? 378  ARG B NH1 1 
ATOM   4029 N NH2 . ARG B 2 204 ? 31.079  43.700  89.123  1.00 56.20  ? 378  ARG B NH2 1 
ATOM   4030 N N   . LYS B 2 205 ? 31.828  48.159  85.223  1.00 39.71  ? 379  LYS B N   1 
ATOM   4031 C CA  . LYS B 2 205 ? 30.883  48.333  84.136  1.00 36.12  ? 379  LYS B CA  1 
ATOM   4032 C C   . LYS B 2 205 ? 31.349  49.316  83.082  1.00 35.56  ? 379  LYS B C   1 
ATOM   4033 O O   . LYS B 2 205 ? 31.313  49.011  81.890  1.00 35.28  ? 379  LYS B O   1 
ATOM   4034 C CB  . LYS B 2 205 ? 29.536  48.813  84.685  1.00 35.10  ? 379  LYS B CB  1 
ATOM   4035 C CG  . LYS B 2 205 ? 28.526  49.159  83.602  1.00 33.74  ? 379  LYS B CG  1 
ATOM   4036 C CD  . LYS B 2 205 ? 27.318  49.884  84.164  1.00 33.27  ? 379  LYS B CD  1 
ATOM   4037 C CE  . LYS B 2 205 ? 26.232  50.072  83.098  1.00 32.72  ? 379  LYS B CE  1 
ATOM   4038 N NZ  . LYS B 2 205 ? 25.573  48.782  82.749  1.00 31.82  ? 379  LYS B NZ  1 
ATOM   4039 N N   . THR B 2 206 ? 31.779  50.496  83.523  1.00 34.09  ? 380  THR B N   1 
ATOM   4040 C CA  . THR B 2 206 ? 32.197  51.556  82.601  1.00 35.81  ? 380  THR B CA  1 
ATOM   4041 C C   . THR B 2 206 ? 33.677  51.663  82.271  1.00 37.02  ? 380  THR B C   1 
ATOM   4042 O O   . THR B 2 206 ? 34.030  52.147  81.198  1.00 37.28  ? 380  THR B O   1 
ATOM   4043 C CB  . THR B 2 206 ? 31.797  52.944  83.124  1.00 34.12  ? 380  THR B CB  1 
ATOM   4044 O OG1 . THR B 2 206 ? 32.456  53.175  84.377  1.00 30.21  ? 380  THR B OG1 1 
ATOM   4045 C CG2 . THR B 2 206 ? 30.289  53.039  83.310  1.00 31.91  ? 380  THR B CG2 1 
ATOM   4046 N N   . GLY B 2 207 ? 34.535  51.239  83.192  1.00 37.41  ? 381  GLY B N   1 
ATOM   4047 C CA  . GLY B 2 207 ? 35.956  51.360  82.960  1.00 37.98  ? 381  GLY B CA  1 
ATOM   4048 C C   . GLY B 2 207 ? 36.429  52.747  83.379  1.00 39.00  ? 381  GLY B C   1 
ATOM   4049 O O   . GLY B 2 207 ? 37.579  53.114  83.149  1.00 40.81  ? 381  GLY B O   1 
ATOM   4050 N N   . TYR B 2 208 ? 35.550  53.541  83.982  1.00 38.13  ? 382  TYR B N   1 
ATOM   4051 C CA  . TYR B 2 208 ? 35.970  54.865  84.422  1.00 36.82  ? 382  TYR B CA  1 
ATOM   4052 C C   . TYR B 2 208 ? 36.292  54.811  85.908  1.00 39.56  ? 382  TYR B C   1 
ATOM   4053 O O   . TYR B 2 208 ? 35.717  54.009  86.661  1.00 38.42  ? 382  TYR B O   1 
ATOM   4054 C CB  . TYR B 2 208 ? 34.889  55.928  84.208  1.00 32.20  ? 382  TYR B CB  1 
ATOM   4055 C CG  . TYR B 2 208 ? 34.435  56.147  82.781  1.00 29.42  ? 382  TYR B CG  1 
ATOM   4056 C CD1 . TYR B 2 208 ? 35.329  56.084  81.713  1.00 25.75  ? 382  TYR B CD1 1 
ATOM   4057 C CD2 . TYR B 2 208 ? 33.102  56.460  82.506  1.00 26.97  ? 382  TYR B CD2 1 
ATOM   4058 C CE1 . TYR B 2 208 ? 34.903  56.330  80.412  1.00 23.45  ? 382  TYR B CE1 1 
ATOM   4059 C CE2 . TYR B 2 208 ? 32.671  56.703  81.214  1.00 24.10  ? 382  TYR B CE2 1 
ATOM   4060 C CZ  . TYR B 2 208 ? 33.567  56.639  80.172  1.00 25.54  ? 382  TYR B CZ  1 
ATOM   4061 O OH  . TYR B 2 208 ? 33.102  56.875  78.894  1.00 27.49  ? 382  TYR B OH  1 
ATOM   4062 N N   . THR B 2 209 ? 37.204  55.686  86.319  1.00 40.38  ? 383  THR B N   1 
ATOM   4063 C CA  . THR B 2 209 ? 37.634  55.780  87.705  1.00 43.34  ? 383  THR B CA  1 
ATOM   4064 C C   . THR B 2 209 ? 37.501  57.231  88.156  1.00 45.45  ? 383  THR B C   1 
ATOM   4065 O O   . THR B 2 209 ? 37.147  58.099  87.354  1.00 45.06  ? 383  THR B O   1 
ATOM   4066 C CB  . THR B 2 209 ? 39.103  55.332  87.837  1.00 43.85  ? 383  THR B CB  1 
ATOM   4067 O OG1 . THR B 2 209 ? 39.917  56.066  86.908  1.00 42.80  ? 383  THR B OG1 1 
ATOM   4068 C CG2 . THR B 2 209 ? 39.224  53.840  87.531  1.00 44.83  ? 383  THR B CG2 1 
ATOM   4069 N N   . LEU B 2 210 ? 37.750  57.496  89.436  1.00 46.28  ? 384  LEU B N   1 
ATOM   4070 C CA  . LEU B 2 210 ? 37.683  58.871  89.914  1.00 48.62  ? 384  LEU B CA  1 
ATOM   4071 C C   . LEU B 2 210 ? 38.711  59.626  89.099  1.00 48.20  ? 384  LEU B C   1 
ATOM   4072 O O   . LEU B 2 210 ? 38.491  60.761  88.694  1.00 48.35  ? 384  LEU B O   1 
ATOM   4073 C CB  . LEU B 2 210 ? 38.074  58.978  91.394  1.00 50.51  ? 384  LEU B CB  1 
ATOM   4074 C CG  . LEU B 2 210 ? 37.029  58.808  92.491  1.00 50.98  ? 384  LEU B CG  1 
ATOM   4075 C CD1 . LEU B 2 210 ? 35.979  59.903  92.378  1.00 51.28  ? 384  LEU B CD1 1 
ATOM   4076 C CD2 . LEU B 2 210 ? 36.404  57.438  92.366  1.00 53.78  ? 384  LEU B CD2 1 
ATOM   4077 N N   . GLU B 2 211 ? 39.840  58.964  88.866  1.00 49.23  ? 385  GLU B N   1 
ATOM   4078 C CA  . GLU B 2 211 ? 40.951  59.546  88.127  1.00 51.50  ? 385  GLU B CA  1 
ATOM   4079 C C   . GLU B 2 211 ? 40.578  59.930  86.697  1.00 50.27  ? 385  GLU B C   1 
ATOM   4080 O O   . GLU B 2 211 ? 40.993  60.974  86.212  1.00 50.82  ? 385  GLU B O   1 
ATOM   4081 C CB  . GLU B 2 211 ? 42.145  58.573  88.148  1.00 54.90  ? 385  GLU B CB  1 
ATOM   4082 C CG  . GLU B 2 211 ? 43.431  59.055  87.459  1.00 62.09  ? 385  GLU B CG  1 
ATOM   4083 C CD  . GLU B 2 211 ? 44.037  60.330  88.071  1.00 66.85  ? 385  GLU B CD  1 
ATOM   4084 O OE1 . GLU B 2 211 ? 45.219  60.620  87.773  1.00 68.76  ? 385  GLU B OE1 1 
ATOM   4085 O OE2 . GLU B 2 211 ? 43.345  61.048  88.833  1.00 69.21  ? 385  GLU B OE2 1 
ATOM   4086 N N   . SER B 2 212 ? 39.788  59.103  86.022  1.00 49.79  ? 386  SER B N   1 
ATOM   4087 C CA  . SER B 2 212 ? 39.389  59.413  84.656  1.00 48.81  ? 386  SER B CA  1 
ATOM   4088 C C   . SER B 2 212 ? 38.269  60.445  84.629  1.00 48.62  ? 386  SER B C   1 
ATOM   4089 O O   . SER B 2 212 ? 38.100  61.168  83.647  1.00 49.37  ? 386  SER B O   1 
ATOM   4090 C CB  . SER B 2 212 ? 38.943  58.143  83.931  1.00 49.74  ? 386  SER B CB  1 
ATOM   4091 O OG  . SER B 2 212 ? 37.943  57.456  84.661  1.00 52.34  ? 386  SER B OG  1 
ATOM   4092 N N   . LEU B 2 213 ? 37.507  60.515  85.714  1.00 48.71  ? 387  LEU B N   1 
ATOM   4093 C CA  . LEU B 2 213 ? 36.400  61.464  85.815  1.00 48.59  ? 387  LEU B CA  1 
ATOM   4094 C C   . LEU B 2 213 ? 36.853  62.814  86.390  1.00 49.65  ? 387  LEU B C   1 
ATOM   4095 O O   . LEU B 2 213 ? 36.213  63.842  86.168  1.00 49.25  ? 387  LEU B O   1 
ATOM   4096 C CB  . LEU B 2 213 ? 35.297  60.872  86.699  1.00 46.32  ? 387  LEU B CB  1 
ATOM   4097 C CG  . LEU B 2 213 ? 34.584  59.628  86.158  1.00 46.67  ? 387  LEU B CG  1 
ATOM   4098 C CD1 . LEU B 2 213 ? 33.644  59.047  87.208  1.00 45.00  ? 387  LEU B CD1 1 
ATOM   4099 C CD2 . LEU B 2 213 ? 33.827  60.004  84.894  1.00 45.46  ? 387  LEU B CD2 1 
ATOM   4100 N N   . LYS B 2 214 ? 37.964  62.795  87.120  1.00 50.04  ? 388  LYS B N   1 
ATOM   4101 C CA  . LYS B 2 214 ? 38.520  63.981  87.761  1.00 52.21  ? 388  LYS B CA  1 
ATOM   4102 C C   . LYS B 2 214 ? 38.481  65.264  86.921  1.00 51.53  ? 388  LYS B C   1 
ATOM   4103 O O   . LYS B 2 214 ? 38.027  66.302  87.394  1.00 51.40  ? 388  LYS B O   1 
ATOM   4104 C CB  . LYS B 2 214 ? 39.953  63.683  88.221  1.00 54.80  ? 388  LYS B CB  1 
ATOM   4105 C CG  . LYS B 2 214 ? 40.620  64.785  89.033  1.00 57.42  ? 388  LYS B CG  1 
ATOM   4106 C CD  . LYS B 2 214 ? 41.652  64.184  89.989  1.00 59.96  ? 388  LYS B CD  1 
ATOM   4107 C CE  . LYS B 2 214 ? 42.511  65.243  90.677  1.00 62.03  ? 388  LYS B CE  1 
ATOM   4108 N NZ  . LYS B 2 214 ? 43.525  65.848  89.760  1.00 63.50  ? 388  LYS B NZ  1 
ATOM   4109 N N   . PRO B 2 215 ? 38.956  65.215  85.668  1.00 50.36  ? 389  PRO B N   1 
ATOM   4110 C CA  . PRO B 2 215 ? 38.924  66.433  84.854  1.00 49.01  ? 389  PRO B CA  1 
ATOM   4111 C C   . PRO B 2 215 ? 37.511  67.013  84.737  1.00 49.98  ? 389  PRO B C   1 
ATOM   4112 O O   . PRO B 2 215 ? 37.317  68.231  84.752  1.00 49.14  ? 389  PRO B O   1 
ATOM   4113 C CB  . PRO B 2 215 ? 39.469  65.959  83.511  1.00 48.69  ? 389  PRO B CB  1 
ATOM   4114 C CG  . PRO B 2 215 ? 40.398  64.859  83.891  1.00 47.17  ? 389  PRO B CG  1 
ATOM   4115 C CD  . PRO B 2 215 ? 39.625  64.118  84.948  1.00 49.65  ? 389  PRO B CD  1 
ATOM   4116 N N   . CYS B 2 216 ? 36.522  66.132  84.630  1.00 50.78  ? 390  CYS B N   1 
ATOM   4117 C CA  . CYS B 2 216 ? 35.131  66.563  84.499  1.00 50.26  ? 390  CYS B CA  1 
ATOM   4118 C C   . CYS B 2 216 ? 34.548  66.964  85.851  1.00 49.48  ? 390  CYS B C   1 
ATOM   4119 O O   . CYS B 2 216 ? 33.809  67.949  85.947  1.00 49.10  ? 390  CYS B O   1 
ATOM   4120 C CB  . CYS B 2 216 ? 34.299  65.444  83.871  1.00 51.34  ? 390  CYS B CB  1 
ATOM   4121 S SG  . CYS B 2 216 ? 32.698  65.966  83.252  1.00 50.15  ? 390  CYS B SG  1 
ATOM   4122 N N   . LEU B 2 217 ? 34.881  66.201  86.889  1.00 48.75  ? 391  LEU B N   1 
ATOM   4123 C CA  . LEU B 2 217 ? 34.418  66.501  88.241  1.00 49.55  ? 391  LEU B CA  1 
ATOM   4124 C C   . LEU B 2 217 ? 34.766  67.937  88.598  1.00 50.61  ? 391  LEU B C   1 
ATOM   4125 O O   . LEU B 2 217 ? 33.919  68.703  89.062  1.00 50.90  ? 391  LEU B O   1 
ATOM   4126 C CB  . LEU B 2 217 ? 35.091  65.592  89.263  1.00 48.56  ? 391  LEU B CB  1 
ATOM   4127 C CG  . LEU B 2 217 ? 34.275  64.446  89.847  1.00 49.43  ? 391  LEU B CG  1 
ATOM   4128 C CD1 . LEU B 2 217 ? 32.792  64.793  89.766  1.00 47.92  ? 391  LEU B CD1 1 
ATOM   4129 C CD2 . LEU B 2 217 ? 34.586  63.163  89.094  1.00 49.36  ? 391  LEU B CD2 1 
ATOM   4130 N N   . MET B 2 218 ? 36.033  68.279  88.392  1.00 50.88  ? 392  MET B N   1 
ATOM   4131 C CA  . MET B 2 218 ? 36.546  69.610  88.676  1.00 52.07  ? 392  MET B CA  1 
ATOM   4132 C C   . MET B 2 218 ? 35.645  70.673  88.065  1.00 51.02  ? 392  MET B C   1 
ATOM   4133 O O   . MET B 2 218 ? 35.208  71.600  88.751  1.00 50.81  ? 392  MET B O   1 
ATOM   4134 C CB  . MET B 2 218 ? 37.957  69.747  88.112  1.00 54.25  ? 392  MET B CB  1 
ATOM   4135 C CG  . MET B 2 218 ? 38.924  68.693  88.612  1.00 56.78  ? 392  MET B CG  1 
ATOM   4136 S SD  . MET B 2 218 ? 39.392  68.934  90.315  1.00 60.81  ? 392  MET B SD  1 
ATOM   4137 C CE  . MET B 2 218 ? 38.050  68.176  91.163  1.00 58.84  ? 392  MET B CE  1 
ATOM   4138 N N   . ASP B 2 219 ? 35.368  70.539  86.775  1.00 49.34  ? 393  ASP B N   1 
ATOM   4139 C CA  . ASP B 2 219 ? 34.506  71.496  86.111  1.00 50.62  ? 393  ASP B CA  1 
ATOM   4140 C C   . ASP B 2 219 ? 33.092  71.517  86.683  1.00 50.73  ? 393  ASP B C   1 
ATOM   4141 O O   . ASP B 2 219 ? 32.595  72.565  87.091  1.00 51.47  ? 393  ASP B O   1 
ATOM   4142 C CB  . ASP B 2 219 ? 34.430  71.199  84.617  1.00 51.15  ? 393  ASP B CB  1 
ATOM   4143 C CG  . ASP B 2 219 ? 35.565  71.814  83.849  1.00 51.68  ? 393  ASP B CG  1 
ATOM   4144 O OD1 . ASP B 2 219 ? 35.874  72.996  84.106  1.00 55.81  ? 393  ASP B OD1 1 
ATOM   4145 O OD2 . ASP B 2 219 ? 36.138  71.134  82.980  1.00 51.89  ? 393  ASP B OD2 1 
ATOM   4146 N N   . LEU B 2 220 ? 32.451  70.353  86.716  1.00 50.58  ? 394  LEU B N   1 
ATOM   4147 C CA  . LEU B 2 220 ? 31.080  70.246  87.206  1.00 51.08  ? 394  LEU B CA  1 
ATOM   4148 C C   . LEU B 2 220 ? 30.930  70.769  88.632  1.00 51.46  ? 394  LEU B C   1 
ATOM   4149 O O   . LEU B 2 220 ? 29.934  71.413  88.963  1.00 49.93  ? 394  LEU B O   1 
ATOM   4150 C CB  . LEU B 2 220 ? 30.617  68.789  87.130  1.00 50.30  ? 394  LEU B CB  1 
ATOM   4151 C CG  . LEU B 2 220 ? 29.115  68.537  87.027  1.00 50.35  ? 394  LEU B CG  1 
ATOM   4152 C CD1 . LEU B 2 220 ? 28.588  69.110  85.710  1.00 49.21  ? 394  LEU B CD1 1 
ATOM   4153 C CD2 . LEU B 2 220 ? 28.846  67.037  87.110  1.00 49.43  ? 394  LEU B CD2 1 
ATOM   4154 N N   . HIS B 2 221 ? 31.921  70.479  89.472  1.00 52.42  ? 395  HIS B N   1 
ATOM   4155 C CA  . HIS B 2 221 ? 31.913  70.928  90.858  1.00 53.23  ? 395  HIS B CA  1 
ATOM   4156 C C   . HIS B 2 221 ? 31.930  72.453  90.865  1.00 54.71  ? 395  HIS B C   1 
ATOM   4157 O O   . HIS B 2 221 ? 31.251  73.086  91.671  1.00 55.79  ? 395  HIS B O   1 
ATOM   4158 C CB  . HIS B 2 221 ? 33.133  70.361  91.591  1.00 53.37  ? 395  HIS B CB  1 
ATOM   4159 C CG  . HIS B 2 221 ? 33.196  70.716  93.046  1.00 53.03  ? 395  HIS B CG  1 
ATOM   4160 N ND1 . HIS B 2 221 ? 32.073  70.848  93.834  1.00 52.09  ? 395  HIS B ND1 1 
ATOM   4161 C CD2 . HIS B 2 221 ? 34.255  70.936  93.862  1.00 51.62  ? 395  HIS B CD2 1 
ATOM   4162 C CE1 . HIS B 2 221 ? 32.437  71.138  95.070  1.00 52.41  ? 395  HIS B CE1 1 
ATOM   4163 N NE2 . HIS B 2 221 ? 33.756  71.197  95.113  1.00 51.34  ? 395  HIS B NE2 1 
ATOM   4164 N N   . GLN B 2 222 ? 32.697  73.037  89.947  1.00 55.59  ? 396  GLN B N   1 
ATOM   4165 C CA  . GLN B 2 222 ? 32.780  74.488  89.830  1.00 55.56  ? 396  GLN B CA  1 
ATOM   4166 C C   . GLN B 2 222 ? 31.456  75.073  89.375  1.00 55.10  ? 396  GLN B C   1 
ATOM   4167 O O   . GLN B 2 222 ? 30.977  76.058  89.933  1.00 55.83  ? 396  GLN B O   1 
ATOM   4168 C CB  . GLN B 2 222 ? 33.870  74.892  88.837  1.00 57.04  ? 396  GLN B CB  1 
ATOM   4169 C CG  . GLN B 2 222 ? 35.259  74.950  89.435  1.00 59.70  ? 396  GLN B CG  1 
ATOM   4170 C CD  . GLN B 2 222 ? 35.306  75.782  90.702  1.00 60.64  ? 396  GLN B CD  1 
ATOM   4171 O OE1 . GLN B 2 222 ? 35.389  75.246  91.808  1.00 62.06  ? 396  GLN B OE1 1 
ATOM   4172 N NE2 . GLN B 2 222 ? 35.238  77.098  90.548  1.00 60.41  ? 396  GLN B NE2 1 
ATOM   4173 N N   . THR B 2 223 ? 30.872  74.475  88.345  1.00 53.62  ? 397  THR B N   1 
ATOM   4174 C CA  . THR B 2 223 ? 29.596  74.953  87.835  1.00 52.21  ? 397  THR B CA  1 
ATOM   4175 C C   . THR B 2 223 ? 28.599  74.927  88.983  1.00 51.08  ? 397  THR B C   1 
ATOM   4176 O O   . THR B 2 223 ? 27.795  75.843  89.150  1.00 51.41  ? 397  THR B O   1 
ATOM   4177 C CB  . THR B 2 223 ? 29.103  74.054  86.675  1.00 52.12  ? 397  THR B CB  1 
ATOM   4178 O OG1 . THR B 2 223 ? 29.980  74.213  85.553  1.00 50.19  ? 397  THR B OG1 1 
ATOM   4179 C CG2 . THR B 2 223 ? 27.682  74.412  86.263  1.00 50.03  ? 397  THR B CG2 1 
ATOM   4180 N N   . TYR B 2 224 ? 28.696  73.875  89.788  1.00 50.84  ? 398  TYR B N   1 
ATOM   4181 C CA  . TYR B 2 224 ? 27.828  73.652  90.941  1.00 51.84  ? 398  TYR B CA  1 
ATOM   4182 C C   . TYR B 2 224 ? 27.946  74.742  92.014  1.00 53.63  ? 398  TYR B C   1 
ATOM   4183 O O   . TYR B 2 224 ? 26.945  75.197  92.586  1.00 53.18  ? 398  TYR B O   1 
ATOM   4184 C CB  . TYR B 2 224 ? 28.159  72.289  91.551  1.00 48.85  ? 398  TYR B CB  1 
ATOM   4185 C CG  . TYR B 2 224 ? 27.164  71.804  92.572  1.00 45.58  ? 398  TYR B CG  1 
ATOM   4186 C CD1 . TYR B 2 224 ? 25.885  72.341  92.636  1.00 42.10  ? 398  TYR B CD1 1 
ATOM   4187 C CD2 . TYR B 2 224 ? 27.476  70.744  93.414  1.00 44.19  ? 398  TYR B CD2 1 
ATOM   4188 C CE1 . TYR B 2 224 ? 24.938  71.828  93.506  1.00 44.18  ? 398  TYR B CE1 1 
ATOM   4189 C CE2 . TYR B 2 224 ? 26.540  70.221  94.282  1.00 43.84  ? 398  TYR B CE2 1 
ATOM   4190 C CZ  . TYR B 2 224 ? 25.269  70.763  94.323  1.00 43.64  ? 398  TYR B CZ  1 
ATOM   4191 O OH  . TYR B 2 224 ? 24.323  70.215  95.158  1.00 43.54  ? 398  TYR B OH  1 
ATOM   4192 N N   . LEU B 2 225 ? 29.177  75.143  92.294  1.00 54.57  ? 399  LEU B N   1 
ATOM   4193 C CA  . LEU B 2 225 ? 29.429  76.179  93.278  1.00 55.04  ? 399  LEU B CA  1 
ATOM   4194 C C   . LEU B 2 225 ? 28.945  77.539  92.771  1.00 54.92  ? 399  LEU B C   1 
ATOM   4195 O O   . LEU B 2 225 ? 28.412  78.338  93.540  1.00 54.86  ? 399  LEU B O   1 
ATOM   4196 C CB  . LEU B 2 225 ? 30.925  76.228  93.594  1.00 53.87  ? 399  LEU B CB  1 
ATOM   4197 C CG  . LEU B 2 225 ? 31.403  75.009  94.383  1.00 54.82  ? 399  LEU B CG  1 
ATOM   4198 C CD1 . LEU B 2 225 ? 32.912  74.928  94.396  1.00 54.97  ? 399  LEU B CD1 1 
ATOM   4199 C CD2 . LEU B 2 225 ? 30.856  75.101  95.796  1.00 55.31  ? 399  LEU B CD2 1 
ATOM   4200 N N   . LYS B 2 226 ? 29.114  77.780  91.474  1.00 54.69  ? 400  LYS B N   1 
ATOM   4201 C CA  . LYS B 2 226 ? 28.724  79.045  90.863  1.00 54.17  ? 400  LYS B CA  1 
ATOM   4202 C C   . LYS B 2 226 ? 27.291  79.057  90.361  1.00 54.71  ? 400  LYS B C   1 
ATOM   4203 O O   . LYS B 2 226 ? 26.817  80.074  89.858  1.00 54.26  ? 400  LYS B O   1 
ATOM   4204 C CB  . LYS B 2 226 ? 29.658  79.379  89.696  1.00 54.43  ? 400  LYS B CB  1 
ATOM   4205 C CG  . LYS B 2 226 ? 31.131  79.492  90.069  1.00 55.90  ? 400  LYS B CG  1 
ATOM   4206 C CD  . LYS B 2 226 ? 31.921  80.134  88.931  1.00 59.28  ? 400  LYS B CD  1 
ATOM   4207 C CE  . LYS B 2 226 ? 33.395  80.328  89.271  1.00 60.39  ? 400  LYS B CE  1 
ATOM   4208 N NZ  . LYS B 2 226 ? 34.170  79.048  89.308  1.00 61.34  ? 400  LYS B NZ  1 
ATOM   4209 N N   . ALA B 2 227 ? 26.601  77.930  90.498  1.00 55.72  ? 401  ALA B N   1 
ATOM   4210 C CA  . ALA B 2 227 ? 25.216  77.823  90.037  1.00 57.27  ? 401  ALA B CA  1 
ATOM   4211 C C   . ALA B 2 227 ? 24.302  78.973  90.484  1.00 57.24  ? 401  ALA B C   1 
ATOM   4212 O O   . ALA B 2 227 ? 23.525  79.503  89.686  1.00 57.46  ? 401  ALA B O   1 
ATOM   4213 C CB  . ALA B 2 227 ? 24.622  76.488  90.478  1.00 56.60  ? 401  ALA B CB  1 
ATOM   4214 N N   . PRO B 2 228 ? 24.371  79.364  91.766  1.00 57.56  ? 402  PRO B N   1 
ATOM   4215 C CA  . PRO B 2 228 ? 23.516  80.459  92.245  1.00 58.14  ? 402  PRO B CA  1 
ATOM   4216 C C   . PRO B 2 228 ? 23.790  81.816  91.575  1.00 58.13  ? 402  PRO B C   1 
ATOM   4217 O O   . PRO B 2 228 ? 22.944  82.712  91.597  1.00 57.57  ? 402  PRO B O   1 
ATOM   4218 C CB  . PRO B 2 228 ? 23.808  80.489  93.748  1.00 57.60  ? 402  PRO B CB  1 
ATOM   4219 C CG  . PRO B 2 228 ? 24.199  79.069  94.056  1.00 57.19  ? 402  PRO B CG  1 
ATOM   4220 C CD  . PRO B 2 228 ? 25.078  78.721  92.889  1.00 56.58  ? 402  PRO B CD  1 
ATOM   4221 N N   . GLN B 2 229 ? 24.966  81.956  90.971  1.00 57.99  ? 403  GLN B N   1 
ATOM   4222 C CA  . GLN B 2 229 ? 25.355  83.204  90.323  1.00 58.99  ? 403  GLN B CA  1 
ATOM   4223 C C   . GLN B 2 229 ? 25.267  83.229  88.792  1.00 58.91  ? 403  GLN B C   1 
ATOM   4224 O O   . GLN B 2 229 ? 25.519  84.266  88.180  1.00 57.97  ? 403  GLN B O   1 
ATOM   4225 C CB  . GLN B 2 229 ? 26.782  83.577  90.744  1.00 61.25  ? 403  GLN B CB  1 
ATOM   4226 C CG  . GLN B 2 229 ? 26.889  84.193  92.134  1.00 64.71  ? 403  GLN B CG  1 
ATOM   4227 C CD  . GLN B 2 229 ? 26.597  83.206  93.247  1.00 67.04  ? 403  GLN B CD  1 
ATOM   4228 O OE1 . GLN B 2 229 ? 26.225  83.595  94.361  1.00 67.12  ? 403  GLN B OE1 1 
ATOM   4229 N NE2 . GLN B 2 229 ? 26.775  81.921  92.958  1.00 68.01  ? 403  GLN B NE2 1 
ATOM   4230 N N   . HIS B 2 230 ? 24.906  82.101  88.182  1.00 57.90  ? 404  HIS B N   1 
ATOM   4231 C CA  . HIS B 2 230 ? 24.814  81.989  86.720  1.00 55.76  ? 404  HIS B CA  1 
ATOM   4232 C C   . HIS B 2 230 ? 23.675  82.817  86.113  1.00 53.78  ? 404  HIS B C   1 
ATOM   4233 O O   . HIS B 2 230 ? 22.565  82.846  86.649  1.00 53.71  ? 404  HIS B O   1 
ATOM   4234 C CB  . HIS B 2 230 ? 24.638  80.511  86.333  1.00 56.61  ? 404  HIS B CB  1 
ATOM   4235 C CG  . HIS B 2 230 ? 24.951  80.210  84.898  1.00 56.65  ? 404  HIS B CG  1 
ATOM   4236 N ND1 . HIS B 2 230 ? 24.227  80.732  83.848  1.00 56.88  ? 404  HIS B ND1 1 
ATOM   4237 C CD2 . HIS B 2 230 ? 25.921  79.444  84.342  1.00 55.95  ? 404  HIS B CD2 1 
ATOM   4238 C CE1 . HIS B 2 230 ? 24.737  80.302  82.707  1.00 56.32  ? 404  HIS B CE1 1 
ATOM   4239 N NE2 . HIS B 2 230 ? 25.766  79.519  82.979  1.00 55.33  ? 404  HIS B NE2 1 
ATOM   4240 N N   . ALA B 2 231 ? 23.956  83.473  84.986  1.00 49.88  ? 405  ALA B N   1 
ATOM   4241 C CA  . ALA B 2 231 ? 22.967  84.296  84.289  1.00 46.69  ? 405  ALA B CA  1 
ATOM   4242 C C   . ALA B 2 231 ? 21.678  83.532  83.943  1.00 45.63  ? 405  ALA B C   1 
ATOM   4243 O O   . ALA B 2 231 ? 20.597  84.111  83.905  1.00 43.28  ? 405  ALA B O   1 
ATOM   4244 C CB  . ALA B 2 231 ? 23.579  84.871  83.030  1.00 45.47  ? 405  ALA B CB  1 
ATOM   4245 N N   . GLN B 2 232 ? 21.807  82.236  83.673  1.00 46.21  ? 406  GLN B N   1 
ATOM   4246 C CA  . GLN B 2 232 ? 20.665  81.380  83.351  1.00 44.26  ? 406  GLN B CA  1 
ATOM   4247 C C   . GLN B 2 232 ? 20.261  80.657  84.634  1.00 45.20  ? 406  GLN B C   1 
ATOM   4248 O O   . GLN B 2 232 ? 21.109  80.074  85.307  1.00 46.78  ? 406  GLN B O   1 
ATOM   4249 C CB  . GLN B 2 232 ? 21.063  80.371  82.283  1.00 44.42  ? 406  GLN B CB  1 
ATOM   4250 C CG  . GLN B 2 232 ? 21.053  80.905  80.855  1.00 45.95  ? 406  GLN B CG  1 
ATOM   4251 C CD  . GLN B 2 232 ? 21.935  82.118  80.650  1.00 45.55  ? 406  GLN B CD  1 
ATOM   4252 O OE1 . GLN B 2 232 ? 23.089  82.145  81.083  1.00 48.65  ? 406  GLN B OE1 1 
ATOM   4253 N NE2 . GLN B 2 232 ? 21.401  83.126  79.969  1.00 44.22  ? 406  GLN B NE2 1 
ATOM   4254 N N   . GLN B 2 233 ? 18.973  80.683  84.972  1.00 45.68  ? 407  GLN B N   1 
ATOM   4255 C CA  . GLN B 2 233 ? 18.501  80.064  86.215  1.00 45.19  ? 407  GLN B CA  1 
ATOM   4256 C C   . GLN B 2 233 ? 17.283  79.143  86.096  1.00 45.28  ? 407  GLN B C   1 
ATOM   4257 O O   . GLN B 2 233 ? 16.655  78.819  87.111  1.00 45.77  ? 407  GLN B O   1 
ATOM   4258 C CB  . GLN B 2 233 ? 18.170  81.164  87.241  1.00 44.88  ? 407  GLN B CB  1 
ATOM   4259 C CG  . GLN B 2 233 ? 19.362  81.954  87.789  1.00 43.82  ? 407  GLN B CG  1 
ATOM   4260 C CD  . GLN B 2 233 ? 20.159  81.184  88.838  1.00 45.65  ? 407  GLN B CD  1 
ATOM   4261 O OE1 . GLN B 2 233 ? 19.597  80.625  89.786  1.00 44.33  ? 407  GLN B OE1 1 
ATOM   4262 N NE2 . GLN B 2 233 ? 21.478  81.165  88.679  1.00 46.54  ? 407  GLN B NE2 1 
ATOM   4263 N N   . SER B 2 234 ? 16.934  78.709  84.890  1.00 43.41  ? 408  SER B N   1 
ATOM   4264 C CA  . SER B 2 234 ? 15.754  77.864  84.769  1.00 44.92  ? 408  SER B CA  1 
ATOM   4265 C C   . SER B 2 234 ? 15.933  76.439  85.285  1.00 45.73  ? 408  SER B C   1 
ATOM   4266 O O   . SER B 2 234 ? 14.963  75.800  85.691  1.00 45.84  ? 408  SER B O   1 
ATOM   4267 C CB  . SER B 2 234 ? 15.260  77.845  83.328  1.00 45.18  ? 408  SER B CB  1 
ATOM   4268 O OG  . SER B 2 234 ? 15.081  79.172  82.869  1.00 46.53  ? 408  SER B OG  1 
ATOM   4269 N N   . ILE B 2 235 ? 17.156  75.927  85.271  1.00 44.81  ? 409  ILE B N   1 
ATOM   4270 C CA  . ILE B 2 235 ? 17.356  74.586  85.787  1.00 45.97  ? 409  ILE B CA  1 
ATOM   4271 C C   . ILE B 2 235 ? 17.243  74.620  87.319  1.00 46.88  ? 409  ILE B C   1 
ATOM   4272 O O   . ILE B 2 235 ? 16.573  73.774  87.903  1.00 46.34  ? 409  ILE B O   1 
ATOM   4273 C CB  . ILE B 2 235 ? 18.728  73.983  85.344  1.00 45.62  ? 409  ILE B CB  1 
ATOM   4274 C CG1 . ILE B 2 235 ? 18.632  73.431  83.922  1.00 43.30  ? 409  ILE B CG1 1 
ATOM   4275 C CG2 . ILE B 2 235 ? 19.124  72.841  86.251  1.00 46.16  ? 409  ILE B CG2 1 
ATOM   4276 C CD1 . ILE B 2 235 ? 19.285  74.286  82.885  1.00 43.37  ? 409  ILE B CD1 1 
ATOM   4277 N N   . ARG B 2 236 ? 17.876  75.595  87.973  1.00 48.93  ? 410  ARG B N   1 
ATOM   4278 C CA  . ARG B 2 236 ? 17.789  75.688  89.438  1.00 49.46  ? 410  ARG B CA  1 
ATOM   4279 C C   . ARG B 2 236 ? 16.343  75.846  89.887  1.00 51.14  ? 410  ARG B C   1 
ATOM   4280 O O   . ARG B 2 236 ? 15.893  75.133  90.778  1.00 52.47  ? 410  ARG B O   1 
ATOM   4281 C CB  . ARG B 2 236 ? 18.581  76.873  89.981  1.00 48.90  ? 410  ARG B CB  1 
ATOM   4282 C CG  . ARG B 2 236 ? 20.073  76.718  89.964  1.00 48.08  ? 410  ARG B CG  1 
ATOM   4283 C CD  . ARG B 2 236 ? 20.683  77.845  90.745  1.00 49.24  ? 410  ARG B CD  1 
ATOM   4284 N NE  . ARG B 2 236 ? 20.568  77.650  92.191  1.00 49.46  ? 410  ARG B NE  1 
ATOM   4285 C CZ  . ARG B 2 236 ? 20.208  78.603  93.049  1.00 49.85  ? 410  ARG B CZ  1 
ATOM   4286 N NH1 . ARG B 2 236 ? 20.147  78.341  94.344  1.00 49.32  ? 410  ARG B NH1 1 
ATOM   4287 N NH2 . ARG B 2 236 ? 19.884  79.812  92.611  1.00 49.49  ? 410  ARG B NH2 1 
ATOM   4288 N N   . GLU B 2 237 ? 15.621  76.791  89.285  1.00 51.43  ? 411  GLU B N   1 
ATOM   4289 C CA  . GLU B 2 237 ? 14.223  76.994  89.644  1.00 53.30  ? 411  GLU B CA  1 
ATOM   4290 C C   . GLU B 2 237 ? 13.517  75.657  89.513  1.00 51.95  ? 411  GLU B C   1 
ATOM   4291 O O   . GLU B 2 237 ? 12.843  75.198  90.429  1.00 52.86  ? 411  GLU B O   1 
ATOM   4292 C CB  . GLU B 2 237 ? 13.563  78.024  88.716  1.00 56.68  ? 411  GLU B CB  1 
ATOM   4293 C CG  . GLU B 2 237 ? 14.192  79.410  88.794  1.00 61.88  ? 411  GLU B CG  1 
ATOM   4294 C CD  . GLU B 2 237 ? 14.462  79.832  90.232  1.00 65.82  ? 411  GLU B CD  1 
ATOM   4295 O OE1 . GLU B 2 237 ? 13.489  79.916  91.019  1.00 67.24  ? 411  GLU B OE1 1 
ATOM   4296 O OE2 . GLU B 2 237 ? 15.646  80.067  90.578  1.00 64.74  ? 411  GLU B OE2 1 
ATOM   4297 N N   . LYS B 2 238 ? 13.700  75.026  88.363  1.00 50.50  ? 412  LYS B N   1 
ATOM   4298 C CA  . LYS B 2 238 ? 13.095  73.739  88.090  1.00 48.53  ? 412  LYS B CA  1 
ATOM   4299 C C   . LYS B 2 238 ? 13.364  72.743  89.209  1.00 48.20  ? 412  LYS B C   1 
ATOM   4300 O O   . LYS B 2 238 ? 12.441  72.170  89.761  1.00 48.45  ? 412  LYS B O   1 
ATOM   4301 C CB  . LYS B 2 238 ? 13.636  73.195  86.771  1.00 46.97  ? 412  LYS B CB  1 
ATOM   4302 C CG  . LYS B 2 238 ? 13.054  71.874  86.346  1.00 46.57  ? 412  LYS B CG  1 
ATOM   4303 C CD  . LYS B 2 238 ? 13.690  71.406  85.049  1.00 48.08  ? 412  LYS B CD  1 
ATOM   4304 C CE  . LYS B 2 238 ? 13.219  70.017  84.662  1.00 46.89  ? 412  LYS B CE  1 
ATOM   4305 N NZ  . LYS B 2 238 ? 14.001  69.506  83.511  1.00 47.48  ? 412  LYS B NZ  1 
ATOM   4306 N N   . TYR B 2 239 ? 14.627  72.553  89.561  1.00 49.91  ? 413  TYR B N   1 
ATOM   4307 C CA  . TYR B 2 239 ? 14.971  71.583  90.594  1.00 51.35  ? 413  TYR B CA  1 
ATOM   4308 C C   . TYR B 2 239 ? 14.748  71.989  92.055  1.00 52.79  ? 413  TYR B C   1 
ATOM   4309 O O   . TYR B 2 239 ? 15.387  71.457  92.969  1.00 52.07  ? 413  TYR B O   1 
ATOM   4310 C CB  . TYR B 2 239 ? 16.409  71.084  90.386  1.00 48.60  ? 413  TYR B CB  1 
ATOM   4311 C CG  . TYR B 2 239 ? 16.513  70.074  89.264  1.00 46.63  ? 413  TYR B CG  1 
ATOM   4312 C CD1 . TYR B 2 239 ? 16.585  70.483  87.935  1.00 44.77  ? 413  TYR B CD1 1 
ATOM   4313 C CD2 . TYR B 2 239 ? 16.450  68.699  89.529  1.00 47.36  ? 413  TYR B CD2 1 
ATOM   4314 C CE1 . TYR B 2 239 ? 16.580  69.554  86.896  1.00 44.39  ? 413  TYR B CE1 1 
ATOM   4315 C CE2 . TYR B 2 239 ? 16.449  67.762  88.496  1.00 44.21  ? 413  TYR B CE2 1 
ATOM   4316 C CZ  . TYR B 2 239 ? 16.509  68.202  87.186  1.00 44.19  ? 413  TYR B CZ  1 
ATOM   4317 O OH  . TYR B 2 239 ? 16.466  67.293  86.164  1.00 45.53  ? 413  TYR B OH  1 
ATOM   4318 N N   . LYS B 2 240 ? 13.827  72.922  92.269  1.00 53.95  ? 414  LYS B N   1 
ATOM   4319 C CA  . LYS B 2 240 ? 13.482  73.359  93.615  1.00 55.55  ? 414  LYS B CA  1 
ATOM   4320 C C   . LYS B 2 240 ? 12.166  72.672  93.939  1.00 55.13  ? 414  LYS B C   1 
ATOM   4321 O O   . LYS B 2 240 ? 11.809  72.466  95.100  1.00 55.59  ? 414  LYS B O   1 
ATOM   4322 C CB  . LYS B 2 240 ? 13.319  74.885  93.663  1.00 56.82  ? 414  LYS B CB  1 
ATOM   4323 C CG  . LYS B 2 240 ? 14.645  75.629  93.809  1.00 60.65  ? 414  LYS B CG  1 
ATOM   4324 C CD  . LYS B 2 240 ? 14.506  77.139  93.616  1.00 64.41  ? 414  LYS B CD  1 
ATOM   4325 C CE  . LYS B 2 240 ? 15.854  77.842  93.817  1.00 66.47  ? 414  LYS B CE  1 
ATOM   4326 N NZ  . LYS B 2 240 ? 15.848  79.246  93.318  1.00 67.68  ? 414  LYS B NZ  1 
ATOM   4327 N N   . ASN B 2 241 ? 11.466  72.301  92.875  1.00 55.76  ? 415  ASN B N   1 
ATOM   4328 C CA  . ASN B 2 241 ? 10.175  71.635  92.957  1.00 56.97  ? 415  ASN B CA  1 
ATOM   4329 C C   . ASN B 2 241 ? 10.271  70.302  93.686  1.00 57.39  ? 415  ASN B C   1 
ATOM   4330 O O   . ASN B 2 241 ? 11.303  69.635  93.668  1.00 57.30  ? 415  ASN B O   1 
ATOM   4331 C CB  . ASN B 2 241 ? 9.626   71.425  91.540  1.00 58.34  ? 415  ASN B CB  1 
ATOM   4332 C CG  . ASN B 2 241 ? 8.207   70.874  91.524  1.00 58.39  ? 415  ASN B CG  1 
ATOM   4333 O OD1 . ASN B 2 241 ? 7.964   69.722  91.880  1.00 56.95  ? 415  ASN B OD1 1 
ATOM   4334 N ND2 . ASN B 2 241 ? 7.264   71.703  91.098  1.00 58.96  ? 415  ASN B ND2 1 
ATOM   4335 N N   . SER B 2 242 ? 9.172   69.926  94.326  1.00 58.49  ? 416  SER B N   1 
ATOM   4336 C CA  . SER B 2 242 ? 9.091   68.685  95.078  1.00 59.17  ? 416  SER B CA  1 
ATOM   4337 C C   . SER B 2 242 ? 9.289   67.480  94.172  1.00 58.18  ? 416  SER B C   1 
ATOM   4338 O O   . SER B 2 242 ? 9.764   66.439  94.624  1.00 57.59  ? 416  SER B O   1 
ATOM   4339 C CB  . SER B 2 242 ? 7.729   68.571  95.763  1.00 60.91  ? 416  SER B CB  1 
ATOM   4340 O OG  . SER B 2 242 ? 6.713   68.294  94.809  1.00 63.48  ? 416  SER B OG  1 
ATOM   4341 N N   . LYS B 2 243 ? 8.918   67.615  92.899  1.00 57.51  ? 417  LYS B N   1 
ATOM   4342 C CA  . LYS B 2 243 ? 9.071   66.512  91.955  1.00 56.97  ? 417  LYS B CA  1 
ATOM   4343 C C   . LYS B 2 243 ? 10.525  66.035  91.946  1.00 55.91  ? 417  LYS B C   1 
ATOM   4344 O O   . LYS B 2 243 ? 10.802  64.863  91.667  1.00 54.00  ? 417  LYS B O   1 
ATOM   4345 C CB  . LYS B 2 243 ? 8.631   66.928  90.539  1.00 57.48  ? 417  LYS B CB  1 
ATOM   4346 C CG  . LYS B 2 243 ? 8.879   65.835  89.483  1.00 61.29  ? 417  LYS B CG  1 
ATOM   4347 C CD  . LYS B 2 243 ? 7.872   65.838  88.328  1.00 61.83  ? 417  LYS B CD  1 
ATOM   4348 C CE  . LYS B 2 243 ? 8.130   66.957  87.327  1.00 64.87  ? 417  LYS B CE  1 
ATOM   4349 N NZ  . LYS B 2 243 ? 7.881   68.319  87.881  1.00 64.01  ? 417  LYS B NZ  1 
ATOM   4350 N N   . TYR B 2 244 ? 11.443  66.944  92.272  1.00 54.04  ? 418  TYR B N   1 
ATOM   4351 C CA  . TYR B 2 244 ? 12.864  66.619  92.313  1.00 53.96  ? 418  TYR B CA  1 
ATOM   4352 C C   . TYR B 2 244 ? 13.432  66.751  93.719  1.00 53.89  ? 418  TYR B C   1 
ATOM   4353 O O   . TYR B 2 244 ? 14.617  67.047  93.894  1.00 54.47  ? 418  TYR B O   1 
ATOM   4354 C CB  . TYR B 2 244 ? 13.643  67.519  91.353  1.00 53.30  ? 418  TYR B CB  1 
ATOM   4355 C CG  . TYR B 2 244 ? 13.187  67.371  89.927  1.00 53.10  ? 418  TYR B CG  1 
ATOM   4356 C CD1 . TYR B 2 244 ? 13.318  66.155  89.258  1.00 51.90  ? 418  TYR B CD1 1 
ATOM   4357 C CD2 . TYR B 2 244 ? 12.560  68.426  89.264  1.00 52.63  ? 418  TYR B CD2 1 
ATOM   4358 C CE1 . TYR B 2 244 ? 12.829  65.991  87.967  1.00 52.67  ? 418  TYR B CE1 1 
ATOM   4359 C CE2 . TYR B 2 244 ? 12.066  68.271  87.977  1.00 52.87  ? 418  TYR B CE2 1 
ATOM   4360 C CZ  . TYR B 2 244 ? 12.201  67.053  87.336  1.00 53.59  ? 418  TYR B CZ  1 
ATOM   4361 O OH  . TYR B 2 244 ? 11.684  66.895  86.072  1.00 56.58  ? 418  TYR B OH  1 
ATOM   4362 N N   . HIS B 2 245 ? 12.577  66.537  94.714  1.00 51.98  ? 419  HIS B N   1 
ATOM   4363 C CA  . HIS B 2 245 ? 12.975  66.608  96.116  1.00 51.16  ? 419  HIS B CA  1 
ATOM   4364 C C   . HIS B 2 245 ? 13.816  67.850  96.446  1.00 50.20  ? 419  HIS B C   1 
ATOM   4365 O O   . HIS B 2 245 ? 14.770  67.787  97.226  1.00 50.30  ? 419  HIS B O   1 
ATOM   4366 C CB  . HIS B 2 245 ? 13.733  65.331  96.492  1.00 51.19  ? 419  HIS B CB  1 
ATOM   4367 C CG  . HIS B 2 245 ? 13.145  64.088  95.899  1.00 52.41  ? 419  HIS B CG  1 
ATOM   4368 N ND1 . HIS B 2 245 ? 13.355  63.721  94.587  1.00 53.12  ? 419  HIS B ND1 1 
ATOM   4369 C CD2 . HIS B 2 245 ? 12.322  63.149  96.425  1.00 53.37  ? 419  HIS B CD2 1 
ATOM   4370 C CE1 . HIS B 2 245 ? 12.686  62.609  94.329  1.00 54.42  ? 419  HIS B CE1 1 
ATOM   4371 N NE2 . HIS B 2 245 ? 12.051  62.242  95.428  1.00 54.60  ? 419  HIS B NE2 1 
ATOM   4372 N N   . GLY B 2 246 ? 13.445  68.975  95.847  1.00 48.50  ? 420  GLY B N   1 
ATOM   4373 C CA  . GLY B 2 246 ? 14.144  70.223  96.083  1.00 47.76  ? 420  GLY B CA  1 
ATOM   4374 C C   . GLY B 2 246 ? 15.655  70.164  96.187  1.00 48.06  ? 420  GLY B C   1 
ATOM   4375 O O   . GLY B 2 246 ? 16.250  71.041  96.810  1.00 49.67  ? 420  GLY B O   1 
ATOM   4376 N N   . VAL B 2 247 ? 16.285  69.168  95.568  1.00 46.71  ? 421  VAL B N   1 
ATOM   4377 C CA  . VAL B 2 247 ? 17.746  69.039  95.628  1.00 46.33  ? 421  VAL B CA  1 
ATOM   4378 C C   . VAL B 2 247 ? 18.545  70.289  95.230  1.00 46.84  ? 421  VAL B C   1 
ATOM   4379 O O   . VAL B 2 247 ? 19.622  70.527  95.773  1.00 47.52  ? 421  VAL B O   1 
ATOM   4380 C CB  . VAL B 2 247 ? 18.261  67.832  94.784  1.00 44.14  ? 421  VAL B CB  1 
ATOM   4381 C CG1 . VAL B 2 247 ? 17.621  66.547  95.273  1.00 41.88  ? 421  VAL B CG1 1 
ATOM   4382 C CG2 . VAL B 2 247 ? 17.978  68.047  93.313  1.00 43.12  ? 421  VAL B CG2 1 
ATOM   4383 N N   . SER B 2 248 ? 18.035  71.088  94.296  1.00 47.54  ? 422  SER B N   1 
ATOM   4384 C CA  . SER B 2 248 ? 18.744  72.301  93.887  1.00 49.28  ? 422  SER B CA  1 
ATOM   4385 C C   . SER B 2 248 ? 18.893  73.248  95.075  1.00 51.23  ? 422  SER B C   1 
ATOM   4386 O O   . SER B 2 248 ? 19.479  74.325  94.955  1.00 51.63  ? 422  SER B O   1 
ATOM   4387 C CB  . SER B 2 248 ? 17.983  73.035  92.786  1.00 49.80  ? 422  SER B CB  1 
ATOM   4388 O OG  . SER B 2 248 ? 16.848  73.698  93.321  1.00 50.65  ? 422  SER B OG  1 
ATOM   4389 N N   . LEU B 2 249 ? 18.334  72.855  96.214  1.00 52.81  ? 423  LEU B N   1 
ATOM   4390 C CA  . LEU B 2 249 ? 18.416  73.658  97.423  1.00 54.39  ? 423  LEU B CA  1 
ATOM   4391 C C   . LEU B 2 249 ? 19.552  73.180  98.310  1.00 55.72  ? 423  LEU B C   1 
ATOM   4392 O O   . LEU B 2 249 ? 19.981  73.894  99.217  1.00 56.38  ? 423  LEU B O   1 
ATOM   4393 C CB  . LEU B 2 249 ? 17.109  73.586  98.211  1.00 56.18  ? 423  LEU B CB  1 
ATOM   4394 C CG  . LEU B 2 249 ? 15.881  74.258  97.600  1.00 57.80  ? 423  LEU B CG  1 
ATOM   4395 C CD1 . LEU B 2 249 ? 14.801  74.331  98.663  1.00 57.98  ? 423  LEU B CD1 1 
ATOM   4396 C CD2 . LEU B 2 249 ? 16.226  75.665  97.108  1.00 57.32  ? 423  LEU B CD2 1 
ATOM   4397 N N   . LEU B 2 250 ? 20.029  71.965  98.052  1.00 56.38  ? 424  LEU B N   1 
ATOM   4398 C CA  . LEU B 2 250 ? 21.124  71.392  98.826  1.00 56.50  ? 424  LEU B CA  1 
ATOM   4399 C C   . LEU B 2 250 ? 22.415  72.190  98.667  1.00 56.75  ? 424  LEU B C   1 
ATOM   4400 O O   . LEU B 2 250 ? 22.657  72.822  97.639  1.00 55.65  ? 424  LEU B O   1 
ATOM   4401 C CB  . LEU B 2 250 ? 21.363  69.940  98.412  1.00 55.94  ? 424  LEU B CB  1 
ATOM   4402 C CG  . LEU B 2 250 ? 20.196  68.985  98.665  1.00 56.47  ? 424  LEU B CG  1 
ATOM   4403 C CD1 . LEU B 2 250 ? 20.557  67.604  98.158  1.00 57.11  ? 424  LEU B CD1 1 
ATOM   4404 C CD2 . LEU B 2 250 ? 19.871  68.941  100.151 1.00 55.90  ? 424  LEU B CD2 1 
ATOM   4405 N N   . ASN B 2 251 ? 23.240  72.154  99.703  1.00 57.70  ? 425  ASN B N   1 
ATOM   4406 C CA  . ASN B 2 251 ? 24.502  72.864  99.696  1.00 59.56  ? 425  ASN B CA  1 
ATOM   4407 C C   . ASN B 2 251 ? 25.628  72.003  99.136  1.00 60.40  ? 425  ASN B C   1 
ATOM   4408 O O   . ASN B 2 251 ? 25.879  70.897  99.615  1.00 60.61  ? 425  ASN B O   1 
ATOM   4409 C CB  . ASN B 2 251 ? 24.838  73.325  101.116 1.00 60.70  ? 425  ASN B CB  1 
ATOM   4410 C CG  . ASN B 2 251 ? 24.227  74.673  101.451 1.00 63.11  ? 425  ASN B CG  1 
ATOM   4411 O OD1 . ASN B 2 251 ? 24.200  75.080  102.611 1.00 64.53  ? 425  ASN B OD1 1 
ATOM   4412 N ND2 . ASN B 2 251 ? 23.745  75.380  100.430 1.00 62.92  ? 425  ASN B ND2 1 
ATOM   4413 N N   . PRO B 2 252 ? 26.317  72.501  98.100  1.00 61.18  ? 426  PRO B N   1 
ATOM   4414 C CA  . PRO B 2 252 ? 27.426  71.787  97.460  1.00 62.57  ? 426  PRO B CA  1 
ATOM   4415 C C   . PRO B 2 252 ? 28.676  71.756  98.335  1.00 64.03  ? 426  PRO B C   1 
ATOM   4416 O O   . PRO B 2 252 ? 29.017  72.747  98.985  1.00 64.29  ? 426  PRO B O   1 
ATOM   4417 C CB  . PRO B 2 252 ? 27.642  72.577  96.176  1.00 62.01  ? 426  PRO B CB  1 
ATOM   4418 C CG  . PRO B 2 252 ? 27.314  73.970  96.602  1.00 62.22  ? 426  PRO B CG  1 
ATOM   4419 C CD  . PRO B 2 252 ? 26.056  73.781  97.418  1.00 61.26  ? 426  PRO B CD  1 
ATOM   4420 N N   . PRO B 2 253 ? 29.377  70.612  98.359  1.00 64.81  ? 427  PRO B N   1 
ATOM   4421 C CA  . PRO B 2 253 ? 30.598  70.432  99.151  1.00 65.57  ? 427  PRO B CA  1 
ATOM   4422 C C   . PRO B 2 253 ? 31.627  71.525  98.882  1.00 66.17  ? 427  PRO B C   1 
ATOM   4423 O O   . PRO B 2 253 ? 31.715  72.026  97.767  1.00 65.99  ? 427  PRO B O   1 
ATOM   4424 C CB  . PRO B 2 253 ? 31.101  69.062  98.696  1.00 66.31  ? 427  PRO B CB  1 
ATOM   4425 C CG  . PRO B 2 253 ? 29.842  68.338  98.335  1.00 65.23  ? 427  PRO B CG  1 
ATOM   4426 C CD  . PRO B 2 253 ? 29.068  69.394  97.588  1.00 64.77  ? 427  PRO B CD  1 
ATOM   4427 N N   . GLU B 2 254 ? 32.395  71.899  99.903  1.00 68.49  ? 428  GLU B N   1 
ATOM   4428 C CA  . GLU B 2 254 ? 33.434  72.913  99.727  1.00 70.00  ? 428  GLU B CA  1 
ATOM   4429 C C   . GLU B 2 254 ? 34.467  72.346  98.766  1.00 69.09  ? 428  GLU B C   1 
ATOM   4430 O O   . GLU B 2 254 ? 34.949  73.042  97.875  1.00 68.88  ? 428  GLU B O   1 
ATOM   4431 C CB  . GLU B 2 254 ? 34.154  73.229  101.040 1.00 72.11  ? 428  GLU B CB  1 
ATOM   4432 C CG  . GLU B 2 254 ? 33.398  74.053  102.056 1.00 74.19  ? 428  GLU B CG  1 
ATOM   4433 C CD  . GLU B 2 254 ? 34.347  74.686  103.071 1.00 75.88  ? 428  GLU B CD  1 
ATOM   4434 O OE1 . GLU B 2 254 ? 33.878  75.132  104.140 1.00 77.78  ? 428  GLU B OE1 1 
ATOM   4435 O OE2 . GLU B 2 254 ? 35.567  74.745  102.790 1.00 74.76  ? 428  GLU B OE2 1 
ATOM   4436 N N   . THR B 2 255 ? 34.808  71.076  98.976  1.00 68.50  ? 429  THR B N   1 
ATOM   4437 C CA  . THR B 2 255 ? 35.785  70.377  98.146  1.00 69.57  ? 429  THR B CA  1 
ATOM   4438 C C   . THR B 2 255 ? 35.416  68.904  97.963  1.00 68.85  ? 429  THR B C   1 
ATOM   4439 O O   . THR B 2 255 ? 34.558  68.378  98.671  1.00 67.41  ? 429  THR B O   1 
ATOM   4440 C CB  . THR B 2 255 ? 37.211  70.467  98.751  1.00 70.28  ? 429  THR B CB  1 
ATOM   4441 O OG1 . THR B 2 255 ? 37.188  70.026  100.117 1.00 69.42  ? 429  THR B OG1 1 
ATOM   4442 C CG2 . THR B 2 255 ? 37.728  71.903  98.683  1.00 71.16  ? 429  THR B CG2 1 
ATOM   4443 N N   . LEU B 2 256 ? 36.076  68.244  97.015  1.00 69.23  ? 430  LEU B N   1 
ATOM   4444 C CA  . LEU B 2 256 ? 35.794  66.841  96.726  1.00 69.66  ? 430  LEU B CA  1 
ATOM   4445 C C   . LEU B 2 256 ? 36.889  65.897  97.186  1.00 71.23  ? 430  LEU B C   1 
ATOM   4446 O O   . LEU B 2 256 ? 36.756  64.683  97.036  1.00 71.38  ? 430  LEU B O   1 
ATOM   4447 C CB  . LEU B 2 256 ? 35.600  66.633  95.222  1.00 67.48  ? 430  LEU B CB  1 
ATOM   4448 C CG  . LEU B 2 256 ? 34.620  67.520  94.463  1.00 66.38  ? 430  LEU B CG  1 
ATOM   4449 C CD1 . LEU B 2 256 ? 34.543  67.056  93.019  1.00 64.58  ? 430  LEU B CD1 1 
ATOM   4450 C CD2 . LEU B 2 256 ? 33.260  67.455  95.123  1.00 67.04  ? 430  LEU B CD2 1 
ATOM   4451 N N   . ASN B 2 257 ? 37.967  66.445  97.738  1.00 72.84  ? 431  ASN B N   1 
ATOM   4452 C CA  . ASN B 2 257 ? 39.093  65.624  98.181  1.00 74.30  ? 431  ASN B CA  1 
ATOM   4453 C C   . ASN B 2 257 ? 39.766  65.026  96.950  1.00 74.33  ? 431  ASN B C   1 
ATOM   4454 O O   . ASN B 2 257 ? 39.988  63.818  96.869  1.00 73.52  ? 431  ASN B O   1 
ATOM   4455 C CB  . ASN B 2 257 ? 38.628  64.494  99.114  1.00 76.02  ? 431  ASN B CB  1 
ATOM   4456 C CG  . ASN B 2 257 ? 38.268  64.986  100.512 1.00 77.87  ? 431  ASN B CG  1 
ATOM   4457 O OD1 . ASN B 2 257 ? 37.417  65.862  100.680 1.00 78.64  ? 431  ASN B OD1 1 
ATOM   4458 N ND2 . ASN B 2 257 ? 38.913  64.411  101.524 1.00 78.17  ? 431  ASN B ND2 1 
ATOM   4459 N N   . LEU B 2 258 ? 40.074  65.888  95.987  1.00 75.38  ? 432  LEU B N   1 
ATOM   4460 C CA  . LEU B 2 258 ? 40.730  65.478  94.749  1.00 76.91  ? 432  LEU B CA  1 
ATOM   4461 C C   . LEU B 2 258 ? 40.993  66.692  93.847  1.00 77.89  ? 432  LEU B C   1 
ATOM   4462 O O   . LEU B 2 258 ? 42.187  66.987  93.586  1.00 78.10  ? 432  LEU B O   1 
ATOM   4463 C CB  . LEU B 2 258 ? 39.880  64.419  94.022  1.00 74.27  ? 432  LEU B CB  1 
ATOM   4464 C CG  . LEU B 2 258 ? 38.386  64.669  93.791  1.00 72.43  ? 432  LEU B CG  1 
ATOM   4465 C CD1 . LEU B 2 258 ? 38.150  65.175  92.386  1.00 71.66  ? 432  LEU B CD1 1 
ATOM   4466 C CD2 . LEU B 2 258 ? 37.627  63.375  93.990  1.00 71.87  ? 432  LEU B CD2 1 
ATOM   4467 N N   . SER C 1 1   ? -22.113 -4.708  103.961 1.00 77.53  ? 0    SER C N   1 
ATOM   4468 C CA  . SER C 1 1   ? -20.617 -4.749  104.025 1.00 77.76  ? 0    SER C CA  1 
ATOM   4469 C C   . SER C 1 1   ? -20.101 -6.147  103.703 1.00 78.16  ? 0    SER C C   1 
ATOM   4470 O O   . SER C 1 1   ? -19.663 -6.427  102.578 1.00 77.29  ? 0    SER C O   1 
ATOM   4471 C CB  . SER C 1 1   ? -20.127 -4.346  105.423 1.00 76.91  ? 0    SER C CB  1 
ATOM   4472 O OG  . SER C 1 1   ? -20.429 -2.992  105.716 1.00 76.12  ? 0    SER C OG  1 
ATOM   4473 N N   . MET C 1 2   ? -20.161 -7.016  104.710 1.00 77.88  ? 1    MET C N   1 
ATOM   4474 C CA  . MET C 1 2   ? -19.712 -8.399  104.588 1.00 76.93  ? 1    MET C CA  1 
ATOM   4475 C C   . MET C 1 2   ? -20.792 -9.258  103.943 1.00 76.53  ? 1    MET C C   1 
ATOM   4476 O O   . MET C 1 2   ? -20.694 -10.484 103.920 1.00 76.29  ? 1    MET C O   1 
ATOM   4477 C CB  . MET C 1 2   ? -19.366 -8.957  105.969 1.00 76.04  ? 1    MET C CB  1 
ATOM   4478 C CG  . MET C 1 2   ? -18.369 -8.108  106.735 1.00 75.28  ? 1    MET C CG  1 
ATOM   4479 S SD  . MET C 1 2   ? -16.833 -7.883  105.824 1.00 75.02  ? 1    MET C SD  1 
ATOM   4480 C CE  . MET C 1 2   ? -16.139 -9.517  105.973 1.00 76.78  ? 1    MET C CE  1 
ATOM   4481 N N   . GLU C 1 3   ? -21.819 -8.595  103.420 1.00 75.85  ? 2    GLU C N   1 
ATOM   4482 C CA  . GLU C 1 3   ? -22.932 -9.267  102.764 1.00 74.52  ? 2    GLU C CA  1 
ATOM   4483 C C   . GLU C 1 3   ? -22.466 -10.124 101.597 1.00 71.76  ? 2    GLU C C   1 
ATOM   4484 O O   . GLU C 1 3   ? -22.968 -11.225 101.389 1.00 70.90  ? 2    GLU C O   1 
ATOM   4485 C CB  . GLU C 1 3   ? -23.935 -8.233  102.253 1.00 76.74  ? 2    GLU C CB  1 
ATOM   4486 C CG  . GLU C 1 3   ? -24.776 -8.730  101.088 1.00 81.81  ? 2    GLU C CG  1 
ATOM   4487 C CD  . GLU C 1 3   ? -25.145 -7.620  100.115 1.00 84.13  ? 2    GLU C CD  1 
ATOM   4488 O OE1 . GLU C 1 3   ? -25.521 -7.937  98.960  1.00 84.24  ? 2    GLU C OE1 1 
ATOM   4489 O OE2 . GLU C 1 3   ? -25.061 -6.433  100.508 1.00 86.61  ? 2    GLU C OE2 1 
ATOM   4490 N N   . ASN C 1 4   ? -21.511 -9.613  100.831 1.00 69.13  ? 3    ASN C N   1 
ATOM   4491 C CA  . ASN C 1 4   ? -21.007 -10.346 99.679  1.00 67.05  ? 3    ASN C CA  1 
ATOM   4492 C C   . ASN C 1 4   ? -20.164 -11.560 100.049 1.00 64.75  ? 3    ASN C C   1 
ATOM   4493 O O   . ASN C 1 4   ? -19.906 -12.417 99.205  1.00 64.95  ? 3    ASN C O   1 
ATOM   4494 C CB  . ASN C 1 4   ? -20.186 -9.420  98.778  1.00 67.66  ? 3    ASN C CB  1 
ATOM   4495 C CG  . ASN C 1 4   ? -21.019 -8.306  98.171  1.00 68.88  ? 3    ASN C CG  1 
ATOM   4496 O OD1 . ASN C 1 4   ? -22.089 -8.553  97.606  1.00 68.84  ? 3    ASN C OD1 1 
ATOM   4497 N ND2 . ASN C 1 4   ? -20.529 -7.072  98.277  1.00 68.09  ? 3    ASN C ND2 1 
ATOM   4498 N N   . PHE C 1 5   ? -19.745 -11.645 101.308 1.00 61.35  ? 4    PHE C N   1 
ATOM   4499 C CA  . PHE C 1 5   ? -18.911 -12.757 101.736 1.00 59.25  ? 4    PHE C CA  1 
ATOM   4500 C C   . PHE C 1 5   ? -19.643 -13.924 102.386 1.00 58.16  ? 4    PHE C C   1 
ATOM   4501 O O   . PHE C 1 5   ? -20.621 -13.744 103.101 1.00 56.78  ? 4    PHE C O   1 
ATOM   4502 C CB  . PHE C 1 5   ? -17.814 -12.259 102.680 1.00 57.35  ? 4    PHE C CB  1 
ATOM   4503 C CG  . PHE C 1 5   ? -16.777 -11.419 102.008 1.00 55.52  ? 4    PHE C CG  1 
ATOM   4504 C CD1 . PHE C 1 5   ? -16.061 -11.911 100.920 1.00 54.73  ? 4    PHE C CD1 1 
ATOM   4505 C CD2 . PHE C 1 5   ? -16.519 -10.128 102.451 1.00 54.14  ? 4    PHE C CD2 1 
ATOM   4506 C CE1 . PHE C 1 5   ? -15.104 -11.123 100.282 1.00 53.24  ? 4    PHE C CE1 1 
ATOM   4507 C CE2 . PHE C 1 5   ? -15.564 -9.334  101.820 1.00 52.44  ? 4    PHE C CE2 1 
ATOM   4508 C CZ  . PHE C 1 5   ? -14.857 -9.832  100.734 1.00 51.95  ? 4    PHE C CZ  1 
ATOM   4509 N N   . GLN C 1 6   ? -19.141 -15.124 102.119 1.00 57.34  ? 5    GLN C N   1 
ATOM   4510 C CA  . GLN C 1 6   ? -19.696 -16.350 102.669 1.00 58.04  ? 5    GLN C CA  1 
ATOM   4511 C C   . GLN C 1 6   ? -18.605 -17.036 103.487 1.00 57.15  ? 5    GLN C C   1 
ATOM   4512 O O   . GLN C 1 6   ? -17.567 -17.429 102.944 1.00 55.83  ? 5    GLN C O   1 
ATOM   4513 C CB  . GLN C 1 6   ? -20.143 -17.273 101.535 1.00 61.99  ? 5    GLN C CB  1 
ATOM   4514 C CG  . GLN C 1 6   ? -20.654 -18.629 101.988 1.00 66.37  ? 5    GLN C CG  1 
ATOM   4515 C CD  . GLN C 1 6   ? -22.109 -18.848 101.616 1.00 70.36  ? 5    GLN C CD  1 
ATOM   4516 O OE1 . GLN C 1 6   ? -22.445 -19.803 100.909 1.00 71.54  ? 5    GLN C OE1 1 
ATOM   4517 N NE2 . GLN C 1 6   ? -22.985 -17.959 102.088 1.00 71.31  ? 5    GLN C NE2 1 
ATOM   4518 N N   . LYS C 1 7   ? -18.821 -17.167 104.791 1.00 56.06  ? 6    LYS C N   1 
ATOM   4519 C CA  . LYS C 1 7   ? -17.827 -17.820 105.629 1.00 55.41  ? 6    LYS C CA  1 
ATOM   4520 C C   . LYS C 1 7   ? -17.726 -19.268 105.170 1.00 56.90  ? 6    LYS C C   1 
ATOM   4521 O O   . LYS C 1 7   ? -18.734 -19.920 104.908 1.00 55.57  ? 6    LYS C O   1 
ATOM   4522 C CB  . LYS C 1 7   ? -18.226 -17.736 107.104 1.00 54.12  ? 6    LYS C CB  1 
ATOM   4523 C CG  . LYS C 1 7   ? -17.189 -17.020 107.987 1.00 54.43  ? 6    LYS C CG  1 
ATOM   4524 C CD  . LYS C 1 7   ? -16.743 -15.654 107.414 1.00 52.00  ? 6    LYS C CD  1 
ATOM   4525 C CE  . LYS C 1 7   ? -17.908 -14.675 107.265 1.00 52.97  ? 6    LYS C CE  1 
ATOM   4526 N NZ  . LYS C 1 7   ? -17.505 -13.364 106.667 1.00 51.16  ? 6    LYS C NZ  1 
ATOM   4527 N N   . VAL C 1 8   ? -16.502 -19.763 105.050 1.00 58.62  ? 7    VAL C N   1 
ATOM   4528 C CA  . VAL C 1 8   ? -16.283 -21.125 104.590 1.00 61.04  ? 7    VAL C CA  1 
ATOM   4529 C C   . VAL C 1 8   ? -15.638 -22.030 105.630 1.00 63.24  ? 7    VAL C C   1 
ATOM   4530 O O   . VAL C 1 8   ? -16.065 -23.167 105.817 1.00 62.74  ? 7    VAL C O   1 
ATOM   4531 C CB  . VAL C 1 8   ? -15.380 -21.140 103.331 1.00 61.05  ? 7    VAL C CB  1 
ATOM   4532 C CG1 . VAL C 1 8   ? -15.012 -22.568 102.960 1.00 61.15  ? 7    VAL C CG1 1 
ATOM   4533 C CG2 . VAL C 1 8   ? -16.079 -20.447 102.180 1.00 59.83  ? 7    VAL C CG2 1 
ATOM   4534 N N   . GLU C 1 9   ? -14.623 -21.515 106.319 1.00 66.61  ? 8    GLU C N   1 
ATOM   4535 C CA  . GLU C 1 9   ? -13.885 -22.317 107.283 1.00 69.19  ? 8    GLU C CA  1 
ATOM   4536 C C   . GLU C 1 9   ? -12.872 -21.468 108.063 1.00 70.24  ? 8    GLU C C   1 
ATOM   4537 O O   . GLU C 1 9   ? -12.100 -20.724 107.461 1.00 71.14  ? 8    GLU C O   1 
ATOM   4538 C CB  . GLU C 1 9   ? -13.197 -23.425 106.471 1.00 70.26  ? 8    GLU C CB  1 
ATOM   4539 C CG  . GLU C 1 9   ? -11.944 -24.075 107.011 1.00 72.94  ? 8    GLU C CG  1 
ATOM   4540 C CD  . GLU C 1 9   ? -11.223 -24.855 105.909 1.00 74.82  ? 8    GLU C CD  1 
ATOM   4541 O OE1 . GLU C 1 9   ? -11.914 -25.347 104.990 1.00 75.42  ? 8    GLU C OE1 1 
ATOM   4542 O OE2 . GLU C 1 9   ? -9.977  -24.984 105.953 1.00 76.55  ? 8    GLU C OE2 1 
ATOM   4543 N N   . LYS C 1 10  ? -12.895 -21.546 109.394 1.00 71.15  ? 9    LYS C N   1 
ATOM   4544 C CA  . LYS C 1 10  ? -11.928 -20.804 110.204 1.00 72.30  ? 9    LYS C CA  1 
ATOM   4545 C C   . LYS C 1 10  ? -10.592 -21.453 109.877 1.00 73.17  ? 9    LYS C C   1 
ATOM   4546 O O   . LYS C 1 10  ? -10.395 -22.643 110.130 1.00 73.34  ? 9    LYS C O   1 
ATOM   4547 C CB  . LYS C 1 10  ? -12.218 -20.950 111.699 1.00 73.31  ? 9    LYS C CB  1 
ATOM   4548 C CG  . LYS C 1 10  ? -11.037 -20.547 112.580 1.00 75.51  ? 9    LYS C CG  1 
ATOM   4549 C CD  . LYS C 1 10  ? -11.315 -20.785 114.059 1.00 76.86  ? 9    LYS C CD  1 
ATOM   4550 C CE  . LYS C 1 10  ? -10.013 -20.866 114.869 1.00 77.63  ? 9    LYS C CE  1 
ATOM   4551 N NZ  . LYS C 1 10  ? -9.160  -22.038 114.465 1.00 77.82  ? 9    LYS C NZ  1 
ATOM   4552 N N   . ILE C 1 11  ? -9.669  -20.684 109.316 1.00 73.42  ? 10   ILE C N   1 
ATOM   4553 C CA  . ILE C 1 11  ? -8.400  -21.263 108.926 1.00 73.83  ? 10   ILE C CA  1 
ATOM   4554 C C   . ILE C 1 11  ? -7.236  -20.828 109.795 1.00 75.64  ? 10   ILE C C   1 
ATOM   4555 O O   . ILE C 1 11  ? -6.073  -20.894 109.397 1.00 74.91  ? 10   ILE C O   1 
ATOM   4556 C CB  . ILE C 1 11  ? -8.129  -20.981 107.426 1.00 72.92  ? 10   ILE C CB  1 
ATOM   4557 C CG1 . ILE C 1 11  ? -7.452  -22.196 106.801 1.00 72.89  ? 10   ILE C CG1 1 
ATOM   4558 C CG2 . ILE C 1 11  ? -7.288  -19.731 107.244 1.00 72.35  ? 10   ILE C CG2 1 
ATOM   4559 C CD1 . ILE C 1 11  ? -7.930  -22.487 105.402 1.00 72.99  ? 10   ILE C CD1 1 
ATOM   4560 N N   . GLY C 1 12  ? -7.555  -20.407 111.009 1.00 77.78  ? 11   GLY C N   1 
ATOM   4561 C CA  . GLY C 1 12  ? -6.507  -19.993 111.914 1.00 81.20  ? 11   GLY C CA  1 
ATOM   4562 C C   . GLY C 1 12  ? -6.899  -18.801 112.751 1.00 83.77  ? 11   GLY C C   1 
ATOM   4563 O O   . GLY C 1 12  ? -7.994  -18.264 112.629 1.00 83.60  ? 11   GLY C O   1 
ATOM   4564 N N   . GLU C 1 13  ? -5.985  -18.391 113.611 1.00 86.48  ? 12   GLU C N   1 
ATOM   4565 C CA  . GLU C 1 13  ? -6.213  -17.261 114.465 1.00 90.22  ? 12   GLU C CA  1 
ATOM   4566 C C   . GLU C 1 13  ? -4.962  -16.423 114.515 1.00 92.02  ? 12   GLU C C   1 
ATOM   4567 O O   . GLU C 1 13  ? -3.877  -16.934 114.767 1.00 92.23  ? 12   GLU C O   1 
ATOM   4568 C CB  . GLU C 1 13  ? -6.574  -17.725 115.865 1.00 90.29  ? 12   GLU C CB  1 
ATOM   4569 C CG  . GLU C 1 13  ? -7.933  -18.334 115.944 1.00 90.98  ? 12   GLU C CG  1 
ATOM   4570 C CD  . GLU C 1 13  ? -8.464  -18.287 117.340 1.00 91.41  ? 12   GLU C CD  1 
ATOM   4571 O OE1 . GLU C 1 13  ? -8.761  -17.167 117.811 1.00 91.00  ? 12   GLU C OE1 1 
ATOM   4572 O OE2 . GLU C 1 13  ? -8.570  -19.364 117.963 1.00 91.08  ? 12   GLU C OE2 1 
ATOM   4573 N N   . GLY C 1 14  ? -5.104  -15.133 114.240 1.00 94.25  ? 13   GLY C N   1 
ATOM   4574 C CA  . GLY C 1 14  ? -3.946  -14.252 114.297 1.00 96.40  ? 13   GLY C CA  1 
ATOM   4575 C C   . GLY C 1 14  ? -3.444  -14.148 115.723 1.00 98.00  ? 13   GLY C C   1 
ATOM   4576 O O   . GLY C 1 14  ? -3.878  -14.956 116.539 1.00 98.30  ? 13   GLY C O   1 
ATOM   4577 N N   . THR C 1 15  ? -2.587  -13.184 116.058 1.00 99.16  ? 14   THR C N   1 
ATOM   4578 C CA  . THR C 1 15  ? -2.101  -13.124 117.417 1.00 99.62  ? 14   THR C CA  1 
ATOM   4579 C C   . THR C 1 15  ? -3.219  -13.069 118.502 1.00 99.29  ? 14   THR C C   1 
ATOM   4580 O O   . THR C 1 15  ? -3.045  -13.534 119.609 1.00 99.81  ? 14   THR C O   1 
ATOM   4581 C CB  . THR C 1 15  ? -1.203  -11.939 117.678 1.00 100.08 ? 14   THR C CB  1 
ATOM   4582 O OG1 . THR C 1 15  ? -0.324  -11.690 116.543 1.00 100.52 ? 14   THR C OG1 1 
ATOM   4583 C CG2 . THR C 1 15  ? -0.386  -12.144 118.966 1.00 99.98  ? 14   THR C CG2 1 
ATOM   4584 N N   . TYR C 1 16  ? -4.336  -12.522 118.017 1.00 97.63  ? 15   TYR C N   1 
ATOM   4585 C CA  . TYR C 1 16  ? -5.516  -12.362 118.806 1.00 96.05  ? 15   TYR C CA  1 
ATOM   4586 C C   . TYR C 1 16  ? -6.739  -12.868 118.038 1.00 94.24  ? 15   TYR C C   1 
ATOM   4587 O O   . TYR C 1 16  ? -7.110  -14.035 118.169 1.00 94.25  ? 15   TYR C O   1 
ATOM   4588 C CB  . TYR C 1 16  ? -5.715  -10.893 119.267 1.00 97.30  ? 15   TYR C CB  1 
ATOM   4589 C CG  . TYR C 1 16  ? -5.773  -10.676 120.774 1.00 98.78  ? 15   TYR C CG  1 
ATOM   4590 C CD1 . TYR C 1 16  ? -5.673  -9.392  121.334 1.00 98.99  ? 15   TYR C CD1 1 
ATOM   4591 C CD2 . TYR C 1 16  ? -5.904  -11.758 121.636 1.00 99.24  ? 15   TYR C CD2 1 
ATOM   4592 C CE1 . TYR C 1 16  ? -5.698  -9.226  122.722 1.00 99.99  ? 15   TYR C CE1 1 
ATOM   4593 C CE2 . TYR C 1 16  ? -5.931  -11.600 123.035 1.00 99.80  ? 15   TYR C CE2 1 
ATOM   4594 C CZ  . TYR C 1 16  ? -5.821  -10.315 123.571 1.00 100.26 ? 15   TYR C CZ  1 
ATOM   4595 O OH  . TYR C 1 16  ? -5.798  -10.129 124.950 1.00 100.09 ? 15   TYR C OH  1 
ATOM   4596 N N   . GLY C 1 17  ? -7.330  -12.016 117.206 1.00 91.70  ? 16   GLY C N   1 
ATOM   4597 C CA  . GLY C 1 17  ? -8.485  -12.389 116.406 1.00 86.66  ? 16   GLY C CA  1 
ATOM   4598 C C   . GLY C 1 17  ? -8.479  -13.705 115.638 1.00 82.81  ? 16   GLY C C   1 
ATOM   4599 O O   . GLY C 1 17  ? -7.771  -14.659 115.995 1.00 82.67  ? 16   GLY C O   1 
ATOM   4600 N N   . VAL C 1 18  ? -9.274  -13.761 114.567 1.00 79.12  ? 17   VAL C N   1 
ATOM   4601 C CA  . VAL C 1 18  ? -9.361  -14.968 113.740 1.00 75.61  ? 17   VAL C CA  1 
ATOM   4602 C C   . VAL C 1 18  ? -9.232  -14.689 112.241 1.00 71.92  ? 17   VAL C C   1 
ATOM   4603 O O   . VAL C 1 18  ? -9.527  -13.595 111.763 1.00 69.49  ? 17   VAL C O   1 
ATOM   4604 C CB  . VAL C 1 18  ? -10.694 -15.706 113.962 1.00 76.01  ? 17   VAL C CB  1 
ATOM   4605 C CG1 . VAL C 1 18  ? -10.685 -17.031 113.204 1.00 76.48  ? 17   VAL C CG1 1 
ATOM   4606 C CG2 . VAL C 1 18  ? -10.932 -15.935 115.444 1.00 76.69  ? 17   VAL C CG2 1 
ATOM   4607 N N   . VAL C 1 19  ? -8.789  -15.706 111.512 1.00 68.63  ? 18   VAL C N   1 
ATOM   4608 C CA  . VAL C 1 19  ? -8.655  -15.616 110.067 1.00 66.20  ? 18   VAL C CA  1 
ATOM   4609 C C   . VAL C 1 19  ? -9.560  -16.664 109.422 1.00 63.55  ? 18   VAL C C   1 
ATOM   4610 O O   . VAL C 1 19  ? -9.420  -17.862 109.676 1.00 62.45  ? 18   VAL C O   1 
ATOM   4611 C CB  . VAL C 1 19  ? -7.213  -15.859 109.614 1.00 66.26  ? 18   VAL C CB  1 
ATOM   4612 C CG1 . VAL C 1 19  ? -7.131  -15.818 108.099 1.00 66.65  ? 18   VAL C CG1 1 
ATOM   4613 C CG2 . VAL C 1 19  ? -6.306  -14.815 110.219 1.00 67.12  ? 18   VAL C CG2 1 
ATOM   4614 N N   . TYR C 1 20  ? -10.497 -16.203 108.601 1.00 59.96  ? 19   TYR C N   1 
ATOM   4615 C CA  . TYR C 1 20  ? -11.420 -17.103 107.939 1.00 58.34  ? 19   TYR C CA  1 
ATOM   4616 C C   . TYR C 1 20  ? -11.214 -17.200 106.438 1.00 56.29  ? 19   TYR C C   1 
ATOM   4617 O O   . TYR C 1 20  ? -10.804 -16.244 105.781 1.00 55.29  ? 19   TYR C O   1 
ATOM   4618 C CB  . TYR C 1 20  ? -12.868 -16.670 108.176 1.00 59.89  ? 19   TYR C CB  1 
ATOM   4619 C CG  . TYR C 1 20  ? -13.280 -16.520 109.621 1.00 63.49  ? 19   TYR C CG  1 
ATOM   4620 C CD1 . TYR C 1 20  ? -13.189 -15.284 110.266 1.00 65.86  ? 19   TYR C CD1 1 
ATOM   4621 C CD2 . TYR C 1 20  ? -13.775 -17.606 110.345 1.00 63.51  ? 19   TYR C CD2 1 
ATOM   4622 C CE1 . TYR C 1 20  ? -13.585 -15.129 111.598 1.00 65.89  ? 19   TYR C CE1 1 
ATOM   4623 C CE2 . TYR C 1 20  ? -14.170 -17.463 111.679 1.00 64.79  ? 19   TYR C CE2 1 
ATOM   4624 C CZ  . TYR C 1 20  ? -14.073 -16.220 112.296 1.00 65.76  ? 19   TYR C CZ  1 
ATOM   4625 O OH  . TYR C 1 20  ? -14.462 -16.061 113.606 1.00 65.96  ? 19   TYR C OH  1 
ATOM   4626 N N   . LYS C 1 21  ? -11.486 -18.376 105.895 1.00 54.12  ? 20   LYS C N   1 
ATOM   4627 C CA  . LYS C 1 21  ? -11.412 -18.543 104.463 1.00 52.65  ? 20   LYS C CA  1 
ATOM   4628 C C   . LYS C 1 21  ? -12.859 -18.390 104.013 1.00 52.21  ? 20   LYS C C   1 
ATOM   4629 O O   . LYS C 1 21  ? -13.668 -19.290 104.202 1.00 53.91  ? 20   LYS C O   1 
ATOM   4630 C CB  . LYS C 1 21  ? -10.909 -19.929 104.073 1.00 53.35  ? 20   LYS C CB  1 
ATOM   4631 C CG  . LYS C 1 21  ? -11.421 -20.358 102.700 1.00 53.03  ? 20   LYS C CG  1 
ATOM   4632 C CD  . LYS C 1 21  ? -10.895 -21.690 102.231 1.00 52.17  ? 20   LYS C CD  1 
ATOM   4633 C CE  . LYS C 1 21  ? -11.649 -22.116 100.985 1.00 52.48  ? 20   LYS C CE  1 
ATOM   4634 N NZ  . LYS C 1 21  ? -10.955 -23.214 100.247 1.00 56.49  ? 20   LYS C NZ  1 
ATOM   4635 N N   . ALA C 1 22  ? -13.195 -17.241 103.447 1.00 49.89  ? 21   ALA C N   1 
ATOM   4636 C CA  . ALA C 1 22  ? -14.549 -17.019 102.976 1.00 48.08  ? 21   ALA C CA  1 
ATOM   4637 C C   . ALA C 1 22  ? -14.493 -16.858 101.463 1.00 47.27  ? 21   ALA C C   1 
ATOM   4638 O O   . ALA C 1 22  ? -13.454 -17.105 100.845 1.00 44.88  ? 21   ALA C O   1 
ATOM   4639 C CB  . ALA C 1 22  ? -15.125 -15.778 103.626 1.00 48.12  ? 21   ALA C CB  1 
ATOM   4640 N N   . ARG C 1 23  ? -15.606 -16.455 100.861 1.00 47.99  ? 22   ARG C N   1 
ATOM   4641 C CA  . ARG C 1 23  ? -15.635 -16.262 99.420  1.00 49.29  ? 22   ARG C CA  1 
ATOM   4642 C C   . ARG C 1 23  ? -16.731 -15.308 98.947  1.00 48.32  ? 22   ARG C C   1 
ATOM   4643 O O   . ARG C 1 23  ? -17.780 -15.156 99.582  1.00 47.57  ? 22   ARG C O   1 
ATOM   4644 C CB  . ARG C 1 23  ? -15.777 -17.608 98.705  1.00 52.45  ? 22   ARG C CB  1 
ATOM   4645 C CG  . ARG C 1 23  ? -17.065 -18.322 99.008  1.00 57.13  ? 22   ARG C CG  1 
ATOM   4646 C CD  . ARG C 1 23  ? -17.623 -18.959 97.757  1.00 64.06  ? 22   ARG C CD  1 
ATOM   4647 N NE  . ARG C 1 23  ? -19.073 -19.131 97.851  1.00 70.28  ? 22   ARG C NE  1 
ATOM   4648 C CZ  . ARG C 1 23  ? -19.903 -19.069 96.811  1.00 72.52  ? 22   ARG C CZ  1 
ATOM   4649 N NH1 . ARG C 1 23  ? -21.208 -19.237 96.996  1.00 71.67  ? 22   ARG C NH1 1 
ATOM   4650 N NH2 . ARG C 1 23  ? -19.432 -18.830 95.587  1.00 73.33  ? 22   ARG C NH2 1 
ATOM   4651 N N   . ASN C 1 24  ? -16.464 -14.687 97.805  1.00 46.78  ? 23   ASN C N   1 
ATOM   4652 C CA  . ASN C 1 24  ? -17.358 -13.723 97.187  1.00 45.45  ? 23   ASN C CA  1 
ATOM   4653 C C   . ASN C 1 24  ? -18.489 -14.388 96.418  1.00 45.19  ? 23   ASN C C   1 
ATOM   4654 O O   . ASN C 1 24  ? -18.263 -15.023 95.384  1.00 44.71  ? 23   ASN C O   1 
ATOM   4655 C CB  . ASN C 1 24  ? -16.559 -12.830 96.232  1.00 44.99  ? 23   ASN C CB  1 
ATOM   4656 C CG  . ASN C 1 24  ? -17.311 -11.572 95.842  1.00 44.66  ? 23   ASN C CG  1 
ATOM   4657 O OD1 . ASN C 1 24  ? -18.486 -11.622 95.465  1.00 39.60  ? 23   ASN C OD1 1 
ATOM   4658 N ND2 . ASN C 1 24  ? -16.628 -10.431 95.925  1.00 42.66  ? 23   ASN C ND2 1 
ATOM   4659 N N   . LYS C 1 25  ? -19.710 -14.213 96.916  1.00 46.36  ? 24   LYS C N   1 
ATOM   4660 C CA  . LYS C 1 25  ? -20.899 -14.782 96.292  1.00 45.84  ? 24   LYS C CA  1 
ATOM   4661 C C   . LYS C 1 25  ? -21.117 -14.311 94.861  1.00 46.28  ? 24   LYS C C   1 
ATOM   4662 O O   . LYS C 1 25  ? -21.536 -15.086 93.996  1.00 47.47  ? 24   LYS C O   1 
ATOM   4663 C CB  . LYS C 1 25  ? -22.137 -14.446 97.123  1.00 47.20  ? 24   LYS C CB  1 
ATOM   4664 C CG  . LYS C 1 25  ? -22.318 -15.338 98.336  1.00 51.69  ? 24   LYS C CG  1 
ATOM   4665 C CD  . LYS C 1 25  ? -22.418 -14.546 99.639  1.00 53.26  ? 24   LYS C CD  1 
ATOM   4666 C CE  . LYS C 1 25  ? -23.864 -14.282 100.030 1.00 54.57  ? 24   LYS C CE  1 
ATOM   4667 N NZ  . LYS C 1 25  ? -23.962 -13.607 101.361 1.00 56.33  ? 24   LYS C NZ  1 
ATOM   4668 N N   . LEU C 1 26  ? -20.828 -13.038 94.613  1.00 45.00  ? 25   LEU C N   1 
ATOM   4669 C CA  . LEU C 1 26  ? -21.030 -12.460 93.295  1.00 43.49  ? 25   LEU C CA  1 
ATOM   4670 C C   . LEU C 1 26  ? -19.955 -12.766 92.264  1.00 43.64  ? 25   LEU C C   1 
ATOM   4671 O O   . LEU C 1 26  ? -20.257 -12.906 91.079  1.00 44.64  ? 25   LEU C O   1 
ATOM   4672 C CB  . LEU C 1 26  ? -21.197 -10.949 93.427  1.00 42.17  ? 25   LEU C CB  1 
ATOM   4673 C CG  . LEU C 1 26  ? -22.447 -10.522 94.196  1.00 39.91  ? 25   LEU C CG  1 
ATOM   4674 C CD1 . LEU C 1 26  ? -22.337 -9.060  94.589  1.00 39.44  ? 25   LEU C CD1 1 
ATOM   4675 C CD2 . LEU C 1 26  ? -23.673 -10.773 93.344  1.00 35.89  ? 25   LEU C CD2 1 
ATOM   4676 N N   . THR C 1 27  ? -18.705 -12.872 92.703  1.00 43.50  ? 26   THR C N   1 
ATOM   4677 C CA  . THR C 1 27  ? -17.614 -13.140 91.775  1.00 42.47  ? 26   THR C CA  1 
ATOM   4678 C C   . THR C 1 27  ? -17.049 -14.552 91.901  1.00 43.17  ? 26   THR C C   1 
ATOM   4679 O O   . THR C 1 27  ? -16.416 -15.067 90.970  1.00 43.31  ? 26   THR C O   1 
ATOM   4680 C CB  . THR C 1 27  ? -16.479 -12.146 91.980  1.00 41.35  ? 26   THR C CB  1 
ATOM   4681 O OG1 . THR C 1 27  ? -15.949 -12.305 93.297  1.00 41.61  ? 26   THR C OG1 1 
ATOM   4682 C CG2 . THR C 1 27  ? -16.991 -10.721 91.822  1.00 44.63  ? 26   THR C CG2 1 
ATOM   4683 N N   . GLY C 1 28  ? -17.277 -15.173 93.052  1.00 41.94  ? 27   GLY C N   1 
ATOM   4684 C CA  . GLY C 1 28  ? -16.778 -16.515 93.265  1.00 43.18  ? 27   GLY C CA  1 
ATOM   4685 C C   . GLY C 1 28  ? -15.405 -16.539 93.895  1.00 44.09  ? 27   GLY C C   1 
ATOM   4686 O O   . GLY C 1 28  ? -14.979 -17.563 94.426  1.00 45.54  ? 27   GLY C O   1 
ATOM   4687 N N   . GLU C 1 29  ? -14.710 -15.406 93.839  1.00 44.96  ? 28   GLU C N   1 
ATOM   4688 C CA  . GLU C 1 29  ? -13.372 -15.293 94.401  1.00 41.88  ? 28   GLU C CA  1 
ATOM   4689 C C   . GLU C 1 29  ? -13.304 -15.801 95.834  1.00 41.62  ? 28   GLU C C   1 
ATOM   4690 O O   . GLU C 1 29  ? -14.212 -15.574 96.633  1.00 40.62  ? 28   GLU C O   1 
ATOM   4691 C CB  . GLU C 1 29  ? -12.899 -13.839 94.361  1.00 41.23  ? 28   GLU C CB  1 
ATOM   4692 C CG  . GLU C 1 29  ? -11.506 -13.637 94.963  1.00 42.59  ? 28   GLU C CG  1 
ATOM   4693 C CD  . GLU C 1 29  ? -11.053 -12.184 94.965  1.00 44.66  ? 28   GLU C CD  1 
ATOM   4694 O OE1 . GLU C 1 29  ? -11.890 -11.299 95.280  1.00 46.50  ? 28   GLU C OE1 1 
ATOM   4695 O OE2 . GLU C 1 29  ? -9.858  -11.932 94.669  1.00 40.78  ? 28   GLU C OE2 1 
ATOM   4696 N N   . VAL C 1 30  ? -12.211 -16.488 96.148  1.00 41.71  ? 29   VAL C N   1 
ATOM   4697 C CA  . VAL C 1 30  ? -11.992 -17.027 97.485  1.00 41.25  ? 29   VAL C CA  1 
ATOM   4698 C C   . VAL C 1 30  ? -10.977 -16.137 98.200  1.00 40.21  ? 29   VAL C C   1 
ATOM   4699 O O   . VAL C 1 30  ? -9.947  -15.768 97.632  1.00 38.14  ? 29   VAL C O   1 
ATOM   4700 C CB  . VAL C 1 30  ? -11.454 -18.490 97.418  1.00 41.58  ? 29   VAL C CB  1 
ATOM   4701 C CG1 . VAL C 1 30  ? -11.482 -19.137 98.809  1.00 39.24  ? 29   VAL C CG1 1 
ATOM   4702 C CG2 . VAL C 1 30  ? -12.275 -19.297 96.419  1.00 37.07  ? 29   VAL C CG2 1 
ATOM   4703 N N   . VAL C 1 31  ? -11.265 -15.799 99.450  1.00 40.82  ? 30   VAL C N   1 
ATOM   4704 C CA  . VAL C 1 31  ? -10.376 -14.929 100.205 1.00 42.64  ? 30   VAL C CA  1 
ATOM   4705 C C   . VAL C 1 31  ? -10.199 -15.316 101.669 1.00 44.44  ? 30   VAL C C   1 
ATOM   4706 O O   . VAL C 1 31  ? -10.927 -16.154 102.202 1.00 46.44  ? 30   VAL C O   1 
ATOM   4707 C CB  . VAL C 1 31  ? -10.886 -13.479 100.175 1.00 41.67  ? 30   VAL C CB  1 
ATOM   4708 C CG1 . VAL C 1 31  ? -10.868 -12.943 98.747  1.00 40.44  ? 30   VAL C CG1 1 
ATOM   4709 C CG2 . VAL C 1 31  ? -12.285 -13.424 100.764 1.00 39.13  ? 30   VAL C CG2 1 
ATOM   4710 N N   . ALA C 1 32  ? -9.221  -14.689 102.314 1.00 44.12  ? 31   ALA C N   1 
ATOM   4711 C CA  . ALA C 1 32  ? -8.956  -14.931 103.720 1.00 43.64  ? 31   ALA C CA  1 
ATOM   4712 C C   . ALA C 1 32  ? -9.265  -13.626 104.433 1.00 43.97  ? 31   ALA C C   1 
ATOM   4713 O O   . ALA C 1 32  ? -8.726  -12.577 104.089 1.00 44.99  ? 31   ALA C O   1 
ATOM   4714 C CB  . ALA C 1 32  ? -7.512  -15.308 103.921 1.00 42.42  ? 31   ALA C CB  1 
ATOM   4715 N N   . LEU C 1 33  ? -10.153 -13.689 105.413 1.00 43.98  ? 32   LEU C N   1 
ATOM   4716 C CA  . LEU C 1 33  ? -10.534 -12.507 106.159 1.00 44.70  ? 32   LEU C CA  1 
ATOM   4717 C C   . LEU C 1 33  ? -9.862  -12.502 107.512 1.00 46.47  ? 32   LEU C C   1 
ATOM   4718 O O   . LEU C 1 33  ? -9.853  -13.513 108.221 1.00 45.72  ? 32   LEU C O   1 
ATOM   4719 C CB  . LEU C 1 33  ? -12.047 -12.463 106.385 1.00 42.32  ? 32   LEU C CB  1 
ATOM   4720 C CG  . LEU C 1 33  ? -13.000 -12.511 105.198 1.00 41.49  ? 32   LEU C CG  1 
ATOM   4721 C CD1 . LEU C 1 33  ? -14.407 -12.568 105.731 1.00 41.24  ? 32   LEU C CD1 1 
ATOM   4722 C CD2 . LEU C 1 33  ? -12.819 -11.300 104.301 1.00 42.58  ? 32   LEU C CD2 1 
ATOM   4723 N N   . LYS C 1 34  ? -9.293  -11.355 107.862 1.00 46.93  ? 33   LYS C N   1 
ATOM   4724 C CA  . LYS C 1 34  ? -8.668  -11.191 109.156 1.00 47.17  ? 33   LYS C CA  1 
ATOM   4725 C C   . LYS C 1 34  ? -9.556  -10.162 109.831 1.00 49.36  ? 33   LYS C C   1 
ATOM   4726 O O   . LYS C 1 34  ? -9.834  -9.103  109.282 1.00 50.53  ? 33   LYS C O   1 
ATOM   4727 C CB  . LYS C 1 34  ? -7.233  -10.678 109.026 1.00 44.97  ? 33   LYS C CB  1 
ATOM   4728 C CG  . LYS C 1 34  ? -6.505  -10.636 110.352 1.00 41.28  ? 33   LYS C CG  1 
ATOM   4729 C CD  . LYS C 1 34  ? -5.095  -10.088 110.246 1.00 37.47  ? 33   LYS C CD  1 
ATOM   4730 C CE  . LYS C 1 34  ? -4.144  -11.080 109.616 1.00 39.01  ? 33   LYS C CE  1 
ATOM   4731 N NZ  . LYS C 1 34  ? -2.735  -10.786 110.017 1.00 36.66  ? 33   LYS C NZ  1 
ATOM   4732 N N   . LYS C 1 35  ? -10.027 -10.501 111.015 1.00 52.90  ? 34   LYS C N   1 
ATOM   4733 C CA  . LYS C 1 35  ? -10.907 -9.642  111.775 1.00 56.30  ? 34   LYS C CA  1 
ATOM   4734 C C   . LYS C 1 35  ? -10.129 -8.996  112.927 1.00 59.41  ? 34   LYS C C   1 
ATOM   4735 O O   . LYS C 1 35  ? -9.361  -9.668  113.621 1.00 58.89  ? 34   LYS C O   1 
ATOM   4736 C CB  . LYS C 1 35  ? -12.051 -10.500 112.294 1.00 58.15  ? 34   LYS C CB  1 
ATOM   4737 C CG  . LYS C 1 35  ? -13.025 -9.818  113.196 1.00 61.15  ? 34   LYS C CG  1 
ATOM   4738 C CD  . LYS C 1 35  ? -13.905 -10.870 113.846 1.00 63.99  ? 34   LYS C CD  1 
ATOM   4739 C CE  . LYS C 1 35  ? -14.907 -10.222 114.753 1.00 65.99  ? 34   LYS C CE  1 
ATOM   4740 N NZ  . LYS C 1 35  ? -14.229 -9.176  115.564 1.00 66.94  ? 34   LYS C NZ  1 
ATOM   4741 N N   . ILE C 1 36  ? -10.325 -7.690  113.112 1.00 61.62  ? 35   ILE C N   1 
ATOM   4742 C CA  . ILE C 1 36  ? -9.645  -6.933  114.160 1.00 63.67  ? 35   ILE C CA  1 
ATOM   4743 C C   . ILE C 1 36  ? -10.650 -6.129  114.988 1.00 67.07  ? 35   ILE C C   1 
ATOM   4744 O O   . ILE C 1 36  ? -11.252 -5.175  114.491 1.00 66.91  ? 35   ILE C O   1 
ATOM   4745 C CB  . ILE C 1 36  ? -8.633  -5.945  113.553 1.00 63.21  ? 35   ILE C CB  1 
ATOM   4746 C CG1 . ILE C 1 36  ? -7.684  -6.676  112.614 1.00 62.37  ? 35   ILE C CG1 1 
ATOM   4747 C CG2 . ILE C 1 36  ? -7.831  -5.275  114.651 1.00 63.65  ? 35   ILE C CG2 1 
ATOM   4748 C CD1 . ILE C 1 36  ? -6.881  -5.738  111.765 1.00 62.85  ? 35   ILE C CD1 1 
ATOM   4749 N N   . ARG C 1 37  ? -10.825 -6.512  116.250 1.00 71.02  ? 36   ARG C N   1 
ATOM   4750 C CA  . ARG C 1 37  ? -11.754 -5.820  117.145 1.00 74.40  ? 36   ARG C CA  1 
ATOM   4751 C C   . ARG C 1 37  ? -11.148 -4.530  117.693 1.00 75.54  ? 36   ARG C C   1 
ATOM   4752 O O   . ARG C 1 37  ? -9.997  -4.514  118.144 1.00 74.96  ? 36   ARG C O   1 
ATOM   4753 C CB  . ARG C 1 37  ? -12.148 -6.735  118.308 1.00 75.84  ? 36   ARG C CB  1 
ATOM   4754 C CG  . ARG C 1 37  ? -13.034 -7.900  117.903 1.00 78.92  ? 36   ARG C CG  1 
ATOM   4755 C CD  . ARG C 1 37  ? -12.951 -9.041  118.906 1.00 81.66  ? 36   ARG C CD  1 
ATOM   4756 N NE  . ARG C 1 37  ? -12.800 -10.334 118.235 1.00 84.55  ? 36   ARG C NE  1 
ATOM   4757 C CZ  . ARG C 1 37  ? -13.788 -11.014 117.655 1.00 85.65  ? 36   ARG C CZ  1 
ATOM   4758 N NH1 . ARG C 1 37  ? -15.031 -10.541 117.660 1.00 85.23  ? 36   ARG C NH1 1 
ATOM   4759 N NH2 . ARG C 1 37  ? -13.529 -12.168 117.050 1.00 85.75  ? 36   ARG C NH2 1 
ATOM   4760 N N   . LEU C 1 38  ? -11.927 -3.450  117.637 1.00 76.63  ? 37   LEU C N   1 
ATOM   4761 C CA  . LEU C 1 38  ? -11.492 -2.146  118.139 1.00 78.58  ? 37   LEU C CA  1 
ATOM   4762 C C   . LEU C 1 38  ? -12.460 -1.749  119.254 1.00 81.18  ? 37   LEU C C   1 
ATOM   4763 O O   . LEU C 1 38  ? -12.049 -1.341  120.348 1.00 81.12  ? 37   LEU C O   1 
ATOM   4764 C CB  . LEU C 1 38  ? -11.557 -1.090  117.034 1.00 76.65  ? 37   LEU C CB  1 
ATOM   4765 C CG  . LEU C 1 38  ? -11.620 -1.528  115.572 1.00 75.16  ? 37   LEU C CG  1 
ATOM   4766 C CD1 . LEU C 1 38  ? -12.654 -0.680  114.849 1.00 73.91  ? 37   LEU C CD1 1 
ATOM   4767 C CD2 . LEU C 1 38  ? -10.254 -1.392  114.919 1.00 74.04  ? 37   LEU C CD2 1 
ATOM   4768 N N   . ASP C 1 39  ? -13.752 -1.863  118.943 1.00 83.93  ? 38   ASP C N   1 
ATOM   4769 C CA  . ASP C 1 39  ? -14.848 -1.553  119.868 1.00 85.79  ? 38   ASP C CA  1 
ATOM   4770 C C   . ASP C 1 39  ? -14.935 -0.092  120.332 1.00 85.45  ? 38   ASP C C   1 
ATOM   4771 O O   . ASP C 1 39  ? -15.895 0.294   121.007 1.00 86.00  ? 38   ASP C O   1 
ATOM   4772 C CB  . ASP C 1 39  ? -14.778 -2.491  121.081 1.00 87.91  ? 38   ASP C CB  1 
ATOM   4773 C CG  . ASP C 1 39  ? -14.971 -3.954  120.699 1.00 90.21  ? 38   ASP C CG  1 
ATOM   4774 O OD1 . ASP C 1 39  ? -16.106 -4.329  120.321 1.00 90.41  ? 38   ASP C OD1 1 
ATOM   4775 O OD2 . ASP C 1 39  ? -13.982 -4.723  120.769 1.00 90.07  ? 38   ASP C OD2 1 
ATOM   4776 N N   . THR C 1 40  ? -13.937 0.708   119.961 1.00 83.75  ? 39   THR C N   1 
ATOM   4777 C CA  . THR C 1 40  ? -13.876 2.126   120.302 1.00 80.99  ? 39   THR C CA  1 
ATOM   4778 C C   . THR C 1 40  ? -13.337 2.380   121.703 1.00 78.97  ? 39   THR C C   1 
ATOM   4779 O O   . THR C 1 40  ? -12.333 1.782   122.086 1.00 78.78  ? 39   THR C O   1 
ATOM   4780 C CB  . THR C 1 40  ? -15.254 2.803   120.134 1.00 82.05  ? 39   THR C CB  1 
ATOM   4781 O OG1 . THR C 1 40  ? -15.792 2.450   118.854 1.00 83.30  ? 39   THR C OG1 1 
ATOM   4782 C CG2 . THR C 1 40  ? -15.126 4.329   120.202 1.00 81.65  ? 39   THR C CG2 1 
ATOM   4783 N N   . GLU C 1 41  ? -14.002 3.254   122.460 1.00 76.81  ? 40   GLU C N   1 
ATOM   4784 C CA  . GLU C 1 41  ? -13.551 3.617   123.800 1.00 75.11  ? 40   GLU C CA  1 
ATOM   4785 C C   . GLU C 1 41  ? -12.781 2.568   124.584 1.00 72.36  ? 40   GLU C C   1 
ATOM   4786 O O   . GLU C 1 41  ? -13.331 1.556   125.019 1.00 74.23  ? 40   GLU C O   1 
ATOM   4787 C CB  . GLU C 1 41  ? -14.703 4.118   124.668 1.00 78.35  ? 40   GLU C CB  1 
ATOM   4788 C CG  . GLU C 1 41  ? -14.351 4.116   126.166 1.00 83.39  ? 40   GLU C CG  1 
ATOM   4789 C CD  . GLU C 1 41  ? -13.035 4.839   126.513 1.00 85.92  ? 40   GLU C CD  1 
ATOM   4790 O OE1 . GLU C 1 41  ? -12.136 4.946   125.654 1.00 87.53  ? 40   GLU C OE1 1 
ATOM   4791 O OE2 . GLU C 1 41  ? -12.889 5.292   127.671 1.00 88.66  ? 40   GLU C OE2 1 
ATOM   4792 N N   . THR C 1 42  ? -11.498 2.869   124.764 1.00 67.74  ? 41   THR C N   1 
ATOM   4793 C CA  . THR C 1 42  ? -10.503 2.075   125.476 1.00 63.27  ? 41   THR C CA  1 
ATOM   4794 C C   . THR C 1 42  ? -9.180  2.610   124.925 1.00 61.46  ? 41   THR C C   1 
ATOM   4795 O O   . THR C 1 42  ? -8.580  3.502   125.527 1.00 61.50  ? 41   THR C O   1 
ATOM   4796 C CB  . THR C 1 42  ? -10.614 0.554   125.193 1.00 62.76  ? 41   THR C CB  1 
ATOM   4797 O OG1 . THR C 1 42  ? -11.774 0.015   125.845 1.00 60.08  ? 41   THR C OG1 1 
ATOM   4798 C CG2 . THR C 1 42  ? -9.390  -0.167  125.713 1.00 61.97  ? 41   THR C CG2 1 
ATOM   4799 N N   . GLU C 1 43  ? -8.746  2.102   123.769 1.00 57.51  ? 42   GLU C N   1 
ATOM   4800 C CA  . GLU C 1 43  ? -7.499  2.570   123.168 1.00 54.13  ? 42   GLU C CA  1 
ATOM   4801 C C   . GLU C 1 43  ? -7.483  2.685   121.639 1.00 51.65  ? 42   GLU C C   1 
ATOM   4802 O O   . GLU C 1 43  ? -6.420  2.867   121.046 1.00 51.14  ? 42   GLU C O   1 
ATOM   4803 C CB  . GLU C 1 43  ? -6.325  1.695   123.624 1.00 54.49  ? 42   GLU C CB  1 
ATOM   4804 C CG  . GLU C 1 43  ? -5.941  1.829   125.111 1.00 54.33  ? 42   GLU C CG  1 
ATOM   4805 C CD  . GLU C 1 43  ? -5.480  3.235   125.510 1.00 54.05  ? 42   GLU C CD  1 
ATOM   4806 O OE1 . GLU C 1 43  ? -4.682  3.853   124.767 1.00 53.65  ? 42   GLU C OE1 1 
ATOM   4807 O OE2 . GLU C 1 43  ? -5.902  3.713   126.583 1.00 52.80  ? 42   GLU C OE2 1 
ATOM   4808 N N   . GLY C 1 44  ? -8.649  2.580   121.005 1.00 49.71  ? 43   GLY C N   1 
ATOM   4809 C CA  . GLY C 1 44  ? -8.737  2.710   119.552 1.00 47.90  ? 43   GLY C CA  1 
ATOM   4810 C C   . GLY C 1 44  ? -8.134  1.613   118.682 1.00 46.64  ? 43   GLY C C   1 
ATOM   4811 O O   . GLY C 1 44  ? -7.893  0.507   119.151 1.00 49.13  ? 43   GLY C O   1 
ATOM   4812 N N   . VAL C 1 45  ? -7.900  1.915   117.407 1.00 44.50  ? 44   VAL C N   1 
ATOM   4813 C CA  . VAL C 1 45  ? -7.316  0.950   116.479 1.00 42.16  ? 44   VAL C CA  1 
ATOM   4814 C C   . VAL C 1 45  ? -5.911  0.611   116.954 1.00 42.42  ? 44   VAL C C   1 
ATOM   4815 O O   . VAL C 1 45  ? -5.129  1.506   117.253 1.00 44.22  ? 44   VAL C O   1 
ATOM   4816 C CB  . VAL C 1 45  ? -7.223  1.526   115.041 1.00 42.28  ? 44   VAL C CB  1 
ATOM   4817 C CG1 . VAL C 1 45  ? -6.605  0.499   114.101 1.00 39.63  ? 44   VAL C CG1 1 
ATOM   4818 C CG2 . VAL C 1 45  ? -8.603  1.925   114.542 1.00 43.14  ? 44   VAL C CG2 1 
ATOM   4819 N N   . PRO C 1 46  ? -5.575  -0.687  117.042 1.00 42.15  ? 45   PRO C N   1 
ATOM   4820 C CA  . PRO C 1 46  ? -4.243  -1.110  117.489 1.00 41.84  ? 45   PRO C CA  1 
ATOM   4821 C C   . PRO C 1 46  ? -3.111  -0.853  116.496 1.00 43.10  ? 45   PRO C C   1 
ATOM   4822 O O   . PRO C 1 46  ? -3.278  -1.027  115.293 1.00 45.23  ? 45   PRO C O   1 
ATOM   4823 C CB  . PRO C 1 46  ? -4.439  -2.594  117.796 1.00 40.51  ? 45   PRO C CB  1 
ATOM   4824 C CG  . PRO C 1 46  ? -5.516  -2.997  116.860 1.00 40.38  ? 45   PRO C CG  1 
ATOM   4825 C CD  . PRO C 1 46  ? -6.484  -1.846  116.949 1.00 40.68  ? 45   PRO C CD  1 
ATOM   4826 N N   . SER C 1 47  ? -1.958  -0.447  117.024 1.00 43.92  ? 46   SER C N   1 
ATOM   4827 C CA  . SER C 1 47  ? -0.770  -0.132  116.231 1.00 43.90  ? 46   SER C CA  1 
ATOM   4828 C C   . SER C 1 47  ? -0.329  -1.176  115.199 1.00 43.95  ? 46   SER C C   1 
ATOM   4829 O O   . SER C 1 47  ? 0.076   -0.818  114.093 1.00 42.64  ? 46   SER C O   1 
ATOM   4830 C CB  . SER C 1 47  ? 0.398   0.154   117.161 1.00 44.95  ? 46   SER C CB  1 
ATOM   4831 O OG  . SER C 1 47  ? 0.674   -0.985  117.953 1.00 50.40  ? 46   SER C OG  1 
ATOM   4832 N N   . THR C 1 48  ? -0.385  -2.457  115.558 1.00 43.21  ? 47   THR C N   1 
ATOM   4833 C CA  . THR C 1 48  ? 0.018   -3.506  114.627 1.00 42.83  ? 47   THR C CA  1 
ATOM   4834 C C   . THR C 1 48  ? -0.935  -3.525  113.435 1.00 42.47  ? 47   THR C C   1 
ATOM   4835 O O   . THR C 1 48  ? -0.528  -3.772  112.294 1.00 43.82  ? 47   THR C O   1 
ATOM   4836 C CB  . THR C 1 48  ? 0.003   -4.890  115.290 1.00 43.83  ? 47   THR C CB  1 
ATOM   4837 O OG1 . THR C 1 48  ? -1.333  -5.206  115.699 1.00 45.78  ? 47   THR C OG1 1 
ATOM   4838 C CG2 . THR C 1 48  ? 0.913   -4.906  116.508 1.00 44.22  ? 47   THR C CG2 1 
ATOM   4839 N N   . ALA C 1 49  ? -2.211  -3.270  113.700 1.00 40.16  ? 48   ALA C N   1 
ATOM   4840 C CA  . ALA C 1 49  ? -3.190  -3.241  112.629 1.00 38.59  ? 48   ALA C CA  1 
ATOM   4841 C C   . ALA C 1 49  ? -2.825  -2.051  111.749 1.00 38.75  ? 48   ALA C C   1 
ATOM   4842 O O   . ALA C 1 49  ? -2.668  -2.184  110.531 1.00 37.96  ? 48   ALA C O   1 
ATOM   4843 C CB  . ALA C 1 49  ? -4.597  -3.078  113.199 1.00 38.48  ? 48   ALA C CB  1 
ATOM   4844 N N   . ILE C 1 50  ? -2.676  -0.888  112.379 1.00 36.95  ? 49   ILE C N   1 
ATOM   4845 C CA  . ILE C 1 50  ? -2.315  0.318   111.657 1.00 39.03  ? 49   ILE C CA  1 
ATOM   4846 C C   . ILE C 1 50  ? -1.063  0.095   110.808 1.00 39.55  ? 49   ILE C C   1 
ATOM   4847 O O   . ILE C 1 50  ? -1.052  0.396   109.612 1.00 40.23  ? 49   ILE C O   1 
ATOM   4848 C CB  . ILE C 1 50  ? -2.101  1.498   112.638 1.00 39.17  ? 49   ILE C CB  1 
ATOM   4849 C CG1 . ILE C 1 50  ? -3.436  2.187   112.893 1.00 40.59  ? 49   ILE C CG1 1 
ATOM   4850 C CG2 . ILE C 1 50  ? -1.099  2.485   112.086 1.00 40.51  ? 49   ILE C CG2 1 
ATOM   4851 C CD1 . ILE C 1 50  ? -3.342  3.366   113.826 1.00 45.48  ? 49   ILE C CD1 1 
ATOM   4852 N N   . ARG C 1 51  ? -0.017  -0.446  111.424 1.00 39.84  ? 50   ARG C N   1 
ATOM   4853 C CA  . ARG C 1 51  ? 1.223   -0.709  110.711 1.00 39.84  ? 50   ARG C CA  1 
ATOM   4854 C C   . ARG C 1 51  ? 1.080   -1.738  109.594 1.00 40.48  ? 50   ARG C C   1 
ATOM   4855 O O   . ARG C 1 51  ? 1.569   -1.518  108.476 1.00 40.17  ? 50   ARG C O   1 
ATOM   4856 C CB  . ARG C 1 51  ? 2.309   -1.156  111.686 1.00 39.95  ? 50   ARG C CB  1 
ATOM   4857 C CG  . ARG C 1 51  ? 2.898   -0.032  112.539 1.00 36.95  ? 50   ARG C CG  1 
ATOM   4858 C CD  . ARG C 1 51  ? 3.909   -0.601  113.513 1.00 36.41  ? 50   ARG C CD  1 
ATOM   4859 N NE  . ARG C 1 51  ? 4.597   0.420   114.289 1.00 37.10  ? 50   ARG C NE  1 
ATOM   4860 C CZ  . ARG C 1 51  ? 5.653   0.175   115.056 1.00 37.71  ? 50   ARG C CZ  1 
ATOM   4861 N NH1 . ARG C 1 51  ? 6.125   -1.063  115.143 1.00 38.34  ? 50   ARG C NH1 1 
ATOM   4862 N NH2 . ARG C 1 51  ? 6.247   1.164   115.720 1.00 33.48  ? 50   ARG C NH2 1 
ATOM   4863 N N   . GLU C 1 52  ? 0.417   -2.858  109.884 1.00 40.63  ? 51   GLU C N   1 
ATOM   4864 C CA  . GLU C 1 52  ? 0.222   -3.897  108.871 1.00 40.67  ? 51   GLU C CA  1 
ATOM   4865 C C   . GLU C 1 52  ? -0.526  -3.383  107.637 1.00 41.44  ? 51   GLU C C   1 
ATOM   4866 O O   . GLU C 1 52  ? -0.106  -3.614  106.505 1.00 39.85  ? 51   GLU C O   1 
ATOM   4867 C CB  . GLU C 1 52  ? -0.540  -5.091  109.456 1.00 41.98  ? 51   GLU C CB  1 
ATOM   4868 C CG  . GLU C 1 52  ? -0.989  -6.105  108.403 1.00 41.38  ? 51   GLU C CG  1 
ATOM   4869 C CD  . GLU C 1 52  ? -1.501  -7.396  109.008 1.00 44.35  ? 51   GLU C CD  1 
ATOM   4870 O OE1 . GLU C 1 52  ? -1.885  -7.378  110.197 1.00 44.55  ? 51   GLU C OE1 1 
ATOM   4871 O OE2 . GLU C 1 52  ? -1.533  -8.427  108.293 1.00 45.28  ? 51   GLU C OE2 1 
ATOM   4872 N N   . ILE C 1 53  ? -1.642  -2.698  107.863 1.00 42.84  ? 52   ILE C N   1 
ATOM   4873 C CA  . ILE C 1 53  ? -2.436  -2.157  106.767 1.00 43.46  ? 52   ILE C CA  1 
ATOM   4874 C C   . ILE C 1 53  ? -1.654  -1.125  105.973 1.00 42.81  ? 52   ILE C C   1 
ATOM   4875 O O   . ILE C 1 53  ? -1.585  -1.211  104.750 1.00 43.46  ? 52   ILE C O   1 
ATOM   4876 C CB  . ILE C 1 53  ? -3.736  -1.486  107.272 1.00 44.12  ? 52   ILE C CB  1 
ATOM   4877 C CG1 . ILE C 1 53  ? -4.562  -2.501  108.074 1.00 45.25  ? 52   ILE C CG1 1 
ATOM   4878 C CG2 . ILE C 1 53  ? -4.531  -0.934  106.078 1.00 41.52  ? 52   ILE C CG2 1 
ATOM   4879 C CD1 . ILE C 1 53  ? -5.878  -1.955  108.622 1.00 45.05  ? 52   ILE C CD1 1 
ATOM   4880 N N   . SER C 1 54  ? -1.063  -0.159  106.672 1.00 42.59  ? 53   SER C N   1 
ATOM   4881 C CA  . SER C 1 54  ? -0.293  0.901   106.019 1.00 44.27  ? 53   SER C CA  1 
ATOM   4882 C C   . SER C 1 54  ? 0.961   0.417   105.293 1.00 44.62  ? 53   SER C C   1 
ATOM   4883 O O   . SER C 1 54  ? 1.313   0.954   104.243 1.00 44.28  ? 53   SER C O   1 
ATOM   4884 C CB  . SER C 1 54  ? 0.095   1.988   107.031 1.00 45.04  ? 53   SER C CB  1 
ATOM   4885 O OG  . SER C 1 54  ? 0.867   1.457   108.096 1.00 48.21  ? 53   SER C OG  1 
ATOM   4886 N N   . LEU C 1 55  ? 1.632   -0.593  105.841 1.00 44.76  ? 54   LEU C N   1 
ATOM   4887 C CA  . LEU C 1 55  ? 2.839   -1.102  105.208 1.00 45.88  ? 54   LEU C CA  1 
ATOM   4888 C C   . LEU C 1 55  ? 2.513   -2.096  104.096 1.00 47.34  ? 54   LEU C C   1 
ATOM   4889 O O   . LEU C 1 55  ? 3.230   -2.199  103.104 1.00 47.58  ? 54   LEU C O   1 
ATOM   4890 C CB  . LEU C 1 55  ? 3.756   -1.737  106.259 1.00 44.84  ? 54   LEU C CB  1 
ATOM   4891 C CG  . LEU C 1 55  ? 4.325   -0.735  107.275 1.00 45.52  ? 54   LEU C CG  1 
ATOM   4892 C CD1 . LEU C 1 55  ? 5.246   -1.434  108.270 1.00 43.75  ? 54   LEU C CD1 1 
ATOM   4893 C CD2 . LEU C 1 55  ? 5.077   0.356   106.527 1.00 43.09  ? 54   LEU C CD2 1 
ATOM   4894 N N   . LEU C 1 56  ? 1.415   -2.817  104.258 1.00 50.27  ? 55   LEU C N   1 
ATOM   4895 C CA  . LEU C 1 56  ? 0.995   -3.793  103.265 1.00 52.09  ? 55   LEU C CA  1 
ATOM   4896 C C   . LEU C 1 56  ? 0.534   -3.054  102.003 1.00 53.58  ? 55   LEU C C   1 
ATOM   4897 O O   . LEU C 1 56  ? 0.644   -3.567  100.892 1.00 53.67  ? 55   LEU C O   1 
ATOM   4898 C CB  . LEU C 1 56  ? -0.138  -4.646  103.848 1.00 51.35  ? 55   LEU C CB  1 
ATOM   4899 C CG  . LEU C 1 56  ? -0.095  -6.175  103.698 1.00 51.80  ? 55   LEU C CG  1 
ATOM   4900 C CD1 . LEU C 1 56  ? 1.346   -6.691  103.663 1.00 48.90  ? 55   LEU C CD1 1 
ATOM   4901 C CD2 . LEU C 1 56  ? -0.882  -6.793  104.855 1.00 48.79  ? 55   LEU C CD2 1 
ATOM   4902 N N   . LYS C 1 57  ? 0.024   -1.840  102.179 1.00 55.55  ? 56   LYS C N   1 
ATOM   4903 C CA  . LYS C 1 57  ? -0.434  -1.051  101.041 1.00 56.25  ? 56   LYS C CA  1 
ATOM   4904 C C   . LYS C 1 57  ? 0.728   -0.547  100.181 1.00 56.38  ? 56   LYS C C   1 
ATOM   4905 O O   . LYS C 1 57  ? 0.546   -0.221  99.013  1.00 56.68  ? 56   LYS C O   1 
ATOM   4906 C CB  . LYS C 1 57  ? -1.315  0.109   101.522 1.00 54.86  ? 56   LYS C CB  1 
ATOM   4907 C CG  . LYS C 1 57  ? -2.764  -0.311  101.732 1.00 54.90  ? 56   LYS C CG  1 
ATOM   4908 C CD  . LYS C 1 57  ? -3.626  0.774   102.366 1.00 56.05  ? 56   LYS C CD  1 
ATOM   4909 C CE  . LYS C 1 57  ? -3.805  1.997   101.463 1.00 57.69  ? 56   LYS C CE  1 
ATOM   4910 N NZ  . LYS C 1 57  ? -4.561  1.720   100.207 1.00 56.73  ? 56   LYS C NZ  1 
ATOM   4911 N N   . GLU C 1 58  ? 1.925   -0.498  100.751 1.00 56.86  ? 57   GLU C N   1 
ATOM   4912 C CA  . GLU C 1 58  ? 3.097   -0.066  99.997  1.00 56.82  ? 57   GLU C CA  1 
ATOM   4913 C C   . GLU C 1 58  ? 3.967   -1.246  99.573  1.00 56.21  ? 57   GLU C C   1 
ATOM   4914 O O   . GLU C 1 58  ? 5.139   -1.068  99.234  1.00 56.27  ? 57   GLU C O   1 
ATOM   4915 C CB  . GLU C 1 58  ? 3.948   0.887   100.829 1.00 58.65  ? 57   GLU C CB  1 
ATOM   4916 C CG  . GLU C 1 58  ? 3.527   2.332   100.761 1.00 60.38  ? 57   GLU C CG  1 
ATOM   4917 C CD  . GLU C 1 58  ? 4.522   3.226   101.454 1.00 62.65  ? 57   GLU C CD  1 
ATOM   4918 O OE1 . GLU C 1 58  ? 5.694   3.257   101.022 1.00 63.35  ? 57   GLU C OE1 1 
ATOM   4919 O OE2 . GLU C 1 58  ? 4.137   3.891   102.435 1.00 65.98  ? 57   GLU C OE2 1 
ATOM   4920 N N   . LEU C 1 59  ? 3.400   -2.449  99.592  1.00 54.53  ? 58   LEU C N   1 
ATOM   4921 C CA  . LEU C 1 59  ? 4.159   -3.633  99.224  1.00 53.11  ? 58   LEU C CA  1 
ATOM   4922 C C   . LEU C 1 59  ? 3.495   -4.495  98.167  1.00 53.77  ? 58   LEU C C   1 
ATOM   4923 O O   . LEU C 1 59  ? 3.010   -5.589  98.458  1.00 54.33  ? 58   LEU C O   1 
ATOM   4924 C CB  . LEU C 1 59  ? 4.441   -4.474  100.469 1.00 51.33  ? 58   LEU C CB  1 
ATOM   4925 C CG  . LEU C 1 59  ? 5.413   -3.834  101.460 1.00 49.25  ? 58   LEU C CG  1 
ATOM   4926 C CD1 . LEU C 1 59  ? 5.502   -4.669  102.724 1.00 47.32  ? 58   LEU C CD1 1 
ATOM   4927 C CD2 . LEU C 1 59  ? 6.771   -3.689  100.799 1.00 48.31  ? 58   LEU C CD2 1 
ATOM   4928 N N   . ASN C 1 60  ? 3.495   -4.004  96.934  1.00 54.69  ? 59   ASN C N   1 
ATOM   4929 C CA  . ASN C 1 60  ? 2.900   -4.725  95.814  1.00 55.44  ? 59   ASN C CA  1 
ATOM   4930 C C   . ASN C 1 60  ? 3.986   -5.556  95.133  1.00 54.26  ? 59   ASN C C   1 
ATOM   4931 O O   . ASN C 1 60  ? 4.840   -5.018  94.432  1.00 54.99  ? 59   ASN C O   1 
ATOM   4932 C CB  . ASN C 1 60  ? 2.309   -3.728  94.818  1.00 58.64  ? 59   ASN C CB  1 
ATOM   4933 C CG  . ASN C 1 60  ? 1.537   -4.400  93.703  1.00 62.72  ? 59   ASN C CG  1 
ATOM   4934 O OD1 . ASN C 1 60  ? 1.351   -3.816  92.632  1.00 65.29  ? 59   ASN C OD1 1 
ATOM   4935 N ND2 . ASN C 1 60  ? 1.065   -5.624  93.950  1.00 63.24  ? 59   ASN C ND2 1 
ATOM   4936 N N   . HIS C 1 61  ? 3.958   -6.867  95.352  1.00 52.43  ? 60   HIS C N   1 
ATOM   4937 C CA  . HIS C 1 61  ? 4.942   -7.763  94.763  1.00 50.40  ? 60   HIS C CA  1 
ATOM   4938 C C   . HIS C 1 61  ? 4.367   -9.165  94.661  1.00 51.07  ? 60   HIS C C   1 
ATOM   4939 O O   . HIS C 1 61  ? 3.466   -9.533  95.408  1.00 50.96  ? 60   HIS C O   1 
ATOM   4940 C CB  . HIS C 1 61  ? 6.203   -7.795  95.624  1.00 49.82  ? 60   HIS C CB  1 
ATOM   4941 C CG  . HIS C 1 61  ? 7.302   -8.644  95.062  1.00 49.93  ? 60   HIS C CG  1 
ATOM   4942 N ND1 . HIS C 1 61  ? 8.265   -8.151  94.208  1.00 50.16  ? 60   HIS C ND1 1 
ATOM   4943 C CD2 . HIS C 1 61  ? 7.582   -9.960  95.223  1.00 49.86  ? 60   HIS C CD2 1 
ATOM   4944 C CE1 . HIS C 1 61  ? 9.092   -9.124  93.870  1.00 49.74  ? 60   HIS C CE1 1 
ATOM   4945 N NE2 . HIS C 1 61  ? 8.700   -10.233 94.472  1.00 49.28  ? 60   HIS C NE2 1 
ATOM   4946 N N   . PRO C 1 62  ? 4.880   -9.971  93.724  1.00 52.00  ? 61   PRO C N   1 
ATOM   4947 C CA  . PRO C 1 62  ? 4.384   -11.340 93.560  1.00 52.39  ? 61   PRO C CA  1 
ATOM   4948 C C   . PRO C 1 62  ? 4.567   -12.241 94.788  1.00 51.49  ? 61   PRO C C   1 
ATOM   4949 O O   . PRO C 1 62  ? 3.816   -13.198 94.978  1.00 52.60  ? 61   PRO C O   1 
ATOM   4950 C CB  . PRO C 1 62  ? 5.184   -11.845 92.361  1.00 51.60  ? 61   PRO C CB  1 
ATOM   4951 C CG  . PRO C 1 62  ? 5.351   -10.617 91.546  1.00 52.99  ? 61   PRO C CG  1 
ATOM   4952 C CD  . PRO C 1 62  ? 5.729   -9.590  92.581  1.00 52.28  ? 61   PRO C CD  1 
ATOM   4953 N N   . ASN C 1 63  ? 5.549   -11.925 95.624  1.00 49.21  ? 62   ASN C N   1 
ATOM   4954 C CA  . ASN C 1 63  ? 5.842   -12.746 96.791  1.00 49.04  ? 62   ASN C CA  1 
ATOM   4955 C C   . ASN C 1 63  ? 5.406   -12.214 98.151  1.00 49.87  ? 62   ASN C C   1 
ATOM   4956 O O   . ASN C 1 63  ? 5.820   -12.734 99.187  1.00 51.76  ? 62   ASN C O   1 
ATOM   4957 C CB  . ASN C 1 63  ? 7.336   -13.049 96.810  1.00 47.38  ? 62   ASN C CB  1 
ATOM   4958 C CG  . ASN C 1 63  ? 7.776   -13.782 95.573  1.00 46.65  ? 62   ASN C CG  1 
ATOM   4959 O OD1 . ASN C 1 63  ? 8.783   -13.442 94.968  1.00 47.99  ? 62   ASN C OD1 1 
ATOM   4960 N ND2 . ASN C 1 63  ? 7.014   -14.800 95.186  1.00 45.98  ? 62   ASN C ND2 1 
ATOM   4961 N N   . ILE C 1 64  ? 4.564   -11.190 98.148  1.00 48.53  ? 63   ILE C N   1 
ATOM   4962 C CA  . ILE C 1 64  ? 4.064   -10.611 99.383  1.00 45.97  ? 63   ILE C CA  1 
ATOM   4963 C C   . ILE C 1 64  ? 2.544   -10.734 99.331  1.00 46.38  ? 63   ILE C C   1 
ATOM   4964 O O   . ILE C 1 64  ? 1.949   -10.454 98.294  1.00 47.04  ? 63   ILE C O   1 
ATOM   4965 C CB  . ILE C 1 64  ? 4.478   -9.135  99.478  1.00 44.35  ? 63   ILE C CB  1 
ATOM   4966 C CG1 . ILE C 1 64  ? 6.009   -9.039  99.430  1.00 43.64  ? 63   ILE C CG1 1 
ATOM   4967 C CG2 . ILE C 1 64  ? 3.908   -8.502  100.740 1.00 41.41  ? 63   ILE C CG2 1 
ATOM   4968 C CD1 . ILE C 1 64  ? 6.560   -7.604  99.363  1.00 43.07  ? 63   ILE C CD1 1 
ATOM   4969 N N   . VAL C 1 65  ? 1.917   -11.177 100.422 1.00 46.29  ? 64   VAL C N   1 
ATOM   4970 C CA  . VAL C 1 65  ? 0.462   -11.310 100.426 1.00 46.10  ? 64   VAL C CA  1 
ATOM   4971 C C   . VAL C 1 65  ? -0.133  -10.037 99.884  1.00 46.61  ? 64   VAL C C   1 
ATOM   4972 O O   . VAL C 1 65  ? 0.335   -8.941  100.190 1.00 48.09  ? 64   VAL C O   1 
ATOM   4973 C CB  . VAL C 1 65  ? -0.152  -11.486 101.831 1.00 45.38  ? 64   VAL C CB  1 
ATOM   4974 C CG1 . VAL C 1 65  ? -0.696  -12.890 101.988 1.00 44.70  ? 64   VAL C CG1 1 
ATOM   4975 C CG2 . VAL C 1 65  ? 0.858   -11.145 102.895 1.00 46.33  ? 64   VAL C CG2 1 
ATOM   4976 N N   . LYS C 1 66  ? -1.181  -10.183 99.092  1.00 46.40  ? 65   LYS C N   1 
ATOM   4977 C CA  . LYS C 1 66  ? -1.836  -9.032  98.522  1.00 46.99  ? 65   LYS C CA  1 
ATOM   4978 C C   . LYS C 1 66  ? -3.057  -8.714  99.361  1.00 47.18  ? 65   LYS C C   1 
ATOM   4979 O O   . LYS C 1 66  ? -3.868  -9.597  99.655  1.00 45.72  ? 65   LYS C O   1 
ATOM   4980 C CB  . LYS C 1 66  ? -2.231  -9.334  97.082  1.00 49.38  ? 65   LYS C CB  1 
ATOM   4981 C CG  . LYS C 1 66  ? -2.672  -8.141  96.261  1.00 53.05  ? 65   LYS C CG  1 
ATOM   4982 C CD  . LYS C 1 66  ? -2.591  -8.511  94.787  1.00 57.29  ? 65   LYS C CD  1 
ATOM   4983 C CE  . LYS C 1 66  ? -3.533  -7.689  93.929  1.00 60.20  ? 65   LYS C CE  1 
ATOM   4984 N NZ  . LYS C 1 66  ? -3.603  -8.256  92.545  1.00 63.32  ? 65   LYS C NZ  1 
ATOM   4985 N N   . LEU C 1 67  ? -3.155  -7.452  99.775  1.00 46.56  ? 66   LEU C N   1 
ATOM   4986 C CA  . LEU C 1 67  ? -4.278  -6.970  100.570 1.00 44.83  ? 66   LEU C CA  1 
ATOM   4987 C C   . LEU C 1 67  ? -5.264  -6.390  99.555  1.00 44.06  ? 66   LEU C C   1 
ATOM   4988 O O   . LEU C 1 67  ? -4.913  -5.530  98.762  1.00 46.19  ? 66   LEU C O   1 
ATOM   4989 C CB  . LEU C 1 67  ? -3.776  -5.913  101.551 1.00 44.67  ? 66   LEU C CB  1 
ATOM   4990 C CG  . LEU C 1 67  ? -4.731  -5.230  102.527 1.00 44.34  ? 66   LEU C CG  1 
ATOM   4991 C CD1 . LEU C 1 67  ? -5.765  -6.200  103.075 1.00 43.69  ? 66   LEU C CD1 1 
ATOM   4992 C CD2 . LEU C 1 67  ? -3.890  -4.642  103.642 1.00 43.21  ? 66   LEU C CD2 1 
ATOM   4993 N N   . LEU C 1 68  ? -6.495  -6.872  99.575  1.00 42.85  ? 67   LEU C N   1 
ATOM   4994 C CA  . LEU C 1 68  ? -7.490  -6.450  98.606  1.00 42.65  ? 67   LEU C CA  1 
ATOM   4995 C C   . LEU C 1 68  ? -8.502  -5.422  99.068  1.00 44.96  ? 67   LEU C C   1 
ATOM   4996 O O   . LEU C 1 68  ? -9.050  -4.681  98.251  1.00 43.31  ? 67   LEU C O   1 
ATOM   4997 C CB  . LEU C 1 68  ? -8.251  -7.678  98.115  1.00 41.66  ? 67   LEU C CB  1 
ATOM   4998 C CG  . LEU C 1 68  ? -7.384  -8.847  97.680  1.00 38.59  ? 67   LEU C CG  1 
ATOM   4999 C CD1 . LEU C 1 68  ? -8.223  -10.100 97.643  1.00 37.80  ? 67   LEU C CD1 1 
ATOM   5000 C CD2 . LEU C 1 68  ? -6.756  -8.537  96.337  1.00 36.48  ? 67   LEU C CD2 1 
ATOM   5001 N N   . ASP C 1 69  ? -8.768  -5.385  100.368 1.00 47.35  ? 68   ASP C N   1 
ATOM   5002 C CA  . ASP C 1 69  ? -9.751  -4.452  100.888 1.00 49.88  ? 68   ASP C CA  1 
ATOM   5003 C C   . ASP C 1 69  ? -9.648  -4.344  102.405 1.00 50.76  ? 68   ASP C C   1 
ATOM   5004 O O   . ASP C 1 69  ? -9.052  -5.197  103.061 1.00 50.69  ? 68   ASP C O   1 
ATOM   5005 C CB  . ASP C 1 69  ? -11.151 -4.938  100.490 1.00 52.18  ? 68   ASP C CB  1 
ATOM   5006 C CG  . ASP C 1 69  ? -12.207 -3.846  100.574 1.00 54.42  ? 68   ASP C CG  1 
ATOM   5007 O OD1 . ASP C 1 69  ? -11.855 -2.682  100.869 1.00 56.71  ? 68   ASP C OD1 1 
ATOM   5008 O OD2 . ASP C 1 69  ? -13.392 -4.153  100.335 1.00 53.19  ? 68   ASP C OD2 1 
ATOM   5009 N N   . VAL C 1 70  ? -10.220 -3.277  102.950 1.00 51.51  ? 69   VAL C N   1 
ATOM   5010 C CA  . VAL C 1 70  ? -10.231 -3.060  104.387 1.00 53.01  ? 69   VAL C CA  1 
ATOM   5011 C C   . VAL C 1 70  ? -11.612 -2.542  104.737 1.00 53.76  ? 69   VAL C C   1 
ATOM   5012 O O   . VAL C 1 70  ? -11.816 -1.340  104.774 1.00 55.08  ? 69   VAL C O   1 
ATOM   5013 C CB  . VAL C 1 70  ? -9.182  -2.010  104.823 1.00 52.14  ? 69   VAL C CB  1 
ATOM   5014 C CG1 . VAL C 1 70  ? -9.224  -1.837  106.331 1.00 51.23  ? 69   VAL C CG1 1 
ATOM   5015 C CG2 . VAL C 1 70  ? -7.789  -2.445  104.388 1.00 52.45  ? 69   VAL C CG2 1 
ATOM   5016 N N   . ILE C 1 71  ? -12.561 -3.451  104.967 1.00 57.25  ? 70   ILE C N   1 
ATOM   5017 C CA  . ILE C 1 71  ? -13.933 -3.068  105.315 1.00 59.18  ? 70   ILE C CA  1 
ATOM   5018 C C   . ILE C 1 71  ? -13.919 -2.421  106.690 1.00 62.40  ? 70   ILE C C   1 
ATOM   5019 O O   . ILE C 1 71  ? -13.680 -3.077  107.709 1.00 61.39  ? 70   ILE C O   1 
ATOM   5020 C CB  . ILE C 1 71  ? -14.899 -4.281  105.300 1.00 57.18  ? 70   ILE C CB  1 
ATOM   5021 C CG1 . ILE C 1 71  ? -15.211 -4.695  103.857 1.00 55.96  ? 70   ILE C CG1 1 
ATOM   5022 C CG2 . ILE C 1 71  ? -16.209 -3.912  105.965 1.00 57.41  ? 70   ILE C CG2 1 
ATOM   5023 C CD1 . ILE C 1 71  ? -14.027 -5.203  103.063 1.00 55.82  ? 70   ILE C CD1 1 
ATOM   5024 N N   . HIS C 1 72  ? -14.197 -1.117  106.675 1.00 67.07  ? 71   HIS C N   1 
ATOM   5025 C CA  . HIS C 1 72  ? -14.173 -0.240  107.840 1.00 70.21  ? 71   HIS C CA  1 
ATOM   5026 C C   . HIS C 1 72  ? -15.475 -0.032  108.601 1.00 71.11  ? 71   HIS C C   1 
ATOM   5027 O O   . HIS C 1 72  ? -16.308 0.790   108.221 1.00 72.43  ? 71   HIS C O   1 
ATOM   5028 C CB  . HIS C 1 72  ? -13.622 1.121   107.404 1.00 72.30  ? 71   HIS C CB  1 
ATOM   5029 C CG  . HIS C 1 72  ? -12.614 1.691   108.347 1.00 75.84  ? 71   HIS C CG  1 
ATOM   5030 N ND1 . HIS C 1 72  ? -11.728 2.682   107.985 1.00 77.79  ? 71   HIS C ND1 1 
ATOM   5031 C CD2 . HIS C 1 72  ? -12.357 1.414   109.646 1.00 77.27  ? 71   HIS C CD2 1 
ATOM   5032 C CE1 . HIS C 1 72  ? -10.969 2.992   109.021 1.00 78.69  ? 71   HIS C CE1 1 
ATOM   5033 N NE2 . HIS C 1 72  ? -11.331 2.237   110.043 1.00 78.55  ? 71   HIS C NE2 1 
ATOM   5034 N N   . THR C 1 73  ? -15.623 -0.762  109.698 1.00 71.92  ? 72   THR C N   1 
ATOM   5035 C CA  . THR C 1 73  ? -16.800 -0.665  110.552 1.00 71.94  ? 72   THR C CA  1 
ATOM   5036 C C   . THR C 1 73  ? -16.432 0.118   111.818 1.00 71.54  ? 72   THR C C   1 
ATOM   5037 O O   . THR C 1 73  ? -15.263 0.428   112.045 1.00 70.61  ? 72   THR C O   1 
ATOM   5038 C CB  . THR C 1 73  ? -17.292 -2.072  110.946 1.00 72.19  ? 72   THR C CB  1 
ATOM   5039 O OG1 . THR C 1 73  ? -17.580 -2.817  109.757 1.00 73.43  ? 72   THR C OG1 1 
ATOM   5040 C CG2 . THR C 1 73  ? -18.542 -1.994  111.802 1.00 71.66  ? 72   THR C CG2 1 
ATOM   5041 N N   . GLU C 1 74  ? -17.434 0.448   112.626 1.00 71.98  ? 73   GLU C N   1 
ATOM   5042 C CA  . GLU C 1 74  ? -17.221 1.172   113.879 1.00 72.25  ? 73   GLU C CA  1 
ATOM   5043 C C   . GLU C 1 74  ? -16.790 0.188   114.968 1.00 70.80  ? 73   GLU C C   1 
ATOM   5044 O O   . GLU C 1 74  ? -15.942 0.496   115.806 1.00 69.59  ? 73   GLU C O   1 
ATOM   5045 C CB  . GLU C 1 74  ? -18.521 1.856   114.321 1.00 75.09  ? 73   GLU C CB  1 
ATOM   5046 C CG  . GLU C 1 74  ? -18.495 2.391   115.756 1.00 77.13  ? 73   GLU C CG  1 
ATOM   5047 C CD  . GLU C 1 74  ? -19.887 2.570   116.350 1.00 77.97  ? 73   GLU C CD  1 
ATOM   5048 O OE1 . GLU C 1 74  ? -20.619 1.561   116.478 1.00 77.05  ? 73   GLU C OE1 1 
ATOM   5049 O OE2 . GLU C 1 74  ? -20.247 3.719   116.691 1.00 78.37  ? 73   GLU C OE2 1 
ATOM   5050 N N   . ASN C 1 75  ? -17.392 -0.999  114.925 1.00 69.50  ? 74   ASN C N   1 
ATOM   5051 C CA  . ASN C 1 75  ? -17.151 -2.067  115.886 1.00 67.73  ? 74   ASN C CA  1 
ATOM   5052 C C   . ASN C 1 75  ? -15.869 -2.869  115.634 1.00 66.45  ? 74   ASN C C   1 
ATOM   5053 O O   . ASN C 1 75  ? -15.086 -3.101  116.562 1.00 65.37  ? 74   ASN C O   1 
ATOM   5054 C CB  . ASN C 1 75  ? -18.358 -3.018  115.901 1.00 69.84  ? 74   ASN C CB  1 
ATOM   5055 C CG  . ASN C 1 75  ? -19.635 -2.370  115.340 1.00 72.27  ? 74   ASN C CG  1 
ATOM   5056 O OD1 . ASN C 1 75  ? -19.955 -2.510  114.154 1.00 72.41  ? 74   ASN C OD1 1 
ATOM   5057 N ND2 . ASN C 1 75  ? -20.362 -1.652  116.195 1.00 72.69  ? 74   ASN C ND2 1 
ATOM   5058 N N   . LYS C 1 76  ? -15.662 -3.305  114.389 1.00 64.58  ? 75   LYS C N   1 
ATOM   5059 C CA  . LYS C 1 76  ? -14.471 -4.081  114.041 1.00 62.58  ? 75   LYS C CA  1 
ATOM   5060 C C   . LYS C 1 76  ? -13.887 -3.764  112.674 1.00 59.86  ? 75   LYS C C   1 
ATOM   5061 O O   . LYS C 1 76  ? -14.525 -3.123  111.852 1.00 59.69  ? 75   LYS C O   1 
ATOM   5062 C CB  . LYS C 1 76  ? -14.762 -5.581  114.143 1.00 63.10  ? 75   LYS C CB  1 
ATOM   5063 C CG  . LYS C 1 76  ? -16.097 -6.015  113.566 1.00 65.98  ? 75   LYS C CG  1 
ATOM   5064 C CD  . LYS C 1 76  ? -16.415 -7.449  113.986 1.00 66.97  ? 75   LYS C CD  1 
ATOM   5065 C CE  . LYS C 1 76  ? -17.861 -7.835  113.680 1.00 68.94  ? 75   LYS C CE  1 
ATOM   5066 N NZ  . LYS C 1 76  ? -18.221 -9.174  114.248 1.00 68.47  ? 75   LYS C NZ  1 
ATOM   5067 N N   . LEU C 1 77  ? -12.662 -4.228  112.448 1.00 58.29  ? 76   LEU C N   1 
ATOM   5068 C CA  . LEU C 1 77  ? -11.942 -3.997  111.198 1.00 56.03  ? 76   LEU C CA  1 
ATOM   5069 C C   . LEU C 1 77  ? -11.686 -5.314  110.443 1.00 55.70  ? 76   LEU C C   1 
ATOM   5070 O O   . LEU C 1 77  ? -11.184 -6.281  111.017 1.00 54.57  ? 76   LEU C O   1 
ATOM   5071 C CB  . LEU C 1 77  ? -10.616 -3.301  111.516 1.00 55.86  ? 76   LEU C CB  1 
ATOM   5072 C CG  . LEU C 1 77  ? -10.106 -2.264  110.521 1.00 55.67  ? 76   LEU C CG  1 
ATOM   5073 C CD1 . LEU C 1 77  ? -11.245 -1.383  110.079 1.00 55.43  ? 76   LEU C CD1 1 
ATOM   5074 C CD2 . LEU C 1 77  ? -9.025  -1.431  111.174 1.00 55.67  ? 76   LEU C CD2 1 
ATOM   5075 N N   . TYR C 1 78  ? -12.029 -5.344  109.156 1.00 54.38  ? 77   TYR C N   1 
ATOM   5076 C CA  . TYR C 1 78  ? -11.854 -6.541  108.338 1.00 52.88  ? 77   TYR C CA  1 
ATOM   5077 C C   . TYR C 1 78  ? -10.860 -6.382  107.210 1.00 50.94  ? 77   TYR C C   1 
ATOM   5078 O O   . TYR C 1 78  ? -11.105 -5.618  106.282 1.00 52.79  ? 77   TYR C O   1 
ATOM   5079 C CB  . TYR C 1 78  ? -13.182 -6.942  107.716 1.00 55.84  ? 77   TYR C CB  1 
ATOM   5080 C CG  . TYR C 1 78  ? -14.131 -7.632  108.651 1.00 58.52  ? 77   TYR C CG  1 
ATOM   5081 C CD1 . TYR C 1 78  ? -13.988 -8.989  108.939 1.00 59.81  ? 77   TYR C CD1 1 
ATOM   5082 C CD2 . TYR C 1 78  ? -15.193 -6.938  109.228 1.00 59.61  ? 77   TYR C CD2 1 
ATOM   5083 C CE1 . TYR C 1 78  ? -14.885 -9.642  109.778 1.00 62.10  ? 77   TYR C CE1 1 
ATOM   5084 C CE2 . TYR C 1 78  ? -16.099 -7.578  110.069 1.00 61.92  ? 77   TYR C CE2 1 
ATOM   5085 C CZ  . TYR C 1 78  ? -15.938 -8.931  110.339 1.00 63.46  ? 77   TYR C CZ  1 
ATOM   5086 O OH  . TYR C 1 78  ? -16.828 -9.576  111.168 1.00 66.61  ? 77   TYR C OH  1 
ATOM   5087 N N   . LEU C 1 79  ? -9.752  -7.109  107.266 1.00 47.38  ? 78   LEU C N   1 
ATOM   5088 C CA  . LEU C 1 79  ? -8.771  -7.031  106.197 1.00 44.53  ? 78   LEU C CA  1 
ATOM   5089 C C   . LEU C 1 79  ? -9.029  -8.220  105.276 1.00 43.16  ? 78   LEU C C   1 
ATOM   5090 O O   . LEU C 1 79  ? -9.051  -9.368  105.722 1.00 42.25  ? 78   LEU C O   1 
ATOM   5091 C CB  . LEU C 1 79  ? -7.347  -7.106  106.752 1.00 44.58  ? 78   LEU C CB  1 
ATOM   5092 C CG  . LEU C 1 79  ? -7.040  -6.506  108.128 1.00 44.49  ? 78   LEU C CG  1 
ATOM   5093 C CD1 . LEU C 1 79  ? -5.539  -6.536  108.352 1.00 41.88  ? 78   LEU C CD1 1 
ATOM   5094 C CD2 . LEU C 1 79  ? -7.564  -5.092  108.230 1.00 45.39  ? 78   LEU C CD2 1 
ATOM   5095 N N   . VAL C 1 80  ? -9.236  -7.938  103.994 1.00 41.79  ? 79   VAL C N   1 
ATOM   5096 C CA  . VAL C 1 80  ? -9.503  -8.975  103.006 1.00 39.86  ? 79   VAL C CA  1 
ATOM   5097 C C   . VAL C 1 80  ? -8.219  -9.282  102.249 1.00 40.21  ? 79   VAL C C   1 
ATOM   5098 O O   . VAL C 1 80  ? -7.640  -8.391  101.634 1.00 39.89  ? 79   VAL C O   1 
ATOM   5099 C CB  . VAL C 1 80  ? -10.590 -8.521  101.995 1.00 39.17  ? 79   VAL C CB  1 
ATOM   5100 C CG1 . VAL C 1 80  ? -11.078 -9.698  101.185 1.00 40.89  ? 79   VAL C CG1 1 
ATOM   5101 C CG2 . VAL C 1 80  ? -11.754 -7.904  102.722 1.00 38.17  ? 79   VAL C CG2 1 
ATOM   5102 N N   . PHE C 1 81  ? -7.768  -10.538 102.308 1.00 39.20  ? 80   PHE C N   1 
ATOM   5103 C CA  . PHE C 1 81  ? -6.547  -10.946 101.616 1.00 38.73  ? 80   PHE C CA  1 
ATOM   5104 C C   . PHE C 1 81  ? -6.804  -11.990 100.542 1.00 40.10  ? 80   PHE C C   1 
ATOM   5105 O O   . PHE C 1 81  ? -7.880  -12.576 100.458 1.00 41.59  ? 80   PHE C O   1 
ATOM   5106 C CB  . PHE C 1 81  ? -5.536  -11.579 102.572 1.00 37.41  ? 80   PHE C CB  1 
ATOM   5107 C CG  . PHE C 1 81  ? -4.973  -10.651 103.604 1.00 35.81  ? 80   PHE C CG  1 
ATOM   5108 C CD1 . PHE C 1 81  ? -5.655  -10.417 104.796 1.00 35.15  ? 80   PHE C CD1 1 
ATOM   5109 C CD2 . PHE C 1 81  ? -3.707  -10.096 103.432 1.00 34.90  ? 80   PHE C CD2 1 
ATOM   5110 C CE1 . PHE C 1 81  ? -5.084  -9.657  105.807 1.00 34.07  ? 80   PHE C CE1 1 
ATOM   5111 C CE2 . PHE C 1 81  ? -3.123  -9.331  104.437 1.00 35.84  ? 80   PHE C CE2 1 
ATOM   5112 C CZ  . PHE C 1 81  ? -3.812  -9.112  105.631 1.00 36.31  ? 80   PHE C CZ  1 
ATOM   5113 N N   . GLU C 1 82  ? -5.786  -12.235 99.730  1.00 40.51  ? 81   GLU C N   1 
ATOM   5114 C CA  . GLU C 1 82  ? -5.882  -13.256 98.711  1.00 42.31  ? 81   GLU C CA  1 
ATOM   5115 C C   . GLU C 1 82  ? -5.705  -14.525 99.535  1.00 42.09  ? 81   GLU C C   1 
ATOM   5116 O O   . GLU C 1 82  ? -5.043  -14.505 100.562 1.00 42.48  ? 81   GLU C O   1 
ATOM   5117 C CB  . GLU C 1 82  ? -4.733  -13.138 97.712  1.00 43.46  ? 81   GLU C CB  1 
ATOM   5118 C CG  . GLU C 1 82  ? -3.370  -13.414 98.321  1.00 46.45  ? 81   GLU C CG  1 
ATOM   5119 C CD  . GLU C 1 82  ? -2.247  -13.320 97.308  1.00 49.44  ? 81   GLU C CD  1 
ATOM   5120 O OE1 . GLU C 1 82  ? -2.383  -13.894 96.208  1.00 49.43  ? 81   GLU C OE1 1 
ATOM   5121 O OE2 . GLU C 1 82  ? -1.221  -12.676 97.617  1.00 52.28  ? 81   GLU C OE2 1 
ATOM   5122 N N   . PHE C 1 83  ? -6.292  -15.623 99.092  1.00 42.74  ? 82   PHE C N   1 
ATOM   5123 C CA  . PHE C 1 83  ? -6.182  -16.875 99.819  1.00 42.58  ? 82   PHE C CA  1 
ATOM   5124 C C   . PHE C 1 83  ? -5.152  -17.797 99.198  1.00 41.97  ? 82   PHE C C   1 
ATOM   5125 O O   . PHE C 1 83  ? -4.967  -17.801 97.985  1.00 43.67  ? 82   PHE C O   1 
ATOM   5126 C CB  . PHE C 1 83  ? -7.535  -17.582 99.827  1.00 43.48  ? 82   PHE C CB  1 
ATOM   5127 C CG  . PHE C 1 83  ? -7.499  -18.956 100.418 1.00 46.66  ? 82   PHE C CG  1 
ATOM   5128 C CD1 . PHE C 1 83  ? -7.537  -19.136 101.796 1.00 49.18  ? 82   PHE C CD1 1 
ATOM   5129 C CD2 . PHE C 1 83  ? -7.405  -20.076 99.597  1.00 48.91  ? 82   PHE C CD2 1 
ATOM   5130 C CE1 . PHE C 1 83  ? -7.481  -20.415 102.353 1.00 50.90  ? 82   PHE C CE1 1 
ATOM   5131 C CE2 . PHE C 1 83  ? -7.347  -21.361 100.139 1.00 50.39  ? 82   PHE C CE2 1 
ATOM   5132 C CZ  . PHE C 1 83  ? -7.385  -21.531 101.523 1.00 51.11  ? 82   PHE C CZ  1 
ATOM   5133 N N   . LEU C 1 84  ? -4.467  -18.558 100.041 1.00 40.66  ? 83   LEU C N   1 
ATOM   5134 C CA  . LEU C 1 84  ? -3.504  -19.550 99.589  1.00 42.08  ? 83   LEU C CA  1 
ATOM   5135 C C   . LEU C 1 84  ? -3.874  -20.814 100.363 1.00 43.94  ? 83   LEU C C   1 
ATOM   5136 O O   . LEU C 1 84  ? -4.312  -20.733 101.507 1.00 44.10  ? 83   LEU C O   1 
ATOM   5137 C CB  . LEU C 1 84  ? -2.059  -19.115 99.861  1.00 38.94  ? 83   LEU C CB  1 
ATOM   5138 C CG  . LEU C 1 84  ? -1.472  -18.153 98.820  1.00 39.15  ? 83   LEU C CG  1 
ATOM   5139 C CD1 . LEU C 1 84  ? -1.883  -16.719 99.160  1.00 38.42  ? 83   LEU C CD1 1 
ATOM   5140 C CD2 . LEU C 1 84  ? 0.054   -18.252 98.795  1.00 37.71  ? 83   LEU C CD2 1 
ATOM   5141 N N   . HIS C 1 85  ? -3.712  -21.974 99.737  1.00 46.62  ? 84   HIS C N   1 
ATOM   5142 C CA  . HIS C 1 85  ? -4.097  -23.251 100.347 1.00 48.74  ? 84   HIS C CA  1 
ATOM   5143 C C   . HIS C 1 85  ? -3.305  -23.754 101.550 1.00 49.08  ? 84   HIS C C   1 
ATOM   5144 O O   . HIS C 1 85  ? -3.801  -24.590 102.302 1.00 48.46  ? 84   HIS C O   1 
ATOM   5145 C CB  . HIS C 1 85  ? -4.095  -24.339 99.275  1.00 50.33  ? 84   HIS C CB  1 
ATOM   5146 C CG  . HIS C 1 85  ? -4.877  -23.979 98.050  1.00 52.66  ? 84   HIS C CG  1 
ATOM   5147 N ND1 . HIS C 1 85  ? -6.253  -24.060 97.993  1.00 54.47  ? 84   HIS C ND1 1 
ATOM   5148 C CD2 . HIS C 1 85  ? -4.475  -23.523 96.839  1.00 52.29  ? 84   HIS C CD2 1 
ATOM   5149 C CE1 . HIS C 1 85  ? -6.664  -23.674 96.797  1.00 54.83  ? 84   HIS C CE1 1 
ATOM   5150 N NE2 . HIS C 1 85  ? -5.604  -23.343 96.078  1.00 53.70  ? 84   HIS C NE2 1 
ATOM   5151 N N   . GLN C 1 86  ? -2.095  -23.244 101.757 1.00 49.86  ? 85   GLN C N   1 
ATOM   5152 C CA  . GLN C 1 86  ? -1.285  -23.733 102.866 1.00 48.97  ? 85   GLN C CA  1 
ATOM   5153 C C   . GLN C 1 86  ? -0.150  -22.796 103.292 1.00 47.30  ? 85   GLN C C   1 
ATOM   5154 O O   . GLN C 1 86  ? 0.294   -21.960 102.504 1.00 45.86  ? 85   GLN C O   1 
ATOM   5155 C CB  . GLN C 1 86  ? -0.694  -25.098 102.461 1.00 48.87  ? 85   GLN C CB  1 
ATOM   5156 C CG  . GLN C 1 86  ? 0.098   -25.814 103.542 1.00 49.47  ? 85   GLN C CG  1 
ATOM   5157 C CD  . GLN C 1 86  ? -0.776  -26.306 104.685 1.00 51.68  ? 85   GLN C CD  1 
ATOM   5158 O OE1 . GLN C 1 86  ? -0.735  -27.484 105.033 1.00 53.91  ? 85   GLN C OE1 1 
ATOM   5159 N NE2 . GLN C 1 86  ? -1.566  -25.409 105.276 1.00 49.07  ? 85   GLN C NE2 1 
ATOM   5160 N N   . ASP C 1 87  ? 0.300   -22.938 104.545 1.00 46.39  ? 86   ASP C N   1 
ATOM   5161 C CA  . ASP C 1 87  ? 1.438   -22.168 105.044 1.00 46.01  ? 86   ASP C CA  1 
ATOM   5162 C C   . ASP C 1 87  ? 2.622   -23.138 105.064 1.00 44.58  ? 86   ASP C C   1 
ATOM   5163 O O   . ASP C 1 87  ? 2.427   -24.355 105.075 1.00 44.87  ? 86   ASP C O   1 
ATOM   5164 C CB  . ASP C 1 87  ? 1.174   -21.576 106.446 1.00 48.99  ? 86   ASP C CB  1 
ATOM   5165 C CG  . ASP C 1 87  ? 1.309   -22.591 107.585 1.00 50.74  ? 86   ASP C CG  1 
ATOM   5166 O OD1 . ASP C 1 87  ? 2.386   -23.218 107.728 1.00 52.24  ? 86   ASP C OD1 1 
ATOM   5167 O OD2 . ASP C 1 87  ? 0.335   -22.735 108.362 1.00 50.75  ? 86   ASP C OD2 1 
ATOM   5168 N N   . LEU C 1 88  ? 3.840   -22.604 105.063 1.00 43.67  ? 87   LEU C N   1 
ATOM   5169 C CA  . LEU C 1 88  ? 5.052   -23.421 105.035 1.00 41.83  ? 87   LEU C CA  1 
ATOM   5170 C C   . LEU C 1 88  ? 5.224   -24.416 106.193 1.00 43.42  ? 87   LEU C C   1 
ATOM   5171 O O   . LEU C 1 88  ? 5.540   -25.589 105.962 1.00 44.44  ? 87   LEU C O   1 
ATOM   5172 C CB  . LEU C 1 88  ? 6.280   -22.508 104.937 1.00 40.51  ? 87   LEU C CB  1 
ATOM   5173 C CG  . LEU C 1 88  ? 7.648   -23.160 104.685 1.00 40.84  ? 87   LEU C CG  1 
ATOM   5174 C CD1 . LEU C 1 88  ? 7.621   -23.983 103.401 1.00 37.21  ? 87   LEU C CD1 1 
ATOM   5175 C CD2 . LEU C 1 88  ? 8.713   -22.074 104.598 1.00 38.51  ? 87   LEU C CD2 1 
ATOM   5176 N N   . LYS C 1 89  ? 5.030   -23.954 107.426 1.00 42.75  ? 88   LYS C N   1 
ATOM   5177 C CA  . LYS C 1 89  ? 5.158   -24.807 108.595 1.00 41.97  ? 88   LYS C CA  1 
ATOM   5178 C C   . LYS C 1 89  ? 4.411   -26.115 108.379 1.00 43.70  ? 88   LYS C C   1 
ATOM   5179 O O   . LYS C 1 89  ? 5.013   -27.178 108.316 1.00 44.69  ? 88   LYS C O   1 
ATOM   5180 C CB  . LYS C 1 89  ? 4.578   -24.111 109.816 1.00 43.97  ? 88   LYS C CB  1 
ATOM   5181 C CG  . LYS C 1 89  ? 4.819   -24.830 111.140 1.00 48.23  ? 88   LYS C CG  1 
ATOM   5182 C CD  . LYS C 1 89  ? 3.810   -24.371 112.180 1.00 53.28  ? 88   LYS C CD  1 
ATOM   5183 C CE  . LYS C 1 89  ? 4.341   -24.518 113.609 1.00 57.15  ? 88   LYS C CE  1 
ATOM   5184 N NZ  . LYS C 1 89  ? 3.406   -23.915 114.622 1.00 56.47  ? 88   LYS C NZ  1 
ATOM   5185 N N   . LYS C 1 90  ? 3.091   -26.032 108.264 1.00 44.17  ? 89   LYS C N   1 
ATOM   5186 C CA  . LYS C 1 90  ? 2.275   -27.217 108.060 1.00 46.71  ? 89   LYS C CA  1 
ATOM   5187 C C   . LYS C 1 90  ? 2.759   -28.114 106.923 1.00 48.72  ? 89   LYS C C   1 
ATOM   5188 O O   . LYS C 1 90  ? 2.703   -29.342 107.019 1.00 49.71  ? 89   LYS C O   1 
ATOM   5189 C CB  . LYS C 1 90  ? 0.839   -26.816 107.778 1.00 45.55  ? 89   LYS C CB  1 
ATOM   5190 C CG  . LYS C 1 90  ? 0.167   -26.090 108.897 1.00 48.79  ? 89   LYS C CG  1 
ATOM   5191 C CD  . LYS C 1 90  ? -1.302  -25.938 108.570 1.00 51.38  ? 89   LYS C CD  1 
ATOM   5192 C CE  . LYS C 1 90  ? -2.056  -25.266 109.692 1.00 53.60  ? 89   LYS C CE  1 
ATOM   5193 N NZ  . LYS C 1 90  ? -3.524  -25.369 109.434 1.00 58.54  ? 89   LYS C NZ  1 
ATOM   5194 N N   . PHE C 1 91  ? 3.195   -27.489 105.833 1.00 50.22  ? 90   PHE C N   1 
ATOM   5195 C CA  . PHE C 1 91  ? 3.688   -28.210 104.668 1.00 50.19  ? 90   PHE C CA  1 
ATOM   5196 C C   . PHE C 1 91  ? 4.889   -29.048 105.078 1.00 51.42  ? 90   PHE C C   1 
ATOM   5197 O O   . PHE C 1 91  ? 4.986   -30.222 104.724 1.00 52.21  ? 90   PHE C O   1 
ATOM   5198 C CB  . PHE C 1 91  ? 4.092   -27.220 103.576 1.00 49.30  ? 90   PHE C CB  1 
ATOM   5199 C CG  . PHE C 1 91  ? 4.721   -27.862 102.378 1.00 47.42  ? 90   PHE C CG  1 
ATOM   5200 C CD1 . PHE C 1 91  ? 3.970   -28.668 101.528 1.00 46.53  ? 90   PHE C CD1 1 
ATOM   5201 C CD2 . PHE C 1 91  ? 6.070   -27.656 102.096 1.00 47.50  ? 90   PHE C CD2 1 
ATOM   5202 C CE1 . PHE C 1 91  ? 4.554   -29.259 100.412 1.00 47.22  ? 90   PHE C CE1 1 
ATOM   5203 C CE2 . PHE C 1 91  ? 6.666   -28.242 100.982 1.00 46.14  ? 90   PHE C CE2 1 
ATOM   5204 C CZ  . PHE C 1 91  ? 5.909   -29.043 100.138 1.00 46.45  ? 90   PHE C CZ  1 
ATOM   5205 N N   . MET C 1 92  ? 5.800   -28.436 105.832 1.00 51.27  ? 91   MET C N   1 
ATOM   5206 C CA  . MET C 1 92  ? 6.991   -29.131 106.302 1.00 51.43  ? 91   MET C CA  1 
ATOM   5207 C C   . MET C 1 92  ? 6.616   -30.345 107.137 1.00 50.82  ? 91   MET C C   1 
ATOM   5208 O O   . MET C 1 92  ? 7.095   -31.446 106.886 1.00 50.84  ? 91   MET C O   1 
ATOM   5209 C CB  . MET C 1 92  ? 7.879   -28.195 107.123 1.00 51.54  ? 91   MET C CB  1 
ATOM   5210 C CG  . MET C 1 92  ? 8.509   -27.101 106.294 1.00 53.39  ? 91   MET C CG  1 
ATOM   5211 S SD  . MET C 1 92  ? 9.774   -26.203 107.173 1.00 57.73  ? 91   MET C SD  1 
ATOM   5212 C CE  . MET C 1 92  ? 8.788   -25.348 108.358 1.00 55.88  ? 91   MET C CE  1 
ATOM   5213 N N   . ASP C 1 93  ? 5.764   -30.148 108.132 1.00 49.44  ? 92   ASP C N   1 
ATOM   5214 C CA  . ASP C 1 93  ? 5.350   -31.266 108.953 1.00 50.54  ? 92   ASP C CA  1 
ATOM   5215 C C   . ASP C 1 93  ? 4.864   -32.379 108.035 1.00 51.77  ? 92   ASP C C   1 
ATOM   5216 O O   . ASP C 1 93  ? 5.360   -33.509 108.076 1.00 51.82  ? 92   ASP C O   1 
ATOM   5217 C CB  . ASP C 1 93  ? 4.226   -30.850 109.902 1.00 49.71  ? 92   ASP C CB  1 
ATOM   5218 C CG  . ASP C 1 93  ? 4.722   -30.001 111.041 1.00 49.79  ? 92   ASP C CG  1 
ATOM   5219 O OD1 . ASP C 1 93  ? 5.794   -30.337 111.583 1.00 49.42  ? 92   ASP C OD1 1 
ATOM   5220 O OD2 . ASP C 1 93  ? 4.045   -29.012 111.400 1.00 50.02  ? 92   ASP C OD2 1 
ATOM   5221 N N   . ALA C 1 94  ? 3.894   -32.039 107.195 1.00 51.39  ? 93   ALA C N   1 
ATOM   5222 C CA  . ALA C 1 94  ? 3.320   -32.988 106.262 1.00 52.04  ? 93   ALA C CA  1 
ATOM   5223 C C   . ALA C 1 94  ? 4.416   -33.634 105.444 1.00 51.46  ? 93   ALA C C   1 
ATOM   5224 O O   . ALA C 1 94  ? 4.190   -34.645 104.799 1.00 52.82  ? 93   ALA C O   1 
ATOM   5225 C CB  . ALA C 1 94  ? 2.326   -32.284 105.345 1.00 52.26  ? 93   ALA C CB  1 
ATOM   5226 N N   . SER C 1 95  ? 5.603   -33.042 105.472 1.00 51.73  ? 94   SER C N   1 
ATOM   5227 C CA  . SER C 1 95  ? 6.743   -33.564 104.728 1.00 53.00  ? 94   SER C CA  1 
ATOM   5228 C C   . SER C 1 95  ? 7.787   -34.143 105.682 1.00 53.52  ? 94   SER C C   1 
ATOM   5229 O O   . SER C 1 95  ? 8.936   -34.339 105.298 1.00 54.53  ? 94   SER C O   1 
ATOM   5230 C CB  . SER C 1 95  ? 7.396   -32.447 103.897 1.00 52.45  ? 94   SER C CB  1 
ATOM   5231 O OG  . SER C 1 95  ? 6.501   -31.896 102.949 1.00 52.87  ? 94   SER C OG  1 
ATOM   5232 N N   . ALA C 1 96  ? 7.393   -34.402 106.923 1.00 53.66  ? 95   ALA C N   1 
ATOM   5233 C CA  . ALA C 1 96  ? 8.318   -34.941 107.913 1.00 55.77  ? 95   ALA C CA  1 
ATOM   5234 C C   . ALA C 1 96  ? 8.961   -36.233 107.425 1.00 56.67  ? 95   ALA C C   1 
ATOM   5235 O O   . ALA C 1 96  ? 10.159  -36.456 107.595 1.00 55.71  ? 95   ALA C O   1 
ATOM   5236 C CB  . ALA C 1 96  ? 7.588   -35.192 109.223 1.00 57.99  ? 95   ALA C CB  1 
ATOM   5237 N N   . LEU C 1 97  ? 8.153   -37.085 106.812 1.00 57.49  ? 96   LEU C N   1 
ATOM   5238 C CA  . LEU C 1 97  ? 8.653   -38.347 106.306 1.00 58.36  ? 96   LEU C CA  1 
ATOM   5239 C C   . LEU C 1 97  ? 9.182   -38.188 104.888 1.00 59.28  ? 96   LEU C C   1 
ATOM   5240 O O   . LEU C 1 97  ? 10.390  -38.197 104.662 1.00 61.89  ? 96   LEU C O   1 
ATOM   5241 C CB  . LEU C 1 97  ? 7.542   -39.400 106.342 1.00 57.48  ? 96   LEU C CB  1 
ATOM   5242 C CG  . LEU C 1 97  ? 6.858   -39.587 107.701 1.00 54.81  ? 96   LEU C CG  1 
ATOM   5243 C CD1 . LEU C 1 97  ? 5.821   -40.708 107.622 1.00 54.95  ? 96   LEU C CD1 1 
ATOM   5244 C CD2 . LEU C 1 97  ? 7.905   -39.892 108.743 1.00 53.23  ? 96   LEU C CD2 1 
ATOM   5245 N N   . THR C 1 98  ? 8.271   -38.008 103.941 1.00 59.68  ? 97   THR C N   1 
ATOM   5246 C CA  . THR C 1 98  ? 8.622   -37.873 102.530 1.00 60.16  ? 97   THR C CA  1 
ATOM   5247 C C   . THR C 1 98  ? 9.744   -36.903 102.138 1.00 59.26  ? 97   THR C C   1 
ATOM   5248 O O   . THR C 1 98  ? 10.488  -37.180 101.206 1.00 58.66  ? 97   THR C O   1 
ATOM   5249 C CB  . THR C 1 98  ? 7.373   -37.520 101.707 1.00 61.73  ? 97   THR C CB  1 
ATOM   5250 O OG1 . THR C 1 98  ? 6.308   -38.416 102.053 1.00 63.01  ? 97   THR C OG1 1 
ATOM   5251 C CG2 . THR C 1 98  ? 7.658   -37.666 100.224 1.00 62.78  ? 97   THR C CG2 1 
ATOM   5252 N N   . GLY C 1 99  ? 9.870   -35.773 102.827 1.00 60.22  ? 98   GLY C N   1 
ATOM   5253 C CA  . GLY C 1 99  ? 10.916  -34.820 102.474 1.00 60.77  ? 98   GLY C CA  1 
ATOM   5254 C C   . GLY C 1 99  ? 10.520  -33.855 101.358 1.00 61.22  ? 98   GLY C C   1 
ATOM   5255 O O   . GLY C 1 99  ? 9.583   -34.117 100.600 1.00 61.88  ? 98   GLY C O   1 
ATOM   5256 N N   . ILE C 1 100 ? 11.238  -32.742 101.239 1.00 60.27  ? 99   ILE C N   1 
ATOM   5257 C CA  . ILE C 1 100 ? 10.920  -31.739 100.224 1.00 60.92  ? 99   ILE C CA  1 
ATOM   5258 C C   . ILE C 1 100 ? 11.895  -31.750 99.048  1.00 59.93  ? 99   ILE C C   1 
ATOM   5259 O O   . ILE C 1 100 ? 13.090  -31.502 99.222  1.00 60.39  ? 99   ILE C O   1 
ATOM   5260 C CB  . ILE C 1 100 ? 10.939  -30.308 100.824 1.00 63.04  ? 99   ILE C CB  1 
ATOM   5261 C CG1 . ILE C 1 100 ? 10.238  -30.289 102.188 1.00 63.94  ? 99   ILE C CG1 1 
ATOM   5262 C CG2 . ILE C 1 100 ? 10.246  -29.333 99.872  1.00 64.06  ? 99   ILE C CG2 1 
ATOM   5263 C CD1 . ILE C 1 100 ? 10.388  -28.973 102.937 1.00 62.58  ? 99   ILE C CD1 1 
ATOM   5264 N N   . PRO C 1 101 ? 11.395  -32.024 97.831  1.00 58.68  ? 100  PRO C N   1 
ATOM   5265 C CA  . PRO C 1 101 ? 12.219  -32.059 96.619  1.00 58.15  ? 100  PRO C CA  1 
ATOM   5266 C C   . PRO C 1 101 ? 13.121  -30.828 96.554  1.00 59.82  ? 100  PRO C C   1 
ATOM   5267 O O   . PRO C 1 101 ? 12.635  -29.699 96.540  1.00 60.64  ? 100  PRO C O   1 
ATOM   5268 C CB  . PRO C 1 101 ? 11.178  -32.069 95.508  1.00 57.93  ? 100  PRO C CB  1 
ATOM   5269 C CG  . PRO C 1 101 ? 10.076  -32.870 96.105  1.00 56.57  ? 100  PRO C CG  1 
ATOM   5270 C CD  . PRO C 1 101 ? 9.986   -32.312 97.510  1.00 59.01  ? 100  PRO C CD  1 
ATOM   5271 N N   . LEU C 1 102 ? 14.431  -31.049 96.506  1.00 60.85  ? 101  LEU C N   1 
ATOM   5272 C CA  . LEU C 1 102 ? 15.398  -29.956 96.475  1.00 61.26  ? 101  LEU C CA  1 
ATOM   5273 C C   . LEU C 1 102 ? 15.034  -28.793 95.557  1.00 62.51  ? 101  LEU C C   1 
ATOM   5274 O O   . LEU C 1 102 ? 15.246  -27.628 95.910  1.00 63.27  ? 101  LEU C O   1 
ATOM   5275 C CB  . LEU C 1 102 ? 16.783  -30.487 96.106  1.00 60.99  ? 101  LEU C CB  1 
ATOM   5276 C CG  . LEU C 1 102 ? 17.850  -30.015 97.096  1.00 62.72  ? 101  LEU C CG  1 
ATOM   5277 C CD1 . LEU C 1 102 ? 19.159  -30.750 96.867  1.00 62.19  ? 101  LEU C CD1 1 
ATOM   5278 C CD2 . LEU C 1 102 ? 18.027  -28.512 96.958  1.00 62.72  ? 101  LEU C CD2 1 
ATOM   5279 N N   . PRO C 1 103 ? 14.499  -29.087 94.361  1.00 63.10  ? 102  PRO C N   1 
ATOM   5280 C CA  . PRO C 1 103 ? 14.119  -28.019 93.429  1.00 63.64  ? 102  PRO C CA  1 
ATOM   5281 C C   . PRO C 1 103 ? 13.101  -27.058 94.060  1.00 63.89  ? 102  PRO C C   1 
ATOM   5282 O O   . PRO C 1 103 ? 13.214  -25.834 93.935  1.00 64.61  ? 102  PRO C O   1 
ATOM   5283 C CB  . PRO C 1 103 ? 13.533  -28.791 92.249  1.00 63.47  ? 102  PRO C CB  1 
ATOM   5284 C CG  . PRO C 1 103 ? 14.338  -30.051 92.253  1.00 63.40  ? 102  PRO C CG  1 
ATOM   5285 C CD  . PRO C 1 103 ? 14.370  -30.408 93.717  1.00 63.04  ? 102  PRO C CD  1 
ATOM   5286 N N   . LEU C 1 104 ? 12.111  -27.630 94.736  1.00 62.49  ? 103  LEU C N   1 
ATOM   5287 C CA  . LEU C 1 104 ? 11.072  -26.854 95.393  1.00 61.06  ? 103  LEU C CA  1 
ATOM   5288 C C   . LEU C 1 104 ? 11.724  -25.950 96.431  1.00 60.47  ? 103  LEU C C   1 
ATOM   5289 O O   . LEU C 1 104 ? 11.410  -24.766 96.530  1.00 61.01  ? 103  LEU C O   1 
ATOM   5290 C CB  . LEU C 1 104 ? 10.072  -27.789 96.081  1.00 60.29  ? 103  LEU C CB  1 
ATOM   5291 C CG  . LEU C 1 104 ? 8.723   -27.200 96.507  1.00 62.01  ? 103  LEU C CG  1 
ATOM   5292 C CD1 . LEU C 1 104 ? 7.889   -26.925 95.270  1.00 61.72  ? 103  LEU C CD1 1 
ATOM   5293 C CD2 . LEU C 1 104 ? 7.981   -28.169 97.419  1.00 60.57  ? 103  LEU C CD2 1 
ATOM   5294 N N   . ILE C 1 105 ? 12.644  -26.519 97.198  1.00 59.71  ? 104  ILE C N   1 
ATOM   5295 C CA  . ILE C 1 105 ? 13.333  -25.781 98.244  1.00 59.50  ? 104  ILE C CA  1 
ATOM   5296 C C   . ILE C 1 105 ? 14.110  -24.597 97.683  1.00 61.07  ? 104  ILE C C   1 
ATOM   5297 O O   . ILE C 1 105 ? 14.199  -23.550 98.327  1.00 61.86  ? 104  ILE C O   1 
ATOM   5298 C CB  . ILE C 1 105 ? 14.274  -26.720 99.037  1.00 57.30  ? 104  ILE C CB  1 
ATOM   5299 C CG1 . ILE C 1 105 ? 13.430  -27.752 99.792  1.00 56.44  ? 104  ILE C CG1 1 
ATOM   5300 C CG2 . ILE C 1 105 ? 15.138  -25.924 100.004 1.00 55.49  ? 104  ILE C CG2 1 
ATOM   5301 C CD1 . ILE C 1 105 ? 14.221  -28.903 100.375 1.00 56.26  ? 104  ILE C CD1 1 
ATOM   5302 N N   . LYS C 1 106 ? 14.660  -24.749 96.481  1.00 62.17  ? 105  LYS C N   1 
ATOM   5303 C CA  . LYS C 1 106 ? 15.420  -23.661 95.874  1.00 62.09  ? 105  LYS C CA  1 
ATOM   5304 C C   . LYS C 1 106 ? 14.484  -22.605 95.299  1.00 60.51  ? 105  LYS C C   1 
ATOM   5305 O O   . LYS C 1 106 ? 14.782  -21.408 95.330  1.00 61.57  ? 105  LYS C O   1 
ATOM   5306 C CB  . LYS C 1 106 ? 16.348  -24.188 94.771  1.00 64.53  ? 105  LYS C CB  1 
ATOM   5307 C CG  . LYS C 1 106 ? 17.266  -23.107 94.195  1.00 65.99  ? 105  LYS C CG  1 
ATOM   5308 C CD  . LYS C 1 106 ? 18.253  -23.659 93.185  1.00 67.62  ? 105  LYS C CD  1 
ATOM   5309 C CE  . LYS C 1 106 ? 19.211  -24.645 93.830  1.00 69.79  ? 105  LYS C CE  1 
ATOM   5310 N NZ  . LYS C 1 106 ? 20.297  -25.068 92.892  1.00 71.58  ? 105  LYS C NZ  1 
ATOM   5311 N N   . SER C 1 107 ? 13.350  -23.050 94.773  1.00 57.96  ? 106  SER C N   1 
ATOM   5312 C CA  . SER C 1 107 ? 12.382  -22.128 94.210  1.00 56.24  ? 106  SER C CA  1 
ATOM   5313 C C   . SER C 1 107 ? 11.930  -21.171 95.309  1.00 55.82  ? 106  SER C C   1 
ATOM   5314 O O   . SER C 1 107 ? 12.028  -19.952 95.169  1.00 56.51  ? 106  SER C O   1 
ATOM   5315 C CB  . SER C 1 107 ? 11.184  -22.896 93.661  1.00 56.33  ? 106  SER C CB  1 
ATOM   5316 O OG  . SER C 1 107 ? 10.249  -22.016 93.067  1.00 58.48  ? 106  SER C OG  1 
ATOM   5317 N N   . TYR C 1 108 ? 11.452  -21.742 96.410  1.00 54.73  ? 107  TYR C N   1 
ATOM   5318 C CA  . TYR C 1 108 ? 10.977  -20.974 97.554  1.00 52.33  ? 107  TYR C CA  1 
ATOM   5319 C C   . TYR C 1 108 ? 12.012  -20.003 98.125  1.00 52.97  ? 107  TYR C C   1 
ATOM   5320 O O   . TYR C 1 108 ? 11.703  -18.834 98.366  1.00 52.88  ? 107  TYR C O   1 
ATOM   5321 C CB  . TYR C 1 108 ? 10.524  -21.923 98.660  1.00 50.78  ? 107  TYR C CB  1 
ATOM   5322 C CG  . TYR C 1 108 ? 9.251   -22.698 98.375  1.00 48.01  ? 107  TYR C CG  1 
ATOM   5323 C CD1 . TYR C 1 108 ? 8.526   -22.506 97.201  1.00 46.19  ? 107  TYR C CD1 1 
ATOM   5324 C CD2 . TYR C 1 108 ? 8.753   -23.604 99.311  1.00 48.44  ? 107  TYR C CD2 1 
ATOM   5325 C CE1 . TYR C 1 108 ? 7.336   -23.194 96.973  1.00 45.62  ? 107  TYR C CE1 1 
ATOM   5326 C CE2 . TYR C 1 108 ? 7.569   -24.298 99.090  1.00 46.94  ? 107  TYR C CE2 1 
ATOM   5327 C CZ  . TYR C 1 108 ? 6.868   -24.086 97.925  1.00 47.03  ? 107  TYR C CZ  1 
ATOM   5328 O OH  . TYR C 1 108 ? 5.692   -24.764 97.724  1.00 49.28  ? 107  TYR C OH  1 
ATOM   5329 N N   . LEU C 1 109 ? 13.234  -20.475 98.353  1.00 52.71  ? 108  LEU C N   1 
ATOM   5330 C CA  . LEU C 1 109 ? 14.256  -19.594 98.903  1.00 53.39  ? 108  LEU C CA  1 
ATOM   5331 C C   . LEU C 1 109 ? 14.559  -18.450 97.948  1.00 55.01  ? 108  LEU C C   1 
ATOM   5332 O O   . LEU C 1 109 ? 14.930  -17.354 98.370  1.00 54.99  ? 108  LEU C O   1 
ATOM   5333 C CB  . LEU C 1 109 ? 15.544  -20.354 99.190  1.00 52.57  ? 108  LEU C CB  1 
ATOM   5334 C CG  . LEU C 1 109 ? 16.566  -19.439 99.884  1.00 54.14  ? 108  LEU C CG  1 
ATOM   5335 C CD1 . LEU C 1 109 ? 16.033  -19.024 101.256 1.00 52.81  ? 108  LEU C CD1 1 
ATOM   5336 C CD2 . LEU C 1 109 ? 17.905  -20.151 100.027 1.00 53.03  ? 108  LEU C CD2 1 
ATOM   5337 N N   . PHE C 1 110 ? 14.412  -18.721 96.655  1.00 56.72  ? 109  PHE C N   1 
ATOM   5338 C CA  . PHE C 1 110 ? 14.658  -17.719 95.626  1.00 56.71  ? 109  PHE C CA  1 
ATOM   5339 C C   . PHE C 1 110 ? 13.547  -16.672 95.711  1.00 56.39  ? 109  PHE C C   1 
ATOM   5340 O O   . PHE C 1 110 ? 13.805  -15.465 95.799  1.00 56.25  ? 109  PHE C O   1 
ATOM   5341 C CB  . PHE C 1 110 ? 14.656  -18.388 94.244  1.00 57.19  ? 109  PHE C CB  1 
ATOM   5342 C CG  . PHE C 1 110 ? 14.973  -17.450 93.102  1.00 57.85  ? 109  PHE C CG  1 
ATOM   5343 C CD1 . PHE C 1 110 ? 16.215  -16.824 93.015  1.00 56.75  ? 109  PHE C CD1 1 
ATOM   5344 C CD2 . PHE C 1 110 ? 14.032  -17.209 92.101  1.00 57.90  ? 109  PHE C CD2 1 
ATOM   5345 C CE1 . PHE C 1 110 ? 16.514  -15.973 91.950  1.00 55.46  ? 109  PHE C CE1 1 
ATOM   5346 C CE2 . PHE C 1 110 ? 14.324  -16.359 91.032  1.00 57.00  ? 109  PHE C CE2 1 
ATOM   5347 C CZ  . PHE C 1 110 ? 15.567  -15.743 90.959  1.00 55.31  ? 109  PHE C CZ  1 
ATOM   5348 N N   . GLN C 1 111 ? 12.309  -17.149 95.703  1.00 54.47  ? 110  GLN C N   1 
ATOM   5349 C CA  . GLN C 1 111 ? 11.159  -16.266 95.771  1.00 53.49  ? 110  GLN C CA  1 
ATOM   5350 C C   . GLN C 1 111 ? 11.103  -15.485 97.068  1.00 54.77  ? 110  GLN C C   1 
ATOM   5351 O O   . GLN C 1 111 ? 10.884  -14.273 97.052  1.00 56.55  ? 110  GLN C O   1 
ATOM   5352 C CB  . GLN C 1 111 ? 9.877   -17.062 95.608  1.00 49.63  ? 110  GLN C CB  1 
ATOM   5353 C CG  . GLN C 1 111 ? 9.741   -17.678 94.253  1.00 47.26  ? 110  GLN C CG  1 
ATOM   5354 C CD  . GLN C 1 111 ? 8.463   -18.442 94.118  1.00 46.71  ? 110  GLN C CD  1 
ATOM   5355 O OE1 . GLN C 1 111 ? 7.384   -17.882 94.262  1.00 45.13  ? 110  GLN C OE1 1 
ATOM   5356 N NE2 . GLN C 1 111 ? 8.570   -19.736 93.848  1.00 48.56  ? 110  GLN C NE2 1 
ATOM   5357 N N   . LEU C 1 112 ? 11.297  -16.178 98.187  1.00 54.69  ? 111  LEU C N   1 
ATOM   5358 C CA  . LEU C 1 112 ? 11.263  -15.532 99.493  1.00 53.21  ? 111  LEU C CA  1 
ATOM   5359 C C   . LEU C 1 112 ? 12.276  -14.400 99.556  1.00 52.91  ? 111  LEU C C   1 
ATOM   5360 O O   . LEU C 1 112 ? 12.038  -13.377 100.187 1.00 50.88  ? 111  LEU C O   1 
ATOM   5361 C CB  . LEU C 1 112 ? 11.550  -16.551 100.597 1.00 53.22  ? 111  LEU C CB  1 
ATOM   5362 C CG  . LEU C 1 112 ? 10.478  -17.604 100.895 1.00 53.25  ? 111  LEU C CG  1 
ATOM   5363 C CD1 . LEU C 1 112 ? 11.039  -18.604 101.890 1.00 53.04  ? 111  LEU C CD1 1 
ATOM   5364 C CD2 . LEU C 1 112 ? 9.212   -16.948 101.444 1.00 50.96  ? 111  LEU C CD2 1 
ATOM   5365 N N   . LEU C 1 113 ? 13.410  -14.587 98.892  1.00 54.77  ? 112  LEU C N   1 
ATOM   5366 C CA  . LEU C 1 113 ? 14.448  -13.563 98.873  1.00 55.35  ? 112  LEU C CA  1 
ATOM   5367 C C   . LEU C 1 113 ? 14.023  -12.389 98.002  1.00 55.36  ? 112  LEU C C   1 
ATOM   5368 O O   . LEU C 1 113 ? 14.475  -11.258 98.198  1.00 55.98  ? 112  LEU C O   1 
ATOM   5369 C CB  . LEU C 1 113 ? 15.763  -14.148 98.359  1.00 54.05  ? 112  LEU C CB  1 
ATOM   5370 C CG  . LEU C 1 113 ? 16.684  -14.714 99.440  1.00 54.91  ? 112  LEU C CG  1 
ATOM   5371 C CD1 . LEU C 1 113 ? 17.858  -15.448 98.796  1.00 56.61  ? 112  LEU C CD1 1 
ATOM   5372 C CD2 . LEU C 1 113 ? 17.186  -13.578 100.315 1.00 54.06  ? 112  LEU C CD2 1 
ATOM   5373 N N   . GLN C 1 114 ? 13.159  -12.670 97.032  1.00 55.56  ? 113  GLN C N   1 
ATOM   5374 C CA  . GLN C 1 114 ? 12.649  -11.641 96.142  1.00 55.12  ? 113  GLN C CA  1 
ATOM   5375 C C   . GLN C 1 114 ? 11.717  -10.753 96.943  1.00 55.41  ? 113  GLN C C   1 
ATOM   5376 O O   . GLN C 1 114 ? 11.866  -9.531  96.967  1.00 56.99  ? 113  GLN C O   1 
ATOM   5377 C CB  . GLN C 1 114 ? 11.886  -12.266 94.975  1.00 54.25  ? 113  GLN C CB  1 
ATOM   5378 C CG  . GLN C 1 114 ? 12.774  -12.740 93.829  1.00 54.19  ? 113  GLN C CG  1 
ATOM   5379 C CD  . GLN C 1 114 ? 11.967  -13.211 92.638  1.00 52.84  ? 113  GLN C CD  1 
ATOM   5380 O OE1 . GLN C 1 114 ? 11.058  -12.521 92.184  1.00 53.86  ? 113  GLN C OE1 1 
ATOM   5381 N NE2 . GLN C 1 114 ? 12.297  -14.385 92.123  1.00 53.84  ? 113  GLN C NE2 1 
ATOM   5382 N N   . GLY C 1 115 ? 10.753  -11.380 97.605  1.00 55.41  ? 114  GLY C N   1 
ATOM   5383 C CA  . GLY C 1 115 ? 9.815   -10.633 98.419  1.00 54.22  ? 114  GLY C CA  1 
ATOM   5384 C C   . GLY C 1 115 ? 10.522  -9.864  99.515  1.00 52.95  ? 114  GLY C C   1 
ATOM   5385 O O   . GLY C 1 115 ? 10.249  -8.687  99.726  1.00 53.89  ? 114  GLY C O   1 
ATOM   5386 N N   . LEU C 1 116 ? 11.441  -10.520 100.212 1.00 52.34  ? 115  LEU C N   1 
ATOM   5387 C CA  . LEU C 1 116 ? 12.163  -9.858  101.287 1.00 53.50  ? 115  LEU C CA  1 
ATOM   5388 C C   . LEU C 1 116 ? 13.059  -8.732  100.776 1.00 54.25  ? 115  LEU C C   1 
ATOM   5389 O O   . LEU C 1 116 ? 13.388  -7.812  101.521 1.00 55.29  ? 115  LEU C O   1 
ATOM   5390 C CB  . LEU C 1 116 ? 13.013  -10.859 102.070 1.00 51.66  ? 115  LEU C CB  1 
ATOM   5391 C CG  . LEU C 1 116 ? 13.805  -10.245 103.233 1.00 49.74  ? 115  LEU C CG  1 
ATOM   5392 C CD1 . LEU C 1 116 ? 12.845  -9.707  104.273 1.00 47.53  ? 115  LEU C CD1 1 
ATOM   5393 C CD2 . LEU C 1 116 ? 14.724  -11.284 103.848 1.00 49.51  ? 115  LEU C CD2 1 
ATOM   5394 N N   . ALA C 1 117 ? 13.462  -8.806  99.513  1.00 54.67  ? 116  ALA C N   1 
ATOM   5395 C CA  . ALA C 1 117 ? 14.318  -7.771  98.946  1.00 55.20  ? 116  ALA C CA  1 
ATOM   5396 C C   . ALA C 1 117 ? 13.486  -6.514  98.737  1.00 55.96  ? 116  ALA C C   1 
ATOM   5397 O O   . ALA C 1 117 ? 13.913  -5.400  99.058  1.00 55.80  ? 116  ALA C O   1 
ATOM   5398 C CB  . ALA C 1 117 ? 14.899  -8.241  97.620  1.00 55.08  ? 116  ALA C CB  1 
ATOM   5399 N N   . PHE C 1 118 ? 12.288  -6.717  98.200  1.00 55.86  ? 117  PHE C N   1 
ATOM   5400 C CA  . PHE C 1 118 ? 11.342  -5.647  97.917  1.00 54.98  ? 117  PHE C CA  1 
ATOM   5401 C C   . PHE C 1 118 ? 11.015  -4.898  99.197  1.00 55.68  ? 117  PHE C C   1 
ATOM   5402 O O   . PHE C 1 118 ? 10.916  -3.671  99.211  1.00 56.03  ? 117  PHE C O   1 
ATOM   5403 C CB  . PHE C 1 118 ? 10.068  -6.254  97.347  1.00 55.23  ? 117  PHE C CB  1 
ATOM   5404 C CG  . PHE C 1 118 ? 9.132   -5.259  96.737  1.00 54.68  ? 117  PHE C CG  1 
ATOM   5405 C CD1 . PHE C 1 118 ? 9.439   -4.645  95.533  1.00 53.84  ? 117  PHE C CD1 1 
ATOM   5406 C CD2 . PHE C 1 118 ? 7.914   -4.971  97.341  1.00 55.41  ? 117  PHE C CD2 1 
ATOM   5407 C CE1 . PHE C 1 118 ? 8.546   -3.766  94.937  1.00 52.85  ? 117  PHE C CE1 1 
ATOM   5408 C CE2 . PHE C 1 118 ? 7.013   -4.090  96.747  1.00 53.69  ? 117  PHE C CE2 1 
ATOM   5409 C CZ  . PHE C 1 118 ? 7.333   -3.491  95.544  1.00 52.63  ? 117  PHE C CZ  1 
ATOM   5410 N N   . CYS C 1 119 ? 10.839  -5.648  100.278 1.00 56.09  ? 118  CYS C N   1 
ATOM   5411 C CA  . CYS C 1 119 ? 10.515  -5.043  101.559 1.00 55.81  ? 118  CYS C CA  1 
ATOM   5412 C C   . CYS C 1 119 ? 11.631  -4.092  101.962 1.00 56.65  ? 118  CYS C C   1 
ATOM   5413 O O   . CYS C 1 119 ? 11.403  -2.902  102.176 1.00 57.85  ? 118  CYS C O   1 
ATOM   5414 C CB  . CYS C 1 119 ? 10.335  -6.125  102.634 1.00 54.05  ? 118  CYS C CB  1 
ATOM   5415 S SG  . CYS C 1 119 ? 8.881   -7.217  102.417 1.00 52.56  ? 118  CYS C SG  1 
ATOM   5416 N N   . HIS C 1 120 ? 12.846  -4.620  102.033 1.00 57.45  ? 119  HIS C N   1 
ATOM   5417 C CA  . HIS C 1 120 ? 14.002  -3.832  102.434 1.00 57.33  ? 119  HIS C CA  1 
ATOM   5418 C C   . HIS C 1 120 ? 14.288  -2.605  101.584 1.00 56.83  ? 119  HIS C C   1 
ATOM   5419 O O   . HIS C 1 120 ? 14.810  -1.617  102.095 1.00 57.47  ? 119  HIS C O   1 
ATOM   5420 C CB  . HIS C 1 120 ? 15.236  -4.730  102.516 1.00 57.39  ? 119  HIS C CB  1 
ATOM   5421 C CG  . HIS C 1 120 ? 15.089  -5.835  103.513 1.00 58.95  ? 119  HIS C CG  1 
ATOM   5422 N ND1 . HIS C 1 120 ? 14.398  -5.675  104.695 1.00 59.62  ? 119  HIS C ND1 1 
ATOM   5423 C CD2 . HIS C 1 120 ? 15.530  -7.114  103.505 1.00 60.03  ? 119  HIS C CD2 1 
ATOM   5424 C CE1 . HIS C 1 120 ? 14.416  -6.809  105.371 1.00 60.34  ? 119  HIS C CE1 1 
ATOM   5425 N NE2 . HIS C 1 120 ? 15.097  -7.698  104.672 1.00 61.13  ? 119  HIS C NE2 1 
ATOM   5426 N N   . SER C 1 121 ? 13.943  -2.649  100.301 1.00 55.90  ? 120  SER C N   1 
ATOM   5427 C CA  . SER C 1 121 ? 14.177  -1.498  99.441  1.00 54.94  ? 120  SER C CA  1 
ATOM   5428 C C   . SER C 1 121 ? 13.039  -0.466  99.550  1.00 54.78  ? 120  SER C C   1 
ATOM   5429 O O   . SER C 1 121 ? 13.129  0.635   99.005  1.00 54.28  ? 120  SER C O   1 
ATOM   5430 C CB  . SER C 1 121 ? 14.374  -1.948  97.993  1.00 53.77  ? 120  SER C CB  1 
ATOM   5431 O OG  . SER C 1 121 ? 13.305  -2.757  97.561  1.00 56.10  ? 120  SER C OG  1 
ATOM   5432 N N   . HIS C 1 122 ? 11.970  -0.823  100.258 1.00 53.34  ? 121  HIS C N   1 
ATOM   5433 C CA  . HIS C 1 122 ? 10.853  0.095   100.464 1.00 51.41  ? 121  HIS C CA  1 
ATOM   5434 C C   . HIS C 1 122 ? 10.836  0.454   101.943 1.00 49.96  ? 121  HIS C C   1 
ATOM   5435 O O   . HIS C 1 122 ? 9.794   0.768   102.509 1.00 51.02  ? 121  HIS C O   1 
ATOM   5436 C CB  . HIS C 1 122 ? 9.526   -0.554  100.075 1.00 52.01  ? 121  HIS C CB  1 
ATOM   5437 C CG  . HIS C 1 122 ? 9.278   -0.586  98.601  1.00 54.62  ? 121  HIS C CG  1 
ATOM   5438 N ND1 . HIS C 1 122 ? 10.270  -0.358  97.674  1.00 57.57  ? 121  HIS C ND1 1 
ATOM   5439 C CD2 . HIS C 1 122 ? 8.152   -0.840  97.892  1.00 56.43  ? 121  HIS C CD2 1 
ATOM   5440 C CE1 . HIS C 1 122 ? 9.768   -0.468  96.456  1.00 57.50  ? 121  HIS C CE1 1 
ATOM   5441 N NE2 . HIS C 1 122 ? 8.484   -0.760  96.560  1.00 56.39  ? 121  HIS C NE2 1 
ATOM   5442 N N   . ARG C 1 123 ? 12.013  0.401   102.556 1.00 47.42  ? 122  ARG C N   1 
ATOM   5443 C CA  . ARG C 1 123 ? 12.197  0.711   103.967 1.00 46.06  ? 122  ARG C CA  1 
ATOM   5444 C C   . ARG C 1 123 ? 11.243  -0.004  104.910 1.00 45.46  ? 122  ARG C C   1 
ATOM   5445 O O   . ARG C 1 123 ? 10.670  0.607   105.815 1.00 45.92  ? 122  ARG C O   1 
ATOM   5446 C CB  . ARG C 1 123 ? 12.153  2.233   104.210 1.00 45.01  ? 122  ARG C CB  1 
ATOM   5447 C CG  . ARG C 1 123 ? 10.952  3.000   103.665 1.00 44.90  ? 122  ARG C CG  1 
ATOM   5448 C CD  . ARG C 1 123 ? 9.799   3.061   104.650 1.00 45.83  ? 122  ARG C CD  1 
ATOM   5449 N NE  . ARG C 1 123 ? 8.743   3.960   104.194 1.00 45.36  ? 122  ARG C NE  1 
ATOM   5450 C CZ  . ARG C 1 123 ? 7.920   3.710   103.179 1.00 45.13  ? 122  ARG C CZ  1 
ATOM   5451 N NH1 . ARG C 1 123 ? 8.016   2.573   102.503 1.00 44.47  ? 122  ARG C NH1 1 
ATOM   5452 N NH2 . ARG C 1 123 ? 7.012   4.612   102.825 1.00 42.65  ? 122  ARG C NH2 1 
ATOM   5453 N N   . VAL C 1 124 ? 11.103  -1.314  104.712 1.00 44.24  ? 123  VAL C N   1 
ATOM   5454 C CA  . VAL C 1 124 ? 10.230  -2.132  105.549 1.00 41.05  ? 123  VAL C CA  1 
ATOM   5455 C C   . VAL C 1 124 ? 10.940  -3.357  106.125 1.00 40.75  ? 123  VAL C C   1 
ATOM   5456 O O   . VAL C 1 124 ? 11.474  -4.182  105.387 1.00 39.47  ? 123  VAL C O   1 
ATOM   5457 C CB  . VAL C 1 124 ? 8.984   -2.633  104.763 1.00 40.16  ? 123  VAL C CB  1 
ATOM   5458 C CG1 . VAL C 1 124 ? 8.092   -3.467  105.663 1.00 38.09  ? 123  VAL C CG1 1 
ATOM   5459 C CG2 . VAL C 1 124 ? 8.198   -1.465  104.221 1.00 39.65  ? 123  VAL C CG2 1 
ATOM   5460 N N   . LEU C 1 125 ? 10.965  -3.447  107.451 1.00 40.37  ? 124  LEU C N   1 
ATOM   5461 C CA  . LEU C 1 125 ? 11.537  -4.596  108.139 1.00 40.57  ? 124  LEU C CA  1 
ATOM   5462 C C   . LEU C 1 125 ? 10.316  -5.485  108.426 1.00 41.61  ? 124  LEU C C   1 
ATOM   5463 O O   . LEU C 1 125 ? 9.261   -4.972  108.818 1.00 42.28  ? 124  LEU C O   1 
ATOM   5464 C CB  . LEU C 1 125 ? 12.167  -4.186  109.474 1.00 39.29  ? 124  LEU C CB  1 
ATOM   5465 C CG  . LEU C 1 125 ? 13.385  -3.266  109.553 1.00 39.18  ? 124  LEU C CG  1 
ATOM   5466 C CD1 . LEU C 1 125 ? 13.813  -3.118  111.015 1.00 36.68  ? 124  LEU C CD1 1 
ATOM   5467 C CD2 . LEU C 1 125 ? 14.522  -3.849  108.735 1.00 38.79  ? 124  LEU C CD2 1 
ATOM   5468 N N   . HIS C 1 126 ? 10.443  -6.796  108.227 1.00 42.82  ? 125  HIS C N   1 
ATOM   5469 C CA  . HIS C 1 126 ? 9.329   -7.714  108.486 1.00 42.54  ? 125  HIS C CA  1 
ATOM   5470 C C   . HIS C 1 126 ? 9.305   -8.076  109.967 1.00 43.48  ? 125  HIS C C   1 
ATOM   5471 O O   . HIS C 1 126 ? 8.305   -7.859  110.646 1.00 46.56  ? 125  HIS C O   1 
ATOM   5472 C CB  . HIS C 1 126 ? 9.454   -8.969  107.624 1.00 41.81  ? 125  HIS C CB  1 
ATOM   5473 C CG  . HIS C 1 126 ? 8.267   -9.873  107.709 1.00 42.93  ? 125  HIS C CG  1 
ATOM   5474 N ND1 . HIS C 1 126 ? 8.111   -10.804 108.715 1.00 43.13  ? 125  HIS C ND1 1 
ATOM   5475 C CD2 . HIS C 1 126 ? 7.144   -9.939  106.956 1.00 41.65  ? 125  HIS C CD2 1 
ATOM   5476 C CE1 . HIS C 1 126 ? 6.940   -11.401 108.581 1.00 40.30  ? 125  HIS C CE1 1 
ATOM   5477 N NE2 . HIS C 1 126 ? 6.334   -10.895 107.522 1.00 41.59  ? 125  HIS C NE2 1 
ATOM   5478 N N   . ARG C 1 127 ? 10.403  -8.642  110.454 1.00 43.79  ? 126  ARG C N   1 
ATOM   5479 C CA  . ARG C 1 127 ? 10.570  -8.985  111.867 1.00 44.35  ? 126  ARG C CA  1 
ATOM   5480 C C   . ARG C 1 127 ? 9.756   -10.120 112.491 1.00 45.22  ? 126  ARG C C   1 
ATOM   5481 O O   . ARG C 1 127 ? 9.658   -10.211 113.718 1.00 45.05  ? 126  ARG C O   1 
ATOM   5482 C CB  . ARG C 1 127 ? 10.400  -7.722  112.713 1.00 43.46  ? 126  ARG C CB  1 
ATOM   5483 C CG  . ARG C 1 127 ? 11.277  -6.574  112.248 1.00 44.65  ? 126  ARG C CG  1 
ATOM   5484 C CD  . ARG C 1 127 ? 11.279  -5.444  113.253 1.00 46.17  ? 126  ARG C CD  1 
ATOM   5485 N NE  . ARG C 1 127 ? 9.930   -4.969  113.532 1.00 46.13  ? 126  ARG C NE  1 
ATOM   5486 C CZ  . ARG C 1 127 ? 9.647   -3.971  114.363 1.00 46.29  ? 126  ARG C CZ  1 
ATOM   5487 N NH1 . ARG C 1 127 ? 10.634  -3.342  114.997 1.00 45.62  ? 126  ARG C NH1 1 
ATOM   5488 N NH2 . ARG C 1 127 ? 8.383   -3.607  114.562 1.00 41.62  ? 126  ARG C NH2 1 
ATOM   5489 N N   . ASP C 1 128 ? 9.176   -10.981 111.665 1.00 45.21  ? 127  ASP C N   1 
ATOM   5490 C CA  . ASP C 1 128 ? 8.435   -12.116 112.190 1.00 46.81  ? 127  ASP C CA  1 
ATOM   5491 C C   . ASP C 1 128 ? 8.394   -13.217 111.140 1.00 47.99  ? 127  ASP C C   1 
ATOM   5492 O O   . ASP C 1 128 ? 7.391   -13.915 110.970 1.00 49.04  ? 127  ASP C O   1 
ATOM   5493 C CB  . ASP C 1 128 ? 7.021   -11.714 112.607 1.00 47.78  ? 127  ASP C CB  1 
ATOM   5494 C CG  . ASP C 1 128 ? 6.368   -12.753 113.508 1.00 50.13  ? 127  ASP C CG  1 
ATOM   5495 O OD1 . ASP C 1 128 ? 7.015   -13.179 114.492 1.00 50.64  ? 127  ASP C OD1 1 
ATOM   5496 O OD2 . ASP C 1 128 ? 5.211   -13.142 113.240 1.00 50.59  ? 127  ASP C OD2 1 
ATOM   5497 N N   . LEU C 1 129 ? 9.506   -13.367 110.434 1.00 46.89  ? 128  LEU C N   1 
ATOM   5498 C CA  . LEU C 1 129 ? 9.611   -14.386 109.413 1.00 46.24  ? 128  LEU C CA  1 
ATOM   5499 C C   . LEU C 1 129 ? 9.797   -15.743 110.064 1.00 47.04  ? 128  LEU C C   1 
ATOM   5500 O O   . LEU C 1 129 ? 10.641  -15.920 110.940 1.00 47.91  ? 128  LEU C O   1 
ATOM   5501 C CB  . LEU C 1 129 ? 10.784  -14.081 108.486 1.00 45.28  ? 128  LEU C CB  1 
ATOM   5502 C CG  . LEU C 1 129 ? 10.573  -12.875 107.570 1.00 43.48  ? 128  LEU C CG  1 
ATOM   5503 C CD1 . LEU C 1 129 ? 11.890  -12.475 106.942 1.00 43.69  ? 128  LEU C CD1 1 
ATOM   5504 C CD2 . LEU C 1 129 ? 9.548   -13.217 106.510 1.00 40.11  ? 128  LEU C CD2 1 
ATOM   5505 N N   . LYS C 1 130 ? 8.978   -16.693 109.637 1.00 47.03  ? 129  LYS C N   1 
ATOM   5506 C CA  . LYS C 1 130 ? 9.020   -18.058 110.129 1.00 47.28  ? 129  LYS C CA  1 
ATOM   5507 C C   . LYS C 1 130 ? 7.974   -18.796 109.313 1.00 47.41  ? 129  LYS C C   1 
ATOM   5508 O O   . LYS C 1 130 ? 6.957   -18.221 108.940 1.00 47.12  ? 129  LYS C O   1 
ATOM   5509 C CB  . LYS C 1 130 ? 8.693   -18.118 111.625 1.00 46.80  ? 129  LYS C CB  1 
ATOM   5510 C CG  . LYS C 1 130 ? 7.306   -17.640 111.998 1.00 44.92  ? 129  LYS C CG  1 
ATOM   5511 C CD  . LYS C 1 130 ? 7.108   -17.716 113.501 1.00 45.22  ? 129  LYS C CD  1 
ATOM   5512 C CE  . LYS C 1 130 ? 5.741   -17.190 113.926 1.00 45.82  ? 129  LYS C CE  1 
ATOM   5513 N NZ  . LYS C 1 130 ? 5.632   -17.085 115.408 1.00 44.95  ? 129  LYS C NZ  1 
ATOM   5514 N N   . PRO C 1 131 ? 8.216   -20.078 109.018 1.00 47.83  ? 130  PRO C N   1 
ATOM   5515 C CA  . PRO C 1 131 ? 7.311   -20.924 108.230 1.00 48.38  ? 130  PRO C CA  1 
ATOM   5516 C C   . PRO C 1 131 ? 5.815   -20.737 108.464 1.00 47.97  ? 130  PRO C C   1 
ATOM   5517 O O   . PRO C 1 131 ? 5.005   -20.898 107.557 1.00 46.99  ? 130  PRO C O   1 
ATOM   5518 C CB  . PRO C 1 131 ? 7.798   -22.344 108.543 1.00 49.85  ? 130  PRO C CB  1 
ATOM   5519 C CG  . PRO C 1 131 ? 8.658   -22.181 109.801 1.00 50.02  ? 130  PRO C CG  1 
ATOM   5520 C CD  . PRO C 1 131 ? 9.321   -20.874 109.578 1.00 48.46  ? 130  PRO C CD  1 
ATOM   5521 N N   . GLN C 1 132 ? 5.451   -20.387 109.684 1.00 49.24  ? 131  GLN C N   1 
ATOM   5522 C CA  . GLN C 1 132 ? 4.057   -20.176 110.014 1.00 50.57  ? 131  GLN C CA  1 
ATOM   5523 C C   . GLN C 1 132 ? 3.528   -18.974 109.236 1.00 49.34  ? 131  GLN C C   1 
ATOM   5524 O O   . GLN C 1 132 ? 2.390   -18.985 108.768 1.00 49.80  ? 131  GLN C O   1 
ATOM   5525 C CB  . GLN C 1 132 ? 3.898   -19.921 111.519 1.00 52.83  ? 131  GLN C CB  1 
ATOM   5526 C CG  . GLN C 1 132 ? 4.434   -21.028 112.430 1.00 57.83  ? 131  GLN C CG  1 
ATOM   5527 C CD  . GLN C 1 132 ? 5.958   -21.191 112.388 1.00 59.87  ? 131  GLN C CD  1 
ATOM   5528 O OE1 . GLN C 1 132 ? 6.679   -20.373 111.809 1.00 61.34  ? 131  GLN C OE1 1 
ATOM   5529 N NE2 . GLN C 1 132 ? 6.450   -22.252 113.021 1.00 62.42  ? 131  GLN C NE2 1 
ATOM   5530 N N   . ASN C 1 133 ? 4.357   -17.943 109.101 1.00 46.28  ? 132  ASN C N   1 
ATOM   5531 C CA  . ASN C 1 133 ? 3.952   -16.727 108.404 1.00 46.29  ? 132  ASN C CA  1 
ATOM   5532 C C   . ASN C 1 133 ? 4.289   -16.708 106.912 1.00 47.04  ? 132  ASN C C   1 
ATOM   5533 O O   . ASN C 1 133 ? 4.397   -15.640 106.307 1.00 47.22  ? 132  ASN C O   1 
ATOM   5534 C CB  . ASN C 1 133 ? 4.567   -15.499 109.088 1.00 43.24  ? 132  ASN C CB  1 
ATOM   5535 C CG  . ASN C 1 133 ? 4.195   -15.402 110.566 1.00 44.21  ? 132  ASN C CG  1 
ATOM   5536 O OD1 . ASN C 1 133 ? 3.082   -15.760 110.972 1.00 42.88  ? 132  ASN C OD1 1 
ATOM   5537 N ND2 . ASN C 1 133 ? 5.123   -14.903 111.373 1.00 39.97  ? 132  ASN C ND2 1 
ATOM   5538 N N   . LEU C 1 134 ? 4.447   -17.891 106.322 1.00 46.24  ? 133  LEU C N   1 
ATOM   5539 C CA  . LEU C 1 134 ? 4.766   -18.007 104.902 1.00 44.18  ? 133  LEU C CA  1 
ATOM   5540 C C   . LEU C 1 134 ? 3.707   -18.875 104.242 1.00 45.01  ? 133  LEU C C   1 
ATOM   5541 O O   . LEU C 1 134 ? 3.410   -19.964 104.730 1.00 44.97  ? 133  LEU C O   1 
ATOM   5542 C CB  . LEU C 1 134 ? 6.142   -18.639 104.717 1.00 41.25  ? 133  LEU C CB  1 
ATOM   5543 C CG  . LEU C 1 134 ? 7.342   -17.907 105.318 1.00 40.31  ? 133  LEU C CG  1 
ATOM   5544 C CD1 . LEU C 1 134 ? 8.618   -18.634 104.910 1.00 36.78  ? 133  LEU C CD1 1 
ATOM   5545 C CD2 . LEU C 1 134 ? 7.379   -16.466 104.841 1.00 38.23  ? 133  LEU C CD2 1 
ATOM   5546 N N   . LEU C 1 135 ? 3.143   -18.396 103.134 1.00 45.90  ? 134  LEU C N   1 
ATOM   5547 C CA  . LEU C 1 135 ? 2.093   -19.128 102.432 1.00 47.18  ? 134  LEU C CA  1 
ATOM   5548 C C   . LEU C 1 135 ? 2.538   -19.653 101.072 1.00 47.50  ? 134  LEU C C   1 
ATOM   5549 O O   . LEU C 1 135 ? 3.379   -19.047 100.401 1.00 47.10  ? 134  LEU C O   1 
ATOM   5550 C CB  . LEU C 1 135 ? 0.872   -18.229 102.240 1.00 49.89  ? 134  LEU C CB  1 
ATOM   5551 C CG  . LEU C 1 135 ? 0.474   -17.317 103.407 1.00 52.48  ? 134  LEU C CG  1 
ATOM   5552 C CD1 . LEU C 1 135 ? -0.596  -16.342 102.928 1.00 52.60  ? 134  LEU C CD1 1 
ATOM   5553 C CD2 . LEU C 1 135 ? -0.031  -18.143 104.594 1.00 53.77  ? 134  LEU C CD2 1 
ATOM   5554 N N   . ILE C 1 136 ? 1.953   -20.784 100.674 1.00 47.50  ? 135  ILE C N   1 
ATOM   5555 C CA  . ILE C 1 136 ? 2.257   -21.423 99.395  1.00 46.46  ? 135  ILE C CA  1 
ATOM   5556 C C   . ILE C 1 136 ? 0.964   -21.889 98.712  1.00 46.00  ? 135  ILE C C   1 
ATOM   5557 O O   . ILE C 1 136 ? -0.013  -22.222 99.375  1.00 43.46  ? 135  ILE C O   1 
ATOM   5558 C CB  . ILE C 1 136 ? 3.217   -22.633 99.589  1.00 45.28  ? 135  ILE C CB  1 
ATOM   5559 C CG1 . ILE C 1 136 ? 2.468   -23.847 100.146 1.00 47.42  ? 135  ILE C CG1 1 
ATOM   5560 C CG2 . ILE C 1 136 ? 4.301   -22.270 100.573 1.00 43.99  ? 135  ILE C CG2 1 
ATOM   5561 C CD1 . ILE C 1 136 ? 3.352   -25.083 100.318 1.00 45.57  ? 135  ILE C CD1 1 
ATOM   5562 N N   . ASN C 1 137 ? 0.956   -21.887 97.384  1.00 48.91  ? 136  ASN C N   1 
ATOM   5563 C CA  . ASN C 1 137 ? -0.221  -22.313 96.626  1.00 52.10  ? 136  ASN C CA  1 
ATOM   5564 C C   . ASN C 1 137 ? 0.100   -23.545 95.791  1.00 54.38  ? 136  ASN C C   1 
ATOM   5565 O O   . ASN C 1 137 ? 1.254   -23.963 95.705  1.00 54.71  ? 136  ASN C O   1 
ATOM   5566 C CB  . ASN C 1 137 ? -0.707  -21.195 95.702  1.00 51.18  ? 136  ASN C CB  1 
ATOM   5567 C CG  . ASN C 1 137 ? 0.373   -20.707 94.764  1.00 51.76  ? 136  ASN C CG  1 
ATOM   5568 O OD1 . ASN C 1 137 ? 1.244   -21.477 94.344  1.00 53.98  ? 136  ASN C OD1 1 
ATOM   5569 N ND2 . ASN C 1 137 ? 0.318   -19.424 94.414  1.00 50.67  ? 136  ASN C ND2 1 
ATOM   5570 N N   . THR C 1 138 ? -0.919  -24.109 95.157  1.00 56.51  ? 137  THR C N   1 
ATOM   5571 C CA  . THR C 1 138 ? -0.738  -25.307 94.350  1.00 60.68  ? 137  THR C CA  1 
ATOM   5572 C C   . THR C 1 138 ? 0.115   -25.109 93.111  1.00 62.97  ? 137  THR C C   1 
ATOM   5573 O O   . THR C 1 138 ? 0.374   -26.073 92.388  1.00 65.08  ? 137  THR C O   1 
ATOM   5574 C CB  . THR C 1 138 ? -2.075  -25.864 93.847  1.00 61.32  ? 137  THR C CB  1 
ATOM   5575 O OG1 . THR C 1 138 ? -2.521  -25.077 92.737  1.00 63.34  ? 137  THR C OG1 1 
ATOM   5576 C CG2 . THR C 1 138 ? -3.126  -25.815 94.937  1.00 61.77  ? 137  THR C CG2 1 
ATOM   5577 N N   . GLU C 1 139 ? 0.571   -23.888 92.855  1.00 64.97  ? 138  GLU C N   1 
ATOM   5578 C CA  . GLU C 1 139 ? 1.333   -23.669 91.638  1.00 65.87  ? 138  GLU C CA  1 
ATOM   5579 C C   . GLU C 1 139 ? 2.811   -23.335 91.722  1.00 65.29  ? 138  GLU C C   1 
ATOM   5580 O O   . GLU C 1 139 ? 3.433   -23.055 90.700  1.00 66.85  ? 138  GLU C O   1 
ATOM   5581 C CB  . GLU C 1 139 ? 0.596   -22.643 90.785  1.00 67.74  ? 138  GLU C CB  1 
ATOM   5582 C CG  . GLU C 1 139 ? -0.852  -23.053 90.567  1.00 73.54  ? 138  GLU C CG  1 
ATOM   5583 C CD  . GLU C 1 139 ? -1.590  -22.177 89.572  1.00 77.88  ? 138  GLU C CD  1 
ATOM   5584 O OE1 . GLU C 1 139 ? -1.715  -20.954 89.823  1.00 79.56  ? 138  GLU C OE1 1 
ATOM   5585 O OE2 . GLU C 1 139 ? -2.053  -22.717 88.539  1.00 79.38  ? 138  GLU C OE2 1 
ATOM   5586 N N   . GLY C 1 140 ? 3.383   -23.376 92.920  1.00 64.41  ? 139  GLY C N   1 
ATOM   5587 C CA  . GLY C 1 140 ? 4.806   -23.107 93.050  1.00 62.23  ? 139  GLY C CA  1 
ATOM   5588 C C   . GLY C 1 140 ? 5.190   -21.758 93.619  1.00 61.98  ? 139  GLY C C   1 
ATOM   5589 O O   . GLY C 1 140 ? 6.348   -21.345 93.528  1.00 62.65  ? 139  GLY C O   1 
ATOM   5590 N N   . ALA C 1 141 ? 4.229   -21.065 94.217  1.00 60.82  ? 140  ALA C N   1 
ATOM   5591 C CA  . ALA C 1 141 ? 4.507   -19.761 94.795  1.00 57.99  ? 140  ALA C CA  1 
ATOM   5592 C C   . ALA C 1 141 ? 4.529   -19.800 96.317  1.00 56.42  ? 140  ALA C C   1 
ATOM   5593 O O   . ALA C 1 141 ? 3.845   -20.609 96.945  1.00 57.25  ? 140  ALA C O   1 
ATOM   5594 C CB  . ALA C 1 141 ? 3.472   -18.759 94.323  1.00 58.83  ? 140  ALA C CB  1 
ATOM   5595 N N   . ILE C 1 142 ? 5.341   -18.928 96.902  1.00 53.63  ? 141  ILE C N   1 
ATOM   5596 C CA  . ILE C 1 142 ? 5.433   -18.807 98.345  1.00 50.67  ? 141  ILE C CA  1 
ATOM   5597 C C   . ILE C 1 142 ? 5.444   -17.311 98.602  1.00 49.63  ? 141  ILE C C   1 
ATOM   5598 O O   . ILE C 1 142 ? 6.184   -16.564 97.956  1.00 48.22  ? 141  ILE C O   1 
ATOM   5599 C CB  . ILE C 1 142 ? 6.706   -19.457 98.902  1.00 50.41  ? 141  ILE C CB  1 
ATOM   5600 C CG1 . ILE C 1 142 ? 6.702   -19.353 100.432 1.00 49.82  ? 141  ILE C CG1 1 
ATOM   5601 C CG2 . ILE C 1 142 ? 7.932   -18.807 98.294  1.00 48.91  ? 141  ILE C CG2 1 
ATOM   5602 C CD1 . ILE C 1 142 ? 7.646   -20.317 101.121 1.00 49.72  ? 141  ILE C CD1 1 
ATOM   5603 N N   . LYS C 1 143 ? 4.607   -16.869 99.533  1.00 48.30  ? 142  LYS C N   1 
ATOM   5604 C CA  . LYS C 1 143 ? 4.502   -15.447 99.819  1.00 47.48  ? 142  LYS C CA  1 
ATOM   5605 C C   . LYS C 1 143 ? 4.657   -15.058 101.276 1.00 46.37  ? 142  LYS C C   1 
ATOM   5606 O O   . LYS C 1 143 ? 4.147   -15.734 102.177 1.00 46.86  ? 142  LYS C O   1 
ATOM   5607 C CB  . LYS C 1 143 ? 3.154   -14.917 99.315  1.00 45.93  ? 142  LYS C CB  1 
ATOM   5608 C CG  . LYS C 1 143 ? 2.945   -15.066 97.825  1.00 44.54  ? 142  LYS C CG  1 
ATOM   5609 C CD  . LYS C 1 143 ? 1.584   -14.531 97.411  1.00 44.89  ? 142  LYS C CD  1 
ATOM   5610 C CE  . LYS C 1 143 ? 1.419   -14.558 95.893  1.00 44.00  ? 142  LYS C CE  1 
ATOM   5611 N NZ  . LYS C 1 143 ? 0.049   -14.175 95.456  1.00 41.25  ? 142  LYS C NZ  1 
ATOM   5612 N N   . LEU C 1 144 ? 5.358   -13.947 101.489 1.00 43.25  ? 143  LEU C N   1 
ATOM   5613 C CA  . LEU C 1 144 ? 5.569   -13.407 102.819 1.00 41.89  ? 143  LEU C CA  1 
ATOM   5614 C C   . LEU C 1 144 ? 4.201   -12.980 103.345 1.00 42.22  ? 143  LEU C C   1 
ATOM   5615 O O   . LEU C 1 144 ? 3.392   -12.434 102.587 1.00 42.06  ? 143  LEU C O   1 
ATOM   5616 C CB  . LEU C 1 144 ? 6.478   -12.176 102.752 1.00 41.48  ? 143  LEU C CB  1 
ATOM   5617 C CG  . LEU C 1 144 ? 7.906   -12.354 102.243 1.00 40.25  ? 143  LEU C CG  1 
ATOM   5618 C CD1 . LEU C 1 144 ? 8.640   -11.028 102.370 1.00 39.09  ? 143  LEU C CD1 1 
ATOM   5619 C CD2 . LEU C 1 144 ? 8.615   -13.439 103.057 1.00 38.62  ? 143  LEU C CD2 1 
ATOM   5620 N N   . ALA C 1 145 ? 3.936   -13.230 104.625 1.00 40.06  ? 144  ALA C N   1 
ATOM   5621 C CA  . ALA C 1 145 ? 2.661   -12.836 105.213 1.00 39.36  ? 144  ALA C CA  1 
ATOM   5622 C C   . ALA C 1 145 ? 2.808   -12.356 106.651 1.00 39.71  ? 144  ALA C C   1 
ATOM   5623 O O   . ALA C 1 145 ? 3.903   -12.245 107.175 1.00 38.69  ? 144  ALA C O   1 
ATOM   5624 C CB  . ALA C 1 145 ? 1.664   -13.975 105.136 1.00 36.88  ? 144  ALA C CB  1 
ATOM   5625 N N   . ASP C 1 146 ? 1.680   -12.057 107.276 1.00 43.10  ? 145  ASP C N   1 
ATOM   5626 C CA  . ASP C 1 146 ? 1.651   -11.558 108.647 1.00 45.24  ? 145  ASP C CA  1 
ATOM   5627 C C   . ASP C 1 146 ? 2.658   -10.437 108.959 1.00 44.03  ? 145  ASP C C   1 
ATOM   5628 O O   . ASP C 1 146 ? 3.715   -10.694 109.531 1.00 45.88  ? 145  ASP C O   1 
ATOM   5629 C CB  . ASP C 1 146 ? 1.864   -12.704 109.633 1.00 45.41  ? 145  ASP C CB  1 
ATOM   5630 C CG  . ASP C 1 146 ? 1.526   -12.307 111.058 1.00 46.80  ? 145  ASP C CG  1 
ATOM   5631 O OD1 . ASP C 1 146 ? 1.325   -11.096 111.307 1.00 46.85  ? 145  ASP C OD1 1 
ATOM   5632 O OD2 . ASP C 1 146 ? 1.466   -13.202 111.927 1.00 47.11  ? 145  ASP C OD2 1 
ATOM   5633 N N   . PHE C 1 147 ? 2.318   -9.201  108.597 1.00 43.28  ? 146  PHE C N   1 
ATOM   5634 C CA  . PHE C 1 147 ? 3.177   -8.043  108.865 1.00 41.69  ? 146  PHE C CA  1 
ATOM   5635 C C   . PHE C 1 147 ? 2.712   -7.348  110.133 1.00 42.11  ? 146  PHE C C   1 
ATOM   5636 O O   . PHE C 1 147 ? 2.896   -6.144  110.292 1.00 42.68  ? 146  PHE C O   1 
ATOM   5637 C CB  . PHE C 1 147 ? 3.118   -7.039  107.713 1.00 39.89  ? 146  PHE C CB  1 
ATOM   5638 C CG  . PHE C 1 147 ? 3.760   -7.525  106.453 1.00 40.13  ? 146  PHE C CG  1 
ATOM   5639 C CD1 . PHE C 1 147 ? 3.308   -8.677  105.821 1.00 41.29  ? 146  PHE C CD1 1 
ATOM   5640 C CD2 . PHE C 1 147 ? 4.829   -6.838  105.902 1.00 40.02  ? 146  PHE C CD2 1 
ATOM   5641 C CE1 . PHE C 1 147 ? 3.919   -9.140  104.653 1.00 42.43  ? 146  PHE C CE1 1 
ATOM   5642 C CE2 . PHE C 1 147 ? 5.443   -7.290  104.738 1.00 41.54  ? 146  PHE C CE2 1 
ATOM   5643 C CZ  . PHE C 1 147 ? 4.989   -8.442  104.111 1.00 40.11  ? 146  PHE C CZ  1 
ATOM   5644 N N   . GLY C 1 148 ? 2.101   -8.110  111.033 1.00 42.64  ? 147  GLY C N   1 
ATOM   5645 C CA  . GLY C 1 148 ? 1.617   -7.540  112.276 1.00 43.65  ? 147  GLY C CA  1 
ATOM   5646 C C   . GLY C 1 148 ? 2.722   -7.052  113.196 1.00 44.95  ? 147  GLY C C   1 
ATOM   5647 O O   . GLY C 1 148 ? 2.459   -6.419  114.217 1.00 46.80  ? 147  GLY C O   1 
ATOM   5648 N N   . LEU C 1 149 ? 3.965   -7.348  112.836 1.00 45.41  ? 148  LEU C N   1 
ATOM   5649 C CA  . LEU C 1 149 ? 5.111   -6.943  113.635 1.00 45.00  ? 148  LEU C CA  1 
ATOM   5650 C C   . LEU C 1 149 ? 6.121   -6.193  112.779 1.00 43.48  ? 148  LEU C C   1 
ATOM   5651 O O   . LEU C 1 149 ? 7.223   -5.898  113.228 1.00 43.83  ? 148  LEU C O   1 
ATOM   5652 C CB  . LEU C 1 149 ? 5.779   -8.179  114.245 1.00 47.06  ? 148  LEU C CB  1 
ATOM   5653 C CG  . LEU C 1 149 ? 5.917   -8.204  115.769 1.00 46.93  ? 148  LEU C CG  1 
ATOM   5654 C CD1 . LEU C 1 149 ? 4.559   -7.984  116.403 1.00 46.02  ? 148  LEU C CD1 1 
ATOM   5655 C CD2 . LEU C 1 149 ? 6.508   -9.535  116.205 1.00 47.65  ? 148  LEU C CD2 1 
ATOM   5656 N N   . ALA C 1 150 ? 5.739   -5.897  111.543 1.00 42.34  ? 149  ALA C N   1 
ATOM   5657 C CA  . ALA C 1 150 ? 6.613   -5.195  110.619 1.00 44.04  ? 149  ALA C CA  1 
ATOM   5658 C C   . ALA C 1 150 ? 6.738   -3.733  111.029 1.00 45.89  ? 149  ALA C C   1 
ATOM   5659 O O   . ALA C 1 150 ? 5.979   -3.249  111.876 1.00 46.28  ? 149  ALA C O   1 
ATOM   5660 C CB  . ALA C 1 150 ? 6.067   -5.302  109.201 1.00 41.84  ? 149  ALA C CB  1 
ATOM   5661 N N   . ARG C 1 151 ? 7.696   -3.034  110.427 1.00 46.28  ? 150  ARG C N   1 
ATOM   5662 C CA  . ARG C 1 151 ? 7.918   -1.623  110.739 1.00 47.79  ? 150  ARG C CA  1 
ATOM   5663 C C   . ARG C 1 151 ? 8.656   -0.898  109.610 1.00 47.36  ? 150  ARG C C   1 
ATOM   5664 O O   . ARG C 1 151 ? 9.483   -1.482  108.913 1.00 47.38  ? 150  ARG C O   1 
ATOM   5665 C CB  . ARG C 1 151 ? 8.688   -1.510  112.074 1.00 46.33  ? 150  ARG C CB  1 
ATOM   5666 C CG  . ARG C 1 151 ? 9.934   -0.640  112.067 1.00 48.01  ? 150  ARG C CG  1 
ATOM   5667 C CD  . ARG C 1 151 ? 9.685   0.762   112.601 1.00 48.87  ? 150  ARG C CD  1 
ATOM   5668 N NE  . ARG C 1 151 ? 9.660   0.825   114.060 1.00 48.33  ? 150  ARG C NE  1 
ATOM   5669 C CZ  . ARG C 1 151 ? 9.512   1.957   114.748 1.00 48.56  ? 150  ARG C CZ  1 
ATOM   5670 N NH1 . ARG C 1 151 ? 9.378   3.110   114.105 1.00 46.85  ? 150  ARG C NH1 1 
ATOM   5671 N NH2 . ARG C 1 151 ? 9.499   1.943   116.074 1.00 46.80  ? 150  ARG C NH2 1 
ATOM   5672 N N   . ALA C 1 152 ? 8.319   0.370   109.408 1.00 49.38  ? 151  ALA C N   1 
ATOM   5673 C CA  . ALA C 1 152 ? 8.982   1.171   108.388 1.00 50.96  ? 151  ALA C CA  1 
ATOM   5674 C C   . ALA C 1 152 ? 10.268  1.663   109.034 1.00 51.46  ? 151  ALA C C   1 
ATOM   5675 O O   . ALA C 1 152 ? 10.221  2.365   110.046 1.00 51.89  ? 151  ALA C O   1 
ATOM   5676 C CB  . ALA C 1 152 ? 8.104   2.358   107.985 1.00 49.77  ? 151  ALA C CB  1 
ATOM   5677 N N   . PHE C 1 153 ? 11.415  1.278   108.481 1.00 52.15  ? 152  PHE C N   1 
ATOM   5678 C CA  . PHE C 1 153 ? 12.680  1.722   109.055 1.00 53.43  ? 152  PHE C CA  1 
ATOM   5679 C C   . PHE C 1 153 ? 13.245  2.938   108.326 1.00 54.13  ? 152  PHE C C   1 
ATOM   5680 O O   . PHE C 1 153 ? 12.955  3.179   107.151 1.00 53.02  ? 152  PHE C O   1 
ATOM   5681 C CB  . PHE C 1 153 ? 13.722  0.588   109.066 1.00 52.64  ? 152  PHE C CB  1 
ATOM   5682 C CG  . PHE C 1 153 ? 14.218  0.192   107.705 1.00 53.58  ? 152  PHE C CG  1 
ATOM   5683 C CD1 . PHE C 1 153 ? 13.593  -0.818  106.988 1.00 54.50  ? 152  PHE C CD1 1 
ATOM   5684 C CD2 . PHE C 1 153 ? 15.321  0.828   107.139 1.00 55.33  ? 152  PHE C CD2 1 
ATOM   5685 C CE1 . PHE C 1 153 ? 14.060  -1.191  105.726 1.00 54.48  ? 152  PHE C CE1 1 
ATOM   5686 C CE2 . PHE C 1 153 ? 15.796  0.465   105.874 1.00 53.72  ? 152  PHE C CE2 1 
ATOM   5687 C CZ  . PHE C 1 153 ? 15.166  -0.544  105.170 1.00 54.88  ? 152  PHE C CZ  1 
ATOM   5688 N N   . GLY C 1 154 ? 14.046  3.710   109.050 1.00 56.23  ? 153  GLY C N   1 
ATOM   5689 C CA  . GLY C 1 154 ? 14.658  4.894   108.481 1.00 57.07  ? 153  GLY C CA  1 
ATOM   5690 C C   . GLY C 1 154 ? 16.103  4.625   108.122 1.00 58.29  ? 153  GLY C C   1 
ATOM   5691 O O   . GLY C 1 154 ? 16.728  3.705   108.650 1.00 59.44  ? 153  GLY C O   1 
ATOM   5692 N N   . VAL C 1 155 ? 16.629  5.426   107.207 1.00 59.25  ? 154  VAL C N   1 
ATOM   5693 C CA  . VAL C 1 155 ? 18.007  5.292   106.762 1.00 59.01  ? 154  VAL C CA  1 
ATOM   5694 C C   . VAL C 1 155 ? 18.782  6.489   107.299 1.00 59.38  ? 154  VAL C C   1 
ATOM   5695 O O   . VAL C 1 155 ? 18.640  7.600   106.787 1.00 60.09  ? 154  VAL C O   1 
ATOM   5696 C CB  . VAL C 1 155 ? 18.085  5.290   105.214 1.00 58.62  ? 154  VAL C CB  1 
ATOM   5697 C CG1 . VAL C 1 155 ? 19.537  5.306   104.757 1.00 60.68  ? 154  VAL C CG1 1 
ATOM   5698 C CG2 . VAL C 1 155 ? 17.376  4.069   104.660 1.00 58.70  ? 154  VAL C CG2 1 
ATOM   5699 N N   . PRO C 1 156 ? 19.603  6.290   108.344 1.00 59.21  ? 155  PRO C N   1 
ATOM   5700 C CA  . PRO C 1 156 ? 19.893  5.060   109.091 1.00 59.01  ? 155  PRO C CA  1 
ATOM   5701 C C   . PRO C 1 156 ? 18.902  4.754   110.219 1.00 58.68  ? 155  PRO C C   1 
ATOM   5702 O O   . PRO C 1 156 ? 18.427  5.649   110.913 1.00 58.05  ? 155  PRO C O   1 
ATOM   5703 C CB  . PRO C 1 156 ? 21.292  5.322   109.631 1.00 59.39  ? 155  PRO C CB  1 
ATOM   5704 C CG  . PRO C 1 156 ? 21.226  6.785   109.946 1.00 59.06  ? 155  PRO C CG  1 
ATOM   5705 C CD  . PRO C 1 156 ? 20.567  7.347   108.704 1.00 58.90  ? 155  PRO C CD  1 
ATOM   5706 N N   . VAL C 1 157 ? 18.617  3.473   110.411 1.00 59.32  ? 156  VAL C N   1 
ATOM   5707 C CA  . VAL C 1 157 ? 17.685  3.039   111.443 1.00 60.11  ? 156  VAL C CA  1 
ATOM   5708 C C   . VAL C 1 157 ? 18.130  3.556   112.808 1.00 60.20  ? 156  VAL C C   1 
ATOM   5709 O O   . VAL C 1 157 ? 19.284  3.934   112.986 1.00 59.87  ? 156  VAL C O   1 
ATOM   5710 C CB  . VAL C 1 157 ? 17.603  1.478   111.511 1.00 60.32  ? 156  VAL C CB  1 
ATOM   5711 C CG1 . VAL C 1 157 ? 17.687  0.885   110.109 1.00 61.44  ? 156  VAL C CG1 1 
ATOM   5712 C CG2 . VAL C 1 157 ? 18.715  0.916   112.383 1.00 60.07  ? 156  VAL C CG2 1 
ATOM   5713 N N   . ARG C 1 158 ? 17.206  3.580   113.763 1.00 60.14  ? 157  ARG C N   1 
ATOM   5714 C CA  . ARG C 1 158 ? 17.521  4.001   115.123 1.00 59.56  ? 157  ARG C CA  1 
ATOM   5715 C C   . ARG C 1 158 ? 17.070  2.851   116.027 1.00 58.70  ? 157  ARG C C   1 
ATOM   5716 O O   . ARG C 1 158 ? 16.722  1.781   115.531 1.00 58.93  ? 157  ARG C O   1 
ATOM   5717 C CB  . ARG C 1 158 ? 16.794  5.304   115.485 1.00 60.71  ? 157  ARG C CB  1 
ATOM   5718 C CG  . ARG C 1 158 ? 15.293  5.181   115.668 1.00 62.79  ? 157  ARG C CG  1 
ATOM   5719 C CD  . ARG C 1 158 ? 14.724  6.430   116.337 1.00 62.46  ? 157  ARG C CD  1 
ATOM   5720 N NE  . ARG C 1 158 ? 13.372  6.209   116.853 1.00 63.96  ? 157  ARG C NE  1 
ATOM   5721 C CZ  . ARG C 1 158 ? 12.286  6.079   116.096 1.00 64.11  ? 157  ARG C CZ  1 
ATOM   5722 N NH1 . ARG C 1 158 ? 12.379  6.150   114.773 1.00 62.95  ? 157  ARG C NH1 1 
ATOM   5723 N NH2 . ARG C 1 158 ? 11.105  5.871   116.668 1.00 63.67  ? 157  ARG C NH2 1 
ATOM   5724 N N   . THR C 1 159 ? 17.080  3.049   117.340 1.00 57.60  ? 158  THR C N   1 
ATOM   5725 C CA  . THR C 1 159 ? 16.667  1.980   118.244 1.00 55.66  ? 158  THR C CA  1 
ATOM   5726 C C   . THR C 1 159 ? 15.179  1.688   118.085 1.00 54.91  ? 158  THR C C   1 
ATOM   5727 O O   . THR C 1 159 ? 14.340  2.584   118.181 1.00 54.12  ? 158  THR C O   1 
ATOM   5728 C CB  . THR C 1 159 ? 16.956  2.333   119.722 1.00 56.15  ? 158  THR C CB  1 
ATOM   5729 O OG1 . THR C 1 159 ? 18.366  2.507   119.913 1.00 56.66  ? 158  THR C OG1 1 
ATOM   5730 C CG2 . THR C 1 159 ? 16.480  1.219   120.634 1.00 55.10  ? 158  THR C CG2 1 
ATOM   5731 N N   . TYR C 1 160 ? 14.866  0.421   117.839 1.00 54.24  ? 159  TYR C N   1 
ATOM   5732 C CA  . TYR C 1 160 ? 13.494  -0.028  117.653 1.00 52.64  ? 159  TYR C CA  1 
ATOM   5733 C C   . TYR C 1 160 ? 13.078  -1.002  118.744 1.00 51.79  ? 159  TYR C C   1 
ATOM   5734 O O   . TYR C 1 160 ? 13.804  -1.219  119.701 1.00 52.53  ? 159  TYR C O   1 
ATOM   5735 C CB  . TYR C 1 160 ? 13.346  -0.692  116.283 1.00 50.78  ? 159  TYR C CB  1 
ATOM   5736 C CG  . TYR C 1 160 ? 13.647  0.232   115.125 1.00 48.36  ? 159  TYR C CG  1 
ATOM   5737 C CD1 . TYR C 1 160 ? 13.198  1.549   115.128 1.00 49.07  ? 159  TYR C CD1 1 
ATOM   5738 C CD2 . TYR C 1 160 ? 14.353  -0.218  114.011 1.00 48.51  ? 159  TYR C CD2 1 
ATOM   5739 C CE1 . TYR C 1 160 ? 13.444  2.399   114.052 1.00 49.12  ? 159  TYR C CE1 1 
ATOM   5740 C CE2 . TYR C 1 160 ? 14.602  0.622   112.925 1.00 48.19  ? 159  TYR C CE2 1 
ATOM   5741 C CZ  . TYR C 1 160 ? 14.146  1.929   112.954 1.00 48.60  ? 159  TYR C CZ  1 
ATOM   5742 O OH  . TYR C 1 160 ? 14.389  2.771   111.893 1.00 50.28  ? 159  TYR C OH  1 
HETATM 5743 N N   . TPO C 1 161 ? 11.902  -1.591  118.585 1.00 52.36  ? 160  TPO C N   1 
HETATM 5744 C CA  . TPO C 1 161 ? 11.355  -2.536  119.552 1.00 52.50  ? 160  TPO C CA  1 
HETATM 5745 C CB  . TPO C 1 161 ? 9.963   -3.015  119.095 1.00 51.44  ? 160  TPO C CB  1 
HETATM 5746 C CG2 . TPO C 1 161 ? 9.388   -4.010  120.102 1.00 51.51  ? 160  TPO C CG2 1 
HETATM 5747 O OG1 . TPO C 1 161 ? 9.081   -1.885  118.996 1.00 51.26  ? 160  TPO C OG1 1 
HETATM 5748 P P   . TPO C 1 161 ? 8.727   -1.250  117.643 1.00 49.50  ? 160  TPO C P   1 
HETATM 5749 O O1P . TPO C 1 161 ? 7.894   -0.025  117.857 1.00 48.37  ? 160  TPO C O1P 1 
HETATM 5750 O O2P . TPO C 1 161 ? 10.066  -1.014  116.997 1.00 50.02  ? 160  TPO C O2P 1 
HETATM 5751 O O3P . TPO C 1 161 ? 7.955   -2.315  117.015 1.00 48.56  ? 160  TPO C O3P 1 
HETATM 5752 C C   . TPO C 1 161 ? 12.263  -3.761  119.750 1.00 53.56  ? 160  TPO C C   1 
HETATM 5753 O O   . TPO C 1 161 ? 12.774  -4.327  118.786 1.00 52.66  ? 160  TPO C O   1 
ATOM   5754 N N   . HIS C 1 162 ? 12.457  -4.171  121.003 1.00 54.72  ? 161  HIS C N   1 
ATOM   5755 C CA  . HIS C 1 162 ? 13.294  -5.330  121.284 1.00 57.51  ? 161  HIS C CA  1 
ATOM   5756 C C   . HIS C 1 162 ? 12.550  -6.659  121.191 1.00 59.36  ? 161  HIS C C   1 
ATOM   5757 O O   . HIS C 1 162 ? 13.060  -7.615  120.602 1.00 59.81  ? 161  HIS C O   1 
ATOM   5758 C CB  . HIS C 1 162 ? 13.927  -5.238  122.666 1.00 59.86  ? 161  HIS C CB  1 
ATOM   5759 C CG  . HIS C 1 162 ? 14.739  -6.445  123.023 1.00 63.07  ? 161  HIS C CG  1 
ATOM   5760 N ND1 . HIS C 1 162 ? 14.503  -7.198  124.154 1.00 64.76  ? 161  HIS C ND1 1 
ATOM   5761 C CD2 . HIS C 1 162 ? 15.758  -7.054  122.373 1.00 62.66  ? 161  HIS C CD2 1 
ATOM   5762 C CE1 . HIS C 1 162 ? 15.341  -8.219  124.185 1.00 63.11  ? 161  HIS C CE1 1 
ATOM   5763 N NE2 . HIS C 1 162 ? 16.113  -8.154  123.115 1.00 63.56  ? 161  HIS C NE2 1 
ATOM   5764 N N   . GLU C 1 163 ? 11.364  -6.728  121.795 1.00 59.97  ? 162  GLU C N   1 
ATOM   5765 C CA  . GLU C 1 163 ? 10.553  -7.949  121.765 1.00 59.37  ? 162  GLU C CA  1 
ATOM   5766 C C   . GLU C 1 163 ? 10.162  -8.134  120.315 1.00 58.37  ? 162  GLU C C   1 
ATOM   5767 O O   . GLU C 1 163 ? 9.043   -7.809  119.917 1.00 57.65  ? 162  GLU C O   1 
ATOM   5768 C CB  . GLU C 1 163 ? 9.284   -7.795  122.611 1.00 59.70  ? 162  GLU C CB  1 
ATOM   5769 C CG  . GLU C 1 163 ? 9.520   -7.301  124.024 1.00 61.88  ? 162  GLU C CG  1 
ATOM   5770 C CD  . GLU C 1 163 ? 10.133  -5.908  124.060 1.00 63.53  ? 162  GLU C CD  1 
ATOM   5771 O OE1 . GLU C 1 163 ? 9.488   -4.958  123.558 1.00 65.21  ? 162  GLU C OE1 1 
ATOM   5772 O OE2 . GLU C 1 163 ? 11.263  -5.767  124.584 1.00 63.94  ? 162  GLU C OE2 1 
ATOM   5773 N N   . VAL C 1 164 ? 11.090  -8.665  119.530 1.00 57.76  ? 163  VAL C N   1 
ATOM   5774 C CA  . VAL C 1 164 ? 10.853  -8.845  118.114 1.00 57.00  ? 163  VAL C CA  1 
ATOM   5775 C C   . VAL C 1 164 ? 11.405  -10.179 117.606 1.00 56.19  ? 163  VAL C C   1 
ATOM   5776 O O   . VAL C 1 164 ? 12.477  -10.616 118.026 1.00 56.30  ? 163  VAL C O   1 
ATOM   5777 C CB  . VAL C 1 164 ? 11.483  -7.658  117.344 1.00 55.84  ? 163  VAL C CB  1 
ATOM   5778 C CG1 . VAL C 1 164 ? 12.977  -7.869  117.172 1.00 55.42  ? 163  VAL C CG1 1 
ATOM   5779 C CG2 . VAL C 1 164 ? 10.784  -7.470  116.023 1.00 59.47  ? 163  VAL C CG2 1 
ATOM   5780 N N   . VAL C 1 165 ? 10.647  -10.819 116.715 1.00 56.21  ? 164  VAL C N   1 
ATOM   5781 C CA  . VAL C 1 165 ? 11.001  -12.114 116.107 1.00 56.19  ? 164  VAL C CA  1 
ATOM   5782 C C   . VAL C 1 165 ? 10.911  -13.349 117.035 1.00 55.43  ? 164  VAL C C   1 
ATOM   5783 O O   . VAL C 1 165 ? 11.439  -13.353 118.152 1.00 54.97  ? 164  VAL C O   1 
ATOM   5784 C CB  . VAL C 1 165 ? 12.419  -12.079 115.479 1.00 55.27  ? 164  VAL C CB  1 
ATOM   5785 C CG1 . VAL C 1 165 ? 12.649  -13.345 114.670 1.00 55.45  ? 164  VAL C CG1 1 
ATOM   5786 C CG2 . VAL C 1 165 ? 12.579  -10.852 114.602 1.00 53.80  ? 164  VAL C CG2 1 
ATOM   5787 N N   . THR C 1 166 ? 10.239  -14.397 116.558 1.00 55.36  ? 165  THR C N   1 
ATOM   5788 C CA  . THR C 1 166 ? 10.086  -15.623 117.342 1.00 55.22  ? 165  THR C CA  1 
ATOM   5789 C C   . THR C 1 166 ? 11.454  -16.212 117.662 1.00 53.49  ? 165  THR C C   1 
ATOM   5790 O O   . THR C 1 166 ? 12.266  -16.445 116.765 1.00 52.93  ? 165  THR C O   1 
ATOM   5791 C CB  . THR C 1 166 ? 9.254   -16.690 116.592 1.00 56.81  ? 165  THR C CB  1 
ATOM   5792 O OG1 . THR C 1 166 ? 8.021   -16.112 116.148 1.00 59.53  ? 165  THR C OG1 1 
ATOM   5793 C CG2 . THR C 1 166 ? 8.930   -17.857 117.517 1.00 57.72  ? 165  THR C CG2 1 
ATOM   5794 N N   . LEU C 1 167 ? 11.686  -16.459 118.947 1.00 52.70  ? 166  LEU C N   1 
ATOM   5795 C CA  . LEU C 1 167 ? 12.954  -16.991 119.439 1.00 51.18  ? 166  LEU C CA  1 
ATOM   5796 C C   . LEU C 1 167 ? 13.775  -17.835 118.460 1.00 50.00  ? 166  LEU C C   1 
ATOM   5797 O O   . LEU C 1 167 ? 14.838  -17.405 118.008 1.00 49.72  ? 166  LEU C O   1 
ATOM   5798 C CB  . LEU C 1 167 ? 12.733  -17.792 120.722 1.00 50.28  ? 166  LEU C CB  1 
ATOM   5799 C CG  . LEU C 1 167 ? 14.051  -18.328 121.292 1.00 53.75  ? 166  LEU C CG  1 
ATOM   5800 C CD1 . LEU C 1 167 ? 14.992  -17.163 121.576 1.00 52.16  ? 166  LEU C CD1 1 
ATOM   5801 C CD2 . LEU C 1 167 ? 13.796  -19.135 122.553 1.00 53.93  ? 166  LEU C CD2 1 
ATOM   5802 N N   . TRP C 1 168 ? 13.298  -19.031 118.137 1.00 47.80  ? 167  TRP C N   1 
ATOM   5803 C CA  . TRP C 1 168 ? 14.040  -19.898 117.232 1.00 47.83  ? 167  TRP C CA  1 
ATOM   5804 C C   . TRP C 1 168 ? 14.645  -19.186 116.017 1.00 48.42  ? 167  TRP C C   1 
ATOM   5805 O O   . TRP C 1 168 ? 15.754  -19.520 115.577 1.00 47.66  ? 167  TRP C O   1 
ATOM   5806 C CB  . TRP C 1 168 ? 13.152  -21.035 116.728 1.00 46.37  ? 167  TRP C CB  1 
ATOM   5807 C CG  . TRP C 1 168 ? 12.802  -22.045 117.745 1.00 44.87  ? 167  TRP C CG  1 
ATOM   5808 C CD1 . TRP C 1 168 ? 13.042  -21.985 119.087 1.00 45.28  ? 167  TRP C CD1 1 
ATOM   5809 C CD2 . TRP C 1 168 ? 12.087  -23.258 117.518 1.00 44.26  ? 167  TRP C CD2 1 
ATOM   5810 N NE1 . TRP C 1 168 ? 12.514  -23.091 119.714 1.00 43.18  ? 167  TRP C NE1 1 
ATOM   5811 C CE2 . TRP C 1 168 ? 11.922  -23.889 118.772 1.00 43.93  ? 167  TRP C CE2 1 
ATOM   5812 C CE3 . TRP C 1 168 ? 11.565  -23.876 116.376 1.00 43.03  ? 167  TRP C CE3 1 
ATOM   5813 C CZ2 . TRP C 1 168 ? 11.260  -25.104 118.914 1.00 43.85  ? 167  TRP C CZ2 1 
ATOM   5814 C CZ3 . TRP C 1 168 ? 10.909  -25.081 116.517 1.00 42.81  ? 167  TRP C CZ3 1 
ATOM   5815 C CH2 . TRP C 1 168 ? 10.761  -25.683 117.778 1.00 44.43  ? 167  TRP C CH2 1 
ATOM   5816 N N   . TYR C 1 169 ? 13.929  -18.203 115.480 1.00 47.14  ? 168  TYR C N   1 
ATOM   5817 C CA  . TYR C 1 169 ? 14.398  -17.513 114.282 1.00 46.94  ? 168  TYR C CA  1 
ATOM   5818 C C   . TYR C 1 169 ? 15.017  -16.135 114.511 1.00 46.50  ? 168  TYR C C   1 
ATOM   5819 O O   . TYR C 1 169 ? 15.252  -15.395 113.556 1.00 45.66  ? 168  TYR C O   1 
ATOM   5820 C CB  . TYR C 1 169 ? 13.236  -17.410 113.287 1.00 45.47  ? 168  TYR C CB  1 
ATOM   5821 C CG  . TYR C 1 169 ? 12.568  -18.738 113.011 1.00 45.05  ? 168  TYR C CG  1 
ATOM   5822 C CD1 . TYR C 1 169 ? 13.174  -19.690 112.202 1.00 45.42  ? 168  TYR C CD1 1 
ATOM   5823 C CD2 . TYR C 1 169 ? 11.344  -19.060 113.593 1.00 46.71  ? 168  TYR C CD2 1 
ATOM   5824 C CE1 . TYR C 1 169 ? 12.578  -20.933 111.977 1.00 44.89  ? 168  TYR C CE1 1 
ATOM   5825 C CE2 . TYR C 1 169 ? 10.742  -20.301 113.376 1.00 44.71  ? 168  TYR C CE2 1 
ATOM   5826 C CZ  . TYR C 1 169 ? 11.364  -21.231 112.568 1.00 44.81  ? 168  TYR C CZ  1 
ATOM   5827 O OH  . TYR C 1 169 ? 10.772  -22.458 112.350 1.00 45.22  ? 168  TYR C OH  1 
ATOM   5828 N N   . ARG C 1 170 ? 15.301  -15.815 115.770 1.00 46.74  ? 169  ARG C N   1 
ATOM   5829 C CA  . ARG C 1 170 ? 15.873  -14.520 116.152 1.00 49.62  ? 169  ARG C CA  1 
ATOM   5830 C C   . ARG C 1 170 ? 17.390  -14.374 115.906 1.00 50.04  ? 169  ARG C C   1 
ATOM   5831 O O   . ARG C 1 170 ? 18.176  -15.263 116.237 1.00 49.49  ? 169  ARG C O   1 
ATOM   5832 C CB  . ARG C 1 170 ? 15.554  -14.260 117.631 1.00 50.09  ? 169  ARG C CB  1 
ATOM   5833 C CG  . ARG C 1 170 ? 15.742  -12.821 118.101 1.00 50.23  ? 169  ARG C CG  1 
ATOM   5834 C CD  . ARG C 1 170 ? 15.257  -12.677 119.531 1.00 48.44  ? 169  ARG C CD  1 
ATOM   5835 N NE  . ARG C 1 170 ? 13.879  -13.136 119.676 1.00 48.26  ? 169  ARG C NE  1 
ATOM   5836 C CZ  . ARG C 1 170 ? 13.300  -13.386 120.845 1.00 48.73  ? 169  ARG C CZ  1 
ATOM   5837 N NH1 . ARG C 1 170 ? 13.990  -13.216 121.971 1.00 46.34  ? 169  ARG C NH1 1 
ATOM   5838 N NH2 . ARG C 1 170 ? 12.040  -13.815 120.886 1.00 43.80  ? 169  ARG C NH2 1 
ATOM   5839 N N   . ALA C 1 171 ? 17.792  -13.241 115.333 1.00 50.65  ? 170  ALA C N   1 
ATOM   5840 C CA  . ALA C 1 171 ? 19.203  -12.985 115.041 1.00 53.18  ? 170  ALA C CA  1 
ATOM   5841 C C   . ALA C 1 171 ? 19.986  -12.641 116.297 1.00 55.56  ? 170  ALA C C   1 
ATOM   5842 O O   . ALA C 1 171 ? 19.440  -12.053 117.235 1.00 56.79  ? 170  ALA C O   1 
ATOM   5843 C CB  . ALA C 1 171 ? 19.336  -11.853 114.040 1.00 52.01  ? 170  ALA C CB  1 
ATOM   5844 N N   . PRO C 1 172 ? 21.287  -12.986 116.323 1.00 56.57  ? 171  PRO C N   1 
ATOM   5845 C CA  . PRO C 1 172 ? 22.179  -12.729 117.457 1.00 56.78  ? 171  PRO C CA  1 
ATOM   5846 C C   . PRO C 1 172 ? 22.175  -11.280 117.944 1.00 57.01  ? 171  PRO C C   1 
ATOM   5847 O O   . PRO C 1 172 ? 22.044  -11.029 119.145 1.00 57.00  ? 171  PRO C O   1 
ATOM   5848 C CB  . PRO C 1 172 ? 23.542  -13.152 116.918 1.00 56.62  ? 171  PRO C CB  1 
ATOM   5849 C CG  . PRO C 1 172 ? 23.197  -14.255 115.992 1.00 55.85  ? 171  PRO C CG  1 
ATOM   5850 C CD  . PRO C 1 172 ? 22.021  -13.676 115.249 1.00 56.70  ? 171  PRO C CD  1 
ATOM   5851 N N   . GLU C 1 173 ? 22.307  -10.329 117.022 1.00 55.87  ? 172  GLU C N   1 
ATOM   5852 C CA  . GLU C 1 173 ? 22.329  -8.928  117.419 1.00 57.03  ? 172  GLU C CA  1 
ATOM   5853 C C   . GLU C 1 173 ? 21.035  -8.483  118.085 1.00 57.53  ? 172  GLU C C   1 
ATOM   5854 O O   . GLU C 1 173 ? 20.951  -7.377  118.603 1.00 57.54  ? 172  GLU C O   1 
ATOM   5855 C CB  . GLU C 1 173 ? 22.650  -8.011  116.234 1.00 56.56  ? 172  GLU C CB  1 
ATOM   5856 C CG  . GLU C 1 173 ? 21.579  -7.887  115.175 1.00 58.39  ? 172  GLU C CG  1 
ATOM   5857 C CD  . GLU C 1 173 ? 21.640  -8.982  114.142 1.00 58.82  ? 172  GLU C CD  1 
ATOM   5858 O OE1 . GLU C 1 173 ? 21.056  -8.794  113.051 1.00 58.55  ? 172  GLU C OE1 1 
ATOM   5859 O OE2 . GLU C 1 173 ? 22.265  -10.026 114.422 1.00 59.52  ? 172  GLU C OE2 1 
ATOM   5860 N N   . ILE C 1 174 ? 20.022  -9.341  118.057 1.00 58.76  ? 173  ILE C N   1 
ATOM   5861 C CA  . ILE C 1 174 ? 18.754  -9.038  118.710 1.00 59.07  ? 173  ILE C CA  1 
ATOM   5862 C C   . ILE C 1 174 ? 18.804  -9.778  120.042 1.00 60.21  ? 173  ILE C C   1 
ATOM   5863 O O   . ILE C 1 174 ? 18.412  -9.250  121.085 1.00 58.64  ? 173  ILE C O   1 
ATOM   5864 C CB  . ILE C 1 174 ? 17.547  -9.546  117.896 1.00 58.96  ? 173  ILE C CB  1 
ATOM   5865 C CG1 . ILE C 1 174 ? 17.380  -8.706  116.632 1.00 59.26  ? 173  ILE C CG1 1 
ATOM   5866 C CG2 . ILE C 1 174 ? 16.283  -9.480  118.738 1.00 57.77  ? 173  ILE C CG2 1 
ATOM   5867 C CD1 . ILE C 1 174 ? 16.177  -9.112  115.786 1.00 61.29  ? 173  ILE C CD1 1 
ATOM   5868 N N   . LEU C 1 175 ? 19.305  -11.008 119.986 1.00 61.61  ? 174  LEU C N   1 
ATOM   5869 C CA  . LEU C 1 175 ? 19.446  -11.851 121.164 1.00 63.06  ? 174  LEU C CA  1 
ATOM   5870 C C   . LEU C 1 175 ? 20.402  -11.229 122.168 1.00 62.99  ? 174  LEU C C   1 
ATOM   5871 O O   . LEU C 1 175 ? 20.121  -11.185 123.361 1.00 62.15  ? 174  LEU C O   1 
ATOM   5872 C CB  . LEU C 1 175 ? 19.958  -13.229 120.756 1.00 63.76  ? 174  LEU C CB  1 
ATOM   5873 C CG  . LEU C 1 175 ? 18.850  -14.214 120.395 1.00 64.19  ? 174  LEU C CG  1 
ATOM   5874 C CD1 . LEU C 1 175 ? 19.452  -15.503 119.858 1.00 64.60  ? 174  LEU C CD1 1 
ATOM   5875 C CD2 . LEU C 1 175 ? 18.003  -14.480 121.641 1.00 64.50  ? 174  LEU C CD2 1 
ATOM   5876 N N   . LEU C 1 176 ? 21.536  -10.753 121.674 1.00 64.58  ? 175  LEU C N   1 
ATOM   5877 C CA  . LEU C 1 176 ? 22.532  -10.115 122.524 1.00 67.00  ? 175  LEU C CA  1 
ATOM   5878 C C   . LEU C 1 176 ? 22.044  -8.736  122.971 1.00 68.30  ? 175  LEU C C   1 
ATOM   5879 O O   . LEU C 1 176 ? 22.655  -8.103  123.830 1.00 69.47  ? 175  LEU C O   1 
ATOM   5880 C CB  . LEU C 1 176 ? 23.856  -9.982  121.769 1.00 67.59  ? 175  LEU C CB  1 
ATOM   5881 C CG  . LEU C 1 176 ? 24.606  -11.292 121.507 1.00 68.07  ? 175  LEU C CG  1 
ATOM   5882 C CD1 . LEU C 1 176 ? 25.435  -11.177 120.238 1.00 66.91  ? 175  LEU C CD1 1 
ATOM   5883 C CD2 . LEU C 1 176 ? 25.468  -11.632 122.715 1.00 68.08  ? 175  LEU C CD2 1 
ATOM   5884 N N   . GLY C 1 177 ? 20.946  -8.273  122.379 1.00 68.65  ? 176  GLY C N   1 
ATOM   5885 C CA  . GLY C 1 177 ? 20.395  -6.980  122.747 1.00 68.66  ? 176  GLY C CA  1 
ATOM   5886 C C   . GLY C 1 177 ? 21.220  -5.791  122.288 1.00 69.06  ? 176  GLY C C   1 
ATOM   5887 O O   . GLY C 1 177 ? 21.201  -4.728  122.912 1.00 68.47  ? 176  GLY C O   1 
ATOM   5888 N N   . CYS C 1 178 ? 21.948  -5.963  121.193 1.00 69.59  ? 177  CYS C N   1 
ATOM   5889 C CA  . CYS C 1 178 ? 22.763  -4.882  120.672 1.00 70.62  ? 177  CYS C CA  1 
ATOM   5890 C C   . CYS C 1 178 ? 21.872  -3.661  120.415 1.00 70.17  ? 177  CYS C C   1 
ATOM   5891 O O   . CYS C 1 178 ? 20.687  -3.791  120.102 1.00 70.41  ? 177  CYS C O   1 
ATOM   5892 C CB  . CYS C 1 178 ? 23.482  -5.336  119.397 1.00 72.64  ? 177  CYS C CB  1 
ATOM   5893 S SG  . CYS C 1 178 ? 22.797  -4.762  117.835 1.00 81.35  ? 177  CYS C SG  1 
ATOM   5894 N N   . LYS C 1 179 ? 22.458  -2.479  120.555 1.00 69.63  ? 178  LYS C N   1 
ATOM   5895 C CA  . LYS C 1 179 ? 21.756  -1.207  120.394 1.00 68.73  ? 178  LYS C CA  1 
ATOM   5896 C C   . LYS C 1 179 ? 20.959  -0.989  119.100 1.00 67.65  ? 178  LYS C C   1 
ATOM   5897 O O   . LYS C 1 179 ? 19.847  -0.461  119.142 1.00 68.04  ? 178  LYS C O   1 
ATOM   5898 C CB  . LYS C 1 179 ? 22.766  -0.072  120.579 1.00 69.81  ? 178  LYS C CB  1 
ATOM   5899 C CG  . LYS C 1 179 ? 22.239  1.175   121.278 1.00 70.81  ? 178  LYS C CG  1 
ATOM   5900 C CD  . LYS C 1 179 ? 21.660  2.178   120.289 1.00 72.05  ? 178  LYS C CD  1 
ATOM   5901 C CE  . LYS C 1 179 ? 21.703  3.603   120.849 1.00 72.41  ? 178  LYS C CE  1 
ATOM   5902 N NZ  . LYS C 1 179 ? 23.101  4.089   121.084 1.00 72.03  ? 178  LYS C NZ  1 
ATOM   5903 N N   . TYR C 1 180 ? 21.513  -1.394  117.961 1.00 66.08  ? 179  TYR C N   1 
ATOM   5904 C CA  . TYR C 1 180 ? 20.841  -1.196  116.674 1.00 63.77  ? 179  TYR C CA  1 
ATOM   5905 C C   . TYR C 1 180 ? 20.667  -2.460  115.859 1.00 61.25  ? 179  TYR C C   1 
ATOM   5906 O O   . TYR C 1 180 ? 21.514  -3.347  115.896 1.00 61.35  ? 179  TYR C O   1 
ATOM   5907 C CB  . TYR C 1 180 ? 21.636  -0.221  115.815 1.00 65.88  ? 179  TYR C CB  1 
ATOM   5908 C CG  . TYR C 1 180 ? 21.770  1.166   116.382 1.00 68.61  ? 179  TYR C CG  1 
ATOM   5909 C CD1 . TYR C 1 180 ? 20.725  2.081   116.288 1.00 68.92  ? 179  TYR C CD1 1 
ATOM   5910 C CD2 . TYR C 1 180 ? 22.957  1.579   116.991 1.00 69.64  ? 179  TYR C CD2 1 
ATOM   5911 C CE1 . TYR C 1 180 ? 20.854  3.377   116.780 1.00 69.61  ? 179  TYR C CE1 1 
ATOM   5912 C CE2 . TYR C 1 180 ? 23.098  2.876   117.490 1.00 70.45  ? 179  TYR C CE2 1 
ATOM   5913 C CZ  . TYR C 1 180 ? 22.041  3.770   117.378 1.00 70.25  ? 179  TYR C CZ  1 
ATOM   5914 O OH  . TYR C 1 180 ? 22.166  5.053   117.859 1.00 69.27  ? 179  TYR C OH  1 
ATOM   5915 N N   . TYR C 1 181 ? 19.570  -2.542  115.113 1.00 58.34  ? 180  TYR C N   1 
ATOM   5916 C CA  . TYR C 1 181 ? 19.344  -3.687  114.239 1.00 55.80  ? 180  TYR C CA  1 
ATOM   5917 C C   . TYR C 1 181 ? 18.602  -3.230  112.999 1.00 55.75  ? 180  TYR C C   1 
ATOM   5918 O O   . TYR C 1 181 ? 18.068  -2.120  112.968 1.00 55.75  ? 180  TYR C O   1 
ATOM   5919 C CB  . TYR C 1 181 ? 18.607  -4.832  114.963 1.00 53.40  ? 180  TYR C CB  1 
ATOM   5920 C CG  . TYR C 1 181 ? 17.144  -4.632  115.294 1.00 51.84  ? 180  TYR C CG  1 
ATOM   5921 C CD1 . TYR C 1 181 ? 16.186  -4.539  114.290 1.00 51.24  ? 180  TYR C CD1 1 
ATOM   5922 C CD2 . TYR C 1 181 ? 16.711  -4.597  116.618 1.00 51.00  ? 180  TYR C CD2 1 
ATOM   5923 C CE1 . TYR C 1 181 ? 14.835  -4.418  114.591 1.00 51.09  ? 180  TYR C CE1 1 
ATOM   5924 C CE2 . TYR C 1 181 ? 15.363  -4.478  116.931 1.00 51.23  ? 180  TYR C CE2 1 
ATOM   5925 C CZ  . TYR C 1 181 ? 14.430  -4.389  115.910 1.00 51.29  ? 180  TYR C CZ  1 
ATOM   5926 O OH  . TYR C 1 181 ? 13.091  -4.279  116.205 1.00 53.85  ? 180  TYR C OH  1 
ATOM   5927 N N   . SER C 1 182 ? 18.597  -4.066  111.966 1.00 55.88  ? 181  SER C N   1 
ATOM   5928 C CA  . SER C 1 182 ? 17.926  -3.716  110.720 1.00 55.15  ? 181  SER C CA  1 
ATOM   5929 C C   . SER C 1 182 ? 17.690  -4.932  109.824 1.00 54.68  ? 181  SER C C   1 
ATOM   5930 O O   . SER C 1 182 ? 17.514  -6.043  110.316 1.00 55.23  ? 181  SER C O   1 
ATOM   5931 C CB  . SER C 1 182 ? 18.743  -2.663  109.972 1.00 55.12  ? 181  SER C CB  1 
ATOM   5932 O OG  . SER C 1 182 ? 18.083  -2.250  108.790 1.00 57.43  ? 181  SER C OG  1 
ATOM   5933 N N   . THR C 1 183 ? 17.694  -4.710  108.513 1.00 53.22  ? 182  THR C N   1 
ATOM   5934 C CA  . THR C 1 183 ? 17.452  -5.760  107.529 1.00 53.28  ? 182  THR C CA  1 
ATOM   5935 C C   . THR C 1 183 ? 18.080  -7.118  107.825 1.00 53.83  ? 182  THR C C   1 
ATOM   5936 O O   . THR C 1 183 ? 17.472  -8.156  107.555 1.00 53.26  ? 182  THR C O   1 
ATOM   5937 C CB  . THR C 1 183 ? 17.922  -5.325  106.130 1.00 53.58  ? 182  THR C CB  1 
ATOM   5938 O OG1 . THR C 1 183 ? 19.343  -5.147  106.136 1.00 53.54  ? 182  THR C OG1 1 
ATOM   5939 C CG2 . THR C 1 183 ? 17.252  -4.023  105.727 1.00 52.58  ? 182  THR C CG2 1 
ATOM   5940 N N   . ALA C 1 184 ? 19.291  -7.116  108.376 1.00 53.95  ? 183  ALA C N   1 
ATOM   5941 C CA  . ALA C 1 184 ? 19.984  -8.366  108.680 1.00 54.46  ? 183  ALA C CA  1 
ATOM   5942 C C   . ALA C 1 184 ? 19.095  -9.371  109.407 1.00 54.73  ? 183  ALA C C   1 
ATOM   5943 O O   . ALA C 1 184 ? 18.996  -10.528 108.986 1.00 56.68  ? 183  ALA C O   1 
ATOM   5944 C CB  . ALA C 1 184 ? 21.237  -8.088  109.508 1.00 55.10  ? 183  ALA C CB  1 
ATOM   5945 N N   . VAL C 1 185 ? 18.452  -8.922  110.487 1.00 52.63  ? 184  VAL C N   1 
ATOM   5946 C CA  . VAL C 1 185 ? 17.575  -9.768  111.294 1.00 50.37  ? 184  VAL C CA  1 
ATOM   5947 C C   . VAL C 1 185 ? 16.566  -10.519 110.439 1.00 49.84  ? 184  VAL C C   1 
ATOM   5948 O O   . VAL C 1 185 ? 16.107  -11.597 110.815 1.00 49.08  ? 184  VAL C O   1 
ATOM   5949 C CB  . VAL C 1 185 ? 16.821  -8.940  112.357 1.00 49.37  ? 184  VAL C CB  1 
ATOM   5950 C CG1 . VAL C 1 185 ? 17.805  -8.107  113.150 1.00 48.15  ? 184  VAL C CG1 1 
ATOM   5951 C CG2 . VAL C 1 185 ? 15.799  -8.051  111.700 1.00 49.00  ? 184  VAL C CG2 1 
ATOM   5952 N N   . ASP C 1 186 ? 16.223  -9.948  109.288 1.00 50.60  ? 185  ASP C N   1 
ATOM   5953 C CA  . ASP C 1 186 ? 15.280  -10.592 108.372 1.00 52.08  ? 185  ASP C CA  1 
ATOM   5954 C C   . ASP C 1 186 ? 15.991  -11.663 107.541 1.00 52.21  ? 185  ASP C C   1 
ATOM   5955 O O   . ASP C 1 186 ? 15.401  -12.687 107.193 1.00 52.84  ? 185  ASP C O   1 
ATOM   5956 C CB  . ASP C 1 186 ? 14.626  -9.565  107.425 1.00 51.74  ? 185  ASP C CB  1 
ATOM   5957 C CG  . ASP C 1 186 ? 13.264  -9.070  107.928 1.00 53.18  ? 185  ASP C CG  1 
ATOM   5958 O OD1 . ASP C 1 186 ? 12.612  -9.801  108.708 1.00 52.63  ? 185  ASP C OD1 1 
ATOM   5959 O OD2 . ASP C 1 186 ? 12.836  -7.960  107.524 1.00 49.38  ? 185  ASP C OD2 1 
ATOM   5960 N N   . ILE C 1 187 ? 17.259  -11.423 107.221 1.00 52.69  ? 186  ILE C N   1 
ATOM   5961 C CA  . ILE C 1 187 ? 18.026  -12.375 106.428 1.00 53.00  ? 186  ILE C CA  1 
ATOM   5962 C C   . ILE C 1 187 ? 18.359  -13.619 107.242 1.00 53.63  ? 186  ILE C C   1 
ATOM   5963 O O   . ILE C 1 187 ? 18.270  -14.744 106.742 1.00 54.47  ? 186  ILE C O   1 
ATOM   5964 C CB  . ILE C 1 187 ? 19.320  -11.719 105.885 1.00 52.56  ? 186  ILE C CB  1 
ATOM   5965 C CG1 . ILE C 1 187 ? 19.062  -11.177 104.477 1.00 51.45  ? 186  ILE C CG1 1 
ATOM   5966 C CG2 . ILE C 1 187 ? 20.464  -12.713 105.870 1.00 52.09  ? 186  ILE C CG2 1 
ATOM   5967 C CD1 . ILE C 1 187 ? 18.638  -12.243 103.493 1.00 50.06  ? 186  ILE C CD1 1 
ATOM   5968 N N   . TRP C 1 188 ? 18.732  -13.407 108.499 1.00 53.73  ? 187  TRP C N   1 
ATOM   5969 C CA  . TRP C 1 188 ? 19.061  -14.502 109.400 1.00 54.17  ? 187  TRP C CA  1 
ATOM   5970 C C   . TRP C 1 188 ? 17.885  -15.479 109.467 1.00 54.46  ? 187  TRP C C   1 
ATOM   5971 O O   . TRP C 1 188 ? 18.055  -16.693 109.312 1.00 54.90  ? 187  TRP C O   1 
ATOM   5972 C CB  . TRP C 1 188 ? 19.369  -13.937 110.789 1.00 55.58  ? 187  TRP C CB  1 
ATOM   5973 C CG  . TRP C 1 188 ? 19.631  -14.971 111.837 1.00 57.41  ? 187  TRP C CG  1 
ATOM   5974 C CD1 . TRP C 1 188 ? 18.704  -15.632 112.594 1.00 57.38  ? 187  TRP C CD1 1 
ATOM   5975 C CD2 . TRP C 1 188 ? 20.910  -15.471 112.239 1.00 58.06  ? 187  TRP C CD2 1 
ATOM   5976 N NE1 . TRP C 1 188 ? 19.328  -16.512 113.443 1.00 57.30  ? 187  TRP C NE1 1 
ATOM   5977 C CE2 . TRP C 1 188 ? 20.683  -16.435 113.247 1.00 57.99  ? 187  TRP C CE2 1 
ATOM   5978 C CE3 . TRP C 1 188 ? 22.229  -15.198 111.844 1.00 58.58  ? 187  TRP C CE3 1 
ATOM   5979 C CZ2 . TRP C 1 188 ? 21.727  -17.130 113.870 1.00 59.46  ? 187  TRP C CZ2 1 
ATOM   5980 C CZ3 . TRP C 1 188 ? 23.269  -15.887 112.463 1.00 59.41  ? 187  TRP C CZ3 1 
ATOM   5981 C CH2 . TRP C 1 188 ? 23.009  -16.844 113.467 1.00 60.40  ? 187  TRP C CH2 1 
ATOM   5982 N N   . SER C 1 189 ? 16.692  -14.934 109.688 1.00 54.05  ? 188  SER C N   1 
ATOM   5983 C CA  . SER C 1 189 ? 15.482  -15.737 109.771 1.00 53.78  ? 188  SER C CA  1 
ATOM   5984 C C   . SER C 1 189 ? 15.355  -16.652 108.564 1.00 53.92  ? 188  SER C C   1 
ATOM   5985 O O   . SER C 1 189 ? 15.076  -17.841 108.710 1.00 54.55  ? 188  SER C O   1 
ATOM   5986 C CB  . SER C 1 189 ? 14.252  -14.833 109.861 1.00 52.89  ? 188  SER C CB  1 
ATOM   5987 O OG  . SER C 1 189 ? 14.256  -14.092 111.068 1.00 52.00  ? 188  SER C OG  1 
ATOM   5988 N N   . LEU C 1 190 ? 15.563  -16.100 107.373 1.00 54.38  ? 189  LEU C N   1 
ATOM   5989 C CA  . LEU C 1 190 ? 15.470  -16.893 106.157 1.00 54.60  ? 189  LEU C CA  1 
ATOM   5990 C C   . LEU C 1 190 ? 16.528  -17.982 106.108 1.00 55.39  ? 189  LEU C C   1 
ATOM   5991 O O   . LEU C 1 190 ? 16.307  -19.050 105.531 1.00 54.98  ? 189  LEU C O   1 
ATOM   5992 C CB  . LEU C 1 190 ? 15.583  -16.006 104.926 1.00 53.75  ? 189  LEU C CB  1 
ATOM   5993 C CG  . LEU C 1 190 ? 14.280  -15.365 104.469 1.00 52.92  ? 189  LEU C CG  1 
ATOM   5994 C CD1 . LEU C 1 190 ? 14.157  -15.576 102.972 1.00 53.55  ? 189  LEU C CD1 1 
ATOM   5995 C CD2 . LEU C 1 190 ? 13.091  -15.982 105.189 1.00 52.14  ? 189  LEU C CD2 1 
ATOM   5996 N N   . GLY C 1 191 ? 17.682  -17.711 106.704 1.00 55.43  ? 190  GLY C N   1 
ATOM   5997 C CA  . GLY C 1 191 ? 18.722  -18.720 106.730 1.00 56.33  ? 190  GLY C CA  1 
ATOM   5998 C C   . GLY C 1 191 ? 18.181  -19.906 107.507 1.00 56.46  ? 190  GLY C C   1 
ATOM   5999 O O   . GLY C 1 191 ? 18.176  -21.038 107.017 1.00 56.76  ? 190  GLY C O   1 
ATOM   6000 N N   . CYS C 1 192 ? 17.710  -19.630 108.722 1.00 56.20  ? 191  CYS C N   1 
ATOM   6001 C CA  . CYS C 1 192 ? 17.143  -20.644 109.598 1.00 54.74  ? 191  CYS C CA  1 
ATOM   6002 C C   . CYS C 1 192 ? 16.050  -21.428 108.881 1.00 54.55  ? 191  CYS C C   1 
ATOM   6003 O O   . CYS C 1 192 ? 15.891  -22.633 109.096 1.00 54.70  ? 191  CYS C O   1 
ATOM   6004 C CB  . CYS C 1 192 ? 16.540  -19.987 110.842 1.00 54.66  ? 191  CYS C CB  1 
ATOM   6005 S SG  . CYS C 1 192 ? 17.715  -19.130 111.904 1.00 53.80  ? 191  CYS C SG  1 
ATOM   6006 N N   . ILE C 1 193 ? 15.293  -20.737 108.035 1.00 54.07  ? 192  ILE C N   1 
ATOM   6007 C CA  . ILE C 1 193 ? 14.205  -21.367 107.296 1.00 54.54  ? 192  ILE C CA  1 
ATOM   6008 C C   . ILE C 1 193 ? 14.703  -22.113 106.066 1.00 53.40  ? 192  ILE C C   1 
ATOM   6009 O O   . ILE C 1 193 ? 14.031  -23.007 105.560 1.00 53.35  ? 192  ILE C O   1 
ATOM   6010 C CB  . ILE C 1 193 ? 13.154  -20.328 106.877 1.00 55.49  ? 192  ILE C CB  1 
ATOM   6011 C CG1 . ILE C 1 193 ? 12.578  -19.665 108.133 1.00 56.20  ? 192  ILE C CG1 1 
ATOM   6012 C CG2 . ILE C 1 193 ? 12.051  -20.993 106.051 1.00 54.69  ? 192  ILE C CG2 1 
ATOM   6013 C CD1 . ILE C 1 193 ? 11.614  -18.519 107.849 1.00 57.26  ? 192  ILE C CD1 1 
ATOM   6014 N N   . PHE C 1 194 ? 15.877  -21.734 105.583 1.00 53.30  ? 193  PHE C N   1 
ATOM   6015 C CA  . PHE C 1 194 ? 16.475  -22.401 104.437 1.00 53.90  ? 193  PHE C CA  1 
ATOM   6016 C C   . PHE C 1 194 ? 16.894  -23.771 104.971 1.00 54.66  ? 193  PHE C C   1 
ATOM   6017 O O   . PHE C 1 194 ? 16.583  -24.818 104.394 1.00 54.95  ? 193  PHE C O   1 
ATOM   6018 C CB  . PHE C 1 194 ? 17.690  -21.602 103.956 1.00 54.02  ? 193  PHE C CB  1 
ATOM   6019 C CG  . PHE C 1 194 ? 18.477  -22.267 102.858 1.00 54.17  ? 193  PHE C CG  1 
ATOM   6020 C CD1 . PHE C 1 194 ? 17.894  -23.225 102.033 1.00 53.26  ? 193  PHE C CD1 1 
ATOM   6021 C CD2 . PHE C 1 194 ? 19.801  -21.897 102.625 1.00 55.08  ? 193  PHE C CD2 1 
ATOM   6022 C CE1 . PHE C 1 194 ? 18.615  -23.805 100.994 1.00 52.68  ? 193  PHE C CE1 1 
ATOM   6023 C CE2 . PHE C 1 194 ? 20.533  -22.471 101.585 1.00 54.70  ? 193  PHE C CE2 1 
ATOM   6024 C CZ  . PHE C 1 194 ? 19.938  -23.426 100.769 1.00 53.80  ? 193  PHE C CZ  1 
ATOM   6025 N N   . ALA C 1 195 ? 17.583  -23.744 106.104 1.00 53.62  ? 194  ALA C N   1 
ATOM   6026 C CA  . ALA C 1 195 ? 18.038  -24.959 106.758 1.00 54.09  ? 194  ALA C CA  1 
ATOM   6027 C C   . ALA C 1 195 ? 16.855  -25.885 107.057 1.00 54.12  ? 194  ALA C C   1 
ATOM   6028 O O   . ALA C 1 195 ? 16.828  -27.035 106.626 1.00 52.31  ? 194  ALA C O   1 
ATOM   6029 C CB  . ALA C 1 195 ? 18.775  -24.600 108.059 1.00 53.28  ? 194  ALA C CB  1 
ATOM   6030 N N   . GLU C 1 196 ? 15.875  -25.362 107.788 1.00 55.31  ? 195  GLU C N   1 
ATOM   6031 C CA  . GLU C 1 196 ? 14.702  -26.130 108.169 1.00 56.29  ? 195  GLU C CA  1 
ATOM   6032 C C   . GLU C 1 196 ? 13.980  -26.781 106.986 1.00 57.09  ? 195  GLU C C   1 
ATOM   6033 O O   . GLU C 1 196 ? 13.337  -27.820 107.156 1.00 57.80  ? 195  GLU C O   1 
ATOM   6034 C CB  . GLU C 1 196 ? 13.732  -25.247 108.969 1.00 56.08  ? 195  GLU C CB  1 
ATOM   6035 C CG  . GLU C 1 196 ? 12.776  -26.035 109.858 1.00 56.28  ? 195  GLU C CG  1 
ATOM   6036 C CD  . GLU C 1 196 ? 11.897  -25.149 110.734 1.00 58.40  ? 195  GLU C CD  1 
ATOM   6037 O OE1 . GLU C 1 196 ? 12.439  -24.236 111.397 1.00 58.54  ? 195  GLU C OE1 1 
ATOM   6038 O OE2 . GLU C 1 196 ? 10.665  -25.377 110.774 1.00 58.13  ? 195  GLU C OE2 1 
ATOM   6039 N N   . MET C 1 197 ? 14.065  -26.188 105.796 1.00 57.14  ? 196  MET C N   1 
ATOM   6040 C CA  . MET C 1 197 ? 13.410  -26.797 104.634 1.00 57.14  ? 196  MET C CA  1 
ATOM   6041 C C   . MET C 1 197 ? 14.196  -28.036 104.209 1.00 58.24  ? 196  MET C C   1 
ATOM   6042 O O   . MET C 1 197 ? 13.626  -29.033 103.759 1.00 57.19  ? 196  MET C O   1 
ATOM   6043 C CB  . MET C 1 197 ? 13.342  -25.824 103.457 1.00 55.40  ? 196  MET C CB  1 
ATOM   6044 C CG  . MET C 1 197 ? 12.145  -24.897 103.462 1.00 55.14  ? 196  MET C CG  1 
ATOM   6045 S SD  . MET C 1 197 ? 12.001  -24.009 101.891 1.00 57.34  ? 196  MET C SD  1 
ATOM   6046 C CE  . MET C 1 197 ? 12.997  -22.548 102.225 1.00 52.69  ? 196  MET C CE  1 
ATOM   6047 N N   . VAL C 1 198 ? 15.513  -27.950 104.370 1.00 59.34  ? 197  VAL C N   1 
ATOM   6048 C CA  . VAL C 1 198 ? 16.430  -29.022 104.014 1.00 61.10  ? 197  VAL C CA  1 
ATOM   6049 C C   . VAL C 1 198 ? 16.502  -30.141 105.052 1.00 62.24  ? 197  VAL C C   1 
ATOM   6050 O O   . VAL C 1 198 ? 16.157  -31.284 104.758 1.00 60.92  ? 197  VAL C O   1 
ATOM   6051 C CB  . VAL C 1 198 ? 17.860  -28.470 103.807 1.00 62.01  ? 197  VAL C CB  1 
ATOM   6052 C CG1 . VAL C 1 198 ? 18.854  -29.618 103.744 1.00 62.21  ? 197  VAL C CG1 1 
ATOM   6053 C CG2 . VAL C 1 198 ? 17.922  -27.645 102.523 1.00 61.79  ? 197  VAL C CG2 1 
ATOM   6054 N N   . THR C 1 199 ? 16.964  -29.799 106.256 1.00 64.00  ? 198  THR C N   1 
ATOM   6055 C CA  . THR C 1 199 ? 17.113  -30.761 107.347 1.00 64.45  ? 198  THR C CA  1 
ATOM   6056 C C   . THR C 1 199 ? 15.794  -31.372 107.777 1.00 65.70  ? 198  THR C C   1 
ATOM   6057 O O   . THR C 1 199 ? 15.741  -32.547 108.132 1.00 67.11  ? 198  THR C O   1 
ATOM   6058 C CB  . THR C 1 199 ? 17.728  -30.122 108.590 1.00 64.03  ? 198  THR C CB  1 
ATOM   6059 O OG1 . THR C 1 199 ? 16.750  -29.286 109.217 1.00 66.39  ? 198  THR C OG1 1 
ATOM   6060 C CG2 . THR C 1 199 ? 18.945  -29.297 108.222 1.00 64.72  ? 198  THR C CG2 1 
ATOM   6061 N N   . ARG C 1 200 ? 14.739  -30.564 107.762 1.00 67.32  ? 199  ARG C N   1 
ATOM   6062 C CA  . ARG C 1 200 ? 13.395  -30.997 108.144 1.00 69.12  ? 199  ARG C CA  1 
ATOM   6063 C C   . ARG C 1 200 ? 13.078  -30.730 109.621 1.00 69.34  ? 199  ARG C C   1 
ATOM   6064 O O   . ARG C 1 200 ? 11.942  -30.908 110.063 1.00 68.71  ? 199  ARG C O   1 
ATOM   6065 C CB  . ARG C 1 200 ? 13.188  -32.485 107.804 1.00 71.56  ? 199  ARG C CB  1 
ATOM   6066 C CG  . ARG C 1 200 ? 13.517  -32.831 106.337 1.00 74.10  ? 199  ARG C CG  1 
ATOM   6067 C CD  . ARG C 1 200 ? 12.509  -33.781 105.661 1.00 73.56  ? 199  ARG C CD  1 
ATOM   6068 N NE  . ARG C 1 200 ? 12.668  -35.199 105.995 1.00 74.09  ? 199  ARG C NE  1 
ATOM   6069 C CZ  . ARG C 1 200 ? 13.818  -35.869 105.955 1.00 74.09  ? 199  ARG C CZ  1 
ATOM   6070 N NH1 . ARG C 1 200 ? 13.846  -37.161 106.263 1.00 72.62  ? 199  ARG C NH1 1 
ATOM   6071 N NH2 . ARG C 1 200 ? 14.946  -35.247 105.637 1.00 74.06  ? 199  ARG C NH2 1 
ATOM   6072 N N   . ARG C 1 201 ? 14.087  -30.297 110.374 1.00 69.66  ? 200  ARG C N   1 
ATOM   6073 C CA  . ARG C 1 201 ? 13.924  -29.976 111.792 1.00 69.67  ? 200  ARG C CA  1 
ATOM   6074 C C   . ARG C 1 201 ? 14.378  -28.522 111.963 1.00 68.09  ? 200  ARG C C   1 
ATOM   6075 O O   . ARG C 1 201 ? 15.126  -28.008 111.130 1.00 68.33  ? 200  ARG C O   1 
ATOM   6076 C CB  . ARG C 1 201 ? 14.806  -30.881 112.664 1.00 72.28  ? 200  ARG C CB  1 
ATOM   6077 C CG  . ARG C 1 201 ? 14.880  -32.350 112.240 1.00 76.50  ? 200  ARG C CG  1 
ATOM   6078 C CD  . ARG C 1 201 ? 15.625  -33.205 113.285 1.00 81.51  ? 200  ARG C CD  1 
ATOM   6079 N NE  . ARG C 1 201 ? 17.004  -32.765 113.528 1.00 86.22  ? 200  ARG C NE  1 
ATOM   6080 C CZ  . ARG C 1 201 ? 17.782  -33.223 114.512 1.00 87.83  ? 200  ARG C CZ  1 
ATOM   6081 N NH1 . ARG C 1 201 ? 17.323  -34.142 115.356 1.00 88.56  ? 200  ARG C NH1 1 
ATOM   6082 N NH2 . ARG C 1 201 ? 19.019  -32.760 114.658 1.00 88.44  ? 200  ARG C NH2 1 
ATOM   6083 N N   . ALA C 1 202 ? 13.935  -27.853 113.025 1.00 65.25  ? 201  ALA C N   1 
ATOM   6084 C CA  . ALA C 1 202 ? 14.351  -26.469 113.248 1.00 63.27  ? 201  ALA C CA  1 
ATOM   6085 C C   . ALA C 1 202 ? 15.867  -26.461 113.412 1.00 61.85  ? 201  ALA C C   1 
ATOM   6086 O O   . ALA C 1 202 ? 16.449  -27.456 113.845 1.00 61.18  ? 201  ALA C O   1 
ATOM   6087 C CB  . ALA C 1 202 ? 13.681  -25.904 114.489 1.00 63.53  ? 201  ALA C CB  1 
ATOM   6088 N N   . LEU C 1 203 ? 16.499  -25.339 113.070 1.00 60.61  ? 202  LEU C N   1 
ATOM   6089 C CA  . LEU C 1 203 ? 17.959  -25.208 113.142 1.00 59.11  ? 202  LEU C CA  1 
ATOM   6090 C C   . LEU C 1 203 ? 18.506  -24.890 114.531 1.00 58.32  ? 202  LEU C C   1 
ATOM   6091 O O   . LEU C 1 203 ? 19.486  -25.491 114.957 1.00 58.20  ? 202  LEU C O   1 
ATOM   6092 C CB  . LEU C 1 203 ? 18.442  -24.140 112.151 1.00 58.41  ? 202  LEU C CB  1 
ATOM   6093 C CG  . LEU C 1 203 ? 19.956  -24.025 111.963 1.00 58.42  ? 202  LEU C CG  1 
ATOM   6094 C CD1 . LEU C 1 203 ? 20.467  -25.315 111.358 1.00 59.13  ? 202  LEU C CD1 1 
ATOM   6095 C CD2 . LEU C 1 203 ? 20.302  -22.854 111.064 1.00 57.14  ? 202  LEU C CD2 1 
ATOM   6096 N N   . PHE C 1 204 ? 17.890  -23.938 115.225 1.00 58.12  ? 203  PHE C N   1 
ATOM   6097 C CA  . PHE C 1 204 ? 18.325  -23.565 116.569 1.00 58.50  ? 203  PHE C CA  1 
ATOM   6098 C C   . PHE C 1 204 ? 17.109  -23.514 117.485 1.00 59.94  ? 203  PHE C C   1 
ATOM   6099 O O   . PHE C 1 204 ? 16.569  -22.440 117.751 1.00 61.14  ? 203  PHE C O   1 
ATOM   6100 C CB  . PHE C 1 204 ? 19.013  -22.197 116.558 1.00 56.30  ? 203  PHE C CB  1 
ATOM   6101 C CG  . PHE C 1 204 ? 20.139  -22.090 115.571 1.00 55.38  ? 203  PHE C CG  1 
ATOM   6102 C CD1 . PHE C 1 204 ? 21.124  -23.064 115.508 1.00 54.67  ? 203  PHE C CD1 1 
ATOM   6103 C CD2 . PHE C 1 204 ? 20.229  -20.997 114.719 1.00 55.79  ? 203  PHE C CD2 1 
ATOM   6104 C CE1 . PHE C 1 204 ? 22.176  -22.950 114.614 1.00 53.95  ? 203  PHE C CE1 1 
ATOM   6105 C CE2 . PHE C 1 204 ? 21.281  -20.872 113.821 1.00 54.83  ? 203  PHE C CE2 1 
ATOM   6106 C CZ  . PHE C 1 204 ? 22.255  -21.850 113.769 1.00 54.74  ? 203  PHE C CZ  1 
ATOM   6107 N N   . PRO C 1 205 ? 16.665  -24.682 117.982 1.00 61.39  ? 204  PRO C N   1 
ATOM   6108 C CA  . PRO C 1 205 ? 15.504  -24.831 118.873 1.00 62.10  ? 204  PRO C CA  1 
ATOM   6109 C C   . PRO C 1 205 ? 15.760  -24.505 120.347 1.00 63.43  ? 204  PRO C C   1 
ATOM   6110 O O   . PRO C 1 205 ? 15.468  -25.324 121.227 1.00 63.86  ? 204  PRO C O   1 
ATOM   6111 C CB  . PRO C 1 205 ? 15.109  -26.303 118.694 1.00 61.34  ? 204  PRO C CB  1 
ATOM   6112 C CG  . PRO C 1 205 ? 15.930  -26.788 117.496 1.00 61.37  ? 204  PRO C CG  1 
ATOM   6113 C CD  . PRO C 1 205 ? 17.188  -26.002 117.602 1.00 60.92  ? 204  PRO C CD  1 
ATOM   6114 N N   . GLY C 1 206 ? 16.298  -23.323 120.624 1.00 63.24  ? 205  GLY C N   1 
ATOM   6115 C CA  . GLY C 1 206 ? 16.558  -22.969 122.004 1.00 64.63  ? 205  GLY C CA  1 
ATOM   6116 C C   . GLY C 1 206 ? 15.262  -22.855 122.779 1.00 65.92  ? 205  GLY C C   1 
ATOM   6117 O O   . GLY C 1 206 ? 14.197  -22.701 122.186 1.00 66.72  ? 205  GLY C O   1 
ATOM   6118 N N   . ASP C 1 207 ? 15.335  -22.957 124.101 1.00 67.30  ? 206  ASP C N   1 
ATOM   6119 C CA  . ASP C 1 207 ? 14.143  -22.819 124.925 1.00 68.40  ? 206  ASP C CA  1 
ATOM   6120 C C   . ASP C 1 207 ? 14.378  -21.688 125.906 1.00 67.90  ? 206  ASP C C   1 
ATOM   6121 O O   . ASP C 1 207 ? 13.564  -21.425 126.786 1.00 68.27  ? 206  ASP C O   1 
ATOM   6122 C CB  . ASP C 1 207 ? 13.818  -24.121 125.662 1.00 70.03  ? 206  ASP C CB  1 
ATOM   6123 C CG  . ASP C 1 207 ? 15.046  -24.828 126.165 1.00 72.60  ? 206  ASP C CG  1 
ATOM   6124 O OD1 . ASP C 1 207 ? 15.886  -24.155 126.799 1.00 74.85  ? 206  ASP C OD1 1 
ATOM   6125 O OD2 . ASP C 1 207 ? 15.164  -26.055 125.933 1.00 72.42  ? 206  ASP C OD2 1 
ATOM   6126 N N   . SER C 1 208 ? 15.503  -21.010 125.722 1.00 67.58  ? 207  SER C N   1 
ATOM   6127 C CA  . SER C 1 208 ? 15.885  -19.888 126.560 1.00 67.92  ? 207  SER C CA  1 
ATOM   6128 C C   . SER C 1 208 ? 16.677  -18.943 125.678 1.00 68.15  ? 207  SER C C   1 
ATOM   6129 O O   . SER C 1 208 ? 17.218  -19.358 124.656 1.00 68.63  ? 207  SER C O   1 
ATOM   6130 C CB  . SER C 1 208 ? 16.763  -20.364 127.717 1.00 69.31  ? 207  SER C CB  1 
ATOM   6131 O OG  . SER C 1 208 ? 16.090  -21.330 128.510 1.00 71.25  ? 207  SER C OG  1 
ATOM   6132 N N   . GLU C 1 209 ? 16.739  -17.675 126.059 1.00 67.73  ? 208  GLU C N   1 
ATOM   6133 C CA  . GLU C 1 209 ? 17.488  -16.709 125.277 1.00 67.91  ? 208  GLU C CA  1 
ATOM   6134 C C   . GLU C 1 209 ? 18.953  -17.107 125.196 1.00 68.41  ? 208  GLU C C   1 
ATOM   6135 O O   . GLU C 1 209 ? 19.587  -16.976 124.146 1.00 66.95  ? 208  GLU C O   1 
ATOM   6136 C CB  . GLU C 1 209 ? 17.384  -15.325 125.900 1.00 69.16  ? 208  GLU C CB  1 
ATOM   6137 C CG  . GLU C 1 209 ? 16.210  -14.517 125.415 1.00 71.00  ? 208  GLU C CG  1 
ATOM   6138 C CD  . GLU C 1 209 ? 16.374  -13.047 125.732 1.00 71.43  ? 208  GLU C CD  1 
ATOM   6139 O OE1 . GLU C 1 209 ? 17.520  -12.555 125.641 1.00 71.81  ? 208  GLU C OE1 1 
ATOM   6140 O OE2 . GLU C 1 209 ? 15.364  -12.384 126.056 1.00 72.55  ? 208  GLU C OE2 1 
ATOM   6141 N N   . ILE C 1 210 ? 19.489  -17.599 126.310 1.00 69.32  ? 209  ILE C N   1 
ATOM   6142 C CA  . ILE C 1 210 ? 20.890  -18.004 126.355 1.00 69.40  ? 209  ILE C CA  1 
ATOM   6143 C C   . ILE C 1 210 ? 21.108  -19.351 125.651 1.00 68.59  ? 209  ILE C C   1 
ATOM   6144 O O   . ILE C 1 210 ? 22.092  -19.524 124.923 1.00 68.20  ? 209  ILE C O   1 
ATOM   6145 C CB  . ILE C 1 210 ? 21.413  -18.050 127.828 1.00 69.89  ? 209  ILE C CB  1 
ATOM   6146 C CG1 . ILE C 1 210 ? 22.775  -17.350 127.896 1.00 70.94  ? 209  ILE C CG1 1 
ATOM   6147 C CG2 . ILE C 1 210 ? 21.466  -19.482 128.346 1.00 69.63  ? 209  ILE C CG2 1 
ATOM   6148 C CD1 . ILE C 1 210 ? 23.702  -17.849 129.001 1.00 72.86  ? 209  ILE C CD1 1 
ATOM   6149 N N   . ASP C 1 211 ? 20.185  -20.292 125.859 1.00 67.49  ? 210  ASP C N   1 
ATOM   6150 C CA  . ASP C 1 211 ? 20.273  -21.607 125.225 1.00 65.36  ? 210  ASP C CA  1 
ATOM   6151 C C   . ASP C 1 211 ? 20.249  -21.401 123.720 1.00 65.20  ? 210  ASP C C   1 
ATOM   6152 O O   . ASP C 1 211 ? 20.831  -22.184 122.969 1.00 66.64  ? 210  ASP C O   1 
ATOM   6153 C CB  . ASP C 1 211 ? 19.086  -22.494 125.627 1.00 63.74  ? 210  ASP C CB  1 
ATOM   6154 C CG  . ASP C 1 211 ? 19.171  -23.897 125.031 1.00 61.86  ? 210  ASP C CG  1 
ATOM   6155 O OD1 . ASP C 1 211 ? 20.097  -24.643 125.399 1.00 61.47  ? 210  ASP C OD1 1 
ATOM   6156 O OD2 . ASP C 1 211 ? 18.316  -24.261 124.197 1.00 60.13  ? 210  ASP C OD2 1 
ATOM   6157 N N   . GLN C 1 212 ? 19.567  -20.342 123.289 1.00 63.93  ? 211  GLN C N   1 
ATOM   6158 C CA  . GLN C 1 212 ? 19.453  -20.020 121.874 1.00 63.62  ? 211  GLN C CA  1 
ATOM   6159 C C   . GLN C 1 212 ? 20.785  -19.465 121.392 1.00 63.72  ? 211  GLN C C   1 
ATOM   6160 O O   . GLN C 1 212 ? 21.153  -19.621 120.231 1.00 64.06  ? 211  GLN C O   1 
ATOM   6161 C CB  . GLN C 1 212 ? 18.337  -18.992 121.653 1.00 63.87  ? 211  GLN C CB  1 
ATOM   6162 C CG  . GLN C 1 212 ? 18.093  -18.581 120.193 1.00 61.39  ? 211  GLN C CG  1 
ATOM   6163 C CD  . GLN C 1 212 ? 17.446  -19.678 119.363 1.00 59.52  ? 211  GLN C CD  1 
ATOM   6164 O OE1 . GLN C 1 212 ? 16.718  -20.519 119.889 1.00 58.06  ? 211  GLN C OE1 1 
ATOM   6165 N NE2 . GLN C 1 212 ? 17.693  -19.660 118.058 1.00 57.41  ? 211  GLN C NE2 1 
ATOM   6166 N N   . LEU C 1 213 ? 21.509  -18.809 122.287 1.00 63.64  ? 212  LEU C N   1 
ATOM   6167 C CA  . LEU C 1 213 ? 22.806  -18.273 121.915 1.00 64.59  ? 212  LEU C CA  1 
ATOM   6168 C C   . LEU C 1 213 ? 23.806  -19.419 121.891 1.00 65.85  ? 212  LEU C C   1 
ATOM   6169 O O   . LEU C 1 213 ? 24.652  -19.514 120.992 1.00 65.80  ? 212  LEU C O   1 
ATOM   6170 C CB  . LEU C 1 213 ? 23.247  -17.194 122.904 1.00 64.08  ? 212  LEU C CB  1 
ATOM   6171 C CG  . LEU C 1 213 ? 22.716  -15.801 122.545 1.00 64.19  ? 212  LEU C CG  1 
ATOM   6172 C CD1 . LEU C 1 213 ? 23.020  -14.805 123.660 1.00 65.23  ? 212  LEU C CD1 1 
ATOM   6173 C CD2 . LEU C 1 213 ? 23.342  -15.348 121.230 1.00 62.22  ? 212  LEU C CD2 1 
ATOM   6174 N N   . PHE C 1 214 ? 23.699  -20.300 122.877 1.00 65.63  ? 213  PHE C N   1 
ATOM   6175 C CA  . PHE C 1 214 ? 24.594  -21.439 122.940 1.00 65.93  ? 213  PHE C CA  1 
ATOM   6176 C C   . PHE C 1 214 ? 24.497  -22.281 121.672 1.00 64.86  ? 213  PHE C C   1 
ATOM   6177 O O   . PHE C 1 214 ? 25.517  -22.577 121.054 1.00 64.86  ? 213  PHE C O   1 
ATOM   6178 C CB  . PHE C 1 214 ? 24.298  -22.278 124.187 1.00 67.12  ? 213  PHE C CB  1 
ATOM   6179 C CG  . PHE C 1 214 ? 24.919  -21.722 125.447 1.00 69.37  ? 213  PHE C CG  1 
ATOM   6180 C CD1 . PHE C 1 214 ? 25.461  -20.431 125.463 1.00 69.04  ? 213  PHE C CD1 1 
ATOM   6181 C CD2 . PHE C 1 214 ? 24.981  -22.488 126.610 1.00 69.47  ? 213  PHE C CD2 1 
ATOM   6182 C CE1 . PHE C 1 214 ? 26.057  -19.916 126.615 1.00 69.00  ? 213  PHE C CE1 1 
ATOM   6183 C CE2 . PHE C 1 214 ? 25.575  -21.981 127.768 1.00 69.16  ? 213  PHE C CE2 1 
ATOM   6184 C CZ  . PHE C 1 214 ? 26.113  -20.695 127.771 1.00 69.59  ? 213  PHE C CZ  1 
ATOM   6185 N N   . ARG C 1 215 ? 23.283  -22.637 121.259 1.00 62.65  ? 214  ARG C N   1 
ATOM   6186 C CA  . ARG C 1 215 ? 23.132  -23.447 120.054 1.00 61.27  ? 214  ARG C CA  1 
ATOM   6187 C C   . ARG C 1 215 ? 23.740  -22.782 118.826 1.00 61.61  ? 214  ARG C C   1 
ATOM   6188 O O   . ARG C 1 215 ? 24.317  -23.453 117.976 1.00 61.22  ? 214  ARG C O   1 
ATOM   6189 C CB  . ARG C 1 215 ? 21.661  -23.756 119.782 1.00 58.65  ? 214  ARG C CB  1 
ATOM   6190 C CG  . ARG C 1 215 ? 20.995  -24.569 120.856 1.00 55.76  ? 214  ARG C CG  1 
ATOM   6191 C CD  . ARG C 1 215 ? 19.567  -24.905 120.505 1.00 55.56  ? 214  ARG C CD  1 
ATOM   6192 N NE  . ARG C 1 215 ? 18.859  -25.462 121.647 1.00 53.36  ? 214  ARG C NE  1 
ATOM   6193 C CZ  . ARG C 1 215 ? 18.484  -26.729 121.743 1.00 55.26  ? 214  ARG C CZ  1 
ATOM   6194 N NH1 . ARG C 1 215 ? 18.749  -27.578 120.757 1.00 54.42  ? 214  ARG C NH1 1 
ATOM   6195 N NH2 . ARG C 1 215 ? 17.837  -27.146 122.823 1.00 56.70  ? 214  ARG C NH2 1 
ATOM   6196 N N   . ILE C 1 216 ? 23.614  -21.463 118.729 1.00 63.71  ? 215  ILE C N   1 
ATOM   6197 C CA  . ILE C 1 216 ? 24.161  -20.751 117.581 1.00 65.55  ? 215  ILE C CA  1 
ATOM   6198 C C   . ILE C 1 216 ? 25.684  -20.807 117.613 1.00 67.64  ? 215  ILE C C   1 
ATOM   6199 O O   . ILE C 1 216 ? 26.325  -21.115 116.606 1.00 68.09  ? 215  ILE C O   1 
ATOM   6200 C CB  . ILE C 1 216 ? 23.686  -19.277 117.549 1.00 64.64  ? 215  ILE C CB  1 
ATOM   6201 C CG1 . ILE C 1 216 ? 22.164  -19.226 117.367 1.00 64.25  ? 215  ILE C CG1 1 
ATOM   6202 C CG2 . ILE C 1 216 ? 24.355  -18.535 116.403 1.00 64.34  ? 215  ILE C CG2 1 
ATOM   6203 C CD1 . ILE C 1 216 ? 21.597  -17.826 117.315 1.00 63.05  ? 215  ILE C CD1 1 
ATOM   6204 N N   . PHE C 1 217 ? 26.260  -20.518 118.776 1.00 69.27  ? 216  PHE C N   1 
ATOM   6205 C CA  . PHE C 1 217 ? 27.706  -20.559 118.929 1.00 71.08  ? 216  PHE C CA  1 
ATOM   6206 C C   . PHE C 1 217 ? 28.232  -21.956 118.601 1.00 72.01  ? 216  PHE C C   1 
ATOM   6207 O O   . PHE C 1 217 ? 29.177  -22.108 117.831 1.00 71.49  ? 216  PHE C O   1 
ATOM   6208 C CB  . PHE C 1 217 ? 28.097  -20.173 120.359 1.00 71.60  ? 216  PHE C CB  1 
ATOM   6209 C CG  . PHE C 1 217 ? 27.877  -18.717 120.678 1.00 72.90  ? 216  PHE C CG  1 
ATOM   6210 C CD1 . PHE C 1 217 ? 27.393  -17.841 119.711 1.00 72.57  ? 216  PHE C CD1 1 
ATOM   6211 C CD2 . PHE C 1 217 ? 28.169  -18.216 121.945 1.00 74.37  ? 216  PHE C CD2 1 
ATOM   6212 C CE1 . PHE C 1 217 ? 27.203  -16.493 119.995 1.00 73.73  ? 216  PHE C CE1 1 
ATOM   6213 C CE2 . PHE C 1 217 ? 27.984  -16.862 122.243 1.00 75.00  ? 216  PHE C CE2 1 
ATOM   6214 C CZ  . PHE C 1 217 ? 27.499  -15.999 121.263 1.00 74.98  ? 216  PHE C CZ  1 
ATOM   6215 N N   . ARG C 1 218 ? 27.603  -22.973 119.181 1.00 73.71  ? 217  ARG C N   1 
ATOM   6216 C CA  . ARG C 1 218 ? 28.006  -24.359 118.959 1.00 75.69  ? 217  ARG C CA  1 
ATOM   6217 C C   . ARG C 1 218 ? 28.131  -24.678 117.476 1.00 74.61  ? 217  ARG C C   1 
ATOM   6218 O O   . ARG C 1 218 ? 29.013  -25.423 117.066 1.00 74.99  ? 217  ARG C O   1 
ATOM   6219 C CB  . ARG C 1 218 ? 26.986  -25.329 119.567 1.00 79.30  ? 217  ARG C CB  1 
ATOM   6220 C CG  . ARG C 1 218 ? 26.547  -25.023 120.985 1.00 86.20  ? 217  ARG C CG  1 
ATOM   6221 C CD  . ARG C 1 218 ? 25.329  -25.862 121.325 1.00 92.41  ? 217  ARG C CD  1 
ATOM   6222 N NE  . ARG C 1 218 ? 24.382  -25.203 122.221 1.00 98.29  ? 217  ARG C NE  1 
ATOM   6223 C CZ  . ARG C 1 218 ? 23.155  -25.656 122.473 1.00 101.03 ? 217  ARG C CZ  1 
ATOM   6224 N NH1 . ARG C 1 218 ? 22.723  -26.773 121.894 1.00 102.43 ? 217  ARG C NH1 1 
ATOM   6225 N NH2 . ARG C 1 218 ? 22.360  -24.996 123.311 1.00 103.30 ? 217  ARG C NH2 1 
ATOM   6226 N N   . THR C 1 219 ? 27.238  -24.113 116.675 1.00 73.81  ? 218  THR C N   1 
ATOM   6227 C CA  . THR C 1 219 ? 27.235  -24.370 115.242 1.00 73.53  ? 218  THR C CA  1 
ATOM   6228 C C   . THR C 1 219 ? 28.192  -23.516 114.415 1.00 73.91  ? 218  THR C C   1 
ATOM   6229 O O   . THR C 1 219 ? 29.088  -24.037 113.753 1.00 73.16  ? 218  THR C O   1 
ATOM   6230 C CB  . THR C 1 219 ? 25.811  -24.204 114.672 1.00 73.27  ? 218  THR C CB  1 
ATOM   6231 O OG1 . THR C 1 219 ? 24.990  -25.292 115.122 1.00 71.73  ? 218  THR C OG1 1 
ATOM   6232 C CG2 . THR C 1 219 ? 25.838  -24.176 113.149 1.00 72.76  ? 218  THR C CG2 1 
ATOM   6233 N N   . LEU C 1 220 ? 27.998  -22.205 114.454 1.00 74.68  ? 219  LEU C N   1 
ATOM   6234 C CA  . LEU C 1 220 ? 28.818  -21.282 113.683 1.00 75.97  ? 219  LEU C CA  1 
ATOM   6235 C C   . LEU C 1 220 ? 30.098  -20.855 114.385 1.00 77.82  ? 219  LEU C C   1 
ATOM   6236 O O   . LEU C 1 220 ? 30.911  -20.128 113.816 1.00 77.73  ? 219  LEU C O   1 
ATOM   6237 C CB  . LEU C 1 220 ? 28.004  -20.038 113.371 1.00 76.40  ? 219  LEU C CB  1 
ATOM   6238 C CG  . LEU C 1 220 ? 26.577  -20.299 112.906 1.00 76.73  ? 219  LEU C CG  1 
ATOM   6239 C CD1 . LEU C 1 220 ? 25.735  -19.068 113.184 1.00 77.53  ? 219  LEU C CD1 1 
ATOM   6240 C CD2 . LEU C 1 220 ? 26.568  -20.655 111.429 1.00 77.66  ? 219  LEU C CD2 1 
ATOM   6241 N N   . GLY C 1 221 ? 30.277  -21.290 115.624 1.00 80.05  ? 220  GLY C N   1 
ATOM   6242 C CA  . GLY C 1 221 ? 31.467  -20.898 116.356 1.00 82.59  ? 220  GLY C CA  1 
ATOM   6243 C C   . GLY C 1 221 ? 31.292  -19.515 116.955 1.00 84.68  ? 220  GLY C C   1 
ATOM   6244 O O   . GLY C 1 221 ? 30.929  -18.569 116.258 1.00 83.93  ? 220  GLY C O   1 
ATOM   6245 N N   . THR C 1 222 ? 31.556  -19.410 118.254 1.00 87.23  ? 221  THR C N   1 
ATOM   6246 C CA  . THR C 1 222 ? 31.431  -18.165 119.011 1.00 90.24  ? 221  THR C CA  1 
ATOM   6247 C C   . THR C 1 222 ? 32.003  -16.937 118.304 1.00 92.49  ? 221  THR C C   1 
ATOM   6248 O O   . THR C 1 222 ? 33.081  -16.993 117.707 1.00 92.64  ? 221  THR C O   1 
ATOM   6249 C CB  . THR C 1 222 ? 32.151  -18.282 120.380 1.00 90.35  ? 221  THR C CB  1 
ATOM   6250 O OG1 . THR C 1 222 ? 31.890  -19.570 120.953 1.00 91.03  ? 221  THR C OG1 1 
ATOM   6251 C CG2 . THR C 1 222 ? 31.663  -17.201 121.341 1.00 89.16  ? 221  THR C CG2 1 
ATOM   6252 N N   . PRO C 1 223 ? 31.284  -15.804 118.355 1.00 94.39  ? 222  PRO C N   1 
ATOM   6253 C CA  . PRO C 1 223 ? 31.840  -14.627 117.690 1.00 95.70  ? 222  PRO C CA  1 
ATOM   6254 C C   . PRO C 1 223 ? 33.031  -14.183 118.532 1.00 97.26  ? 222  PRO C C   1 
ATOM   6255 O O   . PRO C 1 223 ? 33.414  -14.866 119.484 1.00 97.49  ? 222  PRO C O   1 
ATOM   6256 C CB  . PRO C 1 223 ? 30.687  -13.631 117.738 1.00 95.49  ? 222  PRO C CB  1 
ATOM   6257 C CG  . PRO C 1 223 ? 30.040  -13.956 119.051 1.00 95.61  ? 222  PRO C CG  1 
ATOM   6258 C CD  . PRO C 1 223 ? 30.014  -15.477 119.027 1.00 94.97  ? 222  PRO C CD  1 
ATOM   6259 N N   . ASP C 1 224 ? 33.604  -13.040 118.182 1.00 98.67  ? 223  ASP C N   1 
ATOM   6260 C CA  . ASP C 1 224 ? 34.753  -12.481 118.887 1.00 99.58  ? 223  ASP C CA  1 
ATOM   6261 C C   . ASP C 1 224 ? 35.371  -11.492 117.917 1.00 100.19 ? 223  ASP C C   1 
ATOM   6262 O O   . ASP C 1 224 ? 35.120  -11.566 116.713 1.00 100.13 ? 223  ASP C O   1 
ATOM   6263 C CB  . ASP C 1 224 ? 35.776  -13.568 119.251 1.00 99.53  ? 223  ASP C CB  1 
ATOM   6264 C CG  . ASP C 1 224 ? 36.430  -14.191 118.032 1.00 99.46  ? 223  ASP C CG  1 
ATOM   6265 O OD1 . ASP C 1 224 ? 35.714  -14.810 117.213 1.00 99.14  ? 223  ASP C OD1 1 
ATOM   6266 O OD2 . ASP C 1 224 ? 37.665  -14.059 117.895 1.00 99.82  ? 223  ASP C OD2 1 
ATOM   6267 N N   . GLU C 1 225 ? 36.182  -10.578 118.432 1.00 100.68 ? 224  GLU C N   1 
ATOM   6268 C CA  . GLU C 1 225 ? 36.802  -9.556  117.598 1.00 101.45 ? 224  GLU C CA  1 
ATOM   6269 C C   . GLU C 1 225 ? 37.155  -9.929  116.159 1.00 101.38 ? 224  GLU C C   1 
ATOM   6270 O O   . GLU C 1 225 ? 37.054  -9.083  115.267 1.00 100.90 ? 224  GLU C O   1 
ATOM   6271 C CB  . GLU C 1 225 ? 38.030  -8.980  118.305 1.00 101.89 ? 224  GLU C CB  1 
ATOM   6272 C CG  . GLU C 1 225 ? 37.638  -8.128  119.496 1.00 103.30 ? 224  GLU C CG  1 
ATOM   6273 C CD  . GLU C 1 225 ? 36.570  -7.102  119.132 1.00 103.86 ? 224  GLU C CD  1 
ATOM   6274 O OE1 . GLU C 1 225 ? 36.922  -6.056  118.539 1.00 103.45 ? 224  GLU C OE1 1 
ATOM   6275 O OE2 . GLU C 1 225 ? 35.377  -7.358  119.424 1.00 104.13 ? 224  GLU C OE2 1 
ATOM   6276 N N   . VAL C 1 226 ? 37.553  -11.178 115.921 1.00 101.47 ? 225  VAL C N   1 
ATOM   6277 C CA  . VAL C 1 226 ? 37.915  -11.597 114.563 1.00 101.45 ? 225  VAL C CA  1 
ATOM   6278 C C   . VAL C 1 226 ? 36.689  -11.679 113.656 1.00 101.91 ? 225  VAL C C   1 
ATOM   6279 O O   . VAL C 1 226 ? 36.537  -10.882 112.725 1.00 101.53 ? 225  VAL C O   1 
ATOM   6280 C CB  . VAL C 1 226 ? 38.609  -12.984 114.537 1.00 100.70 ? 225  VAL C CB  1 
ATOM   6281 C CG1 . VAL C 1 226 ? 39.519  -13.081 113.311 1.00 99.11  ? 225  VAL C CG1 1 
ATOM   6282 C CG2 . VAL C 1 226 ? 39.388  -13.212 115.820 1.00 100.12 ? 225  VAL C CG2 1 
ATOM   6283 N N   . VAL C 1 227 ? 35.818  -12.646 113.937 1.00 102.51 ? 226  VAL C N   1 
ATOM   6284 C CA  . VAL C 1 227 ? 34.607  -12.846 113.145 1.00 103.30 ? 226  VAL C CA  1 
ATOM   6285 C C   . VAL C 1 227 ? 33.606  -11.694 113.330 1.00 104.33 ? 226  VAL C C   1 
ATOM   6286 O O   . VAL C 1 227 ? 32.979  -11.246 112.368 1.00 104.60 ? 226  VAL C O   1 
ATOM   6287 C CB  . VAL C 1 227 ? 33.935  -14.202 113.501 1.00 103.09 ? 226  VAL C CB  1 
ATOM   6288 C CG1 . VAL C 1 227 ? 33.271  -14.122 114.871 1.00 102.33 ? 226  VAL C CG1 1 
ATOM   6289 C CG2 . VAL C 1 227 ? 32.938  -14.590 112.419 1.00 102.39 ? 226  VAL C CG2 1 
ATOM   6290 N N   . TRP C 1 228 ? 33.464  -11.210 114.563 1.00 104.84 ? 227  TRP C N   1 
ATOM   6291 C CA  . TRP C 1 228 ? 32.554  -10.102 114.851 1.00 105.26 ? 227  TRP C CA  1 
ATOM   6292 C C   . TRP C 1 228 ? 33.300  -9.024  115.635 1.00 105.61 ? 227  TRP C C   1 
ATOM   6293 O O   . TRP C 1 228 ? 33.421  -9.106  116.862 1.00 105.60 ? 227  TRP C O   1 
ATOM   6294 C CB  . TRP C 1 228 ? 31.351  -10.588 115.672 1.00 105.38 ? 227  TRP C CB  1 
ATOM   6295 C CG  . TRP C 1 228 ? 30.255  -9.548  115.890 1.00 105.09 ? 227  TRP C CG  1 
ATOM   6296 C CD1 . TRP C 1 228 ? 30.370  -8.183  115.796 1.00 104.66 ? 227  TRP C CD1 1 
ATOM   6297 C CD2 . TRP C 1 228 ? 28.902  -9.805  116.297 1.00 105.09 ? 227  TRP C CD2 1 
ATOM   6298 N NE1 . TRP C 1 228 ? 29.175  -7.580  116.120 1.00 104.73 ? 227  TRP C NE1 1 
ATOM   6299 C CE2 . TRP C 1 228 ? 28.258  -8.550  116.432 1.00 104.91 ? 227  TRP C CE2 1 
ATOM   6300 C CE3 . TRP C 1 228 ? 28.171  -10.975 116.562 1.00 104.61 ? 227  TRP C CE3 1 
ATOM   6301 C CZ2 . TRP C 1 228 ? 26.916  -8.432  116.820 1.00 104.17 ? 227  TRP C CZ2 1 
ATOM   6302 C CZ3 . TRP C 1 228 ? 26.835  -10.857 116.950 1.00 104.05 ? 227  TRP C CZ3 1 
ATOM   6303 C CH2 . TRP C 1 228 ? 26.224  -9.592  117.075 1.00 104.02 ? 227  TRP C CH2 1 
ATOM   6304 N N   . PRO C 1 229 ? 33.828  -8.005  114.933 1.00 105.72 ? 228  PRO C N   1 
ATOM   6305 C CA  . PRO C 1 229 ? 34.554  -6.925  115.612 1.00 105.65 ? 228  PRO C CA  1 
ATOM   6306 C C   . PRO C 1 229 ? 33.608  -6.021  116.415 1.00 105.65 ? 228  PRO C C   1 
ATOM   6307 O O   . PRO C 1 229 ? 33.065  -5.042  115.889 1.00 105.43 ? 228  PRO C O   1 
ATOM   6308 C CB  . PRO C 1 229 ? 35.236  -6.191  114.458 1.00 105.35 ? 228  PRO C CB  1 
ATOM   6309 C CG  . PRO C 1 229 ? 34.271  -6.381  113.325 1.00 105.19 ? 228  PRO C CG  1 
ATOM   6310 C CD  . PRO C 1 229 ? 33.881  -7.839  113.468 1.00 105.12 ? 228  PRO C CD  1 
ATOM   6311 N N   . GLY C 1 230 ? 33.409  -6.368  117.687 1.00 105.72 ? 229  GLY C N   1 
ATOM   6312 C CA  . GLY C 1 230 ? 32.537  -5.586  118.545 1.00 105.33 ? 229  GLY C CA  1 
ATOM   6313 C C   . GLY C 1 230 ? 31.647  -6.376  119.494 1.00 105.37 ? 229  GLY C C   1 
ATOM   6314 O O   . GLY C 1 230 ? 30.982  -5.777  120.337 1.00 105.18 ? 229  GLY C O   1 
ATOM   6315 N N   . VAL C 1 231 ? 31.614  -7.703  119.365 1.00 105.66 ? 230  VAL C N   1 
ATOM   6316 C CA  . VAL C 1 231 ? 30.784  -8.527  120.253 1.00 105.69 ? 230  VAL C CA  1 
ATOM   6317 C C   . VAL C 1 231 ? 31.197  -8.285  121.699 1.00 105.89 ? 230  VAL C C   1 
ATOM   6318 O O   . VAL C 1 231 ? 30.426  -8.517  122.634 1.00 105.68 ? 230  VAL C O   1 
ATOM   6319 C CB  . VAL C 1 231 ? 30.926  -10.049 119.972 1.00 105.44 ? 230  VAL C CB  1 
ATOM   6320 C CG1 . VAL C 1 231 ? 29.587  -10.617 119.526 1.00 104.27 ? 230  VAL C CG1 1 
ATOM   6321 C CG2 . VAL C 1 231 ? 32.007  -10.305 118.939 1.00 103.87 ? 230  VAL C CG2 1 
ATOM   6322 N N   . THR C 1 232 ? 32.433  -7.833  121.865 1.00 106.26 ? 231  THR C N   1 
ATOM   6323 C CA  . THR C 1 232 ? 32.978  -7.530  123.178 1.00 106.97 ? 231  THR C CA  1 
ATOM   6324 C C   . THR C 1 232 ? 32.192  -6.344  123.729 1.00 106.89 ? 231  THR C C   1 
ATOM   6325 O O   . THR C 1 232 ? 32.072  -6.159  124.942 1.00 106.31 ? 231  THR C O   1 
ATOM   6326 C CB  . THR C 1 232 ? 34.465  -7.133  123.068 1.00 107.43 ? 231  THR C CB  1 
ATOM   6327 O OG1 . THR C 1 232 ? 34.580  -5.891  122.356 1.00 107.56 ? 231  THR C OG1 1 
ATOM   6328 C CG2 . THR C 1 232 ? 35.243  -8.206  122.315 1.00 107.63 ? 231  THR C CG2 1 
ATOM   6329 N N   . SER C 1 233 ? 31.656  -5.551  122.805 1.00 107.23 ? 232  SER C N   1 
ATOM   6330 C CA  . SER C 1 233 ? 30.880  -4.360  123.129 1.00 107.54 ? 232  SER C CA  1 
ATOM   6331 C C   . SER C 1 233 ? 29.383  -4.669  123.105 1.00 107.69 ? 232  SER C C   1 
ATOM   6332 O O   . SER C 1 233 ? 28.557  -3.794  123.386 1.00 107.34 ? 232  SER C O   1 
ATOM   6333 C CB  . SER C 1 233 ? 31.182  -3.254  122.111 1.00 107.35 ? 232  SER C CB  1 
ATOM   6334 O OG  . SER C 1 233 ? 32.523  -3.330  121.651 1.00 106.78 ? 232  SER C OG  1 
ATOM   6335 N N   . MET C 1 234 ? 29.040  -5.912  122.765 1.00 107.94 ? 233  MET C N   1 
ATOM   6336 C CA  . MET C 1 234 ? 27.641  -6.330  122.696 1.00 107.88 ? 233  MET C CA  1 
ATOM   6337 C C   . MET C 1 234 ? 26.915  -6.251  124.036 1.00 107.41 ? 233  MET C C   1 
ATOM   6338 O O   . MET C 1 234 ? 27.073  -7.113  124.903 1.00 107.11 ? 233  MET C O   1 
ATOM   6339 C CB  . MET C 1 234 ? 27.529  -7.739  122.102 1.00 107.81 ? 233  MET C CB  1 
ATOM   6340 C CG  . MET C 1 234 ? 27.446  -7.723  120.583 1.00 107.52 ? 233  MET C CG  1 
ATOM   6341 S SD  . MET C 1 234 ? 26.071  -6.658  120.038 1.00 108.66 ? 233  MET C SD  1 
ATOM   6342 C CE  . MET C 1 234 ? 26.915  -5.110  119.680 1.00 107.31 ? 233  MET C CE  1 
ATOM   6343 N N   . PRO C 1 235 ? 26.078  -5.211  124.196 1.00 106.83 ? 234  PRO C N   1 
ATOM   6344 C CA  . PRO C 1 235 ? 25.259  -4.867  125.359 1.00 106.79 ? 234  PRO C CA  1 
ATOM   6345 C C   . PRO C 1 235 ? 25.091  -5.891  126.485 1.00 106.70 ? 234  PRO C C   1 
ATOM   6346 O O   . PRO C 1 235 ? 25.420  -5.605  127.640 1.00 106.30 ? 234  PRO C O   1 
ATOM   6347 C CB  . PRO C 1 235 ? 23.941  -4.465  124.716 1.00 106.41 ? 234  PRO C CB  1 
ATOM   6348 C CG  . PRO C 1 235 ? 24.433  -3.648  123.564 1.00 106.32 ? 234  PRO C CG  1 
ATOM   6349 C CD  . PRO C 1 235 ? 25.593  -4.476  123.009 1.00 106.45 ? 234  PRO C CD  1 
ATOM   6350 N N   . ASP C 1 236 ? 24.587  -7.077  126.163 1.00 106.60 ? 235  ASP C N   1 
ATOM   6351 C CA  . ASP C 1 236 ? 24.369  -8.084  127.194 1.00 106.36 ? 235  ASP C CA  1 
ATOM   6352 C C   . ASP C 1 236 ? 25.503  -9.095  127.318 1.00 106.17 ? 235  ASP C C   1 
ATOM   6353 O O   . ASP C 1 236 ? 25.617  -9.780  128.336 1.00 106.11 ? 235  ASP C O   1 
ATOM   6354 C CB  . ASP C 1 236 ? 23.041  -8.808  126.940 1.00 106.21 ? 235  ASP C CB  1 
ATOM   6355 C CG  . ASP C 1 236 ? 21.919  -7.851  126.556 1.00 106.01 ? 235  ASP C CG  1 
ATOM   6356 O OD1 . ASP C 1 236 ? 21.914  -6.706  127.060 1.00 106.26 ? 235  ASP C OD1 1 
ATOM   6357 O OD2 . ASP C 1 236 ? 21.040  -8.245  125.758 1.00 105.63 ? 235  ASP C OD2 1 
ATOM   6358 N N   . TYR C 1 237 ? 26.337  -9.178  126.284 1.00 106.24 ? 236  TYR C N   1 
ATOM   6359 C CA  . TYR C 1 237 ? 27.475  -10.101 126.260 1.00 106.58 ? 236  TYR C CA  1 
ATOM   6360 C C   . TYR C 1 237 ? 28.287  -10.129 127.564 1.00 106.32 ? 236  TYR C C   1 
ATOM   6361 O O   . TYR C 1 237 ? 28.479  -9.102  128.219 1.00 106.27 ? 236  TYR C O   1 
ATOM   6362 C CB  . TYR C 1 237 ? 28.397  -9.758  125.075 1.00 106.55 ? 236  TYR C CB  1 
ATOM   6363 C CG  . TYR C 1 237 ? 29.854  -10.108 125.303 1.00 106.27 ? 236  TYR C CG  1 
ATOM   6364 C CD1 . TYR C 1 237 ? 30.792  -9.117  125.612 1.00 105.76 ? 236  TYR C CD1 1 
ATOM   6365 C CD2 . TYR C 1 237 ? 30.286  -11.432 125.255 1.00 105.72 ? 236  TYR C CD2 1 
ATOM   6366 C CE1 . TYR C 1 237 ? 32.125  -9.444  125.869 1.00 105.36 ? 236  TYR C CE1 1 
ATOM   6367 C CE2 . TYR C 1 237 ? 31.611  -11.772 125.510 1.00 105.30 ? 236  TYR C CE2 1 
ATOM   6368 C CZ  . TYR C 1 237 ? 32.525  -10.775 125.817 1.00 105.23 ? 236  TYR C CZ  1 
ATOM   6369 O OH  . TYR C 1 237 ? 33.830  -11.114 126.082 1.00 104.71 ? 236  TYR C OH  1 
ATOM   6370 N N   . LYS C 1 238 ? 28.767  -11.316 127.929 1.00 105.84 ? 237  LYS C N   1 
ATOM   6371 C CA  . LYS C 1 238 ? 29.555  -11.481 129.146 1.00 105.55 ? 237  LYS C CA  1 
ATOM   6372 C C   . LYS C 1 238 ? 30.837  -12.260 128.881 1.00 105.41 ? 237  LYS C C   1 
ATOM   6373 O O   . LYS C 1 238 ? 30.792  -13.441 128.538 1.00 105.71 ? 237  LYS C O   1 
ATOM   6374 C CB  . LYS C 1 238 ? 28.729  -12.205 130.216 1.00 105.31 ? 237  LYS C CB  1 
ATOM   6375 C CG  . LYS C 1 238 ? 27.468  -11.457 130.616 1.00 104.66 ? 237  LYS C CG  1 
ATOM   6376 C CD  . LYS C 1 238 ? 27.807  -10.102 131.223 1.00 103.71 ? 237  LYS C CD  1 
ATOM   6377 C CE  . LYS C 1 238 ? 26.573  -9.222  131.345 1.00 103.14 ? 237  LYS C CE  1 
ATOM   6378 N NZ  . LYS C 1 238 ? 26.575  -8.105  130.346 1.00 101.93 ? 237  LYS C NZ  1 
ATOM   6379 N N   . PRO C 1 239 ? 32.001  -11.600 129.026 1.00 105.13 ? 238  PRO C N   1 
ATOM   6380 C CA  . PRO C 1 239 ? 33.294  -12.256 128.800 1.00 104.56 ? 238  PRO C CA  1 
ATOM   6381 C C   . PRO C 1 239 ? 33.282  -13.666 129.380 1.00 104.35 ? 238  PRO C C   1 
ATOM   6382 O O   . PRO C 1 239 ? 33.807  -14.610 128.779 1.00 103.97 ? 238  PRO C O   1 
ATOM   6383 C CB  . PRO C 1 239 ? 34.292  -11.354 129.528 1.00 104.02 ? 238  PRO C CB  1 
ATOM   6384 C CG  . PRO C 1 239 ? 33.556  -10.037 129.780 1.00 104.03 ? 238  PRO C CG  1 
ATOM   6385 C CD  . PRO C 1 239 ? 32.161  -10.150 129.228 1.00 104.38 ? 238  PRO C CD  1 
ATOM   6386 N N   . SER C 1 240 ? 32.663  -13.793 130.551 1.00 104.37 ? 239  SER C N   1 
ATOM   6387 C CA  . SER C 1 240 ? 32.559  -15.075 131.234 1.00 104.13 ? 239  SER C CA  1 
ATOM   6388 C C   . SER C 1 240 ? 31.810  -16.106 130.393 1.00 103.71 ? 239  SER C C   1 
ATOM   6389 O O   . SER C 1 240 ? 31.461  -17.184 130.884 1.00 102.96 ? 239  SER C O   1 
ATOM   6390 C CB  . SER C 1 240 ? 31.869  -14.904 132.596 1.00 104.03 ? 239  SER C CB  1 
ATOM   6391 O OG  . SER C 1 240 ? 32.717  -14.240 133.523 1.00 102.97 ? 239  SER C OG  1 
ATOM   6392 N N   . PHE C 1 241 ? 31.546  -15.786 129.128 1.00 103.38 ? 240  PHE C N   1 
ATOM   6393 C CA  . PHE C 1 241 ? 30.874  -16.769 128.312 1.00 103.26 ? 240  PHE C CA  1 
ATOM   6394 C C   . PHE C 1 241 ? 31.492  -17.111 126.934 1.00 103.60 ? 240  PHE C C   1 
ATOM   6395 O O   . PHE C 1 241 ? 31.878  -16.240 126.141 1.00 102.73 ? 240  PHE C O   1 
ATOM   6396 C CB  . PHE C 1 241 ? 29.331  -16.503 128.305 1.00 102.79 ? 240  PHE C CB  1 
ATOM   6397 C CG  . PHE C 1 241 ? 28.783  -15.684 127.149 1.00 102.60 ? 240  PHE C CG  1 
ATOM   6398 C CD1 . PHE C 1 241 ? 27.405  -15.710 126.911 1.00 102.03 ? 240  PHE C CD1 1 
ATOM   6399 C CD2 . PHE C 1 241 ? 29.579  -14.885 126.333 1.00 102.43 ? 240  PHE C CD2 1 
ATOM   6400 C CE1 . PHE C 1 241 ? 26.828  -14.962 125.888 1.00 101.29 ? 240  PHE C CE1 1 
ATOM   6401 C CE2 . PHE C 1 241 ? 29.004  -14.130 125.299 1.00 101.32 ? 240  PHE C CE2 1 
ATOM   6402 C CZ  . PHE C 1 241 ? 27.628  -14.170 125.080 1.00 101.04 ? 240  PHE C CZ  1 
ATOM   6403 N N   . PRO C 1 242 ? 31.637  -18.432 126.694 1.00 103.95 ? 241  PRO C N   1 
ATOM   6404 C CA  . PRO C 1 242 ? 32.108  -19.391 125.699 1.00 104.00 ? 241  PRO C CA  1 
ATOM   6405 C C   . PRO C 1 242 ? 33.110  -19.215 124.572 1.00 103.99 ? 241  PRO C C   1 
ATOM   6406 O O   . PRO C 1 242 ? 33.451  -18.108 124.141 1.00 103.74 ? 241  PRO C O   1 
ATOM   6407 C CB  . PRO C 1 242 ? 30.806  -19.964 125.203 1.00 104.24 ? 241  PRO C CB  1 
ATOM   6408 C CG  . PRO C 1 242 ? 30.076  -20.191 126.546 1.00 104.86 ? 241  PRO C CG  1 
ATOM   6409 C CD  . PRO C 1 242 ? 30.644  -19.145 127.521 1.00 104.39 ? 241  PRO C CD  1 
ATOM   6410 N N   . LYS C 1 243 ? 33.557  -20.392 124.127 1.00 103.63 ? 242  LYS C N   1 
ATOM   6411 C CA  . LYS C 1 243 ? 34.517  -20.609 123.050 1.00 103.56 ? 242  LYS C CA  1 
ATOM   6412 C C   . LYS C 1 243 ? 34.070  -21.859 122.311 1.00 104.23 ? 242  LYS C C   1 
ATOM   6413 O O   . LYS C 1 243 ? 34.786  -22.862 122.273 1.00 104.63 ? 242  LYS C O   1 
ATOM   6414 C CB  . LYS C 1 243 ? 35.914  -20.858 123.612 1.00 102.36 ? 242  LYS C CB  1 
ATOM   6415 C CG  . LYS C 1 243 ? 36.575  -19.634 124.172 1.00 100.36 ? 242  LYS C CG  1 
ATOM   6416 C CD  . LYS C 1 243 ? 37.557  -19.035 123.196 1.00 97.97  ? 242  LYS C CD  1 
ATOM   6417 C CE  . LYS C 1 243 ? 38.267  -17.864 123.843 1.00 96.62  ? 242  LYS C CE  1 
ATOM   6418 N NZ  . LYS C 1 243 ? 38.874  -18.241 125.151 1.00 94.44  ? 242  LYS C NZ  1 
ATOM   6419 N N   . TRP C 1 244 ? 32.871  -21.811 121.750 1.00 104.75 ? 243  TRP C N   1 
ATOM   6420 C CA  . TRP C 1 244 ? 32.352  -22.944 121.005 1.00 105.41 ? 243  TRP C CA  1 
ATOM   6421 C C   . TRP C 1 244 ? 33.114  -23.027 119.683 1.00 105.08 ? 243  TRP C C   1 
ATOM   6422 O O   . TRP C 1 244 ? 33.549  -22.006 119.145 1.00 104.75 ? 243  TRP C O   1 
ATOM   6423 C CB  . TRP C 1 244 ? 30.850  -22.762 120.770 1.00 106.42 ? 243  TRP C CB  1 
ATOM   6424 C CG  . TRP C 1 244 ? 29.994  -23.617 121.660 1.00 107.30 ? 243  TRP C CG  1 
ATOM   6425 C CD1 . TRP C 1 244 ? 29.727  -24.954 121.509 1.00 107.36 ? 243  TRP C CD1 1 
ATOM   6426 C CD2 . TRP C 1 244 ? 29.301  -23.204 122.845 1.00 108.48 ? 243  TRP C CD2 1 
ATOM   6427 N NE1 . TRP C 1 244 ? 28.909  -25.395 122.524 1.00 108.09 ? 243  TRP C NE1 1 
ATOM   6428 C CE2 . TRP C 1 244 ? 28.632  -24.343 123.358 1.00 108.61 ? 243  TRP C CE2 1 
ATOM   6429 C CE3 . TRP C 1 244 ? 29.178  -21.984 123.526 1.00 109.30 ? 243  TRP C CE3 1 
ATOM   6430 C CZ2 . TRP C 1 244 ? 27.852  -24.300 124.521 1.00 109.12 ? 243  TRP C CZ2 1 
ATOM   6431 C CZ3 . TRP C 1 244 ? 28.397  -21.942 124.692 1.00 109.72 ? 243  TRP C CZ3 1 
ATOM   6432 C CH2 . TRP C 1 244 ? 27.746  -23.098 125.173 1.00 109.45 ? 243  TRP C CH2 1 
ATOM   6433 N N   . ALA C 1 245 ? 33.292  -24.243 119.174 1.00 104.84 ? 244  ALA C N   1 
ATOM   6434 C CA  . ALA C 1 245 ? 34.026  -24.445 117.927 1.00 104.92 ? 244  ALA C CA  1 
ATOM   6435 C C   . ALA C 1 245 ? 33.117  -24.413 116.703 1.00 104.96 ? 244  ALA C C   1 
ATOM   6436 O O   . ALA C 1 245 ? 32.210  -25.239 116.582 1.00 105.18 ? 244  ALA C O   1 
ATOM   6437 C CB  . ALA C 1 245 ? 34.780  -25.769 117.983 1.00 104.33 ? 244  ALA C CB  1 
ATOM   6438 N N   . ARG C 1 246 ? 33.372  -23.469 115.794 1.00 104.92 ? 245  ARG C N   1 
ATOM   6439 C CA  . ARG C 1 246 ? 32.568  -23.334 114.576 1.00 105.00 ? 245  ARG C CA  1 
ATOM   6440 C C   . ARG C 1 246 ? 32.542  -24.595 113.730 1.00 104.87 ? 245  ARG C C   1 
ATOM   6441 O O   . ARG C 1 246 ? 33.493  -24.876 112.998 1.00 104.58 ? 245  ARG C O   1 
ATOM   6442 C CB  . ARG C 1 246 ? 33.067  -22.190 113.685 1.00 104.84 ? 245  ARG C CB  1 
ATOM   6443 C CG  . ARG C 1 246 ? 32.288  -22.123 112.364 1.00 104.98 ? 245  ARG C CG  1 
ATOM   6444 C CD  . ARG C 1 246 ? 32.838  -21.118 111.363 1.00 104.03 ? 245  ARG C CD  1 
ATOM   6445 N NE  . ARG C 1 246 ? 32.016  -21.086 110.151 1.00 103.99 ? 245  ARG C NE  1 
ATOM   6446 C CZ  . ARG C 1 246 ? 30.823  -20.501 110.062 1.00 103.54 ? 245  ARG C CZ  1 
ATOM   6447 N NH1 . ARG C 1 246 ? 30.300  -19.883 111.115 1.00 103.24 ? 245  ARG C NH1 1 
ATOM   6448 N NH2 . ARG C 1 246 ? 30.144  -20.545 108.921 1.00 102.76 ? 245  ARG C NH2 1 
ATOM   6449 N N   . GLN C 1 247 ? 31.444  -25.338 113.813 1.00 105.06 ? 246  GLN C N   1 
ATOM   6450 C CA  . GLN C 1 247 ? 31.308  -26.558 113.035 1.00 105.04 ? 246  GLN C CA  1 
ATOM   6451 C C   . GLN C 1 247 ? 31.507  -26.198 111.565 1.00 105.20 ? 246  GLN C C   1 
ATOM   6452 O O   . GLN C 1 247 ? 30.846  -25.292 111.048 1.00 104.82 ? 246  GLN C O   1 
ATOM   6453 C CB  . GLN C 1 247 ? 29.907  -27.174 113.206 1.00 104.78 ? 246  GLN C CB  1 
ATOM   6454 C CG  . GLN C 1 247 ? 29.404  -27.320 114.646 1.00 104.72 ? 246  GLN C CG  1 
ATOM   6455 C CD  . GLN C 1 247 ? 30.187  -28.336 115.474 1.00 104.96 ? 246  GLN C CD  1 
ATOM   6456 O OE1 . GLN C 1 247 ? 29.839  -28.612 116.627 1.00 103.75 ? 246  GLN C OE1 1 
ATOM   6457 N NE2 . GLN C 1 247 ? 31.247  -28.893 114.893 1.00 104.73 ? 246  GLN C NE2 1 
ATOM   6458 N N   . ASP C 1 248 ? 32.443  -26.877 110.908 1.00 105.17 ? 247  ASP C N   1 
ATOM   6459 C CA  . ASP C 1 248 ? 32.666  -26.660 109.485 1.00 104.73 ? 247  ASP C CA  1 
ATOM   6460 C C   . ASP C 1 248 ? 31.258  -26.886 108.935 1.00 104.14 ? 247  ASP C C   1 
ATOM   6461 O O   . ASP C 1 248 ? 30.573  -27.830 109.347 1.00 104.31 ? 247  ASP C O   1 
ATOM   6462 C CB  . ASP C 1 248 ? 33.650  -27.709 108.954 1.00 105.33 ? 247  ASP C CB  1 
ATOM   6463 C CG  . ASP C 1 248 ? 33.326  -28.168 107.542 1.00 106.28 ? 247  ASP C CG  1 
ATOM   6464 O OD1 . ASP C 1 248 ? 33.744  -29.291 107.183 1.00 106.39 ? 247  ASP C OD1 1 
ATOM   6465 O OD2 . ASP C 1 248 ? 32.666  -27.415 106.790 1.00 106.90 ? 247  ASP C OD2 1 
ATOM   6466 N N   . PHE C 1 249 ? 30.815  -26.031 108.022 1.00 102.51 ? 248  PHE C N   1 
ATOM   6467 C CA  . PHE C 1 249 ? 29.460  -26.152 107.499 1.00 101.03 ? 248  PHE C CA  1 
ATOM   6468 C C   . PHE C 1 249 ? 28.982  -27.479 106.903 1.00 99.20  ? 248  PHE C C   1 
ATOM   6469 O O   . PHE C 1 249 ? 27.790  -27.786 106.978 1.00 99.59  ? 248  PHE C O   1 
ATOM   6470 C CB  . PHE C 1 249 ? 29.177  -25.007 106.524 1.00 101.76 ? 248  PHE C CB  1 
ATOM   6471 C CG  . PHE C 1 249 ? 28.198  -24.001 107.062 1.00 102.03 ? 248  PHE C CG  1 
ATOM   6472 C CD1 . PHE C 1 249 ? 28.405  -23.414 108.310 1.00 101.90 ? 248  PHE C CD1 1 
ATOM   6473 C CD2 . PHE C 1 249 ? 27.048  -23.676 106.348 1.00 101.81 ? 248  PHE C CD2 1 
ATOM   6474 C CE1 . PHE C 1 249 ? 27.478  -22.524 108.842 1.00 101.84 ? 248  PHE C CE1 1 
ATOM   6475 C CE2 . PHE C 1 249 ? 26.114  -22.786 106.869 1.00 101.89 ? 248  PHE C CE2 1 
ATOM   6476 C CZ  . PHE C 1 249 ? 26.328  -22.209 108.120 1.00 101.96 ? 248  PHE C CZ  1 
ATOM   6477 N N   . SER C 1 250 ? 29.884  -28.270 106.328 1.00 96.78  ? 249  SER C N   1 
ATOM   6478 C CA  . SER C 1 250 ? 29.487  -29.552 105.740 1.00 94.53  ? 249  SER C CA  1 
ATOM   6479 C C   . SER C 1 250 ? 28.692  -30.427 106.711 1.00 92.93  ? 249  SER C C   1 
ATOM   6480 O O   . SER C 1 250 ? 27.783  -31.156 106.309 1.00 92.17  ? 249  SER C O   1 
ATOM   6481 C CB  . SER C 1 250 ? 30.714  -30.325 105.258 1.00 94.61  ? 249  SER C CB  1 
ATOM   6482 O OG  . SER C 1 250 ? 30.334  -31.593 104.749 1.00 94.00  ? 249  SER C OG  1 
ATOM   6483 N N   . LYS C 1 251 ? 29.044  -30.354 107.989 1.00 91.63  ? 250  LYS C N   1 
ATOM   6484 C CA  . LYS C 1 251 ? 28.367  -31.129 109.023 1.00 90.54  ? 250  LYS C CA  1 
ATOM   6485 C C   . LYS C 1 251 ? 26.929  -30.613 109.187 1.00 89.99  ? 250  LYS C C   1 
ATOM   6486 O O   . LYS C 1 251 ? 25.974  -31.394 109.259 1.00 88.48  ? 250  LYS C O   1 
ATOM   6487 C CB  . LYS C 1 251 ? 29.121  -30.982 110.357 1.00 90.55  ? 250  LYS C CB  1 
ATOM   6488 C CG  . LYS C 1 251 ? 29.435  -32.294 111.085 1.00 89.28  ? 250  LYS C CG  1 
ATOM   6489 C CD  . LYS C 1 251 ? 30.789  -32.868 110.681 1.00 88.46  ? 250  LYS C CD  1 
ATOM   6490 C CE  . LYS C 1 251 ? 31.823  -32.747 111.810 1.00 88.86  ? 250  LYS C CE  1 
ATOM   6491 N NZ  . LYS C 1 251 ? 32.200  -31.335 112.142 1.00 87.47  ? 250  LYS C NZ  1 
ATOM   6492 N N   . VAL C 1 252 ? 26.809  -29.285 109.232 1.00 89.69  ? 251  VAL C N   1 
ATOM   6493 C CA  . VAL C 1 252 ? 25.549  -28.556 109.408 1.00 89.19  ? 251  VAL C CA  1 
ATOM   6494 C C   . VAL C 1 252 ? 24.322  -29.075 108.649 1.00 89.32  ? 251  VAL C C   1 
ATOM   6495 O O   . VAL C 1 252 ? 23.435  -29.709 109.232 1.00 89.19  ? 251  VAL C O   1 
ATOM   6496 C CB  . VAL C 1 252 ? 25.743  -27.068 109.043 1.00 88.69  ? 251  VAL C CB  1 
ATOM   6497 C CG1 . VAL C 1 252 ? 24.470  -26.288 109.324 1.00 88.78  ? 251  VAL C CG1 1 
ATOM   6498 C CG2 . VAL C 1 252 ? 26.907  -26.494 109.826 1.00 88.08  ? 251  VAL C CG2 1 
ATOM   6499 N N   . VAL C 1 253 ? 24.256  -28.772 107.357 1.00 88.65  ? 252  VAL C N   1 
ATOM   6500 C CA  . VAL C 1 253 ? 23.135  -29.210 106.537 1.00 88.05  ? 252  VAL C CA  1 
ATOM   6501 C C   . VAL C 1 253 ? 23.561  -30.359 105.633 1.00 87.03  ? 252  VAL C C   1 
ATOM   6502 O O   . VAL C 1 253 ? 24.224  -30.158 104.610 1.00 86.65  ? 252  VAL C O   1 
ATOM   6503 C CB  . VAL C 1 253 ? 22.580  -28.050 105.694 1.00 88.41  ? 252  VAL C CB  1 
ATOM   6504 C CG1 . VAL C 1 253 ? 21.612  -28.575 104.657 1.00 88.15  ? 252  VAL C CG1 1 
ATOM   6505 C CG2 . VAL C 1 253 ? 21.872  -27.062 106.601 1.00 88.69  ? 252  VAL C CG2 1 
ATOM   6506 N N   . PRO C 1 254 ? 23.164  -31.587 106.004 1.00 86.35  ? 253  PRO C N   1 
ATOM   6507 C CA  . PRO C 1 254 ? 23.468  -32.829 105.291 1.00 85.05  ? 253  PRO C CA  1 
ATOM   6508 C C   . PRO C 1 254 ? 23.192  -32.881 103.783 1.00 83.86  ? 253  PRO C C   1 
ATOM   6509 O O   . PRO C 1 254 ? 24.115  -33.071 102.991 1.00 83.41  ? 253  PRO C O   1 
ATOM   6510 C CB  . PRO C 1 254 ? 22.665  -33.877 106.071 1.00 85.30  ? 253  PRO C CB  1 
ATOM   6511 C CG  . PRO C 1 254 ? 22.631  -33.313 107.460 1.00 85.25  ? 253  PRO C CG  1 
ATOM   6512 C CD  . PRO C 1 254 ? 22.335  -31.863 107.194 1.00 85.87  ? 253  PRO C CD  1 
ATOM   6513 N N   . PRO C 1 255 ? 21.925  -32.704 103.364 1.00 82.71  ? 254  PRO C N   1 
ATOM   6514 C CA  . PRO C 1 255 ? 21.594  -32.758 101.934 1.00 82.24  ? 254  PRO C CA  1 
ATOM   6515 C C   . PRO C 1 255 ? 22.021  -31.580 101.063 1.00 82.26  ? 254  PRO C C   1 
ATOM   6516 O O   . PRO C 1 255 ? 21.870  -31.627 99.841  1.00 81.78  ? 254  PRO C O   1 
ATOM   6517 C CB  . PRO C 1 255 ? 20.070  -32.921 101.934 1.00 81.80  ? 254  PRO C CB  1 
ATOM   6518 C CG  . PRO C 1 255 ? 19.745  -33.414 103.326 1.00 81.28  ? 254  PRO C CG  1 
ATOM   6519 C CD  . PRO C 1 255 ? 20.695  -32.621 104.166 1.00 81.85  ? 254  PRO C CD  1 
ATOM   6520 N N   . LEU C 1 256 ? 22.557  -30.531 101.674 1.00 82.14  ? 255  LEU C N   1 
ATOM   6521 C CA  . LEU C 1 256 ? 22.941  -29.356 100.906 1.00 82.40  ? 255  LEU C CA  1 
ATOM   6522 C C   . LEU C 1 256 ? 24.241  -29.479 100.123 1.00 82.94  ? 255  LEU C C   1 
ATOM   6523 O O   . LEU C 1 256 ? 25.296  -29.760 100.692 1.00 83.67  ? 255  LEU C O   1 
ATOM   6524 C CB  . LEU C 1 256 ? 23.012  -28.140 101.828 1.00 81.41  ? 255  LEU C CB  1 
ATOM   6525 C CG  . LEU C 1 256 ? 22.535  -26.811 101.235 1.00 80.62  ? 255  LEU C CG  1 
ATOM   6526 C CD1 . LEU C 1 256 ? 21.167  -26.980 100.592 1.00 78.96  ? 255  LEU C CD1 1 
ATOM   6527 C CD2 . LEU C 1 256 ? 22.478  -25.767 102.337 1.00 80.98  ? 255  LEU C CD2 1 
ATOM   6528 N N   . ASP C 1 257 ? 24.156  -29.271 98.810  1.00 83.40  ? 256  ASP C N   1 
ATOM   6529 C CA  . ASP C 1 257 ? 25.339  -29.321 97.960  1.00 84.13  ? 256  ASP C CA  1 
ATOM   6530 C C   . ASP C 1 257 ? 26.184  -28.101 98.340  1.00 84.76  ? 256  ASP C C   1 
ATOM   6531 O O   . ASP C 1 257 ? 25.723  -27.236 99.089  1.00 85.55  ? 256  ASP C O   1 
ATOM   6532 C CB  . ASP C 1 257 ? 24.954  -29.256 96.478  1.00 84.06  ? 256  ASP C CB  1 
ATOM   6533 C CG  . ASP C 1 257 ? 24.191  -27.994 96.129  1.00 84.53  ? 256  ASP C CG  1 
ATOM   6534 O OD1 . ASP C 1 257 ? 22.948  -27.984 96.295  1.00 83.79  ? 256  ASP C OD1 1 
ATOM   6535 O OD2 . ASP C 1 257 ? 24.845  -27.014 95.702  1.00 83.61  ? 256  ASP C OD2 1 
ATOM   6536 N N   . GLU C 1 258 ? 27.404  -28.024 97.817  1.00 84.42  ? 257  GLU C N   1 
ATOM   6537 C CA  . GLU C 1 258 ? 28.323  -26.930 98.138  1.00 84.08  ? 257  GLU C CA  1 
ATOM   6538 C C   . GLU C 1 258 ? 27.805  -25.498 97.985  1.00 83.21  ? 257  GLU C C   1 
ATOM   6539 O O   . GLU C 1 258 ? 27.989  -24.676 98.884  1.00 81.89  ? 257  GLU C O   1 
ATOM   6540 C CB  . GLU C 1 258 ? 29.601  -27.074 97.322  1.00 85.56  ? 257  GLU C CB  1 
ATOM   6541 C CG  . GLU C 1 258 ? 30.623  -25.999 97.619  1.00 86.96  ? 257  GLU C CG  1 
ATOM   6542 C CD  . GLU C 1 258 ? 31.560  -25.777 96.456  1.00 87.90  ? 257  GLU C CD  1 
ATOM   6543 O OE1 . GLU C 1 258 ? 32.440  -24.893 96.562  1.00 87.91  ? 257  GLU C OE1 1 
ATOM   6544 O OE2 . GLU C 1 258 ? 31.407  -26.486 95.434  1.00 87.80  ? 257  GLU C OE2 1 
ATOM   6545 N N   . ASP C 1 259 ? 27.193  -25.193 96.843  1.00 83.02  ? 258  ASP C N   1 
ATOM   6546 C CA  . ASP C 1 259 ? 26.658  -23.853 96.602  1.00 83.20  ? 258  ASP C CA  1 
ATOM   6547 C C   . ASP C 1 259 ? 25.794  -23.404 97.784  1.00 82.90  ? 258  ASP C C   1 
ATOM   6548 O O   . ASP C 1 259 ? 25.937  -22.287 98.293  1.00 82.22  ? 258  ASP C O   1 
ATOM   6549 C CB  . ASP C 1 259 ? 25.803  -23.829 95.325  1.00 84.49  ? 258  ASP C CB  1 
ATOM   6550 C CG  . ASP C 1 259 ? 26.627  -23.959 94.050  1.00 85.20  ? 258  ASP C CG  1 
ATOM   6551 O OD1 . ASP C 1 259 ? 27.542  -23.133 93.841  1.00 84.50  ? 258  ASP C OD1 1 
ATOM   6552 O OD2 . ASP C 1 259 ? 26.348  -24.881 93.250  1.00 85.84  ? 258  ASP C OD2 1 
ATOM   6553 N N   . GLY C 1 260 ? 24.896  -24.289 98.208  1.00 82.08  ? 259  GLY C N   1 
ATOM   6554 C CA  . GLY C 1 260 ? 24.012  -23.990 99.320  1.00 81.25  ? 259  GLY C CA  1 
ATOM   6555 C C   . GLY C 1 260 ? 24.740  -23.657 100.608 1.00 80.89  ? 259  GLY C C   1 
ATOM   6556 O O   . GLY C 1 260 ? 24.562  -22.572 101.168 1.00 80.56  ? 259  GLY C O   1 
ATOM   6557 N N   . ARG C 1 261 ? 25.556  -24.588 101.089 1.00 80.50  ? 260  ARG C N   1 
ATOM   6558 C CA  . ARG C 1 261 ? 26.297  -24.362 102.319 1.00 80.08  ? 260  ARG C CA  1 
ATOM   6559 C C   . ARG C 1 261 ? 26.927  -22.982 102.329 1.00 79.26  ? 260  ARG C C   1 
ATOM   6560 O O   . ARG C 1 261 ? 26.979  -22.329 103.369 1.00 79.90  ? 260  ARG C O   1 
ATOM   6561 C CB  . ARG C 1 261 ? 27.388  -25.413 102.505 1.00 81.05  ? 260  ARG C CB  1 
ATOM   6562 C CG  . ARG C 1 261 ? 26.883  -26.777 102.936 1.00 82.39  ? 260  ARG C CG  1 
ATOM   6563 C CD  . ARG C 1 261 ? 27.954  -27.483 103.750 1.00 83.22  ? 260  ARG C CD  1 
ATOM   6564 N NE  . ARG C 1 261 ? 29.256  -27.413 103.092 1.00 83.56  ? 260  ARG C NE  1 
ATOM   6565 C CZ  . ARG C 1 261 ? 29.544  -28.020 101.946 1.00 83.62  ? 260  ARG C CZ  1 
ATOM   6566 N NH1 . ARG C 1 261 ? 28.620  -28.751 101.332 1.00 82.93  ? 260  ARG C NH1 1 
ATOM   6567 N NH2 . ARG C 1 261 ? 30.750  -27.887 101.411 1.00 82.77  ? 260  ARG C NH2 1 
ATOM   6568 N N   . SER C 1 262 ? 27.408  -22.538 101.173 1.00 78.30  ? 261  SER C N   1 
ATOM   6569 C CA  . SER C 1 262 ? 28.023  -21.218 101.085 1.00 77.52  ? 261  SER C CA  1 
ATOM   6570 C C   . SER C 1 262 ? 26.977  -20.154 101.411 1.00 76.57  ? 261  SER C C   1 
ATOM   6571 O O   . SER C 1 262 ? 27.072  -19.468 102.430 1.00 76.80  ? 261  SER C O   1 
ATOM   6572 C CB  . SER C 1 262 ? 28.585  -20.976 99.680  1.00 77.70  ? 261  SER C CB  1 
ATOM   6573 O OG  . SER C 1 262 ? 29.167  -19.685 99.580  1.00 77.67  ? 261  SER C OG  1 
ATOM   6574 N N   . LEU C 1 263 ? 25.978  -20.033 100.540 1.00 74.38  ? 262  LEU C N   1 
ATOM   6575 C CA  . LEU C 1 263 ? 24.904  -19.062 100.712 1.00 71.80  ? 262  LEU C CA  1 
ATOM   6576 C C   . LEU C 1 263 ? 24.366  -19.042 102.139 1.00 71.30  ? 262  LEU C C   1 
ATOM   6577 O O   . LEU C 1 263 ? 24.154  -17.976 102.715 1.00 72.09  ? 262  LEU C O   1 
ATOM   6578 C CB  . LEU C 1 263 ? 23.770  -19.374 99.731  1.00 70.11  ? 262  LEU C CB  1 
ATOM   6579 C CG  . LEU C 1 263 ? 22.478  -18.560 99.823  1.00 68.21  ? 262  LEU C CG  1 
ATOM   6580 C CD1 . LEU C 1 263 ? 22.790  -17.078 99.876  1.00 66.70  ? 262  LEU C CD1 1 
ATOM   6581 C CD2 . LEU C 1 263 ? 21.600  -18.884 98.625  1.00 65.98  ? 262  LEU C CD2 1 
ATOM   6582 N N   . LEU C 1 264 ? 24.157  -20.226 102.707 1.00 70.13  ? 263  LEU C N   1 
ATOM   6583 C CA  . LEU C 1 264 ? 23.638  -20.352 104.064 1.00 68.91  ? 263  LEU C CA  1 
ATOM   6584 C C   . LEU C 1 264 ? 24.521  -19.717 105.134 1.00 67.34  ? 263  LEU C C   1 
ATOM   6585 O O   . LEU C 1 264 ? 24.027  -18.982 105.992 1.00 66.42  ? 263  LEU C O   1 
ATOM   6586 C CB  . LEU C 1 264 ? 23.417  -21.829 104.407 1.00 69.67  ? 263  LEU C CB  1 
ATOM   6587 C CG  . LEU C 1 264 ? 22.973  -22.142 105.841 1.00 68.86  ? 263  LEU C CG  1 
ATOM   6588 C CD1 . LEU C 1 264 ? 21.689  -21.397 106.162 1.00 68.53  ? 263  LEU C CD1 1 
ATOM   6589 C CD2 . LEU C 1 264 ? 22.778  -23.642 105.998 1.00 67.74  ? 263  LEU C CD2 1 
ATOM   6590 N N   . SER C 1 265 ? 25.819  -20.006 105.094 1.00 66.27  ? 264  SER C N   1 
ATOM   6591 C CA  . SER C 1 265 ? 26.740  -19.450 106.083 1.00 66.72  ? 264  SER C CA  1 
ATOM   6592 C C   . SER C 1 265 ? 26.887  -17.950 105.871 1.00 66.30  ? 264  SER C C   1 
ATOM   6593 O O   . SER C 1 265 ? 27.327  -17.227 106.764 1.00 65.95  ? 264  SER C O   1 
ATOM   6594 C CB  . SER C 1 265 ? 28.115  -20.115 105.993 1.00 67.28  ? 264  SER C CB  1 
ATOM   6595 O OG  . SER C 1 265 ? 28.992  -19.361 105.176 1.00 69.14  ? 264  SER C OG  1 
ATOM   6596 N N   . GLN C 1 266 ? 26.531  -17.495 104.676 1.00 66.23  ? 265  GLN C N   1 
ATOM   6597 C CA  . GLN C 1 266 ? 26.591  -16.082 104.348 1.00 66.42  ? 265  GLN C CA  1 
ATOM   6598 C C   . GLN C 1 266 ? 25.352  -15.438 104.959 1.00 66.92  ? 265  GLN C C   1 
ATOM   6599 O O   . GLN C 1 266 ? 25.401  -14.320 105.487 1.00 66.39  ? 265  GLN C O   1 
ATOM   6600 C CB  . GLN C 1 266 ? 26.592  -15.889 102.834 1.00 67.12  ? 265  GLN C CB  1 
ATOM   6601 C CG  . GLN C 1 266 ? 27.932  -16.152 102.172 1.00 67.12  ? 265  GLN C CG  1 
ATOM   6602 C CD  . GLN C 1 266 ? 27.880  -15.929 100.673 1.00 68.22  ? 265  GLN C CD  1 
ATOM   6603 O OE1 . GLN C 1 266 ? 27.392  -16.780 99.919  1.00 69.23  ? 265  GLN C OE1 1 
ATOM   6604 N NE2 . GLN C 1 266 ? 28.365  -14.772 100.231 1.00 66.48  ? 265  GLN C NE2 1 
ATOM   6605 N N   . MET C 1 267 ? 24.239  -16.159 104.884 1.00 66.21  ? 266  MET C N   1 
ATOM   6606 C CA  . MET C 1 267 ? 22.987  -15.681 105.450 1.00 65.89  ? 266  MET C CA  1 
ATOM   6607 C C   . MET C 1 267 ? 23.044  -15.756 106.974 1.00 66.77  ? 266  MET C C   1 
ATOM   6608 O O   . MET C 1 267 ? 22.252  -15.119 107.665 1.00 67.28  ? 266  MET C O   1 
ATOM   6609 C CB  . MET C 1 267 ? 21.818  -16.530 104.960 1.00 63.85  ? 266  MET C CB  1 
ATOM   6610 C CG  . MET C 1 267 ? 21.417  -16.299 103.529 1.00 61.57  ? 266  MET C CG  1 
ATOM   6611 S SD  . MET C 1 267 ? 19.854  -17.104 103.260 1.00 62.14  ? 266  MET C SD  1 
ATOM   6612 C CE  . MET C 1 267 ? 19.941  -17.522 101.550 1.00 62.09  ? 266  MET C CE  1 
ATOM   6613 N N   . LEU C 1 268 ? 23.984  -16.535 107.499 1.00 67.43  ? 267  LEU C N   1 
ATOM   6614 C CA  . LEU C 1 268 ? 24.110  -16.686 108.941 1.00 68.13  ? 267  LEU C CA  1 
ATOM   6615 C C   . LEU C 1 268 ? 25.349  -16.029 109.524 1.00 69.10  ? 267  LEU C C   1 
ATOM   6616 O O   . LEU C 1 268 ? 25.838  -16.459 110.565 1.00 69.79  ? 267  LEU C O   1 
ATOM   6617 C CB  . LEU C 1 268 ? 24.125  -18.168 109.318 1.00 66.96  ? 267  LEU C CB  1 
ATOM   6618 C CG  . LEU C 1 268 ? 22.878  -19.001 109.037 1.00 67.11  ? 267  LEU C CG  1 
ATOM   6619 C CD1 . LEU C 1 268 ? 23.107  -20.407 109.574 1.00 67.64  ? 267  LEU C CD1 1 
ATOM   6620 C CD2 . LEU C 1 268 ? 21.656  -18.372 109.697 1.00 65.49  ? 267  LEU C CD2 1 
ATOM   6621 N N   . HIS C 1 269 ? 25.862  -14.991 108.878 1.00 70.47  ? 268  HIS C N   1 
ATOM   6622 C CA  . HIS C 1 269 ? 27.054  -14.342 109.404 1.00 72.09  ? 268  HIS C CA  1 
ATOM   6623 C C   . HIS C 1 269 ? 26.779  -13.699 110.761 1.00 73.93  ? 268  HIS C C   1 
ATOM   6624 O O   . HIS C 1 269 ? 25.743  -13.068 110.965 1.00 73.49  ? 268  HIS C O   1 
ATOM   6625 C CB  . HIS C 1 269 ? 27.568  -13.293 108.419 1.00 71.81  ? 268  HIS C CB  1 
ATOM   6626 C CG  . HIS C 1 269 ? 29.056  -13.132 108.441 1.00 72.25  ? 268  HIS C CG  1 
ATOM   6627 N ND1 . HIS C 1 269 ? 29.817  -13.117 107.293 1.00 71.54  ? 268  HIS C ND1 1 
ATOM   6628 C CD2 . HIS C 1 269 ? 29.926  -13.019 109.472 1.00 71.84  ? 268  HIS C CD2 1 
ATOM   6629 C CE1 . HIS C 1 269 ? 31.092  -13.005 107.615 1.00 71.94  ? 268  HIS C CE1 1 
ATOM   6630 N NE2 . HIS C 1 269 ? 31.186  -12.944 108.931 1.00 72.11  ? 268  HIS C NE2 1 
ATOM   6631 N N   . TYR C 1 270 ? 27.704  -13.880 111.696 1.00 76.76  ? 269  TYR C N   1 
ATOM   6632 C CA  . TYR C 1 270 ? 27.553  -13.298 113.024 1.00 79.88  ? 269  TYR C CA  1 
ATOM   6633 C C   . TYR C 1 270 ? 27.444  -11.789 112.927 1.00 80.11  ? 269  TYR C C   1 
ATOM   6634 O O   . TYR C 1 270 ? 26.642  -11.164 113.617 1.00 81.12  ? 269  TYR C O   1 
ATOM   6635 C CB  . TYR C 1 270 ? 28.747  -13.659 113.903 1.00 82.62  ? 269  TYR C CB  1 
ATOM   6636 C CG  . TYR C 1 270 ? 28.521  -14.890 114.736 1.00 86.31  ? 269  TYR C CG  1 
ATOM   6637 C CD1 . TYR C 1 270 ? 27.818  -14.820 115.941 1.00 87.37  ? 269  TYR C CD1 1 
ATOM   6638 C CD2 . TYR C 1 270 ? 28.985  -16.136 114.308 1.00 87.45  ? 269  TYR C CD2 1 
ATOM   6639 C CE1 . TYR C 1 270 ? 27.583  -15.965 116.702 1.00 88.85  ? 269  TYR C CE1 1 
ATOM   6640 C CE2 . TYR C 1 270 ? 28.754  -17.285 115.057 1.00 88.22  ? 269  TYR C CE2 1 
ATOM   6641 C CZ  . TYR C 1 270 ? 28.055  -17.195 116.252 1.00 89.10  ? 269  TYR C CZ  1 
ATOM   6642 O OH  . TYR C 1 270 ? 27.831  -18.335 116.988 1.00 90.24  ? 269  TYR C OH  1 
ATOM   6643 N N   . ASP C 1 271 ? 28.261  -11.205 112.063 1.00 80.24  ? 270  ASP C N   1 
ATOM   6644 C CA  . ASP C 1 271 ? 28.249  -9.767  111.891 1.00 81.05  ? 270  ASP C CA  1 
ATOM   6645 C C   . ASP C 1 271 ? 27.098  -9.344  110.982 1.00 80.28  ? 270  ASP C C   1 
ATOM   6646 O O   . ASP C 1 271 ? 26.996  -9.796  109.842 1.00 79.90  ? 270  ASP C O   1 
ATOM   6647 C CB  . ASP C 1 271 ? 29.571  -9.301  111.286 1.00 82.49  ? 270  ASP C CB  1 
ATOM   6648 C CG  . ASP C 1 271 ? 29.764  -7.804  111.400 1.00 84.29  ? 270  ASP C CG  1 
ATOM   6649 O OD1 . ASP C 1 271 ? 28.792  -7.055  111.151 1.00 84.30  ? 270  ASP C OD1 1 
ATOM   6650 O OD2 . ASP C 1 271 ? 30.894  -7.381  111.733 1.00 85.53  ? 270  ASP C OD2 1 
ATOM   6651 N N   . PRO C 1 272 ? 26.201  -8.483  111.490 1.00 79.44  ? 271  PRO C N   1 
ATOM   6652 C CA  . PRO C 1 272 ? 25.060  -8.003  110.703 1.00 78.84  ? 271  PRO C CA  1 
ATOM   6653 C C   . PRO C 1 272 ? 25.531  -7.220  109.476 1.00 78.25  ? 271  PRO C C   1 
ATOM   6654 O O   . PRO C 1 272 ? 24.787  -7.031  108.515 1.00 77.71  ? 271  PRO C O   1 
ATOM   6655 C CB  . PRO C 1 272 ? 24.308  -7.128  111.698 1.00 78.81  ? 271  PRO C CB  1 
ATOM   6656 C CG  . PRO C 1 272 ? 24.559  -7.828  112.997 1.00 78.96  ? 271  PRO C CG  1 
ATOM   6657 C CD  . PRO C 1 272 ? 26.037  -8.130  112.912 1.00 78.95  ? 271  PRO C CD  1 
ATOM   6658 N N   . ASN C 1 273 ? 26.775  -6.761  109.526 1.00 78.38  ? 272  ASN C N   1 
ATOM   6659 C CA  . ASN C 1 273 ? 27.358  -6.010  108.425 1.00 79.34  ? 272  ASN C CA  1 
ATOM   6660 C C   . ASN C 1 273 ? 27.915  -6.976  107.390 1.00 79.14  ? 272  ASN C C   1 
ATOM   6661 O O   . ASN C 1 273 ? 27.886  -6.708  106.185 1.00 79.81  ? 272  ASN C O   1 
ATOM   6662 C CB  . ASN C 1 273 ? 28.478  -5.113  108.943 1.00 80.61  ? 272  ASN C CB  1 
ATOM   6663 C CG  . ASN C 1 273 ? 27.965  -4.006  109.836 1.00 82.07  ? 272  ASN C CG  1 
ATOM   6664 O OD1 . ASN C 1 273 ? 27.326  -3.065  109.365 1.00 82.72  ? 272  ASN C OD1 1 
ATOM   6665 N ND2 . ASN C 1 273 ? 28.233  -4.116  111.135 1.00 82.40  ? 272  ASN C ND2 1 
ATOM   6666 N N   . LYS C 1 274 ? 28.420  -8.106  107.869 1.00 77.94  ? 273  LYS C N   1 
ATOM   6667 C CA  . LYS C 1 274 ? 28.986  -9.119  106.989 1.00 76.74  ? 273  LYS C CA  1 
ATOM   6668 C C   . LYS C 1 274 ? 27.882  -9.983  106.381 1.00 75.19  ? 273  LYS C C   1 
ATOM   6669 O O   . LYS C 1 274 ? 28.020  -10.485 105.264 1.00 75.22  ? 273  LYS C O   1 
ATOM   6670 C CB  . LYS C 1 274 ? 29.976  -10.000 107.763 1.00 77.39  ? 273  LYS C CB  1 
ATOM   6671 C CG  . LYS C 1 274 ? 31.235  -9.299  108.319 1.00 78.26  ? 273  LYS C CG  1 
ATOM   6672 C CD  . LYS C 1 274 ? 31.296  -7.791  108.057 1.00 78.89  ? 273  LYS C CD  1 
ATOM   6673 C CE  . LYS C 1 274 ? 31.645  -7.469  106.604 1.00 80.40  ? 273  LYS C CE  1 
ATOM   6674 N NZ  . LYS C 1 274 ? 31.569  -6.002  106.317 1.00 80.58  ? 273  LYS C NZ  1 
ATOM   6675 N N   . ARG C 1 275 ? 26.788  -10.144 107.122 1.00 72.73  ? 274  ARG C N   1 
ATOM   6676 C CA  . ARG C 1 275 ? 25.654  -10.945 106.677 1.00 68.82  ? 274  ARG C CA  1 
ATOM   6677 C C   . ARG C 1 275 ? 25.222  -10.449 105.300 1.00 66.66  ? 274  ARG C C   1 
ATOM   6678 O O   . ARG C 1 275 ? 25.028  -9.254  105.098 1.00 65.85  ? 274  ARG C O   1 
ATOM   6679 C CB  . ARG C 1 275 ? 24.514  -10.818 107.689 1.00 68.54  ? 274  ARG C CB  1 
ATOM   6680 C CG  . ARG C 1 275 ? 23.579  -12.012 107.757 1.00 67.76  ? 274  ARG C CG  1 
ATOM   6681 C CD  . ARG C 1 275 ? 22.652  -11.885 108.959 1.00 67.31  ? 274  ARG C CD  1 
ATOM   6682 N NE  . ARG C 1 275 ? 23.381  -11.915 110.225 1.00 67.00  ? 274  ARG C NE  1 
ATOM   6683 C CZ  . ARG C 1 275 ? 22.963  -11.333 111.348 1.00 67.58  ? 274  ARG C CZ  1 
ATOM   6684 N NH1 . ARG C 1 275 ? 21.813  -10.667 111.369 1.00 68.20  ? 274  ARG C NH1 1 
ATOM   6685 N NH2 . ARG C 1 275 ? 23.698  -11.415 112.451 1.00 67.31  ? 274  ARG C NH2 1 
ATOM   6686 N N   . ILE C 1 276 ? 25.086  -11.381 104.361 1.00 65.58  ? 275  ILE C N   1 
ATOM   6687 C CA  . ILE C 1 276 ? 24.714  -11.077 102.980 1.00 64.97  ? 275  ILE C CA  1 
ATOM   6688 C C   . ILE C 1 276 ? 23.330  -10.454 102.802 1.00 65.88  ? 275  ILE C C   1 
ATOM   6689 O O   . ILE C 1 276 ? 22.344  -10.914 103.383 1.00 66.01  ? 275  ILE C O   1 
ATOM   6690 C CB  . ILE C 1 276 ? 24.776  -12.348 102.108 1.00 64.71  ? 275  ILE C CB  1 
ATOM   6691 C CG1 . ILE C 1 276 ? 24.529  -11.991 100.640 1.00 64.42  ? 275  ILE C CG1 1 
ATOM   6692 C CG2 . ILE C 1 276 ? 23.733  -13.353 102.584 1.00 64.02  ? 275  ILE C CG2 1 
ATOM   6693 C CD1 . ILE C 1 276 ? 24.510  -13.191 99.718  1.00 62.52  ? 275  ILE C CD1 1 
ATOM   6694 N N   . SER C 1 277 ? 23.260  -9.406  101.985 1.00 66.48  ? 276  SER C N   1 
ATOM   6695 C CA  . SER C 1 277 ? 21.990  -8.740  101.729 1.00 66.77  ? 276  SER C CA  1 
ATOM   6696 C C   . SER C 1 277 ? 21.140  -9.681  100.887 1.00 67.81  ? 276  SER C C   1 
ATOM   6697 O O   . SER C 1 277 ? 21.671  -10.498 100.132 1.00 68.46  ? 276  SER C O   1 
ATOM   6698 C CB  . SER C 1 277 ? 22.198  -7.430  100.962 1.00 66.14  ? 276  SER C CB  1 
ATOM   6699 O OG  . SER C 1 277 ? 22.223  -7.651  99.560  1.00 65.53  ? 276  SER C OG  1 
ATOM   6700 N N   . ALA C 1 278 ? 19.823  -9.559  101.021 1.00 67.87  ? 277  ALA C N   1 
ATOM   6701 C CA  . ALA C 1 278 ? 18.886  -10.389 100.274 1.00 67.36  ? 277  ALA C CA  1 
ATOM   6702 C C   . ALA C 1 278 ? 19.004  -10.098 98.781  1.00 67.59  ? 277  ALA C C   1 
ATOM   6703 O O   . ALA C 1 278 ? 18.923  -11.000 97.946  1.00 66.93  ? 277  ALA C O   1 
ATOM   6704 C CB  . ALA C 1 278 ? 17.466  -10.120 100.753 1.00 67.52  ? 277  ALA C CB  1 
ATOM   6705 N N   . LYS C 1 279 ? 19.185  -8.826  98.452  1.00 68.40  ? 278  LYS C N   1 
ATOM   6706 C CA  . LYS C 1 279 ? 19.326  -8.414  97.067  1.00 69.20  ? 278  LYS C CA  1 
ATOM   6707 C C   . LYS C 1 279 ? 20.584  -9.066  96.500  1.00 69.43  ? 278  LYS C C   1 
ATOM   6708 O O   . LYS C 1 279 ? 20.614  -9.496  95.344  1.00 68.58  ? 278  LYS C O   1 
ATOM   6709 C CB  . LYS C 1 279 ? 19.428  -6.888  96.992  1.00 70.73  ? 278  LYS C CB  1 
ATOM   6710 C CG  . LYS C 1 279 ? 19.892  -6.341  95.650  1.00 72.08  ? 278  LYS C CG  1 
ATOM   6711 C CD  . LYS C 1 279 ? 19.731  -4.827  95.572  1.00 74.06  ? 278  LYS C CD  1 
ATOM   6712 C CE  . LYS C 1 279 ? 20.472  -4.100  96.696  1.00 75.82  ? 278  LYS C CE  1 
ATOM   6713 N NZ  . LYS C 1 279 ? 20.391  -2.610  96.546  1.00 76.73  ? 278  LYS C NZ  1 
ATOM   6714 N N   . ALA C 1 280 ? 21.615  -9.154  97.332  1.00 69.46  ? 279  ALA C N   1 
ATOM   6715 C CA  . ALA C 1 280 ? 22.878  -9.752  96.920  1.00 70.31  ? 279  ALA C CA  1 
ATOM   6716 C C   . ALA C 1 280 ? 22.843  -11.278 96.966  1.00 70.50  ? 279  ALA C C   1 
ATOM   6717 O O   . ALA C 1 280 ? 23.712  -11.945 96.403  1.00 71.14  ? 279  ALA C O   1 
ATOM   6718 C CB  . ALA C 1 280 ? 24.008  -9.230  97.795  1.00 70.12  ? 279  ALA C CB  1 
ATOM   6719 N N   . ALA C 1 281 ? 21.840  -11.836 97.630  1.00 70.32  ? 280  ALA C N   1 
ATOM   6720 C CA  . ALA C 1 281 ? 21.740  -13.284 97.724  1.00 69.98  ? 280  ALA C CA  1 
ATOM   6721 C C   . ALA C 1 281 ? 21.043  -13.849 96.500  1.00 69.29  ? 280  ALA C C   1 
ATOM   6722 O O   . ALA C 1 281 ? 21.154  -15.035 96.204  1.00 69.06  ? 280  ALA C O   1 
ATOM   6723 C CB  . ALA C 1 281 ? 20.987  -13.680 98.988  1.00 71.01  ? 280  ALA C CB  1 
ATOM   6724 N N   . LEU C 1 282 ? 20.326  -12.989 95.789  1.00 68.92  ? 281  LEU C N   1 
ATOM   6725 C CA  . LEU C 1 282 ? 19.606  -13.404 94.596  1.00 69.48  ? 281  LEU C CA  1 
ATOM   6726 C C   . LEU C 1 282 ? 20.562  -13.715 93.453  1.00 71.18  ? 281  LEU C C   1 
ATOM   6727 O O   . LEU C 1 282 ? 20.204  -14.416 92.502  1.00 71.71  ? 281  LEU C O   1 
ATOM   6728 C CB  . LEU C 1 282 ? 18.632  -12.307 94.181  1.00 69.55  ? 281  LEU C CB  1 
ATOM   6729 C CG  . LEU C 1 282 ? 17.394  -12.208 95.068  1.00 68.77  ? 281  LEU C CG  1 
ATOM   6730 C CD1 . LEU C 1 282 ? 17.002  -10.758 95.259  1.00 69.04  ? 281  LEU C CD1 1 
ATOM   6731 C CD2 . LEU C 1 282 ? 16.270  -13.020 94.443  1.00 68.55  ? 281  LEU C CD2 1 
ATOM   6732 N N   . ALA C 1 283 ? 21.782  -13.194 93.551  1.00 71.80  ? 282  ALA C N   1 
ATOM   6733 C CA  . ALA C 1 283 ? 22.786  -13.426 92.522  1.00 71.71  ? 282  ALA C CA  1 
ATOM   6734 C C   . ALA C 1 283 ? 23.808  -14.458 92.982  1.00 71.97  ? 282  ALA C C   1 
ATOM   6735 O O   . ALA C 1 283 ? 25.004  -14.315 92.735  1.00 72.22  ? 282  ALA C O   1 
ATOM   6736 C CB  . ALA C 1 283 ? 23.482  -12.122 92.169  1.00 71.46  ? 282  ALA C CB  1 
ATOM   6737 N N   . HIS C 1 284 ? 23.334  -15.500 93.654  1.00 71.75  ? 283  HIS C N   1 
ATOM   6738 C CA  . HIS C 1 284 ? 24.224  -16.547 94.134  1.00 71.79  ? 283  HIS C CA  1 
ATOM   6739 C C   . HIS C 1 284 ? 24.114  -17.751 93.210  1.00 72.39  ? 283  HIS C C   1 
ATOM   6740 O O   . HIS C 1 284 ? 23.007  -18.228 92.929  1.00 71.73  ? 283  HIS C O   1 
ATOM   6741 C CB  . HIS C 1 284 ? 23.859  -16.949 95.564  1.00 70.81  ? 283  HIS C CB  1 
ATOM   6742 C CG  . HIS C 1 284 ? 24.930  -17.730 96.263  1.00 70.28  ? 283  HIS C CG  1 
ATOM   6743 N ND1 . HIS C 1 284 ? 25.222  -19.041 95.953  1.00 70.09  ? 283  HIS C ND1 1 
ATOM   6744 C CD2 . HIS C 1 284 ? 25.788  -17.376 97.249  1.00 69.24  ? 283  HIS C CD2 1 
ATOM   6745 C CE1 . HIS C 1 284 ? 26.211  -19.462 96.722  1.00 68.53  ? 283  HIS C CE1 1 
ATOM   6746 N NE2 . HIS C 1 284 ? 26.573  -18.471 97.517  1.00 68.61  ? 283  HIS C NE2 1 
ATOM   6747 N N   . PRO C 1 285 ? 25.266  -18.257 92.724  1.00 72.47  ? 284  PRO C N   1 
ATOM   6748 C CA  . PRO C 1 285 ? 25.311  -19.411 91.820  1.00 72.21  ? 284  PRO C CA  1 
ATOM   6749 C C   . PRO C 1 285 ? 24.357  -20.514 92.235  1.00 72.19  ? 284  PRO C C   1 
ATOM   6750 O O   . PRO C 1 285 ? 23.866  -21.277 91.403  1.00 72.32  ? 284  PRO C O   1 
ATOM   6751 C CB  . PRO C 1 285 ? 26.781  -19.842 91.868  1.00 72.40  ? 284  PRO C CB  1 
ATOM   6752 C CG  . PRO C 1 285 ? 27.276  -19.281 93.175  1.00 72.70  ? 284  PRO C CG  1 
ATOM   6753 C CD  . PRO C 1 285 ? 26.618  -17.933 93.205  1.00 72.23  ? 284  PRO C CD  1 
ATOM   6754 N N   . PHE C 1 286 ? 24.081  -20.587 93.529  1.00 71.78  ? 285  PHE C N   1 
ATOM   6755 C CA  . PHE C 1 286 ? 23.170  -21.599 94.029  1.00 71.66  ? 285  PHE C CA  1 
ATOM   6756 C C   . PHE C 1 286 ? 21.838  -21.502 93.281  1.00 71.73  ? 285  PHE C C   1 
ATOM   6757 O O   . PHE C 1 286 ? 21.083  -22.473 93.213  1.00 71.58  ? 285  PHE C O   1 
ATOM   6758 C CB  . PHE C 1 286 ? 22.961  -21.405 95.535  1.00 71.60  ? 285  PHE C CB  1 
ATOM   6759 C CG  . PHE C 1 286 ? 21.891  -22.281 96.119  1.00 71.65  ? 285  PHE C CG  1 
ATOM   6760 C CD1 . PHE C 1 286 ? 21.899  -23.655 95.901  1.00 71.52  ? 285  PHE C CD1 1 
ATOM   6761 C CD2 . PHE C 1 286 ? 20.882  -21.734 96.899  1.00 70.50  ? 285  PHE C CD2 1 
ATOM   6762 C CE1 . PHE C 1 286 ? 20.917  -24.471 96.453  1.00 71.74  ? 285  PHE C CE1 1 
ATOM   6763 C CE2 . PHE C 1 286 ? 19.897  -22.542 97.454  1.00 71.37  ? 285  PHE C CE2 1 
ATOM   6764 C CZ  . PHE C 1 286 ? 19.913  -23.913 97.231  1.00 71.52  ? 285  PHE C CZ  1 
ATOM   6765 N N   . PHE C 1 287 ? 21.579  -20.336 92.689  1.00 71.48  ? 286  PHE C N   1 
ATOM   6766 C CA  . PHE C 1 287 ? 20.328  -20.089 91.972  1.00 71.60  ? 286  PHE C CA  1 
ATOM   6767 C C   . PHE C 1 287 ? 20.331  -20.171 90.441  1.00 73.10  ? 286  PHE C C   1 
ATOM   6768 O O   . PHE C 1 287 ? 19.270  -20.068 89.826  1.00 74.00  ? 286  PHE C O   1 
ATOM   6769 C CB  . PHE C 1 287 ? 19.771  -18.718 92.371  1.00 67.81  ? 286  PHE C CB  1 
ATOM   6770 C CG  . PHE C 1 287 ? 19.271  -18.649 93.786  1.00 64.19  ? 286  PHE C CG  1 
ATOM   6771 C CD1 . PHE C 1 287 ? 18.181  -19.407 94.190  1.00 63.14  ? 286  PHE C CD1 1 
ATOM   6772 C CD2 . PHE C 1 287 ? 19.888  -17.819 94.713  1.00 62.31  ? 286  PHE C CD2 1 
ATOM   6773 C CE1 . PHE C 1 287 ? 17.714  -19.336 95.497  1.00 61.90  ? 286  PHE C CE1 1 
ATOM   6774 C CE2 . PHE C 1 287 ? 19.428  -17.743 96.021  1.00 60.59  ? 286  PHE C CE2 1 
ATOM   6775 C CZ  . PHE C 1 287 ? 18.341  -18.501 96.414  1.00 60.32  ? 286  PHE C CZ  1 
ATOM   6776 N N   . GLN C 1 288 ? 21.487  -20.367 89.814  1.00 75.12  ? 287  GLN C N   1 
ATOM   6777 C CA  . GLN C 1 288 ? 21.518  -20.411 88.351  1.00 76.69  ? 287  GLN C CA  1 
ATOM   6778 C C   . GLN C 1 288 ? 20.707  -21.491 87.646  1.00 76.65  ? 287  GLN C C   1 
ATOM   6779 O O   . GLN C 1 288 ? 20.570  -21.449 86.425  1.00 76.90  ? 287  GLN C O   1 
ATOM   6780 C CB  . GLN C 1 288 ? 22.961  -20.451 87.844  1.00 78.26  ? 287  GLN C CB  1 
ATOM   6781 C CG  . GLN C 1 288 ? 23.910  -21.239 88.705  1.00 80.74  ? 287  GLN C CG  1 
ATOM   6782 C CD  . GLN C 1 288 ? 25.296  -20.615 88.726  1.00 82.68  ? 287  GLN C CD  1 
ATOM   6783 O OE1 . GLN C 1 288 ? 25.434  -19.402 88.900  1.00 81.99  ? 287  GLN C OE1 1 
ATOM   6784 N NE2 . GLN C 1 288 ? 26.331  -21.442 88.558  1.00 83.32  ? 287  GLN C NE2 1 
ATOM   6785 N N   . ASP C 1 289 ? 20.156  -22.445 88.388  1.00 76.22  ? 288  ASP C N   1 
ATOM   6786 C CA  . ASP C 1 289 ? 19.367  -23.494 87.750  1.00 76.50  ? 288  ASP C CA  1 
ATOM   6787 C C   . ASP C 1 289 ? 17.895  -23.532 88.162  1.00 76.63  ? 288  ASP C C   1 
ATOM   6788 O O   . ASP C 1 289 ? 17.053  -24.035 87.417  1.00 77.53  ? 288  ASP C O   1 
ATOM   6789 C CB  . ASP C 1 289 ? 20.021  -24.863 87.987  1.00 76.40  ? 288  ASP C CB  1 
ATOM   6790 C CG  . ASP C 1 289 ? 20.544  -25.031 89.401  1.00 76.12  ? 288  ASP C CG  1 
ATOM   6791 O OD1 . ASP C 1 289 ? 19.729  -25.233 90.326  1.00 74.76  ? 288  ASP C OD1 1 
ATOM   6792 O OD2 . ASP C 1 289 ? 21.779  -24.954 89.582  1.00 76.24  ? 288  ASP C OD2 1 
ATOM   6793 N N   . VAL C 1 290 ? 17.594  -22.981 89.336  1.00 75.72  ? 289  VAL C N   1 
ATOM   6794 C CA  . VAL C 1 290 ? 16.235  -22.945 89.885  1.00 73.99  ? 289  VAL C CA  1 
ATOM   6795 C C   . VAL C 1 290 ? 15.095  -22.845 88.864  1.00 72.49  ? 289  VAL C C   1 
ATOM   6796 O O   . VAL C 1 290 ? 15.224  -22.197 87.828  1.00 72.23  ? 289  VAL C O   1 
ATOM   6797 C CB  . VAL C 1 290 ? 16.093  -21.769 90.892  1.00 74.39  ? 289  VAL C CB  1 
ATOM   6798 C CG1 . VAL C 1 290 ? 16.391  -20.446 90.198  1.00 72.04  ? 289  VAL C CG1 1 
ATOM   6799 C CG2 . VAL C 1 290 ? 14.698  -21.760 91.498  1.00 73.05  ? 289  VAL C CG2 1 
ATOM   6800 N N   . THR C 1 291 ? 13.981  -23.502 89.173  1.00 71.97  ? 290  THR C N   1 
ATOM   6801 C CA  . THR C 1 291 ? 12.792  -23.483 88.321  1.00 71.33  ? 290  THR C CA  1 
ATOM   6802 C C   . THR C 1 291 ? 11.627  -23.033 89.195  1.00 70.27  ? 290  THR C C   1 
ATOM   6803 O O   . THR C 1 291 ? 11.771  -22.156 90.044  1.00 69.90  ? 290  THR C O   1 
ATOM   6804 C CB  . THR C 1 291 ? 12.430  -24.888 87.778  1.00 72.21  ? 290  THR C CB  1 
ATOM   6805 O OG1 . THR C 1 291 ? 13.619  -25.588 87.402  1.00 73.57  ? 290  THR C OG1 1 
ATOM   6806 C CG2 . THR C 1 291 ? 11.516  -24.765 86.556  1.00 72.56  ? 290  THR C CG2 1 
ATOM   6807 N N   . LYS C 1 292 ? 10.474  -23.654 88.980  1.00 69.65  ? 291  LYS C N   1 
ATOM   6808 C CA  . LYS C 1 292 ? 9.281   -23.358 89.749  1.00 69.39  ? 291  LYS C CA  1 
ATOM   6809 C C   . LYS C 1 292 ? 8.392   -24.594 89.760  1.00 69.23  ? 291  LYS C C   1 
ATOM   6810 O O   . LYS C 1 292 ? 7.325   -24.618 89.151  1.00 69.66  ? 291  LYS C O   1 
ATOM   6811 C CB  . LYS C 1 292 ? 8.533   -22.162 89.150  1.00 69.26  ? 291  LYS C CB  1 
ATOM   6812 C CG  . LYS C 1 292 ? 7.192   -21.877 89.817  1.00 69.42  ? 291  LYS C CG  1 
ATOM   6813 C CD  . LYS C 1 292 ? 6.686   -20.469 89.534  1.00 69.84  ? 291  LYS C CD  1 
ATOM   6814 C CE  . LYS C 1 292 ? 5.266   -20.294 90.056  1.00 69.81  ? 291  LYS C CE  1 
ATOM   6815 N NZ  . LYS C 1 292 ? 4.768   -18.904 89.898  1.00 70.59  ? 291  LYS C NZ  1 
ATOM   6816 N N   . PRO C 1 293 ? 8.833   -25.650 90.455  1.00 69.12  ? 292  PRO C N   1 
ATOM   6817 C CA  . PRO C 1 293 ? 8.054   -26.886 90.529  1.00 69.86  ? 292  PRO C CA  1 
ATOM   6818 C C   . PRO C 1 293 ? 6.860   -26.764 91.470  1.00 70.86  ? 292  PRO C C   1 
ATOM   6819 O O   . PRO C 1 293 ? 6.893   -25.990 92.423  1.00 71.55  ? 292  PRO C O   1 
ATOM   6820 C CB  . PRO C 1 293 ? 9.081   -27.896 91.024  1.00 68.89  ? 292  PRO C CB  1 
ATOM   6821 C CG  . PRO C 1 293 ? 9.913   -27.076 91.948  1.00 68.08  ? 292  PRO C CG  1 
ATOM   6822 C CD  . PRO C 1 293 ? 10.117  -25.797 91.165  1.00 68.82  ? 292  PRO C CD  1 
ATOM   6823 N N   . VAL C 1 294 ? 5.802   -27.516 91.188  1.00 72.29  ? 293  VAL C N   1 
ATOM   6824 C CA  . VAL C 1 294 ? 4.616   -27.506 92.037  1.00 73.32  ? 293  VAL C CA  1 
ATOM   6825 C C   . VAL C 1 294 ? 4.939   -28.377 93.243  1.00 73.68  ? 293  VAL C C   1 
ATOM   6826 O O   . VAL C 1 294 ? 5.736   -29.307 93.146  1.00 73.60  ? 293  VAL C O   1 
ATOM   6827 C CB  . VAL C 1 294 ? 3.379   -28.088 91.301  1.00 73.59  ? 293  VAL C CB  1 
ATOM   6828 C CG1 . VAL C 1 294 ? 2.256   -28.384 92.293  1.00 73.39  ? 293  VAL C CG1 1 
ATOM   6829 C CG2 . VAL C 1 294 ? 2.894   -27.101 90.249  1.00 74.18  ? 293  VAL C CG2 1 
ATOM   6830 N N   . PRO C 1 295 ? 4.340   -28.076 94.403  1.00 74.41  ? 294  PRO C N   1 
ATOM   6831 C CA  . PRO C 1 295 ? 4.621   -28.884 95.590  1.00 74.62  ? 294  PRO C CA  1 
ATOM   6832 C C   . PRO C 1 295 ? 3.702   -30.082 95.806  1.00 75.35  ? 294  PRO C C   1 
ATOM   6833 O O   . PRO C 1 295 ? 2.736   -30.305 95.071  1.00 74.51  ? 294  PRO C O   1 
ATOM   6834 C CB  . PRO C 1 295 ? 4.506   -27.871 96.715  1.00 73.86  ? 294  PRO C CB  1 
ATOM   6835 C CG  . PRO C 1 295 ? 3.368   -27.037 96.246  1.00 73.94  ? 294  PRO C CG  1 
ATOM   6836 C CD  . PRO C 1 295 ? 3.691   -26.809 94.782  1.00 73.58  ? 294  PRO C CD  1 
ATOM   6837 N N   . HIS C 1 296 ? 4.028   -30.833 96.850  1.00 77.48  ? 295  HIS C N   1 
ATOM   6838 C CA  . HIS C 1 296 ? 3.305   -32.031 97.268  1.00 79.00  ? 295  HIS C CA  1 
ATOM   6839 C C   . HIS C 1 296 ? 1.781   -31.885 97.303  1.00 79.53  ? 295  HIS C C   1 
ATOM   6840 O O   . HIS C 1 296 ? 1.066   -32.885 97.256  1.00 80.55  ? 295  HIS C O   1 
ATOM   6841 C CB  . HIS C 1 296 ? 3.776   -32.434 98.667  1.00 79.30  ? 295  HIS C CB  1 
ATOM   6842 C CG  . HIS C 1 296 ? 4.075   -33.890 98.813  1.00 80.21  ? 295  HIS C CG  1 
ATOM   6843 N ND1 . HIS C 1 296 ? 5.313   -34.426 98.527  1.00 80.61  ? 295  HIS C ND1 1 
ATOM   6844 C CD2 . HIS C 1 296 ? 3.295   -34.926 99.200  1.00 80.44  ? 295  HIS C CD2 1 
ATOM   6845 C CE1 . HIS C 1 296 ? 5.283   -35.730 98.734  1.00 81.12  ? 295  HIS C CE1 1 
ATOM   6846 N NE2 . HIS C 1 296 ? 4.069   -36.059 99.142  1.00 82.04  ? 295  HIS C NE2 1 
ATOM   6847 N N   . LEU C 1 297 ? 1.288   -30.650 97.397  1.00 79.45  ? 296  LEU C N   1 
ATOM   6848 C CA  . LEU C 1 297 ? -0.150  -30.397 97.482  1.00 79.04  ? 296  LEU C CA  1 
ATOM   6849 C C   . LEU C 1 297 ? -0.975  -31.193 96.489  1.00 80.42  ? 296  LEU C C   1 
ATOM   6850 O O   . LEU C 1 297 ? -0.375  -31.854 95.610  1.00 81.98  ? 296  LEU C O   1 
ATOM   6851 C CB  . LEU C 1 297 ? -0.450  -28.905 97.303  1.00 77.10  ? 296  LEU C CB  1 
ATOM   6852 C CG  . LEU C 1 297 ? 0.193   -27.935 98.297  1.00 75.48  ? 296  LEU C CG  1 
ATOM   6853 C CD1 . LEU C 1 297 ? -0.481  -26.575 98.184  1.00 74.21  ? 296  LEU C CD1 1 
ATOM   6854 C CD2 . LEU C 1 297 ? 0.056   -28.474 99.714  1.00 75.33  ? 296  LEU C CD2 1 
ATOM   6855 O OXT . LEU C 1 297 ? -2.219  -31.135 96.612  1.00 81.37  ? 296  LEU C OXT 1 
ATOM   6856 N N   . VAL D 2 1   ? 25.784  -0.627  106.421 1.00 92.28  ? 175  VAL D N   1 
ATOM   6857 C CA  . VAL D 2 1   ? 25.203  -1.592  105.437 1.00 93.04  ? 175  VAL D CA  1 
ATOM   6858 C C   . VAL D 2 1   ? 24.383  -0.834  104.379 1.00 92.86  ? 175  VAL D C   1 
ATOM   6859 O O   . VAL D 2 1   ? 23.174  -1.040  104.252 1.00 93.46  ? 175  VAL D O   1 
ATOM   6860 C CB  . VAL D 2 1   ? 24.276  -2.615  106.154 1.00 93.44  ? 175  VAL D CB  1 
ATOM   6861 C CG1 . VAL D 2 1   ? 23.953  -3.778  105.226 1.00 92.58  ? 175  VAL D CG1 1 
ATOM   6862 C CG2 . VAL D 2 1   ? 24.935  -3.110  107.437 1.00 93.16  ? 175  VAL D CG2 1 
ATOM   6863 N N   . PRO D 2 2   ? 25.036  0.048   103.601 1.00 92.35  ? 176  PRO D N   1 
ATOM   6864 C CA  . PRO D 2 2   ? 24.348  0.829   102.565 1.00 91.52  ? 176  PRO D CA  1 
ATOM   6865 C C   . PRO D 2 2   ? 23.871  0.073   101.314 1.00 90.59  ? 176  PRO D C   1 
ATOM   6866 O O   . PRO D 2 2   ? 23.883  0.621   100.211 1.00 90.07  ? 176  PRO D O   1 
ATOM   6867 C CB  . PRO D 2 2   ? 25.365  1.922   102.238 1.00 91.69  ? 176  PRO D CB  1 
ATOM   6868 C CG  . PRO D 2 2   ? 26.667  1.212   102.402 1.00 91.94  ? 176  PRO D CG  1 
ATOM   6869 C CD  . PRO D 2 2   ? 26.456  0.440   103.692 1.00 92.40  ? 176  PRO D CD  1 
ATOM   6870 N N   . ASP D 2 3   ? 23.440  -1.174  101.486 1.00 89.93  ? 177  ASP D N   1 
ATOM   6871 C CA  . ASP D 2 3   ? 22.950  -1.977  100.361 1.00 88.65  ? 177  ASP D CA  1 
ATOM   6872 C C   . ASP D 2 3   ? 21.777  -1.311  99.636  1.00 87.30  ? 177  ASP D C   1 
ATOM   6873 O O   . ASP D 2 3   ? 21.813  -1.106  98.420  1.00 87.48  ? 177  ASP D O   1 
ATOM   6874 C CB  . ASP D 2 3   ? 22.477  -3.358  100.841 1.00 89.52  ? 177  ASP D CB  1 
ATOM   6875 C CG  . ASP D 2 3   ? 23.619  -4.299  101.181 1.00 89.53  ? 177  ASP D CG  1 
ATOM   6876 O OD1 . ASP D 2 3   ? 24.364  -4.704  100.260 1.00 89.21  ? 177  ASP D OD1 1 
ATOM   6877 O OD2 . ASP D 2 3   ? 23.761  -4.640  102.374 1.00 89.80  ? 177  ASP D OD2 1 
ATOM   6878 N N   . TYR D 2 4   ? 20.741  -0.979  100.405 1.00 85.03  ? 178  TYR D N   1 
ATOM   6879 C CA  . TYR D 2 4   ? 19.513  -0.385  99.881  1.00 81.87  ? 178  TYR D CA  1 
ATOM   6880 C C   . TYR D 2 4   ? 19.396  1.127   99.984  1.00 80.30  ? 178  TYR D C   1 
ATOM   6881 O O   . TYR D 2 4   ? 18.482  1.720   99.414  1.00 79.33  ? 178  TYR D O   1 
ATOM   6882 C CB  . TYR D 2 4   ? 18.329  -1.030  100.588 1.00 81.60  ? 178  TYR D CB  1 
ATOM   6883 C CG  . TYR D 2 4   ? 18.337  -2.523  100.438 1.00 81.84  ? 178  TYR D CG  1 
ATOM   6884 C CD1 . TYR D 2 4   ? 17.796  -3.127  99.303  1.00 82.33  ? 178  TYR D CD1 1 
ATOM   6885 C CD2 . TYR D 2 4   ? 18.957  -3.334  101.389 1.00 82.16  ? 178  TYR D CD2 1 
ATOM   6886 C CE1 . TYR D 2 4   ? 17.874  -4.505  99.110  1.00 82.11  ? 178  TYR D CE1 1 
ATOM   6887 C CE2 . TYR D 2 4   ? 19.044  -4.718  101.207 1.00 82.62  ? 178  TYR D CE2 1 
ATOM   6888 C CZ  . TYR D 2 4   ? 18.500  -5.294  100.063 1.00 81.91  ? 178  TYR D CZ  1 
ATOM   6889 O OH  . TYR D 2 4   ? 18.594  -6.651  99.864  1.00 81.70  ? 178  TYR D OH  1 
ATOM   6890 N N   . HIS D 2 5   ? 20.314  1.744   100.716 1.00 79.26  ? 179  HIS D N   1 
ATOM   6891 C CA  . HIS D 2 5   ? 20.314  3.191   100.895 1.00 78.60  ? 179  HIS D CA  1 
ATOM   6892 C C   . HIS D 2 5   ? 19.737  3.983   99.727  1.00 77.46  ? 179  HIS D C   1 
ATOM   6893 O O   . HIS D 2 5   ? 18.886  4.850   99.927  1.00 78.12  ? 179  HIS D O   1 
ATOM   6894 C CB  . HIS D 2 5   ? 21.732  3.683   101.190 1.00 79.45  ? 179  HIS D CB  1 
ATOM   6895 C CG  . HIS D 2 5   ? 22.107  3.606   102.636 1.00 80.54  ? 179  HIS D CG  1 
ATOM   6896 N ND1 . HIS D 2 5   ? 21.914  2.473   103.397 1.00 81.23  ? 179  HIS D ND1 1 
ATOM   6897 C CD2 . HIS D 2 5   ? 22.666  4.522   103.462 1.00 81.54  ? 179  HIS D CD2 1 
ATOM   6898 C CE1 . HIS D 2 5   ? 22.337  2.693   104.629 1.00 81.57  ? 179  HIS D CE1 1 
ATOM   6899 N NE2 . HIS D 2 5   ? 22.798  3.930   104.695 1.00 83.07  ? 179  HIS D NE2 1 
ATOM   6900 N N   . GLU D 2 6   ? 20.186  3.692   98.510  1.00 75.45  ? 180  GLU D N   1 
ATOM   6901 C CA  . GLU D 2 6   ? 19.690  4.429   97.351  1.00 73.79  ? 180  GLU D CA  1 
ATOM   6902 C C   . GLU D 2 6   ? 18.339  3.973   96.812  1.00 71.19  ? 180  GLU D C   1 
ATOM   6903 O O   . GLU D 2 6   ? 17.572  4.788   96.290  1.00 69.98  ? 180  GLU D O   1 
ATOM   6904 C CB  . GLU D 2 6   ? 20.742  4.435   96.240  1.00 74.86  ? 180  GLU D CB  1 
ATOM   6905 C CG  . GLU D 2 6   ? 21.976  5.235   96.636  1.00 77.12  ? 180  GLU D CG  1 
ATOM   6906 C CD  . GLU D 2 6   ? 21.611  6.572   97.287  1.00 78.04  ? 180  GLU D CD  1 
ATOM   6907 O OE1 . GLU D 2 6   ? 21.104  7.473   96.577  1.00 77.74  ? 180  GLU D OE1 1 
ATOM   6908 O OE2 . GLU D 2 6   ? 21.822  6.714   98.513  1.00 78.30  ? 180  GLU D OE2 1 
ATOM   6909 N N   . ASP D 2 7   ? 18.048  2.680   96.929  1.00 68.84  ? 181  ASP D N   1 
ATOM   6910 C CA  . ASP D 2 7   ? 16.760  2.157   96.475  1.00 66.03  ? 181  ASP D CA  1 
ATOM   6911 C C   . ASP D 2 7   ? 15.720  2.889   97.319  1.00 63.30  ? 181  ASP D C   1 
ATOM   6912 O O   . ASP D 2 7   ? 14.719  3.383   96.812  1.00 62.85  ? 181  ASP D O   1 
ATOM   6913 C CB  . ASP D 2 7   ? 16.664  0.651   96.744  1.00 67.28  ? 181  ASP D CB  1 
ATOM   6914 C CG  . ASP D 2 7   ? 17.760  -0.141  96.057  1.00 68.35  ? 181  ASP D CG  1 
ATOM   6915 O OD1 . ASP D 2 7   ? 17.655  -0.346  94.829  1.00 68.95  ? 181  ASP D OD1 1 
ATOM   6916 O OD2 . ASP D 2 7   ? 18.724  -0.554  96.745  1.00 68.81  ? 181  ASP D OD2 1 
ATOM   6917 N N   . ILE D 2 8   ? 15.994  2.945   98.619  1.00 61.63  ? 182  ILE D N   1 
ATOM   6918 C CA  . ILE D 2 8   ? 15.149  3.613   99.602  1.00 59.78  ? 182  ILE D CA  1 
ATOM   6919 C C   . ILE D 2 8   ? 14.945  5.067   99.189  1.00 59.33  ? 182  ILE D C   1 
ATOM   6920 O O   . ILE D 2 8   ? 13.818  5.545   99.039  1.00 60.15  ? 182  ILE D O   1 
ATOM   6921 C CB  . ILE D 2 8   ? 15.834  3.610   100.995 1.00 59.54  ? 182  ILE D CB  1 
ATOM   6922 C CG1 . ILE D 2 8   ? 16.179  2.170   101.413 1.00 58.65  ? 182  ILE D CG1 1 
ATOM   6923 C CG2 . ILE D 2 8   ? 14.965  4.347   102.006 1.00 57.11  ? 182  ILE D CG2 1 
ATOM   6924 C CD1 . ILE D 2 8   ? 15.260  1.549   102.460 1.00 57.82  ? 182  ILE D CD1 1 
ATOM   6925 N N   . HIS D 2 9   ? 16.062  5.762   99.009  1.00 59.75  ? 183  HIS D N   1 
ATOM   6926 C CA  . HIS D 2 9   ? 16.058  7.165   98.628  1.00 58.43  ? 183  HIS D CA  1 
ATOM   6927 C C   . HIS D 2 9   ? 15.205  7.422   97.391  1.00 57.42  ? 183  HIS D C   1 
ATOM   6928 O O   . HIS D 2 9   ? 14.435  8.378   97.353  1.00 58.08  ? 183  HIS D O   1 
ATOM   6929 C CB  . HIS D 2 9   ? 17.490  7.647   98.375  1.00 57.57  ? 183  HIS D CB  1 
ATOM   6930 C CG  . HIS D 2 9   ? 17.586  9.116   98.108  1.00 58.91  ? 183  HIS D CG  1 
ATOM   6931 N ND1 . HIS D 2 9   ? 17.533  10.059  99.112  1.00 58.75  ? 183  HIS D ND1 1 
ATOM   6932 C CD2 . HIS D 2 9   ? 17.669  9.807   96.947  1.00 59.02  ? 183  HIS D CD2 1 
ATOM   6933 C CE1 . HIS D 2 9   ? 17.578  11.268  98.580  1.00 59.23  ? 183  HIS D CE1 1 
ATOM   6934 N NE2 . HIS D 2 9   ? 17.660  11.143  97.268  1.00 59.13  ? 183  HIS D NE2 1 
ATOM   6935 N N   . THR D 2 10  ? 15.344  6.581   96.374  1.00 56.23  ? 184  THR D N   1 
ATOM   6936 C CA  . THR D 2 10  ? 14.557  6.767   95.164  1.00 57.75  ? 184  THR D CA  1 
ATOM   6937 C C   . THR D 2 10  ? 13.081  6.529   95.461  1.00 58.95  ? 184  THR D C   1 
ATOM   6938 O O   . THR D 2 10  ? 12.210  7.206   94.901  1.00 59.45  ? 184  THR D O   1 
ATOM   6939 C CB  . THR D 2 10  ? 15.029  5.822   94.030  1.00 58.12  ? 184  THR D CB  1 
ATOM   6940 O OG1 . THR D 2 10  ? 16.291  6.283   93.532  1.00 61.38  ? 184  THR D OG1 1 
ATOM   6941 C CG2 . THR D 2 10  ? 14.031  5.795   92.883  1.00 56.23  ? 184  THR D CG2 1 
ATOM   6942 N N   . TYR D 2 11  ? 12.793  5.576   96.346  1.00 57.94  ? 185  TYR D N   1 
ATOM   6943 C CA  . TYR D 2 11  ? 11.404  5.306   96.691  1.00 57.50  ? 185  TYR D CA  1 
ATOM   6944 C C   . TYR D 2 11  ? 10.800  6.507   97.406  1.00 57.03  ? 185  TYR D C   1 
ATOM   6945 O O   . TYR D 2 11  ? 9.752   7.008   97.003  1.00 56.63  ? 185  TYR D O   1 
ATOM   6946 C CB  . TYR D 2 11  ? 11.262  4.069   97.589  1.00 56.43  ? 185  TYR D CB  1 
ATOM   6947 C CG  . TYR D 2 11  ? 9.805   3.708   97.850  1.00 53.28  ? 185  TYR D CG  1 
ATOM   6948 C CD1 . TYR D 2 11  ? 8.918   3.541   96.787  1.00 51.67  ? 185  TYR D CD1 1 
ATOM   6949 C CD2 . TYR D 2 11  ? 9.317   3.535   99.148  1.00 51.30  ? 185  TYR D CD2 1 
ATOM   6950 C CE1 . TYR D 2 11  ? 7.585   3.211   97.001  1.00 51.11  ? 185  TYR D CE1 1 
ATOM   6951 C CE2 . TYR D 2 11  ? 7.978   3.201   99.376  1.00 49.99  ? 185  TYR D CE2 1 
ATOM   6952 C CZ  . TYR D 2 11  ? 7.118   3.040   98.294  1.00 51.21  ? 185  TYR D CZ  1 
ATOM   6953 O OH  . TYR D 2 11  ? 5.791   2.702   98.480  1.00 50.95  ? 185  TYR D OH  1 
ATOM   6954 N N   . LEU D 2 12  ? 11.457  6.964   98.469  1.00 56.27  ? 186  LEU D N   1 
ATOM   6955 C CA  . LEU D 2 12  ? 10.946  8.108   99.204  1.00 57.91  ? 186  LEU D CA  1 
ATOM   6956 C C   . LEU D 2 12  ? 10.580  9.225   98.233  1.00 59.72  ? 186  LEU D C   1 
ATOM   6957 O O   . LEU D 2 12  ? 9.531   9.850   98.367  1.00 60.22  ? 186  LEU D O   1 
ATOM   6958 C CB  . LEU D 2 12  ? 11.981  8.620   100.202 1.00 56.86  ? 186  LEU D CB  1 
ATOM   6959 C CG  . LEU D 2 12  ? 12.350  7.725   101.387 1.00 57.15  ? 186  LEU D CG  1 
ATOM   6960 C CD1 . LEU D 2 12  ? 13.398  8.434   102.234 1.00 56.19  ? 186  LEU D CD1 1 
ATOM   6961 C CD2 . LEU D 2 12  ? 11.121  7.422   102.225 1.00 55.99  ? 186  LEU D CD2 1 
ATOM   6962 N N   . ARG D 2 13  ? 11.443  9.452   97.244  1.00 61.38  ? 187  ARG D N   1 
ATOM   6963 C CA  . ARG D 2 13  ? 11.234  10.498  96.241  1.00 62.47  ? 187  ARG D CA  1 
ATOM   6964 C C   . ARG D 2 13  ? 9.962   10.352  95.400  1.00 63.50  ? 187  ARG D C   1 
ATOM   6965 O O   . ARG D 2 13  ? 9.243   11.333  95.183  1.00 63.51  ? 187  ARG D O   1 
ATOM   6966 C CB  . ARG D 2 13  ? 12.461  10.597  95.321  1.00 62.70  ? 187  ARG D CB  1 
ATOM   6967 C CG  . ARG D 2 13  ? 13.571  11.513  95.850  1.00 64.37  ? 187  ARG D CG  1 
ATOM   6968 C CD  . ARG D 2 13  ? 13.133  12.983  95.831  1.00 66.70  ? 187  ARG D CD  1 
ATOM   6969 N NE  . ARG D 2 13  ? 12.934  13.458  94.463  1.00 68.83  ? 187  ARG D NE  1 
ATOM   6970 C CZ  . ARG D 2 13  ? 13.903  13.948  93.693  1.00 69.84  ? 187  ARG D CZ  1 
ATOM   6971 N NH1 . ARG D 2 13  ? 15.143  14.044  94.164  1.00 68.63  ? 187  ARG D NH1 1 
ATOM   6972 N NH2 . ARG D 2 13  ? 13.636  14.314  92.441  1.00 68.65  ? 187  ARG D NH2 1 
ATOM   6973 N N   . GLU D 2 14  ? 9.675   9.147   94.917  1.00 65.02  ? 188  GLU D N   1 
ATOM   6974 C CA  . GLU D 2 14  ? 8.465   8.966   94.121  1.00 66.00  ? 188  GLU D CA  1 
ATOM   6975 C C   . GLU D 2 14  ? 7.253   9.147   95.020  1.00 63.75  ? 188  GLU D C   1 
ATOM   6976 O O   . GLU D 2 14  ? 6.249   9.730   94.614  1.00 63.73  ? 188  GLU D O   1 
ATOM   6977 C CB  . GLU D 2 14  ? 8.436   7.582   93.448  1.00 69.06  ? 188  GLU D CB  1 
ATOM   6978 C CG  . GLU D 2 14  ? 8.515   6.379   94.387  1.00 74.81  ? 188  GLU D CG  1 
ATOM   6979 C CD  . GLU D 2 14  ? 8.517   5.046   93.629  1.00 78.01  ? 188  GLU D CD  1 
ATOM   6980 O OE1 . GLU D 2 14  ? 9.323   4.916   92.678  1.00 80.05  ? 188  GLU D OE1 1 
ATOM   6981 O OE2 . GLU D 2 14  ? 7.728   4.134   93.984  1.00 78.02  ? 188  GLU D OE2 1 
ATOM   6982 N N   . MET D 2 15  ? 7.368   8.661   96.253  1.00 61.84  ? 189  MET D N   1 
ATOM   6983 C CA  . MET D 2 15  ? 6.288   8.759   97.230  1.00 60.24  ? 189  MET D CA  1 
ATOM   6984 C C   . MET D 2 15  ? 6.087   10.181  97.740  1.00 59.18  ? 189  MET D C   1 
ATOM   6985 O O   . MET D 2 15  ? 4.955   10.652  97.865  1.00 58.62  ? 189  MET D O   1 
ATOM   6986 C CB  . MET D 2 15  ? 6.563   7.820   98.403  1.00 59.18  ? 189  MET D CB  1 
ATOM   6987 C CG  . MET D 2 15  ? 6.467   6.350   98.032  1.00 59.80  ? 189  MET D CG  1 
ATOM   6988 S SD  . MET D 2 15  ? 4.837   5.945   97.343  1.00 61.05  ? 189  MET D SD  1 
ATOM   6989 C CE  . MET D 2 15  ? 3.801   6.201   98.811  1.00 59.69  ? 189  MET D CE  1 
ATOM   6990 N N   . GLU D 2 16  ? 7.193   10.856  98.038  1.00 59.30  ? 190  GLU D N   1 
ATOM   6991 C CA  . GLU D 2 16  ? 7.169   12.237  98.531  1.00 58.36  ? 190  GLU D CA  1 
ATOM   6992 C C   . GLU D 2 16  ? 6.297   13.146  97.672  1.00 56.53  ? 190  GLU D C   1 
ATOM   6993 O O   . GLU D 2 16  ? 5.778   14.152  98.141  1.00 55.81  ? 190  GLU D O   1 
ATOM   6994 C CB  . GLU D 2 16  ? 8.595   12.784  98.586  1.00 57.78  ? 190  GLU D CB  1 
ATOM   6995 C CG  . GLU D 2 16  ? 8.757   14.196  98.079  1.00 57.82  ? 190  GLU D CG  1 
ATOM   6996 C CD  . GLU D 2 16  ? 10.189  14.654  98.172  1.00 59.92  ? 190  GLU D CD  1 
ATOM   6997 O OE1 . GLU D 2 16  ? 10.626  14.999  99.293  1.00 59.50  ? 190  GLU D OE1 1 
ATOM   6998 O OE2 . GLU D 2 16  ? 10.880  14.647  97.124  1.00 61.19  ? 190  GLU D OE2 1 
ATOM   6999 N N   . VAL D 2 17  ? 6.137   12.772  96.412  1.00 57.00  ? 191  VAL D N   1 
ATOM   7000 C CA  . VAL D 2 17  ? 5.332   13.533  95.476  1.00 56.86  ? 191  VAL D CA  1 
ATOM   7001 C C   . VAL D 2 17  ? 3.876   13.076  95.482  1.00 57.21  ? 191  VAL D C   1 
ATOM   7002 O O   . VAL D 2 17  ? 2.994   13.798  95.022  1.00 57.42  ? 191  VAL D O   1 
ATOM   7003 C CB  . VAL D 2 17  ? 5.897   13.384  94.064  1.00 57.21  ? 191  VAL D CB  1 
ATOM   7004 C CG1 . VAL D 2 17  ? 5.038   14.151  93.072  1.00 57.66  ? 191  VAL D CG1 1 
ATOM   7005 C CG2 . VAL D 2 17  ? 7.347   13.860  94.046  1.00 54.40  ? 191  VAL D CG2 1 
ATOM   7006 N N   . LYS D 2 18  ? 3.631   11.878  96.008  1.00 58.46  ? 192  LYS D N   1 
ATOM   7007 C CA  . LYS D 2 18  ? 2.282   11.314  96.075  1.00 58.34  ? 192  LYS D CA  1 
ATOM   7008 C C   . LYS D 2 18  ? 1.564   11.640  97.382  1.00 58.90  ? 192  LYS D C   1 
ATOM   7009 O O   . LYS D 2 18  ? 0.380   11.962  97.370  1.00 59.71  ? 192  LYS D O   1 
ATOM   7010 C CB  . LYS D 2 18  ? 2.329   9.793   95.911  1.00 59.55  ? 192  LYS D CB  1 
ATOM   7011 C CG  . LYS D 2 18  ? 2.778   9.305   94.550  1.00 60.20  ? 192  LYS D CG  1 
ATOM   7012 C CD  . LYS D 2 18  ? 2.822   7.790   94.522  1.00 61.66  ? 192  LYS D CD  1 
ATOM   7013 C CE  . LYS D 2 18  ? 3.269   7.262   93.161  1.00 64.74  ? 192  LYS D CE  1 
ATOM   7014 N NZ  . LYS D 2 18  ? 3.461   5.772   93.158  1.00 64.50  ? 192  LYS D NZ  1 
ATOM   7015 N N   . CYS D 2 19  ? 2.273   11.541  98.504  1.00 59.16  ? 193  CYS D N   1 
ATOM   7016 C CA  . CYS D 2 19  ? 1.691   11.824  99.818  1.00 59.77  ? 193  CYS D CA  1 
ATOM   7017 C C   . CYS D 2 19  ? 1.756   13.314  100.136 1.00 60.60  ? 193  CYS D C   1 
ATOM   7018 O O   . CYS D 2 19  ? 1.687   13.724  101.299 1.00 61.58  ? 193  CYS D O   1 
ATOM   7019 C CB  . CYS D 2 19  ? 2.431   11.038  100.908 1.00 61.05  ? 193  CYS D CB  1 
ATOM   7020 S SG  . CYS D 2 19  ? 1.987   9.282   101.040 1.00 64.17  ? 193  CYS D SG  1 
ATOM   7021 N N   . LYS D 2 20  ? 1.881   14.118  99.086  1.00 60.12  ? 194  LYS D N   1 
ATOM   7022 C CA  . LYS D 2 20  ? 1.985   15.570  99.193  1.00 59.43  ? 194  LYS D CA  1 
ATOM   7023 C C   . LYS D 2 20  ? 0.621   16.287  99.168  1.00 57.09  ? 194  LYS D C   1 
ATOM   7024 O O   . LYS D 2 20  ? -0.168  16.083  98.251  1.00 56.56  ? 194  LYS D O   1 
ATOM   7025 C CB  . LYS D 2 20  ? 2.888   16.054  98.054  1.00 61.68  ? 194  LYS D CB  1 
ATOM   7026 C CG  . LYS D 2 20  ? 2.525   17.387  97.451  1.00 64.89  ? 194  LYS D CG  1 
ATOM   7027 C CD  . LYS D 2 20  ? 2.879   18.521  98.374  1.00 67.04  ? 194  LYS D CD  1 
ATOM   7028 C CE  . LYS D 2 20  ? 2.540   19.846  97.731  1.00 68.20  ? 194  LYS D CE  1 
ATOM   7029 N NZ  . LYS D 2 20  ? 3.079   20.944  98.557  1.00 68.59  ? 194  LYS D NZ  1 
ATOM   7030 N N   . PRO D 2 21  ? 0.342   17.145  100.175 1.00 54.99  ? 195  PRO D N   1 
ATOM   7031 C CA  . PRO D 2 21  ? -0.907  17.905  100.308 1.00 54.76  ? 195  PRO D CA  1 
ATOM   7032 C C   . PRO D 2 21  ? -1.275  18.733  99.090  1.00 56.94  ? 195  PRO D C   1 
ATOM   7033 O O   . PRO D 2 21  ? -0.503  18.828  98.136  1.00 57.29  ? 195  PRO D O   1 
ATOM   7034 C CB  . PRO D 2 21  ? -0.645  18.788  101.520 1.00 52.05  ? 195  PRO D CB  1 
ATOM   7035 C CG  . PRO D 2 21  ? 0.243   17.962  102.339 1.00 52.16  ? 195  PRO D CG  1 
ATOM   7036 C CD  . PRO D 2 21  ? 1.213   17.409  101.332 1.00 53.39  ? 195  PRO D CD  1 
ATOM   7037 N N   . LYS D 2 22  ? -2.468  19.325  99.137  1.00 59.56  ? 196  LYS D N   1 
ATOM   7038 C CA  . LYS D 2 22  ? -2.971  20.186  98.062  1.00 61.19  ? 196  LYS D CA  1 
ATOM   7039 C C   . LYS D 2 22  ? -2.584  21.632  98.391  1.00 60.99  ? 196  LYS D C   1 
ATOM   7040 O O   . LYS D 2 22  ? -3.018  22.193  99.395  1.00 61.17  ? 196  LYS D O   1 
ATOM   7041 C CB  . LYS D 2 22  ? -4.496  20.040  97.927  1.00 62.49  ? 196  LYS D CB  1 
ATOM   7042 C CG  . LYS D 2 22  ? -5.156  21.109  97.070  1.00 65.22  ? 196  LYS D CG  1 
ATOM   7043 C CD  . LYS D 2 22  ? -6.239  20.540  96.140  1.00 68.11  ? 196  LYS D CD  1 
ATOM   7044 C CE  . LYS D 2 22  ? -7.447  19.961  96.884  1.00 67.77  ? 196  LYS D CE  1 
ATOM   7045 N NZ  . LYS D 2 22  ? -7.147  18.652  97.523  1.00 67.05  ? 196  LYS D NZ  1 
ATOM   7046 N N   . VAL D 2 23  ? -1.752  22.210  97.527  1.00 61.94  ? 197  VAL D N   1 
ATOM   7047 C CA  . VAL D 2 23  ? -1.208  23.567  97.662  1.00 61.53  ? 197  VAL D CA  1 
ATOM   7048 C C   . VAL D 2 23  ? -2.027  24.705  98.287  1.00 58.88  ? 197  VAL D C   1 
ATOM   7049 O O   . VAL D 2 23  ? -1.575  25.347  99.238  1.00 59.02  ? 197  VAL D O   1 
ATOM   7050 C CB  . VAL D 2 23  ? -0.651  24.050  96.291  1.00 62.88  ? 197  VAL D CB  1 
ATOM   7051 C CG1 . VAL D 2 23  ? -0.274  25.514  96.350  1.00 64.74  ? 197  VAL D CG1 1 
ATOM   7052 C CG2 . VAL D 2 23  ? 0.577   23.230  95.928  1.00 64.44  ? 197  VAL D CG2 1 
ATOM   7053 N N   . GLY D 2 24  ? -3.208  24.980  97.760  1.00 55.64  ? 198  GLY D N   1 
ATOM   7054 C CA  . GLY D 2 24  ? -3.989  26.061  98.329  1.00 54.44  ? 198  GLY D CA  1 
ATOM   7055 C C   . GLY D 2 24  ? -5.249  25.608  99.036  1.00 53.92  ? 198  GLY D C   1 
ATOM   7056 O O   . GLY D 2 24  ? -6.301  26.239  98.896  1.00 55.16  ? 198  GLY D O   1 
ATOM   7057 N N   . TYR D 2 25  ? -5.147  24.531  99.811  1.00 50.95  ? 199  TYR D N   1 
ATOM   7058 C CA  . TYR D 2 25  ? -6.301  24.000  100.519 1.00 46.90  ? 199  TYR D CA  1 
ATOM   7059 C C   . TYR D 2 25  ? -6.855  24.963  101.554 1.00 47.19  ? 199  TYR D C   1 
ATOM   7060 O O   . TYR D 2 25  ? -8.068  25.082  101.710 1.00 47.42  ? 199  TYR D O   1 
ATOM   7061 C CB  . TYR D 2 25  ? -5.949  22.652  101.172 1.00 44.47  ? 199  TYR D CB  1 
ATOM   7062 C CG  . TYR D 2 25  ? -5.238  22.705  102.509 1.00 41.03  ? 199  TYR D CG  1 
ATOM   7063 C CD1 . TYR D 2 25  ? -5.913  23.090  103.667 1.00 40.63  ? 199  TYR D CD1 1 
ATOM   7064 C CD2 . TYR D 2 25  ? -3.900  22.328  102.625 1.00 42.06  ? 199  TYR D CD2 1 
ATOM   7065 C CE1 . TYR D 2 25  ? -5.281  23.101  104.910 1.00 39.62  ? 199  TYR D CE1 1 
ATOM   7066 C CE2 . TYR D 2 25  ? -3.252  22.332  103.873 1.00 42.31  ? 199  TYR D CE2 1 
ATOM   7067 C CZ  . TYR D 2 25  ? -3.957  22.723  105.007 1.00 41.33  ? 199  TYR D CZ  1 
ATOM   7068 O OH  . TYR D 2 25  ? -3.339  22.745  106.233 1.00 43.36  ? 199  TYR D OH  1 
ATOM   7069 N N   . MET D 2 26  ? -5.970  25.652  102.264 1.00 48.50  ? 200  MET D N   1 
ATOM   7070 C CA  . MET D 2 26  ? -6.407  26.591  103.288 1.00 50.66  ? 200  MET D CA  1 
ATOM   7071 C C   . MET D 2 26  ? -7.263  27.703  102.684 1.00 53.04  ? 200  MET D C   1 
ATOM   7072 O O   . MET D 2 26  ? -8.148  28.256  103.343 1.00 52.89  ? 200  MET D O   1 
ATOM   7073 C CB  . MET D 2 26  ? -5.204  27.205  103.988 1.00 49.88  ? 200  MET D CB  1 
ATOM   7074 C CG  . MET D 2 26  ? -5.576  27.938  105.252 1.00 48.05  ? 200  MET D CG  1 
ATOM   7075 S SD  . MET D 2 26  ? -6.207  26.803  106.492 1.00 46.55  ? 200  MET D SD  1 
ATOM   7076 C CE  . MET D 2 26  ? -4.696  26.041  107.025 1.00 41.05  ? 200  MET D CE  1 
ATOM   7077 N N   . LYS D 2 27  ? -6.987  28.026  101.425 1.00 55.29  ? 201  LYS D N   1 
ATOM   7078 C CA  . LYS D 2 27  ? -7.729  29.060  100.723 1.00 57.07  ? 201  LYS D CA  1 
ATOM   7079 C C   . LYS D 2 27  ? -9.178  28.616  100.583 1.00 56.71  ? 201  LYS D C   1 
ATOM   7080 O O   . LYS D 2 27  ? -10.080 29.443  100.423 1.00 56.14  ? 201  LYS D O   1 
ATOM   7081 C CB  . LYS D 2 27  ? -7.110  29.291  99.345  1.00 60.55  ? 201  LYS D CB  1 
ATOM   7082 C CG  . LYS D 2 27  ? -7.970  30.105  98.406  1.00 65.37  ? 201  LYS D CG  1 
ATOM   7083 C CD  . LYS D 2 27  ? -7.844  29.567  96.981  1.00 70.39  ? 201  LYS D CD  1 
ATOM   7084 C CE  . LYS D 2 27  ? -8.997  30.043  96.107  1.00 72.05  ? 201  LYS D CE  1 
ATOM   7085 N NZ  . LYS D 2 27  ? -10.315 29.659  96.717  1.00 75.82  ? 201  LYS D NZ  1 
ATOM   7086 N N   . LYS D 2 28  ? -9.393  27.303  100.657 1.00 56.58  ? 202  LYS D N   1 
ATOM   7087 C CA  . LYS D 2 28  ? -10.726 26.721  100.529 1.00 54.24  ? 202  LYS D CA  1 
ATOM   7088 C C   . LYS D 2 28  ? -11.375 26.428  101.883 1.00 52.55  ? 202  LYS D C   1 
ATOM   7089 O O   . LYS D 2 28  ? -12.577 26.194  101.951 1.00 52.53  ? 202  LYS D O   1 
ATOM   7090 C CB  . LYS D 2 28  ? -10.660 25.435  99.699  1.00 55.45  ? 202  LYS D CB  1 
ATOM   7091 C CG  . LYS D 2 28  ? -9.919  25.569  98.361  1.00 58.07  ? 202  LYS D CG  1 
ATOM   7092 C CD  . LYS D 2 28  ? -10.832 25.900  97.180  1.00 60.52  ? 202  LYS D CD  1 
ATOM   7093 C CE  . LYS D 2 28  ? -11.606 27.208  97.378  1.00 64.32  ? 202  LYS D CE  1 
ATOM   7094 N NZ  . LYS D 2 28  ? -12.246 27.714  96.114  1.00 63.59  ? 202  LYS D NZ  1 
ATOM   7095 N N   . GLN D 2 29  ? -10.586 26.427  102.957 1.00 51.06  ? 203  GLN D N   1 
ATOM   7096 C CA  . GLN D 2 29  ? -11.132 26.180  104.294 1.00 48.84  ? 203  GLN D CA  1 
ATOM   7097 C C   . GLN D 2 29  ? -11.859 27.447  104.721 1.00 48.44  ? 203  GLN D C   1 
ATOM   7098 O O   . GLN D 2 29  ? -11.233 28.466  104.982 1.00 48.88  ? 203  GLN D O   1 
ATOM   7099 C CB  . GLN D 2 29  ? -10.016 25.868  105.285 1.00 46.17  ? 203  GLN D CB  1 
ATOM   7100 C CG  . GLN D 2 29  ? -9.423  24.475  105.154 1.00 47.64  ? 203  GLN D CG  1 
ATOM   7101 C CD  . GLN D 2 29  ? -10.405 23.376  105.542 1.00 46.09  ? 203  GLN D CD  1 
ATOM   7102 O OE1 . GLN D 2 29  ? -11.450 23.646  106.128 1.00 48.00  ? 203  GLN D OE1 1 
ATOM   7103 N NE2 . GLN D 2 29  ? -10.061 22.133  105.229 1.00 43.60  ? 203  GLN D NE2 1 
ATOM   7104 N N   . PRO D 2 30  ? -13.193 27.387  104.827 1.00 48.87  ? 204  PRO D N   1 
ATOM   7105 C CA  . PRO D 2 30  ? -14.023 28.528  105.211 1.00 48.69  ? 204  PRO D CA  1 
ATOM   7106 C C   . PRO D 2 30  ? -13.938 29.043  106.643 1.00 49.48  ? 204  PRO D C   1 
ATOM   7107 O O   . PRO D 2 30  ? -14.237 30.209  106.887 1.00 52.81  ? 204  PRO D O   1 
ATOM   7108 C CB  . PRO D 2 30  ? -15.427 28.048  104.864 1.00 46.60  ? 204  PRO D CB  1 
ATOM   7109 C CG  . PRO D 2 30  ? -15.363 26.618  105.263 1.00 47.95  ? 204  PRO D CG  1 
ATOM   7110 C CD  . PRO D 2 30  ? -14.017 26.168  104.709 1.00 48.53  ? 204  PRO D CD  1 
ATOM   7111 N N   . ASP D 2 31  ? -13.535 28.211  107.593 1.00 49.32  ? 205  ASP D N   1 
ATOM   7112 C CA  . ASP D 2 31  ? -13.493 28.684  108.965 1.00 49.51  ? 205  ASP D CA  1 
ATOM   7113 C C   . ASP D 2 31  ? -12.144 28.624  109.644 1.00 48.90  ? 205  ASP D C   1 
ATOM   7114 O O   . ASP D 2 31  ? -12.042 28.980  110.814 1.00 51.79  ? 205  ASP D O   1 
ATOM   7115 C CB  . ASP D 2 31  ? -14.513 27.922  109.819 1.00 53.29  ? 205  ASP D CB  1 
ATOM   7116 C CG  . ASP D 2 31  ? -14.646 28.491  111.237 1.00 56.38  ? 205  ASP D CG  1 
ATOM   7117 O OD1 . ASP D 2 31  ? -15.105 29.647  111.376 1.00 60.95  ? 205  ASP D OD1 1 
ATOM   7118 O OD2 . ASP D 2 31  ? -14.291 27.790  112.215 1.00 56.05  ? 205  ASP D OD2 1 
ATOM   7119 N N   . ILE D 2 32  ? -11.110 28.172  108.947 1.00 46.36  ? 206  ILE D N   1 
ATOM   7120 C CA  . ILE D 2 32  ? -9.791  28.121  109.566 1.00 44.39  ? 206  ILE D CA  1 
ATOM   7121 C C   . ILE D 2 32  ? -8.779  28.838  108.706 1.00 45.21  ? 206  ILE D C   1 
ATOM   7122 O O   . ILE D 2 32  ? -9.074  29.172  107.563 1.00 45.43  ? 206  ILE D O   1 
ATOM   7123 C CB  . ILE D 2 32  ? -9.323  26.675  109.832 1.00 44.12  ? 206  ILE D CB  1 
ATOM   7124 C CG1 . ILE D 2 32  ? -9.351  25.858  108.548 1.00 41.96  ? 206  ILE D CG1 1 
ATOM   7125 C CG2 . ILE D 2 32  ? -10.201 26.039  110.905 1.00 42.01  ? 206  ILE D CG2 1 
ATOM   7126 C CD1 . ILE D 2 32  ? -8.880  24.448  108.748 1.00 44.98  ? 206  ILE D CD1 1 
ATOM   7127 N N   . THR D 2 33  ? -7.588  29.079  109.253 1.00 45.69  ? 207  THR D N   1 
ATOM   7128 C CA  . THR D 2 33  ? -6.552  29.809  108.527 1.00 46.08  ? 207  THR D CA  1 
ATOM   7129 C C   . THR D 2 33  ? -5.140  29.321  108.823 1.00 47.13  ? 207  THR D C   1 
ATOM   7130 O O   . THR D 2 33  ? -4.924  28.481  109.697 1.00 47.24  ? 207  THR D O   1 
ATOM   7131 C CB  . THR D 2 33  ? -6.585  31.281  108.899 1.00 46.47  ? 207  THR D CB  1 
ATOM   7132 O OG1 . THR D 2 33  ? -5.980  31.433  110.187 1.00 49.72  ? 207  THR D OG1 1 
ATOM   7133 C CG2 . THR D 2 33  ? -8.025  31.793  108.972 1.00 43.01  ? 207  THR D CG2 1 
ATOM   7134 N N   . ASN D 2 34  ? -4.170  29.876  108.106 1.00 48.58  ? 208  ASN D N   1 
ATOM   7135 C CA  . ASN D 2 34  ? -2.783  29.484  108.307 1.00 50.14  ? 208  ASN D CA  1 
ATOM   7136 C C   . ASN D 2 34  ? -2.255  29.925  109.664 1.00 49.93  ? 208  ASN D C   1 
ATOM   7137 O O   . ASN D 2 34  ? -1.271  29.378  110.160 1.00 52.78  ? 208  ASN D O   1 
ATOM   7138 C CB  . ASN D 2 34  ? -1.904  30.034  107.187 1.00 52.95  ? 208  ASN D CB  1 
ATOM   7139 C CG  . ASN D 2 34  ? -2.280  29.469  105.826 1.00 55.33  ? 208  ASN D CG  1 
ATOM   7140 O OD1 . ASN D 2 34  ? -2.642  28.299  105.707 1.00 57.93  ? 208  ASN D OD1 1 
ATOM   7141 N ND2 . ASN D 2 34  ? -2.187  30.296  104.793 1.00 57.25  ? 208  ASN D ND2 1 
ATOM   7142 N N   . SER D 2 35  ? -2.908  30.905  110.276 1.00 48.72  ? 209  SER D N   1 
ATOM   7143 C CA  . SER D 2 35  ? -2.485  31.364  111.593 1.00 46.43  ? 209  SER D CA  1 
ATOM   7144 C C   . SER D 2 35  ? -2.877  30.305  112.610 1.00 44.73  ? 209  SER D C   1 
ATOM   7145 O O   . SER D 2 35  ? -2.097  29.953  113.490 1.00 46.38  ? 209  SER D O   1 
ATOM   7146 C CB  . SER D 2 35  ? -3.163  32.686  111.957 1.00 46.72  ? 209  SER D CB  1 
ATOM   7147 O OG  . SER D 2 35  ? -2.863  33.048  113.296 1.00 44.27  ? 209  SER D OG  1 
ATOM   7148 N N   . MET D 2 36  ? -4.097  29.801  112.478 1.00 43.89  ? 210  MET D N   1 
ATOM   7149 C CA  . MET D 2 36  ? -4.612  28.774  113.377 1.00 42.50  ? 210  MET D CA  1 
ATOM   7150 C C   . MET D 2 36  ? -3.820  27.477  113.244 1.00 41.13  ? 210  MET D C   1 
ATOM   7151 O O   . MET D 2 36  ? -3.552  26.795  114.233 1.00 39.67  ? 210  MET D O   1 
ATOM   7152 C CB  . MET D 2 36  ? -6.082  28.517  113.069 1.00 41.34  ? 210  MET D CB  1 
ATOM   7153 C CG  . MET D 2 36  ? -6.879  29.782  112.879 1.00 41.27  ? 210  MET D CG  1 
ATOM   7154 S SD  . MET D 2 36  ? -8.621  29.420  112.810 1.00 46.69  ? 210  MET D SD  1 
ATOM   7155 C CE  . MET D 2 36  ? -8.835  28.906  114.477 1.00 45.09  ? 210  MET D CE  1 
ATOM   7156 N N   . ARG D 2 37  ? -3.450  27.148  112.012 1.00 41.87  ? 211  ARG D N   1 
ATOM   7157 C CA  . ARG D 2 37  ? -2.684  25.943  111.728 1.00 43.12  ? 211  ARG D CA  1 
ATOM   7158 C C   . ARG D 2 37  ? -1.338  26.042  112.437 1.00 45.08  ? 211  ARG D C   1 
ATOM   7159 O O   . ARG D 2 37  ? -0.868  25.069  113.039 1.00 45.94  ? 211  ARG D O   1 
ATOM   7160 C CB  . ARG D 2 37  ? -2.486  25.810  110.215 1.00 42.21  ? 211  ARG D CB  1 
ATOM   7161 C CG  . ARG D 2 37  ? -1.648  24.630  109.767 1.00 41.29  ? 211  ARG D CG  1 
ATOM   7162 C CD  . ARG D 2 37  ? -1.280  24.782  108.294 1.00 41.73  ? 211  ARG D CD  1 
ATOM   7163 N NE  . ARG D 2 37  ? -0.355  23.761  107.801 1.00 42.47  ? 211  ARG D NE  1 
ATOM   7164 C CZ  . ARG D 2 37  ? 0.826   23.469  108.345 1.00 43.13  ? 211  ARG D CZ  1 
ATOM   7165 N NH1 . ARG D 2 37  ? 1.258   24.112  109.416 1.00 43.44  ? 211  ARG D NH1 1 
ATOM   7166 N NH2 . ARG D 2 37  ? 1.584   22.524  107.813 1.00 44.12  ? 211  ARG D NH2 1 
ATOM   7167 N N   . ALA D 2 38  ? -0.734  27.229  112.373 1.00 45.99  ? 212  ALA D N   1 
ATOM   7168 C CA  . ALA D 2 38  ? 0.571   27.498  112.994 1.00 45.87  ? 212  ALA D CA  1 
ATOM   7169 C C   . ALA D 2 38  ? 0.505   27.340  114.517 1.00 45.10  ? 212  ALA D C   1 
ATOM   7170 O O   . ALA D 2 38  ? 1.437   26.850  115.157 1.00 44.09  ? 212  ALA D O   1 
ATOM   7171 C CB  . ALA D 2 38  ? 1.028   28.903  112.635 1.00 46.04  ? 212  ALA D CB  1 
ATOM   7172 N N   . ILE D 2 39  ? -0.605  27.773  115.090 1.00 43.67  ? 213  ILE D N   1 
ATOM   7173 C CA  . ILE D 2 39  ? -0.808  27.657  116.517 1.00 44.84  ? 213  ILE D CA  1 
ATOM   7174 C C   . ILE D 2 39  ? -0.859  26.167  116.856 1.00 47.31  ? 213  ILE D C   1 
ATOM   7175 O O   . ILE D 2 39  ? -0.247  25.713  117.829 1.00 49.28  ? 213  ILE D O   1 
ATOM   7176 C CB  . ILE D 2 39  ? -2.132  28.328  116.910 1.00 44.70  ? 213  ILE D CB  1 
ATOM   7177 C CG1 . ILE D 2 39  ? -1.969  29.847  116.822 1.00 42.59  ? 213  ILE D CG1 1 
ATOM   7178 C CG2 . ILE D 2 39  ? -2.583  27.854  118.279 1.00 44.37  ? 213  ILE D CG2 1 
ATOM   7179 C CD1 . ILE D 2 39  ? -3.257  30.605  116.936 1.00 41.78  ? 213  ILE D CD1 1 
ATOM   7180 N N   . LEU D 2 40  ? -1.581  25.412  116.032 1.00 46.48  ? 214  LEU D N   1 
ATOM   7181 C CA  . LEU D 2 40  ? -1.735  23.979  116.228 1.00 45.67  ? 214  LEU D CA  1 
ATOM   7182 C C   . LEU D 2 40  ? -0.415  23.234  116.156 1.00 44.75  ? 214  LEU D C   1 
ATOM   7183 O O   . LEU D 2 40  ? -0.085  22.462  117.053 1.00 45.34  ? 214  LEU D O   1 
ATOM   7184 C CB  . LEU D 2 40  ? -2.690  23.397  115.186 1.00 45.60  ? 214  LEU D CB  1 
ATOM   7185 C CG  . LEU D 2 40  ? -2.777  21.870  115.200 1.00 46.50  ? 214  LEU D CG  1 
ATOM   7186 C CD1 . LEU D 2 40  ? -3.523  21.417  116.436 1.00 47.38  ? 214  LEU D CD1 1 
ATOM   7187 C CD2 . LEU D 2 40  ? -3.474  21.384  113.952 1.00 46.73  ? 214  LEU D CD2 1 
ATOM   7188 N N   . VAL D 2 41  ? 0.331   23.462  115.082 1.00 43.97  ? 215  VAL D N   1 
ATOM   7189 C CA  . VAL D 2 41  ? 1.615   22.793  114.890 1.00 43.35  ? 215  VAL D CA  1 
ATOM   7190 C C   . VAL D 2 41  ? 2.604   23.152  115.997 1.00 44.34  ? 215  VAL D C   1 
ATOM   7191 O O   . VAL D 2 41  ? 3.401   22.314  116.424 1.00 45.36  ? 215  VAL D O   1 
ATOM   7192 C CB  . VAL D 2 41  ? 2.244   23.153  113.522 1.00 41.65  ? 215  VAL D CB  1 
ATOM   7193 C CG1 . VAL D 2 41  ? 3.538   22.391  113.331 1.00 41.10  ? 215  VAL D CG1 1 
ATOM   7194 C CG2 . VAL D 2 41  ? 1.282   22.817  112.398 1.00 39.84  ? 215  VAL D CG2 1 
ATOM   7195 N N   . ASP D 2 42  ? 2.557   24.400  116.457 1.00 45.64  ? 216  ASP D N   1 
ATOM   7196 C CA  . ASP D 2 42  ? 3.448   24.843  117.524 1.00 45.21  ? 216  ASP D CA  1 
ATOM   7197 C C   . ASP D 2 42  ? 3.065   24.092  118.786 1.00 43.53  ? 216  ASP D C   1 
ATOM   7198 O O   . ASP D 2 42  ? 3.919   23.741  119.596 1.00 41.37  ? 216  ASP D O   1 
ATOM   7199 C CB  . ASP D 2 42  ? 3.331   26.368  117.743 1.00 48.07  ? 216  ASP D CB  1 
ATOM   7200 C CG  . ASP D 2 42  ? 4.179   26.865  118.919 1.00 48.28  ? 216  ASP D CG  1 
ATOM   7201 O OD1 . ASP D 2 42  ? 3.696   26.813  120.077 1.00 50.47  ? 216  ASP D OD1 1 
ATOM   7202 O OD2 . ASP D 2 42  ? 5.330   27.290  118.688 1.00 46.20  ? 216  ASP D OD2 1 
ATOM   7203 N N   . TRP D 2 43  ? 1.771   23.842  118.943 1.00 44.81  ? 217  TRP D N   1 
ATOM   7204 C CA  . TRP D 2 43  ? 1.295   23.107  120.099 1.00 46.12  ? 217  TRP D CA  1 
ATOM   7205 C C   . TRP D 2 43  ? 1.741   21.642  120.012 1.00 48.08  ? 217  TRP D C   1 
ATOM   7206 O O   . TRP D 2 43  ? 1.989   21.005  121.038 1.00 50.13  ? 217  TRP D O   1 
ATOM   7207 C CB  . TRP D 2 43  ? -0.225  23.176  120.186 1.00 47.49  ? 217  TRP D CB  1 
ATOM   7208 C CG  . TRP D 2 43  ? -0.787  22.388  121.340 1.00 51.27  ? 217  TRP D CG  1 
ATOM   7209 C CD1 . TRP D 2 43  ? -0.584  22.619  122.676 1.00 51.46  ? 217  TRP D CD1 1 
ATOM   7210 C CD2 . TRP D 2 43  ? -1.629  21.231  121.258 1.00 51.41  ? 217  TRP D CD2 1 
ATOM   7211 N NE1 . TRP D 2 43  ? -1.247  21.677  123.427 1.00 52.10  ? 217  TRP D NE1 1 
ATOM   7212 C CE2 . TRP D 2 43  ? -1.896  20.813  122.584 1.00 52.39  ? 217  TRP D CE2 1 
ATOM   7213 C CE3 . TRP D 2 43  ? -2.183  20.505  120.193 1.00 51.68  ? 217  TRP D CE3 1 
ATOM   7214 C CZ2 . TRP D 2 43  ? -2.693  19.698  122.872 1.00 52.38  ? 217  TRP D CZ2 1 
ATOM   7215 C CZ3 . TRP D 2 43  ? -2.975  19.397  120.478 1.00 51.39  ? 217  TRP D CZ3 1 
ATOM   7216 C CH2 . TRP D 2 43  ? -3.222  19.005  121.810 1.00 53.25  ? 217  TRP D CH2 1 
ATOM   7217 N N   . LEU D 2 44  ? 1.854   21.103  118.799 1.00 46.62  ? 218  LEU D N   1 
ATOM   7218 C CA  . LEU D 2 44  ? 2.274   19.710  118.663 1.00 48.23  ? 218  LEU D CA  1 
ATOM   7219 C C   . LEU D 2 44  ? 3.766   19.561  118.964 1.00 49.52  ? 218  LEU D C   1 
ATOM   7220 O O   . LEU D 2 44  ? 4.229   18.475  119.326 1.00 46.96  ? 218  LEU D O   1 
ATOM   7221 C CB  . LEU D 2 44  ? 1.954   19.170  117.262 1.00 46.41  ? 218  LEU D CB  1 
ATOM   7222 C CG  . LEU D 2 44  ? 0.469   19.124  116.872 1.00 45.59  ? 218  LEU D CG  1 
ATOM   7223 C CD1 . LEU D 2 44  ? 0.328   18.645  115.440 1.00 44.91  ? 218  LEU D CD1 1 
ATOM   7224 C CD2 . LEU D 2 44  ? -0.288  18.213  117.811 1.00 43.69  ? 218  LEU D CD2 1 
ATOM   7225 N N   . VAL D 2 45  ? 4.514   20.656  118.822 1.00 50.61  ? 219  VAL D N   1 
ATOM   7226 C CA  . VAL D 2 45  ? 5.945   20.632  119.109 1.00 51.63  ? 219  VAL D CA  1 
ATOM   7227 C C   . VAL D 2 45  ? 6.101   20.581  120.623 1.00 53.34  ? 219  VAL D C   1 
ATOM   7228 O O   . VAL D 2 45  ? 6.940   19.852  121.143 1.00 54.25  ? 219  VAL D O   1 
ATOM   7229 C CB  . VAL D 2 45  ? 6.659   21.877  118.550 1.00 52.60  ? 219  VAL D CB  1 
ATOM   7230 C CG1 . VAL D 2 45  ? 8.111   21.901  119.014 1.00 50.68  ? 219  VAL D CG1 1 
ATOM   7231 C CG2 . VAL D 2 45  ? 6.592   21.866  117.017 1.00 53.06  ? 219  VAL D CG2 1 
ATOM   7232 N N   . GLU D 2 46  ? 5.286   21.356  121.332 1.00 54.36  ? 220  GLU D N   1 
ATOM   7233 C CA  . GLU D 2 46  ? 5.324   21.337  122.790 1.00 54.76  ? 220  GLU D CA  1 
ATOM   7234 C C   . GLU D 2 46  ? 5.072   19.904  123.228 1.00 54.02  ? 220  GLU D C   1 
ATOM   7235 O O   . GLU D 2 46  ? 5.929   19.270  123.838 1.00 52.97  ? 220  GLU D O   1 
ATOM   7236 C CB  . GLU D 2 46  ? 4.220   22.208  123.384 1.00 56.94  ? 220  GLU D CB  1 
ATOM   7237 C CG  . GLU D 2 46  ? 4.442   23.693  123.289 1.00 60.69  ? 220  GLU D CG  1 
ATOM   7238 C CD  . GLU D 2 46  ? 3.415   24.454  124.091 1.00 63.70  ? 220  GLU D CD  1 
ATOM   7239 O OE1 . GLU D 2 46  ? 3.269   24.142  125.297 1.00 64.57  ? 220  GLU D OE1 1 
ATOM   7240 O OE2 . GLU D 2 46  ? 2.754   25.353  123.518 1.00 66.29  ? 220  GLU D OE2 1 
ATOM   7241 N N   . VAL D 2 47  ? 3.875   19.415  122.911 1.00 53.38  ? 221  VAL D N   1 
ATOM   7242 C CA  . VAL D 2 47  ? 3.463   18.056  123.245 1.00 53.94  ? 221  VAL D CA  1 
ATOM   7243 C C   . VAL D 2 47  ? 4.578   17.046  122.970 1.00 54.98  ? 221  VAL D C   1 
ATOM   7244 O O   . VAL D 2 47  ? 4.878   16.201  123.808 1.00 55.01  ? 221  VAL D O   1 
ATOM   7245 C CB  . VAL D 2 47  ? 2.193   17.659  122.444 1.00 52.58  ? 221  VAL D CB  1 
ATOM   7246 C CG1 . VAL D 2 47  ? 1.966   16.157  122.514 1.00 48.50  ? 221  VAL D CG1 1 
ATOM   7247 C CG2 . VAL D 2 47  ? 0.988   18.400  122.996 1.00 49.10  ? 221  VAL D CG2 1 
ATOM   7248 N N   . GLY D 2 48  ? 5.193   17.147  121.798 1.00 56.35  ? 222  GLY D N   1 
ATOM   7249 C CA  . GLY D 2 48  ? 6.267   16.238  121.443 1.00 58.92  ? 222  GLY D CA  1 
ATOM   7250 C C   . GLY D 2 48  ? 7.402   16.254  122.448 1.00 60.65  ? 222  GLY D C   1 
ATOM   7251 O O   . GLY D 2 48  ? 8.088   15.247  122.634 1.00 60.95  ? 222  GLY D O   1 
ATOM   7252 N N   . GLU D 2 49  ? 7.613   17.404  123.082 1.00 62.33  ? 223  GLU D N   1 
ATOM   7253 C CA  . GLU D 2 49  ? 8.658   17.549  124.095 1.00 64.63  ? 223  GLU D CA  1 
ATOM   7254 C C   . GLU D 2 49  ? 8.132   16.983  125.404 1.00 63.89  ? 223  GLU D C   1 
ATOM   7255 O O   . GLU D 2 49  ? 8.762   16.137  126.030 1.00 63.66  ? 223  GLU D O   1 
ATOM   7256 C CB  . GLU D 2 49  ? 9.018   19.025  124.310 1.00 67.12  ? 223  GLU D CB  1 
ATOM   7257 C CG  . GLU D 2 49  ? 9.576   19.710  123.090 1.00 71.36  ? 223  GLU D CG  1 
ATOM   7258 C CD  . GLU D 2 49  ? 10.680  18.903  122.458 1.00 74.23  ? 223  GLU D CD  1 
ATOM   7259 O OE1 . GLU D 2 49  ? 11.711  18.683  123.130 1.00 76.76  ? 223  GLU D OE1 1 
ATOM   7260 O OE2 . GLU D 2 49  ? 10.508  18.478  121.294 1.00 76.47  ? 223  GLU D OE2 1 
ATOM   7261 N N   . GLU D 2 50  ? 6.966   17.471  125.809 1.00 63.08  ? 224  GLU D N   1 
ATOM   7262 C CA  . GLU D 2 50  ? 6.340   17.026  127.035 1.00 62.94  ? 224  GLU D CA  1 
ATOM   7263 C C   . GLU D 2 50  ? 6.441   15.510  127.175 1.00 61.90  ? 224  GLU D C   1 
ATOM   7264 O O   . GLU D 2 50  ? 6.764   15.003  128.252 1.00 61.77  ? 224  GLU D O   1 
ATOM   7265 C CB  . GLU D 2 50  ? 4.870   17.440  127.050 1.00 65.79  ? 224  GLU D CB  1 
ATOM   7266 C CG  . GLU D 2 50  ? 4.167   17.100  128.349 1.00 70.66  ? 224  GLU D CG  1 
ATOM   7267 C CD  . GLU D 2 50  ? 4.659   17.949  129.506 1.00 74.46  ? 224  GLU D CD  1 
ATOM   7268 O OE1 . GLU D 2 50  ? 4.113   19.062  129.696 1.00 76.82  ? 224  GLU D OE1 1 
ATOM   7269 O OE2 . GLU D 2 50  ? 5.597   17.511  130.213 1.00 75.14  ? 224  GLU D OE2 1 
ATOM   7270 N N   . TYR D 2 51  ? 6.182   14.793  126.081 1.00 58.92  ? 225  TYR D N   1 
ATOM   7271 C CA  . TYR D 2 51  ? 6.214   13.332  126.100 1.00 56.75  ? 225  TYR D CA  1 
ATOM   7272 C C   . TYR D 2 51  ? 7.429   12.690  125.468 1.00 56.31  ? 225  TYR D C   1 
ATOM   7273 O O   . TYR D 2 51  ? 7.532   11.464  125.439 1.00 56.31  ? 225  TYR D O   1 
ATOM   7274 C CB  . TYR D 2 51  ? 4.945   12.761  125.457 1.00 54.95  ? 225  TYR D CB  1 
ATOM   7275 C CG  . TYR D 2 51  ? 3.706   13.067  126.254 1.00 53.06  ? 225  TYR D CG  1 
ATOM   7276 C CD1 . TYR D 2 51  ? 3.109   14.327  126.199 1.00 52.54  ? 225  TYR D CD1 1 
ATOM   7277 C CD2 . TYR D 2 51  ? 3.183   12.131  127.134 1.00 52.19  ? 225  TYR D CD2 1 
ATOM   7278 C CE1 . TYR D 2 51  ? 2.027   14.647  127.008 1.00 53.04  ? 225  TYR D CE1 1 
ATOM   7279 C CE2 . TYR D 2 51  ? 2.104   12.440  127.947 1.00 54.06  ? 225  TYR D CE2 1 
ATOM   7280 C CZ  . TYR D 2 51  ? 1.532   13.698  127.882 1.00 53.91  ? 225  TYR D CZ  1 
ATOM   7281 O OH  . TYR D 2 51  ? 0.474   14.000  128.705 1.00 55.84  ? 225  TYR D OH  1 
ATOM   7282 N N   . LYS D 2 52  ? 8.339   13.510  124.954 1.00 56.17  ? 226  LYS D N   1 
ATOM   7283 C CA  . LYS D 2 52  ? 9.573   13.012  124.351 1.00 56.81  ? 226  LYS D CA  1 
ATOM   7284 C C   . LYS D 2 52  ? 9.372   12.179  123.092 1.00 56.56  ? 226  LYS D C   1 
ATOM   7285 O O   . LYS D 2 52  ? 10.194  11.324  122.773 1.00 58.62  ? 226  LYS D O   1 
ATOM   7286 C CB  . LYS D 2 52  ? 10.338  12.185  125.383 1.00 56.93  ? 226  LYS D CB  1 
ATOM   7287 C CG  . LYS D 2 52  ? 10.717  12.980  126.616 1.00 58.35  ? 226  LYS D CG  1 
ATOM   7288 C CD  . LYS D 2 52  ? 10.512  12.177  127.886 1.00 59.29  ? 226  LYS D CD  1 
ATOM   7289 C CE  . LYS D 2 52  ? 11.822  12.000  128.635 1.00 60.43  ? 226  LYS D CE  1 
ATOM   7290 N NZ  . LYS D 2 52  ? 12.516  13.307  128.858 1.00 61.39  ? 226  LYS D NZ  1 
ATOM   7291 N N   . LEU D 2 53  ? 8.286   12.424  122.374 1.00 55.10  ? 227  LEU D N   1 
ATOM   7292 C CA  . LEU D 2 53  ? 8.014   11.676  121.159 1.00 53.70  ? 227  LEU D CA  1 
ATOM   7293 C C   . LEU D 2 53  ? 9.074   12.024  120.124 1.00 54.28  ? 227  LEU D C   1 
ATOM   7294 O O   . LEU D 2 53  ? 9.463   13.181  119.999 1.00 56.96  ? 227  LEU D O   1 
ATOM   7295 C CB  . LEU D 2 53  ? 6.627   12.042  120.627 1.00 51.22  ? 227  LEU D CB  1 
ATOM   7296 C CG  . LEU D 2 53  ? 5.500   12.017  121.661 1.00 47.59  ? 227  LEU D CG  1 
ATOM   7297 C CD1 . LEU D 2 53  ? 4.178   12.410  121.024 1.00 48.40  ? 227  LEU D CD1 1 
ATOM   7298 C CD2 . LEU D 2 53  ? 5.411   10.634  122.249 1.00 46.78  ? 227  LEU D CD2 1 
ATOM   7299 N N   . GLN D 2 54  ? 9.549   11.021  119.395 1.00 54.99  ? 228  GLN D N   1 
ATOM   7300 C CA  . GLN D 2 54  ? 10.556  11.228  118.354 1.00 54.18  ? 228  GLN D CA  1 
ATOM   7301 C C   . GLN D 2 54  ? 10.129  12.393  117.475 1.00 53.07  ? 228  GLN D C   1 
ATOM   7302 O O   . GLN D 2 54  ? 8.937   12.681  117.365 1.00 53.88  ? 228  GLN D O   1 
ATOM   7303 C CB  . GLN D 2 54  ? 10.683  9.977   117.479 1.00 53.97  ? 228  GLN D CB  1 
ATOM   7304 C CG  . GLN D 2 54  ? 11.133  8.738   118.209 1.00 55.01  ? 228  GLN D CG  1 
ATOM   7305 C CD  . GLN D 2 54  ? 12.569  8.837   118.664 1.00 55.97  ? 228  GLN D CD  1 
ATOM   7306 O OE1 . GLN D 2 54  ? 13.466  9.117   117.866 1.00 54.79  ? 228  GLN D OE1 1 
ATOM   7307 N NE2 . GLN D 2 54  ? 12.799  8.605   119.949 1.00 56.72  ? 228  GLN D NE2 1 
ATOM   7308 N N   . ASN D 2 55  ? 11.096  13.059  116.851 1.00 52.83  ? 229  ASN D N   1 
ATOM   7309 C CA  . ASN D 2 55  ? 10.793  14.188  115.973 1.00 52.15  ? 229  ASN D CA  1 
ATOM   7310 C C   . ASN D 2 55  ? 10.002  13.705  114.777 1.00 51.23  ? 229  ASN D C   1 
ATOM   7311 O O   . ASN D 2 55  ? 9.088   14.388  114.311 1.00 49.05  ? 229  ASN D O   1 
ATOM   7312 C CB  . ASN D 2 55  ? 12.076  14.847  115.477 1.00 54.40  ? 229  ASN D CB  1 
ATOM   7313 C CG  . ASN D 2 55  ? 12.596  15.886  116.432 1.00 58.24  ? 229  ASN D CG  1 
ATOM   7314 O OD1 . ASN D 2 55  ? 12.722  15.635  117.634 1.00 59.72  ? 229  ASN D OD1 1 
ATOM   7315 N ND2 . ASN D 2 55  ? 12.909  17.070  115.906 1.00 60.48  ? 229  ASN D ND2 1 
ATOM   7316 N N   . GLU D 2 56  ? 10.373  12.522  114.286 1.00 50.55  ? 230  GLU D N   1 
ATOM   7317 C CA  . GLU D 2 56  ? 9.718   11.918  113.135 1.00 49.10  ? 230  GLU D CA  1 
ATOM   7318 C C   . GLU D 2 56  ? 8.218   11.901  113.361 1.00 48.32  ? 230  GLU D C   1 
ATOM   7319 O O   . GLU D 2 56  ? 7.437   12.180  112.447 1.00 49.07  ? 230  GLU D O   1 
ATOM   7320 C CB  . GLU D 2 56  ? 10.240  10.496  112.923 1.00 50.53  ? 230  GLU D CB  1 
ATOM   7321 C CG  . GLU D 2 56  ? 9.539   9.723   111.818 1.00 50.79  ? 230  GLU D CG  1 
ATOM   7322 C CD  . GLU D 2 56  ? 9.599   10.426  110.477 1.00 50.97  ? 230  GLU D CD  1 
ATOM   7323 O OE1 . GLU D 2 56  ? 10.193  11.526  110.403 1.00 49.13  ? 230  GLU D OE1 1 
ATOM   7324 O OE2 . GLU D 2 56  ? 9.044   9.876   109.498 1.00 48.15  ? 230  GLU D OE2 1 
ATOM   7325 N N   . THR D 2 57  ? 7.820   11.585  114.587 1.00 46.69  ? 231  THR D N   1 
ATOM   7326 C CA  . THR D 2 57  ? 6.407   11.553  114.934 1.00 46.87  ? 231  THR D CA  1 
ATOM   7327 C C   . THR D 2 57  ? 5.772   12.895  114.594 1.00 46.64  ? 231  THR D C   1 
ATOM   7328 O O   . THR D 2 57  ? 4.772   12.958  113.880 1.00 47.71  ? 231  THR D O   1 
ATOM   7329 C CB  . THR D 2 57  ? 6.205   11.316  116.434 1.00 47.71  ? 231  THR D CB  1 
ATOM   7330 O OG1 . THR D 2 57  ? 6.995   10.199  116.855 1.00 44.90  ? 231  THR D OG1 1 
ATOM   7331 C CG2 . THR D 2 57  ? 4.731   11.043  116.728 1.00 47.90  ? 231  THR D CG2 1 
ATOM   7332 N N   . LEU D 2 58  ? 6.367   13.962  115.123 1.00 46.68  ? 232  LEU D N   1 
ATOM   7333 C CA  . LEU D 2 58  ? 5.903   15.329  114.912 1.00 46.47  ? 232  LEU D CA  1 
ATOM   7334 C C   . LEU D 2 58  ? 5.705   15.647  113.429 1.00 47.61  ? 232  LEU D C   1 
ATOM   7335 O O   . LEU D 2 58  ? 4.659   16.181  113.040 1.00 48.65  ? 232  LEU D O   1 
ATOM   7336 C CB  . LEU D 2 58  ? 6.913   16.294  115.525 1.00 47.72  ? 232  LEU D CB  1 
ATOM   7337 C CG  . LEU D 2 58  ? 6.681   17.806  115.652 1.00 49.38  ? 232  LEU D CG  1 
ATOM   7338 C CD1 . LEU D 2 58  ? 7.885   18.493  115.015 1.00 49.85  ? 232  LEU D CD1 1 
ATOM   7339 C CD2 . LEU D 2 58  ? 5.370   18.265  115.014 1.00 47.53  ? 232  LEU D CD2 1 
ATOM   7340 N N   . HIS D 2 59  ? 6.697   15.321  112.599 1.00 47.08  ? 233  HIS D N   1 
ATOM   7341 C CA  . HIS D 2 59  ? 6.591   15.589  111.166 1.00 45.38  ? 233  HIS D CA  1 
ATOM   7342 C C   . HIS D 2 59  ? 5.486   14.769  110.511 1.00 43.12  ? 233  HIS D C   1 
ATOM   7343 O O   . HIS D 2 59  ? 4.758   15.280  109.666 1.00 41.57  ? 233  HIS D O   1 
ATOM   7344 C CB  . HIS D 2 59  ? 7.916   15.313  110.450 1.00 47.86  ? 233  HIS D CB  1 
ATOM   7345 C CG  . HIS D 2 59  ? 8.953   16.378  110.648 1.00 51.39  ? 233  HIS D CG  1 
ATOM   7346 N ND1 . HIS D 2 59  ? 9.760   16.439  111.764 1.00 52.02  ? 233  HIS D ND1 1 
ATOM   7347 C CD2 . HIS D 2 59  ? 9.326   17.415  109.861 1.00 52.37  ? 233  HIS D CD2 1 
ATOM   7348 C CE1 . HIS D 2 59  ? 10.585  17.465  111.655 1.00 50.94  ? 233  HIS D CE1 1 
ATOM   7349 N NE2 . HIS D 2 59  ? 10.343  18.074  110.509 1.00 51.21  ? 233  HIS D NE2 1 
ATOM   7350 N N   . LEU D 2 60  ? 5.371   13.495  110.889 1.00 41.96  ? 234  LEU D N   1 
ATOM   7351 C CA  . LEU D 2 60  ? 4.330   12.633  110.331 1.00 40.85  ? 234  LEU D CA  1 
ATOM   7352 C C   . LEU D 2 60  ? 2.952   13.204  110.654 1.00 41.63  ? 234  LEU D C   1 
ATOM   7353 O O   . LEU D 2 60  ? 2.056   13.182  109.809 1.00 42.58  ? 234  LEU D O   1 
ATOM   7354 C CB  . LEU D 2 60  ? 4.434   11.203  110.885 1.00 39.18  ? 234  LEU D CB  1 
ATOM   7355 C CG  . LEU D 2 60  ? 5.472   10.257  110.263 1.00 38.40  ? 234  LEU D CG  1 
ATOM   7356 C CD1 . LEU D 2 60  ? 5.520   8.962   111.060 1.00 36.24  ? 234  LEU D CD1 1 
ATOM   7357 C CD2 . LEU D 2 60  ? 5.129   9.981   108.800 1.00 34.01  ? 234  LEU D CD2 1 
ATOM   7358 N N   . ALA D 2 61  ? 2.794   13.722  111.873 1.00 40.93  ? 235  ALA D N   1 
ATOM   7359 C CA  . ALA D 2 61  ? 1.532   14.312  112.306 1.00 40.82  ? 235  ALA D CA  1 
ATOM   7360 C C   . ALA D 2 61  ? 1.132   15.519  111.457 1.00 41.39  ? 235  ALA D C   1 
ATOM   7361 O O   . ALA D 2 61  ? -0.038  15.685  111.121 1.00 43.07  ? 235  ALA D O   1 
ATOM   7362 C CB  . ALA D 2 61  ? 1.620   14.714  113.771 1.00 41.10  ? 235  ALA D CB  1 
ATOM   7363 N N   . VAL D 2 62  ? 2.093   16.369  111.117 1.00 42.07  ? 236  VAL D N   1 
ATOM   7364 C CA  . VAL D 2 62  ? 1.791   17.544  110.307 1.00 44.07  ? 236  VAL D CA  1 
ATOM   7365 C C   . VAL D 2 62  ? 1.355   17.106  108.905 1.00 44.28  ? 236  VAL D C   1 
ATOM   7366 O O   . VAL D 2 62  ? 0.450   17.694  108.312 1.00 45.80  ? 236  VAL D O   1 
ATOM   7367 C CB  . VAL D 2 62  ? 3.026   18.506  110.227 1.00 45.29  ? 236  VAL D CB  1 
ATOM   7368 C CG1 . VAL D 2 62  ? 2.770   19.650  109.240 1.00 43.23  ? 236  VAL D CG1 1 
ATOM   7369 C CG2 . VAL D 2 62  ? 3.312   19.077  111.603 1.00 43.12  ? 236  VAL D CG2 1 
ATOM   7370 N N   . ASN D 2 63  ? 1.987   16.066  108.376 1.00 44.79  ? 237  ASN D N   1 
ATOM   7371 C CA  . ASN D 2 63  ? 1.617   15.568  107.054 1.00 45.76  ? 237  ASN D CA  1 
ATOM   7372 C C   . ASN D 2 63  ? 0.170   15.068  107.096 1.00 45.69  ? 237  ASN D C   1 
ATOM   7373 O O   . ASN D 2 63  ? -0.645  15.413  106.235 1.00 45.76  ? 237  ASN D O   1 
ATOM   7374 C CB  . ASN D 2 63  ? 2.567   14.442  106.636 1.00 47.59  ? 237  ASN D CB  1 
ATOM   7375 C CG  . ASN D 2 63  ? 2.162   13.784  105.331 1.00 48.62  ? 237  ASN D CG  1 
ATOM   7376 O OD1 . ASN D 2 63  ? 1.257   12.956  105.302 1.00 52.94  ? 237  ASN D OD1 1 
ATOM   7377 N ND2 . ASN D 2 63  ? 2.830   14.149  104.244 1.00 47.71  ? 237  ASN D ND2 1 
ATOM   7378 N N   . TYR D 2 64  ? -0.157  14.275  108.110 1.00 44.49  ? 238  TYR D N   1 
ATOM   7379 C CA  . TYR D 2 64  ? -1.514  13.758  108.237 1.00 44.07  ? 238  TYR D CA  1 
ATOM   7380 C C   . TYR D 2 64  ? -2.499  14.917  108.295 1.00 44.48  ? 238  TYR D C   1 
ATOM   7381 O O   . TYR D 2 64  ? -3.502  14.936  107.574 1.00 46.72  ? 238  TYR D O   1 
ATOM   7382 C CB  . TYR D 2 64  ? -1.671  12.909  109.504 1.00 41.08  ? 238  TYR D CB  1 
ATOM   7383 C CG  . TYR D 2 64  ? -0.735  11.725  109.600 1.00 37.91  ? 238  TYR D CG  1 
ATOM   7384 C CD1 . TYR D 2 64  ? -0.086  11.222  108.473 1.00 38.10  ? 238  TYR D CD1 1 
ATOM   7385 C CD2 . TYR D 2 64  ? -0.507  11.096  110.821 1.00 37.52  ? 238  TYR D CD2 1 
ATOM   7386 C CE1 . TYR D 2 64  ? 0.769   10.119  108.563 1.00 35.72  ? 238  TYR D CE1 1 
ATOM   7387 C CE2 . TYR D 2 64  ? 0.344   9.996   110.917 1.00 35.00  ? 238  TYR D CE2 1 
ATOM   7388 C CZ  . TYR D 2 64  ? 0.975   9.517   109.788 1.00 34.41  ? 238  TYR D CZ  1 
ATOM   7389 O OH  . TYR D 2 64  ? 1.817   8.439   109.884 1.00 34.65  ? 238  TYR D OH  1 
ATOM   7390 N N   . ILE D 2 65  ? -2.208  15.892  109.147 1.00 42.73  ? 239  ILE D N   1 
ATOM   7391 C CA  . ILE D 2 65  ? -3.091  17.038  109.288 1.00 41.26  ? 239  ILE D CA  1 
ATOM   7392 C C   . ILE D 2 65  ? -3.302  17.819  107.995 1.00 39.87  ? 239  ILE D C   1 
ATOM   7393 O O   . ILE D 2 65  ? -4.404  18.270  107.720 1.00 41.42  ? 239  ILE D O   1 
ATOM   7394 C CB  . ILE D 2 65  ? -2.587  17.987  110.376 1.00 40.45  ? 239  ILE D CB  1 
ATOM   7395 C CG1 . ILE D 2 65  ? -2.483  17.227  111.698 1.00 41.46  ? 239  ILE D CG1 1 
ATOM   7396 C CG2 . ILE D 2 65  ? -3.549  19.143  110.534 1.00 41.18  ? 239  ILE D CG2 1 
ATOM   7397 C CD1 . ILE D 2 65  ? -2.125  18.093  112.884 1.00 42.34  ? 239  ILE D CD1 1 
ATOM   7398 N N   . ASP D 2 66  ? -2.263  17.980  107.190 1.00 39.39  ? 240  ASP D N   1 
ATOM   7399 C CA  . ASP D 2 66  ? -2.438  18.720  105.951 1.00 37.55  ? 240  ASP D CA  1 
ATOM   7400 C C   . ASP D 2 66  ? -3.224  17.954  104.899 1.00 35.85  ? 240  ASP D C   1 
ATOM   7401 O O   . ASP D 2 66  ? -4.023  18.535  104.187 1.00 35.11  ? 240  ASP D O   1 
ATOM   7402 C CB  . ASP D 2 66  ? -1.086  19.150  105.387 1.00 38.98  ? 240  ASP D CB  1 
ATOM   7403 C CG  . ASP D 2 66  ? -0.506  20.344  106.126 1.00 40.81  ? 240  ASP D CG  1 
ATOM   7404 O OD1 . ASP D 2 66  ? -1.276  21.285  106.420 1.00 36.24  ? 240  ASP D OD1 1 
ATOM   7405 O OD2 . ASP D 2 66  ? 0.716   20.341  106.404 1.00 42.20  ? 240  ASP D OD2 1 
ATOM   7406 N N   . ARG D 2 67  ? -3.001  16.650  104.792 1.00 36.36  ? 241  ARG D N   1 
ATOM   7407 C CA  . ARG D 2 67  ? -3.731  15.855  103.809 1.00 35.07  ? 241  ARG D CA  1 
ATOM   7408 C C   . ARG D 2 67  ? -5.195  15.760  104.222 1.00 35.75  ? 241  ARG D C   1 
ATOM   7409 O O   . ARG D 2 67  ? -6.099  15.792  103.378 1.00 35.07  ? 241  ARG D O   1 
ATOM   7410 C CB  . ARG D 2 67  ? -3.111  14.468  103.699 1.00 34.06  ? 241  ARG D CB  1 
ATOM   7411 C CG  . ARG D 2 67  ? -1.796  14.474  102.972 1.00 33.13  ? 241  ARG D CG  1 
ATOM   7412 C CD  . ARG D 2 67  ? -0.910  13.349  103.436 1.00 33.28  ? 241  ARG D CD  1 
ATOM   7413 N NE  . ARG D 2 67  ? -1.577  12.072  103.289 1.00 36.66  ? 241  ARG D NE  1 
ATOM   7414 C CZ  . ARG D 2 67  ? -1.172  10.947  103.869 1.00 38.17  ? 241  ARG D CZ  1 
ATOM   7415 N NH1 . ARG D 2 67  ? -0.093  10.945  104.641 1.00 35.84  ? 241  ARG D NH1 1 
ATOM   7416 N NH2 . ARG D 2 67  ? -1.856  9.825   103.681 1.00 38.88  ? 241  ARG D NH2 1 
ATOM   7417 N N   . PHE D 2 68  ? -5.434  15.655  105.526 1.00 35.34  ? 242  PHE D N   1 
ATOM   7418 C CA  . PHE D 2 68  ? -6.801  15.587  106.011 1.00 34.96  ? 242  PHE D CA  1 
ATOM   7419 C C   . PHE D 2 68  ? -7.509  16.886  105.644 1.00 36.66  ? 242  PHE D C   1 
ATOM   7420 O O   . PHE D 2 68  ? -8.591  16.873  105.047 1.00 36.18  ? 242  PHE D O   1 
ATOM   7421 C CB  . PHE D 2 68  ? -6.842  15.403  107.529 1.00 32.31  ? 242  PHE D CB  1 
ATOM   7422 C CG  . PHE D 2 68  ? -8.231  15.160  108.067 1.00 31.31  ? 242  PHE D CG  1 
ATOM   7423 C CD1 . PHE D 2 68  ? -8.739  13.865  108.166 1.00 30.91  ? 242  PHE D CD1 1 
ATOM   7424 C CD2 . PHE D 2 68  ? -9.039  16.227  108.447 1.00 29.46  ? 242  PHE D CD2 1 
ATOM   7425 C CE1 . PHE D 2 68  ? -10.028 13.637  108.635 1.00 29.42  ? 242  PHE D CE1 1 
ATOM   7426 C CE2 . PHE D 2 68  ? -10.334 16.011  108.918 1.00 30.06  ? 242  PHE D CE2 1 
ATOM   7427 C CZ  . PHE D 2 68  ? -10.828 14.719  109.013 1.00 29.47  ? 242  PHE D CZ  1 
ATOM   7428 N N   . LEU D 2 69  ? -6.900  18.010  106.011 1.00 38.65  ? 243  LEU D N   1 
ATOM   7429 C CA  . LEU D 2 69  ? -7.495  19.312  105.715 1.00 41.11  ? 243  LEU D CA  1 
ATOM   7430 C C   . LEU D 2 69  ? -7.491  19.581  104.218 1.00 42.34  ? 243  LEU D C   1 
ATOM   7431 O O   . LEU D 2 69  ? -8.248  20.420  103.736 1.00 44.97  ? 243  LEU D O   1 
ATOM   7432 C CB  . LEU D 2 69  ? -6.754  20.433  106.456 1.00 41.16  ? 243  LEU D CB  1 
ATOM   7433 C CG  . LEU D 2 69  ? -6.785  20.393  107.998 1.00 41.69  ? 243  LEU D CG  1 
ATOM   7434 C CD1 . LEU D 2 69  ? -6.019  21.585  108.539 1.00 42.03  ? 243  LEU D CD1 1 
ATOM   7435 C CD2 . LEU D 2 69  ? -8.219  20.417  108.524 1.00 37.07  ? 243  LEU D CD2 1 
ATOM   7436 N N   . SER D 2 70  ? -6.646  18.863  103.480 1.00 42.49  ? 244  SER D N   1 
ATOM   7437 C CA  . SER D 2 70  ? -6.582  19.026  102.030 1.00 42.65  ? 244  SER D CA  1 
ATOM   7438 C C   . SER D 2 70  ? -7.879  18.552  101.389 1.00 43.85  ? 244  SER D C   1 
ATOM   7439 O O   . SER D 2 70  ? -8.139  18.874  100.237 1.00 46.71  ? 244  SER D O   1 
ATOM   7440 C CB  . SER D 2 70  ? -5.428  18.216  101.421 1.00 41.59  ? 244  SER D CB  1 
ATOM   7441 O OG  . SER D 2 70  ? -4.154  18.783  101.683 1.00 41.59  ? 244  SER D OG  1 
ATOM   7442 N N   . SER D 2 71  ? -8.690  17.793  102.125 1.00 42.75  ? 245  SER D N   1 
ATOM   7443 C CA  . SER D 2 71  ? -9.939  17.279  101.567 1.00 42.17  ? 245  SER D CA  1 
ATOM   7444 C C   . SER D 2 71  ? -11.137 17.389  102.498 1.00 41.67  ? 245  SER D C   1 
ATOM   7445 O O   . SER D 2 71  ? -12.282 17.303  102.056 1.00 40.65  ? 245  SER D O   1 
ATOM   7446 C CB  . SER D 2 71  ? -9.767  15.812  101.154 1.00 43.32  ? 245  SER D CB  1 
ATOM   7447 O OG  . SER D 2 71  ? -9.785  14.946  102.279 1.00 45.39  ? 245  SER D OG  1 
ATOM   7448 N N   . MET D 2 72  ? -10.878 17.579  103.786 1.00 41.33  ? 246  MET D N   1 
ATOM   7449 C CA  . MET D 2 72  ? -11.954 17.701  104.761 1.00 40.18  ? 246  MET D CA  1 
ATOM   7450 C C   . MET D 2 72  ? -12.119 19.115  105.322 1.00 40.68  ? 246  MET D C   1 
ATOM   7451 O O   . MET D 2 72  ? -11.223 19.652  105.977 1.00 39.32  ? 246  MET D O   1 
ATOM   7452 C CB  . MET D 2 72  ? -11.713 16.720  105.902 1.00 39.92  ? 246  MET D CB  1 
ATOM   7453 C CG  . MET D 2 72  ? -11.781 15.270  105.471 1.00 40.64  ? 246  MET D CG  1 
ATOM   7454 S SD  . MET D 2 72  ? -13.451 14.782  104.987 1.00 38.47  ? 246  MET D SD  1 
ATOM   7455 C CE  . MET D 2 72  ? -14.144 14.398  106.611 1.00 36.87  ? 246  MET D CE  1 
ATOM   7456 N N   . SER D 2 73  ? -13.275 19.712  105.058 1.00 40.68  ? 247  SER D N   1 
ATOM   7457 C CA  . SER D 2 73  ? -13.577 21.044  105.546 1.00 41.88  ? 247  SER D CA  1 
ATOM   7458 C C   . SER D 2 73  ? -13.824 20.931  107.051 1.00 43.33  ? 247  SER D C   1 
ATOM   7459 O O   . SER D 2 73  ? -14.654 20.132  107.481 1.00 43.71  ? 247  SER D O   1 
ATOM   7460 C CB  . SER D 2 73  ? -14.815 21.577  104.833 1.00 41.09  ? 247  SER D CB  1 
ATOM   7461 O OG  . SER D 2 73  ? -15.269 22.773  105.425 1.00 43.47  ? 247  SER D OG  1 
ATOM   7462 N N   . VAL D 2 74  ? -13.112 21.731  107.847 1.00 43.23  ? 248  VAL D N   1 
ATOM   7463 C CA  . VAL D 2 74  ? -13.233 21.676  109.308 1.00 43.31  ? 248  VAL D CA  1 
ATOM   7464 C C   . VAL D 2 74  ? -13.455 23.034  109.979 1.00 44.75  ? 248  VAL D C   1 
ATOM   7465 O O   . VAL D 2 74  ? -12.910 24.048  109.544 1.00 46.85  ? 248  VAL D O   1 
ATOM   7466 C CB  . VAL D 2 74  ? -11.957 21.048  109.937 1.00 42.58  ? 248  VAL D CB  1 
ATOM   7467 C CG1 . VAL D 2 74  ? -12.123 20.924  111.441 1.00 40.99  ? 248  VAL D CG1 1 
ATOM   7468 C CG2 . VAL D 2 74  ? -11.664 19.695  109.300 1.00 38.12  ? 248  VAL D CG2 1 
ATOM   7469 N N   . LEU D 2 75  ? -14.260 23.047  111.039 1.00 45.09  ? 249  LEU D N   1 
ATOM   7470 C CA  . LEU D 2 75  ? -14.524 24.272  111.784 1.00 43.46  ? 249  LEU D CA  1 
ATOM   7471 C C   . LEU D 2 75  ? -13.383 24.414  112.784 1.00 46.12  ? 249  LEU D C   1 
ATOM   7472 O O   . LEU D 2 75  ? -12.817 23.406  113.232 1.00 44.95  ? 249  LEU D O   1 
ATOM   7473 C CB  . LEU D 2 75  ? -15.856 24.187  112.521 1.00 41.20  ? 249  LEU D CB  1 
ATOM   7474 C CG  . LEU D 2 75  ? -17.147 24.172  111.697 1.00 42.20  ? 249  LEU D CG  1 
ATOM   7475 C CD1 . LEU D 2 75  ? -18.323 24.155  112.650 1.00 41.97  ? 249  LEU D CD1 1 
ATOM   7476 C CD2 . LEU D 2 75  ? -17.235 25.390  110.796 1.00 39.40  ? 249  LEU D CD2 1 
ATOM   7477 N N   . ARG D 2 76  ? -13.048 25.653  113.146 1.00 48.39  ? 250  ARG D N   1 
ATOM   7478 C CA  . ARG D 2 76  ? -11.936 25.875  114.062 1.00 49.93  ? 250  ARG D CA  1 
ATOM   7479 C C   . ARG D 2 76  ? -12.088 25.229  115.436 1.00 48.49  ? 250  ARG D C   1 
ATOM   7480 O O   . ARG D 2 76  ? -11.093 24.868  116.066 1.00 48.41  ? 250  ARG D O   1 
ATOM   7481 C CB  . ARG D 2 76  ? -11.622 27.376  114.196 1.00 52.37  ? 250  ARG D CB  1 
ATOM   7482 C CG  . ARG D 2 76  ? -12.588 28.256  114.985 1.00 57.59  ? 250  ARG D CG  1 
ATOM   7483 C CD  . ARG D 2 76  ? -11.765 29.382  115.625 1.00 62.07  ? 250  ARG D CD  1 
ATOM   7484 N NE  . ARG D 2 76  ? -12.478 30.612  115.968 1.00 65.52  ? 250  ARG D NE  1 
ATOM   7485 C CZ  . ARG D 2 76  ? -12.883 31.523  115.086 1.00 69.83  ? 250  ARG D CZ  1 
ATOM   7486 N NH1 . ARG D 2 76  ? -13.515 32.611  115.510 1.00 70.52  ? 250  ARG D NH1 1 
ATOM   7487 N NH2 . ARG D 2 76  ? -12.673 31.343  113.784 1.00 71.53  ? 250  ARG D NH2 1 
ATOM   7488 N N   . GLY D 2 77  ? -13.327 25.057  115.884 1.00 47.87  ? 251  GLY D N   1 
ATOM   7489 C CA  . GLY D 2 77  ? -13.562 24.440  117.180 1.00 46.20  ? 251  GLY D CA  1 
ATOM   7490 C C   . GLY D 2 77  ? -13.116 22.992  117.260 1.00 45.11  ? 251  GLY D C   1 
ATOM   7491 O O   . GLY D 2 77  ? -12.962 22.438  118.350 1.00 43.60  ? 251  GLY D O   1 
ATOM   7492 N N   . LYS D 2 78  ? -12.898 22.375  116.105 1.00 45.07  ? 252  LYS D N   1 
ATOM   7493 C CA  . LYS D 2 78  ? -12.473 20.982  116.064 1.00 46.55  ? 252  LYS D CA  1 
ATOM   7494 C C   . LYS D 2 78  ? -11.054 20.803  115.541 1.00 45.72  ? 252  LYS D C   1 
ATOM   7495 O O   . LYS D 2 78  ? -10.521 19.695  115.555 1.00 46.33  ? 252  LYS D O   1 
ATOM   7496 C CB  . LYS D 2 78  ? -13.437 20.173  115.197 1.00 46.49  ? 252  LYS D CB  1 
ATOM   7497 C CG  . LYS D 2 78  ? -14.858 20.128  115.727 1.00 46.96  ? 252  LYS D CG  1 
ATOM   7498 C CD  . LYS D 2 78  ? -14.962 19.176  116.895 1.00 49.56  ? 252  LYS D CD  1 
ATOM   7499 C CE  . LYS D 2 78  ? -16.406 18.964  117.305 1.00 51.33  ? 252  LYS D CE  1 
ATOM   7500 N NZ  . LYS D 2 78  ? -16.939 20.145  118.028 1.00 53.67  ? 252  LYS D NZ  1 
ATOM   7501 N N   . LEU D 2 79  ? -10.443 21.892  115.083 1.00 46.42  ? 253  LEU D N   1 
ATOM   7502 C CA  . LEU D 2 79  ? -9.082  21.835  114.554 1.00 45.89  ? 253  LEU D CA  1 
ATOM   7503 C C   . LEU D 2 79  ? -8.135  21.113  115.506 1.00 46.08  ? 253  LEU D C   1 
ATOM   7504 O O   . LEU D 2 79  ? -7.317  20.296  115.077 1.00 44.90  ? 253  LEU D O   1 
ATOM   7505 C CB  . LEU D 2 79  ? -8.549  23.247  114.268 1.00 44.75  ? 253  LEU D CB  1 
ATOM   7506 C CG  . LEU D 2 79  ? -7.131  23.329  113.670 1.00 45.16  ? 253  LEU D CG  1 
ATOM   7507 C CD1 . LEU D 2 79  ? -7.043  22.513  112.377 1.00 41.91  ? 253  LEU D CD1 1 
ATOM   7508 C CD2 . LEU D 2 79  ? -6.771  24.788  113.400 1.00 41.88  ? 253  LEU D CD2 1 
ATOM   7509 N N   . GLN D 2 80  ? -8.245  21.401  116.799 1.00 46.81  ? 254  GLN D N   1 
ATOM   7510 C CA  . GLN D 2 80  ? -7.372  20.747  117.757 1.00 46.19  ? 254  GLN D CA  1 
ATOM   7511 C C   . GLN D 2 80  ? -7.725  19.275  117.911 1.00 45.52  ? 254  GLN D C   1 
ATOM   7512 O O   . GLN D 2 80  ? -6.897  18.478  118.361 1.00 47.10  ? 254  GLN D O   1 
ATOM   7513 C CB  . GLN D 2 80  ? -7.427  21.431  119.118 1.00 47.73  ? 254  GLN D CB  1 
ATOM   7514 C CG  . GLN D 2 80  ? -6.298  20.963  120.029 1.00 51.85  ? 254  GLN D CG  1 
ATOM   7515 C CD  . GLN D 2 80  ? -6.339  21.565  121.425 1.00 53.75  ? 254  GLN D CD  1 
ATOM   7516 O OE1 . GLN D 2 80  ? -5.406  21.386  122.209 1.00 55.81  ? 254  GLN D OE1 1 
ATOM   7517 N NE2 . GLN D 2 80  ? -7.419  22.271  121.745 1.00 54.42  ? 254  GLN D NE2 1 
ATOM   7518 N N   . LEU D 2 81  ? -8.948  18.902  117.544 1.00 43.25  ? 255  LEU D N   1 
ATOM   7519 C CA  . LEU D 2 81  ? -9.345  17.502  117.648 1.00 41.19  ? 255  LEU D CA  1 
ATOM   7520 C C   . LEU D 2 81  ? -8.667  16.713  116.529 1.00 41.52  ? 255  LEU D C   1 
ATOM   7521 O O   . LEU D 2 81  ? -8.281  15.556  116.706 1.00 41.98  ? 255  LEU D O   1 
ATOM   7522 C CB  . LEU D 2 81  ? -10.865 17.357  117.565 1.00 40.67  ? 255  LEU D CB  1 
ATOM   7523 C CG  . LEU D 2 81  ? -11.370 15.913  117.607 1.00 40.40  ? 255  LEU D CG  1 
ATOM   7524 C CD1 . LEU D 2 81  ? -10.723 15.158  118.756 1.00 38.96  ? 255  LEU D CD1 1 
ATOM   7525 C CD2 . LEU D 2 81  ? -12.861 15.913  117.739 1.00 36.66  ? 255  LEU D CD2 1 
ATOM   7526 N N   . VAL D 2 82  ? -8.516  17.344  115.371 1.00 39.90  ? 256  VAL D N   1 
ATOM   7527 C CA  . VAL D 2 82  ? -7.845  16.689  114.258 1.00 38.80  ? 256  VAL D CA  1 
ATOM   7528 C C   . VAL D 2 82  ? -6.373  16.508  114.637 1.00 40.03  ? 256  VAL D C   1 
ATOM   7529 O O   . VAL D 2 82  ? -5.821  15.407  114.540 1.00 39.99  ? 256  VAL D O   1 
ATOM   7530 C CB  . VAL D 2 82  ? -7.955  17.539  112.973 1.00 37.19  ? 256  VAL D CB  1 
ATOM   7531 C CG1 . VAL D 2 82  ? -7.013  17.017  111.914 1.00 35.66  ? 256  VAL D CG1 1 
ATOM   7532 C CG2 . VAL D 2 82  ? -9.389  17.513  112.465 1.00 32.34  ? 256  VAL D CG2 1 
ATOM   7533 N N   . GLY D 2 83  ? -5.756  17.604  115.080 1.00 40.71  ? 257  GLY D N   1 
ATOM   7534 C CA  . GLY D 2 83  ? -4.358  17.595  115.484 1.00 39.09  ? 257  GLY D CA  1 
ATOM   7535 C C   . GLY D 2 83  ? -4.024  16.530  116.508 1.00 39.45  ? 257  GLY D C   1 
ATOM   7536 O O   . GLY D 2 83  ? -2.968  15.905  116.435 1.00 39.43  ? 257  GLY D O   1 
ATOM   7537 N N   . THR D 2 84  ? -4.916  16.312  117.468 1.00 39.60  ? 258  THR D N   1 
ATOM   7538 C CA  . THR D 2 84  ? -4.665  15.293  118.471 1.00 39.04  ? 258  THR D CA  1 
ATOM   7539 C C   . THR D 2 84  ? -4.771  13.899  117.845 1.00 37.53  ? 258  THR D C   1 
ATOM   7540 O O   . THR D 2 84  ? -3.918  13.044  118.076 1.00 36.20  ? 258  THR D O   1 
ATOM   7541 C CB  . THR D 2 84  ? -5.657  15.397  119.647 1.00 41.13  ? 258  THR D CB  1 
ATOM   7542 O OG1 . THR D 2 84  ? -5.624  16.724  120.181 1.00 41.65  ? 258  THR D OG1 1 
ATOM   7543 C CG2 . THR D 2 84  ? -5.277  14.415  120.751 1.00 40.24  ? 258  THR D CG2 1 
ATOM   7544 N N   . ALA D 2 85  ? -5.812  13.664  117.050 1.00 37.12  ? 259  ALA D N   1 
ATOM   7545 C CA  . ALA D 2 85  ? -5.970  12.346  116.423 1.00 36.70  ? 259  ALA D CA  1 
ATOM   7546 C C   . ALA D 2 85  ? -4.753  12.073  115.558 1.00 34.57  ? 259  ALA D C   1 
ATOM   7547 O O   . ALA D 2 85  ? -4.284  10.939  115.469 1.00 33.86  ? 259  ALA D O   1 
ATOM   7548 C CB  . ALA D 2 85  ? -7.250  12.283  115.577 1.00 31.84  ? 259  ALA D CB  1 
ATOM   7549 N N   . ALA D 2 86  ? -4.233  13.128  114.941 1.00 34.81  ? 260  ALA D N   1 
ATOM   7550 C CA  . ALA D 2 86  ? -3.059  13.006  114.088 1.00 36.66  ? 260  ALA D CA  1 
ATOM   7551 C C   . ALA D 2 86  ? -1.805  12.624  114.882 1.00 37.85  ? 260  ALA D C   1 
ATOM   7552 O O   . ALA D 2 86  ? -1.014  11.783  114.446 1.00 38.32  ? 260  ALA D O   1 
ATOM   7553 C CB  . ALA D 2 86  ? -2.828  14.305  113.343 1.00 35.45  ? 260  ALA D CB  1 
ATOM   7554 N N   . MET D 2 87  ? -1.634  13.241  116.048 1.00 38.47  ? 261  MET D N   1 
ATOM   7555 C CA  . MET D 2 87  ? -0.476  12.981  116.894 1.00 39.25  ? 261  MET D CA  1 
ATOM   7556 C C   . MET D 2 87  ? -0.540  11.546  117.414 1.00 40.83  ? 261  MET D C   1 
ATOM   7557 O O   . MET D 2 87  ? 0.483   10.871  117.589 1.00 41.31  ? 261  MET D O   1 
ATOM   7558 C CB  . MET D 2 87  ? -0.462  13.970  118.068 1.00 39.22  ? 261  MET D CB  1 
ATOM   7559 C CG  . MET D 2 87  ? 0.901   14.182  118.706 1.00 38.40  ? 261  MET D CG  1 
ATOM   7560 S SD  . MET D 2 87  ? 2.087   14.743  117.475 1.00 44.67  ? 261  MET D SD  1 
ATOM   7561 C CE  . MET D 2 87  ? 3.598   14.777  118.424 1.00 43.36  ? 261  MET D CE  1 
ATOM   7562 N N   . LEU D 2 88  ? -1.760  11.087  117.656 1.00 40.65  ? 262  LEU D N   1 
ATOM   7563 C CA  . LEU D 2 88  ? -1.993  9.745   118.155 1.00 40.55  ? 262  LEU D CA  1 
ATOM   7564 C C   . LEU D 2 88  ? -1.561  8.724   117.106 1.00 40.67  ? 262  LEU D C   1 
ATOM   7565 O O   . LEU D 2 88  ? -0.795  7.796   117.404 1.00 42.44  ? 262  LEU D O   1 
ATOM   7566 C CB  . LEU D 2 88  ? -3.482  9.576   118.491 1.00 40.71  ? 262  LEU D CB  1 
ATOM   7567 C CG  . LEU D 2 88  ? -4.011  8.247   119.039 1.00 39.94  ? 262  LEU D CG  1 
ATOM   7568 C CD1 . LEU D 2 88  ? -3.351  7.923   120.368 1.00 40.24  ? 262  LEU D CD1 1 
ATOM   7569 C CD2 . LEU D 2 88  ? -5.517  8.343   119.202 1.00 36.50  ? 262  LEU D CD2 1 
ATOM   7570 N N   . LEU D 2 89  ? -2.038  8.908   115.877 1.00 38.58  ? 263  LEU D N   1 
ATOM   7571 C CA  . LEU D 2 89  ? -1.710  7.994   114.792 1.00 36.53  ? 263  LEU D CA  1 
ATOM   7572 C C   . LEU D 2 89  ? -0.227  7.959   114.506 1.00 36.36  ? 263  LEU D C   1 
ATOM   7573 O O   . LEU D 2 89  ? 0.354   6.876   114.370 1.00 36.69  ? 263  LEU D O   1 
ATOM   7574 C CB  . LEU D 2 89  ? -2.479  8.372   113.532 1.00 36.37  ? 263  LEU D CB  1 
ATOM   7575 C CG  . LEU D 2 89  ? -3.955  7.996   113.625 1.00 36.62  ? 263  LEU D CG  1 
ATOM   7576 C CD1 . LEU D 2 89  ? -4.764  8.735   112.576 1.00 37.83  ? 263  LEU D CD1 1 
ATOM   7577 C CD2 . LEU D 2 89  ? -4.082  6.488   113.473 1.00 36.64  ? 263  LEU D CD2 1 
ATOM   7578 N N   . ALA D 2 90  ? 0.389   9.137   114.423 1.00 35.24  ? 264  ALA D N   1 
ATOM   7579 C CA  . ALA D 2 90  ? 1.822   9.222   114.160 1.00 34.77  ? 264  ALA D CA  1 
ATOM   7580 C C   . ALA D 2 90  ? 2.572   8.430   115.214 1.00 35.57  ? 264  ALA D C   1 
ATOM   7581 O O   . ALA D 2 90  ? 3.534   7.722   114.907 1.00 36.71  ? 264  ALA D O   1 
ATOM   7582 C CB  . ALA D 2 90  ? 2.272   10.666  114.184 1.00 36.17  ? 264  ALA D CB  1 
ATOM   7583 N N   . SER D 2 91  ? 2.111   8.553   116.459 1.00 37.32  ? 265  SER D N   1 
ATOM   7584 C CA  . SER D 2 91  ? 2.707   7.858   117.596 1.00 36.61  ? 265  SER D CA  1 
ATOM   7585 C C   . SER D 2 91  ? 2.503   6.348   117.506 1.00 37.97  ? 265  SER D C   1 
ATOM   7586 O O   . SER D 2 91  ? 3.464   5.583   117.625 1.00 37.17  ? 265  SER D O   1 
ATOM   7587 C CB  . SER D 2 91  ? 2.110   8.381   118.896 1.00 36.56  ? 265  SER D CB  1 
ATOM   7588 O OG  . SER D 2 91  ? 2.358   9.767   119.019 1.00 38.78  ? 265  SER D OG  1 
ATOM   7589 N N   . LYS D 2 92  ? 1.263   5.910   117.303 1.00 37.26  ? 266  LYS D N   1 
ATOM   7590 C CA  . LYS D 2 92  ? 1.017   4.479   117.188 1.00 37.34  ? 266  LYS D CA  1 
ATOM   7591 C C   . LYS D 2 92  ? 1.853   3.929   116.038 1.00 39.04  ? 266  LYS D C   1 
ATOM   7592 O O   . LYS D 2 92  ? 2.288   2.781   116.083 1.00 42.53  ? 266  LYS D O   1 
ATOM   7593 C CB  . LYS D 2 92  ? -0.468  4.184   116.933 1.00 36.42  ? 266  LYS D CB  1 
ATOM   7594 C CG  . LYS D 2 92  ? -1.397  4.482   118.105 1.00 33.15  ? 266  LYS D CG  1 
ATOM   7595 C CD  . LYS D 2 92  ? -2.771  3.896   117.864 1.00 32.25  ? 266  LYS D CD  1 
ATOM   7596 C CE  . LYS D 2 92  ? -3.723  4.206   119.006 1.00 35.32  ? 266  LYS D CE  1 
ATOM   7597 N NZ  . LYS D 2 92  ? -5.134  3.793   118.722 1.00 32.83  ? 266  LYS D NZ  1 
ATOM   7598 N N   . PHE D 2 93  ? 2.100   4.749   115.019 1.00 38.97  ? 267  PHE D N   1 
ATOM   7599 C CA  . PHE D 2 93  ? 2.889   4.309   113.873 1.00 39.70  ? 267  PHE D CA  1 
ATOM   7600 C C   . PHE D 2 93  ? 4.399   4.323   114.094 1.00 41.84  ? 267  PHE D C   1 
ATOM   7601 O O   . PHE D 2 93  ? 5.077   3.328   113.824 1.00 42.56  ? 267  PHE D O   1 
ATOM   7602 C CB  . PHE D 2 93  ? 2.587   5.174   112.646 1.00 38.62  ? 267  PHE D CB  1 
ATOM   7603 C CG  . PHE D 2 93  ? 3.310   4.734   111.387 1.00 36.56  ? 267  PHE D CG  1 
ATOM   7604 C CD1 . PHE D 2 93  ? 2.722   3.827   110.508 1.00 36.66  ? 267  PHE D CD1 1 
ATOM   7605 C CD2 . PHE D 2 93  ? 4.570   5.236   111.077 1.00 36.44  ? 267  PHE D CD2 1 
ATOM   7606 C CE1 . PHE D 2 93  ? 3.376   3.428   109.333 1.00 35.98  ? 267  PHE D CE1 1 
ATOM   7607 C CE2 . PHE D 2 93  ? 5.236   4.845   109.906 1.00 36.90  ? 267  PHE D CE2 1 
ATOM   7608 C CZ  . PHE D 2 93  ? 4.639   3.941   109.031 1.00 36.77  ? 267  PHE D CZ  1 
ATOM   7609 N N   . GLU D 2 94  ? 4.922   5.440   114.597 1.00 41.84  ? 268  GLU D N   1 
ATOM   7610 C CA  . GLU D 2 94  ? 6.374   5.600   114.775 1.00 43.69  ? 268  GLU D CA  1 
ATOM   7611 C C   . GLU D 2 94  ? 7.085   5.199   116.082 1.00 42.40  ? 268  GLU D C   1 
ATOM   7612 O O   . GLU D 2 94  ? 8.199   4.688   116.041 1.00 42.50  ? 268  GLU D O   1 
ATOM   7613 C CB  . GLU D 2 94  ? 6.731   7.056   114.447 1.00 42.35  ? 268  GLU D CB  1 
ATOM   7614 C CG  . GLU D 2 94  ? 8.215   7.367   114.299 1.00 41.94  ? 268  GLU D CG  1 
ATOM   7615 C CD  . GLU D 2 94  ? 8.865   6.650   113.129 1.00 42.27  ? 268  GLU D CD  1 
ATOM   7616 O OE1 . GLU D 2 94  ? 8.225   6.502   112.067 1.00 40.84  ? 268  GLU D OE1 1 
ATOM   7617 O OE2 . GLU D 2 94  ? 10.038  6.248   113.267 1.00 45.55  ? 268  GLU D OE2 1 
ATOM   7618 N N   . GLU D 2 95  ? 6.443   5.440   117.222 1.00 42.86  ? 269  GLU D N   1 
ATOM   7619 C CA  . GLU D 2 95  ? 7.005   5.176   118.546 1.00 42.86  ? 269  GLU D CA  1 
ATOM   7620 C C   . GLU D 2 95  ? 7.087   3.732   119.034 1.00 43.75  ? 269  GLU D C   1 
ATOM   7621 O O   . GLU D 2 95  ? 6.313   2.874   118.626 1.00 45.54  ? 269  GLU D O   1 
ATOM   7622 C CB  . GLU D 2 95  ? 6.224   5.968   119.593 1.00 42.92  ? 269  GLU D CB  1 
ATOM   7623 C CG  . GLU D 2 95  ? 6.163   7.457   119.355 1.00 45.49  ? 269  GLU D CG  1 
ATOM   7624 C CD  . GLU D 2 95  ? 7.517   8.119   119.459 1.00 48.46  ? 269  GLU D CD  1 
ATOM   7625 O OE1 . GLU D 2 95  ? 8.235   7.868   120.451 1.00 49.93  ? 269  GLU D OE1 1 
ATOM   7626 O OE2 . GLU D 2 95  ? 7.860   8.899   118.549 1.00 48.80  ? 269  GLU D OE2 1 
ATOM   7627 N N   . ILE D 2 96  ? 8.025   3.485   119.940 1.00 43.76  ? 270  ILE D N   1 
ATOM   7628 C CA  . ILE D 2 96  ? 8.191   2.168   120.524 1.00 45.18  ? 270  ILE D CA  1 
ATOM   7629 C C   . ILE D 2 96  ? 7.201   2.104   121.669 1.00 45.86  ? 270  ILE D C   1 
ATOM   7630 O O   . ILE D 2 96  ? 6.657   1.047   121.984 1.00 47.16  ? 270  ILE D O   1 
ATOM   7631 C CB  . ILE D 2 96  ? 9.622   1.955   121.070 1.00 45.95  ? 270  ILE D CB  1 
ATOM   7632 C CG1 . ILE D 2 96  ? 10.621  2.006   119.914 1.00 47.06  ? 270  ILE D CG1 1 
ATOM   7633 C CG2 . ILE D 2 96  ? 9.718   0.607   121.786 1.00 44.69  ? 270  ILE D CG2 1 
ATOM   7634 C CD1 . ILE D 2 96  ? 12.034  1.604   120.293 1.00 50.71  ? 270  ILE D CD1 1 
ATOM   7635 N N   . TYR D 2 97  ? 6.976   3.249   122.298 1.00 46.98  ? 271  TYR D N   1 
ATOM   7636 C CA  . TYR D 2 97  ? 6.018   3.338   123.390 1.00 48.54  ? 271  TYR D CA  1 
ATOM   7637 C C   . TYR D 2 97  ? 5.175   4.580   123.161 1.00 48.78  ? 271  TYR D C   1 
ATOM   7638 O O   . TYR D 2 97  ? 5.535   5.674   123.598 1.00 49.89  ? 271  TYR D O   1 
ATOM   7639 C CB  . TYR D 2 97  ? 6.720   3.453   124.737 1.00 49.83  ? 271  TYR D CB  1 
ATOM   7640 C CG  . TYR D 2 97  ? 7.684   2.336   125.034 1.00 50.74  ? 271  TYR D CG  1 
ATOM   7641 C CD1 . TYR D 2 97  ? 7.256   1.015   125.090 1.00 51.18  ? 271  TYR D CD1 1 
ATOM   7642 C CD2 . TYR D 2 97  ? 9.026   2.607   125.274 1.00 52.40  ? 271  TYR D CD2 1 
ATOM   7643 C CE1 . TYR D 2 97  ? 8.142   -0.013  125.381 1.00 53.09  ? 271  TYR D CE1 1 
ATOM   7644 C CE2 . TYR D 2 97  ? 9.922   1.592   125.565 1.00 54.85  ? 271  TYR D CE2 1 
ATOM   7645 C CZ  . TYR D 2 97  ? 9.477   0.284   125.619 1.00 55.13  ? 271  TYR D CZ  1 
ATOM   7646 O OH  . TYR D 2 97  ? 10.373  -0.716  125.923 1.00 56.56  ? 271  TYR D OH  1 
ATOM   7647 N N   . PRO D 2 98  ? 4.047   4.429   122.454 1.00 48.00  ? 272  PRO D N   1 
ATOM   7648 C CA  . PRO D 2 98  ? 3.183   5.576   122.194 1.00 46.82  ? 272  PRO D CA  1 
ATOM   7649 C C   . PRO D 2 98  ? 2.387   5.895   123.448 1.00 46.73  ? 272  PRO D C   1 
ATOM   7650 O O   . PRO D 2 98  ? 2.006   4.993   124.179 1.00 47.88  ? 272  PRO D O   1 
ATOM   7651 C CB  . PRO D 2 98  ? 2.298   5.074   121.059 1.00 46.45  ? 272  PRO D CB  1 
ATOM   7652 C CG  . PRO D 2 98  ? 2.105   3.635   121.425 1.00 45.93  ? 272  PRO D CG  1 
ATOM   7653 C CD  . PRO D 2 98  ? 3.506   3.208   121.825 1.00 47.47  ? 272  PRO D CD  1 
ATOM   7654 N N   . PRO D 2 99  ? 2.164   7.182   123.739 1.00 47.25  ? 273  PRO D N   1 
ATOM   7655 C CA  . PRO D 2 99  ? 1.389   7.502   124.939 1.00 48.44  ? 273  PRO D CA  1 
ATOM   7656 C C   . PRO D 2 99  ? -0.020  6.934   124.749 1.00 50.22  ? 273  PRO D C   1 
ATOM   7657 O O   . PRO D 2 99  ? -0.438  6.673   123.615 1.00 50.46  ? 273  PRO D O   1 
ATOM   7658 C CB  . PRO D 2 99  ? 1.391   9.030   124.952 1.00 48.22  ? 273  PRO D CB  1 
ATOM   7659 C CG  . PRO D 2 99  ? 2.693   9.368   124.297 1.00 47.45  ? 273  PRO D CG  1 
ATOM   7660 C CD  . PRO D 2 99  ? 2.738   8.400   123.141 1.00 47.18  ? 273  PRO D CD  1 
ATOM   7661 N N   . GLU D 2 100 ? -0.749  6.737   125.842 1.00 50.31  ? 274  GLU D N   1 
ATOM   7662 C CA  . GLU D 2 100 ? -2.103  6.208   125.737 1.00 49.35  ? 274  GLU D CA  1 
ATOM   7663 C C   . GLU D 2 100 ? -3.102  7.335   125.489 1.00 47.92  ? 274  GLU D C   1 
ATOM   7664 O O   . GLU D 2 100 ? -2.858  8.482   125.861 1.00 46.72  ? 274  GLU D O   1 
ATOM   7665 C CB  . GLU D 2 100 ? -2.460  5.431   127.002 1.00 52.38  ? 274  GLU D CB  1 
ATOM   7666 C CG  . GLU D 2 100 ? -2.316  6.217   128.296 1.00 56.98  ? 274  GLU D CG  1 
ATOM   7667 C CD  . GLU D 2 100 ? -2.438  5.331   129.522 1.00 58.88  ? 274  GLU D CD  1 
ATOM   7668 O OE1 . GLU D 2 100 ? -1.541  4.486   129.731 1.00 59.44  ? 274  GLU D OE1 1 
ATOM   7669 O OE2 . GLU D 2 100 ? -3.429  5.470   130.270 1.00 59.72  ? 274  GLU D OE2 1 
ATOM   7670 N N   . VAL D 2 101 ? -4.223  7.004   124.855 1.00 47.22  ? 275  VAL D N   1 
ATOM   7671 C CA  . VAL D 2 101 ? -5.253  7.996   124.538 1.00 47.27  ? 275  VAL D CA  1 
ATOM   7672 C C   . VAL D 2 101 ? -5.529  8.942   125.703 1.00 47.86  ? 275  VAL D C   1 
ATOM   7673 O O   . VAL D 2 101 ? -5.780  10.136  125.503 1.00 48.43  ? 275  VAL D O   1 
ATOM   7674 C CB  . VAL D 2 101 ? -6.594  7.332   124.129 1.00 45.52  ? 275  VAL D CB  1 
ATOM   7675 C CG1 . VAL D 2 101 ? -7.483  8.361   123.458 1.00 44.12  ? 275  VAL D CG1 1 
ATOM   7676 C CG2 . VAL D 2 101 ? -6.349  6.162   123.200 1.00 44.52  ? 275  VAL D CG2 1 
ATOM   7677 N N   . ALA D 2 102 ? -5.484  8.408   126.918 1.00 48.21  ? 276  ALA D N   1 
ATOM   7678 C CA  . ALA D 2 102 ? -5.723  9.214   128.106 1.00 49.31  ? 276  ALA D CA  1 
ATOM   7679 C C   . ALA D 2 102 ? -4.845  10.465  128.092 1.00 51.31  ? 276  ALA D C   1 
ATOM   7680 O O   . ALA D 2 102 ? -5.321  11.548  128.438 1.00 51.60  ? 276  ALA D O   1 
ATOM   7681 C CB  . ALA D 2 102 ? -5.453  8.397   129.354 1.00 49.89  ? 276  ALA D CB  1 
ATOM   7682 N N   . GLU D 2 103 ? -3.576  10.315  127.685 1.00 51.23  ? 277  GLU D N   1 
ATOM   7683 C CA  . GLU D 2 103 ? -2.636  11.442  127.619 1.00 51.53  ? 277  GLU D CA  1 
ATOM   7684 C C   . GLU D 2 103 ? -3.080  12.390  126.539 1.00 51.51  ? 277  GLU D C   1 
ATOM   7685 O O   . GLU D 2 103 ? -3.070  13.607  126.712 1.00 49.72  ? 277  GLU D O   1 
ATOM   7686 C CB  . GLU D 2 103 ? -1.220  10.994  127.254 1.00 53.71  ? 277  GLU D CB  1 
ATOM   7687 C CG  . GLU D 2 103 ? -0.608  9.922   128.135 1.00 57.13  ? 277  GLU D CG  1 
ATOM   7688 C CD  . GLU D 2 103 ? -0.810  10.175  129.618 1.00 58.53  ? 277  GLU D CD  1 
ATOM   7689 O OE1 . GLU D 2 103 ? -0.607  11.325  130.080 1.00 57.21  ? 277  GLU D OE1 1 
ATOM   7690 O OE2 . GLU D 2 103 ? -1.164  9.201   130.318 1.00 61.98  ? 277  GLU D OE2 1 
ATOM   7691 N N   . PHE D 2 104 ? -3.452  11.814  125.405 1.00 52.75  ? 278  PHE D N   1 
ATOM   7692 C CA  . PHE D 2 104 ? -3.900  12.601  124.271 1.00 52.90  ? 278  PHE D CA  1 
ATOM   7693 C C   . PHE D 2 104 ? -5.162  13.405  124.571 1.00 53.05  ? 278  PHE D C   1 
ATOM   7694 O O   . PHE D 2 104 ? -5.402  14.437  123.942 1.00 53.81  ? 278  PHE D O   1 
ATOM   7695 C CB  . PHE D 2 104 ? -4.068  11.688  123.058 1.00 51.23  ? 278  PHE D CB  1 
ATOM   7696 C CG  . PHE D 2 104 ? -2.760  11.278  122.448 1.00 48.88  ? 278  PHE D CG  1 
ATOM   7697 C CD1 . PHE D 2 104 ? -2.017  12.185  121.709 1.00 49.19  ? 278  PHE D CD1 1 
ATOM   7698 C CD2 . PHE D 2 104 ? -2.239  10.017  122.663 1.00 48.60  ? 278  PHE D CD2 1 
ATOM   7699 C CE1 . PHE D 2 104 ? -0.772  11.840  121.196 1.00 48.34  ? 278  PHE D CE1 1 
ATOM   7700 C CE2 . PHE D 2 104 ? -0.994  9.665   122.155 1.00 49.04  ? 278  PHE D CE2 1 
ATOM   7701 C CZ  . PHE D 2 104 ? -0.260  10.580  121.420 1.00 47.74  ? 278  PHE D CZ  1 
ATOM   7702 N N   . VAL D 2 105 ? -5.967  12.951  125.528 1.00 52.23  ? 279  VAL D N   1 
ATOM   7703 C CA  . VAL D 2 105 ? -7.151  13.719  125.889 1.00 53.03  ? 279  VAL D CA  1 
ATOM   7704 C C   . VAL D 2 105 ? -6.664  14.793  126.854 1.00 55.60  ? 279  VAL D C   1 
ATOM   7705 O O   . VAL D 2 105 ? -6.955  15.980  126.699 1.00 58.38  ? 279  VAL D O   1 
ATOM   7706 C CB  . VAL D 2 105 ? -8.201  12.880  126.623 1.00 50.85  ? 279  VAL D CB  1 
ATOM   7707 C CG1 . VAL D 2 105 ? -9.225  13.793  127.251 1.00 48.45  ? 279  VAL D CG1 1 
ATOM   7708 C CG2 . VAL D 2 105 ? -8.882  11.936  125.665 1.00 49.55  ? 279  VAL D CG2 1 
ATOM   7709 N N   . TYR D 2 106 ? -5.905  14.349  127.847 1.00 57.00  ? 280  TYR D N   1 
ATOM   7710 C CA  . TYR D 2 106 ? -5.343  15.208  128.880 1.00 58.07  ? 280  TYR D CA  1 
ATOM   7711 C C   . TYR D 2 106 ? -4.755  16.519  128.357 1.00 58.94  ? 280  TYR D C   1 
ATOM   7712 O O   . TYR D 2 106 ? -5.163  17.603  128.772 1.00 59.61  ? 280  TYR D O   1 
ATOM   7713 C CB  . TYR D 2 106 ? -4.267  14.436  129.635 1.00 60.33  ? 280  TYR D CB  1 
ATOM   7714 C CG  . TYR D 2 106 ? -3.685  15.192  130.795 1.00 62.94  ? 280  TYR D CG  1 
ATOM   7715 C CD1 . TYR D 2 106 ? -4.455  15.463  131.925 1.00 64.38  ? 280  TYR D CD1 1 
ATOM   7716 C CD2 . TYR D 2 106 ? -2.369  15.646  130.763 1.00 63.31  ? 280  TYR D CD2 1 
ATOM   7717 C CE1 . TYR D 2 106 ? -3.930  16.166  132.998 1.00 66.27  ? 280  TYR D CE1 1 
ATOM   7718 C CE2 . TYR D 2 106 ? -1.831  16.352  131.827 1.00 66.58  ? 280  TYR D CE2 1 
ATOM   7719 C CZ  . TYR D 2 106 ? -2.617  16.609  132.944 1.00 68.17  ? 280  TYR D CZ  1 
ATOM   7720 O OH  . TYR D 2 106 ? -2.098  17.312  134.007 1.00 71.14  ? 280  TYR D OH  1 
ATOM   7721 N N   . ILE D 2 107 ? -3.789  16.415  127.453 1.00 58.40  ? 281  ILE D N   1 
ATOM   7722 C CA  . ILE D 2 107 ? -3.141  17.588  126.886 1.00 58.64  ? 281  ILE D CA  1 
ATOM   7723 C C   . ILE D 2 107 ? -4.102  18.601  126.258 1.00 60.47  ? 281  ILE D C   1 
ATOM   7724 O O   . ILE D 2 107 ? -3.728  19.752  126.037 1.00 61.26  ? 281  ILE D O   1 
ATOM   7725 C CB  . ILE D 2 107 ? -2.115  17.184  125.812 1.00 58.60  ? 281  ILE D CB  1 
ATOM   7726 C CG1 . ILE D 2 107 ? -2.827  16.457  124.663 1.00 57.31  ? 281  ILE D CG1 1 
ATOM   7727 C CG2 . ILE D 2 107 ? -1.026  16.319  126.438 1.00 57.95  ? 281  ILE D CG2 1 
ATOM   7728 C CD1 . ILE D 2 107 ? -1.938  16.142  123.478 1.00 54.73  ? 281  ILE D CD1 1 
ATOM   7729 N N   . THR D 2 108 ? -5.328  18.182  125.961 1.00 61.70  ? 282  THR D N   1 
ATOM   7730 C CA  . THR D 2 108 ? -6.301  19.085  125.352 1.00 62.70  ? 282  THR D CA  1 
ATOM   7731 C C   . THR D 2 108 ? -7.159  19.730  126.428 1.00 64.84  ? 282  THR D C   1 
ATOM   7732 O O   . THR D 2 108 ? -8.161  20.380  126.128 1.00 64.87  ? 282  THR D O   1 
ATOM   7733 C CB  . THR D 2 108 ? -7.242  18.345  124.377 1.00 60.83  ? 282  THR D CB  1 
ATOM   7734 O OG1 . THR D 2 108 ? -8.173  17.547  125.119 1.00 58.42  ? 282  THR D OG1 1 
ATOM   7735 C CG2 . THR D 2 108 ? -6.445  17.456  123.439 1.00 60.00  ? 282  THR D CG2 1 
ATOM   7736 N N   . ASP D 2 109 ? -6.757  19.535  127.678 1.00 66.69  ? 283  ASP D N   1 
ATOM   7737 C CA  . ASP D 2 109 ? -7.478  20.079  128.818 1.00 69.23  ? 283  ASP D CA  1 
ATOM   7738 C C   . ASP D 2 109 ? -8.970  19.818  128.723 1.00 70.88  ? 283  ASP D C   1 
ATOM   7739 O O   . ASP D 2 109 ? -9.779  20.752  128.715 1.00 71.19  ? 283  ASP D O   1 
ATOM   7740 C CB  . ASP D 2 109 ? -7.227  21.573  128.939 1.00 70.32  ? 283  ASP D CB  1 
ATOM   7741 C CG  . ASP D 2 109 ? -6.457  21.918  130.187 1.00 73.67  ? 283  ASP D CG  1 
ATOM   7742 O OD1 . ASP D 2 109 ? -5.244  21.607  130.243 1.00 73.80  ? 283  ASP D OD1 1 
ATOM   7743 O OD2 . ASP D 2 109 ? -7.070  22.484  131.120 1.00 75.78  ? 283  ASP D OD2 1 
ATOM   7744 N N   . ASP D 2 110 ? -9.321  18.536  128.670 1.00 71.79  ? 284  ASP D N   1 
ATOM   7745 C CA  . ASP D 2 110 ? -10.706 18.105  128.561 1.00 72.09  ? 284  ASP D CA  1 
ATOM   7746 C C   . ASP D 2 110 ? -11.570 19.089  127.777 1.00 70.57  ? 284  ASP D C   1 
ATOM   7747 O O   . ASP D 2 110 ? -12.546 19.647  128.285 1.00 70.53  ? 284  ASP D O   1 
ATOM   7748 C CB  . ASP D 2 110 ? -11.303 17.828  129.949 1.00 75.82  ? 284  ASP D CB  1 
ATOM   7749 C CG  . ASP D 2 110 ? -10.950 16.429  130.470 1.00 79.53  ? 284  ASP D CG  1 
ATOM   7750 O OD1 . ASP D 2 110 ? -11.192 15.445  129.725 1.00 80.24  ? 284  ASP D OD1 1 
ATOM   7751 O OD2 . ASP D 2 110 ? -10.440 16.312  131.615 1.00 80.01  ? 284  ASP D OD2 1 
ATOM   7752 N N   . THR D 2 111 ? -11.160 19.305  126.531 1.00 68.39  ? 285  THR D N   1 
ATOM   7753 C CA  . THR D 2 111 ? -11.862 20.166  125.592 1.00 65.30  ? 285  THR D CA  1 
ATOM   7754 C C   . THR D 2 111 ? -12.615 19.146  124.758 1.00 62.49  ? 285  THR D C   1 
ATOM   7755 O O   . THR D 2 111 ? -13.676 19.420  124.205 1.00 62.26  ? 285  THR D O   1 
ATOM   7756 C CB  . THR D 2 111 ? -10.885 20.936  124.672 1.00 65.56  ? 285  THR D CB  1 
ATOM   7757 O OG1 . THR D 2 111 ? -10.123 21.866  125.448 1.00 65.58  ? 285  THR D OG1 1 
ATOM   7758 C CG2 . THR D 2 111 ? -11.650 21.692  123.594 1.00 64.82  ? 285  THR D CG2 1 
ATOM   7759 N N   . TYR D 2 112 ? -12.028 17.958  124.684 1.00 59.64  ? 286  TYR D N   1 
ATOM   7760 C CA  . TYR D 2 112 ? -12.598 16.844  123.954 1.00 57.36  ? 286  TYR D CA  1 
ATOM   7761 C C   . TYR D 2 112 ? -12.602 15.663  124.912 1.00 57.58  ? 286  TYR D C   1 
ATOM   7762 O O   . TYR D 2 112 ? -11.963 15.699  125.961 1.00 57.33  ? 286  TYR D O   1 
ATOM   7763 C CB  . TYR D 2 112 ? -11.750 16.518  122.721 1.00 55.09  ? 286  TYR D CB  1 
ATOM   7764 C CG  . TYR D 2 112 ? -11.565 17.680  121.777 1.00 53.90  ? 286  TYR D CG  1 
ATOM   7765 C CD1 . TYR D 2 112 ? -12.656 18.292  121.174 1.00 53.55  ? 286  TYR D CD1 1 
ATOM   7766 C CD2 . TYR D 2 112 ? -10.295 18.177  121.496 1.00 54.21  ? 286  TYR D CD2 1 
ATOM   7767 C CE1 . TYR D 2 112 ? -12.491 19.374  120.314 1.00 53.86  ? 286  TYR D CE1 1 
ATOM   7768 C CE2 . TYR D 2 112 ? -10.116 19.258  120.639 1.00 53.84  ? 286  TYR D CE2 1 
ATOM   7769 C CZ  . TYR D 2 112 ? -11.218 19.853  120.049 1.00 54.79  ? 286  TYR D CZ  1 
ATOM   7770 O OH  . TYR D 2 112 ? -11.043 20.923  119.192 1.00 54.78  ? 286  TYR D OH  1 
ATOM   7771 N N   . THR D 2 113 ? -13.326 14.614  124.550 1.00 58.66  ? 287  THR D N   1 
ATOM   7772 C CA  . THR D 2 113 ? -13.410 13.429  125.386 1.00 58.68  ? 287  THR D CA  1 
ATOM   7773 C C   . THR D 2 113 ? -12.722 12.281  124.678 1.00 59.01  ? 287  THR D C   1 
ATOM   7774 O O   . THR D 2 113 ? -12.468 12.347  123.478 1.00 60.40  ? 287  THR D O   1 
ATOM   7775 C CB  . THR D 2 113 ? -14.871 13.027  125.634 1.00 58.00  ? 287  THR D CB  1 
ATOM   7776 O OG1 . THR D 2 113 ? -15.394 12.388  124.464 1.00 56.92  ? 287  THR D OG1 1 
ATOM   7777 C CG2 . THR D 2 113 ? -15.707 14.258  125.935 1.00 57.47  ? 287  THR D CG2 1 
ATOM   7778 N N   . LYS D 2 114 ? -12.432 11.226  125.428 1.00 58.66  ? 288  LYS D N   1 
ATOM   7779 C CA  . LYS D 2 114 ? -11.784 10.051  124.877 1.00 58.81  ? 288  LYS D CA  1 
ATOM   7780 C C   . LYS D 2 114 ? -12.545 9.598   123.629 1.00 58.81  ? 288  LYS D C   1 
ATOM   7781 O O   . LYS D 2 114 ? -11.963 9.485   122.545 1.00 60.29  ? 288  LYS D O   1 
ATOM   7782 C CB  . LYS D 2 114 ? -11.777 8.945   125.930 1.00 59.72  ? 288  LYS D CB  1 
ATOM   7783 C CG  . LYS D 2 114 ? -10.734 7.872   125.733 1.00 62.08  ? 288  LYS D CG  1 
ATOM   7784 C CD  . LYS D 2 114 ? -10.551 7.121   127.035 1.00 66.15  ? 288  LYS D CD  1 
ATOM   7785 C CE  . LYS D 2 114 ? -9.414  6.123   126.980 1.00 68.01  ? 288  LYS D CE  1 
ATOM   7786 N NZ  . LYS D 2 114 ? -9.090  5.641   128.359 1.00 71.05  ? 288  LYS D NZ  1 
ATOM   7787 N N   . LYS D 2 115 ? -13.847 9.365   123.791 1.00 57.22  ? 289  LYS D N   1 
ATOM   7788 C CA  . LYS D 2 115 ? -14.716 8.918   122.703 1.00 54.43  ? 289  LYS D CA  1 
ATOM   7789 C C   . LYS D 2 115 ? -14.549 9.795   121.459 1.00 51.54  ? 289  LYS D C   1 
ATOM   7790 O O   . LYS D 2 115 ? -14.540 9.292   120.339 1.00 49.79  ? 289  LYS D O   1 
ATOM   7791 C CB  . LYS D 2 115 ? -16.179 8.905   123.182 1.00 56.08  ? 289  LYS D CB  1 
ATOM   7792 C CG  . LYS D 2 115 ? -17.222 8.531   122.123 1.00 58.91  ? 289  LYS D CG  1 
ATOM   7793 C CD  . LYS D 2 115 ? -18.035 7.285   122.497 1.00 60.21  ? 289  LYS D CD  1 
ATOM   7794 C CE  . LYS D 2 115 ? -17.475 6.021   121.817 1.00 63.93  ? 289  LYS D CE  1 
ATOM   7795 N NZ  . LYS D 2 115 ? -18.222 4.752   122.125 1.00 61.96  ? 289  LYS D NZ  1 
ATOM   7796 N N   . GLN D 2 116 ? -14.415 11.103  121.656 1.00 48.62  ? 290  GLN D N   1 
ATOM   7797 C CA  . GLN D 2 116 ? -14.220 12.016  120.532 1.00 47.64  ? 290  GLN D CA  1 
ATOM   7798 C C   . GLN D 2 116 ? -12.855 11.760  119.892 1.00 45.52  ? 290  GLN D C   1 
ATOM   7799 O O   . GLN D 2 116 ? -12.737 11.640  118.674 1.00 44.07  ? 290  GLN D O   1 
ATOM   7800 C CB  . GLN D 2 116 ? -14.281 13.472  120.995 1.00 48.21  ? 290  GLN D CB  1 
ATOM   7801 C CG  . GLN D 2 116 ? -15.667 14.065  121.060 1.00 51.30  ? 290  GLN D CG  1 
ATOM   7802 C CD  . GLN D 2 116 ? -15.685 15.368  121.837 1.00 53.83  ? 290  GLN D CD  1 
ATOM   7803 O OE1 . GLN D 2 116 ? -15.427 15.377  123.038 1.00 56.99  ? 290  GLN D OE1 1 
ATOM   7804 N NE2 . GLN D 2 116 ? -15.979 16.474  121.159 1.00 54.67  ? 290  GLN D NE2 1 
ATOM   7805 N N   . VAL D 2 117 ? -11.820 11.675  120.716 1.00 42.80  ? 291  VAL D N   1 
ATOM   7806 C CA  . VAL D 2 117 ? -10.498 11.445  120.181 1.00 41.59  ? 291  VAL D CA  1 
ATOM   7807 C C   . VAL D 2 117 ? -10.499 10.185  119.343 1.00 41.69  ? 291  VAL D C   1 
ATOM   7808 O O   . VAL D 2 117 ? -10.123 10.219  118.175 1.00 41.46  ? 291  VAL D O   1 
ATOM   7809 C CB  . VAL D 2 117 ? -9.443  11.321  121.298 1.00 41.87  ? 291  VAL D CB  1 
ATOM   7810 C CG1 . VAL D 2 117 ? -8.117  10.845  120.714 1.00 41.65  ? 291  VAL D CG1 1 
ATOM   7811 C CG2 . VAL D 2 117 ? -9.241  12.672  121.976 1.00 41.50  ? 291  VAL D CG2 1 
ATOM   7812 N N   . LEU D 2 118 ? -10.938 9.076   119.933 1.00 42.20  ? 292  LEU D N   1 
ATOM   7813 C CA  . LEU D 2 118 ? -10.958 7.804   119.218 1.00 42.20  ? 292  LEU D CA  1 
ATOM   7814 C C   . LEU D 2 118 ? -11.730 7.845   117.908 1.00 40.52  ? 292  LEU D C   1 
ATOM   7815 O O   . LEU D 2 118 ? -11.249 7.343   116.896 1.00 40.20  ? 292  LEU D O   1 
ATOM   7816 C CB  . LEU D 2 118 ? -11.522 6.678   120.098 1.00 44.86  ? 292  LEU D CB  1 
ATOM   7817 C CG  . LEU D 2 118 ? -10.648 6.080   121.204 1.00 44.84  ? 292  LEU D CG  1 
ATOM   7818 C CD1 . LEU D 2 118 ? -9.186  6.297   120.864 1.00 44.56  ? 292  LEU D CD1 1 
ATOM   7819 C CD2 . LEU D 2 118 ? -10.990 6.728   122.537 1.00 45.83  ? 292  LEU D CD2 1 
ATOM   7820 N N   . ARG D 2 119 ? -12.922 8.431   117.921 1.00 38.39  ? 293  ARG D N   1 
ATOM   7821 C CA  . ARG D 2 119 ? -13.716 8.514   116.703 1.00 40.49  ? 293  ARG D CA  1 
ATOM   7822 C C   . ARG D 2 119 ? -12.968 9.296   115.607 1.00 39.81  ? 293  ARG D C   1 
ATOM   7823 O O   . ARG D 2 119 ? -12.999 8.920   114.433 1.00 39.23  ? 293  ARG D O   1 
ATOM   7824 C CB  . ARG D 2 119 ? -15.083 9.157   116.987 1.00 42.40  ? 293  ARG D CB  1 
ATOM   7825 C CG  . ARG D 2 119 ? -15.954 8.383   117.970 1.00 48.81  ? 293  ARG D CG  1 
ATOM   7826 C CD  . ARG D 2 119 ? -17.396 8.243   117.474 1.00 55.53  ? 293  ARG D CD  1 
ATOM   7827 N NE  . ARG D 2 119 ? -18.386 8.809   118.397 1.00 62.24  ? 293  ARG D NE  1 
ATOM   7828 C CZ  . ARG D 2 119 ? -19.302 8.097   119.056 1.00 65.99  ? 293  ARG D CZ  1 
ATOM   7829 N NH1 . ARG D 2 119 ? -19.361 6.775   118.903 1.00 65.96  ? 293  ARG D NH1 1 
ATOM   7830 N NH2 . ARG D 2 119 ? -20.173 8.707   119.858 1.00 65.80  ? 293  ARG D NH2 1 
ATOM   7831 N N   . MET D 2 120 ? -12.293 10.377  115.991 1.00 39.93  ? 294  MET D N   1 
ATOM   7832 C CA  . MET D 2 120 ? -11.530 11.168  115.034 1.00 39.18  ? 294  MET D CA  1 
ATOM   7833 C C   . MET D 2 120 ? -10.388 10.323  114.488 1.00 38.96  ? 294  MET D C   1 
ATOM   7834 O O   . MET D 2 120 ? -10.079 10.381  113.297 1.00 40.67  ? 294  MET D O   1 
ATOM   7835 C CB  . MET D 2 120 ? -10.982 12.429  115.695 1.00 39.68  ? 294  MET D CB  1 
ATOM   7836 C CG  . MET D 2 120 ? -10.191 13.345  114.764 1.00 42.30  ? 294  MET D CG  1 
ATOM   7837 S SD  . MET D 2 120 ? -11.082 13.989  113.331 1.00 41.12  ? 294  MET D SD  1 
ATOM   7838 C CE  . MET D 2 120 ? -12.026 15.295  114.118 1.00 40.12  ? 294  MET D CE  1 
ATOM   7839 N N   . GLU D 2 121 ? -9.772  9.519   115.349 1.00 38.98  ? 295  GLU D N   1 
ATOM   7840 C CA  . GLU D 2 121 ? -8.674  8.647   114.911 1.00 39.29  ? 295  GLU D CA  1 
ATOM   7841 C C   . GLU D 2 121 ? -9.107  7.848   113.691 1.00 37.86  ? 295  GLU D C   1 
ATOM   7842 O O   . GLU D 2 121 ? -8.398  7.738   112.696 1.00 38.81  ? 295  GLU D O   1 
ATOM   7843 C CB  . GLU D 2 121 ? -8.281  7.665   116.023 1.00 38.45  ? 295  GLU D CB  1 
ATOM   7844 C CG  . GLU D 2 121 ? -7.176  6.686   115.617 1.00 38.41  ? 295  GLU D CG  1 
ATOM   7845 C CD  . GLU D 2 121 ? -6.820  5.695   116.715 1.00 40.42  ? 295  GLU D CD  1 
ATOM   7846 O OE1 . GLU D 2 121 ? -7.722  4.973   117.197 1.00 41.95  ? 295  GLU D OE1 1 
ATOM   7847 O OE2 . GLU D 2 121 ? -5.634  5.632   117.096 1.00 40.67  ? 295  GLU D OE2 1 
ATOM   7848 N N   . HIS D 2 122 ? -10.294 7.288   113.803 1.00 38.74  ? 296  HIS D N   1 
ATOM   7849 C CA  . HIS D 2 122 ? -10.890 6.470   112.771 1.00 40.35  ? 296  HIS D CA  1 
ATOM   7850 C C   . HIS D 2 122 ? -11.201 7.275   111.498 1.00 38.53  ? 296  HIS D C   1 
ATOM   7851 O O   . HIS D 2 122 ? -10.940 6.821   110.379 1.00 37.14  ? 296  HIS D O   1 
ATOM   7852 C CB  . HIS D 2 122 ? -12.168 5.872   113.342 1.00 44.24  ? 296  HIS D CB  1 
ATOM   7853 C CG  . HIS D 2 122 ? -12.595 4.603   112.683 1.00 49.63  ? 296  HIS D CG  1 
ATOM   7854 N ND1 . HIS D 2 122 ? -12.441 3.371   113.281 1.00 52.46  ? 296  HIS D ND1 1 
ATOM   7855 C CD2 . HIS D 2 122 ? -13.229 4.379   111.510 1.00 51.17  ? 296  HIS D CD2 1 
ATOM   7856 C CE1 . HIS D 2 122 ? -12.973 2.443   112.507 1.00 53.86  ? 296  HIS D CE1 1 
ATOM   7857 N NE2 . HIS D 2 122 ? -13.459 3.029   111.427 1.00 53.22  ? 296  HIS D NE2 1 
ATOM   7858 N N   . LEU D 2 123 ? -11.764 8.466   111.672 1.00 35.18  ? 297  LEU D N   1 
ATOM   7859 C CA  . LEU D 2 123 ? -12.098 9.301   110.532 1.00 33.36  ? 297  LEU D CA  1 
ATOM   7860 C C   . LEU D 2 123 ? -10.838 9.714   109.812 1.00 32.96  ? 297  LEU D C   1 
ATOM   7861 O O   . LEU D 2 123 ? -10.815 9.802   108.590 1.00 34.11  ? 297  LEU D O   1 
ATOM   7862 C CB  . LEU D 2 123 ? -12.871 10.541  110.973 1.00 33.93  ? 297  LEU D CB  1 
ATOM   7863 C CG  . LEU D 2 123 ? -13.232 11.509  109.841 1.00 35.72  ? 297  LEU D CG  1 
ATOM   7864 C CD1 . LEU D 2 123 ? -13.845 10.741  108.681 1.00 34.38  ? 297  LEU D CD1 1 
ATOM   7865 C CD2 . LEU D 2 123 ? -14.188 12.575  110.357 1.00 32.79  ? 297  LEU D CD2 1 
ATOM   7866 N N   . VAL D 2 124 ? -9.777  9.963   110.565 1.00 32.02  ? 298  VAL D N   1 
ATOM   7867 C CA  . VAL D 2 124 ? -8.532  10.351  109.940 1.00 32.54  ? 298  VAL D CA  1 
ATOM   7868 C C   . VAL D 2 124 ? -7.970  9.176   109.152 1.00 34.47  ? 298  VAL D C   1 
ATOM   7869 O O   . VAL D 2 124 ? -7.414  9.358   108.064 1.00 34.58  ? 298  VAL D O   1 
ATOM   7870 C CB  . VAL D 2 124 ? -7.513  10.831  110.990 1.00 33.70  ? 298  VAL D CB  1 
ATOM   7871 C CG1 . VAL D 2 124 ? -6.107  10.871  110.397 1.00 34.09  ? 298  VAL D CG1 1 
ATOM   7872 C CG2 . VAL D 2 124 ? -7.907  12.210  111.479 1.00 28.54  ? 298  VAL D CG2 1 
ATOM   7873 N N   . LEU D 2 125 ? -8.130  7.968   109.696 1.00 35.79  ? 299  LEU D N   1 
ATOM   7874 C CA  . LEU D 2 125 ? -7.632  6.767   109.036 1.00 35.40  ? 299  LEU D CA  1 
ATOM   7875 C C   . LEU D 2 125 ? -8.367  6.526   107.719 1.00 35.91  ? 299  LEU D C   1 
ATOM   7876 O O   . LEU D 2 125 ? -7.755  6.167   106.719 1.00 35.74  ? 299  LEU D O   1 
ATOM   7877 C CB  . LEU D 2 125 ? -7.766  5.546   109.962 1.00 35.10  ? 299  LEU D CB  1 
ATOM   7878 C CG  . LEU D 2 125 ? -6.648  5.278   110.982 1.00 35.70  ? 299  LEU D CG  1 
ATOM   7879 C CD1 . LEU D 2 125 ? -7.096  4.225   111.995 1.00 36.41  ? 299  LEU D CD1 1 
ATOM   7880 C CD2 . LEU D 2 125 ? -5.391  4.815   110.260 1.00 32.32  ? 299  LEU D CD2 1 
ATOM   7881 N N   . LYS D 2 126 ? -9.680  6.725   107.716 1.00 37.42  ? 300  LYS D N   1 
ATOM   7882 C CA  . LYS D 2 126 ? -10.454 6.525   106.499 1.00 39.61  ? 300  LYS D CA  1 
ATOM   7883 C C   . LYS D 2 126 ? -10.076 7.563   105.450 1.00 39.16  ? 300  LYS D C   1 
ATOM   7884 O O   . LYS D 2 126 ? -9.701  7.218   104.330 1.00 39.90  ? 300  LYS D O   1 
ATOM   7885 C CB  . LYS D 2 126 ? -11.960 6.611   106.787 1.00 42.37  ? 300  LYS D CB  1 
ATOM   7886 C CG  . LYS D 2 126 ? -12.563 5.317   107.302 1.00 46.98  ? 300  LYS D CG  1 
ATOM   7887 C CD  . LYS D 2 126 ? -14.079 5.286   107.141 1.00 50.27  ? 300  LYS D CD  1 
ATOM   7888 C CE  . LYS D 2 126 ? -14.799 6.079   108.228 1.00 54.11  ? 300  LYS D CE  1 
ATOM   7889 N NZ  . LYS D 2 126 ? -14.829 5.336   109.521 1.00 53.54  ? 300  LYS D NZ  1 
ATOM   7890 N N   . VAL D 2 127 ? -10.175 8.836   105.822 1.00 37.47  ? 301  VAL D N   1 
ATOM   7891 C CA  . VAL D 2 127 ? -9.846  9.925   104.917 1.00 35.88  ? 301  VAL D CA  1 
ATOM   7892 C C   . VAL D 2 127 ? -8.470  9.777   104.279 1.00 35.23  ? 301  VAL D C   1 
ATOM   7893 O O   . VAL D 2 127 ? -8.279  10.176  103.130 1.00 35.48  ? 301  VAL D O   1 
ATOM   7894 C CB  . VAL D 2 127 ? -9.922  11.276  105.642 1.00 36.02  ? 301  VAL D CB  1 
ATOM   7895 C CG1 . VAL D 2 127 ? -9.335  12.388  104.762 1.00 35.41  ? 301  VAL D CG1 1 
ATOM   7896 C CG2 . VAL D 2 127 ? -11.367 11.580  105.987 1.00 32.57  ? 301  VAL D CG2 1 
ATOM   7897 N N   . LEU D 2 128 ? -7.517  9.214   105.020 1.00 34.93  ? 302  LEU D N   1 
ATOM   7898 C CA  . LEU D 2 128 ? -6.155  9.009   104.510 1.00 35.25  ? 302  LEU D CA  1 
ATOM   7899 C C   . LEU D 2 128 ? -6.018  7.602   103.923 1.00 35.75  ? 302  LEU D C   1 
ATOM   7900 O O   . LEU D 2 128 ? -4.926  7.171   103.557 1.00 38.32  ? 302  LEU D O   1 
ATOM   7901 C CB  . LEU D 2 128 ? -5.119  9.210   105.636 1.00 32.64  ? 302  LEU D CB  1 
ATOM   7902 C CG  . LEU D 2 128 ? -5.108  10.596  106.318 1.00 34.90  ? 302  LEU D CG  1 
ATOM   7903 C CD1 . LEU D 2 128 ? -4.270  10.569  107.575 1.00 31.28  ? 302  LEU D CD1 1 
ATOM   7904 C CD2 . LEU D 2 128 ? -4.584  11.651  105.354 1.00 32.50  ? 302  LEU D CD2 1 
ATOM   7905 N N   . THR D 2 129 ? -7.143  6.902   103.826 1.00 36.18  ? 303  THR D N   1 
ATOM   7906 C CA  . THR D 2 129 ? -7.190  5.534   103.322 1.00 36.05  ? 303  THR D CA  1 
ATOM   7907 C C   . THR D 2 129 ? -6.061  4.669   103.866 1.00 37.06  ? 303  THR D C   1 
ATOM   7908 O O   . THR D 2 129 ? -5.541  3.802   103.160 1.00 37.57  ? 303  THR D O   1 
ATOM   7909 C CB  . THR D 2 129 ? -7.152  5.478   101.785 1.00 36.36  ? 303  THR D CB  1 
ATOM   7910 O OG1 . THR D 2 129 ? -5.921  6.028   101.310 1.00 36.89  ? 303  THR D OG1 1 
ATOM   7911 C CG2 . THR D 2 129 ? -8.317  6.265   101.200 1.00 36.66  ? 303  THR D CG2 1 
ATOM   7912 N N   . PHE D 2 130 ? -5.690  4.919   105.121 1.00 36.95  ? 304  PHE D N   1 
ATOM   7913 C CA  . PHE D 2 130 ? -4.649  4.162   105.806 1.00 39.82  ? 304  PHE D CA  1 
ATOM   7914 C C   . PHE D 2 130 ? -3.211  4.359   105.346 1.00 42.19  ? 304  PHE D C   1 
ATOM   7915 O O   . PHE D 2 130 ? -2.319  3.630   105.788 1.00 44.30  ? 304  PHE D O   1 
ATOM   7916 C CB  . PHE D 2 130 ? -4.979  2.665   105.771 1.00 39.02  ? 304  PHE D CB  1 
ATOM   7917 C CG  . PHE D 2 130 ? -5.762  2.208   106.948 1.00 41.31  ? 304  PHE D CG  1 
ATOM   7918 C CD1 . PHE D 2 130 ? -5.127  1.979   108.167 1.00 42.04  ? 304  PHE D CD1 1 
ATOM   7919 C CD2 . PHE D 2 130 ? -7.149  2.079   106.872 1.00 42.98  ? 304  PHE D CD2 1 
ATOM   7920 C CE1 . PHE D 2 130 ? -5.863  1.630   109.305 1.00 42.81  ? 304  PHE D CE1 1 
ATOM   7921 C CE2 . PHE D 2 130 ? -7.902  1.730   108.002 1.00 43.61  ? 304  PHE D CE2 1 
ATOM   7922 C CZ  . PHE D 2 130 ? -7.255  1.507   109.223 1.00 43.20  ? 304  PHE D CZ  1 
ATOM   7923 N N   . ASP D 2 131 ? -2.970  5.328   104.472 1.00 41.52  ? 305  ASP D N   1 
ATOM   7924 C CA  . ASP D 2 131 ? -1.611  5.566   104.002 1.00 42.47  ? 305  ASP D CA  1 
ATOM   7925 C C   . ASP D 2 131 ? -0.893  6.471   105.005 1.00 41.95  ? 305  ASP D C   1 
ATOM   7926 O O   . ASP D 2 131 ? -0.985  7.700   104.931 1.00 39.47  ? 305  ASP D O   1 
ATOM   7927 C CB  . ASP D 2 131 ? -1.645  6.217   102.615 1.00 45.80  ? 305  ASP D CB  1 
ATOM   7928 C CG  . ASP D 2 131 ? -2.449  5.404   101.605 1.00 47.34  ? 305  ASP D CG  1 
ATOM   7929 O OD1 . ASP D 2 131 ? -2.114  4.221   101.389 1.00 47.87  ? 305  ASP D OD1 1 
ATOM   7930 O OD2 . ASP D 2 131 ? -3.413  5.951   101.030 1.00 46.53  ? 305  ASP D OD2 1 
ATOM   7931 N N   . LEU D 2 132 ? -0.178  5.869   105.951 1.00 40.59  ? 306  LEU D N   1 
ATOM   7932 C CA  . LEU D 2 132 ? 0.506   6.669   106.956 1.00 40.27  ? 306  LEU D CA  1 
ATOM   7933 C C   . LEU D 2 132 ? 2.007   6.766   106.758 1.00 42.20  ? 306  LEU D C   1 
ATOM   7934 O O   . LEU D 2 132 ? 2.639   7.682   107.283 1.00 42.34  ? 306  LEU D O   1 
ATOM   7935 C CB  . LEU D 2 132 ? 0.217   6.127   108.361 1.00 39.02  ? 306  LEU D CB  1 
ATOM   7936 C CG  . LEU D 2 132 ? -1.236  6.095   108.874 1.00 38.80  ? 306  LEU D CG  1 
ATOM   7937 C CD1 . LEU D 2 132 ? -1.218  5.705   110.334 1.00 37.73  ? 306  LEU D CD1 1 
ATOM   7938 C CD2 . LEU D 2 132 ? -1.909  7.450   108.725 1.00 37.63  ? 306  LEU D CD2 1 
ATOM   7939 N N   . ALA D 2 133 ? 2.574   5.835   105.993 1.00 42.98  ? 307  ALA D N   1 
ATOM   7940 C CA  . ALA D 2 133 ? 4.018   5.798   105.762 1.00 41.97  ? 307  ALA D CA  1 
ATOM   7941 C C   . ALA D 2 133 ? 4.477   6.883   104.804 1.00 43.62  ? 307  ALA D C   1 
ATOM   7942 O O   . ALA D 2 133 ? 4.922   6.592   103.694 1.00 45.06  ? 307  ALA D O   1 
ATOM   7943 C CB  . ALA D 2 133 ? 4.413   4.437   105.233 1.00 38.93  ? 307  ALA D CB  1 
ATOM   7944 N N   . ALA D 2 134 ? 4.388   8.135   105.244 1.00 43.90  ? 308  ALA D N   1 
ATOM   7945 C CA  . ALA D 2 134 ? 4.774   9.263   104.408 1.00 44.43  ? 308  ALA D CA  1 
ATOM   7946 C C   . ALA D 2 134 ? 6.230   9.698   104.528 1.00 45.73  ? 308  ALA D C   1 
ATOM   7947 O O   . ALA D 2 134 ? 6.837   9.625   105.598 1.00 43.56  ? 308  ALA D O   1 
ATOM   7948 C CB  . ALA D 2 134 ? 3.871   10.447  104.698 1.00 44.14  ? 308  ALA D CB  1 
ATOM   7949 N N   . PRO D 2 135 ? 6.818   10.140  103.405 1.00 47.63  ? 309  PRO D N   1 
ATOM   7950 C CA  . PRO D 2 135 ? 8.210   10.595  103.409 1.00 49.35  ? 309  PRO D CA  1 
ATOM   7951 C C   . PRO D 2 135 ? 8.186   11.963  104.103 1.00 50.26  ? 309  PRO D C   1 
ATOM   7952 O O   . PRO D 2 135 ? 7.245   12.731  103.927 1.00 49.89  ? 309  PRO D O   1 
ATOM   7953 C CB  . PRO D 2 135 ? 8.543   10.707  101.921 1.00 48.48  ? 309  PRO D CB  1 
ATOM   7954 C CG  . PRO D 2 135 ? 7.552   9.799   101.261 1.00 46.16  ? 309  PRO D CG  1 
ATOM   7955 C CD  . PRO D 2 135 ? 6.303   10.069  102.029 1.00 46.57  ? 309  PRO D CD  1 
ATOM   7956 N N   . THR D 2 136 ? 9.206   12.259  104.894 1.00 51.89  ? 310  THR D N   1 
ATOM   7957 C CA  . THR D 2 136 ? 9.244   13.526  105.606 1.00 53.39  ? 310  THR D CA  1 
ATOM   7958 C C   . THR D 2 136 ? 10.616  14.200  105.578 1.00 55.26  ? 310  THR D C   1 
ATOM   7959 O O   . THR D 2 136 ? 11.652  13.555  105.343 1.00 54.30  ? 310  THR D O   1 
ATOM   7960 C CB  . THR D 2 136 ? 8.808   13.339  107.086 1.00 52.80  ? 310  THR D CB  1 
ATOM   7961 O OG1 . THR D 2 136 ? 9.754   12.505  107.778 1.00 49.19  ? 310  THR D OG1 1 
ATOM   7962 C CG2 . THR D 2 136 ? 7.429   12.694  107.149 1.00 51.49  ? 310  THR D CG2 1 
ATOM   7963 N N   . VAL D 2 137 ? 10.595  15.510  105.817 1.00 56.17  ? 311  VAL D N   1 
ATOM   7964 C CA  . VAL D 2 137 ? 11.802  16.323  105.856 1.00 56.64  ? 311  VAL D CA  1 
ATOM   7965 C C   . VAL D 2 137 ? 12.821  15.639  106.756 1.00 55.87  ? 311  VAL D C   1 
ATOM   7966 O O   . VAL D 2 137 ? 13.996  15.524  106.415 1.00 56.84  ? 311  VAL D O   1 
ATOM   7967 C CB  . VAL D 2 137 ? 11.484  17.733  106.404 1.00 57.85  ? 311  VAL D CB  1 
ATOM   7968 C CG1 . VAL D 2 137 ? 12.757  18.408  106.892 1.00 58.70  ? 311  VAL D CG1 1 
ATOM   7969 C CG2 . VAL D 2 137 ? 10.813  18.570  105.315 1.00 56.72  ? 311  VAL D CG2 1 
ATOM   7970 N N   . ASN D 2 138 ? 12.350  15.164  107.899 1.00 55.03  ? 312  ASN D N   1 
ATOM   7971 C CA  . ASN D 2 138 ? 13.210  14.479  108.848 1.00 55.04  ? 312  ASN D CA  1 
ATOM   7972 C C   . ASN D 2 138 ? 13.791  13.186  108.274 1.00 56.22  ? 312  ASN D C   1 
ATOM   7973 O O   . ASN D 2 138 ? 14.869  12.756  108.681 1.00 57.60  ? 312  ASN D O   1 
ATOM   7974 C CB  . ASN D 2 138 ? 12.428  14.156  110.121 1.00 54.29  ? 312  ASN D CB  1 
ATOM   7975 C CG  . ASN D 2 138 ? 13.275  13.461  111.164 1.00 52.33  ? 312  ASN D CG  1 
ATOM   7976 O OD1 . ASN D 2 138 ? 14.059  14.103  111.855 1.00 55.11  ? 312  ASN D OD1 1 
ATOM   7977 N ND2 . ASN D 2 138 ? 13.130  12.143  111.278 1.00 49.01  ? 312  ASN D ND2 1 
ATOM   7978 N N   . GLN D 2 139 ? 13.084  12.555  107.341 1.00 56.32  ? 313  GLN D N   1 
ATOM   7979 C CA  . GLN D 2 139 ? 13.582  11.311  106.757 1.00 57.34  ? 313  GLN D CA  1 
ATOM   7980 C C   . GLN D 2 139 ? 14.690  11.596  105.765 1.00 58.11  ? 313  GLN D C   1 
ATOM   7981 O O   . GLN D 2 139 ? 15.579  10.767  105.548 1.00 57.89  ? 313  GLN D O   1 
ATOM   7982 C CB  . GLN D 2 139 ? 12.455  10.544  106.063 1.00 57.06  ? 313  GLN D CB  1 
ATOM   7983 C CG  . GLN D 2 139 ? 11.641  9.651   106.980 1.00 54.47  ? 313  GLN D CG  1 
ATOM   7984 C CD  . GLN D 2 139 ? 10.332  9.245   106.347 1.00 53.71  ? 313  GLN D CD  1 
ATOM   7985 O OE1 . GLN D 2 139 ? 10.304  8.770   105.218 1.00 55.23  ? 313  GLN D OE1 1 
ATOM   7986 N NE2 . GLN D 2 139 ? 9.237   9.438   107.068 1.00 52.57  ? 313  GLN D NE2 1 
ATOM   7987 N N   . PHE D 2 140 ? 14.629  12.775  105.157 1.00 58.63  ? 314  PHE D N   1 
ATOM   7988 C CA  . PHE D 2 140 ? 15.642  13.178  104.195 1.00 59.43  ? 314  PHE D CA  1 
ATOM   7989 C C   . PHE D 2 140 ? 16.866  13.730  104.933 1.00 60.32  ? 314  PHE D C   1 
ATOM   7990 O O   . PHE D 2 140 ? 17.999  13.358  104.632 1.00 61.08  ? 314  PHE D O   1 
ATOM   7991 C CB  . PHE D 2 140 ? 15.060  14.218  103.239 1.00 58.78  ? 314  PHE D CB  1 
ATOM   7992 C CG  . PHE D 2 140 ? 14.189  13.630  102.158 1.00 57.88  ? 314  PHE D CG  1 
ATOM   7993 C CD1 . PHE D 2 140 ? 14.753  12.946  101.086 1.00 56.80  ? 314  PHE D CD1 1 
ATOM   7994 C CD2 . PHE D 2 140 ? 12.803  13.765  102.209 1.00 58.04  ? 314  PHE D CD2 1 
ATOM   7995 C CE1 . PHE D 2 140 ? 13.949  12.407  100.075 1.00 56.82  ? 314  PHE D CE1 1 
ATOM   7996 C CE2 . PHE D 2 140 ? 11.992  13.228  101.204 1.00 56.78  ? 314  PHE D CE2 1 
ATOM   7997 C CZ  . PHE D 2 140 ? 12.567  12.550  100.135 1.00 54.83  ? 314  PHE D CZ  1 
ATOM   7998 N N   . LEU D 2 141 ? 16.635  14.607  105.906 1.00 60.74  ? 315  LEU D N   1 
ATOM   7999 C CA  . LEU D 2 141 ? 17.729  15.175  106.689 1.00 60.12  ? 315  LEU D CA  1 
ATOM   8000 C C   . LEU D 2 141 ? 18.605  14.037  107.189 1.00 59.49  ? 315  LEU D C   1 
ATOM   8001 O O   . LEU D 2 141 ? 19.834  14.083  107.103 1.00 59.64  ? 315  LEU D O   1 
ATOM   8002 C CB  . LEU D 2 141 ? 17.183  15.953  107.890 1.00 59.76  ? 315  LEU D CB  1 
ATOM   8003 C CG  . LEU D 2 141 ? 16.296  17.162  107.594 1.00 60.52  ? 315  LEU D CG  1 
ATOM   8004 C CD1 . LEU D 2 141 ? 15.896  17.832  108.898 1.00 61.01  ? 315  LEU D CD1 1 
ATOM   8005 C CD2 . LEU D 2 141 ? 17.044  18.140  106.703 1.00 61.37  ? 315  LEU D CD2 1 
ATOM   8006 N N   . THR D 2 142 ? 17.954  13.006  107.707 1.00 59.28  ? 316  THR D N   1 
ATOM   8007 C CA  . THR D 2 142 ? 18.650  11.845  108.233 1.00 59.30  ? 316  THR D CA  1 
ATOM   8008 C C   . THR D 2 142 ? 19.589  11.210  107.214 1.00 58.85  ? 316  THR D C   1 
ATOM   8009 O O   . THR D 2 142 ? 20.725  10.876  107.538 1.00 57.10  ? 316  THR D O   1 
ATOM   8010 C CB  . THR D 2 142 ? 17.631  10.811  108.760 1.00 59.99  ? 316  THR D CB  1 
ATOM   8011 O OG1 . THR D 2 142 ? 17.360  11.084  110.141 1.00 61.32  ? 316  THR D OG1 1 
ATOM   8012 C CG2 . THR D 2 142 ? 18.148  9.402   108.615 1.00 59.07  ? 316  THR D CG2 1 
ATOM   8013 N N   . GLN D 2 143 ? 19.124  11.045  105.982 1.00 59.81  ? 317  GLN D N   1 
ATOM   8014 C CA  . GLN D 2 143 ? 19.972  10.459  104.956 1.00 61.04  ? 317  GLN D CA  1 
ATOM   8015 C C   . GLN D 2 143 ? 21.151  11.385  104.668 1.00 62.68  ? 317  GLN D C   1 
ATOM   8016 O O   . GLN D 2 143 ? 22.309  10.957  104.707 1.00 63.72  ? 317  GLN D O   1 
ATOM   8017 C CB  . GLN D 2 143 ? 19.184  10.217  103.666 1.00 61.23  ? 317  GLN D CB  1 
ATOM   8018 C CG  . GLN D 2 143 ? 18.040  9.216   103.795 1.00 62.41  ? 317  GLN D CG  1 
ATOM   8019 C CD  . GLN D 2 143 ? 17.429  8.846   102.450 1.00 61.46  ? 317  GLN D CD  1 
ATOM   8020 O OE1 . GLN D 2 143 ? 16.240  8.553   102.356 1.00 61.09  ? 317  GLN D OE1 1 
ATOM   8021 N NE2 . GLN D 2 143 ? 18.250  8.845   101.408 1.00 61.75  ? 317  GLN D NE2 1 
ATOM   8022 N N   . TYR D 2 144 ? 20.852  12.653  104.384 1.00 62.76  ? 318  TYR D N   1 
ATOM   8023 C CA  . TYR D 2 144 ? 21.886  13.642  104.087 1.00 62.04  ? 318  TYR D CA  1 
ATOM   8024 C C   . TYR D 2 144 ? 22.929  13.721  105.191 1.00 62.70  ? 318  TYR D C   1 
ATOM   8025 O O   . TYR D 2 144 ? 24.125  13.802  104.919 1.00 63.00  ? 318  TYR D O   1 
ATOM   8026 C CB  . TYR D 2 144 ? 21.270  15.027  103.887 1.00 60.66  ? 318  TYR D CB  1 
ATOM   8027 C CG  . TYR D 2 144 ? 20.233  15.100  102.788 1.00 60.14  ? 318  TYR D CG  1 
ATOM   8028 C CD1 . TYR D 2 144 ? 20.225  14.174  101.741 1.00 59.38  ? 318  TYR D CD1 1 
ATOM   8029 C CD2 . TYR D 2 144 ? 19.290  16.129  102.763 1.00 57.59  ? 318  TYR D CD2 1 
ATOM   8030 C CE1 . TYR D 2 144 ? 19.304  14.278  100.696 1.00 58.10  ? 318  TYR D CE1 1 
ATOM   8031 C CE2 . TYR D 2 144 ? 18.371  16.241  101.721 1.00 55.84  ? 318  TYR D CE2 1 
ATOM   8032 C CZ  . TYR D 2 144 ? 18.385  15.317  100.694 1.00 55.02  ? 318  TYR D CZ  1 
ATOM   8033 O OH  . TYR D 2 144 ? 17.505  15.444  99.648  1.00 55.16  ? 318  TYR D OH  1 
ATOM   8034 N N   . PHE D 2 145 ? 22.470  13.700  106.438 1.00 63.76  ? 319  PHE D N   1 
ATOM   8035 C CA  . PHE D 2 145 ? 23.371  13.767  107.583 1.00 65.21  ? 319  PHE D CA  1 
ATOM   8036 C C   . PHE D 2 145 ? 24.540  12.797  107.458 1.00 66.59  ? 319  PHE D C   1 
ATOM   8037 O O   . PHE D 2 145 ? 25.628  13.067  107.974 1.00 66.26  ? 319  PHE D O   1 
ATOM   8038 C CB  . PHE D 2 145 ? 22.609  13.478  108.880 1.00 63.86  ? 319  PHE D CB  1 
ATOM   8039 C CG  . PHE D 2 145 ? 21.806  14.641  109.388 1.00 63.66  ? 319  PHE D CG  1 
ATOM   8040 C CD1 . PHE D 2 145 ? 21.633  15.790  108.612 1.00 63.12  ? 319  PHE D CD1 1 
ATOM   8041 C CD2 . PHE D 2 145 ? 21.212  14.585  110.647 1.00 61.97  ? 319  PHE D CD2 1 
ATOM   8042 C CE1 . PHE D 2 145 ? 20.878  16.865  109.084 1.00 62.41  ? 319  PHE D CE1 1 
ATOM   8043 C CE2 . PHE D 2 145 ? 20.456  15.654  111.127 1.00 60.84  ? 319  PHE D CE2 1 
ATOM   8044 C CZ  . PHE D 2 145 ? 20.288  16.796  110.346 1.00 60.88  ? 319  PHE D CZ  1 
ATOM   8045 N N   . LEU D 2 146 ? 24.315  11.671  106.781 1.00 68.22  ? 320  LEU D N   1 
ATOM   8046 C CA  . LEU D 2 146 ? 25.363  10.669  106.602 1.00 70.24  ? 320  LEU D CA  1 
ATOM   8047 C C   . LEU D 2 146 ? 26.586  11.230  105.883 1.00 72.15  ? 320  LEU D C   1 
ATOM   8048 O O   . LEU D 2 146 ? 27.700  10.751  106.086 1.00 71.88  ? 320  LEU D O   1 
ATOM   8049 C CB  . LEU D 2 146 ? 24.840  9.452   105.826 1.00 69.13  ? 320  LEU D CB  1 
ATOM   8050 C CG  . LEU D 2 146 ? 23.996  8.401   106.554 1.00 68.93  ? 320  LEU D CG  1 
ATOM   8051 C CD1 . LEU D 2 146 ? 23.898  7.153   105.678 1.00 68.16  ? 320  LEU D CD1 1 
ATOM   8052 C CD2 . LEU D 2 146 ? 24.632  8.040   107.895 1.00 67.33  ? 320  LEU D CD2 1 
ATOM   8053 N N   . HIS D 2 147 ? 26.375  12.243  105.044 1.00 74.59  ? 321  HIS D N   1 
ATOM   8054 C CA  . HIS D 2 147 ? 27.466  12.867  104.298 1.00 76.24  ? 321  HIS D CA  1 
ATOM   8055 C C   . HIS D 2 147 ? 28.097  14.041  105.045 1.00 77.31  ? 321  HIS D C   1 
ATOM   8056 O O   . HIS D 2 147 ? 28.236  15.133  104.495 1.00 77.49  ? 321  HIS D O   1 
ATOM   8057 C CB  . HIS D 2 147 ? 26.968  13.342  102.933 1.00 76.38  ? 321  HIS D CB  1 
ATOM   8058 C CG  . HIS D 2 147 ? 26.370  12.252  102.100 1.00 77.46  ? 321  HIS D CG  1 
ATOM   8059 N ND1 . HIS D 2 147 ? 25.990  12.442  100.790 1.00 78.00  ? 321  HIS D ND1 1 
ATOM   8060 C CD2 . HIS D 2 147 ? 26.079  10.963  102.394 1.00 77.99  ? 321  HIS D CD2 1 
ATOM   8061 C CE1 . HIS D 2 147 ? 25.490  11.316  100.312 1.00 78.61  ? 321  HIS D CE1 1 
ATOM   8062 N NE2 . HIS D 2 147 ? 25.533  10.403  101.265 1.00 78.83  ? 321  HIS D NE2 1 
ATOM   8063 N N   . GLN D 2 148 ? 28.464  13.806  106.303 1.00 78.79  ? 322  GLN D N   1 
ATOM   8064 C CA  . GLN D 2 148 ? 29.103  14.814  107.144 1.00 80.23  ? 322  GLN D CA  1 
ATOM   8065 C C   . GLN D 2 148 ? 30.544  14.389  107.372 1.00 81.44  ? 322  GLN D C   1 
ATOM   8066 O O   . GLN D 2 148 ? 30.815  13.238  107.722 1.00 79.96  ? 322  GLN D O   1 
ATOM   8067 C CB  . GLN D 2 148 ? 28.399  14.931  108.496 1.00 80.80  ? 322  GLN D CB  1 
ATOM   8068 C CG  . GLN D 2 148 ? 27.522  16.152  108.649 1.00 81.58  ? 322  GLN D CG  1 
ATOM   8069 C CD  . GLN D 2 148 ? 27.847  16.934  109.911 1.00 83.27  ? 322  GLN D CD  1 
ATOM   8070 O OE1 . GLN D 2 148 ? 28.881  17.604  109.997 1.00 83.50  ? 322  GLN D OE1 1 
ATOM   8071 N NE2 . GLN D 2 148 ? 26.969  16.842  110.904 1.00 83.61  ? 322  GLN D NE2 1 
ATOM   8072 N N   . GLN D 2 149 ? 31.471  15.321  107.180 1.00 83.65  ? 323  GLN D N   1 
ATOM   8073 C CA  . GLN D 2 149 ? 32.877  14.998  107.354 1.00 85.55  ? 323  GLN D CA  1 
ATOM   8074 C C   . GLN D 2 149 ? 33.670  16.010  108.183 1.00 85.80  ? 323  GLN D C   1 
ATOM   8075 O O   . GLN D 2 149 ? 34.149  17.021  107.661 1.00 85.18  ? 323  GLN D O   1 
ATOM   8076 C CB  . GLN D 2 149 ? 33.534  14.809  105.981 1.00 86.89  ? 323  GLN D CB  1 
ATOM   8077 C CG  . GLN D 2 149 ? 34.961  14.295  106.048 1.00 89.73  ? 323  GLN D CG  1 
ATOM   8078 C CD  . GLN D 2 149 ? 35.157  13.271  107.159 1.00 90.66  ? 323  GLN D CD  1 
ATOM   8079 O OE1 . GLN D 2 149 ? 35.243  13.627  108.334 1.00 91.31  ? 323  GLN D OE1 1 
ATOM   8080 N NE2 . GLN D 2 149 ? 35.216  11.995  106.792 1.00 91.04  ? 323  GLN D NE2 1 
ATOM   8081 N N   . PRO D 2 150 ? 33.790  15.759  109.503 1.00 86.26  ? 324  PRO D N   1 
ATOM   8082 C CA  . PRO D 2 150 ? 33.201  14.592  110.174 1.00 85.64  ? 324  PRO D CA  1 
ATOM   8083 C C   . PRO D 2 150 ? 31.897  14.982  110.874 1.00 85.27  ? 324  PRO D C   1 
ATOM   8084 O O   . PRO D 2 150 ? 31.708  16.143  111.248 1.00 84.85  ? 324  PRO D O   1 
ATOM   8085 C CB  . PRO D 2 150 ? 34.284  14.190  111.164 1.00 85.15  ? 324  PRO D CB  1 
ATOM   8086 C CG  . PRO D 2 150 ? 34.767  15.526  111.632 1.00 86.00  ? 324  PRO D CG  1 
ATOM   8087 C CD  . PRO D 2 150 ? 34.853  16.350  110.342 1.00 86.30  ? 324  PRO D CD  1 
ATOM   8088 N N   . ALA D 2 151 ? 31.008  14.008  111.045 1.00 84.52  ? 325  ALA D N   1 
ATOM   8089 C CA  . ALA D 2 151 ? 29.717  14.222  111.693 1.00 83.94  ? 325  ALA D CA  1 
ATOM   8090 C C   . ALA D 2 151 ? 29.749  15.327  112.755 1.00 83.45  ? 325  ALA D C   1 
ATOM   8091 O O   . ALA D 2 151 ? 30.418  15.191  113.780 1.00 83.16  ? 325  ALA D O   1 
ATOM   8092 C CB  . ALA D 2 151 ? 29.241  12.913  112.318 1.00 83.39  ? 325  ALA D CB  1 
ATOM   8093 N N   . ASN D 2 152 ? 29.024  16.416  112.506 1.00 82.70  ? 326  ASN D N   1 
ATOM   8094 C CA  . ASN D 2 152 ? 28.969  17.533  113.448 1.00 82.09  ? 326  ASN D CA  1 
ATOM   8095 C C   . ASN D 2 152 ? 27.773  17.468  114.386 1.00 81.80  ? 326  ASN D C   1 
ATOM   8096 O O   . ASN D 2 152 ? 26.625  17.427  113.950 1.00 81.61  ? 326  ASN D O   1 
ATOM   8097 C CB  . ASN D 2 152 ? 28.911  18.876  112.723 1.00 82.16  ? 326  ASN D CB  1 
ATOM   8098 C CG  . ASN D 2 152 ? 28.672  20.042  113.685 1.00 82.69  ? 326  ASN D CG  1 
ATOM   8099 O OD1 . ASN D 2 152 ? 28.210  21.110  113.287 1.00 82.09  ? 326  ASN D OD1 1 
ATOM   8100 N ND2 . ASN D 2 152 ? 28.997  19.836  114.961 1.00 82.18  ? 326  ASN D ND2 1 
ATOM   8101 N N   . CYS D 2 153 ? 28.058  17.504  115.681 1.00 81.65  ? 327  CYS D N   1 
ATOM   8102 C CA  . CYS D 2 153 ? 27.034  17.461  116.716 1.00 80.89  ? 327  CYS D CA  1 
ATOM   8103 C C   . CYS D 2 153 ? 25.982  18.573  116.610 1.00 79.21  ? 327  CYS D C   1 
ATOM   8104 O O   . CYS D 2 153 ? 24.868  18.418  117.110 1.00 77.48  ? 327  CYS D O   1 
ATOM   8105 C CB  . CYS D 2 153 ? 27.709  17.498  118.097 1.00 82.81  ? 327  CYS D CB  1 
ATOM   8106 S SG  . CYS D 2 153 ? 29.219  18.551  118.200 1.00 85.88  ? 327  CYS D SG  1 
ATOM   8107 N N   . LYS D 2 154 ? 26.325  19.688  115.963 1.00 78.83  ? 328  LYS D N   1 
ATOM   8108 C CA  . LYS D 2 154 ? 25.376  20.796  115.831 1.00 77.43  ? 328  LYS D CA  1 
ATOM   8109 C C   . LYS D 2 154 ? 24.939  21.164  114.412 1.00 76.10  ? 328  LYS D C   1 
ATOM   8110 O O   . LYS D 2 154 ? 23.865  21.736  114.237 1.00 76.11  ? 328  LYS D O   1 
ATOM   8111 C CB  . LYS D 2 154 ? 25.902  22.057  116.524 1.00 78.85  ? 328  LYS D CB  1 
ATOM   8112 C CG  . LYS D 2 154 ? 27.243  21.919  117.220 1.00 80.06  ? 328  LYS D CG  1 
ATOM   8113 C CD  . LYS D 2 154 ? 27.698  23.266  117.774 1.00 80.97  ? 328  LYS D CD  1 
ATOM   8114 C CE  . LYS D 2 154 ? 27.722  24.333  116.676 1.00 82.59  ? 328  LYS D CE  1 
ATOM   8115 N NZ  . LYS D 2 154 ? 28.349  25.626  117.097 1.00 82.23  ? 328  LYS D NZ  1 
ATOM   8116 N N   . VAL D 2 155 ? 25.753  20.877  113.402 1.00 75.05  ? 329  VAL D N   1 
ATOM   8117 C CA  . VAL D 2 155 ? 25.331  21.183  112.037 1.00 75.08  ? 329  VAL D CA  1 
ATOM   8118 C C   . VAL D 2 155 ? 24.003  20.455  111.895 1.00 75.42  ? 329  VAL D C   1 
ATOM   8119 O O   . VAL D 2 155 ? 23.025  20.993  111.366 1.00 74.63  ? 329  VAL D O   1 
ATOM   8120 C CB  . VAL D 2 155 ? 26.333  20.648  110.972 1.00 76.14  ? 329  VAL D CB  1 
ATOM   8121 C CG1 . VAL D 2 155 ? 25.618  20.389  109.647 1.00 75.02  ? 329  VAL D CG1 1 
ATOM   8122 C CG2 . VAL D 2 155 ? 27.443  21.672  110.739 1.00 76.50  ? 329  VAL D CG2 1 
ATOM   8123 N N   . GLU D 2 156 ? 23.987  19.222  112.397 1.00 75.66  ? 330  GLU D N   1 
ATOM   8124 C CA  . GLU D 2 156 ? 22.800  18.377  112.375 1.00 75.74  ? 330  GLU D CA  1 
ATOM   8125 C C   . GLU D 2 156 ? 21.656  19.067  113.114 1.00 75.29  ? 330  GLU D C   1 
ATOM   8126 O O   . GLU D 2 156 ? 20.629  19.400  112.519 1.00 75.48  ? 330  GLU D O   1 
ATOM   8127 C CB  . GLU D 2 156 ? 23.102  17.027  113.042 1.00 76.14  ? 330  GLU D CB  1 
ATOM   8128 C CG  . GLU D 2 156 ? 23.844  16.027  112.160 1.00 76.01  ? 330  GLU D CG  1 
ATOM   8129 C CD  . GLU D 2 156 ? 24.386  14.842  112.945 1.00 76.77  ? 330  GLU D CD  1 
ATOM   8130 O OE1 . GLU D 2 156 ? 23.905  14.607  114.076 1.00 77.13  ? 330  GLU D OE1 1 
ATOM   8131 O OE2 . GLU D 2 156 ? 25.288  14.144  112.427 1.00 76.93  ? 330  GLU D OE2 1 
ATOM   8132 N N   . SER D 2 157 ? 21.845  19.284  114.412 1.00 73.73  ? 331  SER D N   1 
ATOM   8133 C CA  . SER D 2 157 ? 20.829  19.926  115.232 1.00 72.38  ? 331  SER D CA  1 
ATOM   8134 C C   . SER D 2 157 ? 20.243  21.178  114.589 1.00 71.84  ? 331  SER D C   1 
ATOM   8135 O O   . SER D 2 157 ? 19.027  21.352  114.562 1.00 71.07  ? 331  SER D O   1 
ATOM   8136 C CB  . SER D 2 157 ? 21.399  20.264  116.609 1.00 71.89  ? 331  SER D CB  1 
ATOM   8137 O OG  . SER D 2 157 ? 21.651  19.082  117.347 1.00 71.43  ? 331  SER D OG  1 
ATOM   8138 N N   . LEU D 2 158 ? 21.091  22.054  114.067 1.00 71.60  ? 332  LEU D N   1 
ATOM   8139 C CA  . LEU D 2 158 ? 20.570  23.260  113.439 1.00 72.48  ? 332  LEU D CA  1 
ATOM   8140 C C   . LEU D 2 158 ? 19.624  22.911  112.287 1.00 71.62  ? 332  LEU D C   1 
ATOM   8141 O O   . LEU D 2 158 ? 18.523  23.460  112.197 1.00 71.43  ? 332  LEU D O   1 
ATOM   8142 C CB  . LEU D 2 158 ? 21.710  24.156  112.927 1.00 73.32  ? 332  LEU D CB  1 
ATOM   8143 C CG  . LEU D 2 158 ? 21.250  25.469  112.271 1.00 73.54  ? 332  LEU D CG  1 
ATOM   8144 C CD1 . LEU D 2 158 ? 20.311  26.224  113.211 1.00 73.14  ? 332  LEU D CD1 1 
ATOM   8145 C CD2 . LEU D 2 158 ? 22.451  26.321  111.927 1.00 73.65  ? 332  LEU D CD2 1 
ATOM   8146 N N   . ALA D 2 159 ? 20.050  22.003  111.411 1.00 70.39  ? 333  ALA D N   1 
ATOM   8147 C CA  . ALA D 2 159 ? 19.221  21.596  110.277 1.00 69.90  ? 333  ALA D CA  1 
ATOM   8148 C C   . ALA D 2 159 ? 17.838  21.143  110.760 1.00 70.02  ? 333  ALA D C   1 
ATOM   8149 O O   . ALA D 2 159 ? 16.816  21.517  110.173 1.00 68.43  ? 333  ALA D O   1 
ATOM   8150 C CB  . ALA D 2 159 ? 19.905  20.481  109.500 1.00 69.62  ? 333  ALA D CB  1 
ATOM   8151 N N   . MET D 2 160 ? 17.809  20.340  111.826 1.00 69.76  ? 334  MET D N   1 
ATOM   8152 C CA  . MET D 2 160 ? 16.543  19.875  112.391 1.00 70.32  ? 334  MET D CA  1 
ATOM   8153 C C   . MET D 2 160 ? 15.701  21.122  112.645 1.00 68.53  ? 334  MET D C   1 
ATOM   8154 O O   . MET D 2 160 ? 14.598  21.271  112.112 1.00 67.50  ? 334  MET D O   1 
ATOM   8155 C CB  . MET D 2 160 ? 16.772  19.126  113.715 1.00 72.93  ? 334  MET D CB  1 
ATOM   8156 C CG  . MET D 2 160 ? 17.512  17.800  113.575 1.00 76.74  ? 334  MET D CG  1 
ATOM   8157 S SD  . MET D 2 160 ? 16.722  16.434  114.495 1.00 82.35  ? 334  MET D SD  1 
ATOM   8158 C CE  . MET D 2 160 ? 17.971  16.046  115.744 1.00 80.18  ? 334  MET D CE  1 
ATOM   8159 N N   . PHE D 2 161 ? 16.261  22.013  113.461 1.00 67.58  ? 335  PHE D N   1 
ATOM   8160 C CA  . PHE D 2 161 ? 15.655  23.290  113.827 1.00 65.10  ? 335  PHE D CA  1 
ATOM   8161 C C   . PHE D 2 161 ? 15.024  23.980  112.622 1.00 62.25  ? 335  PHE D C   1 
ATOM   8162 O O   . PHE D 2 161 ? 13.843  24.317  112.630 1.00 61.79  ? 335  PHE D O   1 
ATOM   8163 C CB  . PHE D 2 161 ? 16.734  24.198  114.427 1.00 67.04  ? 335  PHE D CB  1 
ATOM   8164 C CG  . PHE D 2 161 ? 16.288  25.618  114.667 1.00 68.53  ? 335  PHE D CG  1 
ATOM   8165 C CD1 . PHE D 2 161 ? 15.607  25.964  115.833 1.00 68.76  ? 335  PHE D CD1 1 
ATOM   8166 C CD2 . PHE D 2 161 ? 16.569  26.616  113.731 1.00 69.21  ? 335  PHE D CD2 1 
ATOM   8167 C CE1 . PHE D 2 161 ? 15.215  27.286  116.067 1.00 69.62  ? 335  PHE D CE1 1 
ATOM   8168 C CE2 . PHE D 2 161 ? 16.181  27.939  113.953 1.00 69.28  ? 335  PHE D CE2 1 
ATOM   8169 C CZ  . PHE D 2 161 ? 15.504  28.275  115.124 1.00 68.92  ? 335  PHE D CZ  1 
ATOM   8170 N N   . LEU D 2 162 ? 15.821  24.190  111.584 1.00 59.94  ? 336  LEU D N   1 
ATOM   8171 C CA  . LEU D 2 162 ? 15.329  24.857  110.390 1.00 59.71  ? 336  LEU D CA  1 
ATOM   8172 C C   . LEU D 2 162 ? 14.177  24.096  109.732 1.00 58.36  ? 336  LEU D C   1 
ATOM   8173 O O   . LEU D 2 162 ? 13.114  24.664  109.475 1.00 56.97  ? 336  LEU D O   1 
ATOM   8174 C CB  . LEU D 2 162 ? 16.490  25.072  109.407 1.00 59.41  ? 336  LEU D CB  1 
ATOM   8175 C CG  . LEU D 2 162 ? 17.512  26.120  109.874 1.00 59.19  ? 336  LEU D CG  1 
ATOM   8176 C CD1 . LEU D 2 162 ? 18.900  25.774  109.356 1.00 59.48  ? 336  LEU D CD1 1 
ATOM   8177 C CD2 . LEU D 2 162 ? 17.079  27.500  109.408 1.00 58.00  ? 336  LEU D CD2 1 
ATOM   8178 N N   . GLY D 2 163 ? 14.381  22.808  109.473 1.00 58.25  ? 337  GLY D N   1 
ATOM   8179 C CA  . GLY D 2 163 ? 13.337  22.013  108.849 1.00 55.85  ? 337  GLY D CA  1 
ATOM   8180 C C   . GLY D 2 163 ? 12.067  22.030  109.675 1.00 54.46  ? 337  GLY D C   1 
ATOM   8181 O O   . GLY D 2 163 ? 10.962  22.218  109.157 1.00 52.51  ? 337  GLY D O   1 
ATOM   8182 N N   . GLU D 2 164 ? 12.237  21.847  110.976 1.00 52.88  ? 338  GLU D N   1 
ATOM   8183 C CA  . GLU D 2 164 ? 11.119  21.830  111.898 1.00 52.82  ? 338  GLU D CA  1 
ATOM   8184 C C   . GLU D 2 164 ? 10.386  23.174  111.968 1.00 53.98  ? 338  GLU D C   1 
ATOM   8185 O O   . GLU D 2 164 ? 9.213   23.231  112.333 1.00 53.76  ? 338  GLU D O   1 
ATOM   8186 C CB  . GLU D 2 164 ? 11.627  21.414  113.274 1.00 52.30  ? 338  GLU D CB  1 
ATOM   8187 C CG  . GLU D 2 164 ? 10.559  21.280  114.324 1.00 51.32  ? 338  GLU D CG  1 
ATOM   8188 C CD  . GLU D 2 164 ? 11.039  20.472  115.498 1.00 51.59  ? 338  GLU D CD  1 
ATOM   8189 O OE1 . GLU D 2 164 ? 10.687  20.828  116.639 1.00 53.17  ? 338  GLU D OE1 1 
ATOM   8190 O OE2 . GLU D 2 164 ? 11.764  19.475  115.281 1.00 52.20  ? 338  GLU D OE2 1 
ATOM   8191 N N   . LEU D 2 165 ? 11.078  24.257  111.622 1.00 54.66  ? 339  LEU D N   1 
ATOM   8192 C CA  . LEU D 2 165 ? 10.462  25.581  111.641 1.00 54.21  ? 339  LEU D CA  1 
ATOM   8193 C C   . LEU D 2 165 ? 9.540   25.740  110.439 1.00 53.97  ? 339  LEU D C   1 
ATOM   8194 O O   . LEU D 2 165 ? 8.580   26.503  110.482 1.00 55.02  ? 339  LEU D O   1 
ATOM   8195 C CB  . LEU D 2 165 ? 11.531  26.693  111.606 1.00 53.14  ? 339  LEU D CB  1 
ATOM   8196 C CG  . LEU D 2 165 ? 12.179  27.191  112.903 1.00 50.64  ? 339  LEU D CG  1 
ATOM   8197 C CD1 . LEU D 2 165 ? 13.155  28.301  112.581 1.00 49.20  ? 339  LEU D CD1 1 
ATOM   8198 C CD2 . LEU D 2 165 ? 11.113  27.693  113.860 1.00 47.59  ? 339  LEU D CD2 1 
ATOM   8199 N N   . SER D 2 166 ? 9.840   25.018  109.363 1.00 54.22  ? 340  SER D N   1 
ATOM   8200 C CA  . SER D 2 166 ? 9.039   25.101  108.146 1.00 55.28  ? 340  SER D CA  1 
ATOM   8201 C C   . SER D 2 166 ? 7.679   24.440  108.303 1.00 55.75  ? 340  SER D C   1 
ATOM   8202 O O   . SER D 2 166 ? 6.843   24.541  107.414 1.00 56.60  ? 340  SER D O   1 
ATOM   8203 C CB  . SER D 2 166 ? 9.765   24.436  106.981 1.00 55.56  ? 340  SER D CB  1 
ATOM   8204 O OG  . SER D 2 166 ? 9.746   23.025  107.126 1.00 56.85  ? 340  SER D OG  1 
ATOM   8205 N N   . LEU D 2 167 ? 7.470   23.754  109.427 1.00 54.83  ? 341  LEU D N   1 
ATOM   8206 C CA  . LEU D 2 167 ? 6.210   23.065  109.697 1.00 53.17  ? 341  LEU D CA  1 
ATOM   8207 C C   . LEU D 2 167 ? 5.112   24.034  110.110 1.00 53.21  ? 341  LEU D C   1 
ATOM   8208 O O   . LEU D 2 167 ? 3.933   23.848  109.778 1.00 52.67  ? 341  LEU D O   1 
ATOM   8209 C CB  . LEU D 2 167 ? 6.408   22.029  110.807 1.00 52.56  ? 341  LEU D CB  1 
ATOM   8210 C CG  . LEU D 2 167 ? 7.456   20.947  110.524 1.00 51.93  ? 341  LEU D CG  1 
ATOM   8211 C CD1 . LEU D 2 167 ? 7.632   20.060  111.739 1.00 50.55  ? 341  LEU D CD1 1 
ATOM   8212 C CD2 . LEU D 2 167 ? 7.036   20.131  109.317 1.00 49.95  ? 341  LEU D CD2 1 
ATOM   8213 N N   . ILE D 2 168 ? 5.521   25.071  110.833 1.00 52.23  ? 342  ILE D N   1 
ATOM   8214 C CA  . ILE D 2 168 ? 4.623   26.102  111.345 1.00 50.61  ? 342  ILE D CA  1 
ATOM   8215 C C   . ILE D 2 168 ? 3.967   26.960  110.259 1.00 51.09  ? 342  ILE D C   1 
ATOM   8216 O O   . ILE D 2 168 ? 2.803   27.347  110.374 1.00 48.82  ? 342  ILE D O   1 
ATOM   8217 C CB  . ILE D 2 168 ? 5.386   27.070  112.282 1.00 48.01  ? 342  ILE D CB  1 
ATOM   8218 C CG1 . ILE D 2 168 ? 6.241   26.284  113.282 1.00 46.41  ? 342  ILE D CG1 1 
ATOM   8219 C CG2 . ILE D 2 168 ? 4.403   27.992  112.982 1.00 46.84  ? 342  ILE D CG2 1 
ATOM   8220 C CD1 . ILE D 2 168 ? 5.465   25.529  114.336 1.00 44.47  ? 342  ILE D CD1 1 
ATOM   8221 N N   . ASP D 2 169 ? 4.719   27.244  109.203 1.00 52.32  ? 343  ASP D N   1 
ATOM   8222 C CA  . ASP D 2 169 ? 4.231   28.116  108.145 1.00 54.54  ? 343  ASP D CA  1 
ATOM   8223 C C   . ASP D 2 169 ? 3.766   27.456  106.854 1.00 54.51  ? 343  ASP D C   1 
ATOM   8224 O O   . ASP D 2 169 ? 4.563   27.213  105.952 1.00 53.70  ? 343  ASP D O   1 
ATOM   8225 C CB  . ASP D 2 169 ? 5.315   29.159  107.832 1.00 56.17  ? 343  ASP D CB  1 
ATOM   8226 C CG  . ASP D 2 169 ? 5.706   29.986  109.059 1.00 57.88  ? 343  ASP D CG  1 
ATOM   8227 O OD1 . ASP D 2 169 ? 4.868   30.789  109.517 1.00 58.07  ? 343  ASP D OD1 1 
ATOM   8228 O OD2 . ASP D 2 169 ? 6.842   29.827  109.569 1.00 56.51  ? 343  ASP D OD2 1 
ATOM   8229 N N   . ALA D 2 170 ? 2.467   27.188  106.765 1.00 56.50  ? 344  ALA D N   1 
ATOM   8230 C CA  . ALA D 2 170 ? 1.896   26.576  105.567 1.00 58.94  ? 344  ALA D CA  1 
ATOM   8231 C C   . ALA D 2 170 ? 2.350   27.439  104.401 1.00 60.29  ? 344  ALA D C   1 
ATOM   8232 O O   . ALA D 2 170 ? 2.610   26.953  103.295 1.00 60.69  ? 344  ALA D O   1 
ATOM   8233 C CB  . ALA D 2 170 ? 0.365   26.560  105.654 1.00 58.01  ? 344  ALA D CB  1 
ATOM   8234 N N   . ASP D 2 171 ? 2.427   28.736  104.672 1.00 62.35  ? 345  ASP D N   1 
ATOM   8235 C CA  . ASP D 2 171 ? 2.879   29.719  103.697 1.00 63.94  ? 345  ASP D CA  1 
ATOM   8236 C C   . ASP D 2 171 ? 4.319   30.021  104.110 1.00 63.11  ? 345  ASP D C   1 
ATOM   8237 O O   . ASP D 2 171 ? 4.550   30.538  105.200 1.00 64.23  ? 345  ASP D O   1 
ATOM   8238 C CB  . ASP D 2 171 ? 2.036   30.990  103.806 1.00 65.21  ? 345  ASP D CB  1 
ATOM   8239 C CG  . ASP D 2 171 ? 2.110   31.845  102.559 1.00 66.50  ? 345  ASP D CG  1 
ATOM   8240 O OD1 . ASP D 2 171 ? 3.191   31.888  101.930 1.00 66.44  ? 345  ASP D OD1 1 
ATOM   8241 O OD2 . ASP D 2 171 ? 1.086   32.479  102.219 1.00 66.57  ? 345  ASP D OD2 1 
ATOM   8242 N N   . PRO D 2 172 ? 5.304   29.740  103.241 1.00 62.14  ? 346  PRO D N   1 
ATOM   8243 C CA  . PRO D 2 172 ? 5.274   29.172  101.889 1.00 61.84  ? 346  PRO D CA  1 
ATOM   8244 C C   . PRO D 2 172 ? 5.579   27.666  101.770 1.00 61.13  ? 346  PRO D C   1 
ATOM   8245 O O   . PRO D 2 172 ? 5.181   27.013  100.809 1.00 61.23  ? 346  PRO D O   1 
ATOM   8246 C CB  . PRO D 2 172 ? 6.345   29.985  101.196 1.00 60.90  ? 346  PRO D CB  1 
ATOM   8247 C CG  . PRO D 2 172 ? 7.428   29.971  102.260 1.00 59.98  ? 346  PRO D CG  1 
ATOM   8248 C CD  . PRO D 2 172 ? 6.667   30.210  103.563 1.00 60.00  ? 346  PRO D CD  1 
ATOM   8249 N N   . TYR D 2 173 ? 6.305   27.143  102.748 1.00 60.66  ? 347  TYR D N   1 
ATOM   8250 C CA  . TYR D 2 173 ? 6.756   25.756  102.780 1.00 59.72  ? 347  TYR D CA  1 
ATOM   8251 C C   . TYR D 2 173 ? 5.894   24.635  102.225 1.00 59.60  ? 347  TYR D C   1 
ATOM   8252 O O   . TYR D 2 173 ? 6.394   23.548  101.940 1.00 59.97  ? 347  TYR D O   1 
ATOM   8253 C CB  . TYR D 2 173 ? 7.193   25.448  104.200 1.00 60.86  ? 347  TYR D CB  1 
ATOM   8254 C CG  . TYR D 2 173 ? 8.318   26.367  104.572 1.00 62.77  ? 347  TYR D CG  1 
ATOM   8255 C CD1 . TYR D 2 173 ? 9.611   26.133  104.110 1.00 62.59  ? 347  TYR D CD1 1 
ATOM   8256 C CD2 . TYR D 2 173 ? 8.067   27.551  105.266 1.00 64.52  ? 347  TYR D CD2 1 
ATOM   8257 C CE1 . TYR D 2 173 ? 10.625  27.060  104.322 1.00 64.58  ? 347  TYR D CE1 1 
ATOM   8258 C CE2 . TYR D 2 173 ? 9.067   28.484  105.482 1.00 64.09  ? 347  TYR D CE2 1 
ATOM   8259 C CZ  . TYR D 2 173 ? 10.343  28.236  105.008 1.00 64.94  ? 347  TYR D CZ  1 
ATOM   8260 O OH  . TYR D 2 173 ? 11.328  29.170  105.222 1.00 64.14  ? 347  TYR D OH  1 
ATOM   8261 N N   . LEU D 2 174 ? 4.610   24.889  102.050 1.00 59.59  ? 348  LEU D N   1 
ATOM   8262 C CA  . LEU D 2 174 ? 3.734   23.871  101.511 1.00 59.30  ? 348  LEU D CA  1 
ATOM   8263 C C   . LEU D 2 174 ? 3.952   23.820  100.002 1.00 60.62  ? 348  LEU D C   1 
ATOM   8264 O O   . LEU D 2 174 ? 3.346   23.018  99.304  1.00 60.39  ? 348  LEU D O   1 
ATOM   8265 C CB  . LEU D 2 174 ? 2.282   24.233  101.819 1.00 60.38  ? 348  LEU D CB  1 
ATOM   8266 C CG  . LEU D 2 174 ? 1.352   23.133  102.326 1.00 60.05  ? 348  LEU D CG  1 
ATOM   8267 C CD1 . LEU D 2 174 ? 1.950   22.496  103.573 1.00 60.84  ? 348  LEU D CD1 1 
ATOM   8268 C CD2 . LEU D 2 174 ? -0.024  23.729  102.619 1.00 59.51  ? 348  LEU D CD2 1 
ATOM   8269 N N   . LYS D 2 175 ? 4.822   24.686  99.497  1.00 61.73  ? 349  LYS D N   1 
ATOM   8270 C CA  . LYS D 2 175 ? 5.087   24.733  98.064  1.00 62.09  ? 349  LYS D CA  1 
ATOM   8271 C C   . LYS D 2 175 ? 6.303   23.902  97.693  1.00 61.45  ? 349  LYS D C   1 
ATOM   8272 O O   . LYS D 2 175 ? 6.580   23.683  96.517  1.00 61.23  ? 349  LYS D O   1 
ATOM   8273 C CB  . LYS D 2 175 ? 5.310   26.179  97.611  1.00 62.84  ? 349  LYS D CB  1 
ATOM   8274 C CG  . LYS D 2 175 ? 4.237   27.147  98.076  1.00 65.67  ? 349  LYS D CG  1 
ATOM   8275 C CD  . LYS D 2 175 ? 4.255   28.448  97.278  1.00 67.17  ? 349  LYS D CD  1 
ATOM   8276 C CE  . LYS D 2 175 ? 5.642   29.075  97.231  1.00 68.65  ? 349  LYS D CE  1 
ATOM   8277 N NZ  . LYS D 2 175 ? 6.194   29.298  98.589  1.00 68.77  ? 349  LYS D NZ  1 
ATOM   8278 N N   . TYR D 2 176 ? 7.023   23.432  98.700  1.00 61.10  ? 350  TYR D N   1 
ATOM   8279 C CA  . TYR D 2 176 ? 8.216   22.654  98.448  1.00 62.22  ? 350  TYR D CA  1 
ATOM   8280 C C   . TYR D 2 176 ? 8.108   21.240  98.988  1.00 61.26  ? 350  TYR D C   1 
ATOM   8281 O O   . TYR D 2 176 ? 7.549   21.013  100.057 1.00 61.80  ? 350  TYR D O   1 
ATOM   8282 C CB  . TYR D 2 176 ? 9.430   23.355  99.069  1.00 65.12  ? 350  TYR D CB  1 
ATOM   8283 C CG  . TYR D 2 176 ? 9.572   24.820  98.690  1.00 68.27  ? 350  TYR D CG  1 
ATOM   8284 C CD1 . TYR D 2 176 ? 9.515   25.224  97.355  1.00 69.36  ? 350  TYR D CD1 1 
ATOM   8285 C CD2 . TYR D 2 176 ? 9.794   25.799  99.664  1.00 69.03  ? 350  TYR D CD2 1 
ATOM   8286 C CE1 . TYR D 2 176 ? 9.677   26.558  96.998  1.00 71.20  ? 350  TYR D CE1 1 
ATOM   8287 C CE2 . TYR D 2 176 ? 9.959   27.137  99.316  1.00 70.35  ? 350  TYR D CE2 1 
ATOM   8288 C CZ  . TYR D 2 176 ? 9.900   27.509  97.980  1.00 71.63  ? 350  TYR D CZ  1 
ATOM   8289 O OH  . TYR D 2 176 ? 10.072  28.827  97.620  1.00 72.80  ? 350  TYR D OH  1 
ATOM   8290 N N   . LEU D 2 177 ? 8.646   20.290  98.233  1.00 60.40  ? 351  LEU D N   1 
ATOM   8291 C CA  . LEU D 2 177 ? 8.644   18.891  98.632  1.00 58.97  ? 351  LEU D CA  1 
ATOM   8292 C C   . LEU D 2 177 ? 9.516   18.731  99.866  1.00 58.97  ? 351  LEU D C   1 
ATOM   8293 O O   . LEU D 2 177 ? 10.326  19.596  100.178 1.00 60.75  ? 351  LEU D O   1 
ATOM   8294 C CB  . LEU D 2 177 ? 9.174   18.028  97.491  1.00 57.35  ? 351  LEU D CB  1 
ATOM   8295 C CG  . LEU D 2 177 ? 8.285   18.017  96.244  1.00 57.53  ? 351  LEU D CG  1 
ATOM   8296 C CD1 . LEU D 2 177 ? 8.972   17.249  95.131  1.00 57.87  ? 351  LEU D CD1 1 
ATOM   8297 C CD2 . LEU D 2 177 ? 6.939   17.378  96.575  1.00 57.73  ? 351  LEU D CD2 1 
ATOM   8298 N N   . PRO D 2 178 ? 9.362   17.618  100.590 1.00 59.29  ? 352  PRO D N   1 
ATOM   8299 C CA  . PRO D 2 178 ? 10.170  17.410  101.795 1.00 59.47  ? 352  PRO D CA  1 
ATOM   8300 C C   . PRO D 2 178 ? 11.668  17.254  101.545 1.00 59.76  ? 352  PRO D C   1 
ATOM   8301 O O   . PRO D 2 178 ? 12.475  17.577  102.421 1.00 59.70  ? 352  PRO D O   1 
ATOM   8302 C CB  . PRO D 2 178 ? 9.560   16.147  102.407 1.00 58.35  ? 352  PRO D CB  1 
ATOM   8303 C CG  . PRO D 2 178 ? 8.145   16.180  101.926 1.00 57.49  ? 352  PRO D CG  1 
ATOM   8304 C CD  . PRO D 2 178 ? 8.310   16.594  100.487 1.00 58.33  ? 352  PRO D CD  1 
ATOM   8305 N N   . SER D 2 179 ? 12.036  16.759  100.363 1.00 58.60  ? 353  SER D N   1 
ATOM   8306 C CA  . SER D 2 179 ? 13.445  16.549  100.038 1.00 58.98  ? 353  SER D CA  1 
ATOM   8307 C C   . SER D 2 179 ? 14.158  17.861  99.716  1.00 59.74  ? 353  SER D C   1 
ATOM   8308 O O   . SER D 2 179 ? 15.354  18.017  100.004 1.00 58.42  ? 353  SER D O   1 
ATOM   8309 C CB  . SER D 2 179 ? 13.592  15.580  98.860  1.00 59.22  ? 353  SER D CB  1 
ATOM   8310 O OG  . SER D 2 179 ? 13.122  16.155  97.656  1.00 60.72  ? 353  SER D OG  1 
ATOM   8311 N N   . VAL D 2 180 ? 13.423  18.794  99.110  1.00 58.55  ? 354  VAL D N   1 
ATOM   8312 C CA  . VAL D 2 180 ? 13.974  20.100  98.768  1.00 58.04  ? 354  VAL D CA  1 
ATOM   8313 C C   . VAL D 2 180 ? 14.148  20.900  100.057 1.00 57.58  ? 354  VAL D C   1 
ATOM   8314 O O   . VAL D 2 180 ? 15.252  21.341  100.372 1.00 58.15  ? 354  VAL D O   1 
ATOM   8315 C CB  . VAL D 2 180 ? 13.049  20.859  97.801  1.00 57.96  ? 354  VAL D CB  1 
ATOM   8316 C CG1 . VAL D 2 180 ? 13.589  22.251  97.544  1.00 56.42  ? 354  VAL D CG1 1 
ATOM   8317 C CG2 . VAL D 2 180 ? 12.936  20.089  96.492  1.00 56.94  ? 354  VAL D CG2 1 
ATOM   8318 N N   . ILE D 2 181 ? 13.061  21.077  100.803 1.00 56.30  ? 355  ILE D N   1 
ATOM   8319 C CA  . ILE D 2 181 ? 13.133  21.796  102.070 1.00 54.85  ? 355  ILE D CA  1 
ATOM   8320 C C   . ILE D 2 181 ? 14.290  21.235  102.891 1.00 55.81  ? 355  ILE D C   1 
ATOM   8321 O O   . ILE D 2 181 ? 15.064  21.982  103.484 1.00 55.00  ? 355  ILE D O   1 
ATOM   8322 C CB  . ILE D 2 181 ? 11.840  21.621  102.909 1.00 53.08  ? 355  ILE D CB  1 
ATOM   8323 C CG1 . ILE D 2 181 ? 10.657  22.282  102.205 1.00 52.95  ? 355  ILE D CG1 1 
ATOM   8324 C CG2 . ILE D 2 181 ? 12.024  22.227  104.297 1.00 51.14  ? 355  ILE D CG2 1 
ATOM   8325 C CD1 . ILE D 2 181 ? 9.367   22.261  103.017 1.00 51.66  ? 355  ILE D CD1 1 
ATOM   8326 N N   . ALA D 2 182 ? 14.400  19.910  102.907 1.00 57.70  ? 356  ALA D N   1 
ATOM   8327 C CA  . ALA D 2 182 ? 15.432  19.212  103.671 1.00 60.13  ? 356  ALA D CA  1 
ATOM   8328 C C   . ALA D 2 182 ? 16.858  19.569  103.271 1.00 62.24  ? 356  ALA D C   1 
ATOM   8329 O O   . ALA D 2 182 ? 17.736  19.675  104.125 1.00 62.90  ? 356  ALA D O   1 
ATOM   8330 C CB  . ALA D 2 182 ? 15.226  17.703  103.564 1.00 58.47  ? 356  ALA D CB  1 
ATOM   8331 N N   . GLY D 2 183 ? 17.093  19.736  101.975 1.00 64.79  ? 357  GLY D N   1 
ATOM   8332 C CA  . GLY D 2 183 ? 18.425  20.084  101.513 1.00 66.88  ? 357  GLY D CA  1 
ATOM   8333 C C   . GLY D 2 183 ? 18.800  21.489  101.948 1.00 68.16  ? 357  GLY D C   1 
ATOM   8334 O O   . GLY D 2 183 ? 19.875  21.719  102.514 1.00 66.79  ? 357  GLY D O   1 
ATOM   8335 N N   . ALA D 2 184 ? 17.903  22.433  101.673 1.00 69.75  ? 358  ALA D N   1 
ATOM   8336 C CA  . ALA D 2 184 ? 18.118  23.822  102.044 1.00 72.03  ? 358  ALA D CA  1 
ATOM   8337 C C   . ALA D 2 184 ? 18.434  23.847  103.529 1.00 73.43  ? 358  ALA D C   1 
ATOM   8338 O O   . ALA D 2 184 ? 19.432  24.428  103.951 1.00 75.57  ? 358  ALA D O   1 
ATOM   8339 C CB  . ALA D 2 184 ? 16.867  24.644  101.756 1.00 70.75  ? 358  ALA D CB  1 
ATOM   8340 N N   . ALA D 2 185 ? 17.586  23.194  104.317 1.00 73.77  ? 359  ALA D N   1 
ATOM   8341 C CA  . ALA D 2 185 ? 17.780  23.135  105.759 1.00 74.50  ? 359  ALA D CA  1 
ATOM   8342 C C   . ALA D 2 185 ? 19.206  22.703  106.065 1.00 74.21  ? 359  ALA D C   1 
ATOM   8343 O O   . ALA D 2 185 ? 19.879  23.290  106.914 1.00 74.42  ? 359  ALA D O   1 
ATOM   8344 C CB  . ALA D 2 185 ? 16.796  22.150  106.382 1.00 74.80  ? 359  ALA D CB  1 
ATOM   8345 N N   . PHE D 2 186 ? 19.663  21.676  105.360 1.00 74.08  ? 360  PHE D N   1 
ATOM   8346 C CA  . PHE D 2 186 ? 21.005  21.163  105.566 1.00 73.49  ? 360  PHE D CA  1 
ATOM   8347 C C   . PHE D 2 186 ? 22.060  22.231  105.288 1.00 74.70  ? 360  PHE D C   1 
ATOM   8348 O O   . PHE D 2 186 ? 22.986  22.412  106.079 1.00 74.68  ? 360  PHE D O   1 
ATOM   8349 C CB  . PHE D 2 186 ? 21.251  19.943  104.681 1.00 70.45  ? 360  PHE D CB  1 
ATOM   8350 C CG  . PHE D 2 186 ? 22.520  19.214  105.005 1.00 67.94  ? 360  PHE D CG  1 
ATOM   8351 C CD1 . PHE D 2 186 ? 22.768  18.773  106.299 1.00 66.97  ? 360  PHE D CD1 1 
ATOM   8352 C CD2 . PHE D 2 186 ? 23.459  18.950  104.018 1.00 66.68  ? 360  PHE D CD2 1 
ATOM   8353 C CE1 . PHE D 2 186 ? 23.932  18.076  106.606 1.00 66.20  ? 360  PHE D CE1 1 
ATOM   8354 C CE2 . PHE D 2 186 ? 24.626  18.253  104.317 1.00 66.22  ? 360  PHE D CE2 1 
ATOM   8355 C CZ  . PHE D 2 186 ? 24.862  17.816  105.613 1.00 66.13  ? 360  PHE D CZ  1 
ATOM   8356 N N   . HIS D 2 187 ? 21.922  22.945  104.173 1.00 75.78  ? 361  HIS D N   1 
ATOM   8357 C CA  . HIS D 2 187 ? 22.892  23.985  103.840 1.00 76.76  ? 361  HIS D CA  1 
ATOM   8358 C C   . HIS D 2 187 ? 22.936  25.084  104.895 1.00 75.76  ? 361  HIS D C   1 
ATOM   8359 O O   . HIS D 2 187 ? 23.966  25.334  105.510 1.00 74.57  ? 361  HIS D O   1 
ATOM   8360 C CB  . HIS D 2 187 ? 22.583  24.622  102.482 1.00 77.69  ? 361  HIS D CB  1 
ATOM   8361 C CG  . HIS D 2 187 ? 23.580  25.664  102.076 1.00 79.35  ? 361  HIS D CG  1 
ATOM   8362 N ND1 . HIS D 2 187 ? 24.344  25.561  100.933 1.00 79.92  ? 361  HIS D ND1 1 
ATOM   8363 C CD2 . HIS D 2 187 ? 23.979  26.803  102.691 1.00 79.93  ? 361  HIS D CD2 1 
ATOM   8364 C CE1 . HIS D 2 187 ? 25.173  26.588  100.866 1.00 80.01  ? 361  HIS D CE1 1 
ATOM   8365 N NE2 . HIS D 2 187 ? 24.972  27.356  101.920 1.00 80.46  ? 361  HIS D NE2 1 
ATOM   8366 N N   . LEU D 2 188 ? 21.810  25.753  105.085 1.00 76.35  ? 362  LEU D N   1 
ATOM   8367 C CA  . LEU D 2 188 ? 21.736  26.832  106.048 1.00 78.09  ? 362  LEU D CA  1 
ATOM   8368 C C   . LEU D 2 188 ? 22.423  26.431  107.357 1.00 78.95  ? 362  LEU D C   1 
ATOM   8369 O O   . LEU D 2 188 ? 23.128  27.233  107.973 1.00 79.04  ? 362  LEU D O   1 
ATOM   8370 C CB  . LEU D 2 188 ? 20.269  27.198  106.289 1.00 79.15  ? 362  LEU D CB  1 
ATOM   8371 C CG  . LEU D 2 188 ? 19.942  28.666  106.584 1.00 80.92  ? 362  LEU D CG  1 
ATOM   8372 C CD1 . LEU D 2 188 ? 20.648  29.563  105.580 1.00 79.89  ? 362  LEU D CD1 1 
ATOM   8373 C CD2 . LEU D 2 188 ? 18.431  28.881  106.509 1.00 80.98  ? 362  LEU D CD2 1 
ATOM   8374 N N   . ALA D 2 189 ? 22.243  25.179  107.763 1.00 79.23  ? 363  ALA D N   1 
ATOM   8375 C CA  . ALA D 2 189 ? 22.845  24.700  109.002 1.00 79.96  ? 363  ALA D CA  1 
ATOM   8376 C C   . ALA D 2 189 ? 24.381  24.702  108.995 1.00 80.50  ? 363  ALA D C   1 
ATOM   8377 O O   . ALA D 2 189 ? 25.002  25.493  109.705 1.00 80.41  ? 363  ALA D O   1 
ATOM   8378 C CB  . ALA D 2 189 ? 22.320  23.300  109.333 1.00 79.07  ? 363  ALA D CB  1 
ATOM   8379 N N   . LEU D 2 190 ? 24.992  23.826  108.199 1.00 80.63  ? 364  LEU D N   1 
ATOM   8380 C CA  . LEU D 2 190 ? 26.452  23.741  108.150 1.00 81.08  ? 364  LEU D CA  1 
ATOM   8381 C C   . LEU D 2 190 ? 27.124  25.089  107.875 1.00 81.67  ? 364  LEU D C   1 
ATOM   8382 O O   . LEU D 2 190 ? 28.116  25.433  108.518 1.00 81.28  ? 364  LEU D O   1 
ATOM   8383 C CB  . LEU D 2 190 ? 26.898  22.696  107.111 1.00 80.96  ? 364  LEU D CB  1 
ATOM   8384 C CG  . LEU D 2 190 ? 27.219  23.040  105.649 1.00 81.24  ? 364  LEU D CG  1 
ATOM   8385 C CD1 . LEU D 2 190 ? 27.606  21.755  104.923 1.00 81.74  ? 364  LEU D CD1 1 
ATOM   8386 C CD2 . LEU D 2 190 ? 26.036  23.683  104.955 1.00 80.88  ? 364  LEU D CD2 1 
ATOM   8387 N N   . TYR D 2 191 ? 26.585  25.850  106.925 1.00 82.74  ? 365  TYR D N   1 
ATOM   8388 C CA  . TYR D 2 191 ? 27.132  27.163  106.589 1.00 82.29  ? 365  TYR D CA  1 
ATOM   8389 C C   . TYR D 2 191 ? 27.272  27.918  107.907 1.00 80.72  ? 365  TYR D C   1 
ATOM   8390 O O   . TYR D 2 191 ? 28.376  28.196  108.372 1.00 79.59  ? 365  TYR D O   1 
ATOM   8391 C CB  . TYR D 2 191 ? 26.169  27.902  105.651 1.00 83.95  ? 365  TYR D CB  1 
ATOM   8392 C CG  . TYR D 2 191 ? 26.687  29.212  105.091 1.00 87.03  ? 365  TYR D CG  1 
ATOM   8393 C CD1 . TYR D 2 191 ? 27.802  29.245  104.248 1.00 88.53  ? 365  TYR D CD1 1 
ATOM   8394 C CD2 . TYR D 2 191 ? 26.043  30.419  105.382 1.00 87.68  ? 365  TYR D CD2 1 
ATOM   8395 C CE1 . TYR D 2 191 ? 28.263  30.453  103.704 1.00 89.78  ? 365  TYR D CE1 1 
ATOM   8396 C CE2 . TYR D 2 191 ? 26.494  31.631  104.844 1.00 89.43  ? 365  TYR D CE2 1 
ATOM   8397 C CZ  . TYR D 2 191 ? 27.603  31.639  104.006 1.00 89.95  ? 365  TYR D CZ  1 
ATOM   8398 O OH  . TYR D 2 191 ? 28.048  32.826  103.466 1.00 91.45  ? 365  TYR D OH  1 
ATOM   8399 N N   . THR D 2 192 ? 26.128  28.209  108.511 1.00 80.26  ? 366  THR D N   1 
ATOM   8400 C CA  . THR D 2 192 ? 26.051  28.920  109.781 1.00 81.04  ? 366  THR D CA  1 
ATOM   8401 C C   . THR D 2 192 ? 27.067  28.460  110.834 1.00 81.53  ? 366  THR D C   1 
ATOM   8402 O O   . THR D 2 192 ? 27.719  29.287  111.474 1.00 82.08  ? 366  THR D O   1 
ATOM   8403 C CB  . THR D 2 192 ? 24.625  28.788  110.383 1.00 81.02  ? 366  THR D CB  1 
ATOM   8404 O OG1 . THR D 2 192 ? 23.675  29.393  109.494 1.00 80.10  ? 366  THR D OG1 1 
ATOM   8405 C CG2 . THR D 2 192 ? 24.544  29.454  111.763 1.00 79.45  ? 366  THR D CG2 1 
ATOM   8406 N N   . VAL D 2 193 ? 27.197  27.147  111.011 1.00 81.30  ? 367  VAL D N   1 
ATOM   8407 C CA  . VAL D 2 193 ? 28.108  26.583  112.008 1.00 81.02  ? 367  VAL D CA  1 
ATOM   8408 C C   . VAL D 2 193 ? 29.554  26.336  111.547 1.00 81.43  ? 367  VAL D C   1 
ATOM   8409 O O   . VAL D 2 193 ? 30.470  26.289  112.375 1.00 80.91  ? 367  VAL D O   1 
ATOM   8410 C CB  . VAL D 2 193 ? 27.545  25.241  112.571 1.00 80.56  ? 367  VAL D CB  1 
ATOM   8411 C CG1 . VAL D 2 193 ? 28.515  24.637  113.582 1.00 79.03  ? 367  VAL D CG1 1 
ATOM   8412 C CG2 . VAL D 2 193 ? 26.190  25.474  113.216 1.00 79.62  ? 367  VAL D CG2 1 
ATOM   8413 N N   . THR D 2 194 ? 29.766  26.183  110.241 1.00 80.75  ? 368  THR D N   1 
ATOM   8414 C CA  . THR D 2 194 ? 31.109  25.913  109.737 1.00 80.20  ? 368  THR D CA  1 
ATOM   8415 C C   . THR D 2 194 ? 31.547  26.831  108.605 1.00 80.22  ? 368  THR D C   1 
ATOM   8416 O O   . THR D 2 194 ? 32.667  27.346  108.616 1.00 80.28  ? 368  THR D O   1 
ATOM   8417 C CB  . THR D 2 194 ? 31.238  24.451  109.243 1.00 80.65  ? 368  THR D CB  1 
ATOM   8418 O OG1 . THR D 2 194 ? 30.514  24.293  108.015 1.00 80.41  ? 368  THR D OG1 1 
ATOM   8419 C CG2 . THR D 2 194 ? 30.678  23.482  110.282 1.00 79.27  ? 368  THR D CG2 1 
ATOM   8420 N N   . GLY D 2 195 ? 30.674  27.023  107.622 1.00 79.85  ? 369  GLY D N   1 
ATOM   8421 C CA  . GLY D 2 195 ? 31.013  27.882  106.501 1.00 79.88  ? 369  GLY D CA  1 
ATOM   8422 C C   . GLY D 2 195 ? 31.045  27.137  105.181 1.00 79.89  ? 369  GLY D C   1 
ATOM   8423 O O   . GLY D 2 195 ? 31.252  27.735  104.123 1.00 79.26  ? 369  GLY D O   1 
ATOM   8424 N N   . GLN D 2 196 ? 30.839  25.824  105.247 1.00 80.28  ? 370  GLN D N   1 
ATOM   8425 C CA  . GLN D 2 196 ? 30.829  24.973  104.058 1.00 80.89  ? 370  GLN D CA  1 
ATOM   8426 C C   . GLN D 2 196 ? 29.489  25.122  103.345 1.00 81.25  ? 370  GLN D C   1 
ATOM   8427 O O   . GLN D 2 196 ? 28.569  25.762  103.863 1.00 81.35  ? 370  GLN D O   1 
ATOM   8428 C CB  . GLN D 2 196 ? 31.007  23.511  104.455 1.00 81.04  ? 370  GLN D CB  1 
ATOM   8429 C CG  . GLN D 2 196 ? 32.023  23.282  105.548 1.00 82.09  ? 370  GLN D CG  1 
ATOM   8430 C CD  . GLN D 2 196 ? 31.840  21.937  106.215 1.00 82.87  ? 370  GLN D CD  1 
ATOM   8431 O OE1 . GLN D 2 196 ? 31.973  20.891  105.579 1.00 83.48  ? 370  GLN D OE1 1 
ATOM   8432 N NE2 . GLN D 2 196 ? 31.523  21.957  107.503 1.00 83.13  ? 370  GLN D NE2 1 
ATOM   8433 N N   . SER D 2 197 ? 29.374  24.518  102.166 1.00 81.61  ? 371  SER D N   1 
ATOM   8434 C CA  . SER D 2 197 ? 28.137  24.589  101.399 1.00 81.39  ? 371  SER D CA  1 
ATOM   8435 C C   . SER D 2 197 ? 27.671  23.223  100.899 1.00 81.71  ? 371  SER D C   1 
ATOM   8436 O O   . SER D 2 197 ? 28.419  22.246  100.935 1.00 80.93  ? 371  SER D O   1 
ATOM   8437 C CB  . SER D 2 197 ? 28.299  25.561  100.226 1.00 81.77  ? 371  SER D CB  1 
ATOM   8438 O OG  . SER D 2 197 ? 28.434  26.900  100.690 1.00 81.33  ? 371  SER D OG  1 
ATOM   8439 N N   . TRP D 2 198 ? 26.419  23.173  100.448 1.00 82.45  ? 372  TRP D N   1 
ATOM   8440 C CA  . TRP D 2 198 ? 25.776  21.956  99.944  1.00 82.54  ? 372  TRP D CA  1 
ATOM   8441 C C   . TRP D 2 198 ? 26.702  21.008  99.181  1.00 81.92  ? 372  TRP D C   1 
ATOM   8442 O O   . TRP D 2 198 ? 26.970  21.199  97.992  1.00 81.83  ? 372  TRP D O   1 
ATOM   8443 C CB  . TRP D 2 198 ? 24.575  22.345  99.073  1.00 83.45  ? 372  TRP D CB  1 
ATOM   8444 C CG  . TRP D 2 198 ? 23.849  21.201  98.424  1.00 84.61  ? 372  TRP D CG  1 
ATOM   8445 C CD1 . TRP D 2 198 ? 23.764  20.944  97.087  1.00 84.92  ? 372  TRP D CD1 1 
ATOM   8446 C CD2 . TRP D 2 198 ? 23.062  20.192  99.076  1.00 85.24  ? 372  TRP D CD2 1 
ATOM   8447 N NE1 . TRP D 2 198 ? 22.972  19.844  96.862  1.00 85.23  ? 372  TRP D NE1 1 
ATOM   8448 C CE2 . TRP D 2 198 ? 22.528  19.361  98.065  1.00 85.45  ? 372  TRP D CE2 1 
ATOM   8449 C CE3 . TRP D 2 198 ? 22.756  19.909  100.416 1.00 85.66  ? 372  TRP D CE3 1 
ATOM   8450 C CZ2 . TRP D 2 198 ? 21.701  18.265  98.351  1.00 84.95  ? 372  TRP D CZ2 1 
ATOM   8451 C CZ3 . TRP D 2 198 ? 21.932  18.816  100.699 1.00 84.95  ? 372  TRP D CZ3 1 
ATOM   8452 C CH2 . TRP D 2 198 ? 21.417  18.010  99.669  1.00 84.13  ? 372  TRP D CH2 1 
ATOM   8453 N N   . PRO D 2 199 ? 27.183  19.956  99.868  1.00 81.07  ? 373  PRO D N   1 
ATOM   8454 C CA  . PRO D 2 199 ? 28.087  18.901  99.388  1.00 80.48  ? 373  PRO D CA  1 
ATOM   8455 C C   . PRO D 2 199 ? 27.838  18.356  97.982  1.00 79.53  ? 373  PRO D C   1 
ATOM   8456 O O   . PRO D 2 199 ? 26.710  18.350  97.494  1.00 79.43  ? 373  PRO D O   1 
ATOM   8457 C CB  . PRO D 2 199 ? 27.947  17.828  100.458 1.00 80.65  ? 373  PRO D CB  1 
ATOM   8458 C CG  . PRO D 2 199 ? 27.799  18.652  101.701 1.00 80.88  ? 373  PRO D CG  1 
ATOM   8459 C CD  . PRO D 2 199 ? 26.798  19.702  101.270 1.00 80.31  ? 373  PRO D CD  1 
ATOM   8460 N N   . GLU D 2 200 ? 28.915  17.893  97.350  1.00 78.62  ? 374  GLU D N   1 
ATOM   8461 C CA  . GLU D 2 200 ? 28.881  17.347  95.995  1.00 77.94  ? 374  GLU D CA  1 
ATOM   8462 C C   . GLU D 2 200 ? 28.339  15.926  95.987  1.00 77.02  ? 374  GLU D C   1 
ATOM   8463 O O   . GLU D 2 200 ? 27.773  15.470  94.990  1.00 76.25  ? 374  GLU D O   1 
ATOM   8464 C CB  . GLU D 2 200 ? 30.296  17.371  95.395  1.00 78.59  ? 374  GLU D CB  1 
ATOM   8465 C CG  . GLU D 2 200 ? 30.480  16.604  94.081  1.00 78.24  ? 374  GLU D CG  1 
ATOM   8466 C CD  . GLU D 2 200 ? 29.644  17.157  92.939  1.00 79.44  ? 374  GLU D CD  1 
ATOM   8467 O OE1 . GLU D 2 200 ? 29.542  18.400  92.825  1.00 78.19  ? 374  GLU D OE1 1 
ATOM   8468 O OE2 . GLU D 2 200 ? 29.103  16.348  92.148  1.00 79.37  ? 374  GLU D OE2 1 
ATOM   8469 N N   . SER D 2 201 ? 28.527  15.223  97.097  1.00 76.29  ? 375  SER D N   1 
ATOM   8470 C CA  . SER D 2 201 ? 28.041  13.859  97.203  1.00 76.40  ? 375  SER D CA  1 
ATOM   8471 C C   . SER D 2 201 ? 26.517  13.884  97.242  1.00 75.92  ? 375  SER D C   1 
ATOM   8472 O O   . SER D 2 201 ? 25.859  13.058  96.616  1.00 75.92  ? 375  SER D O   1 
ATOM   8473 C CB  . SER D 2 201 ? 28.612  13.188  98.458  1.00 76.78  ? 375  SER D CB  1 
ATOM   8474 O OG  . SER D 2 201 ? 28.510  14.035  99.589  1.00 79.26  ? 375  SER D OG  1 
ATOM   8475 N N   . LEU D 2 202 ? 25.958  14.847  97.965  1.00 75.74  ? 376  LEU D N   1 
ATOM   8476 C CA  . LEU D 2 202 ? 24.509  14.965  98.048  1.00 76.89  ? 376  LEU D CA  1 
ATOM   8477 C C   . LEU D 2 202 ? 23.937  15.451  96.717  1.00 78.11  ? 376  LEU D C   1 
ATOM   8478 O O   . LEU D 2 202 ? 22.793  15.147  96.377  1.00 79.06  ? 376  LEU D O   1 
ATOM   8479 C CB  . LEU D 2 202 ? 24.111  15.916  99.180  1.00 75.94  ? 376  LEU D CB  1 
ATOM   8480 C CG  . LEU D 2 202 ? 24.351  15.389  100.599 1.00 75.54  ? 376  LEU D CG  1 
ATOM   8481 C CD1 . LEU D 2 202 ? 23.971  16.446  101.615 1.00 74.27  ? 376  LEU D CD1 1 
ATOM   8482 C CD2 . LEU D 2 202 ? 23.532  14.126  100.821 1.00 75.15  ? 376  LEU D CD2 1 
ATOM   8483 N N   . ILE D 2 203 ? 24.734  16.210  95.967  1.00 79.12  ? 377  ILE D N   1 
ATOM   8484 C CA  . ILE D 2 203 ? 24.309  16.710  94.658  1.00 79.48  ? 377  ILE D CA  1 
ATOM   8485 C C   . ILE D 2 203 ? 24.229  15.508  93.730  1.00 79.75  ? 377  ILE D C   1 
ATOM   8486 O O   . ILE D 2 203 ? 23.257  15.316  93.002  1.00 78.98  ? 377  ILE D O   1 
ATOM   8487 C CB  . ILE D 2 203 ? 25.340  17.689  94.048  1.00 79.62  ? 377  ILE D CB  1 
ATOM   8488 C CG1 . ILE D 2 203 ? 25.512  18.911  94.948  1.00 80.21  ? 377  ILE D CG1 1 
ATOM   8489 C CG2 . ILE D 2 203 ? 24.882  18.126  92.665  1.00 79.54  ? 377  ILE D CG2 1 
ATOM   8490 C CD1 . ILE D 2 203 ? 26.594  19.866  94.478  1.00 80.09  ? 377  ILE D CD1 1 
ATOM   8491 N N   . ARG D 2 204 ? 25.285  14.706  93.774  1.00 81.12  ? 378  ARG D N   1 
ATOM   8492 C CA  . ARG D 2 204 ? 25.406  13.503  92.963  1.00 82.75  ? 378  ARG D CA  1 
ATOM   8493 C C   . ARG D 2 204 ? 24.371  12.472  93.405  1.00 82.19  ? 378  ARG D C   1 
ATOM   8494 O O   . ARG D 2 204 ? 24.177  11.443  92.751  1.00 81.97  ? 378  ARG D O   1 
ATOM   8495 C CB  . ARG D 2 204 ? 26.809  12.927  93.139  1.00 84.91  ? 378  ARG D CB  1 
ATOM   8496 C CG  . ARG D 2 204 ? 27.321  12.039  92.012  1.00 88.19  ? 378  ARG D CG  1 
ATOM   8497 C CD  . ARG D 2 204 ? 28.738  11.609  92.376  1.00 90.26  ? 378  ARG D CD  1 
ATOM   8498 N NE  . ARG D 2 204 ? 29.377  12.659  93.175  1.00 92.45  ? 378  ARG D NE  1 
ATOM   8499 C CZ  . ARG D 2 204 ? 30.282  12.441  94.126  1.00 92.93  ? 378  ARG D CZ  1 
ATOM   8500 N NH1 . ARG D 2 204 ? 30.801  13.461  94.805  1.00 92.16  ? 378  ARG D NH1 1 
ATOM   8501 N NH2 . ARG D 2 204 ? 30.672  11.201  94.398  1.00 92.33  ? 378  ARG D NH2 1 
ATOM   8502 N N   . LYS D 2 205 ? 23.710  12.757  94.522  1.00 81.03  ? 379  LYS D N   1 
ATOM   8503 C CA  . LYS D 2 205 ? 22.704  11.856  95.067  1.00 80.11  ? 379  LYS D CA  1 
ATOM   8504 C C   . LYS D 2 205 ? 21.275  12.344  94.831  1.00 79.64  ? 379  LYS D C   1 
ATOM   8505 O O   . LYS D 2 205 ? 20.430  11.590  94.346  1.00 78.83  ? 379  LYS D O   1 
ATOM   8506 C CB  . LYS D 2 205 ? 22.946  11.662  96.568  1.00 80.11  ? 379  LYS D CB  1 
ATOM   8507 C CG  . LYS D 2 205 ? 21.857  10.879  97.287  1.00 80.77  ? 379  LYS D CG  1 
ATOM   8508 C CD  . LYS D 2 205 ? 22.136  10.811  98.782  1.00 79.62  ? 379  LYS D CD  1 
ATOM   8509 C CE  . LYS D 2 205 ? 20.988  10.161  99.541  1.00 77.86  ? 379  LYS D CE  1 
ATOM   8510 N NZ  . LYS D 2 205 ? 20.751  8.762   99.108  1.00 74.24  ? 379  LYS D NZ  1 
ATOM   8511 N N   . THR D 2 206 ? 21.012  13.606  95.165  1.00 78.89  ? 380  THR D N   1 
ATOM   8512 C CA  . THR D 2 206 ? 19.678  14.178  95.008  1.00 78.26  ? 380  THR D CA  1 
ATOM   8513 C C   . THR D 2 206 ? 19.452  14.799  93.639  1.00 78.04  ? 380  THR D C   1 
ATOM   8514 O O   . THR D 2 206 ? 18.342  14.756  93.106  1.00 78.05  ? 380  THR D O   1 
ATOM   8515 C CB  . THR D 2 206 ? 19.400  15.274  96.066  1.00 78.32  ? 380  THR D CB  1 
ATOM   8516 O OG1 . THR D 2 206 ? 20.126  16.464  95.733  1.00 78.50  ? 380  THR D OG1 1 
ATOM   8517 C CG2 . THR D 2 206 ? 19.828  14.806  97.442  1.00 78.34  ? 380  THR D CG2 1 
ATOM   8518 N N   . GLY D 2 207 ? 20.509  15.379  93.077  1.00 78.45  ? 381  GLY D N   1 
ATOM   8519 C CA  . GLY D 2 207 ? 20.399  16.032  91.783  1.00 76.65  ? 381  GLY D CA  1 
ATOM   8520 C C   . GLY D 2 207 ? 19.940  17.458  92.016  1.00 75.79  ? 381  GLY D C   1 
ATOM   8521 O O   . GLY D 2 207 ? 19.374  18.107  91.132  1.00 73.74  ? 381  GLY D O   1 
ATOM   8522 N N   . TYR D 2 208 ? 20.181  17.936  93.233  1.00 76.15  ? 382  TYR D N   1 
ATOM   8523 C CA  . TYR D 2 208 ? 19.798  19.285  93.620  1.00 77.94  ? 382  TYR D CA  1 
ATOM   8524 C C   . TYR D 2 208 ? 21.009  20.202  93.774  1.00 78.84  ? 382  TYR D C   1 
ATOM   8525 O O   . TYR D 2 208 ? 22.000  19.839  94.412  1.00 79.78  ? 382  TYR D O   1 
ATOM   8526 C CB  . TYR D 2 208 ? 18.995  19.260  94.932  1.00 77.27  ? 382  TYR D CB  1 
ATOM   8527 C CG  . TYR D 2 208 ? 17.649  18.562  94.831  1.00 76.33  ? 382  TYR D CG  1 
ATOM   8528 C CD1 . TYR D 2 208 ? 16.866  18.678  93.679  1.00 76.02  ? 382  TYR D CD1 1 
ATOM   8529 C CD2 . TYR D 2 208 ? 17.148  17.804  95.894  1.00 75.71  ? 382  TYR D CD2 1 
ATOM   8530 C CE1 . TYR D 2 208 ? 15.620  18.058  93.586  1.00 75.56  ? 382  TYR D CE1 1 
ATOM   8531 C CE2 . TYR D 2 208 ? 15.899  17.180  95.813  1.00 74.60  ? 382  TYR D CE2 1 
ATOM   8532 C CZ  . TYR D 2 208 ? 15.144  17.313  94.654  1.00 74.76  ? 382  TYR D CZ  1 
ATOM   8533 O OH  . TYR D 2 208 ? 13.916  16.708  94.559  1.00 72.12  ? 382  TYR D OH  1 
ATOM   8534 N N   . THR D 2 209 ? 20.917  21.388  93.176  1.00 79.08  ? 383  THR D N   1 
ATOM   8535 C CA  . THR D 2 209 ? 21.978  22.390  93.234  1.00 79.26  ? 383  THR D CA  1 
ATOM   8536 C C   . THR D 2 209 ? 21.495  23.550  94.093  1.00 79.04  ? 383  THR D C   1 
ATOM   8537 O O   . THR D 2 209 ? 20.301  23.668  94.370  1.00 78.93  ? 383  THR D O   1 
ATOM   8538 C CB  . THR D 2 209 ? 22.304  22.963  91.837  1.00 79.21  ? 383  THR D CB  1 
ATOM   8539 O OG1 . THR D 2 209 ? 21.174  23.704  91.352  1.00 78.72  ? 383  THR D OG1 1 
ATOM   8540 C CG2 . THR D 2 209 ? 22.636  21.843  90.857  1.00 78.35  ? 383  THR D CG2 1 
ATOM   8541 N N   . LEU D 2 210 ? 22.423  24.408  94.504  1.00 78.50  ? 384  LEU D N   1 
ATOM   8542 C CA  . LEU D 2 210 ? 22.074  25.572  95.310  1.00 77.62  ? 384  LEU D CA  1 
ATOM   8543 C C   . LEU D 2 210 ? 21.271  26.483  94.391  1.00 77.44  ? 384  LEU D C   1 
ATOM   8544 O O   . LEU D 2 210 ? 20.591  27.408  94.841  1.00 76.75  ? 384  LEU D O   1 
ATOM   8545 C CB  . LEU D 2 210 ? 23.331  26.313  95.769  1.00 78.17  ? 384  LEU D CB  1 
ATOM   8546 C CG  . LEU D 2 210 ? 24.490  25.574  96.453  1.00 78.96  ? 384  LEU D CG  1 
ATOM   8547 C CD1 . LEU D 2 210 ? 24.640  26.086  97.868  1.00 77.61  ? 384  LEU D CD1 1 
ATOM   8548 C CD2 . LEU D 2 210 ? 24.264  24.075  96.448  1.00 79.35  ? 384  LEU D CD2 1 
ATOM   8549 N N   . GLU D 2 211 ? 21.373  26.212  93.092  1.00 76.59  ? 385  GLU D N   1 
ATOM   8550 C CA  . GLU D 2 211 ? 20.663  26.994  92.094  1.00 76.06  ? 385  GLU D CA  1 
ATOM   8551 C C   . GLU D 2 211 ? 19.218  26.551  92.166  1.00 75.42  ? 385  GLU D C   1 
ATOM   8552 O O   . GLU D 2 211 ? 18.305  27.372  92.281  1.00 74.80  ? 385  GLU D O   1 
ATOM   8553 C CB  . GLU D 2 211 ? 21.222  26.723  90.692  1.00 76.60  ? 385  GLU D CB  1 
ATOM   8554 C CG  . GLU D 2 211 ? 20.964  27.855  89.685  1.00 77.59  ? 385  GLU D CG  1 
ATOM   8555 C CD  . GLU D 2 211 ? 19.481  28.177  89.502  1.00 77.45  ? 385  GLU D CD  1 
ATOM   8556 O OE1 . GLU D 2 211 ? 18.731  27.300  89.016  1.00 76.59  ? 385  GLU D OE1 1 
ATOM   8557 O OE2 . GLU D 2 211 ? 19.070  29.307  89.846  1.00 75.99  ? 385  GLU D OE2 1 
ATOM   8558 N N   . SER D 2 212 ? 19.020  25.240  92.103  1.00 75.22  ? 386  SER D N   1 
ATOM   8559 C CA  . SER D 2 212 ? 17.678  24.677  92.179  1.00 75.01  ? 386  SER D CA  1 
ATOM   8560 C C   . SER D 2 212 ? 17.124  24.879  93.593  1.00 75.23  ? 386  SER D C   1 
ATOM   8561 O O   . SER D 2 212 ? 15.923  25.086  93.774  1.00 76.48  ? 386  SER D O   1 
ATOM   8562 C CB  . SER D 2 212 ? 17.711  23.186  91.826  1.00 73.15  ? 386  SER D CB  1 
ATOM   8563 O OG  . SER D 2 212 ? 18.725  22.519  92.553  1.00 69.69  ? 386  SER D OG  1 
ATOM   8564 N N   . LEU D 2 213 ? 18.014  24.847  94.583  1.00 74.13  ? 387  LEU D N   1 
ATOM   8565 C CA  . LEU D 2 213 ? 17.635  25.018  95.982  1.00 74.12  ? 387  LEU D CA  1 
ATOM   8566 C C   . LEU D 2 213 ? 17.490  26.457  96.483  1.00 74.76  ? 387  LEU D C   1 
ATOM   8567 O O   . LEU D 2 213 ? 17.182  26.666  97.656  1.00 74.46  ? 387  LEU D O   1 
ATOM   8568 C CB  . LEU D 2 213 ? 18.641  24.314  96.898  1.00 73.10  ? 387  LEU D CB  1 
ATOM   8569 C CG  . LEU D 2 213 ? 18.689  22.793  97.040  1.00 73.30  ? 387  LEU D CG  1 
ATOM   8570 C CD1 . LEU D 2 213 ? 18.811  22.480  98.527  1.00 72.29  ? 387  LEU D CD1 1 
ATOM   8571 C CD2 . LEU D 2 213 ? 17.443  22.133  96.456  1.00 73.09  ? 387  LEU D CD2 1 
ATOM   8572 N N   . LYS D 2 214 ? 17.696  27.451  95.628  1.00 75.51  ? 388  LYS D N   1 
ATOM   8573 C CA  . LYS D 2 214 ? 17.604  28.826  96.106  1.00 76.60  ? 388  LYS D CA  1 
ATOM   8574 C C   . LYS D 2 214 ? 16.219  29.347  96.470  1.00 75.31  ? 388  LYS D C   1 
ATOM   8575 O O   . LYS D 2 214 ? 16.027  29.864  97.574  1.00 75.38  ? 388  LYS D O   1 
ATOM   8576 C CB  . LYS D 2 214 ? 18.290  29.788  95.126  1.00 79.40  ? 388  LYS D CB  1 
ATOM   8577 C CG  . LYS D 2 214 ? 19.636  30.293  95.660  1.00 82.52  ? 388  LYS D CG  1 
ATOM   8578 C CD  . LYS D 2 214 ? 20.461  31.057  94.626  1.00 84.56  ? 388  LYS D CD  1 
ATOM   8579 C CE  . LYS D 2 214 ? 19.797  32.361  94.214  1.00 86.23  ? 388  LYS D CE  1 
ATOM   8580 N NZ  . LYS D 2 214 ? 20.660  33.131  93.271  1.00 87.00  ? 388  LYS D NZ  1 
ATOM   8581 N N   . PRO D 2 215 ? 15.236  29.218  95.564  1.00 73.57  ? 389  PRO D N   1 
ATOM   8582 C CA  . PRO D 2 215 ? 13.899  29.717  95.902  1.00 73.20  ? 389  PRO D CA  1 
ATOM   8583 C C   . PRO D 2 215 ? 13.489  29.365  97.339  1.00 73.48  ? 389  PRO D C   1 
ATOM   8584 O O   . PRO D 2 215 ? 13.055  30.233  98.104  1.00 73.80  ? 389  PRO D O   1 
ATOM   8585 C CB  . PRO D 2 215 ? 13.016  29.055  94.851  1.00 72.18  ? 389  PRO D CB  1 
ATOM   8586 C CG  . PRO D 2 215 ? 13.923  29.006  93.661  1.00 71.06  ? 389  PRO D CG  1 
ATOM   8587 C CD  . PRO D 2 215 ? 15.226  28.532  94.259  1.00 71.72  ? 389  PRO D CD  1 
ATOM   8588 N N   . CYS D 2 216 ? 13.649  28.091  97.695  1.00 72.89  ? 390  CYS D N   1 
ATOM   8589 C CA  . CYS D 2 216 ? 13.316  27.600  99.031  1.00 71.94  ? 390  CYS D CA  1 
ATOM   8590 C C   . CYS D 2 216 ? 14.364  28.095  100.028 1.00 71.29  ? 390  CYS D C   1 
ATOM   8591 O O   . CYS D 2 216 ? 14.054  28.397  101.184 1.00 70.08  ? 390  CYS D O   1 
ATOM   8592 C CB  . CYS D 2 216 ? 13.274  26.056  99.023  1.00 71.79  ? 390  CYS D CB  1 
ATOM   8593 S SG  . CYS D 2 216 ? 13.022  25.223  100.639 1.00 67.76  ? 390  CYS D SG  1 
ATOM   8594 N N   . LEU D 2 217 ? 15.604  28.188  99.557  1.00 70.73  ? 391  LEU D N   1 
ATOM   8595 C CA  . LEU D 2 217 ? 16.719  28.626  100.386 1.00 70.27  ? 391  LEU D CA  1 
ATOM   8596 C C   . LEU D 2 217 ? 16.507  29.977  101.053 1.00 70.22  ? 391  LEU D C   1 
ATOM   8597 O O   . LEU D 2 217 ? 16.512  30.073  102.282 1.00 71.01  ? 391  LEU D O   1 
ATOM   8598 C CB  . LEU D 2 217 ? 18.008  28.681  99.565  1.00 70.03  ? 391  LEU D CB  1 
ATOM   8599 C CG  . LEU D 2 217 ? 19.217  27.937  100.145 1.00 69.58  ? 391  LEU D CG  1 
ATOM   8600 C CD1 . LEU D 2 217 ? 19.177  27.969  101.677 1.00 67.37  ? 391  LEU D CD1 1 
ATOM   8601 C CD2 . LEU D 2 217 ? 19.204  26.498  99.651  1.00 70.00  ? 391  LEU D CD2 1 
ATOM   8602 N N   . MET D 2 218 ? 16.339  31.027  100.256 1.00 70.17  ? 392  MET D N   1 
ATOM   8603 C CA  . MET D 2 218 ? 16.143  32.353  100.834 1.00 70.65  ? 392  MET D CA  1 
ATOM   8604 C C   . MET D 2 218 ? 14.906  32.395  101.714 1.00 69.97  ? 392  MET D C   1 
ATOM   8605 O O   . MET D 2 218 ? 14.929  33.009  102.786 1.00 70.40  ? 392  MET D O   1 
ATOM   8606 C CB  . MET D 2 218 ? 16.069  33.430  99.744  1.00 72.41  ? 392  MET D CB  1 
ATOM   8607 C CG  . MET D 2 218 ? 15.658  32.933  98.368  1.00 74.63  ? 392  MET D CG  1 
ATOM   8608 S SD  . MET D 2 218 ? 16.235  34.059  97.072  1.00 77.14  ? 392  MET D SD  1 
ATOM   8609 C CE  . MET D 2 218 ? 18.033  33.818  97.208  1.00 74.39  ? 392  MET D CE  1 
ATOM   8610 N N   . ASP D 2 219 ? 13.832  31.741  101.269 1.00 68.23  ? 393  ASP D N   1 
ATOM   8611 C CA  . ASP D 2 219 ? 12.600  31.694  102.055 1.00 65.71  ? 393  ASP D CA  1 
ATOM   8612 C C   . ASP D 2 219 ? 12.975  31.211  103.451 1.00 64.74  ? 393  ASP D C   1 
ATOM   8613 O O   . ASP D 2 219 ? 12.611  31.816  104.463 1.00 62.53  ? 393  ASP D O   1 
ATOM   8614 C CB  . ASP D 2 219 ? 11.599  30.709  101.443 1.00 65.10  ? 393  ASP D CB  1 
ATOM   8615 C CG  . ASP D 2 219 ? 10.507  31.396  100.649 1.00 64.70  ? 393  ASP D CG  1 
ATOM   8616 O OD1 . ASP D 2 219 ? 9.979   32.425  101.120 1.00 65.24  ? 393  ASP D OD1 1 
ATOM   8617 O OD2 . ASP D 2 219 ? 10.160  30.893  99.560  1.00 64.23  ? 393  ASP D OD2 1 
ATOM   8618 N N   . LEU D 2 220 ? 13.727  30.114  103.480 1.00 64.83  ? 394  LEU D N   1 
ATOM   8619 C CA  . LEU D 2 220 ? 14.175  29.503  104.721 1.00 64.84  ? 394  LEU D CA  1 
ATOM   8620 C C   . LEU D 2 220 ? 15.079  30.469  105.482 1.00 66.12  ? 394  LEU D C   1 
ATOM   8621 O O   . LEU D 2 220 ? 14.955  30.627  106.698 1.00 66.11  ? 394  LEU D O   1 
ATOM   8622 C CB  . LEU D 2 220 ? 14.904  28.191  104.414 1.00 62.59  ? 394  LEU D CB  1 
ATOM   8623 C CG  . LEU D 2 220 ? 15.146  27.241  105.588 1.00 61.57  ? 394  LEU D CG  1 
ATOM   8624 C CD1 . LEU D 2 220 ? 13.850  27.021  106.354 1.00 61.12  ? 394  LEU D CD1 1 
ATOM   8625 C CD2 . LEU D 2 220 ? 15.696  25.923  105.068 1.00 61.31  ? 394  LEU D CD2 1 
ATOM   8626 N N   . HIS D 2 221 ? 15.987  31.122  104.765 1.00 67.64  ? 395  HIS D N   1 
ATOM   8627 C CA  . HIS D 2 221 ? 16.880  32.086  105.397 1.00 68.92  ? 395  HIS D CA  1 
ATOM   8628 C C   . HIS D 2 221 ? 16.033  33.177  106.057 1.00 67.08  ? 395  HIS D C   1 
ATOM   8629 O O   . HIS D 2 221 ? 16.271  33.574  107.203 1.00 65.33  ? 395  HIS D O   1 
ATOM   8630 C CB  . HIS D 2 221 ? 17.802  32.716  104.355 1.00 72.20  ? 395  HIS D CB  1 
ATOM   8631 C CG  . HIS D 2 221 ? 18.858  33.598  104.944 1.00 74.90  ? 395  HIS D CG  1 
ATOM   8632 N ND1 . HIS D 2 221 ? 19.700  33.173  105.948 1.00 75.34  ? 395  HIS D ND1 1 
ATOM   8633 C CD2 . HIS D 2 221 ? 19.215  34.875  104.666 1.00 75.42  ? 395  HIS D CD2 1 
ATOM   8634 C CE1 . HIS D 2 221 ? 20.530  34.150  106.265 1.00 75.82  ? 395  HIS D CE1 1 
ATOM   8635 N NE2 . HIS D 2 221 ? 20.258  35.193  105.502 1.00 76.00  ? 395  HIS D NE2 1 
ATOM   8636 N N   . GLN D 2 222 ? 15.033  33.643  105.317 1.00 65.36  ? 396  GLN D N   1 
ATOM   8637 C CA  . GLN D 2 222 ? 14.135  34.678  105.799 1.00 64.38  ? 396  GLN D CA  1 
ATOM   8638 C C   . GLN D 2 222 ? 13.371  34.214  107.046 1.00 63.65  ? 396  GLN D C   1 
ATOM   8639 O O   . GLN D 2 222 ? 13.101  35.011  107.952 1.00 63.22  ? 396  GLN D O   1 
ATOM   8640 C CB  . GLN D 2 222 ? 13.153  35.069  104.688 1.00 64.30  ? 396  GLN D CB  1 
ATOM   8641 C CG  . GLN D 2 222 ? 12.507  36.424  104.896 1.00 64.88  ? 396  GLN D CG  1 
ATOM   8642 C CD  . GLN D 2 222 ? 13.515  37.561  104.834 1.00 64.87  ? 396  GLN D CD  1 
ATOM   8643 O OE1 . GLN D 2 222 ? 14.728  37.344  104.894 1.00 62.35  ? 396  GLN D OE1 1 
ATOM   8644 N NE2 . GLN D 2 222 ? 13.013  38.784  104.725 1.00 65.98  ? 396  GLN D NE2 1 
ATOM   8645 N N   . THR D 2 223 ? 13.029  32.928  107.093 1.00 61.24  ? 397  THR D N   1 
ATOM   8646 C CA  . THR D 2 223 ? 12.305  32.383  108.236 1.00 59.40  ? 397  THR D CA  1 
ATOM   8647 C C   . THR D 2 223 ? 13.232  32.263  109.439 1.00 58.21  ? 397  THR D C   1 
ATOM   8648 O O   . THR D 2 223 ? 12.837  32.549  110.566 1.00 57.25  ? 397  THR D O   1 
ATOM   8649 C CB  . THR D 2 223 ? 11.684  30.986  107.909 1.00 59.47  ? 397  THR D CB  1 
ATOM   8650 O OG1 . THR D 2 223 ? 10.538  31.155  107.062 1.00 57.36  ? 397  THR D OG1 1 
ATOM   8651 C CG2 . THR D 2 223 ? 11.254  30.268  109.184 1.00 58.26  ? 397  THR D CG2 1 
ATOM   8652 N N   . TYR D 2 224 ? 14.469  31.847  109.188 1.00 59.10  ? 398  TYR D N   1 
ATOM   8653 C CA  . TYR D 2 224 ? 15.468  31.683  110.246 1.00 60.15  ? 398  TYR D CA  1 
ATOM   8654 C C   . TYR D 2 224 ? 15.712  33.020  110.959 1.00 61.81  ? 398  TYR D C   1 
ATOM   8655 O O   . TYR D 2 224 ? 15.803  33.088  112.192 1.00 61.50  ? 398  TYR D O   1 
ATOM   8656 C CB  . TYR D 2 224 ? 16.776  31.151  109.638 1.00 58.28  ? 398  TYR D CB  1 
ATOM   8657 C CG  . TYR D 2 224 ? 17.870  30.815  110.638 1.00 57.43  ? 398  TYR D CG  1 
ATOM   8658 C CD1 . TYR D 2 224 ? 17.617  30.809  112.017 1.00 56.49  ? 398  TYR D CD1 1 
ATOM   8659 C CD2 . TYR D 2 224 ? 19.160  30.488  110.201 1.00 55.39  ? 398  TYR D CD2 1 
ATOM   8660 C CE1 . TYR D 2 224 ? 18.620  30.490  112.937 1.00 56.36  ? 398  TYR D CE1 1 
ATOM   8661 C CE2 . TYR D 2 224 ? 20.171  30.165  111.110 1.00 55.67  ? 398  TYR D CE2 1 
ATOM   8662 C CZ  . TYR D 2 224 ? 19.897  30.168  112.480 1.00 56.37  ? 398  TYR D CZ  1 
ATOM   8663 O OH  . TYR D 2 224 ? 20.892  29.850  113.388 1.00 53.74  ? 398  TYR D OH  1 
ATOM   8664 N N   . LEU D 2 225 ? 15.813  34.082  110.168 1.00 62.27  ? 399  LEU D N   1 
ATOM   8665 C CA  . LEU D 2 225 ? 16.033  35.414  110.705 1.00 63.20  ? 399  LEU D CA  1 
ATOM   8666 C C   . LEU D 2 225 ? 14.874  35.846  111.601 1.00 63.91  ? 399  LEU D C   1 
ATOM   8667 O O   . LEU D 2 225 ? 15.057  36.071  112.796 1.00 64.09  ? 399  LEU D O   1 
ATOM   8668 C CB  . LEU D 2 225 ? 16.222  36.405  109.551 1.00 61.21  ? 399  LEU D CB  1 
ATOM   8669 C CG  . LEU D 2 225 ? 17.488  36.119  108.725 1.00 62.05  ? 399  LEU D CG  1 
ATOM   8670 C CD1 . LEU D 2 225 ? 17.393  36.739  107.332 1.00 60.03  ? 399  LEU D CD1 1 
ATOM   8671 C CD2 . LEU D 2 225 ? 18.709  36.637  109.487 1.00 60.35  ? 399  LEU D CD2 1 
ATOM   8672 N N   . LYS D 2 226 ? 13.679  35.930  111.026 1.00 65.77  ? 400  LYS D N   1 
ATOM   8673 C CA  . LYS D 2 226 ? 12.490  36.361  111.760 1.00 66.62  ? 400  LYS D CA  1 
ATOM   8674 C C   . LYS D 2 226 ? 12.060  35.549  112.983 1.00 67.40  ? 400  LYS D C   1 
ATOM   8675 O O   . LYS D 2 226 ? 11.393  36.086  113.869 1.00 67.48  ? 400  LYS D O   1 
ATOM   8676 C CB  . LYS D 2 226 ? 11.309  36.481  110.797 1.00 66.69  ? 400  LYS D CB  1 
ATOM   8677 C CG  . LYS D 2 226 ? 11.104  37.885  110.245 1.00 68.35  ? 400  LYS D CG  1 
ATOM   8678 C CD  . LYS D 2 226 ? 10.000  37.908  109.189 1.00 70.15  ? 400  LYS D CD  1 
ATOM   8679 C CE  . LYS D 2 226 ? 10.516  37.504  107.807 1.00 70.60  ? 400  LYS D CE  1 
ATOM   8680 N NZ  . LYS D 2 226 ? 10.720  38.700  106.925 1.00 70.48  ? 400  LYS D NZ  1 
ATOM   8681 N N   . ALA D 2 227 ? 12.444  34.274  113.035 1.00 68.39  ? 401  ALA D N   1 
ATOM   8682 C CA  . ALA D 2 227 ? 12.084  33.371  114.137 1.00 69.06  ? 401  ALA D CA  1 
ATOM   8683 C C   . ALA D 2 227 ? 11.779  34.008  115.503 1.00 70.41  ? 401  ALA D C   1 
ATOM   8684 O O   . ALA D 2 227 ? 10.693  33.803  116.056 1.00 71.24  ? 401  ALA D O   1 
ATOM   8685 C CB  . ALA D 2 227 ? 13.164  32.296  114.300 1.00 68.46  ? 401  ALA D CB  1 
ATOM   8686 N N   . PRO D 2 228 ? 12.728  34.781  116.069 1.00 70.83  ? 402  PRO D N   1 
ATOM   8687 C CA  . PRO D 2 228 ? 12.503  35.417  117.374 1.00 70.27  ? 402  PRO D CA  1 
ATOM   8688 C C   . PRO D 2 228 ? 11.302  36.360  117.385 1.00 70.11  ? 402  PRO D C   1 
ATOM   8689 O O   . PRO D 2 228 ? 10.744  36.657  118.440 1.00 69.87  ? 402  PRO D O   1 
ATOM   8690 C CB  . PRO D 2 228 ? 13.813  36.154  117.631 1.00 69.74  ? 402  PRO D CB  1 
ATOM   8691 C CG  . PRO D 2 228 ? 14.818  35.327  116.888 1.00 70.81  ? 402  PRO D CG  1 
ATOM   8692 C CD  . PRO D 2 228 ? 14.097  35.053  115.596 1.00 70.93  ? 402  PRO D CD  1 
ATOM   8693 N N   . GLN D 2 229 ? 10.916  36.834  116.206 1.00 70.06  ? 403  GLN D N   1 
ATOM   8694 C CA  . GLN D 2 229 ? 9.779   37.736  116.078 1.00 71.64  ? 403  GLN D CA  1 
ATOM   8695 C C   . GLN D 2 229 ? 8.496   36.942  115.864 1.00 71.12  ? 403  GLN D C   1 
ATOM   8696 O O   . GLN D 2 229 ? 7.395   37.450  116.097 1.00 70.77  ? 403  GLN D O   1 
ATOM   8697 C CB  . GLN D 2 229 ? 9.985   38.688  114.894 1.00 74.66  ? 403  GLN D CB  1 
ATOM   8698 C CG  . GLN D 2 229 ? 10.968  39.829  115.139 1.00 77.83  ? 403  GLN D CG  1 
ATOM   8699 C CD  . GLN D 2 229 ? 12.268  39.365  115.769 1.00 80.56  ? 403  GLN D CD  1 
ATOM   8700 O OE1 . GLN D 2 229 ? 12.493  39.564  116.966 1.00 81.65  ? 403  GLN D OE1 1 
ATOM   8701 N NE2 . GLN D 2 229 ? 13.129  38.735  114.968 1.00 81.87  ? 403  GLN D NE2 1 
ATOM   8702 N N   . HIS D 2 230 ? 8.651   35.690  115.431 1.00 69.64  ? 404  HIS D N   1 
ATOM   8703 C CA  . HIS D 2 230 ? 7.519   34.809  115.145 1.00 66.08  ? 404  HIS D CA  1 
ATOM   8704 C C   . HIS D 2 230 ? 6.617   34.528  116.341 1.00 63.42  ? 404  HIS D C   1 
ATOM   8705 O O   . HIS D 2 230 ? 7.090   34.258  117.442 1.00 62.49  ? 404  HIS D O   1 
ATOM   8706 C CB  . HIS D 2 230 ? 8.012   33.480  114.565 1.00 67.12  ? 404  HIS D CB  1 
ATOM   8707 C CG  . HIS D 2 230 ? 6.945   32.713  113.849 1.00 67.96  ? 404  HIS D CG  1 
ATOM   8708 N ND1 . HIS D 2 230 ? 5.765   32.337  114.454 1.00 67.60  ? 404  HIS D ND1 1 
ATOM   8709 C CD2 . HIS D 2 230 ? 6.858   32.297  112.563 1.00 68.38  ? 404  HIS D CD2 1 
ATOM   8710 C CE1 . HIS D 2 230 ? 4.997   31.725  113.571 1.00 67.73  ? 404  HIS D CE1 1 
ATOM   8711 N NE2 . HIS D 2 230 ? 5.636   31.688  112.416 1.00 68.53  ? 404  HIS D NE2 1 
ATOM   8712 N N   . ALA D 2 231 ? 5.310   34.572  116.094 1.00 60.67  ? 405  ALA D N   1 
ATOM   8713 C CA  . ALA D 2 231 ? 4.297   34.346  117.117 1.00 58.36  ? 405  ALA D CA  1 
ATOM   8714 C C   . ALA D 2 231 ? 4.398   33.005  117.840 1.00 58.96  ? 405  ALA D C   1 
ATOM   8715 O O   . ALA D 2 231 ? 4.000   32.890  119.002 1.00 59.47  ? 405  ALA D O   1 
ATOM   8716 C CB  . ALA D 2 231 ? 2.926   34.487  116.502 1.00 56.03  ? 405  ALA D CB  1 
ATOM   8717 N N   . GLN D 2 232 ? 4.915   31.988  117.160 1.00 58.51  ? 406  GLN D N   1 
ATOM   8718 C CA  . GLN D 2 232 ? 5.040   30.670  117.775 1.00 58.18  ? 406  GLN D CA  1 
ATOM   8719 C C   . GLN D 2 232 ? 6.474   30.504  118.259 1.00 57.34  ? 406  GLN D C   1 
ATOM   8720 O O   . GLN D 2 232 ? 7.415   30.585  117.472 1.00 55.90  ? 406  GLN D O   1 
ATOM   8721 C CB  . GLN D 2 232 ? 4.670   29.586  116.761 1.00 58.07  ? 406  GLN D CB  1 
ATOM   8722 C CG  . GLN D 2 232 ? 3.597   30.031  115.763 1.00 56.41  ? 406  GLN D CG  1 
ATOM   8723 C CD  . GLN D 2 232 ? 2.315   30.531  116.418 1.00 56.18  ? 406  GLN D CD  1 
ATOM   8724 O OE1 . GLN D 2 232 ? 1.541   31.272  115.802 1.00 54.22  ? 406  GLN D OE1 1 
ATOM   8725 N NE2 . GLN D 2 232 ? 2.075   30.116  117.661 1.00 54.77  ? 406  GLN D NE2 1 
ATOM   8726 N N   . GLN D 2 233 ? 6.626   30.267  119.559 1.00 56.62  ? 407  GLN D N   1 
ATOM   8727 C CA  . GLN D 2 233 ? 7.941   30.148  120.170 1.00 56.63  ? 407  GLN D CA  1 
ATOM   8728 C C   . GLN D 2 233 ? 8.301   28.789  120.756 1.00 57.98  ? 407  GLN D C   1 
ATOM   8729 O O   . GLN D 2 233 ? 9.346   28.654  121.401 1.00 58.39  ? 407  GLN D O   1 
ATOM   8730 C CB  . GLN D 2 233 ? 8.086   31.214  121.265 1.00 56.06  ? 407  GLN D CB  1 
ATOM   8731 C CG  . GLN D 2 233 ? 8.139   32.660  120.762 1.00 51.74  ? 407  GLN D CG  1 
ATOM   8732 C CD  . GLN D 2 233 ? 9.384   32.943  119.949 1.00 50.34  ? 407  GLN D CD  1 
ATOM   8733 O OE1 . GLN D 2 233 ? 10.499  32.649  120.378 1.00 49.84  ? 407  GLN D OE1 1 
ATOM   8734 N NE2 . GLN D 2 233 ? 9.201   33.515  118.766 1.00 49.61  ? 407  GLN D NE2 1 
ATOM   8735 N N   . SER D 2 234 ? 7.459   27.784  120.536 1.00 58.35  ? 408  SER D N   1 
ATOM   8736 C CA  . SER D 2 234 ? 7.732   26.452  121.076 1.00 59.16  ? 408  SER D CA  1 
ATOM   8737 C C   . SER D 2 234 ? 9.006   25.787  120.547 1.00 58.69  ? 408  SER D C   1 
ATOM   8738 O O   . SER D 2 234 ? 9.730   25.135  121.303 1.00 57.04  ? 408  SER D O   1 
ATOM   8739 C CB  . SER D 2 234 ? 6.535   25.528  120.837 1.00 59.46  ? 408  SER D CB  1 
ATOM   8740 O OG  . SER D 2 234 ? 5.435   25.915  121.643 1.00 61.72  ? 408  SER D OG  1 
ATOM   8741 N N   . ILE D 2 235 ? 9.276   25.957  119.256 1.00 58.75  ? 409  ILE D N   1 
ATOM   8742 C CA  . ILE D 2 235 ? 10.452  25.363  118.629 1.00 60.30  ? 409  ILE D CA  1 
ATOM   8743 C C   . ILE D 2 235 ? 11.786  25.904  119.161 1.00 63.09  ? 409  ILE D C   1 
ATOM   8744 O O   . ILE D 2 235 ? 12.660  25.127  119.556 1.00 63.75  ? 409  ILE D O   1 
ATOM   8745 C CB  . ILE D 2 235 ? 10.393  25.537  117.095 1.00 58.66  ? 409  ILE D CB  1 
ATOM   8746 C CG1 . ILE D 2 235 ? 9.209   24.737  116.538 1.00 56.18  ? 409  ILE D CG1 1 
ATOM   8747 C CG2 . ILE D 2 235 ? 11.706  25.094  116.463 1.00 58.44  ? 409  ILE D CG2 1 
ATOM   8748 C CD1 . ILE D 2 235 ? 9.071   24.784  115.036 1.00 53.54  ? 409  ILE D CD1 1 
ATOM   8749 N N   . ARG D 2 236 ? 11.950  27.225  119.170 1.00 64.78  ? 410  ARG D N   1 
ATOM   8750 C CA  . ARG D 2 236 ? 13.184  27.819  119.676 1.00 66.53  ? 410  ARG D CA  1 
ATOM   8751 C C   . ARG D 2 236 ? 13.398  27.410  121.132 1.00 65.99  ? 410  ARG D C   1 
ATOM   8752 O O   . ARG D 2 236 ? 14.526  27.170  121.553 1.00 65.76  ? 410  ARG D O   1 
ATOM   8753 C CB  . ARG D 2 236 ? 13.139  29.350  119.547 1.00 69.36  ? 410  ARG D CB  1 
ATOM   8754 C CG  . ARG D 2 236 ? 13.157  29.828  118.093 1.00 73.30  ? 410  ARG D CG  1 
ATOM   8755 C CD  . ARG D 2 236 ? 12.803  31.311  117.913 1.00 77.04  ? 410  ARG D CD  1 
ATOM   8756 N NE  . ARG D 2 236 ? 13.926  32.222  118.132 1.00 80.86  ? 410  ARG D NE  1 
ATOM   8757 C CZ  . ARG D 2 236 ? 14.311  32.672  119.323 1.00 83.22  ? 410  ARG D CZ  1 
ATOM   8758 N NH1 . ARG D 2 236 ? 15.348  33.496  119.417 1.00 83.91  ? 410  ARG D NH1 1 
ATOM   8759 N NH2 . ARG D 2 236 ? 13.655  32.307  120.419 1.00 83.76  ? 410  ARG D NH2 1 
ATOM   8760 N N   . GLU D 2 237 ? 12.314  27.318  121.897 1.00 66.18  ? 411  GLU D N   1 
ATOM   8761 C CA  . GLU D 2 237 ? 12.415  26.921  123.298 1.00 67.49  ? 411  GLU D CA  1 
ATOM   8762 C C   . GLU D 2 237 ? 12.786  25.448  123.410 1.00 68.84  ? 411  GLU D C   1 
ATOM   8763 O O   . GLU D 2 237 ? 13.116  24.957  124.488 1.00 69.44  ? 411  GLU D O   1 
ATOM   8764 C CB  . GLU D 2 237 ? 11.089  27.164  124.018 1.00 67.44  ? 411  GLU D CB  1 
ATOM   8765 C CG  . GLU D 2 237 ? 10.668  28.615  124.054 1.00 69.25  ? 411  GLU D CG  1 
ATOM   8766 C CD  . GLU D 2 237 ? 11.701  29.506  124.723 1.00 70.59  ? 411  GLU D CD  1 
ATOM   8767 O OE1 . GLU D 2 237 ? 11.994  29.283  125.922 1.00 71.07  ? 411  GLU D OE1 1 
ATOM   8768 O OE2 . GLU D 2 237 ? 12.217  30.428  124.049 1.00 69.67  ? 411  GLU D OE2 1 
ATOM   8769 N N   . LYS D 2 238 ? 12.728  24.745  122.287 1.00 69.42  ? 412  LYS D N   1 
ATOM   8770 C CA  . LYS D 2 238 ? 13.051  23.329  122.260 1.00 70.06  ? 412  LYS D CA  1 
ATOM   8771 C C   . LYS D 2 238 ? 14.537  23.119  122.013 1.00 71.07  ? 412  LYS D C   1 
ATOM   8772 O O   . LYS D 2 238 ? 15.181  22.321  122.694 1.00 70.90  ? 412  LYS D O   1 
ATOM   8773 C CB  . LYS D 2 238 ? 12.238  22.630  121.163 1.00 69.79  ? 412  LYS D CB  1 
ATOM   8774 C CG  . LYS D 2 238 ? 12.608  21.169  120.909 1.00 68.92  ? 412  LYS D CG  1 
ATOM   8775 C CD  . LYS D 2 238 ? 11.786  20.580  119.764 1.00 67.96  ? 412  LYS D CD  1 
ATOM   8776 C CE  . LYS D 2 238 ? 12.284  19.196  119.357 1.00 66.34  ? 412  LYS D CE  1 
ATOM   8777 N NZ  . LYS D 2 238 ? 11.350  18.522  118.414 1.00 63.37  ? 412  LYS D NZ  1 
ATOM   8778 N N   . TYR D 2 239 ? 15.075  23.849  121.041 1.00 72.56  ? 413  TYR D N   1 
ATOM   8779 C CA  . TYR D 2 239 ? 16.481  23.730  120.676 1.00 74.63  ? 413  TYR D CA  1 
ATOM   8780 C C   . TYR D 2 239 ? 17.455  24.572  121.513 1.00 74.94  ? 413  TYR D C   1 
ATOM   8781 O O   . TYR D 2 239 ? 18.651  24.590  121.242 1.00 73.32  ? 413  TYR D O   1 
ATOM   8782 C CB  . TYR D 2 239 ? 16.640  24.034  119.182 1.00 76.99  ? 413  TYR D CB  1 
ATOM   8783 C CG  . TYR D 2 239 ? 16.076  22.947  118.281 1.00 80.06  ? 413  TYR D CG  1 
ATOM   8784 C CD1 . TYR D 2 239 ? 14.758  22.504  118.423 1.00 81.70  ? 413  TYR D CD1 1 
ATOM   8785 C CD2 . TYR D 2 239 ? 16.868  22.346  117.298 1.00 81.35  ? 413  TYR D CD2 1 
ATOM   8786 C CE1 . TYR D 2 239 ? 14.242  21.484  117.611 1.00 82.54  ? 413  TYR D CE1 1 
ATOM   8787 C CE2 . TYR D 2 239 ? 16.362  21.327  116.480 1.00 82.23  ? 413  TYR D CE2 1 
ATOM   8788 C CZ  . TYR D 2 239 ? 15.051  20.900  116.643 1.00 82.92  ? 413  TYR D CZ  1 
ATOM   8789 O OH  . TYR D 2 239 ? 14.555  19.889  115.847 1.00 81.83  ? 413  TYR D OH  1 
ATOM   8790 N N   . LYS D 2 240 ? 16.934  25.267  122.524 1.00 76.42  ? 414  LYS D N   1 
ATOM   8791 C CA  . LYS D 2 240 ? 17.756  26.069  123.437 1.00 77.11  ? 414  LYS D CA  1 
ATOM   8792 C C   . LYS D 2 240 ? 18.122  25.151  124.595 1.00 78.05  ? 414  LYS D C   1 
ATOM   8793 O O   . LYS D 2 240 ? 18.355  25.598  125.716 1.00 79.41  ? 414  LYS D O   1 
ATOM   8794 C CB  . LYS D 2 240 ? 16.969  27.255  124.000 1.00 76.37  ? 414  LYS D CB  1 
ATOM   8795 C CG  . LYS D 2 240 ? 16.960  28.497  123.135 1.00 76.51  ? 414  LYS D CG  1 
ATOM   8796 C CD  . LYS D 2 240 ? 16.153  29.602  123.800 1.00 76.24  ? 414  LYS D CD  1 
ATOM   8797 C CE  . LYS D 2 240 ? 16.135  30.862  122.953 1.00 76.20  ? 414  LYS D CE  1 
ATOM   8798 N NZ  . LYS D 2 240 ? 15.240  31.911  123.522 1.00 75.95  ? 414  LYS D NZ  1 
ATOM   8799 N N   . ASN D 2 241 ? 18.152  23.857  124.310 1.00 78.07  ? 415  ASN D N   1 
ATOM   8800 C CA  . ASN D 2 241 ? 18.462  22.849  125.305 1.00 78.05  ? 415  ASN D CA  1 
ATOM   8801 C C   . ASN D 2 241 ? 19.801  22.195  124.976 1.00 78.67  ? 415  ASN D C   1 
ATOM   8802 O O   . ASN D 2 241 ? 20.287  22.286  123.848 1.00 79.44  ? 415  ASN D O   1 
ATOM   8803 C CB  . ASN D 2 241 ? 17.328  21.824  125.314 1.00 77.31  ? 415  ASN D CB  1 
ATOM   8804 C CG  . ASN D 2 241 ? 17.610  20.642  126.203 1.00 77.14  ? 415  ASN D CG  1 
ATOM   8805 O OD1 . ASN D 2 241 ? 18.487  19.830  125.918 1.00 77.05  ? 415  ASN D OD1 1 
ATOM   8806 N ND2 . ASN D 2 241 ? 16.859  20.534  127.290 1.00 76.85  ? 415  ASN D ND2 1 
ATOM   8807 N N   . SER D 2 242 ? 20.409  21.549  125.964 1.00 79.14  ? 416  SER D N   1 
ATOM   8808 C CA  . SER D 2 242 ? 21.691  20.888  125.749 1.00 79.43  ? 416  SER D CA  1 
ATOM   8809 C C   . SER D 2 242 ? 21.560  19.826  124.660 1.00 79.28  ? 416  SER D C   1 
ATOM   8810 O O   . SER D 2 242 ? 22.396  19.727  123.763 1.00 78.46  ? 416  SER D O   1 
ATOM   8811 C CB  . SER D 2 242 ? 22.178  20.241  127.055 1.00 80.80  ? 416  SER D CB  1 
ATOM   8812 O OG  . SER D 2 242 ? 21.271  19.255  127.535 1.00 82.30  ? 416  SER D OG  1 
ATOM   8813 N N   . LYS D 2 243 ? 20.492  19.042  124.752 1.00 79.75  ? 417  LYS D N   1 
ATOM   8814 C CA  . LYS D 2 243 ? 20.205  17.973  123.809 1.00 80.21  ? 417  LYS D CA  1 
ATOM   8815 C C   . LYS D 2 243 ? 20.419  18.379  122.350 1.00 80.80  ? 417  LYS D C   1 
ATOM   8816 O O   . LYS D 2 243 ? 20.876  17.567  121.539 1.00 80.36  ? 417  LYS D O   1 
ATOM   8817 C CB  . LYS D 2 243 ? 18.770  17.477  124.028 1.00 79.65  ? 417  LYS D CB  1 
ATOM   8818 C CG  . LYS D 2 243 ? 18.248  16.514  122.971 1.00 80.35  ? 417  LYS D CG  1 
ATOM   8819 C CD  . LYS D 2 243 ? 17.245  15.529  123.564 1.00 80.58  ? 417  LYS D CD  1 
ATOM   8820 C CE  . LYS D 2 243 ? 16.129  16.235  124.323 1.00 81.04  ? 417  LYS D CE  1 
ATOM   8821 N NZ  . LYS D 2 243 ? 15.967  15.672  125.699 1.00 80.73  ? 417  LYS D NZ  1 
ATOM   8822 N N   . TYR D 2 244 ? 20.096  19.626  122.014 1.00 81.06  ? 418  TYR D N   1 
ATOM   8823 C CA  . TYR D 2 244 ? 20.274  20.094  120.639 1.00 82.08  ? 418  TYR D CA  1 
ATOM   8824 C C   . TYR D 2 244 ? 21.410  21.097  120.491 1.00 81.96  ? 418  TYR D C   1 
ATOM   8825 O O   . TYR D 2 244 ? 21.562  21.724  119.439 1.00 82.42  ? 418  TYR D O   1 
ATOM   8826 C CB  . TYR D 2 244 ? 18.972  20.691  120.082 1.00 82.69  ? 418  TYR D CB  1 
ATOM   8827 C CG  . TYR D 2 244 ? 17.854  19.681  119.966 1.00 83.03  ? 418  TYR D CG  1 
ATOM   8828 C CD1 . TYR D 2 244 ? 18.082  18.427  119.395 1.00 83.31  ? 418  TYR D CD1 1 
ATOM   8829 C CD2 . TYR D 2 244 ? 16.577  19.964  120.451 1.00 83.08  ? 418  TYR D CD2 1 
ATOM   8830 C CE1 . TYR D 2 244 ? 17.069  17.477  119.316 1.00 83.13  ? 418  TYR D CE1 1 
ATOM   8831 C CE2 . TYR D 2 244 ? 15.555  19.022  120.375 1.00 83.19  ? 418  TYR D CE2 1 
ATOM   8832 C CZ  . TYR D 2 244 ? 15.809  17.780  119.808 1.00 83.07  ? 418  TYR D CZ  1 
ATOM   8833 O OH  . TYR D 2 244 ? 14.810  16.837  119.741 1.00 82.45  ? 418  TYR D OH  1 
ATOM   8834 N N   . HIS D 2 245 ? 22.200  21.249  121.550 1.00 81.40  ? 419  HIS D N   1 
ATOM   8835 C CA  . HIS D 2 245 ? 23.358  22.142  121.533 1.00 80.70  ? 419  HIS D CA  1 
ATOM   8836 C C   . HIS D 2 245 ? 23.003  23.619  121.374 1.00 78.63  ? 419  HIS D C   1 
ATOM   8837 O O   . HIS D 2 245 ? 23.730  24.372  120.727 1.00 78.42  ? 419  HIS D O   1 
ATOM   8838 C CB  . HIS D 2 245 ? 24.311  21.714  120.408 1.00 82.76  ? 419  HIS D CB  1 
ATOM   8839 C CG  . HIS D 2 245 ? 24.691  20.264  120.457 1.00 85.09  ? 419  HIS D CG  1 
ATOM   8840 N ND1 . HIS D 2 245 ? 23.801  19.272  120.814 1.00 85.54  ? 419  HIS D ND1 1 
ATOM   8841 C CD2 . HIS D 2 245 ? 25.853  19.634  120.160 1.00 85.56  ? 419  HIS D CD2 1 
ATOM   8842 C CE1 . HIS D 2 245 ? 24.397  18.096  120.736 1.00 85.77  ? 419  HIS D CE1 1 
ATOM   8843 N NE2 . HIS D 2 245 ? 25.643  18.287  120.340 1.00 86.71  ? 419  HIS D NE2 1 
ATOM   8844 N N   . GLY D 2 246 ? 21.889  24.021  121.980 1.00 76.36  ? 420  GLY D N   1 
ATOM   8845 C CA  . GLY D 2 246 ? 21.441  25.401  121.914 1.00 73.37  ? 420  GLY D CA  1 
ATOM   8846 C C   . GLY D 2 246 ? 21.628  26.072  120.568 1.00 71.67  ? 420  GLY D C   1 
ATOM   8847 O O   . GLY D 2 246 ? 21.772  27.291  120.504 1.00 71.99  ? 420  GLY D O   1 
ATOM   8848 N N   . VAL D 2 247 ? 21.609  25.288  119.492 1.00 70.32  ? 421  VAL D N   1 
ATOM   8849 C CA  . VAL D 2 247 ? 21.799  25.826  118.147 1.00 68.90  ? 421  VAL D CA  1 
ATOM   8850 C C   . VAL D 2 247 ? 20.725  26.830  117.733 1.00 68.57  ? 421  VAL D C   1 
ATOM   8851 O O   . VAL D 2 247 ? 20.798  27.407  116.648 1.00 67.71  ? 421  VAL D O   1 
ATOM   8852 C CB  . VAL D 2 247 ? 21.856  24.695  117.096 1.00 68.39  ? 421  VAL D CB  1 
ATOM   8853 C CG1 . VAL D 2 247 ? 22.840  23.631  117.542 1.00 68.52  ? 421  VAL D CG1 1 
ATOM   8854 C CG2 . VAL D 2 247 ? 20.479  24.096  116.886 1.00 68.92  ? 421  VAL D CG2 1 
ATOM   8855 N N   . SER D 2 248 ? 19.735  27.036  118.599 1.00 68.54  ? 422  SER D N   1 
ATOM   8856 C CA  . SER D 2 248 ? 18.650  27.977  118.321 1.00 68.54  ? 422  SER D CA  1 
ATOM   8857 C C   . SER D 2 248 ? 18.995  29.349  118.884 1.00 69.11  ? 422  SER D C   1 
ATOM   8858 O O   . SER D 2 248 ? 18.240  30.307  118.721 1.00 68.58  ? 422  SER D O   1 
ATOM   8859 C CB  . SER D 2 248 ? 17.341  27.493  118.951 1.00 67.63  ? 422  SER D CB  1 
ATOM   8860 O OG  . SER D 2 248 ? 17.404  27.545  120.365 1.00 65.85  ? 422  SER D OG  1 
ATOM   8861 N N   . LEU D 2 249 ? 20.136  29.427  119.561 1.00 69.93  ? 423  LEU D N   1 
ATOM   8862 C CA  . LEU D 2 249 ? 20.609  30.675  120.153 1.00 71.32  ? 423  LEU D CA  1 
ATOM   8863 C C   . LEU D 2 249 ? 21.631  31.317  119.216 1.00 72.67  ? 423  LEU D C   1 
ATOM   8864 O O   . LEU D 2 249 ? 21.850  32.532  119.247 1.00 72.88  ? 423  LEU D O   1 
ATOM   8865 C CB  . LEU D 2 249 ? 21.264  30.398  121.508 1.00 69.33  ? 423  LEU D CB  1 
ATOM   8866 C CG  . LEU D 2 249 ? 20.378  29.779  122.590 1.00 68.56  ? 423  LEU D CG  1 
ATOM   8867 C CD1 . LEU D 2 249 ? 21.225  28.899  123.497 1.00 69.27  ? 423  LEU D CD1 1 
ATOM   8868 C CD2 . LEU D 2 249 ? 19.676  30.866  123.375 1.00 64.90  ? 423  LEU D CD2 1 
ATOM   8869 N N   . LEU D 2 250 ? 22.248  30.487  118.380 1.00 73.33  ? 424  LEU D N   1 
ATOM   8870 C CA  . LEU D 2 250 ? 23.249  30.951  117.430 1.00 74.34  ? 424  LEU D CA  1 
ATOM   8871 C C   . LEU D 2 250 ? 22.744  32.083  116.538 1.00 74.41  ? 424  LEU D C   1 
ATOM   8872 O O   . LEU D 2 250 ? 21.564  32.439  116.574 1.00 73.31  ? 424  LEU D O   1 
ATOM   8873 C CB  . LEU D 2 250 ? 23.737  29.777  116.576 1.00 74.56  ? 424  LEU D CB  1 
ATOM   8874 C CG  . LEU D 2 250 ? 24.202  28.565  117.391 1.00 75.40  ? 424  LEU D CG  1 
ATOM   8875 C CD1 . LEU D 2 250 ? 25.027  27.640  116.499 1.00 74.71  ? 424  LEU D CD1 1 
ATOM   8876 C CD2 . LEU D 2 250 ? 25.031  29.027  118.594 1.00 75.54  ? 424  LEU D CD2 1 
ATOM   8877 N N   . ASN D 2 251 ? 23.650  32.642  115.739 1.00 75.78  ? 425  ASN D N   1 
ATOM   8878 C CA  . ASN D 2 251 ? 23.320  33.755  114.851 1.00 77.59  ? 425  ASN D CA  1 
ATOM   8879 C C   . ASN D 2 251 ? 23.086  33.420  113.389 1.00 78.06  ? 425  ASN D C   1 
ATOM   8880 O O   . ASN D 2 251 ? 23.950  32.858  112.715 1.00 78.68  ? 425  ASN D O   1 
ATOM   8881 C CB  . ASN D 2 251 ? 24.404  34.830  114.922 1.00 77.95  ? 425  ASN D CB  1 
ATOM   8882 C CG  . ASN D 2 251 ? 24.222  35.760  116.095 1.00 77.48  ? 425  ASN D CG  1 
ATOM   8883 O OD1 . ASN D 2 251 ? 24.335  35.351  117.253 1.00 77.65  ? 425  ASN D OD1 1 
ATOM   8884 N ND2 . ASN D 2 251 ? 23.928  37.023  115.803 1.00 77.06  ? 425  ASN D ND2 1 
ATOM   8885 N N   . PRO D 2 252 ? 21.910  33.788  112.872 1.00 78.97  ? 426  PRO D N   1 
ATOM   8886 C CA  . PRO D 2 252 ? 21.562  33.532  111.475 1.00 80.90  ? 426  PRO D CA  1 
ATOM   8887 C C   . PRO D 2 252 ? 22.434  34.401  110.578 1.00 82.90  ? 426  PRO D C   1 
ATOM   8888 O O   . PRO D 2 252 ? 22.355  35.631  110.626 1.00 83.05  ? 426  PRO D O   1 
ATOM   8889 C CB  . PRO D 2 252 ? 20.090  33.921  111.417 1.00 80.49  ? 426  PRO D CB  1 
ATOM   8890 C CG  . PRO D 2 252 ? 20.006  35.033  112.419 1.00 80.04  ? 426  PRO D CG  1 
ATOM   8891 C CD  . PRO D 2 252 ? 20.818  34.490  113.567 1.00 79.23  ? 426  PRO D CD  1 
ATOM   8892 N N   . PRO D 2 253 ? 23.277  33.772  109.743 1.00 84.53  ? 427  PRO D N   1 
ATOM   8893 C CA  . PRO D 2 253 ? 24.161  34.523  108.843 1.00 86.24  ? 427  PRO D CA  1 
ATOM   8894 C C   . PRO D 2 253 ? 23.431  35.701  108.211 1.00 87.79  ? 427  PRO D C   1 
ATOM   8895 O O   . PRO D 2 253 ? 22.523  35.507  107.408 1.00 88.23  ? 427  PRO D O   1 
ATOM   8896 C CB  . PRO D 2 253 ? 24.576  33.475  107.813 1.00 85.89  ? 427  PRO D CB  1 
ATOM   8897 C CG  . PRO D 2 253 ? 23.407  32.537  107.803 1.00 85.21  ? 427  PRO D CG  1 
ATOM   8898 C CD  . PRO D 2 253 ? 23.124  32.387  109.274 1.00 84.12  ? 427  PRO D CD  1 
ATOM   8899 N N   . GLU D 2 254 ? 23.823  36.918  108.578 1.00 89.11  ? 428  GLU D N   1 
ATOM   8900 C CA  . GLU D 2 254 ? 23.171  38.108  108.045 1.00 90.10  ? 428  GLU D CA  1 
ATOM   8901 C C   . GLU D 2 254 ? 22.977  37.974  106.533 1.00 90.61  ? 428  GLU D C   1 
ATOM   8902 O O   . GLU D 2 254 ? 22.012  38.497  105.971 1.00 90.14  ? 428  GLU D O   1 
ATOM   8903 C CB  . GLU D 2 254 ? 23.985  39.369  108.381 1.00 91.17  ? 428  GLU D CB  1 
ATOM   8904 C CG  . GLU D 2 254 ? 24.896  39.885  107.268 1.00 92.21  ? 428  GLU D CG  1 
ATOM   8905 C CD  . GLU D 2 254 ? 25.427  41.287  107.545 1.00 92.48  ? 428  GLU D CD  1 
ATOM   8906 O OE1 . GLU D 2 254 ? 26.249  41.451  108.471 1.00 92.01  ? 428  GLU D OE1 1 
ATOM   8907 O OE2 . GLU D 2 254 ? 25.015  42.231  106.837 1.00 93.54  ? 428  GLU D OE2 1 
ATOM   8908 N N   . THR D 2 255 ? 23.894  37.258  105.886 1.00 91.42  ? 429  THR D N   1 
ATOM   8909 C CA  . THR D 2 255 ? 23.828  37.036  104.444 1.00 92.50  ? 429  THR D CA  1 
ATOM   8910 C C   . THR D 2 255 ? 24.108  35.576  104.100 1.00 92.71  ? 429  THR D C   1 
ATOM   8911 O O   . THR D 2 255 ? 24.710  34.842  104.891 1.00 92.45  ? 429  THR D O   1 
ATOM   8912 C CB  . THR D 2 255 ? 24.856  37.908  103.679 1.00 93.29  ? 429  THR D CB  1 
ATOM   8913 O OG1 . THR D 2 255 ? 26.170  37.686  104.215 1.00 93.56  ? 429  THR D OG1 1 
ATOM   8914 C CG2 . THR D 2 255 ? 24.495  39.386  103.789 1.00 93.62  ? 429  THR D CG2 1 
ATOM   8915 N N   . LEU D 2 256 ? 23.662  35.162  102.917 1.00 92.78  ? 430  LEU D N   1 
ATOM   8916 C CA  . LEU D 2 256 ? 23.879  33.798  102.449 1.00 93.23  ? 430  LEU D CA  1 
ATOM   8917 C C   . LEU D 2 256 ? 24.791  33.820  101.232 1.00 93.86  ? 430  LEU D C   1 
ATOM   8918 O O   . LEU D 2 256 ? 25.332  32.788  100.828 1.00 94.22  ? 430  LEU D O   1 
ATOM   8919 C CB  . LEU D 2 256 ? 22.553  33.126  102.083 1.00 91.75  ? 430  LEU D CB  1 
ATOM   8920 C CG  . LEU D 2 256 ? 21.609  32.726  103.217 1.00 90.49  ? 430  LEU D CG  1 
ATOM   8921 C CD1 . LEU D 2 256 ? 20.526  31.814  102.662 1.00 89.09  ? 430  LEU D CD1 1 
ATOM   8922 C CD2 . LEU D 2 256 ? 22.383  32.009  104.313 1.00 88.70  ? 430  LEU D CD2 1 
ATOM   8923 N N   . ASN D 2 257 ? 24.953  35.013  100.662 1.00 94.43  ? 431  ASN D N   1 
ATOM   8924 C CA  . ASN D 2 257 ? 25.792  35.229  99.485  1.00 94.40  ? 431  ASN D CA  1 
ATOM   8925 C C   . ASN D 2 257 ? 25.502  34.271  98.339  1.00 94.32  ? 431  ASN D C   1 
ATOM   8926 O O   . ASN D 2 257 ? 26.302  33.382  98.035  1.00 93.91  ? 431  ASN D O   1 
ATOM   8927 C CB  . ASN D 2 257 ? 27.280  35.150  99.853  1.00 94.21  ? 431  ASN D CB  1 
ATOM   8928 C CG  . ASN D 2 257 ? 27.890  36.518  100.119 1.00 94.06  ? 431  ASN D CG  1 
ATOM   8929 O OD1 . ASN D 2 257 ? 27.525  37.201  101.078 1.00 94.10  ? 431  ASN D OD1 1 
ATOM   8930 N ND2 . ASN D 2 257 ? 28.821  36.926  99.261  1.00 93.69  ? 431  ASN D ND2 1 
ATOM   8931 N N   . LEU D 2 258 ? 24.352  34.466  97.703  1.00 94.37  ? 432  LEU D N   1 
ATOM   8932 C CA  . LEU D 2 258 ? 23.951  33.640  96.574  1.00 94.89  ? 432  LEU D CA  1 
ATOM   8933 C C   . LEU D 2 258 ? 23.589  34.504  95.370  1.00 95.39  ? 432  LEU D C   1 
ATOM   8934 O O   . LEU D 2 258 ? 23.966  35.702  95.373  1.00 94.97  ? 432  LEU D O   1 
ATOM   8935 C CB  . LEU D 2 258 ? 22.768  32.746  96.957  1.00 94.29  ? 432  LEU D CB  1 
ATOM   8936 C CG  . LEU D 2 258 ? 23.121  31.593  97.897  1.00 93.62  ? 432  LEU D CG  1 
ATOM   8937 C CD1 . LEU D 2 258 ? 22.469  31.808  99.245  1.00 93.22  ? 432  LEU D CD1 1 
ATOM   8938 C CD2 . LEU D 2 258 ? 22.659  30.282  97.283  1.00 93.08  ? 432  LEU D CD2 1 
HETATM 8939 C C1  . INR E 3 .   ? 5.479   42.288  49.591  1.00 49.33  ? 1298 INR A C1  1 
HETATM 8940 C C2  . INR E 3 .   ? 4.474   42.643  50.507  1.00 50.03  ? 1298 INR A C2  1 
HETATM 8941 C C6  . INR E 3 .   ? 5.251   41.307  48.589  1.00 50.82  ? 1298 INR A C6  1 
HETATM 8942 N N7  . INR E 3 .   ? 6.596   42.991  49.815  1.00 50.40  ? 1298 INR A N7  1 
HETATM 8943 C C3  . INR E 3 .   ? 3.185   42.041  50.488  1.00 50.50  ? 1298 INR A C3  1 
HETATM 8944 C C8  . INR E 3 .   ? 5.139   43.688  51.353  1.00 48.79  ? 1298 INR A C8  1 
HETATM 8945 C C4  . INR E 3 .   ? 2.939   41.052  49.489  1.00 52.03  ? 1298 INR A C4  1 
HETATM 8946 C C5  . INR E 3 .   ? 3.962   40.688  48.549  1.00 52.26  ? 1298 INR A C5  1 
HETATM 8947 O O10 . INR E 3 .   ? 4.608   44.260  52.282  1.00 50.46  ? 1298 INR A O10 1 
HETATM 8948 C C9  . INR E 3 .   ? 6.514   43.828  50.830  1.00 48.40  ? 1298 INR A C9  1 
HETATM 8949 C C11 . INR E 3 .   ? 7.575   44.609  51.186  1.00 44.98  ? 1298 INR A C11 1 
HETATM 8950 C C12 . INR E 3 .   ? 8.895   44.592  50.514  1.00 44.21  ? 1298 INR A C12 1 
HETATM 8951 C C15 . INR E 3 .   ? 7.776   45.632  52.303  1.00 42.20  ? 1298 INR A C15 1 
HETATM 8952 O O13 . INR E 3 .   ? 9.167   43.886  49.543  1.00 45.32  ? 1298 INR A O13 1 
HETATM 8953 N N14 . INR E 3 .   ? 9.694   45.429  51.104  1.00 43.11  ? 1298 INR A N14 1 
HETATM 8954 C C16 . INR E 3 .   ? 9.111   46.047  52.134  1.00 40.66  ? 1298 INR A C16 1 
HETATM 8955 C C20 . INR E 3 .   ? 6.991   46.187  53.355  1.00 40.24  ? 1298 INR A C20 1 
HETATM 8956 C C19 . INR E 3 .   ? 7.591   47.156  54.223  1.00 38.31  ? 1298 INR A C19 1 
HETATM 8957 C C18 . INR E 3 .   ? 8.941   47.558  54.040  1.00 37.91  ? 1298 INR A C18 1 
HETATM 8958 S S21 . INR E 3 .   ? 6.585   47.819  55.525  1.00 37.78  ? 1298 INR A S21 1 
HETATM 8959 C C17 . INR E 3 .   ? 9.716   47.006  52.984  1.00 39.43  ? 1298 INR A C17 1 
HETATM 8960 O O24 . INR E 3 .   ? 7.483   48.751  56.254  1.00 36.08  ? 1298 INR A O24 1 
HETATM 8961 O O23 . INR E 3 .   ? 6.190   46.745  56.409  1.00 36.58  ? 1298 INR A O23 1 
HETATM 8962 O O22 . INR E 3 .   ? 5.563   48.627  54.891  1.00 40.48  ? 1298 INR A O22 1 
HETATM 8963 C C1  . INR F 3 .   ? -3.833  -20.700 105.008 1.00 52.80  ? 1298 INR C C1  1 
HETATM 8964 C C2  . INR F 3 .   ? -3.266  -20.532 106.279 1.00 53.19  ? 1298 INR C C2  1 
HETATM 8965 C C6  . INR F 3 .   ? -4.137  -21.997 104.509 1.00 52.77  ? 1298 INR C C6  1 
HETATM 8966 N N7  . INR F 3 .   ? -4.022  -19.513 104.400 1.00 52.24  ? 1298 INR C N7  1 
HETATM 8967 C C3  . INR F 3 .   ? -2.963  -21.629 107.129 1.00 52.43  ? 1298 INR C C3  1 
HETATM 8968 C C8  . INR F 3 .   ? -3.116  -19.043 106.389 1.00 53.46  ? 1298 INR C C8  1 
HETATM 8969 C C4  . INR F 3 .   ? -3.263  -22.934 106.637 1.00 51.52  ? 1298 INR C C4  1 
HETATM 8970 C C5  . INR F 3 .   ? -3.842  -23.119 105.343 1.00 51.66  ? 1298 INR C C5  1 
HETATM 8971 O O10 . INR F 3 .   ? -2.649  -18.471 107.360 1.00 53.51  ? 1298 INR C O10 1 
HETATM 8972 C C9  . INR F 3 .   ? -3.634  -18.481 105.112 1.00 51.98  ? 1298 INR C C9  1 
HETATM 8973 C C11 . INR F 3 .   ? -3.739  -17.214 104.647 1.00 50.45  ? 1298 INR C C11 1 
HETATM 8974 C C12 . INR F 3 .   ? -4.289  -16.818 103.327 1.00 50.13  ? 1298 INR C C12 1 
HETATM 8975 C C15 . INR F 3 .   ? -3.351  -15.890 105.259 1.00 48.76  ? 1298 INR C C15 1 
HETATM 8976 O O13 . INR F 3 .   ? -4.725  -17.590 102.497 1.00 51.00  ? 1298 INR C O13 1 
HETATM 8977 N N14 . INR F 3 .   ? -4.225  -15.531 103.209 1.00 50.47  ? 1298 INR C N14 1 
HETATM 8978 C C16 . INR F 3 .   ? -3.694  -14.951 104.283 1.00 47.68  ? 1298 INR C C16 1 
HETATM 8979 C C20 . INR F 3 .   ? -2.771  -15.458 106.469 1.00 48.16  ? 1298 INR C C20 1 
HETATM 8980 C C19 . INR F 3 .   ? -2.546  -14.086 106.676 1.00 46.74  ? 1298 INR C C19 1 
HETATM 8981 C C18 . INR F 3 .   ? -2.895  -13.136 105.681 1.00 46.34  ? 1298 INR C C18 1 
HETATM 8982 S S21 . INR F 3 .   ? -1.805  -13.620 108.206 1.00 47.84  ? 1298 INR C S21 1 
HETATM 8983 C C17 . INR F 3 .   ? -3.480  -13.568 104.466 1.00 46.76  ? 1298 INR C C17 1 
HETATM 8984 O O24 . INR F 3 .   ? -1.715  -12.125 108.092 1.00 46.99  ? 1298 INR C O24 1 
HETATM 8985 O O23 . INR F 3 .   ? -0.472  -14.143 108.222 1.00 47.48  ? 1298 INR C O23 1 
HETATM 8986 O O22 . INR F 3 .   ? -2.707  -13.966 109.281 1.00 45.21  ? 1298 INR C O22 1 
HETATM 8987 O O   . HOH G 4 .   ? 14.210  60.032  33.257  1.00 75.41  ? 2001 HOH A O   1 
HETATM 8988 O O   . HOH G 4 .   ? 18.777  61.636  37.557  1.00 78.27  ? 2002 HOH A O   1 
HETATM 8989 O O   . HOH G 4 .   ? 6.532   59.177  41.000  1.00 64.76  ? 2003 HOH A O   1 
HETATM 8990 O O   . HOH G 4 .   ? 5.032   40.636  44.793  1.00 66.87  ? 2004 HOH A O   1 
HETATM 8991 O O   . HOH G 4 .   ? 19.114  53.443  46.230  1.00 46.29  ? 2005 HOH A O   1 
HETATM 8992 O O   . HOH G 4 .   ? 17.835  61.896  55.000  1.00 51.57  ? 2006 HOH A O   1 
HETATM 8993 O O   . HOH G 4 .   ? 21.710  54.228  55.168  1.00 43.99  ? 2007 HOH A O   1 
HETATM 8994 O O   . HOH G 4 .   ? 16.588  48.848  31.284  1.00 41.53  ? 2008 HOH A O   1 
HETATM 8995 O O   . HOH G 4 .   ? 19.966  51.648  45.046  1.00 72.10  ? 2009 HOH A O   1 
HETATM 8996 O O   . HOH G 4 .   ? 21.444  47.599  47.184  1.00 41.77  ? 2010 HOH A O   1 
HETATM 8997 O O   . HOH G 4 .   ? 19.703  50.883  47.388  1.00 80.07  ? 2011 HOH A O   1 
HETATM 8998 O O   . HOH G 4 .   ? 17.544  51.126  44.104  1.00 52.77  ? 2012 HOH A O   1 
HETATM 8999 O O   . HOH G 4 .   ? 21.370  49.361  43.230  1.00 39.68  ? 2013 HOH A O   1 
HETATM 9000 O O   . HOH G 4 .   ? 17.080  42.865  42.517  1.00 40.57  ? 2014 HOH A O   1 
HETATM 9001 O O   . HOH G 4 .   ? 5.075   51.972  58.436  1.00 46.55  ? 2015 HOH A O   1 
HETATM 9002 O O   . HOH G 4 .   ? -0.891  66.568  54.838  1.00 49.14  ? 2016 HOH A O   1 
HETATM 9003 O O   . HOH G 4 .   ? 2.926   69.179  56.523  1.00 60.94  ? 2017 HOH A O   1 
HETATM 9004 O O   . HOH G 4 .   ? 3.088   67.524  66.819  1.00 58.50  ? 2018 HOH A O   1 
HETATM 9005 O O   . HOH G 4 .   ? 16.611  37.680  46.369  1.00 50.90  ? 2019 HOH A O   1 
HETATM 9006 O O   . HOH G 4 .   ? 3.691   56.864  67.265  1.00 59.16  ? 2020 HOH A O   1 
HETATM 9007 O O   . HOH G 4 .   ? 15.249  47.561  79.773  1.00 50.57  ? 2021 HOH A O   1 
HETATM 9008 O O   . HOH G 4 .   ? 19.278  59.423  54.789  1.00 51.25  ? 2022 HOH A O   1 
HETATM 9009 O O   . HOH G 4 .   ? 19.956  57.037  54.371  1.00 51.99  ? 2023 HOH A O   1 
HETATM 9010 O O   . HOH G 4 .   ? 6.726   58.682  83.436  1.00 65.75  ? 2024 HOH A O   1 
HETATM 9011 O O   . HOH G 4 .   ? 17.697  48.278  57.773  1.00 32.21  ? 2025 HOH A O   1 
HETATM 9012 O O   . HOH G 4 .   ? -4.191  47.381  65.729  1.00 33.80  ? 2026 HOH A O   1 
HETATM 9013 O O   . HOH G 4 .   ? 22.644  42.540  57.226  1.00 46.93  ? 2027 HOH A O   1 
HETATM 9014 O O   . HOH G 4 .   ? 18.624  37.001  54.956  1.00 34.85  ? 2028 HOH A O   1 
HETATM 9015 O O   . HOH G 4 .   ? 4.649   50.188  89.251  1.00 57.75  ? 2029 HOH A O   1 
HETATM 9016 O O   . HOH G 4 .   ? 18.899  45.514  57.746  1.00 27.25  ? 2030 HOH A O   1 
HETATM 9017 O O   . HOH G 4 .   ? 24.175  45.107  53.762  1.00 53.60  ? 2031 HOH A O   1 
HETATM 9018 O O   . HOH G 4 .   ? 19.308  54.643  54.387  1.00 60.44  ? 2032 HOH A O   1 
HETATM 9019 O O   . HOH G 4 .   ? 22.386  57.046  47.032  1.00 50.45  ? 2033 HOH A O   1 
HETATM 9020 O O   . HOH G 4 .   ? -11.475 29.551  73.155  1.00 22.65  ? 2034 HOH A O   1 
HETATM 9021 O O   . HOH G 4 .   ? 4.049   59.523  42.946  1.00 65.10  ? 2035 HOH A O   1 
HETATM 9022 O O   . HOH G 4 .   ? -13.987 31.712  91.239  1.00 42.77  ? 2036 HOH A O   1 
HETATM 9023 O O   . HOH G 4 .   ? -8.359  24.973  70.280  1.00 40.75  ? 2037 HOH A O   1 
HETATM 9024 O O   . HOH G 4 .   ? -4.492  27.346  49.184  1.00 52.88  ? 2038 HOH A O   1 
HETATM 9025 O O   . HOH G 4 .   ? 15.016  25.157  81.257  1.00 66.93  ? 2039 HOH A O   1 
HETATM 9026 O O   . HOH G 4 .   ? -1.316  18.157  53.436  1.00 58.16  ? 2040 HOH A O   1 
HETATM 9027 O O   . HOH G 4 .   ? 2.710   19.443  56.335  1.00 46.34  ? 2041 HOH A O   1 
HETATM 9028 O O   . HOH G 4 .   ? 21.798  25.468  66.926  1.00 30.66  ? 2042 HOH A O   1 
HETATM 9029 O O   . HOH G 4 .   ? 12.006  19.817  61.388  1.00 72.41  ? 2043 HOH A O   1 
HETATM 9030 O O   . HOH G 4 .   ? 21.719  25.148  56.348  1.00 50.42  ? 2044 HOH A O   1 
HETATM 9031 O O   . HOH G 4 .   ? 11.400  32.378  52.839  1.00 32.08  ? 2045 HOH A O   1 
HETATM 9032 O O   . HOH G 4 .   ? 21.237  38.617  67.053  1.00 36.85  ? 2046 HOH A O   1 
HETATM 9033 O O   . HOH G 4 .   ? 22.037  39.963  70.226  1.00 36.21  ? 2047 HOH A O   1 
HETATM 9034 O O   . HOH G 4 .   ? 19.532  55.673  72.475  1.00 41.96  ? 2048 HOH A O   1 
HETATM 9035 O O   . HOH G 4 .   ? 6.639   48.617  64.820  1.00 28.99  ? 2049 HOH A O   1 
HETATM 9036 O O   . HOH G 4 .   ? 2.581   42.614  54.118  1.00 58.24  ? 2050 HOH A O   1 
HETATM 9037 O O   . HOH G 4 .   ? 18.113  36.323  51.315  1.00 42.08  ? 2051 HOH A O   1 
HETATM 9038 O O   . HOH G 4 .   ? 14.648  35.319  47.319  1.00 46.32  ? 2052 HOH A O   1 
HETATM 9039 O O   . HOH G 4 .   ? 14.518  28.838  55.327  1.00 36.73  ? 2053 HOH A O   1 
HETATM 9040 O O   . HOH G 4 .   ? 13.385  55.714  75.111  1.00 51.50  ? 2054 HOH A O   1 
HETATM 9041 O O   . HOH G 4 .   ? 11.884  56.181  70.103  1.00 18.93  ? 2055 HOH A O   1 
HETATM 9042 O O   . HOH G 4 .   ? 16.676  55.313  74.730  1.00 43.52  ? 2056 HOH A O   1 
HETATM 9043 O O   . HOH G 4 .   ? 18.958  54.380  78.824  1.00 37.63  ? 2057 HOH A O   1 
HETATM 9044 O O   . HOH G 4 .   ? 14.852  55.216  81.290  1.00 49.45  ? 2058 HOH A O   1 
HETATM 9045 O O   . HOH G 4 .   ? 13.666  47.732  82.948  1.00 45.26  ? 2059 HOH A O   1 
HETATM 9046 O O   . HOH G 4 .   ? 8.052   56.655  83.767  1.00 48.69  ? 2060 HOH A O   1 
HETATM 9047 O O   . HOH G 4 .   ? 3.098   55.858  84.916  1.00 43.73  ? 2061 HOH A O   1 
HETATM 9048 O O   . HOH G 4 .   ? 7.235   58.305  80.298  1.00 47.13  ? 2062 HOH A O   1 
HETATM 9049 O O   . HOH G 4 .   ? 13.490  55.529  78.737  1.00 31.12  ? 2063 HOH A O   1 
HETATM 9050 O O   . HOH G 4 .   ? 3.532   58.138  69.938  1.00 50.82  ? 2064 HOH A O   1 
HETATM 9051 O O   . HOH G 4 .   ? 2.847   54.646  69.148  1.00 37.34  ? 2065 HOH A O   1 
HETATM 9052 O O   . HOH G 4 .   ? -5.793  45.888  67.228  1.00 42.67  ? 2066 HOH A O   1 
HETATM 9053 O O   . HOH G 4 .   ? -2.298  37.762  72.593  1.00 23.39  ? 2067 HOH A O   1 
HETATM 9054 O O   . HOH G 4 .   ? -2.809  36.493  61.400  1.00 76.46  ? 2068 HOH A O   1 
HETATM 9055 O O   . HOH G 4 .   ? -4.678  46.494  76.213  1.00 26.96  ? 2069 HOH A O   1 
HETATM 9056 O O   . HOH G 4 .   ? 2.691   41.836  73.250  1.00 28.16  ? 2070 HOH A O   1 
HETATM 9057 O O   . HOH G 4 .   ? 3.045   53.989  90.684  1.00 50.88  ? 2071 HOH A O   1 
HETATM 9058 O O   . HOH G 4 .   ? 4.659   51.135  79.890  1.00 40.86  ? 2072 HOH A O   1 
HETATM 9059 O O   . HOH G 4 .   ? 2.349   48.945  86.975  1.00 45.05  ? 2073 HOH A O   1 
HETATM 9060 O O   . HOH G 4 .   ? 9.524   56.393  86.424  1.00 59.71  ? 2074 HOH A O   1 
HETATM 9061 O O   . HOH G 4 .   ? 7.324   50.554  79.399  1.00 38.76  ? 2075 HOH A O   1 
HETATM 9062 O O   . HOH G 4 .   ? 13.901  39.631  77.023  1.00 25.98  ? 2076 HOH A O   1 
HETATM 9063 O O   . HOH G 4 .   ? 10.742  43.061  79.559  1.00 49.97  ? 2077 HOH A O   1 
HETATM 9064 O O   . HOH G 4 .   ? 5.171   42.806  68.945  1.00 27.71  ? 2078 HOH A O   1 
HETATM 9065 O O   . HOH G 4 .   ? -2.457  33.947  59.116  1.00 64.56  ? 2079 HOH A O   1 
HETATM 9066 O O   . HOH G 4 .   ? -1.308  33.827  66.748  1.00 31.35  ? 2080 HOH A O   1 
HETATM 9067 O O   . HOH G 4 .   ? 1.709   21.578  61.443  1.00 54.37  ? 2081 HOH A O   1 
HETATM 9068 O O   . HOH G 4 .   ? -2.823  28.249  67.591  1.00 42.66  ? 2082 HOH A O   1 
HETATM 9069 O O   . HOH G 4 .   ? -3.707  31.410  59.125  1.00 46.51  ? 2083 HOH A O   1 
HETATM 9070 O O   . HOH G 4 .   ? -8.721  21.700  66.188  1.00 73.82  ? 2084 HOH A O   1 
HETATM 9071 O O   . HOH G 4 .   ? -5.277  27.648  68.520  1.00 59.49  ? 2085 HOH A O   1 
HETATM 9072 O O   . HOH G 4 .   ? -8.020  31.449  72.035  1.00 30.54  ? 2086 HOH A O   1 
HETATM 9073 O O   . HOH G 4 .   ? -14.773 36.680  68.349  1.00 60.36  ? 2087 HOH A O   1 
HETATM 9074 O O   . HOH G 4 .   ? -12.110 46.983  73.778  1.00 37.81  ? 2088 HOH A O   1 
HETATM 9075 O O   . HOH G 4 .   ? -15.495 34.379  73.661  1.00 60.26  ? 2089 HOH A O   1 
HETATM 9076 O O   . HOH G 4 .   ? -11.578 29.857  75.084  1.00 20.30  ? 2090 HOH A O   1 
HETATM 9077 O O   . HOH G 4 .   ? -14.466 34.798  77.245  1.00 45.10  ? 2091 HOH A O   1 
HETATM 9078 O O   . HOH G 4 .   ? -1.008  29.843  85.392  1.00 41.40  ? 2092 HOH A O   1 
HETATM 9079 O O   . HOH G 4 .   ? 6.725   32.874  92.856  1.00 65.57  ? 2093 HOH A O   1 
HETATM 9080 O O   . HOH G 4 .   ? 1.453   38.915  90.453  1.00 85.15  ? 2094 HOH A O   1 
HETATM 9081 O O   . HOH G 4 .   ? 0.106   42.277  94.577  1.00 62.90  ? 2095 HOH A O   1 
HETATM 9082 O O   . HOH G 4 .   ? -15.085 39.541  92.872  1.00 54.86  ? 2096 HOH A O   1 
HETATM 9083 O O   . HOH G 4 .   ? -14.160 39.986  85.300  1.00 39.43  ? 2097 HOH A O   1 
HETATM 9084 O O   . HOH G 4 .   ? -13.544 34.263  90.543  1.00 43.32  ? 2098 HOH A O   1 
HETATM 9085 O O   . HOH G 4 .   ? -12.996 28.672  86.164  1.00 69.22  ? 2099 HOH A O   1 
HETATM 9086 O O   . HOH G 4 .   ? -8.954  23.559  75.015  1.00 45.34  ? 2100 HOH A O   1 
HETATM 9087 O O   . HOH G 4 .   ? -7.871  26.662  75.332  1.00 55.45  ? 2101 HOH A O   1 
HETATM 9088 O O   . HOH G 4 .   ? -0.318  13.805  75.798  1.00 60.07  ? 2102 HOH A O   1 
HETATM 9089 O O   . HOH G 4 .   ? -2.641  15.920  74.664  1.00 48.33  ? 2103 HOH A O   1 
HETATM 9090 O O   . HOH G 4 .   ? -6.128  22.406  70.258  1.00 37.90  ? 2104 HOH A O   1 
HETATM 9091 O O   . HOH G 4 .   ? 1.332   22.744  72.454  1.00 51.73  ? 2105 HOH A O   1 
HETATM 9092 O O   . HOH G 4 .   ? 8.435   14.496  72.056  1.00 38.01  ? 2106 HOH A O   1 
HETATM 9093 O O   . HOH G 4 .   ? 13.531  20.571  75.290  1.00 32.88  ? 2107 HOH A O   1 
HETATM 9094 O O   . HOH G 4 .   ? 13.890  19.167  68.774  1.00 47.63  ? 2108 HOH A O   1 
HETATM 9095 O O   . HOH G 4 .   ? 6.321   14.372  71.850  1.00 28.03  ? 2109 HOH A O   1 
HETATM 9096 O O   . HOH G 4 .   ? 6.980   14.383  74.177  1.00 36.41  ? 2110 HOH A O   1 
HETATM 9097 O O   . HOH G 4 .   ? 12.350  20.203  77.776  1.00 54.16  ? 2111 HOH A O   1 
HETATM 9098 O O   . HOH G 4 .   ? 14.724  22.074  77.810  1.00 57.56  ? 2112 HOH A O   1 
HETATM 9099 O O   . HOH G 4 .   ? 14.864  24.803  78.363  1.00 39.62  ? 2113 HOH A O   1 
HETATM 9100 O O   . HOH G 4 .   ? 11.495  27.252  82.310  1.00 62.54  ? 2114 HOH A O   1 
HETATM 9101 O O   . HOH G 4 .   ? 2.971   31.485  82.193  1.00 44.43  ? 2115 HOH A O   1 
HETATM 9102 O O   . HOH G 4 .   ? 7.281   40.923  88.397  1.00 65.10  ? 2116 HOH A O   1 
HETATM 9103 O O   . HOH G 4 .   ? 11.456  38.115  77.104  1.00 20.17  ? 2117 HOH A O   1 
HETATM 9104 O O   . HOH G 4 .   ? 11.851  38.819  79.539  1.00 33.48  ? 2118 HOH A O   1 
HETATM 9105 O O   . HOH G 4 .   ? 20.153  26.008  69.444  1.00 45.07  ? 2119 HOH A O   1 
HETATM 9106 O O   . HOH G 4 .   ? 22.073  23.805  65.213  1.00 44.27  ? 2120 HOH A O   1 
HETATM 9107 O O   . HOH G 4 .   ? 15.212  20.696  61.035  1.00 34.76  ? 2121 HOH A O   1 
HETATM 9108 O O   . HOH G 4 .   ? 18.167  33.859  51.723  1.00 66.93  ? 2122 HOH A O   1 
HETATM 9109 O O   . HOH G 4 .   ? 18.944  24.025  54.440  1.00 54.68  ? 2123 HOH A O   1 
HETATM 9110 O O   . HOH G 4 .   ? 9.603   27.906  47.107  1.00 62.56  ? 2124 HOH A O   1 
HETATM 9111 O O   . HOH H 4 .   ? 13.005  85.131  56.444  1.00 41.12  ? 2001 HOH B O   1 
HETATM 9112 O O   . HOH H 4 .   ? 23.374  46.271  86.533  1.00 45.03  ? 2002 HOH B O   1 
HETATM 9113 O O   . HOH H 4 .   ? 25.049  47.966  64.460  1.00 72.00  ? 2003 HOH B O   1 
HETATM 9114 O O   . HOH H 4 .   ? 23.326  57.173  64.873  1.00 55.78  ? 2004 HOH B O   1 
HETATM 9115 O O   . HOH H 4 .   ? 30.274  86.303  67.359  1.00 51.44  ? 2005 HOH B O   1 
HETATM 9116 O O   . HOH H 4 .   ? 32.045  82.576  70.382  1.00 61.37  ? 2006 HOH B O   1 
HETATM 9117 O O   . HOH H 4 .   ? 23.721  66.316  75.404  1.00 68.76  ? 2007 HOH B O   1 
HETATM 9118 O O   . HOH H 4 .   ? 11.256  86.512  58.225  1.00 67.69  ? 2008 HOH B O   1 
HETATM 9119 O O   . HOH H 4 .   ? 10.812  88.559  60.464  1.00 52.89  ? 2009 HOH B O   1 
HETATM 9120 O O   . HOH H 4 .   ? 36.069  60.325  77.015  1.00 40.12  ? 2010 HOH B O   1 
HETATM 9121 O O   . HOH H 4 .   ? 37.428  62.970  79.718  1.00 34.55  ? 2011 HOH B O   1 
HETATM 9122 O O   . HOH H 4 .   ? 30.561  77.846  85.946  1.00 48.94  ? 2012 HOH B O   1 
HETATM 9123 O O   . HOH H 4 .   ? 24.708  76.875  85.978  1.00 38.00  ? 2013 HOH B O   1 
HETATM 9124 O O   . HOH H 4 .   ? 33.484  69.126  102.337 1.00 52.84  ? 2014 HOH B O   1 
HETATM 9125 O O   . HOH H 4 .   ? 37.375  72.673  94.838  1.00 60.54  ? 2015 HOH B O   1 
HETATM 9126 O O   . HOH H 4 .   ? 17.383  43.634  79.679  1.00 54.37  ? 2016 HOH B O   1 
HETATM 9127 O O   . HOH H 4 .   ? 15.027  39.411  83.646  1.00 49.13  ? 2017 HOH B O   1 
HETATM 9128 O O   . HOH H 4 .   ? 14.285  39.479  74.025  1.00 25.91  ? 2018 HOH B O   1 
HETATM 9129 O O   . HOH H 4 .   ? 23.412  42.189  80.398  1.00 32.37  ? 2019 HOH B O   1 
HETATM 9130 O O   . HOH H 4 .   ? 29.800  47.077  80.448  1.00 33.14  ? 2020 HOH B O   1 
HETATM 9131 O O   . HOH H 4 .   ? 25.390  46.557  85.161  1.00 38.86  ? 2021 HOH B O   1 
HETATM 9132 O O   . HOH H 4 .   ? 23.628  42.207  77.552  1.00 16.08  ? 2022 HOH B O   1 
HETATM 9133 O O   . HOH H 4 .   ? 29.559  48.150  77.797  1.00 50.91  ? 2023 HOH B O   1 
HETATM 9134 O O   . HOH H 4 .   ? 24.184  51.476  64.346  1.00 56.76  ? 2024 HOH B O   1 
HETATM 9135 O O   . HOH H 4 .   ? 30.039  54.066  80.413  1.00 30.80  ? 2025 HOH B O   1 
HETATM 9136 O O   . HOH H 4 .   ? 27.760  62.672  72.418  1.00 31.83  ? 2026 HOH B O   1 
HETATM 9137 O O   . HOH H 4 .   ? 25.353  58.988  64.364  1.00 45.45  ? 2027 HOH B O   1 
HETATM 9138 O O   . HOH H 4 .   ? 29.762  52.611  61.717  1.00 64.99  ? 2028 HOH B O   1 
HETATM 9139 O O   . HOH H 4 .   ? 27.344  63.544  64.871  1.00 48.95  ? 2029 HOH B O   1 
HETATM 9140 O O   . HOH H 4 .   ? 29.215  66.285  73.507  1.00 59.40  ? 2030 HOH B O   1 
HETATM 9141 O O   . HOH H 4 .   ? 34.050  74.294  73.839  1.00 61.40  ? 2031 HOH B O   1 
HETATM 9142 O O   . HOH H 4 .   ? 34.745  84.369  65.358  1.00 58.85  ? 2032 HOH B O   1 
HETATM 9143 O O   . HOH H 4 .   ? 31.097  83.110  67.273  1.00 36.57  ? 2033 HOH B O   1 
HETATM 9144 O O   . HOH H 4 .   ? 32.512  86.047  66.088  1.00 74.74  ? 2034 HOH B O   1 
HETATM 9145 O O   . HOH H 4 .   ? 26.670  89.360  63.653  1.00 72.01  ? 2035 HOH B O   1 
HETATM 9146 O O   . HOH H 4 .   ? 16.248  82.480  72.211  1.00 45.07  ? 2036 HOH B O   1 
HETATM 9147 O O   . HOH H 4 .   ? 15.244  83.971  74.029  1.00 61.96  ? 2037 HOH B O   1 
HETATM 9148 O O   . HOH H 4 .   ? 8.731   81.014  76.627  1.00 50.20  ? 2038 HOH B O   1 
HETATM 9149 O O   . HOH H 4 .   ? 5.671   60.144  79.748  1.00 46.51  ? 2039 HOH B O   1 
HETATM 9150 O O   . HOH H 4 .   ? 11.826  63.571  83.573  1.00 38.22  ? 2040 HOH B O   1 
HETATM 9151 O O   . HOH H 4 .   ? 13.356  61.620  81.197  1.00 35.56  ? 2041 HOH B O   1 
HETATM 9152 O O   . HOH H 4 .   ? 24.606  65.509  73.190  1.00 59.23  ? 2042 HOH B O   1 
HETATM 9153 O O   . HOH H 4 .   ? 23.510  60.452  65.347  1.00 28.38  ? 2043 HOH B O   1 
HETATM 9154 O O   . HOH H 4 .   ? 25.013  64.034  63.242  1.00 44.37  ? 2044 HOH B O   1 
HETATM 9155 O O   . HOH H 4 .   ? 26.422  68.618  61.100  1.00 35.94  ? 2045 HOH B O   1 
HETATM 9156 O O   . HOH H 4 .   ? 26.636  82.252  63.815  1.00 50.00  ? 2046 HOH B O   1 
HETATM 9157 O O   . HOH H 4 .   ? 19.755  87.914  62.652  1.00 54.43  ? 2047 HOH B O   1 
HETATM 9158 O O   . HOH H 4 .   ? 12.438  56.776  72.675  1.00 23.70  ? 2048 HOH B O   1 
HETATM 9159 O O   . HOH H 4 .   ? 6.324   63.936  79.071  1.00 29.07  ? 2049 HOH B O   1 
HETATM 9160 O O   . HOH H 4 .   ? 6.286   60.911  77.412  1.00 33.05  ? 2050 HOH B O   1 
HETATM 9161 O O   . HOH H 4 .   ? -0.133  62.462  70.238  1.00 51.57  ? 2051 HOH B O   1 
HETATM 9162 O O   . HOH H 4 .   ? -0.548  72.633  65.834  1.00 44.38  ? 2052 HOH B O   1 
HETATM 9163 O O   . HOH H 4 .   ? 12.866  86.293  62.989  1.00 60.02  ? 2053 HOH B O   1 
HETATM 9164 O O   . HOH H 4 .   ? 6.260   81.953  56.200  1.00 55.16  ? 2054 HOH B O   1 
HETATM 9165 O O   . HOH H 4 .   ? 11.728  85.560  60.906  1.00 46.95  ? 2055 HOH B O   1 
HETATM 9166 O O   . HOH H 4 .   ? 8.774   85.499  59.834  1.00 49.60  ? 2056 HOH B O   1 
HETATM 9167 O O   . HOH H 4 .   ? 8.447   69.176  58.178  1.00 48.39  ? 2057 HOH B O   1 
HETATM 9168 O O   . HOH H 4 .   ? 7.902   68.983  54.825  1.00 48.13  ? 2058 HOH B O   1 
HETATM 9169 O O   . HOH H 4 .   ? 15.026  71.193  53.241  1.00 53.82  ? 2059 HOH B O   1 
HETATM 9170 O O   . HOH H 4 .   ? 16.696  68.253  49.703  1.00 57.00  ? 2060 HOH B O   1 
HETATM 9171 O O   . HOH H 4 .   ? 24.836  64.665  60.563  1.00 68.75  ? 2061 HOH B O   1 
HETATM 9172 O O   . HOH H 4 .   ? 22.422  70.111  54.232  1.00 51.36  ? 2062 HOH B O   1 
HETATM 9173 O O   . HOH H 4 .   ? 19.762  56.761  61.939  1.00 62.19  ? 2063 HOH B O   1 
HETATM 9174 O O   . HOH H 4 .   ? 19.008  57.387  64.881  1.00 29.63  ? 2064 HOH B O   1 
HETATM 9175 O O   . HOH H 4 .   ? 22.772  64.899  77.090  1.00 32.58  ? 2065 HOH B O   1 
HETATM 9176 O O   . HOH H 4 .   ? 18.976  54.094  76.116  1.00 34.05  ? 2066 HOH B O   1 
HETATM 9177 O O   . HOH H 4 .   ? 23.849  46.379  89.902  1.00 40.38  ? 2067 HOH B O   1 
HETATM 9178 O O   . HOH H 4 .   ? 27.121  49.629  94.526  1.00 45.69  ? 2068 HOH B O   1 
HETATM 9179 O O   . HOH H 4 .   ? 26.092  50.649  96.834  1.00 57.55  ? 2069 HOH B O   1 
HETATM 9180 O O   . HOH H 4 .   ? 16.201  49.647  95.307  1.00 63.52  ? 2070 HOH B O   1 
HETATM 9181 O O   . HOH H 4 .   ? 19.085  61.182  101.762 1.00 84.05  ? 2071 HOH B O   1 
HETATM 9182 O O   . HOH H 4 .   ? 18.581  66.169  83.347  1.00 61.96  ? 2072 HOH B O   1 
HETATM 9183 O O   . HOH H 4 .   ? 26.616  68.830  78.175  1.00 42.78  ? 2073 HOH B O   1 
HETATM 9184 O O   . HOH H 4 .   ? 35.084  62.685  77.295  1.00 44.32  ? 2074 HOH B O   1 
HETATM 9185 O O   . HOH H 4 .   ? 23.912  66.914  101.910 1.00 63.35  ? 2075 HOH B O   1 
HETATM 9186 O O   . HOH H 4 .   ? 35.741  54.872  93.406  1.00 49.22  ? 2076 HOH B O   1 
HETATM 9187 O O   . HOH H 4 .   ? 39.614  49.231  92.261  1.00 54.83  ? 2077 HOH B O   1 
HETATM 9188 O O   . HOH H 4 .   ? 30.046  48.776  94.059  1.00 39.30  ? 2078 HOH B O   1 
HETATM 9189 O O   . HOH H 4 .   ? 29.519  45.386  87.713  1.00 39.46  ? 2079 HOH B O   1 
HETATM 9190 O O   . HOH H 4 .   ? 31.620  44.180  82.992  1.00 45.50  ? 2080 HOH B O   1 
HETATM 9191 O O   . HOH H 4 .   ? 32.150  49.735  79.286  1.00 52.42  ? 2081 HOH B O   1 
HETATM 9192 O O   . HOH H 4 .   ? 36.106  53.116  79.977  1.00 41.20  ? 2082 HOH B O   1 
HETATM 9193 O O   . HOH H 4 .   ? 37.894  54.985  91.398  1.00 53.71  ? 2083 HOH B O   1 
HETATM 9194 O O   . HOH H 4 .   ? 43.242  61.962  91.881  1.00 82.57  ? 2084 HOH B O   1 
HETATM 9195 O O   . HOH H 4 .   ? 40.947  56.576  91.228  1.00 48.18  ? 2085 HOH B O   1 
HETATM 9196 O O   . HOH H 4 .   ? 37.080  63.593  82.577  1.00 40.68  ? 2086 HOH B O   1 
HETATM 9197 O O   . HOH H 4 .   ? 33.438  74.735  85.196  1.00 47.85  ? 2087 HOH B O   1 
HETATM 9198 O O   . HOH H 4 .   ? 29.375  76.074  84.081  1.00 47.42  ? 2088 HOH B O   1 
HETATM 9199 O O   . HOH H 4 .   ? 24.341  75.823  94.262  1.00 42.99  ? 2089 HOH B O   1 
HETATM 9200 O O   . HOH H 4 .   ? 22.174  77.481  83.959  1.00 50.84  ? 2090 HOH B O   1 
HETATM 9201 O O   . HOH H 4 .   ? 19.518  77.189  86.368  1.00 41.73  ? 2091 HOH B O   1 
HETATM 9202 O O   . HOH H 4 .   ? 12.389  70.945  81.742  1.00 37.98  ? 2092 HOH B O   1 
HETATM 9203 O O   . HOH H 4 .   ? 17.386  81.093  95.840  1.00 39.25  ? 2093 HOH B O   1 
HETATM 9204 O O   . HOH H 4 .   ? 21.790  75.188  93.670  1.00 31.13  ? 2094 HOH B O   1 
HETATM 9205 O O   . HOH H 4 .   ? 23.591  76.739  105.420 1.00 64.70  ? 2095 HOH B O   1 
HETATM 9206 O O   . HOH H 4 .   ? 23.231  76.677  97.052  1.00 72.76  ? 2096 HOH B O   1 
HETATM 9207 O O   . HOH H 4 .   ? 32.264  70.915  102.692 1.00 44.11  ? 2097 HOH B O   1 
HETATM 9208 O O   . HOH H 4 .   ? 37.868  70.183  95.405  1.00 62.31  ? 2098 HOH B O   1 
HETATM 9209 O O   . HOH H 4 .   ? 34.624  63.287  96.301  1.00 33.06  ? 2099 HOH B O   1 
HETATM 9210 O O   . HOH H 4 .   ? 39.454  68.407  96.377  1.00 71.03  ? 2100 HOH B O   1 
HETATM 9211 O O   . HOH I 4 .   ? -2.723  -23.096 113.913 1.00 60.41  ? 2001 HOH C O   1 
HETATM 9212 O O   . HOH I 4 .   ? -18.115 -12.633 109.764 1.00 41.97  ? 2002 HOH C O   1 
HETATM 9213 O O   . HOH I 4 .   ? -12.041 -7.886  97.175  1.00 40.99  ? 2003 HOH C O   1 
HETATM 9214 O O   . HOH I 4 .   ? -3.253  -20.425 114.039 1.00 64.88  ? 2004 HOH C O   1 
HETATM 9215 O O   . HOH I 4 .   ? -4.373  -0.432  121.101 1.00 74.01  ? 2005 HOH C O   1 
HETATM 9216 O O   . HOH I 4 .   ? -15.360 -17.742 115.497 1.00 57.78  ? 2006 HOH C O   1 
HETATM 9217 O O   . HOH I 4 .   ? -11.018 -23.651 97.541  1.00 73.61  ? 2007 HOH C O   1 
HETATM 9218 O O   . HOH I 4 .   ? -10.347 -27.220 100.065 1.00 70.36  ? 2008 HOH C O   1 
HETATM 9219 O O   . HOH I 4 .   ? -6.445  -8.799  89.201  1.00 42.01  ? 2009 HOH C O   1 
HETATM 9220 O O   . HOH I 4 .   ? -6.265  -1.744  100.281 1.00 51.59  ? 2010 HOH C O   1 
HETATM 9221 O O   . HOH I 4 .   ? -13.828 -10.636 93.206  1.00 42.87  ? 2011 HOH C O   1 
HETATM 9222 O O   . HOH I 4 .   ? -16.202 -20.130 94.755  1.00 51.00  ? 2012 HOH C O   1 
HETATM 9223 O O   . HOH I 4 .   ? -9.133  -9.826  93.061  1.00 44.68  ? 2013 HOH C O   1 
HETATM 9224 O O   . HOH I 4 .   ? -13.416 -10.064 97.091  1.00 49.77  ? 2014 HOH C O   1 
HETATM 9225 O O   . HOH I 4 .   ? -15.636 -0.893  123.244 1.00 66.22  ? 2015 HOH C O   1 
HETATM 9226 O O   . HOH I 4 .   ? 0.059   -30.984 102.186 1.00 45.26  ? 2016 HOH C O   1 
HETATM 9227 O O   . HOH I 4 .   ? -11.863 -3.451  126.317 1.00 51.98  ? 2017 HOH C O   1 
HETATM 9228 O O   . HOH I 4 .   ? -5.491  5.921   127.526 1.00 63.36  ? 2018 HOH C O   1 
HETATM 9229 O O   . HOH I 4 .   ? -3.708  4.192   122.309 1.00 68.31  ? 2019 HOH C O   1 
HETATM 9230 O O   . HOH I 4 .   ? -0.486  -3.269  118.599 1.00 56.73  ? 2020 HOH C O   1 
HETATM 9231 O O   . HOH I 4 .   ? -1.817  -0.282  119.639 1.00 44.45  ? 2021 HOH C O   1 
HETATM 9232 O O   . HOH I 4 .   ? 0.734   -15.798 90.718  1.00 50.55  ? 2022 HOH C O   1 
HETATM 9233 O O   . HOH I 4 .   ? -2.202  -6.694  113.008 1.00 45.34  ? 2023 HOH C O   1 
HETATM 9234 O O   . HOH I 4 .   ? 2.198   -10.269 91.435  1.00 79.81  ? 2024 HOH C O   1 
HETATM 9235 O O   . HOH I 4 .   ? -6.532  -9.274  92.340  1.00 28.91  ? 2025 HOH C O   1 
HETATM 9236 O O   . HOH I 4 .   ? -0.864  -8.937  92.364  1.00 78.82  ? 2026 HOH C O   1 
HETATM 9237 O O   . HOH I 4 .   ? -8.389  -1.456  98.894  1.00 50.77  ? 2027 HOH C O   1 
HETATM 9238 O O   . HOH I 4 .   ? -13.704 -6.823  98.576  1.00 45.28  ? 2028 HOH C O   1 
HETATM 9239 O O   . HOH I 4 .   ? -15.874 0.096   104.548 1.00 35.84  ? 2029 HOH C O   1 
HETATM 9240 O O   . HOH I 4 .   ? 14.817  -28.209 130.081 1.00 60.90  ? 2030 HOH C O   1 
HETATM 9241 O O   . HOH I 4 .   ? -19.581 -5.047  113.502 1.00 53.67  ? 2031 HOH C O   1 
HETATM 9242 O O   . HOH I 4 .   ? -18.876 -11.768 112.587 1.00 68.10  ? 2032 HOH C O   1 
HETATM 9243 O O   . HOH I 4 .   ? 29.771  -12.443 122.593 1.00 52.38  ? 2033 HOH C O   1 
HETATM 9244 O O   . HOH I 4 .   ? 36.114  0.734   120.276 1.00 65.84  ? 2034 HOH C O   1 
HETATM 9245 O O   . HOH I 4 .   ? 31.279  1.598   120.774 1.00 63.66  ? 2035 HOH C O   1 
HETATM 9246 O O   . HOH I 4 .   ? -7.052  -24.657 103.036 1.00 72.95  ? 2036 HOH C O   1 
HETATM 9247 O O   . HOH I 4 .   ? 26.151  -28.990 92.026  1.00 63.22  ? 2037 HOH C O   1 
HETATM 9248 O O   . HOH I 4 .   ? 8.833   -28.560 111.274 1.00 57.29  ? 2038 HOH C O   1 
HETATM 9249 O O   . HOH I 4 .   ? 5.300   -41.177 103.679 1.00 52.28  ? 2039 HOH C O   1 
HETATM 9250 O O   . HOH I 4 .   ? 7.178   -32.579 100.190 1.00 50.73  ? 2040 HOH C O   1 
HETATM 9251 O O   . HOH I 4 .   ? 13.212  -32.136 103.038 1.00 44.03  ? 2041 HOH C O   1 
HETATM 9252 O O   . HOH I 4 .   ? 2.812   -32.784 101.401 1.00 45.23  ? 2042 HOH C O   1 
HETATM 9253 O O   . HOH I 4 .   ? 8.623   -11.859 91.122  1.00 58.20  ? 2043 HOH C O   1 
HETATM 9254 O O   . HOH I 4 .   ? 12.085  -12.153 110.552 1.00 45.10  ? 2044 HOH C O   1 
HETATM 9255 O O   . HOH I 4 .   ? 3.547   -23.830 96.500  1.00 32.68  ? 2045 HOH C O   1 
HETATM 9256 O O   . HOH I 4 .   ? 0.150   -15.046 92.893  1.00 34.58  ? 2046 HOH C O   1 
HETATM 9257 O O   . HOH I 4 .   ? 5.290   -8.621  111.091 1.00 45.26  ? 2047 HOH C O   1 
HETATM 9258 O O   . HOH I 4 .   ? 4.393   -3.629  114.131 1.00 44.12  ? 2048 HOH C O   1 
HETATM 9259 O O   . HOH I 4 .   ? 10.475  5.389   119.537 1.00 46.09  ? 2049 HOH C O   1 
HETATM 9260 O O   . HOH I 4 .   ? 14.207  5.116   119.088 1.00 53.63  ? 2050 HOH C O   1 
HETATM 9261 O O   . HOH I 4 .   ? 17.574  6.130   118.744 1.00 70.29  ? 2051 HOH C O   1 
HETATM 9262 O O   . HOH I 4 .   ? 8.298   -11.458 119.864 1.00 60.06  ? 2052 HOH C O   1 
HETATM 9263 O O   . HOH I 4 .   ? 17.781  -17.880 115.681 1.00 48.18  ? 2053 HOH C O   1 
HETATM 9264 O O   . HOH I 4 .   ? 19.935  7.434   118.306 1.00 50.63  ? 2054 HOH C O   1 
HETATM 9265 O O   . HOH I 4 .   ? 23.962  -1.774  117.490 1.00 62.58  ? 2055 HOH C O   1 
HETATM 9266 O O   . HOH I 4 .   ? 19.974  -6.691  104.329 1.00 55.94  ? 2056 HOH C O   1 
HETATM 9267 O O   . HOH I 4 .   ? 14.789  -23.079 111.865 1.00 47.40  ? 2057 HOH C O   1 
HETATM 9268 O O   . HOH I 4 .   ? 15.493  -38.738 107.140 1.00 43.03  ? 2058 HOH C O   1 
HETATM 9269 O O   . HOH I 4 .   ? 10.822  -31.220 107.050 1.00 39.31  ? 2059 HOH C O   1 
HETATM 9270 O O   . HOH I 4 .   ? 17.694  -27.372 110.906 1.00 53.28  ? 2060 HOH C O   1 
HETATM 9271 O O   . HOH I 4 .   ? 17.936  -29.839 114.876 1.00 58.01  ? 2061 HOH C O   1 
HETATM 9272 O O   . HOH I 4 .   ? 16.065  -22.142 114.206 1.00 56.40  ? 2062 HOH C O   1 
HETATM 9273 O O   . HOH I 4 .   ? 16.147  -26.046 128.844 1.00 56.88  ? 2063 HOH C O   1 
HETATM 9274 O O   . HOH I 4 .   ? 22.563  -28.513 119.658 1.00 51.44  ? 2064 HOH C O   1 
HETATM 9275 O O   . HOH I 4 .   ? 24.850  -27.933 120.005 1.00 41.82  ? 2065 HOH C O   1 
HETATM 9276 O O   . HOH I 4 .   ? 29.489  -3.780  119.851 1.00 60.43  ? 2066 HOH C O   1 
HETATM 9277 O O   . HOH I 4 .   ? 31.761  -10.753 122.685 1.00 60.62  ? 2067 HOH C O   1 
HETATM 9278 O O   . HOH I 4 .   ? 33.284  -1.978  118.786 1.00 75.97  ? 2068 HOH C O   1 
HETATM 9279 O O   . HOH I 4 .   ? 20.698  -8.022  129.640 1.00 47.88  ? 2069 HOH C O   1 
HETATM 9280 O O   . HOH I 4 .   ? 31.622  -18.661 133.666 1.00 54.28  ? 2070 HOH C O   1 
HETATM 9281 O O   . HOH I 4 .   ? 26.696  -29.135 115.955 1.00 58.36  ? 2071 HOH C O   1 
HETATM 9282 O O   . HOH I 4 .   ? 22.729  -29.115 111.582 1.00 51.28  ? 2072 HOH C O   1 
HETATM 9283 O O   . HOH I 4 .   ? 24.772  -27.301 93.300  1.00 65.39  ? 2073 HOH C O   1 
HETATM 9284 O O   . HOH I 4 .   ? 33.605  -13.868 106.282 1.00 56.89  ? 2074 HOH C O   1 
HETATM 9285 O O   . HOH I 4 .   ? 19.595  -19.098 84.596  1.00 80.18  ? 2075 HOH C O   1 
HETATM 9286 O O   . HOH I 4 .   ? 6.969   -29.925 89.028  1.00 52.12  ? 2076 HOH C O   1 
HETATM 9287 O O   . HOH I 4 .   ? 4.816   -35.017 101.587 1.00 57.66  ? 2077 HOH C O   1 
HETATM 9288 O O   . HOH J 4 .   ? -9.208  34.849  102.649 1.00 50.25  ? 2001 HOH D O   1 
HETATM 9289 O O   . HOH J 4 .   ? -3.721  33.854  106.827 1.00 38.10  ? 2002 HOH D O   1 
HETATM 9290 O O   . HOH J 4 .   ? -7.703  32.509  103.264 1.00 62.11  ? 2003 HOH D O   1 
HETATM 9291 O O   . HOH J 4 .   ? 15.633  13.310  116.337 1.00 56.67  ? 2004 HOH D O   1 
HETATM 9292 O O   . HOH J 4 .   ? 12.577  5.190   122.115 1.00 54.63  ? 2005 HOH D O   1 
HETATM 9293 O O   . HOH J 4 .   ? 10.306  7.708   124.640 1.00 43.28  ? 2006 HOH D O   1 
HETATM 9294 O O   . HOH J 4 .   ? 5.004   21.553  105.270 1.00 38.11  ? 2007 HOH D O   1 
HETATM 9295 O O   . HOH J 4 .   ? -3.066  13.773  99.810  1.00 59.17  ? 2008 HOH D O   1 
HETATM 9296 O O   . HOH J 4 .   ? -12.875 21.974  101.559 1.00 42.66  ? 2009 HOH D O   1 
HETATM 9297 O O   . HOH J 4 .   ? 0.717   19.231  126.798 1.00 57.24  ? 2010 HOH D O   1 
HETATM 9298 O O   . HOH J 4 .   ? 0.223   32.991  109.343 1.00 60.19  ? 2011 HOH D O   1 
HETATM 9299 O O   . HOH J 4 .   ? 10.250  30.675  113.778 1.00 40.94  ? 2012 HOH D O   1 
HETATM 9300 O O   . HOH J 4 .   ? 27.302  16.697  88.103  1.00 59.73  ? 2013 HOH D O   1 
HETATM 9301 O O   . HOH J 4 .   ? 20.401  37.955  100.437 1.00 57.81  ? 2014 HOH D O   1 
HETATM 9302 O O   . HOH J 4 .   ? 18.851  -7.412  102.212 1.00 47.33  ? 2015 HOH D O   1 
HETATM 9303 O O   . HOH J 4 .   ? 0.006   8.258   99.514  1.00 46.12  ? 2016 HOH D O   1 
HETATM 9304 O O   . HOH J 4 .   ? 0.779   26.946  100.014 1.00 46.26  ? 2017 HOH D O   1 
HETATM 9305 O O   . HOH J 4 .   ? -3.454  29.180  97.119  1.00 39.01  ? 2018 HOH D O   1 
HETATM 9306 O O   . HOH J 4 .   ? -17.093 27.882  113.204 1.00 57.78  ? 2019 HOH D O   1 
HETATM 9307 O O   . HOH J 4 .   ? -5.162  31.414  103.279 1.00 56.29  ? 2020 HOH D O   1 
HETATM 9308 O O   . HOH J 4 .   ? -5.256  31.829  106.145 1.00 69.84  ? 2021 HOH D O   1 
HETATM 9309 O O   . HOH J 4 .   ? -5.085  32.780  114.570 1.00 37.51  ? 2022 HOH D O   1 
HETATM 9310 O O   . HOH J 4 .   ? 16.095  10.283  116.623 1.00 46.61  ? 2023 HOH D O   1 
HETATM 9311 O O   . HOH J 4 .   ? 11.031  8.325   121.384 1.00 41.24  ? 2024 HOH D O   1 
HETATM 9312 O O   . HOH J 4 .   ? 14.032  13.320  118.316 1.00 51.32  ? 2025 HOH D O   1 
HETATM 9313 O O   . HOH J 4 .   ? 3.376   18.956  105.588 1.00 55.35  ? 2026 HOH D O   1 
HETATM 9314 O O   . HOH J 4 .   ? -6.039  15.027  100.299 1.00 65.42  ? 2027 HOH D O   1 
HETATM 9315 O O   . HOH J 4 .   ? -10.563 21.797  101.985 1.00 62.48  ? 2028 HOH D O   1 
HETATM 9316 O O   . HOH J 4 .   ? -8.425  21.175  101.014 1.00 73.30  ? 2029 HOH D O   1 
HETATM 9317 O O   . HOH J 4 .   ? -14.769 16.220  102.041 1.00 36.21  ? 2030 HOH D O   1 
HETATM 9318 O O   . HOH J 4 .   ? -14.739 31.040  117.030 1.00 76.50  ? 2031 HOH D O   1 
HETATM 9319 O O   . HOH J 4 .   ? -9.467  23.708  118.044 1.00 40.92  ? 2032 HOH D O   1 
HETATM 9320 O O   . HOH J 4 .   ? -16.163 26.353  115.951 1.00 39.03  ? 2033 HOH D O   1 
HETATM 9321 O O   . HOH J 4 .   ? -16.005 20.626  120.807 1.00 41.26  ? 2034 HOH D O   1 
HETATM 9322 O O   . HOH J 4 .   ? -9.808  24.262  120.568 1.00 43.40  ? 2035 HOH D O   1 
HETATM 9323 O O   . HOH J 4 .   ? -4.636  23.717  119.836 1.00 32.56  ? 2036 HOH D O   1 
HETATM 9324 O O   . HOH J 4 .   ? 8.356   6.524   122.686 1.00 50.65  ? 2037 HOH D O   1 
HETATM 9325 O O   . HOH J 4 .   ? 7.786   7.516   124.930 1.00 56.81  ? 2038 HOH D O   1 
HETATM 9326 O O   . HOH J 4 .   ? -1.227  21.122  126.696 1.00 56.91  ? 2039 HOH D O   1 
HETATM 9327 O O   . HOH J 4 .   ? -9.585  8.858   129.677 1.00 46.67  ? 2040 HOH D O   1 
HETATM 9328 O O   . HOH J 4 .   ? -10.293 5.072   117.184 1.00 45.23  ? 2041 HOH D O   1 
HETATM 9329 O O   . HOH J 4 .   ? 0.709   3.458   101.049 1.00 47.46  ? 2042 HOH D O   1 
HETATM 9330 O O   . HOH J 4 .   ? -0.244  6.975   97.481  1.00 54.49  ? 2043 HOH D O   1 
HETATM 9331 O O   . HOH J 4 .   ? 1.266   3.955   104.082 1.00 43.10  ? 2044 HOH D O   1 
HETATM 9332 O O   . HOH J 4 .   ? 8.115   16.742  107.233 1.00 37.90  ? 2045 HOH D O   1 
HETATM 9333 O O   . HOH J 4 .   ? 15.220  8.055   105.906 1.00 49.11  ? 2046 HOH D O   1 
HETATM 9334 O O   . HOH J 4 .   ? 30.380  17.897  105.448 1.00 64.01  ? 2047 HOH D O   1 
HETATM 9335 O O   . HOH J 4 .   ? 31.950  18.835  110.338 1.00 65.64  ? 2048 HOH D O   1 
HETATM 9336 O O   . HOH J 4 .   ? 12.834  18.352  112.879 1.00 46.31  ? 2049 HOH D O   1 
HETATM 9337 O O   . HOH J 4 .   ? 7.784   21.283  106.715 1.00 40.20  ? 2050 HOH D O   1 
HETATM 9338 O O   . HOH J 4 .   ? 0.510   27.651  109.143 1.00 42.33  ? 2051 HOH D O   1 
HETATM 9339 O O   . HOH J 4 .   ? 7.869   29.389  112.010 1.00 52.06  ? 2052 HOH D O   1 
HETATM 9340 O O   . HOH J 4 .   ? 2.191   30.739  109.038 1.00 72.41  ? 2053 HOH D O   1 
HETATM 9341 O O   . HOH J 4 .   ? 0.988   23.770  99.104  1.00 52.21  ? 2054 HOH D O   1 
HETATM 9342 O O   . HOH J 4 .   ? 34.385  21.766  103.302 1.00 64.27  ? 2055 HOH D O   1 
HETATM 9343 O O   . HOH J 4 .   ? 27.352  23.938  97.152  1.00 66.71  ? 2056 HOH D O   1 
HETATM 9344 O O   . HOH J 4 .   ? 29.480  14.977  88.879  1.00 44.09  ? 2057 HOH D O   1 
HETATM 9345 O O   . HOH J 4 .   ? 17.386  20.922  89.873  1.00 56.43  ? 2058 HOH D O   1 
HETATM 9346 O O   . HOH J 4 .   ? 10.206  33.078  103.677 1.00 57.64  ? 2059 HOH D O   1 
HETATM 9347 O O   . HOH J 4 .   ? 4.622   29.397  120.944 1.00 44.64  ? 2060 HOH D O   1 
HETATM 9348 O O   . HOH J 4 .   ? 14.915  35.336  124.196 1.00 66.91  ? 2061 HOH D O   1 
HETATM 9349 O O   . HOH J 4 .   ? 20.002  29.701  116.168 1.00 45.01  ? 2062 HOH D O   1 
HETATM 9350 O O   . HOH J 4 .   ? 26.469  31.801  113.086 1.00 74.72  ? 2063 HOH D O   1 
HETATM 9351 O O   . HOH J 4 .   ? 21.135  37.507  115.273 1.00 53.07  ? 2064 HOH D O   1 
HETATM 9352 O O   . HOH J 4 .   ? 22.408  37.427  112.365 1.00 60.80  ? 2065 HOH D O   1 
HETATM 9353 O O   . HOH J 4 .   ? 27.491  36.703  106.864 1.00 41.27  ? 2066 HOH D O   1 
HETATM 9354 O O   . HOH J 4 .   ? 26.165  30.267  101.671 1.00 64.93  ? 2067 HOH D O   1 
HETATM 9355 O O   . HOH J 4 .   ? 22.479  35.655  99.382  1.00 74.36  ? 2068 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   GLU 3   2   2   GLU GLU A . n 
A 1 4   ASN 4   3   3   ASN ASN A . n 
A 1 5   PHE 5   4   4   PHE PHE A . n 
A 1 6   GLN 6   5   5   GLN GLN A . n 
A 1 7   LYS 7   6   6   LYS LYS A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   GLU 9   8   8   GLU GLU A . n 
A 1 10  LYS 10  9   9   LYS LYS A . n 
A 1 11  ILE 11  10  10  ILE ILE A . n 
A 1 12  GLY 12  11  11  GLY GLY A . n 
A 1 13  GLU 13  12  12  GLU GLU A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  THR 15  14  14  THR THR A . n 
A 1 16  TYR 16  15  15  TYR TYR A . n 
A 1 17  GLY 17  16  16  GLY GLY A . n 
A 1 18  VAL 18  17  17  VAL VAL A . n 
A 1 19  VAL 19  18  18  VAL VAL A . n 
A 1 20  TYR 20  19  19  TYR TYR A . n 
A 1 21  LYS 21  20  20  LYS LYS A . n 
A 1 22  ALA 22  21  21  ALA ALA A . n 
A 1 23  ARG 23  22  22  ARG ARG A . n 
A 1 24  ASN 24  23  23  ASN ASN A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  LEU 26  25  25  LEU LEU A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  GLY 28  27  27  GLY GLY A . n 
A 1 29  GLU 29  28  28  GLU GLU A . n 
A 1 30  VAL 30  29  29  VAL VAL A . n 
A 1 31  VAL 31  30  30  VAL VAL A . n 
A 1 32  ALA 32  31  31  ALA ALA A . n 
A 1 33  LEU 33  32  32  LEU LEU A . n 
A 1 34  LYS 34  33  33  LYS LYS A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  ILE 36  35  35  ILE ILE A . n 
A 1 37  ARG 37  36  36  ARG ARG A . n 
A 1 38  LEU 38  37  37  LEU LEU A . n 
A 1 39  ASP 39  38  38  ASP ASP A . n 
A 1 40  THR 40  39  39  THR THR A . n 
A 1 41  GLU 41  40  40  GLU GLU A . n 
A 1 42  THR 42  41  41  THR THR A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  VAL 45  44  44  VAL VAL A . n 
A 1 46  PRO 46  45  45  PRO PRO A . n 
A 1 47  SER 47  46  46  SER SER A . n 
A 1 48  THR 48  47  47  THR THR A . n 
A 1 49  ALA 49  48  48  ALA ALA A . n 
A 1 50  ILE 50  49  49  ILE ILE A . n 
A 1 51  ARG 51  50  50  ARG ARG A . n 
A 1 52  GLU 52  51  51  GLU GLU A . n 
A 1 53  ILE 53  52  52  ILE ILE A . n 
A 1 54  SER 54  53  53  SER SER A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  LEU 56  55  55  LEU LEU A . n 
A 1 57  LYS 57  56  56  LYS LYS A . n 
A 1 58  GLU 58  57  57  GLU GLU A . n 
A 1 59  LEU 59  58  58  LEU LEU A . n 
A 1 60  ASN 60  59  59  ASN ASN A . n 
A 1 61  HIS 61  60  60  HIS HIS A . n 
A 1 62  PRO 62  61  61  PRO PRO A . n 
A 1 63  ASN 63  62  62  ASN ASN A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  LYS 66  65  65  LYS LYS A . n 
A 1 67  LEU 67  66  66  LEU LEU A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  ASP 69  68  68  ASP ASP A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  ILE 71  70  70  ILE ILE A . n 
A 1 72  HIS 72  71  71  HIS HIS A . n 
A 1 73  THR 73  72  72  THR THR A . n 
A 1 74  GLU 74  73  73  GLU GLU A . n 
A 1 75  ASN 75  74  74  ASN ASN A . n 
A 1 76  LYS 76  75  75  LYS LYS A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  TYR 78  77  77  TYR TYR A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  VAL 80  79  79  VAL VAL A . n 
A 1 81  PHE 81  80  80  PHE PHE A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  PHE 83  82  82  PHE PHE A . n 
A 1 84  LEU 84  83  83  LEU LEU A . n 
A 1 85  HIS 85  84  84  HIS HIS A . n 
A 1 86  GLN 86  85  85  GLN GLN A . n 
A 1 87  ASP 87  86  86  ASP ASP A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  LYS 89  88  88  LYS LYS A . n 
A 1 90  LYS 90  89  89  LYS LYS A . n 
A 1 91  PHE 91  90  90  PHE PHE A . n 
A 1 92  MET 92  91  91  MET MET A . n 
A 1 93  ASP 93  92  92  ASP ASP A . n 
A 1 94  ALA 94  93  93  ALA ALA A . n 
A 1 95  SER 95  94  94  SER SER A . n 
A 1 96  ALA 96  95  95  ALA ALA A . n 
A 1 97  LEU 97  96  96  LEU LEU A . n 
A 1 98  THR 98  97  97  THR THR A . n 
A 1 99  GLY 99  98  98  GLY GLY A . n 
A 1 100 ILE 100 99  99  ILE ILE A . n 
A 1 101 PRO 101 100 100 PRO PRO A . n 
A 1 102 LEU 102 101 101 LEU LEU A . n 
A 1 103 PRO 103 102 102 PRO PRO A . n 
A 1 104 LEU 104 103 103 LEU LEU A . n 
A 1 105 ILE 105 104 104 ILE ILE A . n 
A 1 106 LYS 106 105 105 LYS LYS A . n 
A 1 107 SER 107 106 106 SER SER A . n 
A 1 108 TYR 108 107 107 TYR TYR A . n 
A 1 109 LEU 109 108 108 LEU LEU A . n 
A 1 110 PHE 110 109 109 PHE PHE A . n 
A 1 111 GLN 111 110 110 GLN GLN A . n 
A 1 112 LEU 112 111 111 LEU LEU A . n 
A 1 113 LEU 113 112 112 LEU LEU A . n 
A 1 114 GLN 114 113 113 GLN GLN A . n 
A 1 115 GLY 115 114 114 GLY GLY A . n 
A 1 116 LEU 116 115 115 LEU LEU A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 PHE 118 117 117 PHE PHE A . n 
A 1 119 CYS 119 118 118 CYS CYS A . n 
A 1 120 HIS 120 119 119 HIS HIS A . n 
A 1 121 SER 121 120 120 SER SER A . n 
A 1 122 HIS 122 121 121 HIS HIS A . n 
A 1 123 ARG 123 122 122 ARG ARG A . n 
A 1 124 VAL 124 123 123 VAL VAL A . n 
A 1 125 LEU 125 124 124 LEU LEU A . n 
A 1 126 HIS 126 125 125 HIS HIS A . n 
A 1 127 ARG 127 126 126 ARG ARG A . n 
A 1 128 ASP 128 127 127 ASP ASP A . n 
A 1 129 LEU 129 128 128 LEU LEU A . n 
A 1 130 LYS 130 129 129 LYS LYS A . n 
A 1 131 PRO 131 130 130 PRO PRO A . n 
A 1 132 GLN 132 131 131 GLN GLN A . n 
A 1 133 ASN 133 132 132 ASN ASN A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 LEU 135 134 134 LEU LEU A . n 
A 1 136 ILE 136 135 135 ILE ILE A . n 
A 1 137 ASN 137 136 136 ASN ASN A . n 
A 1 138 THR 138 137 137 THR THR A . n 
A 1 139 GLU 139 138 138 GLU GLU A . n 
A 1 140 GLY 140 139 139 GLY GLY A . n 
A 1 141 ALA 141 140 140 ALA ALA A . n 
A 1 142 ILE 142 141 141 ILE ILE A . n 
A 1 143 LYS 143 142 142 LYS LYS A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 ALA 145 144 144 ALA ALA A . n 
A 1 146 ASP 146 145 145 ASP ASP A . n 
A 1 147 PHE 147 146 146 PHE PHE A . n 
A 1 148 GLY 148 147 147 GLY GLY A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 ARG 151 150 150 ARG ARG A . n 
A 1 152 ALA 152 151 151 ALA ALA A . n 
A 1 153 PHE 153 152 152 PHE PHE A . n 
A 1 154 GLY 154 153 153 GLY GLY A . n 
A 1 155 VAL 155 154 154 VAL VAL A . n 
A 1 156 PRO 156 155 155 PRO PRO A . n 
A 1 157 VAL 157 156 156 VAL VAL A . n 
A 1 158 ARG 158 157 157 ARG ARG A . n 
A 1 159 THR 159 158 158 THR THR A . n 
A 1 160 TYR 160 159 159 TYR TYR A . n 
A 1 161 TPO 161 160 160 TPO TPO A . n 
A 1 162 HIS 162 161 161 HIS HIS A . n 
A 1 163 GLU 163 162 162 GLU GLU A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 VAL 165 164 164 VAL VAL A . n 
A 1 166 THR 166 165 165 THR THR A . n 
A 1 167 LEU 167 166 166 LEU LEU A . n 
A 1 168 TRP 168 167 167 TRP TRP A . n 
A 1 169 TYR 169 168 168 TYR TYR A . n 
A 1 170 ARG 170 169 169 ARG ARG A . n 
A 1 171 ALA 171 170 170 ALA ALA A . n 
A 1 172 PRO 172 171 171 PRO PRO A . n 
A 1 173 GLU 173 172 172 GLU GLU A . n 
A 1 174 ILE 174 173 173 ILE ILE A . n 
A 1 175 LEU 175 174 174 LEU LEU A . n 
A 1 176 LEU 176 175 175 LEU LEU A . n 
A 1 177 GLY 177 176 176 GLY GLY A . n 
A 1 178 CYS 178 177 177 CYS CYS A . n 
A 1 179 LYS 179 178 178 LYS LYS A . n 
A 1 180 TYR 180 179 179 TYR TYR A . n 
A 1 181 TYR 181 180 180 TYR TYR A . n 
A 1 182 SER 182 181 181 SER SER A . n 
A 1 183 THR 183 182 182 THR THR A . n 
A 1 184 ALA 184 183 183 ALA ALA A . n 
A 1 185 VAL 185 184 184 VAL VAL A . n 
A 1 186 ASP 186 185 185 ASP ASP A . n 
A 1 187 ILE 187 186 186 ILE ILE A . n 
A 1 188 TRP 188 187 187 TRP TRP A . n 
A 1 189 SER 189 188 188 SER SER A . n 
A 1 190 LEU 190 189 189 LEU LEU A . n 
A 1 191 GLY 191 190 190 GLY GLY A . n 
A 1 192 CYS 192 191 191 CYS CYS A . n 
A 1 193 ILE 193 192 192 ILE ILE A . n 
A 1 194 PHE 194 193 193 PHE PHE A . n 
A 1 195 ALA 195 194 194 ALA ALA A . n 
A 1 196 GLU 196 195 195 GLU GLU A . n 
A 1 197 MET 197 196 196 MET MET A . n 
A 1 198 VAL 198 197 197 VAL VAL A . n 
A 1 199 THR 199 198 198 THR THR A . n 
A 1 200 ARG 200 199 199 ARG ARG A . n 
A 1 201 ARG 201 200 200 ARG ARG A . n 
A 1 202 ALA 202 201 201 ALA ALA A . n 
A 1 203 LEU 203 202 202 LEU LEU A . n 
A 1 204 PHE 204 203 203 PHE PHE A . n 
A 1 205 PRO 205 204 204 PRO PRO A . n 
A 1 206 GLY 206 205 205 GLY GLY A . n 
A 1 207 ASP 207 206 206 ASP ASP A . n 
A 1 208 SER 208 207 207 SER SER A . n 
A 1 209 GLU 209 208 208 GLU GLU A . n 
A 1 210 ILE 210 209 209 ILE ILE A . n 
A 1 211 ASP 211 210 210 ASP ASP A . n 
A 1 212 GLN 212 211 211 GLN GLN A . n 
A 1 213 LEU 213 212 212 LEU LEU A . n 
A 1 214 PHE 214 213 213 PHE PHE A . n 
A 1 215 ARG 215 214 214 ARG ARG A . n 
A 1 216 ILE 216 215 215 ILE ILE A . n 
A 1 217 PHE 217 216 216 PHE PHE A . n 
A 1 218 ARG 218 217 217 ARG ARG A . n 
A 1 219 THR 219 218 218 THR THR A . n 
A 1 220 LEU 220 219 219 LEU LEU A . n 
A 1 221 GLY 221 220 220 GLY GLY A . n 
A 1 222 THR 222 221 221 THR THR A . n 
A 1 223 PRO 223 222 222 PRO PRO A . n 
A 1 224 ASP 224 223 223 ASP ASP A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 VAL 226 225 225 VAL VAL A . n 
A 1 227 VAL 227 226 226 VAL VAL A . n 
A 1 228 TRP 228 227 227 TRP TRP A . n 
A 1 229 PRO 229 228 228 PRO PRO A . n 
A 1 230 GLY 230 229 229 GLY GLY A . n 
A 1 231 VAL 231 230 230 VAL VAL A . n 
A 1 232 THR 232 231 231 THR THR A . n 
A 1 233 SER 233 232 232 SER SER A . n 
A 1 234 MET 234 233 233 MET MET A . n 
A 1 235 PRO 235 234 234 PRO PRO A . n 
A 1 236 ASP 236 235 235 ASP ASP A . n 
A 1 237 TYR 237 236 236 TYR TYR A . n 
A 1 238 LYS 238 237 237 LYS LYS A . n 
A 1 239 PRO 239 238 238 PRO PRO A . n 
A 1 240 SER 240 239 239 SER SER A . n 
A 1 241 PHE 241 240 240 PHE PHE A . n 
A 1 242 PRO 242 241 241 PRO PRO A . n 
A 1 243 LYS 243 242 242 LYS LYS A . n 
A 1 244 TRP 244 243 243 TRP TRP A . n 
A 1 245 ALA 245 244 244 ALA ALA A . n 
A 1 246 ARG 246 245 245 ARG ARG A . n 
A 1 247 GLN 247 246 246 GLN GLN A . n 
A 1 248 ASP 248 247 247 ASP ASP A . n 
A 1 249 PHE 249 248 248 PHE PHE A . n 
A 1 250 SER 250 249 249 SER SER A . n 
A 1 251 LYS 251 250 250 LYS LYS A . n 
A 1 252 VAL 252 251 251 VAL VAL A . n 
A 1 253 VAL 253 252 252 VAL VAL A . n 
A 1 254 PRO 254 253 253 PRO PRO A . n 
A 1 255 PRO 255 254 254 PRO PRO A . n 
A 1 256 LEU 256 255 255 LEU LEU A . n 
A 1 257 ASP 257 256 256 ASP ASP A . n 
A 1 258 GLU 258 257 257 GLU GLU A . n 
A 1 259 ASP 259 258 258 ASP ASP A . n 
A 1 260 GLY 260 259 259 GLY GLY A . n 
A 1 261 ARG 261 260 260 ARG ARG A . n 
A 1 262 SER 262 261 261 SER SER A . n 
A 1 263 LEU 263 262 262 LEU LEU A . n 
A 1 264 LEU 264 263 263 LEU LEU A . n 
A 1 265 SER 265 264 264 SER SER A . n 
A 1 266 GLN 266 265 265 GLN GLN A . n 
A 1 267 MET 267 266 266 MET MET A . n 
A 1 268 LEU 268 267 267 LEU LEU A . n 
A 1 269 HIS 269 268 268 HIS HIS A . n 
A 1 270 TYR 270 269 269 TYR TYR A . n 
A 1 271 ASP 271 270 270 ASP ASP A . n 
A 1 272 PRO 272 271 271 PRO PRO A . n 
A 1 273 ASN 273 272 272 ASN ASN A . n 
A 1 274 LYS 274 273 273 LYS LYS A . n 
A 1 275 ARG 275 274 274 ARG ARG A . n 
A 1 276 ILE 276 275 275 ILE ILE A . n 
A 1 277 SER 277 276 276 SER SER A . n 
A 1 278 ALA 278 277 277 ALA ALA A . n 
A 1 279 LYS 279 278 278 LYS LYS A . n 
A 1 280 ALA 280 279 279 ALA ALA A . n 
A 1 281 ALA 281 280 280 ALA ALA A . n 
A 1 282 LEU 282 281 281 LEU LEU A . n 
A 1 283 ALA 283 282 282 ALA ALA A . n 
A 1 284 HIS 284 283 283 HIS HIS A . n 
A 1 285 PRO 285 284 284 PRO PRO A . n 
A 1 286 PHE 286 285 285 PHE PHE A . n 
A 1 287 PHE 287 286 286 PHE PHE A . n 
A 1 288 GLN 288 287 287 GLN GLN A . n 
A 1 289 ASP 289 288 288 ASP ASP A . n 
A 1 290 VAL 290 289 289 VAL VAL A . n 
A 1 291 THR 291 290 290 THR THR A . n 
A 1 292 LYS 292 291 291 LYS LYS A . n 
A 1 293 PRO 293 292 292 PRO PRO A . n 
A 1 294 VAL 294 293 293 VAL VAL A . n 
A 1 295 PRO 295 294 294 PRO PRO A . n 
A 1 296 HIS 296 295 295 HIS HIS A . n 
A 1 297 LEU 297 296 296 LEU LEU A . n 
B 2 1   VAL 1   175 175 VAL VAL B . n 
B 2 2   PRO 2   176 176 PRO PRO B . n 
B 2 3   ASP 3   177 177 ASP ASP B . n 
B 2 4   TYR 4   178 178 TYR TYR B . n 
B 2 5   HIS 5   179 179 HIS HIS B . n 
B 2 6   GLU 6   180 180 GLU GLU B . n 
B 2 7   ASP 7   181 181 ASP ASP B . n 
B 2 8   ILE 8   182 182 ILE ILE B . n 
B 2 9   HIS 9   183 183 HIS HIS B . n 
B 2 10  THR 10  184 184 THR THR B . n 
B 2 11  TYR 11  185 185 TYR TYR B . n 
B 2 12  LEU 12  186 186 LEU LEU B . n 
B 2 13  ARG 13  187 187 ARG ARG B . n 
B 2 14  GLU 14  188 188 GLU GLU B . n 
B 2 15  MET 15  189 189 MET MET B . n 
B 2 16  GLU 16  190 190 GLU GLU B . n 
B 2 17  VAL 17  191 191 VAL VAL B . n 
B 2 18  LYS 18  192 192 LYS LYS B . n 
B 2 19  CYS 19  193 193 CYS CYS B . n 
B 2 20  LYS 20  194 194 LYS LYS B . n 
B 2 21  PRO 21  195 195 PRO PRO B . n 
B 2 22  LYS 22  196 196 LYS LYS B . n 
B 2 23  VAL 23  197 197 VAL VAL B . n 
B 2 24  GLY 24  198 198 GLY GLY B . n 
B 2 25  TYR 25  199 199 TYR TYR B . n 
B 2 26  MET 26  200 200 MET MET B . n 
B 2 27  LYS 27  201 201 LYS LYS B . n 
B 2 28  LYS 28  202 202 LYS LYS B . n 
B 2 29  GLN 29  203 203 GLN GLN B . n 
B 2 30  PRO 30  204 204 PRO PRO B . n 
B 2 31  ASP 31  205 205 ASP ASP B . n 
B 2 32  ILE 32  206 206 ILE ILE B . n 
B 2 33  THR 33  207 207 THR THR B . n 
B 2 34  ASN 34  208 208 ASN ASN B . n 
B 2 35  SER 35  209 209 SER SER B . n 
B 2 36  MET 36  210 210 MET MET B . n 
B 2 37  ARG 37  211 211 ARG ARG B . n 
B 2 38  ALA 38  212 212 ALA ALA B . n 
B 2 39  ILE 39  213 213 ILE ILE B . n 
B 2 40  LEU 40  214 214 LEU LEU B . n 
B 2 41  VAL 41  215 215 VAL VAL B . n 
B 2 42  ASP 42  216 216 ASP ASP B . n 
B 2 43  TRP 43  217 217 TRP TRP B . n 
B 2 44  LEU 44  218 218 LEU LEU B . n 
B 2 45  VAL 45  219 219 VAL VAL B . n 
B 2 46  GLU 46  220 220 GLU GLU B . n 
B 2 47  VAL 47  221 221 VAL VAL B . n 
B 2 48  GLY 48  222 222 GLY GLY B . n 
B 2 49  GLU 49  223 223 GLU GLU B . n 
B 2 50  GLU 50  224 224 GLU GLU B . n 
B 2 51  TYR 51  225 225 TYR TYR B . n 
B 2 52  LYS 52  226 226 LYS LYS B . n 
B 2 53  LEU 53  227 227 LEU LEU B . n 
B 2 54  GLN 54  228 228 GLN GLN B . n 
B 2 55  ASN 55  229 229 ASN ASN B . n 
B 2 56  GLU 56  230 230 GLU GLU B . n 
B 2 57  THR 57  231 231 THR THR B . n 
B 2 58  LEU 58  232 232 LEU LEU B . n 
B 2 59  HIS 59  233 233 HIS HIS B . n 
B 2 60  LEU 60  234 234 LEU LEU B . n 
B 2 61  ALA 61  235 235 ALA ALA B . n 
B 2 62  VAL 62  236 236 VAL VAL B . n 
B 2 63  ASN 63  237 237 ASN ASN B . n 
B 2 64  TYR 64  238 238 TYR TYR B . n 
B 2 65  ILE 65  239 239 ILE ILE B . n 
B 2 66  ASP 66  240 240 ASP ASP B . n 
B 2 67  ARG 67  241 241 ARG ARG B . n 
B 2 68  PHE 68  242 242 PHE PHE B . n 
B 2 69  LEU 69  243 243 LEU LEU B . n 
B 2 70  SER 70  244 244 SER SER B . n 
B 2 71  SER 71  245 245 SER SER B . n 
B 2 72  MET 72  246 246 MET MET B . n 
B 2 73  SER 73  247 247 SER SER B . n 
B 2 74  VAL 74  248 248 VAL VAL B . n 
B 2 75  LEU 75  249 249 LEU LEU B . n 
B 2 76  ARG 76  250 250 ARG ARG B . n 
B 2 77  GLY 77  251 251 GLY GLY B . n 
B 2 78  LYS 78  252 252 LYS LYS B . n 
B 2 79  LEU 79  253 253 LEU LEU B . n 
B 2 80  GLN 80  254 254 GLN GLN B . n 
B 2 81  LEU 81  255 255 LEU LEU B . n 
B 2 82  VAL 82  256 256 VAL VAL B . n 
B 2 83  GLY 83  257 257 GLY GLY B . n 
B 2 84  THR 84  258 258 THR THR B . n 
B 2 85  ALA 85  259 259 ALA ALA B . n 
B 2 86  ALA 86  260 260 ALA ALA B . n 
B 2 87  MET 87  261 261 MET MET B . n 
B 2 88  LEU 88  262 262 LEU LEU B . n 
B 2 89  LEU 89  263 263 LEU LEU B . n 
B 2 90  ALA 90  264 264 ALA ALA B . n 
B 2 91  SER 91  265 265 SER SER B . n 
B 2 92  LYS 92  266 266 LYS LYS B . n 
B 2 93  PHE 93  267 267 PHE PHE B . n 
B 2 94  GLU 94  268 268 GLU GLU B . n 
B 2 95  GLU 95  269 269 GLU GLU B . n 
B 2 96  ILE 96  270 270 ILE ILE B . n 
B 2 97  TYR 97  271 271 TYR TYR B . n 
B 2 98  PRO 98  272 272 PRO PRO B . n 
B 2 99  PRO 99  273 273 PRO PRO B . n 
B 2 100 GLU 100 274 274 GLU GLU B . n 
B 2 101 VAL 101 275 275 VAL VAL B . n 
B 2 102 ALA 102 276 276 ALA ALA B . n 
B 2 103 GLU 103 277 277 GLU GLU B . n 
B 2 104 PHE 104 278 278 PHE PHE B . n 
B 2 105 VAL 105 279 279 VAL VAL B . n 
B 2 106 TYR 106 280 280 TYR TYR B . n 
B 2 107 ILE 107 281 281 ILE ILE B . n 
B 2 108 THR 108 282 282 THR THR B . n 
B 2 109 ASP 109 283 283 ASP ASP B . n 
B 2 110 ASP 110 284 284 ASP ASP B . n 
B 2 111 THR 111 285 285 THR THR B . n 
B 2 112 TYR 112 286 286 TYR TYR B . n 
B 2 113 THR 113 287 287 THR THR B . n 
B 2 114 LYS 114 288 288 LYS LYS B . n 
B 2 115 LYS 115 289 289 LYS LYS B . n 
B 2 116 GLN 116 290 290 GLN GLN B . n 
B 2 117 VAL 117 291 291 VAL VAL B . n 
B 2 118 LEU 118 292 292 LEU LEU B . n 
B 2 119 ARG 119 293 293 ARG ARG B . n 
B 2 120 MET 120 294 294 MET MET B . n 
B 2 121 GLU 121 295 295 GLU GLU B . n 
B 2 122 HIS 122 296 296 HIS HIS B . n 
B 2 123 LEU 123 297 297 LEU LEU B . n 
B 2 124 VAL 124 298 298 VAL VAL B . n 
B 2 125 LEU 125 299 299 LEU LEU B . n 
B 2 126 LYS 126 300 300 LYS LYS B . n 
B 2 127 VAL 127 301 301 VAL VAL B . n 
B 2 128 LEU 128 302 302 LEU LEU B . n 
B 2 129 THR 129 303 303 THR THR B . n 
B 2 130 PHE 130 304 304 PHE PHE B . n 
B 2 131 ASP 131 305 305 ASP ASP B . n 
B 2 132 LEU 132 306 306 LEU LEU B . n 
B 2 133 ALA 133 307 307 ALA ALA B . n 
B 2 134 ALA 134 308 308 ALA ALA B . n 
B 2 135 PRO 135 309 309 PRO PRO B . n 
B 2 136 THR 136 310 310 THR THR B . n 
B 2 137 VAL 137 311 311 VAL VAL B . n 
B 2 138 ASN 138 312 312 ASN ASN B . n 
B 2 139 GLN 139 313 313 GLN GLN B . n 
B 2 140 PHE 140 314 314 PHE PHE B . n 
B 2 141 LEU 141 315 315 LEU LEU B . n 
B 2 142 THR 142 316 316 THR THR B . n 
B 2 143 GLN 143 317 317 GLN GLN B . n 
B 2 144 TYR 144 318 318 TYR TYR B . n 
B 2 145 PHE 145 319 319 PHE PHE B . n 
B 2 146 LEU 146 320 320 LEU LEU B . n 
B 2 147 HIS 147 321 321 HIS HIS B . n 
B 2 148 GLN 148 322 322 GLN GLN B . n 
B 2 149 GLN 149 323 323 GLN GLN B . n 
B 2 150 PRO 150 324 324 PRO PRO B . n 
B 2 151 ALA 151 325 325 ALA ALA B . n 
B 2 152 ASN 152 326 326 ASN ASN B . n 
B 2 153 CYS 153 327 327 CYS CYS B . n 
B 2 154 LYS 154 328 328 LYS LYS B . n 
B 2 155 VAL 155 329 329 VAL VAL B . n 
B 2 156 GLU 156 330 330 GLU GLU B . n 
B 2 157 SER 157 331 331 SER SER B . n 
B 2 158 LEU 158 332 332 LEU LEU B . n 
B 2 159 ALA 159 333 333 ALA ALA B . n 
B 2 160 MET 160 334 334 MET MET B . n 
B 2 161 PHE 161 335 335 PHE PHE B . n 
B 2 162 LEU 162 336 336 LEU LEU B . n 
B 2 163 GLY 163 337 337 GLY GLY B . n 
B 2 164 GLU 164 338 338 GLU GLU B . n 
B 2 165 LEU 165 339 339 LEU LEU B . n 
B 2 166 SER 166 340 340 SER SER B . n 
B 2 167 LEU 167 341 341 LEU LEU B . n 
B 2 168 ILE 168 342 342 ILE ILE B . n 
B 2 169 ASP 169 343 343 ASP ASP B . n 
B 2 170 ALA 170 344 344 ALA ALA B . n 
B 2 171 ASP 171 345 345 ASP ASP B . n 
B 2 172 PRO 172 346 346 PRO PRO B . n 
B 2 173 TYR 173 347 347 TYR TYR B . n 
B 2 174 LEU 174 348 348 LEU LEU B . n 
B 2 175 LYS 175 349 349 LYS LYS B . n 
B 2 176 TYR 176 350 350 TYR TYR B . n 
B 2 177 LEU 177 351 351 LEU LEU B . n 
B 2 178 PRO 178 352 352 PRO PRO B . n 
B 2 179 SER 179 353 353 SER SER B . n 
B 2 180 VAL 180 354 354 VAL VAL B . n 
B 2 181 ILE 181 355 355 ILE ILE B . n 
B 2 182 ALA 182 356 356 ALA ALA B . n 
B 2 183 GLY 183 357 357 GLY GLY B . n 
B 2 184 ALA 184 358 358 ALA ALA B . n 
B 2 185 ALA 185 359 359 ALA ALA B . n 
B 2 186 PHE 186 360 360 PHE PHE B . n 
B 2 187 HIS 187 361 361 HIS HIS B . n 
B 2 188 LEU 188 362 362 LEU LEU B . n 
B 2 189 ALA 189 363 363 ALA ALA B . n 
B 2 190 LEU 190 364 364 LEU LEU B . n 
B 2 191 TYR 191 365 365 TYR TYR B . n 
B 2 192 THR 192 366 366 THR THR B . n 
B 2 193 VAL 193 367 367 VAL VAL B . n 
B 2 194 THR 194 368 368 THR THR B . n 
B 2 195 GLY 195 369 369 GLY GLY B . n 
B 2 196 GLN 196 370 370 GLN GLN B . n 
B 2 197 SER 197 371 371 SER SER B . n 
B 2 198 TRP 198 372 372 TRP TRP B . n 
B 2 199 PRO 199 373 373 PRO PRO B . n 
B 2 200 GLU 200 374 374 GLU GLU B . n 
B 2 201 SER 201 375 375 SER SER B . n 
B 2 202 LEU 202 376 376 LEU LEU B . n 
B 2 203 ILE 203 377 377 ILE ILE B . n 
B 2 204 ARG 204 378 378 ARG ARG B . n 
B 2 205 LYS 205 379 379 LYS LYS B . n 
B 2 206 THR 206 380 380 THR THR B . n 
B 2 207 GLY 207 381 381 GLY GLY B . n 
B 2 208 TYR 208 382 382 TYR TYR B . n 
B 2 209 THR 209 383 383 THR THR B . n 
B 2 210 LEU 210 384 384 LEU LEU B . n 
B 2 211 GLU 211 385 385 GLU GLU B . n 
B 2 212 SER 212 386 386 SER SER B . n 
B 2 213 LEU 213 387 387 LEU LEU B . n 
B 2 214 LYS 214 388 388 LYS LYS B . n 
B 2 215 PRO 215 389 389 PRO PRO B . n 
B 2 216 CYS 216 390 390 CYS CYS B . n 
B 2 217 LEU 217 391 391 LEU LEU B . n 
B 2 218 MET 218 392 392 MET MET B . n 
B 2 219 ASP 219 393 393 ASP ASP B . n 
B 2 220 LEU 220 394 394 LEU LEU B . n 
B 2 221 HIS 221 395 395 HIS HIS B . n 
B 2 222 GLN 222 396 396 GLN GLN B . n 
B 2 223 THR 223 397 397 THR THR B . n 
B 2 224 TYR 224 398 398 TYR TYR B . n 
B 2 225 LEU 225 399 399 LEU LEU B . n 
B 2 226 LYS 226 400 400 LYS LYS B . n 
B 2 227 ALA 227 401 401 ALA ALA B . n 
B 2 228 PRO 228 402 402 PRO PRO B . n 
B 2 229 GLN 229 403 403 GLN GLN B . n 
B 2 230 HIS 230 404 404 HIS HIS B . n 
B 2 231 ALA 231 405 405 ALA ALA B . n 
B 2 232 GLN 232 406 406 GLN GLN B . n 
B 2 233 GLN 233 407 407 GLN GLN B . n 
B 2 234 SER 234 408 408 SER SER B . n 
B 2 235 ILE 235 409 409 ILE ILE B . n 
B 2 236 ARG 236 410 410 ARG ARG B . n 
B 2 237 GLU 237 411 411 GLU GLU B . n 
B 2 238 LYS 238 412 412 LYS LYS B . n 
B 2 239 TYR 239 413 413 TYR TYR B . n 
B 2 240 LYS 240 414 414 LYS LYS B . n 
B 2 241 ASN 241 415 415 ASN ASN B . n 
B 2 242 SER 242 416 416 SER SER B . n 
B 2 243 LYS 243 417 417 LYS LYS B . n 
B 2 244 TYR 244 418 418 TYR TYR B . n 
B 2 245 HIS 245 419 419 HIS HIS B . n 
B 2 246 GLY 246 420 420 GLY GLY B . n 
B 2 247 VAL 247 421 421 VAL VAL B . n 
B 2 248 SER 248 422 422 SER SER B . n 
B 2 249 LEU 249 423 423 LEU LEU B . n 
B 2 250 LEU 250 424 424 LEU LEU B . n 
B 2 251 ASN 251 425 425 ASN ASN B . n 
B 2 252 PRO 252 426 426 PRO PRO B . n 
B 2 253 PRO 253 427 427 PRO PRO B . n 
B 2 254 GLU 254 428 428 GLU GLU B . n 
B 2 255 THR 255 429 429 THR THR B . n 
B 2 256 LEU 256 430 430 LEU LEU B . n 
B 2 257 ASN 257 431 431 ASN ASN B . n 
B 2 258 LEU 258 432 432 LEU LEU B . n 
B 2 259 LEU 259 433 ?   ?   ?   B . n 
B 2 260 ASN 260 434 ?   ?   ?   B . n 
B 2 261 LEU 261 435 ?   ?   ?   B . n 
C 1 1   SER 1   0   0   SER SER C . n 
C 1 2   MET 2   1   1   MET MET C . n 
C 1 3   GLU 3   2   2   GLU GLU C . n 
C 1 4   ASN 4   3   3   ASN ASN C . n 
C 1 5   PHE 5   4   4   PHE PHE C . n 
C 1 6   GLN 6   5   5   GLN GLN C . n 
C 1 7   LYS 7   6   6   LYS LYS C . n 
C 1 8   VAL 8   7   7   VAL VAL C . n 
C 1 9   GLU 9   8   8   GLU GLU C . n 
C 1 10  LYS 10  9   9   LYS LYS C . n 
C 1 11  ILE 11  10  10  ILE ILE C . n 
C 1 12  GLY 12  11  11  GLY GLY C . n 
C 1 13  GLU 13  12  12  GLU GLU C . n 
C 1 14  GLY 14  13  13  GLY GLY C . n 
C 1 15  THR 15  14  14  THR THR C . n 
C 1 16  TYR 16  15  15  TYR TYR C . n 
C 1 17  GLY 17  16  16  GLY GLY C . n 
C 1 18  VAL 18  17  17  VAL VAL C . n 
C 1 19  VAL 19  18  18  VAL VAL C . n 
C 1 20  TYR 20  19  19  TYR TYR C . n 
C 1 21  LYS 21  20  20  LYS LYS C . n 
C 1 22  ALA 22  21  21  ALA ALA C . n 
C 1 23  ARG 23  22  22  ARG ARG C . n 
C 1 24  ASN 24  23  23  ASN ASN C . n 
C 1 25  LYS 25  24  24  LYS LYS C . n 
C 1 26  LEU 26  25  25  LEU LEU C . n 
C 1 27  THR 27  26  26  THR THR C . n 
C 1 28  GLY 28  27  27  GLY GLY C . n 
C 1 29  GLU 29  28  28  GLU GLU C . n 
C 1 30  VAL 30  29  29  VAL VAL C . n 
C 1 31  VAL 31  30  30  VAL VAL C . n 
C 1 32  ALA 32  31  31  ALA ALA C . n 
C 1 33  LEU 33  32  32  LEU LEU C . n 
C 1 34  LYS 34  33  33  LYS LYS C . n 
C 1 35  LYS 35  34  34  LYS LYS C . n 
C 1 36  ILE 36  35  35  ILE ILE C . n 
C 1 37  ARG 37  36  36  ARG ARG C . n 
C 1 38  LEU 38  37  37  LEU LEU C . n 
C 1 39  ASP 39  38  38  ASP ASP C . n 
C 1 40  THR 40  39  39  THR THR C . n 
C 1 41  GLU 41  40  40  GLU GLU C . n 
C 1 42  THR 42  41  41  THR THR C . n 
C 1 43  GLU 43  42  42  GLU GLU C . n 
C 1 44  GLY 44  43  43  GLY GLY C . n 
C 1 45  VAL 45  44  44  VAL VAL C . n 
C 1 46  PRO 46  45  45  PRO PRO C . n 
C 1 47  SER 47  46  46  SER SER C . n 
C 1 48  THR 48  47  47  THR THR C . n 
C 1 49  ALA 49  48  48  ALA ALA C . n 
C 1 50  ILE 50  49  49  ILE ILE C . n 
C 1 51  ARG 51  50  50  ARG ARG C . n 
C 1 52  GLU 52  51  51  GLU GLU C . n 
C 1 53  ILE 53  52  52  ILE ILE C . n 
C 1 54  SER 54  53  53  SER SER C . n 
C 1 55  LEU 55  54  54  LEU LEU C . n 
C 1 56  LEU 56  55  55  LEU LEU C . n 
C 1 57  LYS 57  56  56  LYS LYS C . n 
C 1 58  GLU 58  57  57  GLU GLU C . n 
C 1 59  LEU 59  58  58  LEU LEU C . n 
C 1 60  ASN 60  59  59  ASN ASN C . n 
C 1 61  HIS 61  60  60  HIS HIS C . n 
C 1 62  PRO 62  61  61  PRO PRO C . n 
C 1 63  ASN 63  62  62  ASN ASN C . n 
C 1 64  ILE 64  63  63  ILE ILE C . n 
C 1 65  VAL 65  64  64  VAL VAL C . n 
C 1 66  LYS 66  65  65  LYS LYS C . n 
C 1 67  LEU 67  66  66  LEU LEU C . n 
C 1 68  LEU 68  67  67  LEU LEU C . n 
C 1 69  ASP 69  68  68  ASP ASP C . n 
C 1 70  VAL 70  69  69  VAL VAL C . n 
C 1 71  ILE 71  70  70  ILE ILE C . n 
C 1 72  HIS 72  71  71  HIS HIS C . n 
C 1 73  THR 73  72  72  THR THR C . n 
C 1 74  GLU 74  73  73  GLU GLU C . n 
C 1 75  ASN 75  74  74  ASN ASN C . n 
C 1 76  LYS 76  75  75  LYS LYS C . n 
C 1 77  LEU 77  76  76  LEU LEU C . n 
C 1 78  TYR 78  77  77  TYR TYR C . n 
C 1 79  LEU 79  78  78  LEU LEU C . n 
C 1 80  VAL 80  79  79  VAL VAL C . n 
C 1 81  PHE 81  80  80  PHE PHE C . n 
C 1 82  GLU 82  81  81  GLU GLU C . n 
C 1 83  PHE 83  82  82  PHE PHE C . n 
C 1 84  LEU 84  83  83  LEU LEU C . n 
C 1 85  HIS 85  84  84  HIS HIS C . n 
C 1 86  GLN 86  85  85  GLN GLN C . n 
C 1 87  ASP 87  86  86  ASP ASP C . n 
C 1 88  LEU 88  87  87  LEU LEU C . n 
C 1 89  LYS 89  88  88  LYS LYS C . n 
C 1 90  LYS 90  89  89  LYS LYS C . n 
C 1 91  PHE 91  90  90  PHE PHE C . n 
C 1 92  MET 92  91  91  MET MET C . n 
C 1 93  ASP 93  92  92  ASP ASP C . n 
C 1 94  ALA 94  93  93  ALA ALA C . n 
C 1 95  SER 95  94  94  SER SER C . n 
C 1 96  ALA 96  95  95  ALA ALA C . n 
C 1 97  LEU 97  96  96  LEU LEU C . n 
C 1 98  THR 98  97  97  THR THR C . n 
C 1 99  GLY 99  98  98  GLY GLY C . n 
C 1 100 ILE 100 99  99  ILE ILE C . n 
C 1 101 PRO 101 100 100 PRO PRO C . n 
C 1 102 LEU 102 101 101 LEU LEU C . n 
C 1 103 PRO 103 102 102 PRO PRO C . n 
C 1 104 LEU 104 103 103 LEU LEU C . n 
C 1 105 ILE 105 104 104 ILE ILE C . n 
C 1 106 LYS 106 105 105 LYS LYS C . n 
C 1 107 SER 107 106 106 SER SER C . n 
C 1 108 TYR 108 107 107 TYR TYR C . n 
C 1 109 LEU 109 108 108 LEU LEU C . n 
C 1 110 PHE 110 109 109 PHE PHE C . n 
C 1 111 GLN 111 110 110 GLN GLN C . n 
C 1 112 LEU 112 111 111 LEU LEU C . n 
C 1 113 LEU 113 112 112 LEU LEU C . n 
C 1 114 GLN 114 113 113 GLN GLN C . n 
C 1 115 GLY 115 114 114 GLY GLY C . n 
C 1 116 LEU 116 115 115 LEU LEU C . n 
C 1 117 ALA 117 116 116 ALA ALA C . n 
C 1 118 PHE 118 117 117 PHE PHE C . n 
C 1 119 CYS 119 118 118 CYS CYS C . n 
C 1 120 HIS 120 119 119 HIS HIS C . n 
C 1 121 SER 121 120 120 SER SER C . n 
C 1 122 HIS 122 121 121 HIS HIS C . n 
C 1 123 ARG 123 122 122 ARG ARG C . n 
C 1 124 VAL 124 123 123 VAL VAL C . n 
C 1 125 LEU 125 124 124 LEU LEU C . n 
C 1 126 HIS 126 125 125 HIS HIS C . n 
C 1 127 ARG 127 126 126 ARG ARG C . n 
C 1 128 ASP 128 127 127 ASP ASP C . n 
C 1 129 LEU 129 128 128 LEU LEU C . n 
C 1 130 LYS 130 129 129 LYS LYS C . n 
C 1 131 PRO 131 130 130 PRO PRO C . n 
C 1 132 GLN 132 131 131 GLN GLN C . n 
C 1 133 ASN 133 132 132 ASN ASN C . n 
C 1 134 LEU 134 133 133 LEU LEU C . n 
C 1 135 LEU 135 134 134 LEU LEU C . n 
C 1 136 ILE 136 135 135 ILE ILE C . n 
C 1 137 ASN 137 136 136 ASN ASN C . n 
C 1 138 THR 138 137 137 THR THR C . n 
C 1 139 GLU 139 138 138 GLU GLU C . n 
C 1 140 GLY 140 139 139 GLY GLY C . n 
C 1 141 ALA 141 140 140 ALA ALA C . n 
C 1 142 ILE 142 141 141 ILE ILE C . n 
C 1 143 LYS 143 142 142 LYS LYS C . n 
C 1 144 LEU 144 143 143 LEU LEU C . n 
C 1 145 ALA 145 144 144 ALA ALA C . n 
C 1 146 ASP 146 145 145 ASP ASP C . n 
C 1 147 PHE 147 146 146 PHE PHE C . n 
C 1 148 GLY 148 147 147 GLY GLY C . n 
C 1 149 LEU 149 148 148 LEU LEU C . n 
C 1 150 ALA 150 149 149 ALA ALA C . n 
C 1 151 ARG 151 150 150 ARG ARG C . n 
C 1 152 ALA 152 151 151 ALA ALA C . n 
C 1 153 PHE 153 152 152 PHE PHE C . n 
C 1 154 GLY 154 153 153 GLY GLY C . n 
C 1 155 VAL 155 154 154 VAL VAL C . n 
C 1 156 PRO 156 155 155 PRO PRO C . n 
C 1 157 VAL 157 156 156 VAL VAL C . n 
C 1 158 ARG 158 157 157 ARG ARG C . n 
C 1 159 THR 159 158 158 THR THR C . n 
C 1 160 TYR 160 159 159 TYR TYR C . n 
C 1 161 TPO 161 160 160 TPO TPO C . n 
C 1 162 HIS 162 161 161 HIS HIS C . n 
C 1 163 GLU 163 162 162 GLU GLU C . n 
C 1 164 VAL 164 163 163 VAL VAL C . n 
C 1 165 VAL 165 164 164 VAL VAL C . n 
C 1 166 THR 166 165 165 THR THR C . n 
C 1 167 LEU 167 166 166 LEU LEU C . n 
C 1 168 TRP 168 167 167 TRP TRP C . n 
C 1 169 TYR 169 168 168 TYR TYR C . n 
C 1 170 ARG 170 169 169 ARG ARG C . n 
C 1 171 ALA 171 170 170 ALA ALA C . n 
C 1 172 PRO 172 171 171 PRO PRO C . n 
C 1 173 GLU 173 172 172 GLU GLU C . n 
C 1 174 ILE 174 173 173 ILE ILE C . n 
C 1 175 LEU 175 174 174 LEU LEU C . n 
C 1 176 LEU 176 175 175 LEU LEU C . n 
C 1 177 GLY 177 176 176 GLY GLY C . n 
C 1 178 CYS 178 177 177 CYS CYS C . n 
C 1 179 LYS 179 178 178 LYS LYS C . n 
C 1 180 TYR 180 179 179 TYR TYR C . n 
C 1 181 TYR 181 180 180 TYR TYR C . n 
C 1 182 SER 182 181 181 SER SER C . n 
C 1 183 THR 183 182 182 THR THR C . n 
C 1 184 ALA 184 183 183 ALA ALA C . n 
C 1 185 VAL 185 184 184 VAL VAL C . n 
C 1 186 ASP 186 185 185 ASP ASP C . n 
C 1 187 ILE 187 186 186 ILE ILE C . n 
C 1 188 TRP 188 187 187 TRP TRP C . n 
C 1 189 SER 189 188 188 SER SER C . n 
C 1 190 LEU 190 189 189 LEU LEU C . n 
C 1 191 GLY 191 190 190 GLY GLY C . n 
C 1 192 CYS 192 191 191 CYS CYS C . n 
C 1 193 ILE 193 192 192 ILE ILE C . n 
C 1 194 PHE 194 193 193 PHE PHE C . n 
C 1 195 ALA 195 194 194 ALA ALA C . n 
C 1 196 GLU 196 195 195 GLU GLU C . n 
C 1 197 MET 197 196 196 MET MET C . n 
C 1 198 VAL 198 197 197 VAL VAL C . n 
C 1 199 THR 199 198 198 THR THR C . n 
C 1 200 ARG 200 199 199 ARG ARG C . n 
C 1 201 ARG 201 200 200 ARG ARG C . n 
C 1 202 ALA 202 201 201 ALA ALA C . n 
C 1 203 LEU 203 202 202 LEU LEU C . n 
C 1 204 PHE 204 203 203 PHE PHE C . n 
C 1 205 PRO 205 204 204 PRO PRO C . n 
C 1 206 GLY 206 205 205 GLY GLY C . n 
C 1 207 ASP 207 206 206 ASP ASP C . n 
C 1 208 SER 208 207 207 SER SER C . n 
C 1 209 GLU 209 208 208 GLU GLU C . n 
C 1 210 ILE 210 209 209 ILE ILE C . n 
C 1 211 ASP 211 210 210 ASP ASP C . n 
C 1 212 GLN 212 211 211 GLN GLN C . n 
C 1 213 LEU 213 212 212 LEU LEU C . n 
C 1 214 PHE 214 213 213 PHE PHE C . n 
C 1 215 ARG 215 214 214 ARG ARG C . n 
C 1 216 ILE 216 215 215 ILE ILE C . n 
C 1 217 PHE 217 216 216 PHE PHE C . n 
C 1 218 ARG 218 217 217 ARG ARG C . n 
C 1 219 THR 219 218 218 THR THR C . n 
C 1 220 LEU 220 219 219 LEU LEU C . n 
C 1 221 GLY 221 220 220 GLY GLY C . n 
C 1 222 THR 222 221 221 THR THR C . n 
C 1 223 PRO 223 222 222 PRO PRO C . n 
C 1 224 ASP 224 223 223 ASP ASP C . n 
C 1 225 GLU 225 224 224 GLU GLU C . n 
C 1 226 VAL 226 225 225 VAL VAL C . n 
C 1 227 VAL 227 226 226 VAL VAL C . n 
C 1 228 TRP 228 227 227 TRP TRP C . n 
C 1 229 PRO 229 228 228 PRO PRO C . n 
C 1 230 GLY 230 229 229 GLY GLY C . n 
C 1 231 VAL 231 230 230 VAL VAL C . n 
C 1 232 THR 232 231 231 THR THR C . n 
C 1 233 SER 233 232 232 SER SER C . n 
C 1 234 MET 234 233 233 MET MET C . n 
C 1 235 PRO 235 234 234 PRO PRO C . n 
C 1 236 ASP 236 235 235 ASP ASP C . n 
C 1 237 TYR 237 236 236 TYR TYR C . n 
C 1 238 LYS 238 237 237 LYS LYS C . n 
C 1 239 PRO 239 238 238 PRO PRO C . n 
C 1 240 SER 240 239 239 SER SER C . n 
C 1 241 PHE 241 240 240 PHE PHE C . n 
C 1 242 PRO 242 241 241 PRO PRO C . n 
C 1 243 LYS 243 242 242 LYS LYS C . n 
C 1 244 TRP 244 243 243 TRP TRP C . n 
C 1 245 ALA 245 244 244 ALA ALA C . n 
C 1 246 ARG 246 245 245 ARG ARG C . n 
C 1 247 GLN 247 246 246 GLN GLN C . n 
C 1 248 ASP 248 247 247 ASP ASP C . n 
C 1 249 PHE 249 248 248 PHE PHE C . n 
C 1 250 SER 250 249 249 SER SER C . n 
C 1 251 LYS 251 250 250 LYS LYS C . n 
C 1 252 VAL 252 251 251 VAL VAL C . n 
C 1 253 VAL 253 252 252 VAL VAL C . n 
C 1 254 PRO 254 253 253 PRO PRO C . n 
C 1 255 PRO 255 254 254 PRO PRO C . n 
C 1 256 LEU 256 255 255 LEU LEU C . n 
C 1 257 ASP 257 256 256 ASP ASP C . n 
C 1 258 GLU 258 257 257 GLU GLU C . n 
C 1 259 ASP 259 258 258 ASP ASP C . n 
C 1 260 GLY 260 259 259 GLY GLY C . n 
C 1 261 ARG 261 260 260 ARG ARG C . n 
C 1 262 SER 262 261 261 SER SER C . n 
C 1 263 LEU 263 262 262 LEU LEU C . n 
C 1 264 LEU 264 263 263 LEU LEU C . n 
C 1 265 SER 265 264 264 SER SER C . n 
C 1 266 GLN 266 265 265 GLN GLN C . n 
C 1 267 MET 267 266 266 MET MET C . n 
C 1 268 LEU 268 267 267 LEU LEU C . n 
C 1 269 HIS 269 268 268 HIS HIS C . n 
C 1 270 TYR 270 269 269 TYR TYR C . n 
C 1 271 ASP 271 270 270 ASP ASP C . n 
C 1 272 PRO 272 271 271 PRO PRO C . n 
C 1 273 ASN 273 272 272 ASN ASN C . n 
C 1 274 LYS 274 273 273 LYS LYS C . n 
C 1 275 ARG 275 274 274 ARG ARG C . n 
C 1 276 ILE 276 275 275 ILE ILE C . n 
C 1 277 SER 277 276 276 SER SER C . n 
C 1 278 ALA 278 277 277 ALA ALA C . n 
C 1 279 LYS 279 278 278 LYS LYS C . n 
C 1 280 ALA 280 279 279 ALA ALA C . n 
C 1 281 ALA 281 280 280 ALA ALA C . n 
C 1 282 LEU 282 281 281 LEU LEU C . n 
C 1 283 ALA 283 282 282 ALA ALA C . n 
C 1 284 HIS 284 283 283 HIS HIS C . n 
C 1 285 PRO 285 284 284 PRO PRO C . n 
C 1 286 PHE 286 285 285 PHE PHE C . n 
C 1 287 PHE 287 286 286 PHE PHE C . n 
C 1 288 GLN 288 287 287 GLN GLN C . n 
C 1 289 ASP 289 288 288 ASP ASP C . n 
C 1 290 VAL 290 289 289 VAL VAL C . n 
C 1 291 THR 291 290 290 THR THR C . n 
C 1 292 LYS 292 291 291 LYS LYS C . n 
C 1 293 PRO 293 292 292 PRO PRO C . n 
C 1 294 VAL 294 293 293 VAL VAL C . n 
C 1 295 PRO 295 294 294 PRO PRO C . n 
C 1 296 HIS 296 295 295 HIS HIS C . n 
C 1 297 LEU 297 296 296 LEU LEU C . n 
D 2 1   VAL 1   175 175 VAL VAL D . n 
D 2 2   PRO 2   176 176 PRO PRO D . n 
D 2 3   ASP 3   177 177 ASP ASP D . n 
D 2 4   TYR 4   178 178 TYR TYR D . n 
D 2 5   HIS 5   179 179 HIS HIS D . n 
D 2 6   GLU 6   180 180 GLU GLU D . n 
D 2 7   ASP 7   181 181 ASP ASP D . n 
D 2 8   ILE 8   182 182 ILE ILE D . n 
D 2 9   HIS 9   183 183 HIS HIS D . n 
D 2 10  THR 10  184 184 THR THR D . n 
D 2 11  TYR 11  185 185 TYR TYR D . n 
D 2 12  LEU 12  186 186 LEU LEU D . n 
D 2 13  ARG 13  187 187 ARG ARG D . n 
D 2 14  GLU 14  188 188 GLU GLU D . n 
D 2 15  MET 15  189 189 MET MET D . n 
D 2 16  GLU 16  190 190 GLU GLU D . n 
D 2 17  VAL 17  191 191 VAL VAL D . n 
D 2 18  LYS 18  192 192 LYS LYS D . n 
D 2 19  CYS 19  193 193 CYS CYS D . n 
D 2 20  LYS 20  194 194 LYS LYS D . n 
D 2 21  PRO 21  195 195 PRO PRO D . n 
D 2 22  LYS 22  196 196 LYS LYS D . n 
D 2 23  VAL 23  197 197 VAL VAL D . n 
D 2 24  GLY 24  198 198 GLY GLY D . n 
D 2 25  TYR 25  199 199 TYR TYR D . n 
D 2 26  MET 26  200 200 MET MET D . n 
D 2 27  LYS 27  201 201 LYS LYS D . n 
D 2 28  LYS 28  202 202 LYS LYS D . n 
D 2 29  GLN 29  203 203 GLN GLN D . n 
D 2 30  PRO 30  204 204 PRO PRO D . n 
D 2 31  ASP 31  205 205 ASP ASP D . n 
D 2 32  ILE 32  206 206 ILE ILE D . n 
D 2 33  THR 33  207 207 THR THR D . n 
D 2 34  ASN 34  208 208 ASN ASN D . n 
D 2 35  SER 35  209 209 SER SER D . n 
D 2 36  MET 36  210 210 MET MET D . n 
D 2 37  ARG 37  211 211 ARG ARG D . n 
D 2 38  ALA 38  212 212 ALA ALA D . n 
D 2 39  ILE 39  213 213 ILE ILE D . n 
D 2 40  LEU 40  214 214 LEU LEU D . n 
D 2 41  VAL 41  215 215 VAL VAL D . n 
D 2 42  ASP 42  216 216 ASP ASP D . n 
D 2 43  TRP 43  217 217 TRP TRP D . n 
D 2 44  LEU 44  218 218 LEU LEU D . n 
D 2 45  VAL 45  219 219 VAL VAL D . n 
D 2 46  GLU 46  220 220 GLU GLU D . n 
D 2 47  VAL 47  221 221 VAL VAL D . n 
D 2 48  GLY 48  222 222 GLY GLY D . n 
D 2 49  GLU 49  223 223 GLU GLU D . n 
D 2 50  GLU 50  224 224 GLU GLU D . n 
D 2 51  TYR 51  225 225 TYR TYR D . n 
D 2 52  LYS 52  226 226 LYS LYS D . n 
D 2 53  LEU 53  227 227 LEU LEU D . n 
D 2 54  GLN 54  228 228 GLN GLN D . n 
D 2 55  ASN 55  229 229 ASN ASN D . n 
D 2 56  GLU 56  230 230 GLU GLU D . n 
D 2 57  THR 57  231 231 THR THR D . n 
D 2 58  LEU 58  232 232 LEU LEU D . n 
D 2 59  HIS 59  233 233 HIS HIS D . n 
D 2 60  LEU 60  234 234 LEU LEU D . n 
D 2 61  ALA 61  235 235 ALA ALA D . n 
D 2 62  VAL 62  236 236 VAL VAL D . n 
D 2 63  ASN 63  237 237 ASN ASN D . n 
D 2 64  TYR 64  238 238 TYR TYR D . n 
D 2 65  ILE 65  239 239 ILE ILE D . n 
D 2 66  ASP 66  240 240 ASP ASP D . n 
D 2 67  ARG 67  241 241 ARG ARG D . n 
D 2 68  PHE 68  242 242 PHE PHE D . n 
D 2 69  LEU 69  243 243 LEU LEU D . n 
D 2 70  SER 70  244 244 SER SER D . n 
D 2 71  SER 71  245 245 SER SER D . n 
D 2 72  MET 72  246 246 MET MET D . n 
D 2 73  SER 73  247 247 SER SER D . n 
D 2 74  VAL 74  248 248 VAL VAL D . n 
D 2 75  LEU 75  249 249 LEU LEU D . n 
D 2 76  ARG 76  250 250 ARG ARG D . n 
D 2 77  GLY 77  251 251 GLY GLY D . n 
D 2 78  LYS 78  252 252 LYS LYS D . n 
D 2 79  LEU 79  253 253 LEU LEU D . n 
D 2 80  GLN 80  254 254 GLN GLN D . n 
D 2 81  LEU 81  255 255 LEU LEU D . n 
D 2 82  VAL 82  256 256 VAL VAL D . n 
D 2 83  GLY 83  257 257 GLY GLY D . n 
D 2 84  THR 84  258 258 THR THR D . n 
D 2 85  ALA 85  259 259 ALA ALA D . n 
D 2 86  ALA 86  260 260 ALA ALA D . n 
D 2 87  MET 87  261 261 MET MET D . n 
D 2 88  LEU 88  262 262 LEU LEU D . n 
D 2 89  LEU 89  263 263 LEU LEU D . n 
D 2 90  ALA 90  264 264 ALA ALA D . n 
D 2 91  SER 91  265 265 SER SER D . n 
D 2 92  LYS 92  266 266 LYS LYS D . n 
D 2 93  PHE 93  267 267 PHE PHE D . n 
D 2 94  GLU 94  268 268 GLU GLU D . n 
D 2 95  GLU 95  269 269 GLU GLU D . n 
D 2 96  ILE 96  270 270 ILE ILE D . n 
D 2 97  TYR 97  271 271 TYR TYR D . n 
D 2 98  PRO 98  272 272 PRO PRO D . n 
D 2 99  PRO 99  273 273 PRO PRO D . n 
D 2 100 GLU 100 274 274 GLU GLU D . n 
D 2 101 VAL 101 275 275 VAL VAL D . n 
D 2 102 ALA 102 276 276 ALA ALA D . n 
D 2 103 GLU 103 277 277 GLU GLU D . n 
D 2 104 PHE 104 278 278 PHE PHE D . n 
D 2 105 VAL 105 279 279 VAL VAL D . n 
D 2 106 TYR 106 280 280 TYR TYR D . n 
D 2 107 ILE 107 281 281 ILE ILE D . n 
D 2 108 THR 108 282 282 THR THR D . n 
D 2 109 ASP 109 283 283 ASP ASP D . n 
D 2 110 ASP 110 284 284 ASP ASP D . n 
D 2 111 THR 111 285 285 THR THR D . n 
D 2 112 TYR 112 286 286 TYR TYR D . n 
D 2 113 THR 113 287 287 THR THR D . n 
D 2 114 LYS 114 288 288 LYS LYS D . n 
D 2 115 LYS 115 289 289 LYS LYS D . n 
D 2 116 GLN 116 290 290 GLN GLN D . n 
D 2 117 VAL 117 291 291 VAL VAL D . n 
D 2 118 LEU 118 292 292 LEU LEU D . n 
D 2 119 ARG 119 293 293 ARG ARG D . n 
D 2 120 MET 120 294 294 MET MET D . n 
D 2 121 GLU 121 295 295 GLU GLU D . n 
D 2 122 HIS 122 296 296 HIS HIS D . n 
D 2 123 LEU 123 297 297 LEU LEU D . n 
D 2 124 VAL 124 298 298 VAL VAL D . n 
D 2 125 LEU 125 299 299 LEU LEU D . n 
D 2 126 LYS 126 300 300 LYS LYS D . n 
D 2 127 VAL 127 301 301 VAL VAL D . n 
D 2 128 LEU 128 302 302 LEU LEU D . n 
D 2 129 THR 129 303 303 THR THR D . n 
D 2 130 PHE 130 304 304 PHE PHE D . n 
D 2 131 ASP 131 305 305 ASP ASP D . n 
D 2 132 LEU 132 306 306 LEU LEU D . n 
D 2 133 ALA 133 307 307 ALA ALA D . n 
D 2 134 ALA 134 308 308 ALA ALA D . n 
D 2 135 PRO 135 309 309 PRO PRO D . n 
D 2 136 THR 136 310 310 THR THR D . n 
D 2 137 VAL 137 311 311 VAL VAL D . n 
D 2 138 ASN 138 312 312 ASN ASN D . n 
D 2 139 GLN 139 313 313 GLN GLN D . n 
D 2 140 PHE 140 314 314 PHE PHE D . n 
D 2 141 LEU 141 315 315 LEU LEU D . n 
D 2 142 THR 142 316 316 THR THR D . n 
D 2 143 GLN 143 317 317 GLN GLN D . n 
D 2 144 TYR 144 318 318 TYR TYR D . n 
D 2 145 PHE 145 319 319 PHE PHE D . n 
D 2 146 LEU 146 320 320 LEU LEU D . n 
D 2 147 HIS 147 321 321 HIS HIS D . n 
D 2 148 GLN 148 322 322 GLN GLN D . n 
D 2 149 GLN 149 323 323 GLN GLN D . n 
D 2 150 PRO 150 324 324 PRO PRO D . n 
D 2 151 ALA 151 325 325 ALA ALA D . n 
D 2 152 ASN 152 326 326 ASN ASN D . n 
D 2 153 CYS 153 327 327 CYS CYS D . n 
D 2 154 LYS 154 328 328 LYS LYS D . n 
D 2 155 VAL 155 329 329 VAL VAL D . n 
D 2 156 GLU 156 330 330 GLU GLU D . n 
D 2 157 SER 157 331 331 SER SER D . n 
D 2 158 LEU 158 332 332 LEU LEU D . n 
D 2 159 ALA 159 333 333 ALA ALA D . n 
D 2 160 MET 160 334 334 MET MET D . n 
D 2 161 PHE 161 335 335 PHE PHE D . n 
D 2 162 LEU 162 336 336 LEU LEU D . n 
D 2 163 GLY 163 337 337 GLY GLY D . n 
D 2 164 GLU 164 338 338 GLU GLU D . n 
D 2 165 LEU 165 339 339 LEU LEU D . n 
D 2 166 SER 166 340 340 SER SER D . n 
D 2 167 LEU 167 341 341 LEU LEU D . n 
D 2 168 ILE 168 342 342 ILE ILE D . n 
D 2 169 ASP 169 343 343 ASP ASP D . n 
D 2 170 ALA 170 344 344 ALA ALA D . n 
D 2 171 ASP 171 345 345 ASP ASP D . n 
D 2 172 PRO 172 346 346 PRO PRO D . n 
D 2 173 TYR 173 347 347 TYR TYR D . n 
D 2 174 LEU 174 348 348 LEU LEU D . n 
D 2 175 LYS 175 349 349 LYS LYS D . n 
D 2 176 TYR 176 350 350 TYR TYR D . n 
D 2 177 LEU 177 351 351 LEU LEU D . n 
D 2 178 PRO 178 352 352 PRO PRO D . n 
D 2 179 SER 179 353 353 SER SER D . n 
D 2 180 VAL 180 354 354 VAL VAL D . n 
D 2 181 ILE 181 355 355 ILE ILE D . n 
D 2 182 ALA 182 356 356 ALA ALA D . n 
D 2 183 GLY 183 357 357 GLY GLY D . n 
D 2 184 ALA 184 358 358 ALA ALA D . n 
D 2 185 ALA 185 359 359 ALA ALA D . n 
D 2 186 PHE 186 360 360 PHE PHE D . n 
D 2 187 HIS 187 361 361 HIS HIS D . n 
D 2 188 LEU 188 362 362 LEU LEU D . n 
D 2 189 ALA 189 363 363 ALA ALA D . n 
D 2 190 LEU 190 364 364 LEU LEU D . n 
D 2 191 TYR 191 365 365 TYR TYR D . n 
D 2 192 THR 192 366 366 THR THR D . n 
D 2 193 VAL 193 367 367 VAL VAL D . n 
D 2 194 THR 194 368 368 THR THR D . n 
D 2 195 GLY 195 369 369 GLY GLY D . n 
D 2 196 GLN 196 370 370 GLN GLN D . n 
D 2 197 SER 197 371 371 SER SER D . n 
D 2 198 TRP 198 372 372 TRP TRP D . n 
D 2 199 PRO 199 373 373 PRO PRO D . n 
D 2 200 GLU 200 374 374 GLU GLU D . n 
D 2 201 SER 201 375 375 SER SER D . n 
D 2 202 LEU 202 376 376 LEU LEU D . n 
D 2 203 ILE 203 377 377 ILE ILE D . n 
D 2 204 ARG 204 378 378 ARG ARG D . n 
D 2 205 LYS 205 379 379 LYS LYS D . n 
D 2 206 THR 206 380 380 THR THR D . n 
D 2 207 GLY 207 381 381 GLY GLY D . n 
D 2 208 TYR 208 382 382 TYR TYR D . n 
D 2 209 THR 209 383 383 THR THR D . n 
D 2 210 LEU 210 384 384 LEU LEU D . n 
D 2 211 GLU 211 385 385 GLU GLU D . n 
D 2 212 SER 212 386 386 SER SER D . n 
D 2 213 LEU 213 387 387 LEU LEU D . n 
D 2 214 LYS 214 388 388 LYS LYS D . n 
D 2 215 PRO 215 389 389 PRO PRO D . n 
D 2 216 CYS 216 390 390 CYS CYS D . n 
D 2 217 LEU 217 391 391 LEU LEU D . n 
D 2 218 MET 218 392 392 MET MET D . n 
D 2 219 ASP 219 393 393 ASP ASP D . n 
D 2 220 LEU 220 394 394 LEU LEU D . n 
D 2 221 HIS 221 395 395 HIS HIS D . n 
D 2 222 GLN 222 396 396 GLN GLN D . n 
D 2 223 THR 223 397 397 THR THR D . n 
D 2 224 TYR 224 398 398 TYR TYR D . n 
D 2 225 LEU 225 399 399 LEU LEU D . n 
D 2 226 LYS 226 400 400 LYS LYS D . n 
D 2 227 ALA 227 401 401 ALA ALA D . n 
D 2 228 PRO 228 402 402 PRO PRO D . n 
D 2 229 GLN 229 403 403 GLN GLN D . n 
D 2 230 HIS 230 404 404 HIS HIS D . n 
D 2 231 ALA 231 405 405 ALA ALA D . n 
D 2 232 GLN 232 406 406 GLN GLN D . n 
D 2 233 GLN 233 407 407 GLN GLN D . n 
D 2 234 SER 234 408 408 SER SER D . n 
D 2 235 ILE 235 409 409 ILE ILE D . n 
D 2 236 ARG 236 410 410 ARG ARG D . n 
D 2 237 GLU 237 411 411 GLU GLU D . n 
D 2 238 LYS 238 412 412 LYS LYS D . n 
D 2 239 TYR 239 413 413 TYR TYR D . n 
D 2 240 LYS 240 414 414 LYS LYS D . n 
D 2 241 ASN 241 415 415 ASN ASN D . n 
D 2 242 SER 242 416 416 SER SER D . n 
D 2 243 LYS 243 417 417 LYS LYS D . n 
D 2 244 TYR 244 418 418 TYR TYR D . n 
D 2 245 HIS 245 419 419 HIS HIS D . n 
D 2 246 GLY 246 420 420 GLY GLY D . n 
D 2 247 VAL 247 421 421 VAL VAL D . n 
D 2 248 SER 248 422 422 SER SER D . n 
D 2 249 LEU 249 423 423 LEU LEU D . n 
D 2 250 LEU 250 424 424 LEU LEU D . n 
D 2 251 ASN 251 425 425 ASN ASN D . n 
D 2 252 PRO 252 426 426 PRO PRO D . n 
D 2 253 PRO 253 427 427 PRO PRO D . n 
D 2 254 GLU 254 428 428 GLU GLU D . n 
D 2 255 THR 255 429 429 THR THR D . n 
D 2 256 LEU 256 430 430 LEU LEU D . n 
D 2 257 ASN 257 431 431 ASN ASN D . n 
D 2 258 LEU 258 432 432 LEU LEU D . n 
D 2 259 LEU 259 433 ?   ?   ?   D . n 
D 2 260 ASN 260 434 ?   ?   ?   D . n 
D 2 261 LEU 261 435 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 INR 1   1298 1298 INR INR A . 
F 3 INR 1   1298 1298 INR INR C . 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
G 4 HOH 112 2112 2112 HOH HOH A . 
G 4 HOH 113 2113 2113 HOH HOH A . 
G 4 HOH 114 2114 2114 HOH HOH A . 
G 4 HOH 115 2115 2115 HOH HOH A . 
G 4 HOH 116 2116 2116 HOH HOH A . 
G 4 HOH 117 2117 2117 HOH HOH A . 
G 4 HOH 118 2118 2118 HOH HOH A . 
G 4 HOH 119 2119 2119 HOH HOH A . 
G 4 HOH 120 2120 2120 HOH HOH A . 
G 4 HOH 121 2121 2121 HOH HOH A . 
G 4 HOH 122 2122 2122 HOH HOH A . 
G 4 HOH 123 2123 2123 HOH HOH A . 
G 4 HOH 124 2124 2124 HOH HOH A . 
H 4 HOH 1   2001 2001 HOH HOH B . 
H 4 HOH 2   2002 2002 HOH HOH B . 
H 4 HOH 3   2003 2003 HOH HOH B . 
H 4 HOH 4   2004 2004 HOH HOH B . 
H 4 HOH 5   2005 2005 HOH HOH B . 
H 4 HOH 6   2006 2006 HOH HOH B . 
H 4 HOH 7   2007 2007 HOH HOH B . 
H 4 HOH 8   2008 2008 HOH HOH B . 
H 4 HOH 9   2009 2009 HOH HOH B . 
H 4 HOH 10  2010 2010 HOH HOH B . 
H 4 HOH 11  2011 2011 HOH HOH B . 
H 4 HOH 12  2012 2012 HOH HOH B . 
H 4 HOH 13  2013 2013 HOH HOH B . 
H 4 HOH 14  2014 2014 HOH HOH B . 
H 4 HOH 15  2015 2015 HOH HOH B . 
H 4 HOH 16  2016 2016 HOH HOH B . 
H 4 HOH 17  2017 2017 HOH HOH B . 
H 4 HOH 18  2018 2018 HOH HOH B . 
H 4 HOH 19  2019 2019 HOH HOH B . 
H 4 HOH 20  2020 2020 HOH HOH B . 
H 4 HOH 21  2021 2021 HOH HOH B . 
H 4 HOH 22  2022 2022 HOH HOH B . 
H 4 HOH 23  2023 2023 HOH HOH B . 
H 4 HOH 24  2024 2024 HOH HOH B . 
H 4 HOH 25  2025 2025 HOH HOH B . 
H 4 HOH 26  2026 2026 HOH HOH B . 
H 4 HOH 27  2027 2027 HOH HOH B . 
H 4 HOH 28  2028 2028 HOH HOH B . 
H 4 HOH 29  2029 2029 HOH HOH B . 
H 4 HOH 30  2030 2030 HOH HOH B . 
H 4 HOH 31  2031 2031 HOH HOH B . 
H 4 HOH 32  2032 2032 HOH HOH B . 
H 4 HOH 33  2033 2033 HOH HOH B . 
H 4 HOH 34  2034 2034 HOH HOH B . 
H 4 HOH 35  2035 2035 HOH HOH B . 
H 4 HOH 36  2036 2036 HOH HOH B . 
H 4 HOH 37  2037 2037 HOH HOH B . 
H 4 HOH 38  2038 2038 HOH HOH B . 
H 4 HOH 39  2039 2039 HOH HOH B . 
H 4 HOH 40  2040 2040 HOH HOH B . 
H 4 HOH 41  2041 2041 HOH HOH B . 
H 4 HOH 42  2042 2042 HOH HOH B . 
H 4 HOH 43  2043 2043 HOH HOH B . 
H 4 HOH 44  2044 2044 HOH HOH B . 
H 4 HOH 45  2045 2045 HOH HOH B . 
H 4 HOH 46  2046 2046 HOH HOH B . 
H 4 HOH 47  2047 2047 HOH HOH B . 
H 4 HOH 48  2048 2048 HOH HOH B . 
H 4 HOH 49  2049 2049 HOH HOH B . 
H 4 HOH 50  2050 2050 HOH HOH B . 
H 4 HOH 51  2051 2051 HOH HOH B . 
H 4 HOH 52  2052 2052 HOH HOH B . 
H 4 HOH 53  2053 2053 HOH HOH B . 
H 4 HOH 54  2054 2054 HOH HOH B . 
H 4 HOH 55  2055 2055 HOH HOH B . 
H 4 HOH 56  2056 2056 HOH HOH B . 
H 4 HOH 57  2057 2057 HOH HOH B . 
H 4 HOH 58  2058 2058 HOH HOH B . 
H 4 HOH 59  2059 2059 HOH HOH B . 
H 4 HOH 60  2060 2060 HOH HOH B . 
H 4 HOH 61  2061 2061 HOH HOH B . 
H 4 HOH 62  2062 2062 HOH HOH B . 
H 4 HOH 63  2063 2063 HOH HOH B . 
H 4 HOH 64  2064 2064 HOH HOH B . 
H 4 HOH 65  2065 2065 HOH HOH B . 
H 4 HOH 66  2066 2066 HOH HOH B . 
H 4 HOH 67  2067 2067 HOH HOH B . 
H 4 HOH 68  2068 2068 HOH HOH B . 
H 4 HOH 69  2069 2069 HOH HOH B . 
H 4 HOH 70  2070 2070 HOH HOH B . 
H 4 HOH 71  2071 2071 HOH HOH B . 
H 4 HOH 72  2072 2072 HOH HOH B . 
H 4 HOH 73  2073 2073 HOH HOH B . 
H 4 HOH 74  2074 2074 HOH HOH B . 
H 4 HOH 75  2075 2075 HOH HOH B . 
H 4 HOH 76  2076 2076 HOH HOH B . 
H 4 HOH 77  2077 2077 HOH HOH B . 
H 4 HOH 78  2078 2078 HOH HOH B . 
H 4 HOH 79  2079 2079 HOH HOH B . 
H 4 HOH 80  2080 2080 HOH HOH B . 
H 4 HOH 81  2081 2081 HOH HOH B . 
H 4 HOH 82  2082 2082 HOH HOH B . 
H 4 HOH 83  2083 2083 HOH HOH B . 
H 4 HOH 84  2084 2084 HOH HOH B . 
H 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 86  2086 2086 HOH HOH B . 
H 4 HOH 87  2087 2087 HOH HOH B . 
H 4 HOH 88  2088 2088 HOH HOH B . 
H 4 HOH 89  2089 2089 HOH HOH B . 
H 4 HOH 90  2090 2090 HOH HOH B . 
H 4 HOH 91  2091 2091 HOH HOH B . 
H 4 HOH 92  2092 2092 HOH HOH B . 
H 4 HOH 93  2093 2093 HOH HOH B . 
H 4 HOH 94  2094 2094 HOH HOH B . 
H 4 HOH 95  2095 2095 HOH HOH B . 
H 4 HOH 96  2096 2096 HOH HOH B . 
H 4 HOH 97  2097 2097 HOH HOH B . 
H 4 HOH 98  2098 2098 HOH HOH B . 
H 4 HOH 99  2099 2099 HOH HOH B . 
H 4 HOH 100 2100 2100 HOH HOH B . 
I 4 HOH 1   2001 2001 HOH HOH C . 
I 4 HOH 2   2002 2002 HOH HOH C . 
I 4 HOH 3   2003 2003 HOH HOH C . 
I 4 HOH 4   2004 2004 HOH HOH C . 
I 4 HOH 5   2005 2005 HOH HOH C . 
I 4 HOH 6   2006 2006 HOH HOH C . 
I 4 HOH 7   2007 2007 HOH HOH C . 
I 4 HOH 8   2008 2008 HOH HOH C . 
I 4 HOH 9   2009 2009 HOH HOH C . 
I 4 HOH 10  2010 2010 HOH HOH C . 
I 4 HOH 11  2011 2011 HOH HOH C . 
I 4 HOH 12  2012 2012 HOH HOH C . 
I 4 HOH 13  2013 2013 HOH HOH C . 
I 4 HOH 14  2014 2014 HOH HOH C . 
I 4 HOH 15  2015 2015 HOH HOH C . 
I 4 HOH 16  2016 2016 HOH HOH C . 
I 4 HOH 17  2017 2017 HOH HOH C . 
I 4 HOH 18  2018 2018 HOH HOH C . 
I 4 HOH 19  2019 2019 HOH HOH C . 
I 4 HOH 20  2020 2020 HOH HOH C . 
I 4 HOH 21  2021 2021 HOH HOH C . 
I 4 HOH 22  2022 2022 HOH HOH C . 
I 4 HOH 23  2023 2023 HOH HOH C . 
I 4 HOH 24  2024 2024 HOH HOH C . 
I 4 HOH 25  2025 2025 HOH HOH C . 
I 4 HOH 26  2026 2026 HOH HOH C . 
I 4 HOH 27  2027 2027 HOH HOH C . 
I 4 HOH 28  2028 2028 HOH HOH C . 
I 4 HOH 29  2029 2029 HOH HOH C . 
I 4 HOH 30  2030 2030 HOH HOH C . 
I 4 HOH 31  2031 2031 HOH HOH C . 
I 4 HOH 32  2032 2032 HOH HOH C . 
I 4 HOH 33  2033 2033 HOH HOH C . 
I 4 HOH 34  2034 2034 HOH HOH C . 
I 4 HOH 35  2035 2035 HOH HOH C . 
I 4 HOH 36  2036 2036 HOH HOH C . 
I 4 HOH 37  2037 2037 HOH HOH C . 
I 4 HOH 38  2038 2038 HOH HOH C . 
I 4 HOH 39  2039 2039 HOH HOH C . 
I 4 HOH 40  2040 2040 HOH HOH C . 
I 4 HOH 41  2041 2041 HOH HOH C . 
I 4 HOH 42  2042 2042 HOH HOH C . 
I 4 HOH 43  2043 2043 HOH HOH C . 
I 4 HOH 44  2044 2044 HOH HOH C . 
I 4 HOH 45  2045 2045 HOH HOH C . 
I 4 HOH 46  2046 2046 HOH HOH C . 
I 4 HOH 47  2047 2047 HOH HOH C . 
I 4 HOH 48  2048 2048 HOH HOH C . 
I 4 HOH 49  2049 2049 HOH HOH C . 
I 4 HOH 50  2050 2050 HOH HOH C . 
I 4 HOH 51  2051 2051 HOH HOH C . 
I 4 HOH 52  2052 2052 HOH HOH C . 
I 4 HOH 53  2053 2053 HOH HOH C . 
I 4 HOH 54  2054 2054 HOH HOH C . 
I 4 HOH 55  2055 2055 HOH HOH C . 
I 4 HOH 56  2056 2056 HOH HOH C . 
I 4 HOH 57  2057 2057 HOH HOH C . 
I 4 HOH 58  2058 2058 HOH HOH C . 
I 4 HOH 59  2059 2059 HOH HOH C . 
I 4 HOH 60  2060 2060 HOH HOH C . 
I 4 HOH 61  2061 2061 HOH HOH C . 
I 4 HOH 62  2062 2062 HOH HOH C . 
I 4 HOH 63  2063 2063 HOH HOH C . 
I 4 HOH 64  2064 2064 HOH HOH C . 
I 4 HOH 65  2065 2065 HOH HOH C . 
I 4 HOH 66  2066 2066 HOH HOH C . 
I 4 HOH 67  2067 2067 HOH HOH C . 
I 4 HOH 68  2068 2068 HOH HOH C . 
I 4 HOH 69  2069 2069 HOH HOH C . 
I 4 HOH 70  2070 2070 HOH HOH C . 
I 4 HOH 71  2071 2071 HOH HOH C . 
I 4 HOH 72  2072 2072 HOH HOH C . 
I 4 HOH 73  2073 2073 HOH HOH C . 
I 4 HOH 74  2074 2074 HOH HOH C . 
I 4 HOH 75  2075 2075 HOH HOH C . 
I 4 HOH 76  2076 2076 HOH HOH C . 
I 4 HOH 77  2077 2077 HOH HOH C . 
J 4 HOH 1   2001 2001 HOH HOH D . 
J 4 HOH 2   2002 2002 HOH HOH D . 
J 4 HOH 3   2003 2003 HOH HOH D . 
J 4 HOH 4   2004 2004 HOH HOH D . 
J 4 HOH 5   2005 2005 HOH HOH D . 
J 4 HOH 6   2006 2006 HOH HOH D . 
J 4 HOH 7   2007 2007 HOH HOH D . 
J 4 HOH 8   2008 2008 HOH HOH D . 
J 4 HOH 9   2009 2009 HOH HOH D . 
J 4 HOH 10  2010 2010 HOH HOH D . 
J 4 HOH 11  2011 2011 HOH HOH D . 
J 4 HOH 12  2012 2012 HOH HOH D . 
J 4 HOH 13  2013 2013 HOH HOH D . 
J 4 HOH 14  2014 2014 HOH HOH D . 
J 4 HOH 15  2015 2015 HOH HOH D . 
J 4 HOH 16  2016 2016 HOH HOH D . 
J 4 HOH 17  2017 2017 HOH HOH D . 
J 4 HOH 18  2018 2018 HOH HOH D . 
J 4 HOH 19  2019 2019 HOH HOH D . 
J 4 HOH 20  2020 2020 HOH HOH D . 
J 4 HOH 21  2021 2021 HOH HOH D . 
J 4 HOH 22  2022 2022 HOH HOH D . 
J 4 HOH 23  2023 2023 HOH HOH D . 
J 4 HOH 24  2024 2024 HOH HOH D . 
J 4 HOH 25  2025 2025 HOH HOH D . 
J 4 HOH 26  2026 2026 HOH HOH D . 
J 4 HOH 27  2027 2027 HOH HOH D . 
J 4 HOH 28  2028 2028 HOH HOH D . 
J 4 HOH 29  2029 2029 HOH HOH D . 
J 4 HOH 30  2030 2030 HOH HOH D . 
J 4 HOH 31  2031 2031 HOH HOH D . 
J 4 HOH 32  2032 2032 HOH HOH D . 
J 4 HOH 33  2033 2033 HOH HOH D . 
J 4 HOH 34  2034 2034 HOH HOH D . 
J 4 HOH 35  2035 2035 HOH HOH D . 
J 4 HOH 36  2036 2036 HOH HOH D . 
J 4 HOH 37  2037 2037 HOH HOH D . 
J 4 HOH 38  2038 2038 HOH HOH D . 
J 4 HOH 39  2039 2039 HOH HOH D . 
J 4 HOH 40  2040 2040 HOH HOH D . 
J 4 HOH 41  2041 2041 HOH HOH D . 
J 4 HOH 42  2042 2042 HOH HOH D . 
J 4 HOH 43  2043 2043 HOH HOH D . 
J 4 HOH 44  2044 2044 HOH HOH D . 
J 4 HOH 45  2045 2045 HOH HOH D . 
J 4 HOH 46  2046 2046 HOH HOH D . 
J 4 HOH 47  2047 2047 HOH HOH D . 
J 4 HOH 48  2048 2048 HOH HOH D . 
J 4 HOH 49  2049 2049 HOH HOH D . 
J 4 HOH 50  2050 2050 HOH HOH D . 
J 4 HOH 51  2051 2051 HOH HOH D . 
J 4 HOH 52  2052 2052 HOH HOH D . 
J 4 HOH 53  2053 2053 HOH HOH D . 
J 4 HOH 54  2054 2054 HOH HOH D . 
J 4 HOH 55  2055 2055 HOH HOH D . 
J 4 HOH 56  2056 2056 HOH HOH D . 
J 4 HOH 57  2057 2057 HOH HOH D . 
J 4 HOH 58  2058 2058 HOH HOH D . 
J 4 HOH 59  2059 2059 HOH HOH D . 
J 4 HOH 60  2060 2060 HOH HOH D . 
J 4 HOH 61  2061 2061 HOH HOH D . 
J 4 HOH 62  2062 2062 HOH HOH D . 
J 4 HOH 63  2063 2063 HOH HOH D . 
J 4 HOH 64  2064 2064 HOH HOH D . 
J 4 HOH 65  2065 2065 HOH HOH D . 
J 4 HOH 66  2066 2066 HOH HOH D . 
J 4 HOH 67  2067 2067 HOH HOH D . 
J 4 HOH 68  2068 2068 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 161 A TPO 160 ? THR PHOSPHOTHREONINE 
2 C TPO 161 C TPO 160 ? THR PHOSPHOTHREONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G,H 
2 1 C,D,F,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-10-11 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.0 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
MOLREP phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             1E9H 
_pdbx_entry_details.compound_details     
;THE CDK2 SHOWS MAXIMAL ACTIVITY DURING S PHASE AND G2 AND
 INTERACTS WITH CYCLINS A, D, OR E. IT IS PROBABLY
 INVOLVED IN THE CONTROL OF THE CELL CYCLE.
 CYCLIN IS ESSENTIAL FOR THE CONTROL OF THE CELL CYCLE AT THE
 G1/S(START) AND THE G2/M (MITOSIS) TRANSITIONS.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A TRP 227  ? ? O A HOH 2094 ? ? 1.73 
2 1 N A VAL 230  ? ? O A HOH 2094 ? ? 1.89 
3 1 O A HOH 2034 ? ? O A HOH 2090 ? ? 1.96 
4 1 O A HOH 2106 ? ? O A HOH 2109 ? ? 2.13 
5 1 N A GLY 229  ? ? O A HOH 2094 ? ? 2.15 
6 1 O B HOH 2014 ? ? O B HOH 2097 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C C MET 233 ? ? N  C PRO 234 ? ? CA C PRO 234 ? ? 128.67 119.30 9.37   1.50 Y 
2 1 C C PHE 240 ? ? N  C PRO 241 ? ? CA C PRO 241 ? ? 142.97 119.30 23.67  1.50 Y 
3 1 C C PHE 240 ? ? N  C PRO 241 ? ? CD C PRO 241 ? ? 107.50 128.40 -20.90 2.10 Y 
4 1 N C PRO 241 ? ? CA C PRO 241 ? ? C  C PRO 241 ? ? 129.99 112.10 17.89  2.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 8   ? ? -176.84 143.42  
2  1 ILE A 10  ? ? -131.93 -37.43  
3  1 LEU A 37  ? ? -109.95 -96.69  
4  1 ASP A 38  ? ? 88.42   20.54   
5  1 THR A 39  ? ? 51.39   -165.99 
6  1 GLU A 40  ? ? 13.52   63.45   
7  1 THR A 41  ? ? -156.91 -115.92 
8  1 ALA A 95  ? ? -34.15  -32.60  
9  1 ASP A 127 ? ? -160.66 38.64   
10 1 ASP A 145 ? ? 51.68   79.15   
11 1 PHE A 146 ? ? -95.02  38.05   
12 1 GLU A 162 ? ? -67.77  69.60   
13 1 VAL A 164 ? ? 74.60   131.04  
14 1 SER A 181 ? ? -138.97 -145.16 
15 1 ARG A 199 ? ? 86.57   7.43    
16 1 ALA A 201 ? ? -17.94  125.37  
17 1 PRO A 204 ? ? -91.09  57.22   
18 1 THR A 231 ? ? -47.62  -10.22  
19 1 ASP A 270 ? ? -58.72  108.59  
20 1 ILE A 275 ? ? -39.87  140.66  
21 1 LYS A 291 ? ? -106.40 73.95   
22 1 PRO A 292 ? ? -52.81  -111.17 
23 1 VAL A 293 ? ? 178.64  156.54  
24 1 ASP B 283 ? ? 38.17   49.79   
25 1 CYS B 327 ? ? -29.98  -50.99  
26 1 TRP B 372 ? ? -25.97  114.63  
27 1 TYR B 413 ? ? -77.90  24.84   
28 1 GLU C 8   ? ? -173.50 128.65  
29 1 TYR C 15  ? ? -132.02 -85.54  
30 1 ASP C 38  ? ? 63.01   -6.61   
31 1 THR C 39  ? ? 82.05   -134.08 
32 1 GLU C 40  ? ? -29.60  111.18  
33 1 THR C 41  ? ? 159.60  -83.59  
34 1 GLU C 42  ? ? -142.55 11.37   
35 1 LEU C 96  ? ? -87.91  -71.80  
36 1 ASP C 127 ? ? -155.99 38.08   
37 1 LYS C 129 ? ? -176.84 146.32  
38 1 PRO C 130 ? ? -38.23  -31.79  
39 1 ASP C 145 ? ? 46.31   80.97   
40 1 GLU C 162 ? ? -65.73  79.61   
41 1 VAL C 164 ? ? 71.87   130.47  
42 1 LEU C 166 ? ? -26.81  -69.86  
43 1 SER C 181 ? ? -163.61 -149.29 
44 1 THR C 182 ? ? -39.71  -37.81  
45 1 ARG C 199 ? ? 93.42   -7.34   
46 1 ASP C 223 ? ? 160.73  161.11  
47 1 GLU C 224 ? ? -32.67  -34.48  
48 1 PRO C 234 ? ? -11.86  -57.58  
49 1 SER C 239 ? ? -60.41  9.82    
50 1 PRO C 241 ? ? 23.35   162.19  
51 1 ARG C 245 ? ? -57.52  102.23  
52 1 VAL C 251 ? ? -41.12  -78.04  
53 1 ALA C 282 ? ? -103.55 40.32   
54 1 VAL C 289 ? ? -32.13  144.69  
55 1 THR C 290 ? ? -125.75 -140.81 
56 1 LYS C 291 ? ? -153.26 69.18   
57 1 PRO D 176 ? ? -71.07  35.17   
58 1 PRO D 195 ? ? -53.95  173.62  
59 1 GLN D 228 ? ? -48.15  153.97  
60 1 ASP D 284 ? ? 31.76   59.18   
61 1 HIS D 321 ? ? -90.50  50.91   
62 1 ALA D 325 ? ? -30.46  114.55  
63 1 TYR D 347 ? ? -35.07  -17.80  
64 1 TRP D 372 ? ? -35.40  99.14   
65 1 PRO D 373 ? ? -41.07  151.46  
66 1 ALA D 401 ? ? -25.62  -57.01  
67 1 LEU D 424 ? ? -54.29  173.58  
68 1 ASN D 431 ? ? 50.64   71.27   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      D 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2001 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.91 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 0   ? A SER 1   
2 1 Y 1 B LEU 433 ? B LEU 259 
3 1 Y 1 B ASN 434 ? B ASN 260 
4 1 Y 1 B LEU 435 ? B LEU 261 
5 1 Y 1 D LEU 433 ? D LEU 259 
6 1 Y 1 D ASN 434 ? D ASN 260 
7 1 Y 1 D LEU 435 ? D LEU 261 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 
;2',3-DIOXO-1,1',2',3-TETRAHYDRO-2,3'-BIINDOLE-5'-SULFONIC ACID
;
INR 
4 water                                                            HOH 
#