data_1E9T
# 
_entry.id   1E9T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1E9T         
PDBE  EBI-5458     
WWPDB D_1290005458 
BMRB  5771         
# 
_pdbx_database_related.db_id          5771 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1E9T 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lemercinier, X.' 1 
'Muskett, F.'     2 
'Cheeseman, B.'   3 
'McIntosh, P.'    4 
'Carr, M.'        5 
# 
_citation.id                        primary 
_citation.title                     
;High-Resolution Solution Structure of Human Intestinal Trefoil Factor and Functional Insights from Detailed Structural Comparisons with the Other Members of the Trefoil Family of Mammalian Cell Motility Factors
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                9552 
_citation.page_last                 ? 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11583154 
_citation.pdbx_database_id_DOI      10.1021/BI010184+ 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lemercinier, X.' 1 
primary 'Muskett, F.W.'   2 
primary 'Cheeseman, B.'   3 
primary 'Mcintosh, P.B.'  4 
primary 'Thim, L.'        5 
primary 'Carr, M.D.'      6 
# 
_cell.entry_id           1E9T 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1E9T 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'INTESTINAL TREFOIL FACTOR' 
_entity.formula_weight             6587.457 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HITF 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 
_entity_poly.pdbx_seq_one_letter_code_can   EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  GLU n 
1 3  TYR n 
1 4  VAL n 
1 5  GLY n 
1 6  LEU n 
1 7  SER n 
1 8  ALA n 
1 9  ASN n 
1 10 GLN n 
1 11 CYS n 
1 12 ALA n 
1 13 VAL n 
1 14 PRO n 
1 15 ALA n 
1 16 LYS n 
1 17 ASP n 
1 18 ARG n 
1 19 VAL n 
1 20 ASP n 
1 21 CYS n 
1 22 GLY n 
1 23 TYR n 
1 24 PRO n 
1 25 HIS n 
1 26 VAL n 
1 27 THR n 
1 28 PRO n 
1 29 LYS n 
1 30 GLU n 
1 31 CYS n 
1 32 ASN n 
1 33 ASN n 
1 34 ARG n 
1 35 GLY n 
1 36 CYS n 
1 37 CYS n 
1 38 PHE n 
1 39 ASP n 
1 40 SER n 
1 41 ARG n 
1 42 ILE n 
1 43 PRO n 
1 44 GLY n 
1 45 VAL n 
1 46 PRO n 
1 47 TRP n 
1 48 CYS n 
1 49 PHE n 
1 50 LYS n 
1 51 PRO n 
1 52 LEU n 
1 53 GLN n 
1 54 GLU n 
1 55 ALA n 
1 56 GLU n 
1 57 CYS n 
1 58 THR n 
1 59 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'SACCHAROMYCES CEREVISIAE' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4932 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               MT-663 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PHW 1066' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'RECOMBINANT HITF PRODUCED IN A YEAST EXPRESSION VECTOR.' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITF_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q07654 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1E9T 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 59 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q07654 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  80 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       59 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 NOESY                1 
2 1 ROESY                1 
3 1 'TOCSY AND DQF-COSY' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            308 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '25 MM POTASSIUM PHOSPHATE AND 100 MM POTASSIUM CHLORIDE' 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 UNITY     Varian 500 ? 
2 UNITYPLUS Varian 500 ? 
# 
_pdbx_nmr_refine.entry_id           1E9T 
_pdbx_nmr_refine.method             'SIMULATED ANNEALING COMBINED WITH TORSION ANGLE DYNAMICS' 
_pdbx_nmr_refine.details            
;AFTER THE FINAL DYANA CALCULATIONS, 85 SATISFACTORILY CONVERGED HITF STRUCTURES WERE OBTAINED FROM 100 RANDOM STARTING CONFORMATIONS. THE CONVERGED STRUCTURES CONTAIN NO DISTANCE CONSTRAINT OR VAN DER WAALS VIOLATIONS GREATER THAN 0.5 A AND NO DIHEDRAL ANGLE VIOLATIONS GREATER THAN 5 DEGREES, WITH AN AVERAGE VALUE FOR THE DYANA TARGET FUNCTION OF 4.33.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1E9T 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED FROM 2D 1H NMR DATA ACQUIRED FROM SAMPLES OF HITF' 
# 
_pdbx_nmr_ensemble.entry_id                             1E9T 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    85 
_pdbx_nmr_ensemble.conformer_selection_criteria         'CONSISTENCY WITH THE NMR STRUCTURAL DATA' 
# 
_pdbx_nmr_representative.entry_id             1E9T 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           DYANA ? GUNTERT,WUTHRICH 1 
'structure solution' XEASY ? ?                2 
'structure solution' DYANA ? ?                3 
# 
_exptl.entry_id          1E9T 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1E9T 
_struct.title                     'High resolution solution structure of human intestinal trefoil factor' 
_struct.pdbx_descriptor           'INTESTINAL TREFOIL FACTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1E9T 
_struct_keywords.pdbx_keywords   'CELL MOTILITY FACTOR' 
_struct_keywords.text            
'INTESTINAL TREFOIL FACTOR, SOLUTION STRUCTURE, TREFOIL DOMAIN, NMR SPECTROSCOPY, CELL MOTILITY FACTOR' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H2 LYS A 29 ? ARG A 34 ? LYS A 29 ARG A 34 1 'ALPHA HELIX' 6 
HELX_P HELX_P2 H1 ASN A 9  ? CYS A 11 ? ASN A 9  CYS A 11 5 '3-10 HELIX'  3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 11 A CYS 37 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf2 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 21 A CYS 36 1_555 ? ? ? ? ? ? ? 1.935 ? 
disulf3 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 31 A CYS 48 1_555 ? ? ? ? ? ? ? 1.832 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 1 ? 
S2 ? 1 ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 CYS A 36 ? ASP A 39 ? CYS A 36 ASP A 39 
S2 1 TRP A 47 ? LYS A 50 ? TRP A 47 LYS A 50 
# 
_database_PDB_matrix.entry_id          1E9T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1E9T 
_atom_sites.fract_transf_matrix[1][1]   0.001000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.001000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLU A 1 1  ? 8.014   -14.630 8.682   1.00 0.00 ? 1  GLU A N    1  
ATOM 2     C CA   . GLU A 1 1  ? 8.033   -15.770 9.582   1.00 0.00 ? 1  GLU A CA   1  
ATOM 3     C C    . GLU A 1 1  ? 7.427   -15.390 10.935  1.00 0.00 ? 1  GLU A C    1  
ATOM 4     O O    . GLU A 1 1  ? 8.016   -15.658 11.981  1.00 0.00 ? 1  GLU A O    1  
ATOM 5     C CB   . GLU A 1 1  ? 9.454   -16.311 9.752   1.00 0.00 ? 1  GLU A CB   1  
ATOM 6     C CG   . GLU A 1 1  ? 9.470   -17.840 9.693   1.00 0.00 ? 1  GLU A CG   1  
ATOM 7     C CD   . GLU A 1 1  ? 10.209  -18.333 8.447   1.00 0.00 ? 1  GLU A CD   1  
ATOM 8     O OE1  . GLU A 1 1  ? 9.673   -18.104 7.341   1.00 0.00 ? 1  GLU A OE1  1  
ATOM 9     O OE2  . GLU A 1 1  ? 11.293  -18.929 8.629   1.00 0.00 ? 1  GLU A OE2  1  
ATOM 10    H H    . GLU A 1 1  ? 8.850   -14.498 8.149   1.00 0.00 ? 1  GLU A H    1  
ATOM 11    H HA   . GLU A 1 1  ? 7.417   -16.530 9.101   1.00 0.00 ? 1  GLU A HA   1  
ATOM 12    H HB2  . GLU A 1 1  ? 10.097  -15.907 8.970   1.00 0.00 ? 1  GLU A HB2  1  
ATOM 13    H HB3  . GLU A 1 1  ? 9.864   -15.977 10.705  1.00 0.00 ? 1  GLU A HB3  1  
ATOM 14    H HG2  . GLU A 1 1  ? 9.951   -18.237 10.586  1.00 0.00 ? 1  GLU A HG2  1  
ATOM 15    H HG3  . GLU A 1 1  ? 8.447   -18.218 9.687   1.00 0.00 ? 1  GLU A HG3  1  
ATOM 16    N N    . GLU A 1 2  ? 6.257   -14.770 10.869  1.00 0.00 ? 2  GLU A N    1  
ATOM 17    C CA   . GLU A 1 2  ? 5.565   -14.350 12.075  1.00 0.00 ? 2  GLU A CA   1  
ATOM 18    C C    . GLU A 1 2  ? 4.215   -13.724 11.721  1.00 0.00 ? 2  GLU A C    1  
ATOM 19    O O    . GLU A 1 2  ? 3.200   -14.032 12.345  1.00 0.00 ? 2  GLU A O    1  
ATOM 20    C CB   . GLU A 1 2  ? 6.422   -13.380 12.890  1.00 0.00 ? 2  GLU A CB   1  
ATOM 21    C CG   . GLU A 1 2  ? 6.304   -13.669 14.388  1.00 0.00 ? 2  GLU A CG   1  
ATOM 22    C CD   . GLU A 1 2  ? 7.535   -13.164 15.143  1.00 0.00 ? 2  GLU A CD   1  
ATOM 23    O OE1  . GLU A 1 2  ? 8.540   -13.908 15.151  1.00 0.00 ? 2  GLU A OE1  1  
ATOM 24    O OE2  . GLU A 1 2  ? 7.444   -12.047 15.695  1.00 0.00 ? 2  GLU A OE2  1  
ATOM 25    H H    . GLU A 1 2  ? 5.785   -14.556 10.014  1.00 0.00 ? 2  GLU A H    1  
ATOM 26    H HA   . GLU A 1 2  ? 5.410   -15.261 12.653  1.00 0.00 ? 2  GLU A HA   1  
ATOM 27    H HB2  . GLU A 1 2  ? 7.464   -13.463 12.582  1.00 0.00 ? 2  GLU A HB2  1  
ATOM 28    H HB3  . GLU A 1 2  ? 6.111   -12.355 12.688  1.00 0.00 ? 2  GLU A HB3  1  
ATOM 29    H HG2  . GLU A 1 2  ? 5.408   -13.190 14.785  1.00 0.00 ? 2  GLU A HG2  1  
ATOM 30    H HG3  . GLU A 1 2  ? 6.189   -14.741 14.547  1.00 0.00 ? 2  GLU A HG3  1  
ATOM 31    N N    . TYR A 1 3  ? 4.246   -12.855 10.721  1.00 0.00 ? 3  TYR A N    1  
ATOM 32    C CA   . TYR A 1 3  ? 3.037   -12.182 10.276  1.00 0.00 ? 3  TYR A CA   1  
ATOM 33    C C    . TYR A 1 3  ? 2.321   -11.509 11.449  1.00 0.00 ? 3  TYR A C    1  
ATOM 34    O O    . TYR A 1 3  ? 1.571   -12.157 12.178  1.00 0.00 ? 3  TYR A O    1  
ATOM 35    C CB   . TYR A 1 3  ? 2.133   -13.275 9.702   1.00 0.00 ? 3  TYR A CB   1  
ATOM 36    C CG   . TYR A 1 3  ? 0.958   -12.742 8.879   1.00 0.00 ? 3  TYR A CG   1  
ATOM 37    C CD1  . TYR A 1 3  ? -0.197  -12.331 9.512   1.00 0.00 ? 3  TYR A CD1  1  
ATOM 38    C CD2  . TYR A 1 3  ? 1.055   -12.673 7.504   1.00 0.00 ? 3  TYR A CD2  1  
ATOM 39    C CE1  . TYR A 1 3  ? -1.303  -11.829 8.737   1.00 0.00 ? 3  TYR A CE1  1  
ATOM 40    C CE2  . TYR A 1 3  ? -0.051  -12.171 6.729   1.00 0.00 ? 3  TYR A CE2  1  
ATOM 41    C CZ   . TYR A 1 3  ? -1.175  -11.774 7.384   1.00 0.00 ? 3  TYR A CZ   1  
ATOM 42    O OH   . TYR A 1 3  ? -2.219  -11.301 6.653   1.00 0.00 ? 3  TYR A OH   1  
ATOM 43    H H    . TYR A 1 3  ? 5.075   -12.609 10.219  1.00 0.00 ? 3  TYR A H    1  
ATOM 44    H HA   . TYR A 1 3  ? 3.323   -11.421 9.550   1.00 0.00 ? 3  TYR A HA   1  
ATOM 45    H HB2  . TYR A 1 3  ? 2.732   -13.935 9.075   1.00 0.00 ? 3  TYR A HB2  1  
ATOM 46    H HB3  . TYR A 1 3  ? 1.745   -13.879 10.522  1.00 0.00 ? 3  TYR A HB3  1  
ATOM 47    H HD1  . TYR A 1 3  ? -0.273  -12.386 10.598  1.00 0.00 ? 3  TYR A HD1  1  
ATOM 48    H HD2  . TYR A 1 3  ? 1.967   -12.997 7.004   1.00 0.00 ? 3  TYR A HD2  1  
ATOM 49    H HE1  . TYR A 1 3  ? -2.221  -11.502 9.224   1.00 0.00 ? 3  TYR A HE1  1  
ATOM 50    H HE2  . TYR A 1 3  ? 0.012   -12.111 5.643   1.00 0.00 ? 3  TYR A HE2  1  
ATOM 51    H HH   . TYR A 1 3  ? -2.927  -10.940 7.260   1.00 0.00 ? 3  TYR A HH   1  
ATOM 52    N N    . VAL A 1 4  ? 2.577   -10.217 11.595  1.00 0.00 ? 4  VAL A N    1  
ATOM 53    C CA   . VAL A 1 4  ? 1.966   -9.450  12.667  1.00 0.00 ? 4  VAL A CA   1  
ATOM 54    C C    . VAL A 1 4  ? 2.155   -7.957  12.391  1.00 0.00 ? 4  VAL A C    1  
ATOM 55    O O    . VAL A 1 4  ? 2.634   -7.219  13.250  1.00 0.00 ? 4  VAL A O    1  
ATOM 56    C CB   . VAL A 1 4  ? 2.541   -9.886  14.016  1.00 0.00 ? 4  VAL A CB   1  
ATOM 57    C CG1  . VAL A 1 4  ? 4.060   -9.713  14.046  1.00 0.00 ? 4  VAL A CG1  1  
ATOM 58    C CG2  . VAL A 1 4  ? 1.879   -9.123  15.166  1.00 0.00 ? 4  VAL A CG2  1  
ATOM 59    H H    . VAL A 1 4  ? 3.188   -9.698  10.998  1.00 0.00 ? 4  VAL A H    1  
ATOM 60    H HA   . VAL A 1 4  ? 0.899   -9.674  12.666  1.00 0.00 ? 4  VAL A HA   1  
ATOM 61    H HB   . VAL A 1 4  ? 2.321   -10.945 14.147  1.00 0.00 ? 4  VAL A HB   1  
ATOM 62    H HG11 . VAL A 1 4  ? 4.341   -8.855  13.435  1.00 0.00 ? 4  VAL A HG11 1  
ATOM 63    H HG12 . VAL A 1 4  ? 4.387   -9.549  15.073  1.00 0.00 ? 4  VAL A HG12 1  
ATOM 64    H HG13 . VAL A 1 4  ? 4.536   -10.611 13.652  1.00 0.00 ? 4  VAL A HG13 1  
ATOM 65    H HG21 . VAL A 1 4  ? 0.807   -9.050  14.983  1.00 0.00 ? 4  VAL A HG21 1  
ATOM 66    H HG22 . VAL A 1 4  ? 2.053   -9.655  16.101  1.00 0.00 ? 4  VAL A HG22 1  
ATOM 67    H HG23 . VAL A 1 4  ? 2.306   -8.123  15.232  1.00 0.00 ? 4  VAL A HG23 1  
ATOM 68    N N    . GLY A 1 5  ? 1.769   -7.556  11.188  1.00 0.00 ? 5  GLY A N    1  
ATOM 69    C CA   . GLY A 1 5  ? 1.891   -6.165  10.788  1.00 0.00 ? 5  GLY A CA   1  
ATOM 70    C C    . GLY A 1 5  ? 1.078   -5.256  11.712  1.00 0.00 ? 5  GLY A C    1  
ATOM 71    O O    . GLY A 1 5  ? -0.150  -5.228  11.639  1.00 0.00 ? 5  GLY A O    1  
ATOM 72    H H    . GLY A 1 5  ? 1.381   -8.163  10.495  1.00 0.00 ? 5  GLY A H    1  
ATOM 73    H HA2  . GLY A 1 5  ? 2.939   -5.867  10.809  1.00 0.00 ? 5  GLY A HA2  1  
ATOM 74    H HA3  . GLY A 1 5  ? 1.546   -6.047  9.761   1.00 0.00 ? 5  GLY A HA3  1  
ATOM 75    N N    . LEU A 1 6  ? 1.796   -4.535  12.561  1.00 0.00 ? 6  LEU A N    1  
ATOM 76    C CA   . LEU A 1 6  ? 1.157   -3.627  13.498  1.00 0.00 ? 6  LEU A CA   1  
ATOM 77    C C    . LEU A 1 6  ? 1.467   -2.184  13.097  1.00 0.00 ? 6  LEU A C    1  
ATOM 78    O O    . LEU A 1 6  ? 0.676   -1.279  13.358  1.00 0.00 ? 6  LEU A O    1  
ATOM 79    C CB   . LEU A 1 6  ? 1.562   -3.967  14.934  1.00 0.00 ? 6  LEU A CB   1  
ATOM 80    C CG   . LEU A 1 6  ? 3.060   -3.906  15.240  1.00 0.00 ? 6  LEU A CG   1  
ATOM 81    C CD1  . LEU A 1 6  ? 3.472   -2.501  15.683  1.00 0.00 ? 6  LEU A CD1  1  
ATOM 82    C CD2  . LEU A 1 6  ? 3.453   -4.969  16.268  1.00 0.00 ? 6  LEU A CD2  1  
ATOM 83    H H    . LEU A 1 6  ? 2.794   -4.564  12.614  1.00 0.00 ? 6  LEU A H    1  
ATOM 84    H HA   . LEU A 1 6  ? 0.080   -3.783  13.422  1.00 0.00 ? 6  LEU A HA   1  
ATOM 85    H HB2  . LEU A 1 6  ? 1.046   -3.283  15.608  1.00 0.00 ? 6  LEU A HB2  1  
ATOM 86    H HB3  . LEU A 1 6  ? 1.205   -4.971  15.164  1.00 0.00 ? 6  LEU A HB3  1  
ATOM 87    H HG   . LEU A 1 6  ? 3.605   -4.127  14.323  1.00 0.00 ? 6  LEU A HG   1  
ATOM 88    H HD11 . LEU A 1 6  ? 2.631   -1.819  15.559  1.00 0.00 ? 6  LEU A HD11 1  
ATOM 89    H HD12 . LEU A 1 6  ? 3.771   -2.523  16.731  1.00 0.00 ? 6  LEU A HD12 1  
ATOM 90    H HD13 . LEU A 1 6  ? 4.309   -2.159  15.074  1.00 0.00 ? 6  LEU A HD13 1  
ATOM 91    H HD21 . LEU A 1 6  ? 2.741   -4.958  17.093  1.00 0.00 ? 6  LEU A HD21 1  
ATOM 92    H HD22 . LEU A 1 6  ? 3.446   -5.951  15.795  1.00 0.00 ? 6  LEU A HD22 1  
ATOM 93    H HD23 . LEU A 1 6  ? 4.453   -4.756  16.647  1.00 0.00 ? 6  LEU A HD23 1  
ATOM 94    N N    . SER A 1 7  ? 2.621   -2.014  12.468  1.00 0.00 ? 7  SER A N    1  
ATOM 95    C CA   . SER A 1 7  ? 3.046   -0.696  12.027  1.00 0.00 ? 7  SER A CA   1  
ATOM 96    C C    . SER A 1 7  ? 3.003   -0.616  10.500  1.00 0.00 ? 7  SER A C    1  
ATOM 97    O O    . SER A 1 7  ? 2.271   -1.364  9.856   1.00 0.00 ? 7  SER A O    1  
ATOM 98    C CB   . SER A 1 7  ? 4.451   -0.371  12.537  1.00 0.00 ? 7  SER A CB   1  
ATOM 99    O OG   . SER A 1 7  ? 5.456   -1.091  11.827  1.00 0.00 ? 7  SER A OG   1  
ATOM 100   H H    . SER A 1 7  ? 3.258   -2.755  12.259  1.00 0.00 ? 7  SER A H    1  
ATOM 101   H HA   . SER A 1 7  ? 2.331   0.000   12.467  1.00 0.00 ? 7  SER A HA   1  
ATOM 102   H HB2  . SER A 1 7  ? 4.634   0.699   12.439  1.00 0.00 ? 7  SER A HB2  1  
ATOM 103   H HB3  . SER A 1 7  ? 4.516   -0.610  13.599  1.00 0.00 ? 7  SER A HB3  1  
ATOM 104   H HG   . SER A 1 7  ? 5.969   -0.468  11.236  1.00 0.00 ? 7  SER A HG   1  
ATOM 105   N N    . ALA A 1 8  ? 3.799   0.299   9.965   1.00 0.00 ? 8  ALA A N    1  
ATOM 106   C CA   . ALA A 1 8  ? 3.862   0.487   8.526   1.00 0.00 ? 8  ALA A CA   1  
ATOM 107   C C    . ALA A 1 8  ? 5.089   -0.241  7.974   1.00 0.00 ? 8  ALA A C    1  
ATOM 108   O O    . ALA A 1 8  ? 5.661   0.174   6.967   1.00 0.00 ? 8  ALA A O    1  
ATOM 109   C CB   . ALA A 1 8  ? 3.878   1.983   8.206   1.00 0.00 ? 8  ALA A CB   1  
ATOM 110   H H    . ALA A 1 8  ? 4.392   0.904   10.496  1.00 0.00 ? 8  ALA A H    1  
ATOM 111   H HA   . ALA A 1 8  ? 2.963   0.046   8.094   1.00 0.00 ? 8  ALA A HA   1  
ATOM 112   H HB1  . ALA A 1 8  ? 4.899   2.296   7.986   1.00 0.00 ? 8  ALA A HB1  1  
ATOM 113   H HB2  . ALA A 1 8  ? 3.503   2.542   9.063   1.00 0.00 ? 8  ALA A HB2  1  
ATOM 114   H HB3  . ALA A 1 8  ? 3.244   2.177   7.341   1.00 0.00 ? 8  ALA A HB3  1  
ATOM 115   N N    . ASN A 1 9  ? 5.458   -1.314  8.657   1.00 0.00 ? 9  ASN A N    1  
ATOM 116   C CA   . ASN A 1 9  ? 6.607   -2.104  8.248   1.00 0.00 ? 9  ASN A CA   1  
ATOM 117   C C    . ASN A 1 9  ? 6.444   -2.512  6.782   1.00 0.00 ? 9  ASN A C    1  
ATOM 118   O O    . ASN A 1 9  ? 7.310   -2.230  5.956   1.00 0.00 ? 9  ASN A O    1  
ATOM 119   C CB   . ASN A 1 9  ? 6.725   -3.380  9.084   1.00 0.00 ? 9  ASN A CB   1  
ATOM 120   C CG   . ASN A 1 9  ? 8.066   -3.432  9.819   1.00 0.00 ? 9  ASN A CG   1  
ATOM 121   O OD1  . ASN A 1 9  ? 8.209   -2.967  10.937  1.00 0.00 ? 9  ASN A OD1  1  
ATOM 122   N ND2  . ASN A 1 9  ? 9.038   -4.023  9.129   1.00 0.00 ? 9  ASN A ND2  1  
ATOM 123   H H    . ASN A 1 9  ? 4.988   -1.645  9.475   1.00 0.00 ? 9  ASN A H    1  
ATOM 124   H HA   . ASN A 1 9  ? 7.470   -1.457  8.407   1.00 0.00 ? 9  ASN A HA   1  
ATOM 125   H HB2  . ASN A 1 9  ? 5.909   -3.423  9.806   1.00 0.00 ? 9  ASN A HB2  1  
ATOM 126   H HB3  . ASN A 1 9  ? 6.625   -4.252  8.438   1.00 0.00 ? 9  ASN A HB3  1  
ATOM 127   H HD21 . ASN A 1 9  ? 8.854   -4.384  8.215   1.00 0.00 ? 9  ASN A HD21 1  
ATOM 128   H HD22 . ASN A 1 9  ? 9.952   -4.106  9.525   1.00 0.00 ? 9  ASN A HD22 1  
ATOM 129   N N    . GLN A 1 10 ? 5.328   -3.170  6.505   1.00 0.00 ? 10 GLN A N    1  
ATOM 130   C CA   . GLN A 1 10 ? 5.040   -3.620  5.154   1.00 0.00 ? 10 GLN A CA   1  
ATOM 131   C C    . GLN A 1 10 ? 4.888   -2.420  4.216   1.00 0.00 ? 10 GLN A C    1  
ATOM 132   O O    . GLN A 1 10 ? 5.172   -2.520  3.024   1.00 0.00 ? 10 GLN A O    1  
ATOM 133   C CB   . GLN A 1 10 ? 3.789   -4.501  5.124   1.00 0.00 ? 10 GLN A CB   1  
ATOM 134   C CG   . GLN A 1 10 ? 2.639   -3.847  5.893   1.00 0.00 ? 10 GLN A CG   1  
ATOM 135   C CD   . GLN A 1 10 ? 2.333   -4.616  7.180   1.00 0.00 ? 10 GLN A CD   1  
ATOM 136   O OE1  . GLN A 1 10 ? 1.928   -5.767  7.164   1.00 0.00 ? 10 GLN A OE1  1  
ATOM 137   N NE2  . GLN A 1 10 ? 2.549   -3.918  8.291   1.00 0.00 ? 10 GLN A NE2  1  
ATOM 138   H H    . GLN A 1 10 ? 4.628   -3.395  7.184   1.00 0.00 ? 10 GLN A H    1  
ATOM 139   H HA   . GLN A 1 10 ? 5.903   -4.215  4.857   1.00 0.00 ? 10 GLN A HA   1  
ATOM 140   H HB2  . GLN A 1 10 ? 3.488   -4.676  4.091   1.00 0.00 ? 10 GLN A HB2  1  
ATOM 141   H HB3  . GLN A 1 10 ? 4.015   -5.474  5.559   1.00 0.00 ? 10 GLN A HB3  1  
ATOM 142   H HG2  . GLN A 1 10 ? 2.898   -2.816  6.134   1.00 0.00 ? 10 GLN A HG2  1  
ATOM 143   H HG3  . GLN A 1 10 ? 1.750   -3.814  5.265   1.00 0.00 ? 10 GLN A HG3  1  
ATOM 144   H HE21 . GLN A 1 10 ? 2.882   -2.977  8.234   1.00 0.00 ? 10 GLN A HE21 1  
ATOM 145   H HE22 . GLN A 1 10 ? 2.377   -4.335  9.184   1.00 0.00 ? 10 GLN A HE22 1  
ATOM 146   N N    . CYS A 1 11 ? 4.441   -1.313  4.791   1.00 0.00 ? 11 CYS A N    1  
ATOM 147   C CA   . CYS A 1 11 ? 4.248   -0.096  4.021   1.00 0.00 ? 11 CYS A CA   1  
ATOM 148   C C    . CYS A 1 11 ? 5.248   0.950   4.518   1.00 0.00 ? 11 CYS A C    1  
ATOM 149   O O    . CYS A 1 11 ? 4.881   2.099   4.761   1.00 0.00 ? 11 CYS A O    1  
ATOM 150   C CB   . CYS A 1 11 ? 2.805   0.406   4.109   1.00 0.00 ? 11 CYS A CB   1  
ATOM 151   S SG   . CYS A 1 11 ? 1.566   -0.883  4.498   1.00 0.00 ? 11 CYS A SG   1  
ATOM 152   H H    . CYS A 1 11 ? 4.212   -1.240  5.761   1.00 0.00 ? 11 CYS A H    1  
ATOM 153   H HA   . CYS A 1 11 ? 4.440   -0.351  2.979   1.00 0.00 ? 11 CYS A HA   1  
ATOM 154   H HB2  . CYS A 1 11 ? 2.752   1.183   4.872   1.00 0.00 ? 11 CYS A HB2  1  
ATOM 155   H HB3  . CYS A 1 11 ? 2.539   0.872   3.160   1.00 0.00 ? 11 CYS A HB3  1  
ATOM 156   N N    . ALA A 1 12 ? 6.492   0.515   4.654   1.00 0.00 ? 12 ALA A N    1  
ATOM 157   C CA   . ALA A 1 12 ? 7.548   1.400   5.117   1.00 0.00 ? 12 ALA A CA   1  
ATOM 158   C C    . ALA A 1 12 ? 8.595   1.559   4.013   1.00 0.00 ? 12 ALA A C    1  
ATOM 159   O O    . ALA A 1 12 ? 9.787   1.372   4.252   1.00 0.00 ? 12 ALA A O    1  
ATOM 160   C CB   . ALA A 1 12 ? 8.145   0.847   6.413   1.00 0.00 ? 12 ALA A CB   1  
ATOM 161   H H    . ALA A 1 12 ? 6.782   -0.421  4.454   1.00 0.00 ? 12 ALA A H    1  
ATOM 162   H HA   . ALA A 1 12 ? 7.099   2.371   5.324   1.00 0.00 ? 12 ALA A HA   1  
ATOM 163   H HB1  . ALA A 1 12 ? 9.181   1.173   6.503   1.00 0.00 ? 12 ALA A HB1  1  
ATOM 164   H HB2  . ALA A 1 12 ? 7.573   1.216   7.263   1.00 0.00 ? 12 ALA A HB2  1  
ATOM 165   H HB3  . ALA A 1 12 ? 8.108   -0.242  6.394   1.00 0.00 ? 12 ALA A HB3  1  
ATOM 166   N N    . VAL A 1 13 ? 8.112   1.903   2.828   1.00 0.00 ? 13 VAL A N    1  
ATOM 167   C CA   . VAL A 1 13 ? 8.991   2.089   1.687   1.00 0.00 ? 13 VAL A CA   1  
ATOM 168   C C    . VAL A 1 13 ? 9.408   3.559   1.605   1.00 0.00 ? 13 VAL A C    1  
ATOM 169   O O    . VAL A 1 13 ? 8.660   4.444   2.017   1.00 0.00 ? 13 VAL A O    1  
ATOM 170   C CB   . VAL A 1 13 ? 8.308   1.589   0.413   1.00 0.00 ? 13 VAL A CB   1  
ATOM 171   C CG1  . VAL A 1 13 ? 9.302   0.860   -0.493  1.00 0.00 ? 13 VAL A CG1  1  
ATOM 172   C CG2  . VAL A 1 13 ? 7.112   0.695   0.746   1.00 0.00 ? 13 VAL A CG2  1  
ATOM 173   H H    . VAL A 1 13 ? 7.140   2.052   2.643   1.00 0.00 ? 13 VAL A H    1  
ATOM 174   H HA   . VAL A 1 13 ? 9.880   1.481   1.854   1.00 0.00 ? 13 VAL A HA   1  
ATOM 175   H HB   . VAL A 1 13 ? 7.935   2.458   -0.130  1.00 0.00 ? 13 VAL A HB   1  
ATOM 176   H HG11 . VAL A 1 13 ? 10.185  0.586   0.084   1.00 0.00 ? 13 VAL A HG11 1  
ATOM 177   H HG12 . VAL A 1 13 ? 8.836   -0.040  -0.894  1.00 0.00 ? 13 VAL A HG12 1  
ATOM 178   H HG13 . VAL A 1 13 ? 9.594   1.515   -1.314  1.00 0.00 ? 13 VAL A HG13 1  
ATOM 179   H HG21 . VAL A 1 13 ? 7.358   0.064   1.601   1.00 0.00 ? 13 VAL A HG21 1  
ATOM 180   H HG22 . VAL A 1 13 ? 6.250   1.316   0.989   1.00 0.00 ? 13 VAL A HG22 1  
ATOM 181   H HG23 . VAL A 1 13 ? 6.877   0.067   -0.113  1.00 0.00 ? 13 VAL A HG23 1  
ATOM 182   N N    . PRO A 1 14 ? 10.633  3.779   1.055   1.00 0.00 ? 14 PRO A N    1  
ATOM 183   C CA   . PRO A 1 14 ? 11.158  5.126   0.914   1.00 0.00 ? 14 PRO A CA   1  
ATOM 184   C C    . PRO A 1 14 ? 10.471  5.865   -0.236  1.00 0.00 ? 14 PRO A C    1  
ATOM 185   O O    . PRO A 1 14 ? 10.801  7.014   -0.527  1.00 0.00 ? 14 PRO A O    1  
ATOM 186   C CB   . PRO A 1 14 ? 12.651  4.945   0.696   1.00 0.00 ? 14 PRO A CB   1  
ATOM 187   C CG   . PRO A 1 14 ? 12.837  3.501   0.260   1.00 0.00 ? 14 PRO A CG   1  
ATOM 188   C CD   . PRO A 1 14 ? 11.546  2.755   0.556   1.00 0.00 ? 14 PRO A CD   1  
ATOM 189   H HA   . PRO A 1 14 ? 10.966  5.662   1.736   1.00 0.00 ? 14 PRO A HA   1  
ATOM 190   H HB2  . PRO A 1 14 ? 13.021  5.633   -0.065  1.00 0.00 ? 14 PRO A HB2  1  
ATOM 191   H HB3  . PRO A 1 14 ? 13.208  5.152   1.610   1.00 0.00 ? 14 PRO A HB3  1  
ATOM 192   H HG2  . PRO A 1 14 ? 13.072  3.450   -0.803  1.00 0.00 ? 14 PRO A HG2  1  
ATOM 193   H HG3  . PRO A 1 14 ? 13.672  3.046   0.793   1.00 0.00 ? 14 PRO A HG3  1  
ATOM 194   H HD2  . PRO A 1 14 ? 11.151  2.275   -0.339  1.00 0.00 ? 14 PRO A HD2  1  
ATOM 195   H HD3  . PRO A 1 14 ? 11.703  1.970   1.296   1.00 0.00 ? 14 PRO A HD3  1  
ATOM 196   N N    . ALA A 1 15 ? 9.527   5.175   -0.860  1.00 0.00 ? 15 ALA A N    1  
ATOM 197   C CA   . ALA A 1 15 ? 8.791   5.751   -1.972  1.00 0.00 ? 15 ALA A CA   1  
ATOM 198   C C    . ALA A 1 15 ? 9.541   5.471   -3.276  1.00 0.00 ? 15 ALA A C    1  
ATOM 199   O O    . ALA A 1 15 ? 8.934   5.396   -4.343  1.00 0.00 ? 15 ALA A O    1  
ATOM 200   C CB   . ALA A 1 15 ? 8.585   7.248   -1.728  1.00 0.00 ? 15 ALA A CB   1  
ATOM 201   H H    . ALA A 1 15 ? 9.264   4.241   -0.618  1.00 0.00 ? 15 ALA A H    1  
ATOM 202   H HA   . ALA A 1 15 ? 7.816   5.265   -2.012  1.00 0.00 ? 15 ALA A HA   1  
ATOM 203   H HB1  . ALA A 1 15 ? 9.355   7.811   -2.256  1.00 0.00 ? 15 ALA A HB1  1  
ATOM 204   H HB2  . ALA A 1 15 ? 7.603   7.544   -2.096  1.00 0.00 ? 15 ALA A HB2  1  
ATOM 205   H HB3  . ALA A 1 15 ? 8.651   7.454   -0.660  1.00 0.00 ? 15 ALA A HB3  1  
ATOM 206   N N    . LYS A 1 16 ? 10.852  5.323   -3.146  1.00 0.00 ? 16 LYS A N    1  
ATOM 207   C CA   . LYS A 1 16 ? 11.692  5.052   -4.301  1.00 0.00 ? 16 LYS A CA   1  
ATOM 208   C C    . LYS A 1 16 ? 11.772  3.540   -4.524  1.00 0.00 ? 16 LYS A C    1  
ATOM 209   O O    . LYS A 1 16 ? 12.572  3.070   -5.332  1.00 0.00 ? 16 LYS A O    1  
ATOM 210   C CB   . LYS A 1 16 ? 13.057  5.723   -4.139  1.00 0.00 ? 16 LYS A CB   1  
ATOM 211   C CG   . LYS A 1 16 ? 13.836  5.108   -2.974  1.00 0.00 ? 16 LYS A CG   1  
ATOM 212   C CD   . LYS A 1 16 ? 14.668  3.912   -3.442  1.00 0.00 ? 16 LYS A CD   1  
ATOM 213   C CE   . LYS A 1 16 ? 16.159  4.152   -3.197  1.00 0.00 ? 16 LYS A CE   1  
ATOM 214   N NZ   . LYS A 1 16 ? 16.629  3.358   -2.040  1.00 0.00 ? 16 LYS A NZ   1  
ATOM 215   H H    . LYS A 1 16 ? 11.338  5.385   -2.275  1.00 0.00 ? 16 LYS A H    1  
ATOM 216   H HA   . LYS A 1 16 ? 11.211  5.504   -5.168  1.00 0.00 ? 16 LYS A HA   1  
ATOM 217   H HB2  . LYS A 1 16 ? 13.630  5.618   -5.060  1.00 0.00 ? 16 LYS A HB2  1  
ATOM 218   H HB3  . LYS A 1 16 ? 12.923  6.791   -3.968  1.00 0.00 ? 16 LYS A HB3  1  
ATOM 219   H HG2  . LYS A 1 16 ? 14.490  5.860   -2.533  1.00 0.00 ? 16 LYS A HG2  1  
ATOM 220   H HG3  . LYS A 1 16 ? 13.143  4.791   -2.195  1.00 0.00 ? 16 LYS A HG3  1  
ATOM 221   H HD2  . LYS A 1 16 ? 14.349  3.014   -2.913  1.00 0.00 ? 16 LYS A HD2  1  
ATOM 222   H HD3  . LYS A 1 16 ? 14.493  3.736   -4.503  1.00 0.00 ? 16 LYS A HD3  1  
ATOM 223   H HE2  . LYS A 1 16 ? 16.728  3.882   -4.087  1.00 0.00 ? 16 LYS A HE2  1  
ATOM 224   H HE3  . LYS A 1 16 ? 16.338  5.212   -3.015  1.00 0.00 ? 16 LYS A HE3  1  
ATOM 225   H HZ1  . LYS A 1 16 ? 15.998  3.480   -1.274  1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 226   H HZ2  . LYS A 1 16 ? 16.663  2.391   -2.292  1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 227   H HZ3  . LYS A 1 16 ? 17.542  3.666   -1.774  1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 228   N N    . ASP A 1 17 ? 10.933  2.821   -3.794  1.00 0.00 ? 17 ASP A N    1  
ATOM 229   C CA   . ASP A 1 17 ? 10.899  1.372   -3.902  1.00 0.00 ? 17 ASP A CA   1  
ATOM 230   C C    . ASP A 1 17 ? 9.445   0.906   -4.002  1.00 0.00 ? 17 ASP A C    1  
ATOM 231   O O    . ASP A 1 17 ? 9.143   -0.256  -3.736  1.00 0.00 ? 17 ASP A O    1  
ATOM 232   C CB   . ASP A 1 17 ? 11.524  0.713   -2.671  1.00 0.00 ? 17 ASP A CB   1  
ATOM 233   C CG   . ASP A 1 17 ? 12.728  -0.185  -2.958  1.00 0.00 ? 17 ASP A CG   1  
ATOM 234   O OD1  . ASP A 1 17 ? 12.659  -0.922  -3.965  1.00 0.00 ? 17 ASP A OD1  1  
ATOM 235   O OD2  . ASP A 1 17 ? 13.692  -0.113  -2.166  1.00 0.00 ? 17 ASP A OD2  1  
ATOM 236   H H    . ASP A 1 17 ? 10.285  3.211   -3.139  1.00 0.00 ? 17 ASP A H    1  
ATOM 237   H HA   . ASP A 1 17 ? 11.474  1.139   -4.798  1.00 0.00 ? 17 ASP A HA   1  
ATOM 238   H HB2  . ASP A 1 17 ? 11.830  1.494   -1.975  1.00 0.00 ? 17 ASP A HB2  1  
ATOM 239   H HB3  . ASP A 1 17 ? 10.760  0.120   -2.168  1.00 0.00 ? 17 ASP A HB3  1  
ATOM 240   N N    . ARG A 1 18 ? 8.584   1.837   -4.385  1.00 0.00 ? 18 ARG A N    1  
ATOM 241   C CA   . ARG A 1 18 ? 7.169   1.536   -4.522  1.00 0.00 ? 18 ARG A CA   1  
ATOM 242   C C    . ARG A 1 18 ? 6.919   0.738   -5.803  1.00 0.00 ? 18 ARG A C    1  
ATOM 243   O O    . ARG A 1 18 ? 7.469   1.057   -6.856  1.00 0.00 ? 18 ARG A O    1  
ATOM 244   C CB   . ARG A 1 18 ? 6.334   2.818   -4.558  1.00 0.00 ? 18 ARG A CB   1  
ATOM 245   C CG   . ARG A 1 18 ? 6.824   3.820   -3.510  1.00 0.00 ? 18 ARG A CG   1  
ATOM 246   C CD   . ARG A 1 18 ? 6.175   3.552   -2.150  1.00 0.00 ? 18 ARG A CD   1  
ATOM 247   N NE   . ARG A 1 18 ? 5.777   4.830   -1.519  1.00 0.00 ? 18 ARG A NE   1  
ATOM 248   C CZ   . ARG A 1 18 ? 5.687   5.018   -0.195  1.00 0.00 ? 18 ARG A CZ   1  
ATOM 249   N NH1  . ARG A 1 18 ? 5.965   4.012   0.645   1.00 0.00 ? 18 ARG A NH1  1  
ATOM 250   N NH2  . ARG A 1 18 ? 5.318   6.212   0.289   1.00 0.00 ? 18 ARG A NH2  1  
ATOM 251   H H    . ARG A 1 18 ? 8.838   2.780   -4.599  1.00 0.00 ? 18 ARG A H    1  
ATOM 252   H HA   . ARG A 1 18 ? 6.922   0.948   -3.639  1.00 0.00 ? 18 ARG A HA   1  
ATOM 253   H HB2  . ARG A 1 18 ? 6.392   3.267   -5.549  1.00 0.00 ? 18 ARG A HB2  1  
ATOM 254   H HB3  . ARG A 1 18 ? 5.286   2.579   -4.376  1.00 0.00 ? 18 ARG A HB3  1  
ATOM 255   H HG2  . ARG A 1 18 ? 7.908   3.756   -3.418  1.00 0.00 ? 18 ARG A HG2  1  
ATOM 256   H HG3  . ARG A 1 18 ? 6.591   4.834   -3.834  1.00 0.00 ? 18 ARG A HG3  1  
ATOM 257   H HD2  . ARG A 1 18 ? 5.302   2.912   -2.274  1.00 0.00 ? 18 ARG A HD2  1  
ATOM 258   H HD3  . ARG A 1 18 ? 6.872   3.019   -1.504  1.00 0.00 ? 18 ARG A HD3  1  
ATOM 259   H HE   . ARG A 1 18 ? 5.563   5.602   -2.117  1.00 0.00 ? 18 ARG A HE   1  
ATOM 260   H HH11 . ARG A 1 18 ? 6.240   3.120   0.284   1.00 0.00 ? 18 ARG A HH11 1  
ATOM 261   H HH12 . ARG A 1 18 ? 5.897   4.152   1.633   1.00 0.00 ? 18 ARG A HH12 1  
ATOM 262   H HH21 . ARG A 1 18 ? 5.111   6.963   -0.338  1.00 0.00 ? 18 ARG A HH21 1  
ATOM 263   H HH22 . ARG A 1 18 ? 5.251   6.352   1.277   1.00 0.00 ? 18 ARG A HH22 1  
ATOM 264   N N    . VAL A 1 19 ? 6.087   -0.286  -5.671  1.00 0.00 ? 19 VAL A N    1  
ATOM 265   C CA   . VAL A 1 19 ? 5.757   -1.132  -6.805  1.00 0.00 ? 19 VAL A CA   1  
ATOM 266   C C    . VAL A 1 19 ? 4.447   -0.650  -7.432  1.00 0.00 ? 19 VAL A C    1  
ATOM 267   O O    . VAL A 1 19 ? 4.013   -1.178  -8.455  1.00 0.00 ? 19 VAL A O    1  
ATOM 268   C CB   . VAL A 1 19 ? 5.706   -2.597  -6.366  1.00 0.00 ? 19 VAL A CB   1  
ATOM 269   C CG1  . VAL A 1 19 ? 5.634   -3.530  -7.577  1.00 0.00 ? 19 VAL A CG1  1  
ATOM 270   C CG2  . VAL A 1 19 ? 6.901   -2.945  -5.476  1.00 0.00 ? 19 VAL A CG2  1  
ATOM 271   H H    . VAL A 1 19 ? 5.643   -0.538  -4.812  1.00 0.00 ? 19 VAL A H    1  
ATOM 272   H HA   . VAL A 1 19 ? 6.556   -1.027  -7.538  1.00 0.00 ? 19 VAL A HA   1  
ATOM 273   H HB   . VAL A 1 19 ? 4.799   -2.740  -5.779  1.00 0.00 ? 19 VAL A HB   1  
ATOM 274   H HG11 . VAL A 1 19 ? 6.015   -3.012  -8.457  1.00 0.00 ? 19 VAL A HG11 1  
ATOM 275   H HG12 . VAL A 1 19 ? 6.237   -4.418  -7.388  1.00 0.00 ? 19 VAL A HG12 1  
ATOM 276   H HG13 . VAL A 1 19 ? 4.598   -3.824  -7.748  1.00 0.00 ? 19 VAL A HG13 1  
ATOM 277   H HG21 . VAL A 1 19 ? 7.614   -2.121  -5.487  1.00 0.00 ? 19 VAL A HG21 1  
ATOM 278   H HG22 . VAL A 1 19 ? 6.557   -3.114  -4.456  1.00 0.00 ? 19 VAL A HG22 1  
ATOM 279   H HG23 . VAL A 1 19 ? 7.383   -3.848  -5.852  1.00 0.00 ? 19 VAL A HG23 1  
ATOM 280   N N    . ASP A 1 20 ? 3.854   0.347   -6.792  1.00 0.00 ? 20 ASP A N    1  
ATOM 281   C CA   . ASP A 1 20 ? 2.602   0.906   -7.274  1.00 0.00 ? 20 ASP A CA   1  
ATOM 282   C C    . ASP A 1 20 ? 1.601   -0.226  -7.513  1.00 0.00 ? 20 ASP A C    1  
ATOM 283   O O    . ASP A 1 20 ? 1.685   -0.932  -8.517  1.00 0.00 ? 20 ASP A O    1  
ATOM 284   C CB   . ASP A 1 20 ? 2.804   1.646   -8.598  1.00 0.00 ? 20 ASP A CB   1  
ATOM 285   C CG   . ASP A 1 20 ? 1.520   1.931   -9.381  1.00 0.00 ? 20 ASP A CG   1  
ATOM 286   O OD1  . ASP A 1 20 ? 1.078   1.011   -10.102 1.00 0.00 ? 20 ASP A OD1  1  
ATOM 287   O OD2  . ASP A 1 20 ? 1.010   3.064   -9.241  1.00 0.00 ? 20 ASP A OD2  1  
ATOM 288   H H    . ASP A 1 20 ? 4.213   0.770   -5.960  1.00 0.00 ? 20 ASP A H    1  
ATOM 289   H HA   . ASP A 1 20 ? 2.276   1.593   -6.494  1.00 0.00 ? 20 ASP A HA   1  
ATOM 290   H HB2  . ASP A 1 20 ? 3.306   2.592   -8.396  1.00 0.00 ? 20 ASP A HB2  1  
ATOM 291   H HB3  . ASP A 1 20 ? 3.472   1.058   -9.228  1.00 0.00 ? 20 ASP A HB3  1  
ATOM 292   N N    . CYS A 1 21 ? 0.677   -0.364  -6.573  1.00 0.00 ? 21 CYS A N    1  
ATOM 293   C CA   . CYS A 1 21 ? -0.339  -1.398  -6.669  1.00 0.00 ? 21 CYS A CA   1  
ATOM 294   C C    . CYS A 1 21 ? -1.344  -0.986  -7.746  1.00 0.00 ? 21 CYS A C    1  
ATOM 295   O O    . CYS A 1 21 ? -2.038  -1.832  -8.309  1.00 0.00 ? 21 CYS A O    1  
ATOM 296   C CB   . CYS A 1 21 ? -1.018  -1.650  -5.321  1.00 0.00 ? 21 CYS A CB   1  
ATOM 297   S SG   . CYS A 1 21 ? -1.345  -3.410  -4.943  1.00 0.00 ? 21 CYS A SG   1  
ATOM 298   H H    . CYS A 1 21 ? 0.616   0.215   -5.760  1.00 0.00 ? 21 CYS A H    1  
ATOM 299   H HA   . CYS A 1 21 ? 0.175   -2.317  -6.950  1.00 0.00 ? 21 CYS A HA   1  
ATOM 300   H HB2  . CYS A 1 21 ? -0.393  -1.233  -4.531  1.00 0.00 ? 21 CYS A HB2  1  
ATOM 301   H HB3  . CYS A 1 21 ? -1.963  -1.107  -5.299  1.00 0.00 ? 21 CYS A HB3  1  
ATOM 302   N N    . GLY A 1 22 ? -1.390  0.313   -8.002  1.00 0.00 ? 22 GLY A N    1  
ATOM 303   C CA   . GLY A 1 22 ? -2.298  0.847   -9.002  1.00 0.00 ? 22 GLY A CA   1  
ATOM 304   C C    . GLY A 1 22 ? -3.755  0.675   -8.568  1.00 0.00 ? 22 GLY A C    1  
ATOM 305   O O    . GLY A 1 22 ? -4.359  -0.370  -8.807  1.00 0.00 ? 22 GLY A O    1  
ATOM 306   H H    . GLY A 1 22 ? -0.822  0.994   -7.540  1.00 0.00 ? 22 GLY A H    1  
ATOM 307   H HA2  . GLY A 1 22 ? -2.086  1.904   -9.164  1.00 0.00 ? 22 GLY A HA2  1  
ATOM 308   H HA3  . GLY A 1 22 ? -2.136  0.340   -9.953  1.00 0.00 ? 22 GLY A HA3  1  
ATOM 309   N N    . TYR A 1 23 ? -4.278  1.716   -7.937  1.00 0.00 ? 23 TYR A N    1  
ATOM 310   C CA   . TYR A 1 23 ? -5.653  1.692   -7.466  1.00 0.00 ? 23 TYR A CA   1  
ATOM 311   C C    . TYR A 1 23 ? -6.337  3.040   -7.704  1.00 0.00 ? 23 TYR A C    1  
ATOM 312   O O    . TYR A 1 23 ? -5.685  4.083   -7.682  1.00 0.00 ? 23 TYR A O    1  
ATOM 313   C CB   . TYR A 1 23 ? -5.579  1.430   -5.961  1.00 0.00 ? 23 TYR A CB   1  
ATOM 314   C CG   . TYR A 1 23 ? -5.627  -0.052  -5.584  1.00 0.00 ? 23 TYR A CG   1  
ATOM 315   C CD1  . TYR A 1 23 ? -6.781  -0.780  -5.791  1.00 0.00 ? 23 TYR A CD1  1  
ATOM 316   C CD2  . TYR A 1 23 ? -4.516  -0.661  -5.039  1.00 0.00 ? 23 TYR A CD2  1  
ATOM 317   C CE1  . TYR A 1 23 ? -6.826  -2.175  -5.436  1.00 0.00 ? 23 TYR A CE1  1  
ATOM 318   C CE2  . TYR A 1 23 ? -4.561  -2.057  -4.684  1.00 0.00 ? 23 TYR A CE2  1  
ATOM 319   C CZ   . TYR A 1 23 ? -5.714  -2.744  -4.901  1.00 0.00 ? 23 TYR A CZ   1  
ATOM 320   O OH   . TYR A 1 23 ? -5.756  -4.062  -4.566  1.00 0.00 ? 23 TYR A OH   1  
ATOM 321   H H    . TYR A 1 23 ? -3.781  2.562   -7.746  1.00 0.00 ? 23 TYR A H    1  
ATOM 322   H HA   . TYR A 1 23 ? -6.185  0.920   -8.022  1.00 0.00 ? 23 TYR A HA   1  
ATOM 323   H HB2  . TYR A 1 23 ? -4.658  1.864   -5.571  1.00 0.00 ? 23 TYR A HB2  1  
ATOM 324   H HB3  . TYR A 1 23 ? -6.406  1.945   -5.472  1.00 0.00 ? 23 TYR A HB3  1  
ATOM 325   H HD1  . TYR A 1 23 ? -7.659  -0.298  -6.222  1.00 0.00 ? 23 TYR A HD1  1  
ATOM 326   H HD2  . TYR A 1 23 ? -3.604  -0.087  -4.876  1.00 0.00 ? 23 TYR A HD2  1  
ATOM 327   H HE1  . TYR A 1 23 ? -7.732  -2.761  -5.594  1.00 0.00 ? 23 TYR A HE1  1  
ATOM 328   H HE2  . TYR A 1 23 ? -3.690  -2.550  -4.252  1.00 0.00 ? 23 TYR A HE2  1  
ATOM 329   H HH   . TYR A 1 23 ? -5.744  -4.625  -5.392  1.00 0.00 ? 23 TYR A HH   1  
ATOM 330   N N    . PRO A 1 24 ? -7.676  2.973   -7.933  1.00 0.00 ? 24 PRO A N    1  
ATOM 331   C CA   . PRO A 1 24 ? -8.455  4.175   -8.175  1.00 0.00 ? 24 PRO A CA   1  
ATOM 332   C C    . PRO A 1 24 ? -8.680  4.953   -6.877  1.00 0.00 ? 24 PRO A C    1  
ATOM 333   O O    . PRO A 1 24 ? -8.024  5.964   -6.632  1.00 0.00 ? 24 PRO A O    1  
ATOM 334   C CB   . PRO A 1 24 ? -9.748  3.686   -8.806  1.00 0.00 ? 24 PRO A CB   1  
ATOM 335   C CG   . PRO A 1 24 ? -9.842  2.206   -8.470  1.00 0.00 ? 24 PRO A CG   1  
ATOM 336   C CD   . PRO A 1 24 ? -8.480  1.755   -7.967  1.00 0.00 ? 24 PRO A CD   1  
ATOM 337   H HA   . PRO A 1 24 ? -7.957  4.795   -8.782  1.00 0.00 ? 24 PRO A HA   1  
ATOM 338   H HB2  . PRO A 1 24 ? -10.605 4.231   -8.413  1.00 0.00 ? 24 PRO A HB2  1  
ATOM 339   H HB3  . PRO A 1 24 ? -9.739  3.842   -9.885  1.00 0.00 ? 24 PRO A HB3  1  
ATOM 340   H HG2  . PRO A 1 24 ? -10.605 2.035   -7.711  1.00 0.00 ? 24 PRO A HG2  1  
ATOM 341   H HG3  . PRO A 1 24 ? -10.133 1.633   -9.350  1.00 0.00 ? 24 PRO A HG3  1  
ATOM 342   H HD2  . PRO A 1 24 ? -8.554  1.302   -6.979  1.00 0.00 ? 24 PRO A HD2  1  
ATOM 343   H HD3  . PRO A 1 24 ? -8.041  1.009   -8.629  1.00 0.00 ? 24 PRO A HD3  1  
ATOM 344   N N    . HIS A 1 25 ? -9.611  4.452   -6.078  1.00 0.00 ? 25 HIS A N    1  
ATOM 345   C CA   . HIS A 1 25 ? -9.932  5.087   -4.811  1.00 0.00 ? 25 HIS A CA   1  
ATOM 346   C C    . HIS A 1 25 ? -9.004  4.551   -3.719  1.00 0.00 ? 25 HIS A C    1  
ATOM 347   O O    . HIS A 1 25 ? -9.369  3.635   -2.984  1.00 0.00 ? 25 HIS A O    1  
ATOM 348   C CB   . HIS A 1 25 ? -11.413 4.906   -4.472  1.00 0.00 ? 25 HIS A CB   1  
ATOM 349   C CG   . HIS A 1 25 ? -11.791 3.490   -4.107  1.00 0.00 ? 25 HIS A CG   1  
ATOM 350   N ND1  . HIS A 1 25 ? -13.012 3.162   -3.546  1.00 0.00 ? 25 HIS A ND1  1  
ATOM 351   C CD2  . HIS A 1 25 ? -11.096 2.323   -4.229  1.00 0.00 ? 25 HIS A CD2  1  
ATOM 352   C CE1  . HIS A 1 25 ? -13.041 1.853   -3.343  1.00 0.00 ? 25 HIS A CE1  1  
ATOM 353   N NE2  . HIS A 1 25 ? -11.852 1.335   -3.767  1.00 0.00 ? 25 HIS A NE2  1  
ATOM 354   H H    . HIS A 1 25 ? -10.141 3.629   -6.285  1.00 0.00 ? 25 HIS A H    1  
ATOM 355   H HA   . HIS A 1 25 ? -9.748  6.154   -4.941  1.00 0.00 ? 25 HIS A HA   1  
ATOM 356   H HB2  . HIS A 1 25 ? -11.668 5.565   -3.642  1.00 0.00 ? 25 HIS A HB2  1  
ATOM 357   H HB3  . HIS A 1 25 ? -12.012 5.222   -5.326  1.00 0.00 ? 25 HIS A HB3  1  
ATOM 358   H HD1  . HIS A 1 25 ? -13.749 3.803   -3.330  1.00 0.00 ? 25 HIS A HD1  1  
ATOM 359   H HD2  . HIS A 1 25 ? -10.091 2.219   -4.638  1.00 0.00 ? 25 HIS A HD2  1  
ATOM 360   H HE1  . HIS A 1 25 ? -13.869 1.289   -2.913  1.00 0.00 ? 25 HIS A HE1  1  
ATOM 361   H HE2  . HIS A 1 25 ? -11.616 0.363   -3.786  1.00 0.00 ? 25 HIS A HE2  1  
ATOM 362   N N    . VAL A 1 26 ? -7.821  5.145   -3.648  1.00 0.00 ? 26 VAL A N    1  
ATOM 363   C CA   . VAL A 1 26 ? -6.838  4.738   -2.659  1.00 0.00 ? 26 VAL A CA   1  
ATOM 364   C C    . VAL A 1 26 ? -6.974  5.623   -1.418  1.00 0.00 ? 26 VAL A C    1  
ATOM 365   O O    . VAL A 1 26 ? -7.102  6.841   -1.531  1.00 0.00 ? 26 VAL A O    1  
ATOM 366   C CB   . VAL A 1 26 ? -5.436  4.776   -3.269  1.00 0.00 ? 26 VAL A CB   1  
ATOM 367   C CG1  . VAL A 1 26 ? -5.286  3.718   -4.364  1.00 0.00 ? 26 VAL A CG1  1  
ATOM 368   C CG2  . VAL A 1 26 ? -5.108  6.171   -3.805  1.00 0.00 ? 26 VAL A CG2  1  
ATOM 369   H H    . VAL A 1 26 ? -7.532  5.889   -4.250  1.00 0.00 ? 26 VAL A H    1  
ATOM 370   H HA   . VAL A 1 26 ? -7.058  3.708   -2.381  1.00 0.00 ? 26 VAL A HA   1  
ATOM 371   H HB   . VAL A 1 26 ? -4.721  4.544   -2.479  1.00 0.00 ? 26 VAL A HB   1  
ATOM 372   H HG11 . VAL A 1 26 ? -6.048  3.874   -5.126  1.00 0.00 ? 26 VAL A HG11 1  
ATOM 373   H HG12 . VAL A 1 26 ? -4.297  3.801   -4.816  1.00 0.00 ? 26 VAL A HG12 1  
ATOM 374   H HG13 . VAL A 1 26 ? -5.404  2.725   -3.929  1.00 0.00 ? 26 VAL A HG13 1  
ATOM 375   H HG21 . VAL A 1 26 ? -5.885  6.870   -3.498  1.00 0.00 ? 26 VAL A HG21 1  
ATOM 376   H HG22 . VAL A 1 26 ? -4.147  6.497   -3.406  1.00 0.00 ? 26 VAL A HG22 1  
ATOM 377   H HG23 . VAL A 1 26 ? -5.058  6.139   -4.894  1.00 0.00 ? 26 VAL A HG23 1  
ATOM 378   N N    . THR A 1 27 ? -6.942  4.976   -0.262  1.00 0.00 ? 27 THR A N    1  
ATOM 379   C CA   . THR A 1 27 ? -7.060  5.689   0.998   1.00 0.00 ? 27 THR A CA   1  
ATOM 380   C C    . THR A 1 27 ? -6.316  4.940   2.106   1.00 0.00 ? 27 THR A C    1  
ATOM 381   O O    . THR A 1 27 ? -5.876  3.809   1.908   1.00 0.00 ? 27 THR A O    1  
ATOM 382   C CB   . THR A 1 27 ? -8.549  5.886   1.292   1.00 0.00 ? 27 THR A CB   1  
ATOM 383   O OG1  . THR A 1 27 ? -8.946  4.665   1.910   1.00 0.00 ? 27 THR A OG1  1  
ATOM 384   C CG2  . THR A 1 27 ? -9.394  5.951   0.018   1.00 0.00 ? 27 THR A CG2  1  
ATOM 385   H H    . THR A 1 27 ? -6.838  3.985   -0.179  1.00 0.00 ? 27 THR A H    1  
ATOM 386   H HA   . THR A 1 27 ? -6.579  6.661   0.890   1.00 0.00 ? 27 THR A HA   1  
ATOM 387   H HB   . THR A 1 27 ? -8.710  6.768   1.912   1.00 0.00 ? 27 THR A HB   1  
ATOM 388   H HG1  . THR A 1 27 ? -9.933  4.666   2.066   1.00 0.00 ? 27 THR A HG1  1  
ATOM 389   H HG21 . THR A 1 27 ? -9.161  5.095   -0.616  1.00 0.00 ? 27 THR A HG21 1  
ATOM 390   H HG22 . THR A 1 27 ? -10.451 5.931   0.282   1.00 0.00 ? 27 THR A HG22 1  
ATOM 391   H HG23 . THR A 1 27 ? -9.170  6.873   -0.519  1.00 0.00 ? 27 THR A HG23 1  
ATOM 392   N N    . PRO A 1 28 ? -6.196  5.620   3.278   1.00 0.00 ? 28 PRO A N    1  
ATOM 393   C CA   . PRO A 1 28 ? -5.513  5.031   4.417   1.00 0.00 ? 28 PRO A CA   1  
ATOM 394   C C    . PRO A 1 28 ? -6.381  3.963   5.086   1.00 0.00 ? 28 PRO A C    1  
ATOM 395   O O    . PRO A 1 28 ? -6.407  3.856   6.311   1.00 0.00 ? 28 PRO A O    1  
ATOM 396   C CB   . PRO A 1 28 ? -5.199  6.201   5.335   1.00 0.00 ? 28 PRO A CB   1  
ATOM 397   C CG   . PRO A 1 28 ? -6.122  7.329   4.903   1.00 0.00 ? 28 PRO A CG   1  
ATOM 398   C CD   . PRO A 1 28 ? -6.705  6.961   3.549   1.00 0.00 ? 28 PRO A CD   1  
ATOM 399   H HA   . PRO A 1 28 ? -4.682  4.561   4.119   1.00 0.00 ? 28 PRO A HA   1  
ATOM 400   H HB2  . PRO A 1 28 ? -5.370  5.936   6.379   1.00 0.00 ? 28 PRO A HB2  1  
ATOM 401   H HB3  . PRO A 1 28 ? -4.154  6.497   5.248   1.00 0.00 ? 28 PRO A HB3  1  
ATOM 402   H HG2  . PRO A 1 28 ? -6.917  7.474   5.635   1.00 0.00 ? 28 PRO A HG2  1  
ATOM 403   H HG3  . PRO A 1 28 ? -5.572  8.269   4.839   1.00 0.00 ? 28 PRO A HG3  1  
ATOM 404   H HD2  . PRO A 1 28 ? -7.795  6.974   3.570   1.00 0.00 ? 28 PRO A HD2  1  
ATOM 405   H HD3  . PRO A 1 28 ? -6.393  7.666   2.778   1.00 0.00 ? 28 PRO A HD3  1  
ATOM 406   N N    . LYS A 1 29 ? -7.071  3.200   4.251   1.00 0.00 ? 29 LYS A N    1  
ATOM 407   C CA   . LYS A 1 29 ? -7.938  2.144   4.745   1.00 0.00 ? 29 LYS A CA   1  
ATOM 408   C C    . LYS A 1 29 ? -8.544  1.390   3.560   1.00 0.00 ? 29 LYS A C    1  
ATOM 409   O O    . LYS A 1 29 ? -8.637  0.164   3.581   1.00 0.00 ? 29 LYS A O    1  
ATOM 410   C CB   . LYS A 1 29 ? -8.981  2.714   5.709   1.00 0.00 ? 29 LYS A CB   1  
ATOM 411   C CG   . LYS A 1 29 ? -9.429  1.657   6.720   1.00 0.00 ? 29 LYS A CG   1  
ATOM 412   C CD   . LYS A 1 29 ? -10.528 0.768   6.134   1.00 0.00 ? 29 LYS A CD   1  
ATOM 413   C CE   . LYS A 1 29 ? -10.846 -0.400  7.070   1.00 0.00 ? 29 LYS A CE   1  
ATOM 414   N NZ   . LYS A 1 29 ? -12.302 -0.484  7.316   1.00 0.00 ? 29 LYS A NZ   1  
ATOM 415   H H    . LYS A 1 29 ? -7.045  3.294   3.256   1.00 0.00 ? 29 LYS A H    1  
ATOM 416   H HA   . LYS A 1 29 ? -7.318  1.452   5.315   1.00 0.00 ? 29 LYS A HA   1  
ATOM 417   H HB2  . LYS A 1 29 ? -8.564  3.573   6.236   1.00 0.00 ? 29 LYS A HB2  1  
ATOM 418   H HB3  . LYS A 1 29 ? -9.843  3.074   5.147   1.00 0.00 ? 29 LYS A HB3  1  
ATOM 419   H HG2  . LYS A 1 29 ? -8.577  1.043   7.012   1.00 0.00 ? 29 LYS A HG2  1  
ATOM 420   H HG3  . LYS A 1 29 ? -9.795  2.145   7.624   1.00 0.00 ? 29 LYS A HG3  1  
ATOM 421   H HD2  . LYS A 1 29 ? -11.428 1.359   5.966   1.00 0.00 ? 29 LYS A HD2  1  
ATOM 422   H HD3  . LYS A 1 29 ? -10.212 0.386   5.163   1.00 0.00 ? 29 LYS A HD3  1  
ATOM 423   H HE2  . LYS A 1 29 ? -10.490 -1.332  6.631   1.00 0.00 ? 29 LYS A HE2  1  
ATOM 424   H HE3  . LYS A 1 29 ? -10.318 -0.271  8.014   1.00 0.00 ? 29 LYS A HE3  1  
ATOM 425   H HZ1  . LYS A 1 29 ? -12.680 0.438   7.403   1.00 0.00 ? 29 LYS A HZ1  1  
ATOM 426   H HZ2  . LYS A 1 29 ? -12.743 -0.955  6.552   1.00 0.00 ? 29 LYS A HZ2  1  
ATOM 427   H HZ3  . LYS A 1 29 ? -12.468 -0.993  8.161   1.00 0.00 ? 29 LYS A HZ3  1  
ATOM 428   N N    . GLU A 1 30 ? -8.941  2.155   2.553   1.00 0.00 ? 30 GLU A N    1  
ATOM 429   C CA   . GLU A 1 30 ? -9.535  1.575   1.361   1.00 0.00 ? 30 GLU A CA   1  
ATOM 430   C C    . GLU A 1 30 ? -8.453  0.946   0.481   1.00 0.00 ? 30 GLU A C    1  
ATOM 431   O O    . GLU A 1 30 ? -8.659  -0.121  -0.095  1.00 0.00 ? 30 GLU A O    1  
ATOM 432   C CB   . GLU A 1 30 ? -10.335 2.621   0.583   1.00 0.00 ? 30 GLU A CB   1  
ATOM 433   C CG   . GLU A 1 30 ? -10.982 2.004   -0.659  1.00 0.00 ? 30 GLU A CG   1  
ATOM 434   C CD   . GLU A 1 30 ? -12.490 2.263   -0.677  1.00 0.00 ? 30 GLU A CD   1  
ATOM 435   O OE1  . GLU A 1 30 ? -12.865 3.414   -0.989  1.00 0.00 ? 30 GLU A OE1  1  
ATOM 436   O OE2  . GLU A 1 30 ? -13.234 1.304   -0.379  1.00 0.00 ? 30 GLU A OE2  1  
ATOM 437   H H    . GLU A 1 30 ? -8.862  3.152   2.544   1.00 0.00 ? 30 GLU A H    1  
ATOM 438   H HA   . GLU A 1 30 ? -10.214 0.803   1.722   1.00 0.00 ? 30 GLU A HA   1  
ATOM 439   H HB2  . GLU A 1 30 ? -11.106 3.047   1.225   1.00 0.00 ? 30 GLU A HB2  1  
ATOM 440   H HB3  . GLU A 1 30 ? -9.679  3.440   0.286   1.00 0.00 ? 30 GLU A HB3  1  
ATOM 441   H HG2  . GLU A 1 30 ? -10.527 2.423   -1.557  1.00 0.00 ? 30 GLU A HG2  1  
ATOM 442   H HG3  . GLU A 1 30 ? -10.794 0.931   -0.676  1.00 0.00 ? 30 GLU A HG3  1  
ATOM 443   N N    . CYS A 1 31 ? -7.323  1.634   0.405   1.00 0.00 ? 31 CYS A N    1  
ATOM 444   C CA   . CYS A 1 31 ? -6.209  1.156   -0.395  1.00 0.00 ? 31 CYS A CA   1  
ATOM 445   C C    . CYS A 1 31 ? -5.579  -0.039  0.324   1.00 0.00 ? 31 CYS A C    1  
ATOM 446   O O    . CYS A 1 31 ? -5.044  -0.943  -0.317  1.00 0.00 ? 31 CYS A O    1  
ATOM 447   C CB   . CYS A 1 31 ? -5.188  2.264   -0.663  1.00 0.00 ? 31 CYS A CB   1  
ATOM 448   S SG   . CYS A 1 31 ? -3.484  1.677   -0.980  1.00 0.00 ? 31 CYS A SG   1  
ATOM 449   H H    . CYS A 1 31 ? -7.164  2.501   0.876   1.00 0.00 ? 31 CYS A H    1  
ATOM 450   H HA   . CYS A 1 31 ? -6.621  0.854   -1.358  1.00 0.00 ? 31 CYS A HA   1  
ATOM 451   H HB2  . CYS A 1 31 ? -5.522  2.846   -1.521  1.00 0.00 ? 31 CYS A HB2  1  
ATOM 452   H HB3  . CYS A 1 31 ? -5.172  2.938   0.193   1.00 0.00 ? 31 CYS A HB3  1  
ATOM 453   N N    . ASN A 1 32 ? -5.663  -0.005  1.646   1.00 0.00 ? 32 ASN A N    1  
ATOM 454   C CA   . ASN A 1 32 ? -5.108  -1.073  2.459   1.00 0.00 ? 32 ASN A CA   1  
ATOM 455   C C    . ASN A 1 32 ? -6.191  -2.119  2.728   1.00 0.00 ? 32 ASN A C    1  
ATOM 456   O O    . ASN A 1 32 ? -5.947  -3.108  3.418   1.00 0.00 ? 32 ASN A O    1  
ATOM 457   C CB   . ASN A 1 32 ? -4.618  -0.542  3.808   1.00 0.00 ? 32 ASN A CB   1  
ATOM 458   C CG   . ASN A 1 32 ? -5.617  -0.868  4.920   1.00 0.00 ? 32 ASN A CG   1  
ATOM 459   O OD1  . ASN A 1 32 ? -6.815  -0.684  4.788   1.00 0.00 ? 32 ASN A OD1  1  
ATOM 460   N ND2  . ASN A 1 32 ? -5.057  -1.361  6.022   1.00 0.00 ? 32 ASN A ND2  1  
ATOM 461   H H    . ASN A 1 32 ? -6.099  0.734   2.160   1.00 0.00 ? 32 ASN A H    1  
ATOM 462   H HA   . ASN A 1 32 ? -4.277  -1.473  1.878   1.00 0.00 ? 32 ASN A HA   1  
ATOM 463   H HB2  . ASN A 1 32 ? -3.648  -0.979  4.045   1.00 0.00 ? 32 ASN A HB2  1  
ATOM 464   H HB3  . ASN A 1 32 ? -4.475  0.537   3.747   1.00 0.00 ? 32 ASN A HB3  1  
ATOM 465   H HD21 . ASN A 1 32 ? -4.066  -1.487  6.065   1.00 0.00 ? 32 ASN A HD21 1  
ATOM 466   H HD22 . ASN A 1 32 ? -5.627  -1.605  6.806   1.00 0.00 ? 32 ASN A HD22 1  
ATOM 467   N N    . ASN A 1 33 ? -7.366  -1.865  2.169   1.00 0.00 ? 33 ASN A N    1  
ATOM 468   C CA   . ASN A 1 33 ? -8.487  -2.773  2.340   1.00 0.00 ? 33 ASN A CA   1  
ATOM 469   C C    . ASN A 1 33 ? -8.651  -3.619  1.076   1.00 0.00 ? 33 ASN A C    1  
ATOM 470   O O    . ASN A 1 33 ? -8.911  -4.818  1.157   1.00 0.00 ? 33 ASN A O    1  
ATOM 471   C CB   . ASN A 1 33 ? -9.790  -2.002  2.565   1.00 0.00 ? 33 ASN A CB   1  
ATOM 472   C CG   . ASN A 1 33 ? -11.005 -2.910  2.367   1.00 0.00 ? 33 ASN A CG   1  
ATOM 473   O OD1  . ASN A 1 33 ? -11.325 -3.332  1.268   1.00 0.00 ? 33 ASN A OD1  1  
ATOM 474   N ND2  . ASN A 1 33 ? -11.663 -3.185  3.490   1.00 0.00 ? 33 ASN A ND2  1  
ATOM 475   H H    . ASN A 1 33 ? -7.556  -1.059  1.610   1.00 0.00 ? 33 ASN A H    1  
ATOM 476   H HA   . ASN A 1 33 ? -8.239  -3.373  3.215   1.00 0.00 ? 33 ASN A HA   1  
ATOM 477   H HB2  . ASN A 1 33 ? -9.802  -1.587  3.573   1.00 0.00 ? 33 ASN A HB2  1  
ATOM 478   H HB3  . ASN A 1 33 ? -9.843  -1.161  1.873   1.00 0.00 ? 33 ASN A HB3  1  
ATOM 479   H HD21 . ASN A 1 33 ? -11.348 -2.806  4.360   1.00 0.00 ? 33 ASN A HD21 1  
ATOM 480   H HD22 . ASN A 1 33 ? -12.473 -3.771  3.464   1.00 0.00 ? 33 ASN A HD22 1  
ATOM 481   N N    . ARG A 1 34 ? -8.491  -2.961  -0.063  1.00 0.00 ? 34 ARG A N    1  
ATOM 482   C CA   . ARG A 1 34 ? -8.617  -3.637  -1.342  1.00 0.00 ? 34 ARG A CA   1  
ATOM 483   C C    . ARG A 1 34 ? -7.620  -4.795  -1.432  1.00 0.00 ? 34 ARG A C    1  
ATOM 484   O O    . ARG A 1 34 ? -7.883  -5.796  -2.096  1.00 0.00 ? 34 ARG A O    1  
ATOM 485   C CB   . ARG A 1 34 ? -8.372  -2.671  -2.503  1.00 0.00 ? 34 ARG A CB   1  
ATOM 486   C CG   . ARG A 1 34 ? -9.294  -2.986  -3.683  1.00 0.00 ? 34 ARG A CG   1  
ATOM 487   C CD   . ARG A 1 34 ? -8.951  -4.344  -4.299  1.00 0.00 ? 34 ARG A CD   1  
ATOM 488   N NE   . ARG A 1 34 ? -9.383  -4.380  -5.714  1.00 0.00 ? 34 ARG A NE   1  
ATOM 489   C CZ   . ARG A 1 34 ? -9.100  -5.380  -6.561  1.00 0.00 ? 34 ARG A CZ   1  
ATOM 490   N NH1  . ARG A 1 34 ? -8.383  -6.431  -6.140  1.00 0.00 ? 34 ARG A NH1  1  
ATOM 491   N NH2  . ARG A 1 34 ? -9.533  -5.328  -7.828  1.00 0.00 ? 34 ARG A NH2  1  
ATOM 492   H H    . ARG A 1 34 ? -8.279  -1.985  -0.120  1.00 0.00 ? 34 ARG A H    1  
ATOM 493   H HA   . ARG A 1 34 ? -9.644  -4.002  -1.365  1.00 0.00 ? 34 ARG A HA   1  
ATOM 494   H HB2  . ARG A 1 34 ? -8.539  -1.647  -2.170  1.00 0.00 ? 34 ARG A HB2  1  
ATOM 495   H HB3  . ARG A 1 34 ? -7.332  -2.737  -2.822  1.00 0.00 ? 34 ARG A HB3  1  
ATOM 496   H HG2  . ARG A 1 34 ? -10.331 -2.986  -3.348  1.00 0.00 ? 34 ARG A HG2  1  
ATOM 497   H HG3  . ARG A 1 34 ? -9.203  -2.206  -4.438  1.00 0.00 ? 34 ARG A HG3  1  
ATOM 498   H HD2  . ARG A 1 34 ? -7.878  -4.522  -4.233  1.00 0.00 ? 34 ARG A HD2  1  
ATOM 499   H HD3  . ARG A 1 34 ? -9.442  -5.141  -3.740  1.00 0.00 ? 34 ARG A HD3  1  
ATOM 500   H HE   . ARG A 1 34 ? -9.919  -3.611  -6.061  1.00 0.00 ? 34 ARG A HE   1  
ATOM 501   H HH11 . ARG A 1 34 ? -8.060  -6.470  -5.194  1.00 0.00 ? 34 ARG A HH11 1  
ATOM 502   H HH12 . ARG A 1 34 ? -8.172  -7.177  -6.772  1.00 0.00 ? 34 ARG A HH12 1  
ATOM 503   H HH21 . ARG A 1 34 ? -10.068 -4.544  -8.142  1.00 0.00 ? 34 ARG A HH21 1  
ATOM 504   H HH22 . ARG A 1 34 ? -9.321  -6.074  -8.459  1.00 0.00 ? 34 ARG A HH22 1  
ATOM 505   N N    . GLY A 1 35 ? -6.496  -4.619  -0.752  1.00 0.00 ? 35 GLY A N    1  
ATOM 506   C CA   . GLY A 1 35 ? -5.459  -5.636  -0.746  1.00 0.00 ? 35 GLY A CA   1  
ATOM 507   C C    . GLY A 1 35 ? -4.115  -5.052  -1.188  1.00 0.00 ? 35 GLY A C    1  
ATOM 508   O O    . GLY A 1 35 ? -3.675  -5.280  -2.314  1.00 0.00 ? 35 GLY A O    1  
ATOM 509   H H    . GLY A 1 35 ? -6.290  -3.802  -0.214  1.00 0.00 ? 35 GLY A H    1  
ATOM 510   H HA2  . GLY A 1 35 ? -5.364  -6.059  0.254   1.00 0.00 ? 35 GLY A HA2  1  
ATOM 511   H HA3  . GLY A 1 35 ? -5.741  -6.452  -1.412  1.00 0.00 ? 35 GLY A HA3  1  
ATOM 512   N N    . CYS A 1 36 ? -3.502  -4.309  -0.279  1.00 0.00 ? 36 CYS A N    1  
ATOM 513   C CA   . CYS A 1 36 ? -2.218  -3.690  -0.560  1.00 0.00 ? 36 CYS A CA   1  
ATOM 514   C C    . CYS A 1 36 ? -1.898  -2.710  0.571   1.00 0.00 ? 36 CYS A C    1  
ATOM 515   O O    . CYS A 1 36 ? -2.447  -2.821  1.666   1.00 0.00 ? 36 CYS A O    1  
ATOM 516   C CB   . CYS A 1 36 ? -2.208  -3.005  -1.929  1.00 0.00 ? 36 CYS A CB   1  
ATOM 517   S SG   . CYS A 1 36 ? -0.898  -3.585  -3.067  1.00 0.00 ? 36 CYS A SG   1  
ATOM 518   H H    . CYS A 1 36 ? -3.867  -4.128  0.635   1.00 0.00 ? 36 CYS A H    1  
ATOM 519   H HA   . CYS A 1 36 ? -1.483  -4.495  -0.594  1.00 0.00 ? 36 CYS A HA   1  
ATOM 520   H HB2  . CYS A 1 36 ? -3.177  -3.160  -2.403  1.00 0.00 ? 36 CYS A HB2  1  
ATOM 521   H HB3  . CYS A 1 36 ? -2.092  -1.932  -1.781  1.00 0.00 ? 36 CYS A HB3  1  
ATOM 522   N N    . CYS A 1 37 ? -1.011  -1.774  0.266   1.00 0.00 ? 37 CYS A N    1  
ATOM 523   C CA   . CYS A 1 37 ? -0.612  -0.776  1.244   1.00 0.00 ? 37 CYS A CA   1  
ATOM 524   C C    . CYS A 1 37 ? -0.948  0.607   0.682   1.00 0.00 ? 37 CYS A C    1  
ATOM 525   O O    . CYS A 1 37 ? -0.958  0.802   -0.533  1.00 0.00 ? 37 CYS A O    1  
ATOM 526   C CB   . CYS A 1 37 ? 0.868   -0.900  1.607   1.00 0.00 ? 37 CYS A CB   1  
ATOM 527   S SG   . CYS A 1 37 ? 1.231   -2.085  2.954   1.00 0.00 ? 37 CYS A SG   1  
ATOM 528   H H    . CYS A 1 37 ? -0.570  -1.692  -0.627  1.00 0.00 ? 37 CYS A H    1  
ATOM 529   H HA   . CYS A 1 37 ? -1.187  -0.976  2.148   1.00 0.00 ? 37 CYS A HA   1  
ATOM 530   H HB2  . CYS A 1 37 ? 1.422   -1.202  0.718   1.00 0.00 ? 37 CYS A HB2  1  
ATOM 531   H HB3  . CYS A 1 37 ? 1.241   0.082   1.897   1.00 0.00 ? 37 CYS A HB3  1  
ATOM 532   N N    . PHE A 1 38 ? -1.214  1.532   1.592   1.00 0.00 ? 38 PHE A N    1  
ATOM 533   C CA   . PHE A 1 38 ? -1.549  2.891   1.203   1.00 0.00 ? 38 PHE A CA   1  
ATOM 534   C C    . PHE A 1 38 ? -0.507  3.884   1.724   1.00 0.00 ? 38 PHE A C    1  
ATOM 535   O O    . PHE A 1 38 ? 0.389   3.509   2.479   1.00 0.00 ? 38 PHE A O    1  
ATOM 536   C CB   . PHE A 1 38 ? -2.905  3.216   1.833   1.00 0.00 ? 38 PHE A CB   1  
ATOM 537   C CG   . PHE A 1 38 ? -3.331  4.677   1.673   1.00 0.00 ? 38 PHE A CG   1  
ATOM 538   C CD1  . PHE A 1 38 ? -3.896  5.097   0.509   1.00 0.00 ? 38 PHE A CD1  1  
ATOM 539   C CD2  . PHE A 1 38 ? -3.146  5.555   2.695   1.00 0.00 ? 38 PHE A CD2  1  
ATOM 540   C CE1  . PHE A 1 38 ? -4.292  6.452   0.361   1.00 0.00 ? 38 PHE A CE1  1  
ATOM 541   C CE2  . PHE A 1 38 ? -3.542  6.911   2.546   1.00 0.00 ? 38 PHE A CE2  1  
ATOM 542   C CZ   . PHE A 1 38 ? -4.106  7.331   1.382   1.00 0.00 ? 38 PHE A CZ   1  
ATOM 543   H H    . PHE A 1 38 ? -1.203  1.366   2.578   1.00 0.00 ? 38 PHE A H    1  
ATOM 544   H HA   . PHE A 1 38 ? -1.563  2.921   0.113   1.00 0.00 ? 38 PHE A HA   1  
ATOM 545   H HB2  . PHE A 1 38 ? -3.664  2.575   1.386   1.00 0.00 ? 38 PHE A HB2  1  
ATOM 546   H HB3  . PHE A 1 38 ? -2.867  2.974   2.895   1.00 0.00 ? 38 PHE A HB3  1  
ATOM 547   H HD1  . PHE A 1 38 ? -4.044  4.393   -0.310  1.00 0.00 ? 38 PHE A HD1  1  
ATOM 548   H HD2  . PHE A 1 38 ? -2.693  5.219   3.627   1.00 0.00 ? 38 PHE A HD2  1  
ATOM 549   H HE1  . PHE A 1 38 ? -4.744  6.789   -0.572  1.00 0.00 ? 38 PHE A HE1  1  
ATOM 550   H HE2  . PHE A 1 38 ? -3.393  7.615   3.365   1.00 0.00 ? 38 PHE A HE2  1  
ATOM 551   H HZ   . PHE A 1 38 ? -4.410  8.371   1.268   1.00 0.00 ? 38 PHE A HZ   1  
ATOM 552   N N    . ASP A 1 39 ? -0.659  5.129   1.299   1.00 0.00 ? 39 ASP A N    1  
ATOM 553   C CA   . ASP A 1 39 ? 0.258   6.178   1.713   1.00 0.00 ? 39 ASP A CA   1  
ATOM 554   C C    . ASP A 1 39 ? -0.170  7.503   1.080   1.00 0.00 ? 39 ASP A C    1  
ATOM 555   O O    . ASP A 1 39 ? -0.663  7.526   -0.047  1.00 0.00 ? 39 ASP A O    1  
ATOM 556   C CB   . ASP A 1 39 ? 1.686   5.874   1.255   1.00 0.00 ? 39 ASP A CB   1  
ATOM 557   C CG   . ASP A 1 39 ? 2.701   6.988   1.520   1.00 0.00 ? 39 ASP A CG   1  
ATOM 558   O OD1  . ASP A 1 39 ? 3.295   6.964   2.620   1.00 0.00 ? 39 ASP A OD1  1  
ATOM 559   O OD2  . ASP A 1 39 ? 2.860   7.838   0.618   1.00 0.00 ? 39 ASP A OD2  1  
ATOM 560   H H    . ASP A 1 39 ? -1.390  5.426   0.685   1.00 0.00 ? 39 ASP A H    1  
ATOM 561   H HA   . ASP A 1 39 ? 0.198   6.198   2.801   1.00 0.00 ? 39 ASP A HA   1  
ATOM 562   H HB2  . ASP A 1 39 ? 2.026   4.967   1.753   1.00 0.00 ? 39 ASP A HB2  1  
ATOM 563   H HB3  . ASP A 1 39 ? 1.671   5.664   0.185   1.00 0.00 ? 39 ASP A HB3  1  
ATOM 564   N N    . SER A 1 40 ? 0.033   8.575   1.832   1.00 0.00 ? 40 SER A N    1  
ATOM 565   C CA   . SER A 1 40 ? -0.326  9.901   1.358   1.00 0.00 ? 40 SER A CA   1  
ATOM 566   C C    . SER A 1 40 ? 0.798   10.890  1.671   1.00 0.00 ? 40 SER A C    1  
ATOM 567   O O    . SER A 1 40 ? 0.602   12.102  1.597   1.00 0.00 ? 40 SER A O    1  
ATOM 568   C CB   . SER A 1 40 ? -1.639  10.373  1.985   1.00 0.00 ? 40 SER A CB   1  
ATOM 569   O OG   . SER A 1 40 ? -1.513  10.589  3.388   1.00 0.00 ? 40 SER A OG   1  
ATOM 570   H H    . SER A 1 40 ? 0.434   8.548   2.747   1.00 0.00 ? 40 SER A H    1  
ATOM 571   H HA   . SER A 1 40 ? -0.455  9.797   0.280   1.00 0.00 ? 40 SER A HA   1  
ATOM 572   H HB2  . SER A 1 40 ? -1.959  11.297  1.503   1.00 0.00 ? 40 SER A HB2  1  
ATOM 573   H HB3  . SER A 1 40 ? -2.416  9.632   1.800   1.00 0.00 ? 40 SER A HB3  1  
ATOM 574   H HG   . SER A 1 40 ? -0.868  9.933   3.778   1.00 0.00 ? 40 SER A HG   1  
ATOM 575   N N    . ARG A 1 41 ? 1.952   10.337  2.014   1.00 0.00 ? 41 ARG A N    1  
ATOM 576   C CA   . ARG A 1 41 ? 3.108   11.156  2.338   1.00 0.00 ? 41 ARG A CA   1  
ATOM 577   C C    . ARG A 1 41 ? 3.463   12.064  1.159   1.00 0.00 ? 41 ARG A C    1  
ATOM 578   O O    . ARG A 1 41 ? 3.670   13.264  1.335   1.00 0.00 ? 41 ARG A O    1  
ATOM 579   C CB   . ARG A 1 41 ? 4.318   10.287  2.687   1.00 0.00 ? 41 ARG A CB   1  
ATOM 580   C CG   . ARG A 1 41 ? 5.151   10.929  3.798   1.00 0.00 ? 41 ARG A CG   1  
ATOM 581   C CD   . ARG A 1 41 ? 6.603   10.448  3.743   1.00 0.00 ? 41 ARG A CD   1  
ATOM 582   N NE   . ARG A 1 41 ? 7.051   10.034  5.091   1.00 0.00 ? 41 ARG A NE   1  
ATOM 583   C CZ   . ARG A 1 41 ? 7.415   10.888  6.057   1.00 0.00 ? 41 ARG A CZ   1  
ATOM 584   N NH1  . ARG A 1 41 ? 7.387   12.208  5.829   1.00 0.00 ? 41 ARG A NH1  1  
ATOM 585   N NH2  . ARG A 1 41 ? 7.808   10.422  7.250   1.00 0.00 ? 41 ARG A NH2  1  
ATOM 586   H H    . ARG A 1 41 ? 2.104   9.350   2.071   1.00 0.00 ? 41 ARG A H    1  
ATOM 587   H HA   . ARG A 1 41 ? 2.800   11.741  3.205   1.00 0.00 ? 41 ARG A HA   1  
ATOM 588   H HB2  . ARG A 1 41 ? 3.982   9.300   3.003   1.00 0.00 ? 41 ARG A HB2  1  
ATOM 589   H HB3  . ARG A 1 41 ? 4.936   10.145  1.800   1.00 0.00 ? 41 ARG A HB3  1  
ATOM 590   H HG2  . ARG A 1 41 ? 5.120   12.014  3.701   1.00 0.00 ? 41 ARG A HG2  1  
ATOM 591   H HG3  . ARG A 1 41 ? 4.720   10.683  4.769   1.00 0.00 ? 41 ARG A HG3  1  
ATOM 592   H HD2  . ARG A 1 41 ? 6.691   9.612   3.048   1.00 0.00 ? 41 ARG A HD2  1  
ATOM 593   H HD3  . ARG A 1 41 ? 7.244   11.245  3.366   1.00 0.00 ? 41 ARG A HD3  1  
ATOM 594   H HE   . ARG A 1 41 ? 7.084   9.055   5.294   1.00 0.00 ? 41 ARG A HE   1  
ATOM 595   H HH11 . ARG A 1 41 ? 7.093   12.556  4.939   1.00 0.00 ? 41 ARG A HH11 1  
ATOM 596   H HH12 . ARG A 1 41 ? 7.658   12.846  6.550   1.00 0.00 ? 41 ARG A HH12 1  
ATOM 597   H HH21 . ARG A 1 41 ? 7.830   9.437   7.420   1.00 0.00 ? 41 ARG A HH21 1  
ATOM 598   H HH22 . ARG A 1 41 ? 8.080   11.060  7.971   1.00 0.00 ? 41 ARG A HH22 1  
ATOM 599   N N    . ILE A 1 42 ? 3.524   11.456  -0.017  1.00 0.00 ? 42 ILE A N    1  
ATOM 600   C CA   . ILE A 1 42 ? 3.850   12.195  -1.225  1.00 0.00 ? 42 ILE A CA   1  
ATOM 601   C C    . ILE A 1 42 ? 3.060   11.617  -2.401  1.00 0.00 ? 42 ILE A C    1  
ATOM 602   O O    . ILE A 1 42 ? 2.967   10.399  -2.551  1.00 0.00 ? 42 ILE A O    1  
ATOM 603   C CB   . ILE A 1 42 ? 5.363   12.212  -1.450  1.00 0.00 ? 42 ILE A CB   1  
ATOM 604   C CG1  . ILE A 1 42 ? 6.037   11.040  -0.734  1.00 0.00 ? 42 ILE A CG1  1  
ATOM 605   C CG2  . ILE A 1 42 ? 5.964   13.557  -1.037  1.00 0.00 ? 42 ILE A CG2  1  
ATOM 606   C CD1  . ILE A 1 42 ? 5.520   9.702   -1.267  1.00 0.00 ? 42 ILE A CD1  1  
ATOM 607   H H    . ILE A 1 42 ? 3.354   10.480  -0.152  1.00 0.00 ? 42 ILE A H    1  
ATOM 608   H HA   . ILE A 1 42 ? 3.535   13.227  -1.072  1.00 0.00 ? 42 ILE A HA   1  
ATOM 609   H HB   . ILE A 1 42 ? 5.552   12.090  -2.516  1.00 0.00 ? 42 ILE A HB   1  
ATOM 610   H HG12 . ILE A 1 42 ? 7.117   11.097  -0.872  1.00 0.00 ? 42 ILE A HG12 1  
ATOM 611   H HG13 . ILE A 1 42 ? 5.849   11.106  0.337   1.00 0.00 ? 42 ILE A HG13 1  
ATOM 612   H HG21 . ILE A 1 42 ? 5.522   13.878  -0.093  1.00 0.00 ? 42 ILE A HG21 1  
ATOM 613   H HG22 . ILE A 1 42 ? 7.042   13.452  -0.916  1.00 0.00 ? 42 ILE A HG22 1  
ATOM 614   H HG23 . ILE A 1 42 ? 5.756   14.300  -1.807  1.00 0.00 ? 42 ILE A HG23 1  
ATOM 615   H HD11 . ILE A 1 42 ? 5.028   9.859   -2.227  1.00 0.00 ? 42 ILE A HD11 1  
ATOM 616   H HD12 . ILE A 1 42 ? 6.356   9.014   -1.396  1.00 0.00 ? 42 ILE A HD12 1  
ATOM 617   H HD13 . ILE A 1 42 ? 4.808   9.279   -0.559  1.00 0.00 ? 42 ILE A HD13 1  
ATOM 618   N N    . PRO A 1 43 ? 2.498   12.540  -3.225  1.00 0.00 ? 43 PRO A N    1  
ATOM 619   C CA   . PRO A 1 43 ? 1.719   12.134  -4.383  1.00 0.00 ? 43 PRO A CA   1  
ATOM 620   C C    . PRO A 1 43 ? 2.628   11.634  -5.507  1.00 0.00 ? 43 PRO A C    1  
ATOM 621   O O    . PRO A 1 43 ? 2.285   10.686  -6.212  1.00 0.00 ? 43 PRO A O    1  
ATOM 622   C CB   . PRO A 1 43 ? 0.919   13.367  -4.770  1.00 0.00 ? 43 PRO A CB   1  
ATOM 623   C CG   . PRO A 1 43 ? 1.620   14.544  -4.111  1.00 0.00 ? 43 PRO A CG   1  
ATOM 624   C CD   . PRO A 1 43 ? 2.588   13.990  -3.078  1.00 0.00 ? 43 PRO A CD   1  
ATOM 625   H HA   . PRO A 1 43 ? 1.124   11.365  -4.149  1.00 0.00 ? 43 PRO A HA   1  
ATOM 626   H HB2  . PRO A 1 43 ? 0.887   13.488  -5.853  1.00 0.00 ? 43 PRO A HB2  1  
ATOM 627   H HB3  . PRO A 1 43 ? -0.114  13.286  -4.429  1.00 0.00 ? 43 PRO A HB3  1  
ATOM 628   H HG2  . PRO A 1 43 ? 2.153   15.136  -4.854  1.00 0.00 ? 43 PRO A HG2  1  
ATOM 629   H HG3  . PRO A 1 43 ? 0.893   15.205  -3.638  1.00 0.00 ? 43 PRO A HG3  1  
ATOM 630   H HD2  . PRO A 1 43 ? 3.603   14.344  -3.257  1.00 0.00 ? 43 PRO A HD2  1  
ATOM 631   H HD3  . PRO A 1 43 ? 2.313   14.303  -2.070  1.00 0.00 ? 43 PRO A HD3  1  
ATOM 632   N N    . GLY A 1 44 ? 3.769   12.294  -5.640  1.00 0.00 ? 44 GLY A N    1  
ATOM 633   C CA   . GLY A 1 44 ? 4.730   11.928  -6.667  1.00 0.00 ? 44 GLY A CA   1  
ATOM 634   C C    . GLY A 1 44 ? 4.807   10.408  -6.829  1.00 0.00 ? 44 GLY A C    1  
ATOM 635   O O    . GLY A 1 44 ? 4.788   9.898   -7.948  1.00 0.00 ? 44 GLY A O    1  
ATOM 636   H H    . GLY A 1 44 ? 4.040   13.064  -5.063  1.00 0.00 ? 44 GLY A H    1  
ATOM 637   H HA2  . GLY A 1 44 ? 4.446   12.384  -7.615  1.00 0.00 ? 44 GLY A HA2  1  
ATOM 638   H HA3  . GLY A 1 44 ? 5.713   12.320  -6.406  1.00 0.00 ? 44 GLY A HA3  1  
ATOM 639   N N    . VAL A 1 45 ? 4.893   9.728   -5.695  1.00 0.00 ? 45 VAL A N    1  
ATOM 640   C CA   . VAL A 1 45 ? 4.973   8.277   -5.697  1.00 0.00 ? 45 VAL A CA   1  
ATOM 641   C C    . VAL A 1 45 ? 3.559   7.692   -5.684  1.00 0.00 ? 45 VAL A C    1  
ATOM 642   O O    . VAL A 1 45 ? 2.584   8.421   -5.507  1.00 0.00 ? 45 VAL A O    1  
ATOM 643   C CB   . VAL A 1 45 ? 5.828   7.799   -4.522  1.00 0.00 ? 45 VAL A CB   1  
ATOM 644   C CG1  . VAL A 1 45 ? 6.924   8.814   -4.193  1.00 0.00 ? 45 VAL A CG1  1  
ATOM 645   C CG2  . VAL A 1 45 ? 4.962   7.509   -3.295  1.00 0.00 ? 45 VAL A CG2  1  
ATOM 646   H H    . VAL A 1 45 ? 4.908   10.151  -4.789  1.00 0.00 ? 45 VAL A H    1  
ATOM 647   H HA   . VAL A 1 45 ? 5.469   7.976   -6.620  1.00 0.00 ? 45 VAL A HA   1  
ATOM 648   H HB   . VAL A 1 45 ? 6.312   6.868   -4.817  1.00 0.00 ? 45 VAL A HB   1  
ATOM 649   H HG11 . VAL A 1 45 ? 7.110   9.444   -5.063  1.00 0.00 ? 45 VAL A HG11 1  
ATOM 650   H HG12 . VAL A 1 45 ? 6.604   9.435   -3.356  1.00 0.00 ? 45 VAL A HG12 1  
ATOM 651   H HG13 . VAL A 1 45 ? 7.840   8.287   -3.924  1.00 0.00 ? 45 VAL A HG13 1  
ATOM 652   H HG21 . VAL A 1 45 ? 4.205   8.288   -3.193  1.00 0.00 ? 45 VAL A HG21 1  
ATOM 653   H HG22 . VAL A 1 45 ? 4.474   6.542   -3.414  1.00 0.00 ? 45 VAL A HG22 1  
ATOM 654   H HG23 . VAL A 1 45 ? 5.589   7.493   -2.403  1.00 0.00 ? 45 VAL A HG23 1  
ATOM 655   N N    . PRO A 1 46 ? 3.491   6.348   -5.880  1.00 0.00 ? 46 PRO A N    1  
ATOM 656   C CA   . PRO A 1 46 ? 2.213   5.658   -5.893  1.00 0.00 ? 46 PRO A CA   1  
ATOM 657   C C    . PRO A 1 46 ? 1.653   5.515   -4.476  1.00 0.00 ? 46 PRO A C    1  
ATOM 658   O O    . PRO A 1 46 ? 1.962   4.551   -3.777  1.00 0.00 ? 46 PRO A O    1  
ATOM 659   C CB   . PRO A 1 46 ? 2.495   4.320   -6.558  1.00 0.00 ? 46 PRO A CB   1  
ATOM 660   C CG   . PRO A 1 46 ? 4.000   4.121   -6.472  1.00 0.00 ? 46 PRO A CG   1  
ATOM 661   C CD   . PRO A 1 46 ? 4.625   5.454   -6.093  1.00 0.00 ? 46 PRO A CD   1  
ATOM 662   H HA   . PRO A 1 46 ? 1.536   6.189   -6.402  1.00 0.00 ? 46 PRO A HA   1  
ATOM 663   H HB2  . PRO A 1 46 ? 1.965   3.513   -6.052  1.00 0.00 ? 46 PRO A HB2  1  
ATOM 664   H HB3  . PRO A 1 46 ? 2.160   4.321   -7.595  1.00 0.00 ? 46 PRO A HB3  1  
ATOM 665   H HG2  . PRO A 1 46 ? 4.243   3.361   -5.730  1.00 0.00 ? 46 PRO A HG2  1  
ATOM 666   H HG3  . PRO A 1 46 ? 4.394   3.772   -7.427  1.00 0.00 ? 46 PRO A HG3  1  
ATOM 667   H HD2  . PRO A 1 46 ? 5.234   5.364   -5.194  1.00 0.00 ? 46 PRO A HD2  1  
ATOM 668   H HD3  . PRO A 1 46 ? 5.278   5.824   -6.884  1.00 0.00 ? 46 PRO A HD3  1  
ATOM 669   N N    . TRP A 1 47 ? 0.839   6.488   -4.095  1.00 0.00 ? 47 TRP A N    1  
ATOM 670   C CA   . TRP A 1 47 ? 0.233   6.483   -2.774  1.00 0.00 ? 47 TRP A CA   1  
ATOM 671   C C    . TRP A 1 47 ? 0.014   5.026   -2.360  1.00 0.00 ? 47 TRP A C    1  
ATOM 672   O O    . TRP A 1 47 ? 0.443   4.612   -1.285  1.00 0.00 ? 47 TRP A O    1  
ATOM 673   C CB   . TRP A 1 47 ? -1.055  7.308   -2.759  1.00 0.00 ? 47 TRP A CB   1  
ATOM 674   C CG   . TRP A 1 47 ? -0.846  8.781   -2.402  1.00 0.00 ? 47 TRP A CG   1  
ATOM 675   C CD1  . TRP A 1 47 ? 0.242   9.535   -2.614  1.00 0.00 ? 47 TRP A CD1  1  
ATOM 676   C CD2  . TRP A 1 47 ? -1.798  9.654   -1.757  1.00 0.00 ? 47 TRP A CD2  1  
ATOM 677   N NE1  . TRP A 1 47 ? 0.061   10.824  -2.155  1.00 0.00 ? 47 TRP A NE1  1  
ATOM 678   C CE2  . TRP A 1 47 ? -1.218  10.898  -1.617  1.00 0.00 ? 47 TRP A CE2  1  
ATOM 679   C CE3  . TRP A 1 47 ? -3.105  9.399   -1.306  1.00 0.00 ? 47 TRP A CE3  1  
ATOM 680   C CZ2  . TRP A 1 47 ? -1.873  11.987  -1.027  1.00 0.00 ? 47 TRP A CZ2  1  
ATOM 681   C CZ3  . TRP A 1 47 ? -3.745  10.497  -0.719  1.00 0.00 ? 47 TRP A CZ3  1  
ATOM 682   C CH2  . TRP A 1 47 ? -3.176  11.756  -0.571  1.00 0.00 ? 47 TRP A CH2  1  
ATOM 683   H H    . TRP A 1 47 ? 0.592   7.268   -4.670  1.00 0.00 ? 47 TRP A H    1  
ATOM 684   H HA   . TRP A 1 47 ? 0.928   6.965   -2.087  1.00 0.00 ? 47 TRP A HA   1  
ATOM 685   H HB2  . TRP A 1 47 ? -1.526  7.246   -3.740  1.00 0.00 ? 47 TRP A HB2  1  
ATOM 686   H HB3  . TRP A 1 47 ? -1.749  6.867   -2.043  1.00 0.00 ? 47 TRP A HB3  1  
ATOM 687   H HD1  . TRP A 1 47 ? 1.154   9.176   -3.090  1.00 0.00 ? 47 TRP A HD1  1  
ATOM 688   H HE1  . TRP A 1 47 ? 0.788   11.635  -2.206  1.00 0.00 ? 47 TRP A HE1  1  
ATOM 689   H HE3  . TRP A 1 47 ? -3.584  8.425   -1.404  1.00 0.00 ? 47 TRP A HE3  1  
ATOM 690   H HZ2  . TRP A 1 47 ? -1.393  12.960  -0.929  1.00 0.00 ? 47 TRP A HZ2  1  
ATOM 691   H HZ3  . TRP A 1 47 ? -4.761  10.354  -0.352  1.00 0.00 ? 47 TRP A HZ3  1  
ATOM 692   H HH2  . TRP A 1 47 ? -3.742  12.561  -0.101  1.00 0.00 ? 47 TRP A HH2  1  
ATOM 693   N N    . CYS A 1 48 ? -0.653  4.289   -3.236  1.00 0.00 ? 48 CYS A N    1  
ATOM 694   C CA   . CYS A 1 48 ? -0.934  2.888   -2.975  1.00 0.00 ? 48 CYS A CA   1  
ATOM 695   C C    . CYS A 1 48 ? 0.161   2.047   -3.635  1.00 0.00 ? 48 CYS A C    1  
ATOM 696   O O    . CYS A 1 48 ? 0.256   1.996   -4.861  1.00 0.00 ? 48 CYS A O    1  
ATOM 697   C CB   . CYS A 1 48 ? -2.329  2.490   -3.462  1.00 0.00 ? 48 CYS A CB   1  
ATOM 698   S SG   . CYS A 1 48 ? -3.037  1.015   -2.641  1.00 0.00 ? 48 CYS A SG   1  
ATOM 699   H H    . CYS A 1 48 ? -0.999  4.634   -4.109  1.00 0.00 ? 48 CYS A H    1  
ATOM 700   H HA   . CYS A 1 48 ? -0.919  2.762   -1.893  1.00 0.00 ? 48 CYS A HA   1  
ATOM 701   H HB2  . CYS A 1 48 ? -3.005  3.332   -3.310  1.00 0.00 ? 48 CYS A HB2  1  
ATOM 702   H HB3  . CYS A 1 48 ? -2.286  2.306   -4.535  1.00 0.00 ? 48 CYS A HB3  1  
ATOM 703   N N    . PHE A 1 49 ? 0.960   1.408   -2.794  1.00 0.00 ? 49 PHE A N    1  
ATOM 704   C CA   . PHE A 1 49 ? 2.045   0.573   -3.280  1.00 0.00 ? 49 PHE A CA   1  
ATOM 705   C C    . PHE A 1 49 ? 2.054   -0.782  -2.570  1.00 0.00 ? 49 PHE A C    1  
ATOM 706   O O    . PHE A 1 49 ? 1.438   -0.939  -1.517  1.00 0.00 ? 49 PHE A O    1  
ATOM 707   C CB   . PHE A 1 49 ? 3.350   1.307   -2.967  1.00 0.00 ? 49 PHE A CB   1  
ATOM 708   C CG   . PHE A 1 49 ? 3.422   1.872   -1.547  1.00 0.00 ? 49 PHE A CG   1  
ATOM 709   C CD1  . PHE A 1 49 ? 3.569   1.032   -0.488  1.00 0.00 ? 49 PHE A CD1  1  
ATOM 710   C CD2  . PHE A 1 49 ? 3.340   3.214   -1.344  1.00 0.00 ? 49 PHE A CD2  1  
ATOM 711   C CE1  . PHE A 1 49 ? 3.635   1.556   0.830   1.00 0.00 ? 49 PHE A CE1  1  
ATOM 712   C CE2  . PHE A 1 49 ? 3.406   3.738   -0.026  1.00 0.00 ? 49 PHE A CE2  1  
ATOM 713   C CZ   . PHE A 1 49 ? 3.553   2.898   1.033   1.00 0.00 ? 49 PHE A CZ   1  
ATOM 714   H H    . PHE A 1 49 ? 0.876   1.455   -1.798  1.00 0.00 ? 49 PHE A H    1  
ATOM 715   H HA   . PHE A 1 49 ? 1.883   0.421   -4.347  1.00 0.00 ? 49 PHE A HA   1  
ATOM 716   H HB2  . PHE A 1 49 ? 4.185   0.623   -3.118  1.00 0.00 ? 49 PHE A HB2  1  
ATOM 717   H HB3  . PHE A 1 49 ? 3.475   2.124   -3.679  1.00 0.00 ? 49 PHE A HB3  1  
ATOM 718   H HD1  . PHE A 1 49 ? 3.635   -0.044  -0.651  1.00 0.00 ? 49 PHE A HD1  1  
ATOM 719   H HD2  . PHE A 1 49 ? 3.222   3.888   -2.193  1.00 0.00 ? 49 PHE A HD2  1  
ATOM 720   H HE1  . PHE A 1 49 ? 3.753   0.882   1.679   1.00 0.00 ? 49 PHE A HE1  1  
ATOM 721   H HE2  . PHE A 1 49 ? 3.340   4.814   0.137   1.00 0.00 ? 49 PHE A HE2  1  
ATOM 722   H HZ   . PHE A 1 49 ? 3.604   3.300   2.045   1.00 0.00 ? 49 PHE A HZ   1  
ATOM 723   N N    . LYS A 1 50 ? 2.759   -1.727  -3.174  1.00 0.00 ? 50 LYS A N    1  
ATOM 724   C CA   . LYS A 1 50 ? 2.856   -3.064  -2.613  1.00 0.00 ? 50 LYS A CA   1  
ATOM 725   C C    . LYS A 1 50 ? 3.618   -3.001  -1.287  1.00 0.00 ? 50 LYS A C    1  
ATOM 726   O O    . LYS A 1 50 ? 4.288   -2.011  -0.998  1.00 0.00 ? 50 LYS A O    1  
ATOM 727   C CB   . LYS A 1 50 ? 3.470   -4.028  -3.629  1.00 0.00 ? 50 LYS A CB   1  
ATOM 728   C CG   . LYS A 1 50 ? 2.492   -4.318  -4.770  1.00 0.00 ? 50 LYS A CG   1  
ATOM 729   C CD   . LYS A 1 50 ? 2.468   -5.811  -5.106  1.00 0.00 ? 50 LYS A CD   1  
ATOM 730   C CE   . LYS A 1 50 ? 2.742   -6.043  -6.593  1.00 0.00 ? 50 LYS A CE   1  
ATOM 731   N NZ   . LYS A 1 50 ? 2.054   -7.266  -7.062  1.00 0.00 ? 50 LYS A NZ   1  
ATOM 732   H H    . LYS A 1 50 ? 3.258   -1.591  -4.031  1.00 0.00 ? 50 LYS A H    1  
ATOM 733   H HA   . LYS A 1 50 ? 1.842   -3.409  -2.413  1.00 0.00 ? 50 LYS A HA   1  
ATOM 734   H HB2  . LYS A 1 50 ? 4.389   -3.602  -4.033  1.00 0.00 ? 50 LYS A HB2  1  
ATOM 735   H HB3  . LYS A 1 50 ? 3.742   -4.960  -3.134  1.00 0.00 ? 50 LYS A HB3  1  
ATOM 736   H HG2  . LYS A 1 50 ? 1.492   -3.988  -4.489  1.00 0.00 ? 50 LYS A HG2  1  
ATOM 737   H HG3  . LYS A 1 50 ? 2.780   -3.748  -5.654  1.00 0.00 ? 50 LYS A HG3  1  
ATOM 738   H HD2  . LYS A 1 50 ? 3.214   -6.334  -4.508  1.00 0.00 ? 50 LYS A HD2  1  
ATOM 739   H HD3  . LYS A 1 50 ? 1.497   -6.230  -4.841  1.00 0.00 ? 50 LYS A HD3  1  
ATOM 740   H HE2  . LYS A 1 50 ? 2.402   -5.183  -7.170  1.00 0.00 ? 50 LYS A HE2  1  
ATOM 741   H HE3  . LYS A 1 50 ? 3.815   -6.136  -6.760  1.00 0.00 ? 50 LYS A HE3  1  
ATOM 742   H HZ1  . LYS A 1 50 ? 1.557   -7.682  -6.300  1.00 0.00 ? 50 LYS A HZ1  1  
ATOM 743   H HZ2  . LYS A 1 50 ? 1.410   -7.028  -7.789  1.00 0.00 ? 50 LYS A HZ2  1  
ATOM 744   H HZ3  . LYS A 1 50 ? 2.729   -7.915  -7.413  1.00 0.00 ? 50 LYS A HZ3  1  
ATOM 745   N N    . PRO A 1 51 ? 3.486   -4.100  -0.496  1.00 0.00 ? 51 PRO A N    1  
ATOM 746   C CA   . PRO A 1 51 ? 4.153   -4.179  0.792   1.00 0.00 ? 51 PRO A CA   1  
ATOM 747   C C    . PRO A 1 51 ? 5.650   -4.441  0.619   1.00 0.00 ? 51 PRO A C    1  
ATOM 748   O O    . PRO A 1 51 ? 6.045   -5.466  0.065   1.00 0.00 ? 51 PRO A O    1  
ATOM 749   C CB   . PRO A 1 51 ? 3.437   -5.294  1.538   1.00 0.00 ? 51 PRO A CB   1  
ATOM 750   C CG   . PRO A 1 51 ? 2.710   -6.104  0.478   1.00 0.00 ? 51 PRO A CG   1  
ATOM 751   C CD   . PRO A 1 51 ? 2.701   -5.291  -0.806  1.00 0.00 ? 51 PRO A CD   1  
ATOM 752   H HA   . PRO A 1 51 ? 4.082   -3.306  1.274   1.00 0.00 ? 51 PRO A HA   1  
ATOM 753   H HB2  . PRO A 1 51 ? 4.146   -5.914  2.086   1.00 0.00 ? 51 PRO A HB2  1  
ATOM 754   H HB3  . PRO A 1 51 ? 2.737   -4.888  2.268   1.00 0.00 ? 51 PRO A HB3  1  
ATOM 755   H HG2  . PRO A 1 51 ? 3.208   -7.061  0.320   1.00 0.00 ? 51 PRO A HG2  1  
ATOM 756   H HG3  . PRO A 1 51 ? 1.691   -6.324  0.798   1.00 0.00 ? 51 PRO A HG3  1  
ATOM 757   H HD2  . PRO A 1 51 ? 3.139   -5.850  -1.633  1.00 0.00 ? 51 PRO A HD2  1  
ATOM 758   H HD3  . PRO A 1 51 ? 1.685   -5.030  -1.102  1.00 0.00 ? 51 PRO A HD3  1  
ATOM 759   N N    . LEU A 1 52 ? 6.444   -3.497  1.103   1.00 0.00 ? 52 LEU A N    1  
ATOM 760   C CA   . LEU A 1 52 ? 7.889   -3.613  1.008   1.00 0.00 ? 52 LEU A CA   1  
ATOM 761   C C    . LEU A 1 52 ? 8.287   -5.085  1.126   1.00 0.00 ? 52 LEU A C    1  
ATOM 762   O O    . LEU A 1 52 ? 7.791   -5.798  1.998   1.00 0.00 ? 52 LEU A O    1  
ATOM 763   C CB   . LEU A 1 52 ? 8.568   -2.708  2.038   1.00 0.00 ? 52 LEU A CB   1  
ATOM 764   C CG   . LEU A 1 52 ? 10.090  -2.825  2.134   1.00 0.00 ? 52 LEU A CG   1  
ATOM 765   C CD1  . LEU A 1 52 ? 10.665  -1.755  3.065   1.00 0.00 ? 52 LEU A CD1  1  
ATOM 766   C CD2  . LEU A 1 52 ? 10.506  -4.236  2.556   1.00 0.00 ? 52 LEU A CD2  1  
ATOM 767   H H    . LEU A 1 52 ? 6.115   -2.666  1.552   1.00 0.00 ? 52 LEU A H    1  
ATOM 768   H HA   . LEU A 1 52 ? 8.182   -3.254  0.021   1.00 0.00 ? 52 LEU A HA   1  
ATOM 769   H HB2  . LEU A 1 52 ? 8.317   -1.673  1.805   1.00 0.00 ? 52 LEU A HB2  1  
ATOM 770   H HB3  . LEU A 1 52 ? 8.144   -2.925  3.018   1.00 0.00 ? 52 LEU A HB3  1  
ATOM 771   H HG   . LEU A 1 52 ? 10.510  -2.648  1.144   1.00 0.00 ? 52 LEU A HG   1  
ATOM 772   H HD11 . LEU A 1 52 ? 9.900   -1.008  3.276   1.00 0.00 ? 52 LEU A HD11 1  
ATOM 773   H HD12 . LEU A 1 52 ? 10.985  -2.220  3.998   1.00 0.00 ? 52 LEU A HD12 1  
ATOM 774   H HD13 . LEU A 1 52 ? 11.519  -1.277  2.586   1.00 0.00 ? 52 LEU A HD13 1  
ATOM 775   H HD21 . LEU A 1 52 ? 9.671   -4.727  3.055   1.00 0.00 ? 52 LEU A HD21 1  
ATOM 776   H HD22 . LEU A 1 52 ? 10.791  -4.809  1.674   1.00 0.00 ? 52 LEU A HD22 1  
ATOM 777   H HD23 . LEU A 1 52 ? 11.353  -4.176  3.240   1.00 0.00 ? 52 LEU A HD23 1  
ATOM 778   N N    . GLN A 1 53 ? 9.179   -5.498  0.237   1.00 0.00 ? 53 GLN A N    1  
ATOM 779   C CA   . GLN A 1 53 ? 9.649   -6.873  0.231   1.00 0.00 ? 53 GLN A CA   1  
ATOM 780   C C    . GLN A 1 53 ? 10.401  -7.182  1.526   1.00 0.00 ? 53 GLN A C    1  
ATOM 781   O O    . GLN A 1 53 ? 11.629  -7.258  1.533   1.00 0.00 ? 53 GLN A O    1  
ATOM 782   C CB   . GLN A 1 53 ? 10.527  -7.146  -0.992  1.00 0.00 ? 53 GLN A CB   1  
ATOM 783   C CG   . GLN A 1 53 ? 11.633  -6.096  -1.119  1.00 0.00 ? 53 GLN A CG   1  
ATOM 784   C CD   . GLN A 1 53 ? 11.301  -5.080  -2.214  1.00 0.00 ? 53 GLN A CD   1  
ATOM 785   O OE1  . GLN A 1 53 ? 11.078  -5.419  -3.364  1.00 0.00 ? 53 GLN A OE1  1  
ATOM 786   N NE2  . GLN A 1 53 ? 11.280  -3.818  -1.793  1.00 0.00 ? 53 GLN A NE2  1  
ATOM 787   H H    . GLN A 1 53 ? 9.577   -4.912  -0.469  1.00 0.00 ? 53 GLN A H    1  
ATOM 788   H HA   . GLN A 1 53 ? 8.750   -7.486  0.169   1.00 0.00 ? 53 GLN A HA   1  
ATOM 789   H HB2  . GLN A 1 53 ? 10.971  -8.138  -0.911  1.00 0.00 ? 53 GLN A HB2  1  
ATOM 790   H HB3  . GLN A 1 53 ? 9.914   -7.144  -1.893  1.00 0.00 ? 53 GLN A HB3  1  
ATOM 791   H HG2  . GLN A 1 53 ? 11.761  -5.581  -0.167  1.00 0.00 ? 53 GLN A HG2  1  
ATOM 792   H HG3  . GLN A 1 53 ? 12.579  -6.585  -1.347  1.00 0.00 ? 53 GLN A HG3  1  
ATOM 793   H HE21 . GLN A 1 53 ? 11.472  -3.608  -0.835  1.00 0.00 ? 53 GLN A HE21 1  
ATOM 794   H HE22 . GLN A 1 53 ? 11.073  -3.081  -2.435  1.00 0.00 ? 53 GLN A HE22 1  
ATOM 795   N N    . GLU A 1 54 ? 9.633   -7.353  2.593   1.00 0.00 ? 54 GLU A N    1  
ATOM 796   C CA   . GLU A 1 54 ? 10.212  -7.653  3.891   1.00 0.00 ? 54 GLU A CA   1  
ATOM 797   C C    . GLU A 1 54 ? 11.283  -8.737  3.758   1.00 0.00 ? 54 GLU A C    1  
ATOM 798   O O    . GLU A 1 54 ? 10.994  -9.850  3.320   1.00 0.00 ? 54 GLU A O    1  
ATOM 799   C CB   . GLU A 1 54 ? 9.130   -8.070  4.890   1.00 0.00 ? 54 GLU A CB   1  
ATOM 800   C CG   . GLU A 1 54 ? 8.700   -9.520  4.659   1.00 0.00 ? 54 GLU A CG   1  
ATOM 801   C CD   . GLU A 1 54 ? 8.275   -9.740  3.205   1.00 0.00 ? 54 GLU A CD   1  
ATOM 802   O OE1  . GLU A 1 54 ? 7.433   -8.946  2.734   1.00 0.00 ? 54 GLU A OE1  1  
ATOM 803   O OE2  . GLU A 1 54 ? 8.801   -10.698 2.599   1.00 0.00 ? 54 GLU A OE2  1  
ATOM 804   H H    . GLU A 1 54 ? 8.635   -7.290  2.579   1.00 0.00 ? 54 GLU A H    1  
ATOM 805   H HA   . GLU A 1 54 ? 10.668  -6.721  4.227   1.00 0.00 ? 54 GLU A HA   1  
ATOM 806   H HB2  . GLU A 1 54 ? 9.506   -7.956  5.907   1.00 0.00 ? 54 GLU A HB2  1  
ATOM 807   H HB3  . GLU A 1 54 ? 8.267   -7.411  4.794   1.00 0.00 ? 54 GLU A HB3  1  
ATOM 808   H HG2  . GLU A 1 54 ? 9.523   -10.191 4.906   1.00 0.00 ? 54 GLU A HG2  1  
ATOM 809   H HG3  . GLU A 1 54 ? 7.875   -9.769  5.325   1.00 0.00 ? 54 GLU A HG3  1  
ATOM 810   N N    . ALA A 1 55 ? 12.497  -8.375  4.143   1.00 0.00 ? 55 ALA A N    1  
ATOM 811   C CA   . ALA A 1 55 ? 13.613  -9.303  4.072   1.00 0.00 ? 55 ALA A CA   1  
ATOM 812   C C    . ALA A 1 55 ? 14.663  -8.912  5.114   1.00 0.00 ? 55 ALA A C    1  
ATOM 813   O O    . ALA A 1 55 ? 14.625  -7.808  5.655   1.00 0.00 ? 55 ALA A O    1  
ATOM 814   C CB   . ALA A 1 55 ? 14.178  -9.314  2.650   1.00 0.00 ? 55 ALA A CB   1  
ATOM 815   H H    . ALA A 1 55 ? 12.724  -7.468  4.498   1.00 0.00 ? 55 ALA A H    1  
ATOM 816   H HA   . ALA A 1 55 ? 13.233  -10.297 4.306   1.00 0.00 ? 55 ALA A HA   1  
ATOM 817   H HB1  . ALA A 1 55 ? 14.687  -10.261 2.469   1.00 0.00 ? 55 ALA A HB1  1  
ATOM 818   H HB2  . ALA A 1 55 ? 13.364  -9.196  1.935   1.00 0.00 ? 55 ALA A HB2  1  
ATOM 819   H HB3  . ALA A 1 55 ? 14.886  -8.493  2.534   1.00 0.00 ? 55 ALA A HB3  1  
ATOM 820   N N    . GLU A 1 56 ? 15.577  -9.839  5.363   1.00 0.00 ? 56 GLU A N    1  
ATOM 821   C CA   . GLU A 1 56 ? 16.636  -9.605  6.330   1.00 0.00 ? 56 GLU A CA   1  
ATOM 822   C C    . GLU A 1 56 ? 17.877  -10.421 5.966   1.00 0.00 ? 56 GLU A C    1  
ATOM 823   O O    . GLU A 1 56 ? 17.849  -11.651 6.002   1.00 0.00 ? 56 GLU A O    1  
ATOM 824   C CB   . GLU A 1 56 ? 16.164  -9.928  7.749   1.00 0.00 ? 56 GLU A CB   1  
ATOM 825   C CG   . GLU A 1 56 ? 16.950  -9.123  8.785   1.00 0.00 ? 56 GLU A CG   1  
ATOM 826   C CD   . GLU A 1 56 ? 16.279  -7.774  9.056   1.00 0.00 ? 56 GLU A CD   1  
ATOM 827   O OE1  . GLU A 1 56 ? 16.559  -6.836  8.280   1.00 0.00 ? 56 GLU A OE1  1  
ATOM 828   O OE2  . GLU A 1 56 ? 15.502  -7.713  10.033  1.00 0.00 ? 56 GLU A OE2  1  
ATOM 829   H H    . GLU A 1 56 ? 15.601  -10.734 4.918   1.00 0.00 ? 56 GLU A H    1  
ATOM 830   H HA   . GLU A 1 56 ? 16.860  -8.540  6.262   1.00 0.00 ? 56 GLU A HA   1  
ATOM 831   H HB2  . GLU A 1 56 ? 15.100  -9.707  7.842   1.00 0.00 ? 56 GLU A HB2  1  
ATOM 832   H HB3  . GLU A 1 56 ? 16.285  -10.994 7.943   1.00 0.00 ? 56 GLU A HB3  1  
ATOM 833   H HG2  . GLU A 1 56 ? 17.022  -9.690  9.714   1.00 0.00 ? 56 GLU A HG2  1  
ATOM 834   H HG3  . GLU A 1 56 ? 17.968  -8.962  8.430   1.00 0.00 ? 56 GLU A HG3  1  
ATOM 835   N N    . CYS A 1 57 ? 18.938  -9.705  5.623   1.00 0.00 ? 57 CYS A N    1  
ATOM 836   C CA   . CYS A 1 57 ? 20.187  -10.348 5.253   1.00 0.00 ? 57 CYS A CA   1  
ATOM 837   C C    . CYS A 1 57 ? 21.263  -9.918  6.252   1.00 0.00 ? 57 CYS A C    1  
ATOM 838   O O    . CYS A 1 57 ? 21.808  -10.748 6.978   1.00 0.00 ? 57 CYS A O    1  
ATOM 839   C CB   . CYS A 1 57 ? 20.585  -10.024 3.811   1.00 0.00 ? 57 CYS A CB   1  
ATOM 840   S SG   . CYS A 1 57 ? 21.352  -11.410 2.896   1.00 0.00 ? 57 CYS A SG   1  
ATOM 841   H H    . CYS A 1 57 ? 18.953  -8.706  5.596   1.00 0.00 ? 57 CYS A H    1  
ATOM 842   H HA   . CYS A 1 57 ? 20.015  -11.423 5.308   1.00 0.00 ? 57 CYS A HA   1  
ATOM 843   H HB2  . CYS A 1 57 ? 19.697  -9.697  3.269   1.00 0.00 ? 57 CYS A HB2  1  
ATOM 844   H HB3  . CYS A 1 57 ? 21.280  -9.184  3.821   1.00 0.00 ? 57 CYS A HB3  1  
ATOM 845   N N    . THR A 1 58 ? 21.538  -8.622  6.256   1.00 0.00 ? 58 THR A N    1  
ATOM 846   C CA   . THR A 1 58 ? 22.539  -8.072  7.154   1.00 0.00 ? 58 THR A CA   1  
ATOM 847   C C    . THR A 1 58 ? 22.472  -6.543  7.155   1.00 0.00 ? 58 THR A C    1  
ATOM 848   O O    . THR A 1 58 ? 22.491  -5.917  6.097   1.00 0.00 ? 58 THR A O    1  
ATOM 849   C CB   . THR A 1 58 ? 23.904  -8.620  6.732   1.00 0.00 ? 58 THR A CB   1  
ATOM 850   O OG1  . THR A 1 58 ? 24.803  -8.101  7.709   1.00 0.00 ? 58 THR A OG1  1  
ATOM 851   C CG2  . THR A 1 58 ? 24.396  -8.017  5.415   1.00 0.00 ? 58 THR A CG2  1  
ATOM 852   H H    . THR A 1 58 ? 21.090  -7.954  5.662   1.00 0.00 ? 58 THR A H    1  
ATOM 853   H HA   . THR A 1 58 ? 22.311  -8.403  8.167   1.00 0.00 ? 58 THR A HA   1  
ATOM 854   H HB   . THR A 1 58 ? 23.887  -9.709  6.679   1.00 0.00 ? 58 THR A HB   1  
ATOM 855   H HG1  . THR A 1 58 ? 25.670  -8.599  7.674   1.00 0.00 ? 58 THR A HG1  1  
ATOM 856   H HG21 . THR A 1 58 ? 23.552  -7.592  4.872   1.00 0.00 ? 58 THR A HG21 1  
ATOM 857   H HG22 . THR A 1 58 ? 25.125  -7.234  5.624   1.00 0.00 ? 58 THR A HG22 1  
ATOM 858   H HG23 . THR A 1 58 ? 24.862  -8.795  4.810   1.00 0.00 ? 58 THR A HG23 1  
ATOM 859   N N    . PHE A 1 59 ? 22.395  -5.987  8.355   1.00 0.00 ? 59 PHE A N    1  
ATOM 860   C CA   . PHE A 1 59 ? 22.326  -4.544  8.508   1.00 0.00 ? 59 PHE A CA   1  
ATOM 861   C C    . PHE A 1 59 ? 21.274  -3.944  7.572   1.00 0.00 ? 59 PHE A C    1  
ATOM 862   O O    . PHE A 1 59 ? 21.563  -3.655  6.412   1.00 0.00 ? 59 PHE A O    1  
ATOM 863   C CB   . PHE A 1 59 ? 23.701  -3.988  8.134   1.00 0.00 ? 59 PHE A CB   1  
ATOM 864   C CG   . PHE A 1 59 ? 23.794  -2.462  8.200   1.00 0.00 ? 59 PHE A CG   1  
ATOM 865   C CD1  . PHE A 1 59 ? 23.652  -1.823  9.392   1.00 0.00 ? 59 PHE A CD1  1  
ATOM 866   C CD2  . PHE A 1 59 ? 24.017  -1.745  7.066   1.00 0.00 ? 59 PHE A CD2  1  
ATOM 867   C CE1  . PHE A 1 59 ? 23.738  -0.407  9.453   1.00 0.00 ? 59 PHE A CE1  1  
ATOM 868   C CE2  . PHE A 1 59 ? 24.104  -0.329  7.127   1.00 0.00 ? 59 PHE A CE2  1  
ATOM 869   C CZ   . PHE A 1 59 ? 23.962  0.311   8.319   1.00 0.00 ? 59 PHE A CZ   1  
ATOM 870   H H    . PHE A 1 59 ? 22.381  -6.504  9.211   1.00 0.00 ? 59 PHE A H    1  
ATOM 871   H HA   . PHE A 1 59 ? 22.047  -4.342  9.542   1.00 0.00 ? 59 PHE A HA   1  
ATOM 872   H HB2  . PHE A 1 59 ? 24.449  -4.416  8.802   1.00 0.00 ? 59 PHE A HB2  1  
ATOM 873   H HB3  . PHE A 1 59 ? 23.951  -4.313  7.125   1.00 0.00 ? 59 PHE A HB3  1  
ATOM 874   H HD1  . PHE A 1 59 ? 23.473  -2.397  10.301  1.00 0.00 ? 59 PHE A HD1  1  
ATOM 875   H HD2  . PHE A 1 59 ? 24.131  -2.257  6.111   1.00 0.00 ? 59 PHE A HD2  1  
ATOM 876   H HE1  . PHE A 1 59 ? 23.625  0.106   10.409  1.00 0.00 ? 59 PHE A HE1  1  
ATOM 877   H HE2  . PHE A 1 59 ? 24.283  0.246   6.219   1.00 0.00 ? 59 PHE A HE2  1  
ATOM 878   H HZ   . PHE A 1 59 ? 24.028  1.398   8.367   1.00 0.00 ? 59 PHE A HZ   1  
ATOM 879   N N    . GLU A 1 1  ? 2.034   -17.233 15.340  1.00 0.00 ? 1  GLU A N    2  
ATOM 880   C CA   . GLU A 1 1  ? 0.675   -16.916 14.936  1.00 0.00 ? 1  GLU A CA   2  
ATOM 881   C C    . GLU A 1 1  ? 0.684   -16.069 13.662  1.00 0.00 ? 1  GLU A C    2  
ATOM 882   O O    . GLU A 1 1  ? -0.021  -15.065 13.575  1.00 0.00 ? 1  GLU A O    2  
ATOM 883   C CB   . GLU A 1 1  ? -0.081  -16.206 16.061  1.00 0.00 ? 1  GLU A CB   2  
ATOM 884   C CG   . GLU A 1 1  ? -1.590  -16.413 15.924  1.00 0.00 ? 1  GLU A CG   2  
ATOM 885   C CD   . GLU A 1 1  ? -2.163  -17.111 17.159  1.00 0.00 ? 1  GLU A CD   2  
ATOM 886   O OE1  . GLU A 1 1  ? -2.073  -16.503 18.247  1.00 0.00 ? 1  GLU A OE1  2  
ATOM 887   O OE2  . GLU A 1 1  ? -2.677  -18.237 16.987  1.00 0.00 ? 1  GLU A OE2  2  
ATOM 888   H H    . GLU A 1 1  ? 2.702   -17.254 14.597  1.00 0.00 ? 1  GLU A H    2  
ATOM 889   H HA   . GLU A 1 1  ? 0.200   -17.877 14.738  1.00 0.00 ? 1  GLU A HA   2  
ATOM 890   H HB2  . GLU A 1 1  ? 0.256   -16.586 17.026  1.00 0.00 ? 1  GLU A HB2  2  
ATOM 891   H HB3  . GLU A 1 1  ? 0.148   -15.140 16.041  1.00 0.00 ? 1  GLU A HB3  2  
ATOM 892   H HG2  . GLU A 1 1  ? -2.082  -15.449 15.786  1.00 0.00 ? 1  GLU A HG2  2  
ATOM 893   H HG3  . GLU A 1 1  ? -1.800  -17.008 15.035  1.00 0.00 ? 1  GLU A HG3  2  
ATOM 894   N N    . GLU A 1 2  ? 1.490   -16.505 12.705  1.00 0.00 ? 2  GLU A N    2  
ATOM 895   C CA   . GLU A 1 2  ? 1.601   -15.800 11.440  1.00 0.00 ? 2  GLU A CA   2  
ATOM 896   C C    . GLU A 1 2  ? 1.907   -14.320 11.682  1.00 0.00 ? 2  GLU A C    2  
ATOM 897   O O    . GLU A 1 2  ? 2.028   -13.887 12.827  1.00 0.00 ? 2  GLU A O    2  
ATOM 898   C CB   . GLU A 1 2  ? 0.329   -15.967 10.606  1.00 0.00 ? 2  GLU A CB   2  
ATOM 899   C CG   . GLU A 1 2  ? 0.494   -17.082 9.571   1.00 0.00 ? 2  GLU A CG   2  
ATOM 900   C CD   . GLU A 1 2  ? -0.300  -16.773 8.301   1.00 0.00 ? 2  GLU A CD   2  
ATOM 901   O OE1  . GLU A 1 2  ? -1.356  -16.117 8.437   1.00 0.00 ? 2  GLU A OE1  2  
ATOM 902   O OE2  . GLU A 1 2  ? 0.166   -17.199 7.222   1.00 0.00 ? 2  GLU A OE2  2  
ATOM 903   H H    . GLU A 1 2  ? 2.061   -17.323 12.784  1.00 0.00 ? 2  GLU A H    2  
ATOM 904   H HA   . GLU A 1 2  ? 2.434   -16.270 10.918  1.00 0.00 ? 2  GLU A HA   2  
ATOM 905   H HB2  . GLU A 1 2  ? -0.512  -16.196 11.261  1.00 0.00 ? 2  GLU A HB2  2  
ATOM 906   H HB3  . GLU A 1 2  ? 0.094   -15.030 10.102  1.00 0.00 ? 2  GLU A HB3  2  
ATOM 907   H HG2  . GLU A 1 2  ? 1.550   -17.200 9.325   1.00 0.00 ? 2  GLU A HG2  2  
ATOM 908   H HG3  . GLU A 1 2  ? 0.158   -18.028 9.994   1.00 0.00 ? 2  GLU A HG3  2  
ATOM 909   N N    . TYR A 1 3  ? 2.023   -13.586 10.586  1.00 0.00 ? 3  TYR A N    2  
ATOM 910   C CA   . TYR A 1 3  ? 2.312   -12.164 10.664  1.00 0.00 ? 3  TYR A CA   2  
ATOM 911   C C    . TYR A 1 3  ? 1.032   -11.355 10.878  1.00 0.00 ? 3  TYR A C    2  
ATOM 912   O O    . TYR A 1 3  ? -0.041  -11.924 11.073  1.00 0.00 ? 3  TYR A O    2  
ATOM 913   C CB   . TYR A 1 3  ? 2.923   -11.783 9.314   1.00 0.00 ? 3  TYR A CB   2  
ATOM 914   C CG   . TYR A 1 3  ? 3.981   -10.681 9.399   1.00 0.00 ? 3  TYR A CG   2  
ATOM 915   C CD1  . TYR A 1 3  ? 5.149   -10.899 10.103  1.00 0.00 ? 3  TYR A CD1  2  
ATOM 916   C CD2  . TYR A 1 3  ? 3.769   -9.471  8.772   1.00 0.00 ? 3  TYR A CD2  2  
ATOM 917   C CE1  . TYR A 1 3  ? 6.145   -9.862  10.182  1.00 0.00 ? 3  TYR A CE1  2  
ATOM 918   C CE2  . TYR A 1 3  ? 4.766   -8.434  8.851   1.00 0.00 ? 3  TYR A CE2  2  
ATOM 919   C CZ   . TYR A 1 3  ? 5.904   -8.681  9.553   1.00 0.00 ? 3  TYR A CZ   2  
ATOM 920   O OH   . TYR A 1 3  ? 6.846   -7.702  9.628   1.00 0.00 ? 3  TYR A OH   2  
ATOM 921   H H    . TYR A 1 3  ? 1.923   -13.946 9.658   1.00 0.00 ? 3  TYR A H    2  
ATOM 922   H HA   . TYR A 1 3  ? 2.981   -12.003 11.510  1.00 0.00 ? 3  TYR A HA   2  
ATOM 923   H HB2  . TYR A 1 3  ? 3.371   -12.670 8.866   1.00 0.00 ? 3  TYR A HB2  2  
ATOM 924   H HB3  . TYR A 1 3  ? 2.126   -11.456 8.646   1.00 0.00 ? 3  TYR A HB3  2  
ATOM 925   H HD1  . TYR A 1 3  ? 5.316   -11.855 10.598  1.00 0.00 ? 3  TYR A HD1  2  
ATOM 926   H HD2  . TYR A 1 3  ? 2.848   -9.299  8.216   1.00 0.00 ? 3  TYR A HD2  2  
ATOM 927   H HE1  . TYR A 1 3  ? 7.071   -10.021 10.735  1.00 0.00 ? 3  TYR A HE1  2  
ATOM 928   H HE2  . TYR A 1 3  ? 4.611   -7.473  8.361   1.00 0.00 ? 3  TYR A HE2  2  
ATOM 929   H HH   . TYR A 1 3  ? 6.431   -6.854  9.958   1.00 0.00 ? 3  TYR A HH   2  
ATOM 930   N N    . VAL A 1 4  ? 1.187   -10.040 10.836  1.00 0.00 ? 4  VAL A N    2  
ATOM 931   C CA   . VAL A 1 4  ? 0.056   -9.146  11.022  1.00 0.00 ? 4  VAL A CA   2  
ATOM 932   C C    . VAL A 1 4  ? 0.514   -7.701  10.818  1.00 0.00 ? 4  VAL A C    2  
ATOM 933   O O    . VAL A 1 4  ? 1.405   -7.223  11.519  1.00 0.00 ? 4  VAL A O    2  
ATOM 934   C CB   . VAL A 1 4  ? -0.577  -9.384  12.395  1.00 0.00 ? 4  VAL A CB   2  
ATOM 935   C CG1  . VAL A 1 4  ? 0.459   -9.234  13.510  1.00 0.00 ? 4  VAL A CG1  2  
ATOM 936   C CG2  . VAL A 1 4  ? -1.765  -8.446  12.620  1.00 0.00 ? 4  VAL A CG2  2  
ATOM 937   H H    . VAL A 1 4  ? 2.063   -9.585  10.677  1.00 0.00 ? 4  VAL A H    2  
ATOM 938   H HA   . VAL A 1 4  ? -0.685  -9.391  10.262  1.00 0.00 ? 4  VAL A HA   2  
ATOM 939   H HB   . VAL A 1 4  ? -0.950  -10.408 12.419  1.00 0.00 ? 4  VAL A HB   2  
ATOM 940   H HG11 . VAL A 1 4  ? 1.437   -9.034  13.073  1.00 0.00 ? 4  VAL A HG11 2  
ATOM 941   H HG12 . VAL A 1 4  ? 0.176   -8.407  14.161  1.00 0.00 ? 4  VAL A HG12 2  
ATOM 942   H HG13 . VAL A 1 4  ? 0.503   -10.155 14.092  1.00 0.00 ? 4  VAL A HG13 2  
ATOM 943   H HG21 . VAL A 1 4  ? -1.485  -7.431  12.339  1.00 0.00 ? 4  VAL A HG21 2  
ATOM 944   H HG22 . VAL A 1 4  ? -2.607  -8.773  12.009  1.00 0.00 ? 4  VAL A HG22 2  
ATOM 945   H HG23 . VAL A 1 4  ? -2.050  -8.467  13.672  1.00 0.00 ? 4  VAL A HG23 2  
ATOM 946   N N    . GLY A 1 5  ? -0.114  -7.046  9.853   1.00 0.00 ? 5  GLY A N    2  
ATOM 947   C CA   . GLY A 1 5  ? 0.218   -5.665  9.547   1.00 0.00 ? 5  GLY A CA   2  
ATOM 948   C C    . GLY A 1 5  ? -0.586  -4.701  10.422  1.00 0.00 ? 5  GLY A C    2  
ATOM 949   O O    . GLY A 1 5  ? -1.759  -4.445  10.155  1.00 0.00 ? 5  GLY A O    2  
ATOM 950   H H    . GLY A 1 5  ? -0.837  -7.442  9.287   1.00 0.00 ? 5  GLY A H    2  
ATOM 951   H HA2  . GLY A 1 5  ? 1.284   -5.500  9.703   1.00 0.00 ? 5  GLY A HA2  2  
ATOM 952   H HA3  . GLY A 1 5  ? 0.015   -5.462  8.495   1.00 0.00 ? 5  GLY A HA3  2  
ATOM 953   N N    . LEU A 1 6  ? 0.078   -4.192  11.450  1.00 0.00 ? 6  LEU A N    2  
ATOM 954   C CA   . LEU A 1 6  ? -0.560  -3.261  12.366  1.00 0.00 ? 6  LEU A CA   2  
ATOM 955   C C    . LEU A 1 6  ? 0.235   -1.955  12.395  1.00 0.00 ? 6  LEU A C    2  
ATOM 956   O O    . LEU A 1 6  ? 0.269   -1.267  13.414  1.00 0.00 ? 6  LEU A O    2  
ATOM 957   C CB   . LEU A 1 6  ? -0.739  -3.903  13.743  1.00 0.00 ? 6  LEU A CB   2  
ATOM 958   C CG   . LEU A 1 6  ? 0.541   -4.388  14.428  1.00 0.00 ? 6  LEU A CG   2  
ATOM 959   C CD1  . LEU A 1 6  ? 0.870   -3.525  15.648  1.00 0.00 ? 6  LEU A CD1  2  
ATOM 960   C CD2  . LEU A 1 6  ? 0.442   -5.872  14.786  1.00 0.00 ? 6  LEU A CD2  2  
ATOM 961   H H    . LEU A 1 6  ? 1.032   -4.405  11.660  1.00 0.00 ? 6  LEU A H    2  
ATOM 962   H HA   . LEU A 1 6  ? -1.556  -3.051  11.977  1.00 0.00 ? 6  LEU A HA   2  
ATOM 963   H HB2  . LEU A 1 6  ? -1.227  -3.181  14.398  1.00 0.00 ? 6  LEU A HB2  2  
ATOM 964   H HB3  . LEU A 1 6  ? -1.417  -4.751  13.642  1.00 0.00 ? 6  LEU A HB3  2  
ATOM 965   H HG   . LEU A 1 6  ? 1.367   -4.280  13.725  1.00 0.00 ? 6  LEU A HG   2  
ATOM 966   H HD11 . LEU A 1 6  ? 0.388   -2.553  15.546  1.00 0.00 ? 6  LEU A HD11 2  
ATOM 967   H HD12 . LEU A 1 6  ? 0.507   -4.018  16.550  1.00 0.00 ? 6  LEU A HD12 2  
ATOM 968   H HD13 . LEU A 1 6  ? 1.950   -3.390  15.717  1.00 0.00 ? 6  LEU A HD13 2  
ATOM 969   H HD21 . LEU A 1 6  ? -0.252  -6.365  14.105  1.00 0.00 ? 6  LEU A HD21 2  
ATOM 970   H HD22 . LEU A 1 6  ? 1.426   -6.333  14.697  1.00 0.00 ? 6  LEU A HD22 2  
ATOM 971   H HD23 . LEU A 1 6  ? 0.083   -5.976  15.810  1.00 0.00 ? 6  LEU A HD23 2  
ATOM 972   N N    . SER A 1 7  ? 0.856   -1.652  11.264  1.00 0.00 ? 7  SER A N    2  
ATOM 973   C CA   . SER A 1 7  ? 1.649   -0.440  11.147  1.00 0.00 ? 7  SER A CA   2  
ATOM 974   C C    . SER A 1 7  ? 2.407   -0.437  9.818   1.00 0.00 ? 7  SER A C    2  
ATOM 975   O O    . SER A 1 7  ? 2.212   -1.321  8.986   1.00 0.00 ? 7  SER A O    2  
ATOM 976   C CB   . SER A 1 7  ? 2.626   -0.306  12.316  1.00 0.00 ? 7  SER A CB   2  
ATOM 977   O OG   . SER A 1 7  ? 3.048   -1.575  12.807  1.00 0.00 ? 7  SER A OG   2  
ATOM 978   H H    . SER A 1 7  ? 0.823   -2.217  10.439  1.00 0.00 ? 7  SER A H    2  
ATOM 979   H HA   . SER A 1 7  ? 0.930   0.379   11.179  1.00 0.00 ? 7  SER A HA   2  
ATOM 980   H HB2  . SER A 1 7  ? 3.497   0.267   11.997  1.00 0.00 ? 7  SER A HB2  2  
ATOM 981   H HB3  . SER A 1 7  ? 2.153   0.255   13.122  1.00 0.00 ? 7  SER A HB3  2  
ATOM 982   H HG   . SER A 1 7  ? 3.994   -1.521  13.126  1.00 0.00 ? 7  SER A HG   2  
ATOM 983   N N    . ALA A 1 8  ? 3.256   0.568   9.660   1.00 0.00 ? 8  ALA A N    2  
ATOM 984   C CA   . ALA A 1 8  ? 4.044   0.698   8.447   1.00 0.00 ? 8  ALA A CA   2  
ATOM 985   C C    . ALA A 1 8  ? 4.540   -0.684  8.015   1.00 0.00 ? 8  ALA A C    2  
ATOM 986   O O    . ALA A 1 8  ? 3.865   -1.381  7.260   1.00 0.00 ? 8  ALA A O    2  
ATOM 987   C CB   . ALA A 1 8  ? 5.193   1.680   8.686   1.00 0.00 ? 8  ALA A CB   2  
ATOM 988   H H    . ALA A 1 8  ? 3.409   1.284   10.342  1.00 0.00 ? 8  ALA A H    2  
ATOM 989   H HA   . ALA A 1 8  ? 3.394   1.101   7.670   1.00 0.00 ? 8  ALA A HA   2  
ATOM 990   H HB1  . ALA A 1 8  ? 4.911   2.666   8.315   1.00 0.00 ? 8  ALA A HB1  2  
ATOM 991   H HB2  . ALA A 1 8  ? 5.402   1.741   9.754   1.00 0.00 ? 8  ALA A HB2  2  
ATOM 992   H HB3  . ALA A 1 8  ? 6.083   1.334   8.161   1.00 0.00 ? 8  ALA A HB3  2  
ATOM 993   N N    . ASN A 1 9  ? 5.715   -1.038  8.514   1.00 0.00 ? 9  ASN A N    2  
ATOM 994   C CA   . ASN A 1 9  ? 6.309   -2.324  8.189   1.00 0.00 ? 9  ASN A CA   2  
ATOM 995   C C    . ASN A 1 9  ? 6.101   -2.616  6.702   1.00 0.00 ? 9  ASN A C    2  
ATOM 996   O O    . ASN A 1 9  ? 6.903   -2.202  5.866   1.00 0.00 ? 9  ASN A O    2  
ATOM 997   C CB   . ASN A 1 9  ? 5.652   -3.451  8.989   1.00 0.00 ? 9  ASN A CB   2  
ATOM 998   C CG   . ASN A 1 9  ? 6.327   -3.622  10.351  1.00 0.00 ? 9  ASN A CG   2  
ATOM 999   O OD1  . ASN A 1 9  ? 7.415   -3.130  10.600  1.00 0.00 ? 9  ASN A OD1  2  
ATOM 1000  N ND2  . ASN A 1 9  ? 5.621   -4.344  11.217  1.00 0.00 ? 9  ASN A ND2  2  
ATOM 1001  H H    . ASN A 1 9  ? 6.258   -0.465  9.128   1.00 0.00 ? 9  ASN A H    2  
ATOM 1002  H HA   . ASN A 1 9  ? 7.362   -2.228  8.452   1.00 0.00 ? 9  ASN A HA   2  
ATOM 1003  H HB2  . ASN A 1 9  ? 4.593   -3.234  9.128   1.00 0.00 ? 9  ASN A HB2  2  
ATOM 1004  H HB3  . ASN A 1 9  ? 5.715   -4.384  8.428   1.00 0.00 ? 9  ASN A HB3  2  
ATOM 1005  H HD21 . ASN A 1 9  ? 4.734   -4.719  10.950  1.00 0.00 ? 9  ASN A HD21 2  
ATOM 1006  H HD22 . ASN A 1 9  ? 5.978   -4.512  12.136  1.00 0.00 ? 9  ASN A HD22 2  
ATOM 1007  N N    . GLN A 1 10 ? 5.020   -3.328  6.417   1.00 0.00 ? 10 GLN A N    2  
ATOM 1008  C CA   . GLN A 1 10 ? 4.697   -3.680  5.045   1.00 0.00 ? 10 GLN A CA   2  
ATOM 1009  C C    . GLN A 1 10 ? 4.728   -2.435  4.156   1.00 0.00 ? 10 GLN A C    2  
ATOM 1010  O O    . GLN A 1 10 ? 5.224   -2.484  3.031   1.00 0.00 ? 10 GLN A O    2  
ATOM 1011  C CB   . GLN A 1 10 ? 3.338   -4.378  4.964   1.00 0.00 ? 10 GLN A CB   2  
ATOM 1012  C CG   . GLN A 1 10 ? 3.019   -5.111  6.268   1.00 0.00 ? 10 GLN A CG   2  
ATOM 1013  C CD   . GLN A 1 10 ? 2.033   -6.256  6.027   1.00 0.00 ? 10 GLN A CD   2  
ATOM 1014  O OE1  . GLN A 1 10 ? 1.501   -6.433  4.944   1.00 0.00 ? 10 GLN A OE1  2  
ATOM 1015  N NE2  . GLN A 1 10 ? 1.821   -7.021  7.094   1.00 0.00 ? 10 GLN A NE2  2  
ATOM 1016  H H    . GLN A 1 10 ? 4.373   -3.661  7.102   1.00 0.00 ? 10 GLN A H    2  
ATOM 1017  H HA   . GLN A 1 10 ? 5.475   -4.377  4.733   1.00 0.00 ? 10 GLN A HA   2  
ATOM 1018  H HB2  . GLN A 1 10 ? 2.560   -3.643  4.756   1.00 0.00 ? 10 GLN A HB2  2  
ATOM 1019  H HB3  . GLN A 1 10 ? 3.337   -5.086  4.135   1.00 0.00 ? 10 GLN A HB3  2  
ATOM 1020  H HG2  . GLN A 1 10 ? 3.938   -5.503  6.703   1.00 0.00 ? 10 GLN A HG2  2  
ATOM 1021  H HG3  . GLN A 1 10 ? 2.598   -4.410  6.990   1.00 0.00 ? 10 GLN A HG3  2  
ATOM 1022  H HE21 . GLN A 1 10 ? 2.291   -6.821  7.954   1.00 0.00 ? 10 GLN A HE21 2  
ATOM 1023  H HE22 . GLN A 1 10 ? 1.192   -7.796  7.037   1.00 0.00 ? 10 GLN A HE22 2  
ATOM 1024  N N    . CYS A 1 11 ? 4.192   -1.349  4.693   1.00 0.00 ? 11 CYS A N    2  
ATOM 1025  C CA   . CYS A 1 11 ? 4.152   -0.094  3.963   1.00 0.00 ? 11 CYS A CA   2  
ATOM 1026  C C    . CYS A 1 11 ? 5.226   0.831   4.538   1.00 0.00 ? 11 CYS A C    2  
ATOM 1027  O O    . CYS A 1 11 ? 4.993   2.026   4.712   1.00 0.00 ? 11 CYS A O    2  
ATOM 1028  C CB   . CYS A 1 11 ? 2.763   0.545   4.011   1.00 0.00 ? 11 CYS A CB   2  
ATOM 1029  S SG   . CYS A 1 11 ? 1.403   -0.606  4.431   1.00 0.00 ? 11 CYS A SG   2  
ATOM 1030  H H    . CYS A 1 11 ? 3.791   -1.318  5.609   1.00 0.00 ? 11 CYS A H    2  
ATOM 1031  H HA   . CYS A 1 11 ? 4.364   -0.332  2.920   1.00 0.00 ? 11 CYS A HA   2  
ATOM 1032  H HB2  . CYS A 1 11 ? 2.775   1.353   4.743   1.00 0.00 ? 11 CYS A HB2  2  
ATOM 1033  H HB3  . CYS A 1 11 ? 2.552   0.996   3.042   1.00 0.00 ? 11 CYS A HB3  2  
ATOM 1034  N N    . ALA A 1 12 ? 6.380   0.243   4.819   1.00 0.00 ? 12 ALA A N    2  
ATOM 1035  C CA   . ALA A 1 12 ? 7.491   1.000   5.371   1.00 0.00 ? 12 ALA A CA   2  
ATOM 1036  C C    . ALA A 1 12 ? 8.479   1.336   4.253   1.00 0.00 ? 12 ALA A C    2  
ATOM 1037  O O    . ALA A 1 12 ? 9.691   1.242   4.442   1.00 0.00 ? 12 ALA A O    2  
ATOM 1038  C CB   . ALA A 1 12 ? 8.140   0.201   6.503   1.00 0.00 ? 12 ALA A CB   2  
ATOM 1039  H H    . ALA A 1 12 ? 6.562   -0.730  4.675   1.00 0.00 ? 12 ALA A H    2  
ATOM 1040  H HA   . ALA A 1 12 ? 7.089   1.926   5.781   1.00 0.00 ? 12 ALA A HA   2  
ATOM 1041  H HB1  . ALA A 1 12 ? 8.701   -0.635  6.082   1.00 0.00 ? 12 ALA A HB1  2  
ATOM 1042  H HB2  . ALA A 1 12 ? 7.367   -0.180  7.169   1.00 0.00 ? 12 ALA A HB2  2  
ATOM 1043  H HB3  . ALA A 1 12 ? 8.817   0.847   7.062   1.00 0.00 ? 12 ALA A HB3  2  
ATOM 1044  N N    . VAL A 1 13 ? 7.925   1.722   3.113   1.00 0.00 ? 13 VAL A N    2  
ATOM 1045  C CA   . VAL A 1 13 ? 8.743   2.074   1.964   1.00 0.00 ? 13 VAL A CA   2  
ATOM 1046  C C    . VAL A 1 13 ? 8.946   3.590   1.933   1.00 0.00 ? 13 VAL A C    2  
ATOM 1047  O O    . VAL A 1 13 ? 8.106   4.343   2.423   1.00 0.00 ? 13 VAL A O    2  
ATOM 1048  C CB   . VAL A 1 13 ? 8.107   1.529   0.684   1.00 0.00 ? 13 VAL A CB   2  
ATOM 1049  C CG1  . VAL A 1 13 ? 9.157   0.868   -0.211  1.00 0.00 ? 13 VAL A CG1  2  
ATOM 1050  C CG2  . VAL A 1 13 ? 6.970   0.557   1.006   1.00 0.00 ? 13 VAL A CG2  2  
ATOM 1051  H H    . VAL A 1 13 ? 6.938   1.796   2.968   1.00 0.00 ? 13 VAL A H    2  
ATOM 1052  H HA   . VAL A 1 13 ? 9.712   1.592   2.091   1.00 0.00 ? 13 VAL A HA   2  
ATOM 1053  H HB   . VAL A 1 13 ? 7.683   2.371   0.136   1.00 0.00 ? 13 VAL A HB   2  
ATOM 1054  H HG11 . VAL A 1 13 ? 10.077  0.721   0.355   1.00 0.00 ? 13 VAL A HG11 2  
ATOM 1055  H HG12 . VAL A 1 13 ? 8.785   -0.097  -0.556  1.00 0.00 ? 13 VAL A HG12 2  
ATOM 1056  H HG13 . VAL A 1 13 ? 9.358   1.508   -1.070  1.00 0.00 ? 13 VAL A HG13 2  
ATOM 1057  H HG21 . VAL A 1 13 ? 7.250   -0.059  1.860   1.00 0.00 ? 13 VAL A HG21 2  
ATOM 1058  H HG22 . VAL A 1 13 ? 6.068   1.120   1.243   1.00 0.00 ? 13 VAL A HG22 2  
ATOM 1059  H HG23 . VAL A 1 13 ? 6.783   -0.082  0.143   1.00 0.00 ? 13 VAL A HG23 2  
ATOM 1060  N N    . PRO A 1 14 ? 10.097  4.003   1.337   1.00 0.00 ? 14 PRO A N    2  
ATOM 1061  C CA   . PRO A 1 14 ? 10.421  5.415   1.236   1.00 0.00 ? 14 PRO A CA   2  
ATOM 1062  C C    . PRO A 1 14 ? 9.577   6.096   0.157   1.00 0.00 ? 14 PRO A C    2  
ATOM 1063  O O    . PRO A 1 14 ? 8.857   7.053   0.439   1.00 0.00 ? 14 PRO A O    2  
ATOM 1064  C CB   . PRO A 1 14 ? 11.911  5.456   0.937   1.00 0.00 ? 14 PRO A CB   2  
ATOM 1065  C CG   . PRO A 1 14 ? 12.272  4.072   0.424   1.00 0.00 ? 14 PRO A CG   2  
ATOM 1066  C CD   . PRO A 1 14 ? 11.115  3.140   0.746   1.00 0.00 ? 14 PRO A CD   2  
ATOM 1067  H HA   . PRO A 1 14 ? 10.202  5.884   2.091   1.00 0.00 ? 14 PRO A HA   2  
ATOM 1068  H HB2  . PRO A 1 14 ? 12.140  6.220   0.194   1.00 0.00 ? 14 PRO A HB2  2  
ATOM 1069  H HB3  . PRO A 1 14 ? 12.482  5.702   1.833   1.00 0.00 ? 14 PRO A HB3  2  
ATOM 1070  H HG2  . PRO A 1 14 ? 12.453  4.098   -0.650  1.00 0.00 ? 14 PRO A HG2  2  
ATOM 1071  H HG3  . PRO A 1 14 ? 13.189  3.717   0.894   1.00 0.00 ? 14 PRO A HG3  2  
ATOM 1072  H HD2  . PRO A 1 14 ? 10.743  2.646   -0.152  1.00 0.00 ? 14 PRO A HD2  2  
ATOM 1073  H HD3  . PRO A 1 14 ? 11.419  2.355   1.438   1.00 0.00 ? 14 PRO A HD3  2  
ATOM 1074  N N    . ALA A 1 15 ? 9.693   5.576   -1.056  1.00 0.00 ? 15 ALA A N    2  
ATOM 1075  C CA   . ALA A 1 15 ? 8.949   6.122   -2.179  1.00 0.00 ? 15 ALA A CA   2  
ATOM 1076  C C    . ALA A 1 15 ? 9.617   5.689   -3.486  1.00 0.00 ? 15 ALA A C    2  
ATOM 1077  O O    . ALA A 1 15 ? 8.968   5.631   -4.529  1.00 0.00 ? 15 ALA A O    2  
ATOM 1078  C CB   . ALA A 1 15 ? 8.864   7.643   -2.044  1.00 0.00 ? 15 ALA A CB   2  
ATOM 1079  H H    . ALA A 1 15 ? 10.281  4.798   -1.277  1.00 0.00 ? 15 ALA A H    2  
ATOM 1080  H HA   . ALA A 1 15 ? 7.941   5.708   -2.142  1.00 0.00 ? 15 ALA A HA   2  
ATOM 1081  H HB1  . ALA A 1 15 ? 9.643   7.992   -1.366  1.00 0.00 ? 15 ALA A HB1  2  
ATOM 1082  H HB2  . ALA A 1 15 ? 7.886   7.918   -1.647  1.00 0.00 ? 15 ALA A HB2  2  
ATOM 1083  H HB3  . ALA A 1 15 ? 9.000   8.103   -3.022  1.00 0.00 ? 15 ALA A HB3  2  
ATOM 1084  N N    . LYS A 1 16 ? 10.906  5.398   -3.387  1.00 0.00 ? 16 LYS A N    2  
ATOM 1085  C CA   . LYS A 1 16 ? 11.668  4.972   -4.548  1.00 0.00 ? 16 LYS A CA   2  
ATOM 1086  C C    . LYS A 1 16 ? 11.657  3.445   -4.629  1.00 0.00 ? 16 LYS A C    2  
ATOM 1087  O O    . LYS A 1 16 ? 12.347  2.858   -5.461  1.00 0.00 ? 16 LYS A O    2  
ATOM 1088  C CB   . LYS A 1 16 ? 13.074  5.576   -4.516  1.00 0.00 ? 16 LYS A CB   2  
ATOM 1089  C CG   . LYS A 1 16 ? 13.888  5.009   -3.351  1.00 0.00 ? 16 LYS A CG   2  
ATOM 1090  C CD   . LYS A 1 16 ? 14.478  3.643   -3.708  1.00 0.00 ? 16 LYS A CD   2  
ATOM 1091  C CE   . LYS A 1 16 ? 15.939  3.545   -3.265  1.00 0.00 ? 16 LYS A CE   2  
ATOM 1092  N NZ   . LYS A 1 16 ? 16.162  2.308   -2.484  1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1093  H H    . LYS A 1 16 ? 11.426  5.448   -2.534  1.00 0.00 ? 16 LYS A H    2  
ATOM 1094  H HA   . LYS A 1 16 ? 11.167  5.369   -5.431  1.00 0.00 ? 16 LYS A HA   2  
ATOM 1095  H HB2  . LYS A 1 16 ? 13.585  5.368   -5.456  1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1096  H HB3  . LYS A 1 16 ? 13.006  6.660   -4.424  1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1097  H HG2  . LYS A 1 16 ? 14.690  5.700   -3.093  1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1098  H HG3  . LYS A 1 16 ? 13.252  4.915   -2.471  1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1099  H HD2  . LYS A 1 16 ? 13.896  2.855   -3.230  1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1100  H HD3  . LYS A 1 16 ? 14.409  3.483   -4.784  1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1101  H HE2  . LYS A 1 16 ? 16.592  3.553   -4.138  1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1102  H HE3  . LYS A 1 16 ? 16.202  4.415   -2.663  1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1103  H HZ1  . LYS A 1 16 ? 15.292  1.832   -2.357  1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1104  H HZ2  . LYS A 1 16 ? 16.799  1.713   -2.975  1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1105  H HZ3  . LYS A 1 16 ? 16.547  2.542   -1.591  1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1106  N N    . ASP A 1 17 ? 10.864  2.844   -3.754  1.00 0.00 ? 17 ASP A N    2  
ATOM 1107  C CA   . ASP A 1 17 ? 10.753  1.395   -3.716  1.00 0.00 ? 17 ASP A CA   2  
ATOM 1108  C C    . ASP A 1 17 ? 9.284   0.996   -3.872  1.00 0.00 ? 17 ASP A C    2  
ATOM 1109  O O    . ASP A 1 17 ? 8.927   -0.163  -3.665  1.00 0.00 ? 17 ASP A O    2  
ATOM 1110  C CB   . ASP A 1 17 ? 11.255  0.839   -2.382  1.00 0.00 ? 17 ASP A CB   2  
ATOM 1111  C CG   . ASP A 1 17 ? 12.585  0.087   -2.455  1.00 0.00 ? 17 ASP A CG   2  
ATOM 1112  O OD1  . ASP A 1 17 ? 12.942  -0.328  -3.579  1.00 0.00 ? 17 ASP A OD1  2  
ATOM 1113  O OD2  . ASP A 1 17 ? 13.215  -0.058  -1.385  1.00 0.00 ? 17 ASP A OD2  2  
ATOM 1114  H H    . ASP A 1 17 ? 10.305  3.328   -3.081  1.00 0.00 ? 17 ASP A H    2  
ATOM 1115  H HA   . ASP A 1 17 ? 11.371  1.039   -4.540  1.00 0.00 ? 17 ASP A HA   2  
ATOM 1116  H HB2  . ASP A 1 17 ? 11.360  1.664   -1.678  1.00 0.00 ? 17 ASP A HB2  2  
ATOM 1117  H HB3  . ASP A 1 17 ? 10.497  0.169   -1.977  1.00 0.00 ? 17 ASP A HB3  2  
ATOM 1118  N N    . ARG A 1 18 ? 8.472   1.979   -4.234  1.00 0.00 ? 18 ARG A N    2  
ATOM 1119  C CA   . ARG A 1 18 ? 7.050   1.745   -4.420  1.00 0.00 ? 18 ARG A CA   2  
ATOM 1120  C C    . ARG A 1 18 ? 6.798   1.041   -5.755  1.00 0.00 ? 18 ARG A C    2  
ATOM 1121  O O    . ARG A 1 18 ? 7.083   1.594   -6.815  1.00 0.00 ? 18 ARG A O    2  
ATOM 1122  C CB   . ARG A 1 18 ? 6.267   3.059   -4.387  1.00 0.00 ? 18 ARG A CB   2  
ATOM 1123  C CG   . ARG A 1 18 ? 6.791   3.982   -3.286  1.00 0.00 ? 18 ARG A CG   2  
ATOM 1124  C CD   . ARG A 1 18 ? 6.583   3.360   -1.904  1.00 0.00 ? 18 ARG A CD   2  
ATOM 1125  N NE   . ARG A 1 18 ? 6.823   4.373   -0.852  1.00 0.00 ? 18 ARG A NE   2  
ATOM 1126  C CZ   . ARG A 1 18 ? 6.063   5.461   -0.669  1.00 0.00 ? 18 ARG A CZ   2  
ATOM 1127  N NH1  . ARG A 1 18 ? 5.009   5.684   -1.466  1.00 0.00 ? 18 ARG A NH1  2  
ATOM 1128  N NH2  . ARG A 1 18 ? 6.356   6.326   0.312   1.00 0.00 ? 18 ARG A NH2  2  
ATOM 1129  H H    . ARG A 1 18 ? 8.771   2.919   -4.400  1.00 0.00 ? 18 ARG A H    2  
ATOM 1130  H HA   . ARG A 1 18 ? 6.760   1.111   -3.581  1.00 0.00 ? 18 ARG A HA   2  
ATOM 1131  H HB2  . ARG A 1 18 ? 6.346   3.557   -5.353  1.00 0.00 ? 18 ARG A HB2  2  
ATOM 1132  H HB3  . ARG A 1 18 ? 5.210   2.852   -4.221  1.00 0.00 ? 18 ARG A HB3  2  
ATOM 1133  H HG2  . ARG A 1 18 ? 7.851   4.179   -3.445  1.00 0.00 ? 18 ARG A HG2  2  
ATOM 1134  H HG3  . ARG A 1 18 ? 6.278   4.943   -3.337  1.00 0.00 ? 18 ARG A HG3  2  
ATOM 1135  H HD2  . ARG A 1 18 ? 5.569   2.970   -1.820  1.00 0.00 ? 18 ARG A HD2  2  
ATOM 1136  H HD3  . ARG A 1 18 ? 7.261   2.517   -1.770  1.00 0.00 ? 18 ARG A HD3  2  
ATOM 1137  H HE   . ARG A 1 18 ? 7.602   4.237   -0.239  1.00 0.00 ? 18 ARG A HE   2  
ATOM 1138  H HH11 . ARG A 1 18 ? 4.791   5.039   -2.198  1.00 0.00 ? 18 ARG A HH11 2  
ATOM 1139  H HH12 . ARG A 1 18 ? 4.442   6.496   -1.330  1.00 0.00 ? 18 ARG A HH12 2  
ATOM 1140  H HH21 . ARG A 1 18 ? 7.142   6.160   0.907   1.00 0.00 ? 18 ARG A HH21 2  
ATOM 1141  H HH22 . ARG A 1 18 ? 5.788   7.138   0.448   1.00 0.00 ? 18 ARG A HH22 2  
ATOM 1142  N N    . VAL A 1 19 ? 6.265   -0.168  -5.658  1.00 0.00 ? 19 VAL A N    2  
ATOM 1143  C CA   . VAL A 1 19 ? 5.971   -0.953  -6.845  1.00 0.00 ? 19 VAL A CA   2  
ATOM 1144  C C    . VAL A 1 19 ? 4.634   -0.499  -7.434  1.00 0.00 ? 19 VAL A C    2  
ATOM 1145  O O    . VAL A 1 19 ? 4.263   -0.910  -8.532  1.00 0.00 ? 19 VAL A O    2  
ATOM 1146  C CB   . VAL A 1 19 ? 5.999   -2.445  -6.506  1.00 0.00 ? 19 VAL A CB   2  
ATOM 1147  C CG1  . VAL A 1 19 ? 5.790   -3.296  -7.760  1.00 0.00 ? 19 VAL A CG1  2  
ATOM 1148  C CG2  . VAL A 1 19 ? 7.301   -2.822  -5.797  1.00 0.00 ? 19 VAL A CG2  2  
ATOM 1149  H H    . VAL A 1 19 ? 6.036   -0.611  -4.791  1.00 0.00 ? 19 VAL A H    2  
ATOM 1150  H HA   . VAL A 1 19 ? 6.760   -0.758  -7.572  1.00 0.00 ? 19 VAL A HA   2  
ATOM 1151  H HB   . VAL A 1 19 ? 5.175   -2.648  -5.822  1.00 0.00 ? 19 VAL A HB   2  
ATOM 1152  H HG11 . VAL A 1 19 ? 6.448   -2.941  -8.554  1.00 0.00 ? 19 VAL A HG11 2  
ATOM 1153  H HG12 . VAL A 1 19 ? 6.022   -4.337  -7.535  1.00 0.00 ? 19 VAL A HG12 2  
ATOM 1154  H HG13 . VAL A 1 19 ? 4.753   -3.217  -8.085  1.00 0.00 ? 19 VAL A HG13 2  
ATOM 1155  H HG21 . VAL A 1 19 ? 8.142   -2.349  -6.305  1.00 0.00 ? 19 VAL A HG21 2  
ATOM 1156  H HG22 . VAL A 1 19 ? 7.263   -2.482  -4.762  1.00 0.00 ? 19 VAL A HG22 2  
ATOM 1157  H HG23 . VAL A 1 19 ? 7.426   -3.905  -5.819  1.00 0.00 ? 19 VAL A HG23 2  
ATOM 1158  N N    . ASP A 1 20 ? 3.947   0.345   -6.677  1.00 0.00 ? 20 ASP A N    2  
ATOM 1159  C CA   . ASP A 1 20 ? 2.660   0.860   -7.110  1.00 0.00 ? 20 ASP A CA   2  
ATOM 1160  C C    . ASP A 1 20 ? 1.701   -0.309  -7.346  1.00 0.00 ? 20 ASP A C    2  
ATOM 1161  O O    . ASP A 1 20 ? 1.928   -1.135  -8.228  1.00 0.00 ? 20 ASP A O    2  
ATOM 1162  C CB   . ASP A 1 20 ? 2.790   1.636   -8.422  1.00 0.00 ? 20 ASP A CB   2  
ATOM 1163  C CG   . ASP A 1 20 ? 1.472   1.890   -9.157  1.00 0.00 ? 20 ASP A CG   2  
ATOM 1164  O OD1  . ASP A 1 20 ? 0.443   1.996   -8.456  1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1165  O OD2  . ASP A 1 20 ? 1.524   1.971   -10.403 1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1166  H H    . ASP A 1 20 ? 4.256   0.675   -5.785  1.00 0.00 ? 20 ASP A H    2  
ATOM 1167  H HA   . ASP A 1 20 ? 2.328   1.516   -6.305  1.00 0.00 ? 20 ASP A HA   2  
ATOM 1168  H HB2  . ASP A 1 20 ? 3.262   2.596   -8.213  1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1169  H HB3  . ASP A 1 20 ? 3.459   1.089   -9.086  1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1170  N N    . CYS A 1 21 ? 0.648   -0.341  -6.541  1.00 0.00 ? 21 CYS A N    2  
ATOM 1171  C CA   . CYS A 1 21 ? -0.346  -1.395  -6.651  1.00 0.00 ? 21 CYS A CA   2  
ATOM 1172  C C    . CYS A 1 21 ? -1.355  -0.993  -7.729  1.00 0.00 ? 21 CYS A C    2  
ATOM 1173  O O    . CYS A 1 21 ? -2.052  -1.843  -8.279  1.00 0.00 ? 21 CYS A O    2  
ATOM 1174  C CB   . CYS A 1 21 ? -1.025  -1.673  -5.309  1.00 0.00 ? 21 CYS A CB   2  
ATOM 1175  S SG   . CYS A 1 21 ? -1.337  -3.442  -4.959  1.00 0.00 ? 21 CYS A SG   2  
ATOM 1176  H H    . CYS A 1 21 ? 0.471   0.335   -5.826  1.00 0.00 ? 21 CYS A H    2  
ATOM 1177  H HA   . CYS A 1 21 ? 0.188   -2.300  -6.939  1.00 0.00 ? 21 CYS A HA   2  
ATOM 1178  H HB2  . CYS A 1 21 ? -0.405  -1.264  -4.511  1.00 0.00 ? 21 CYS A HB2  2  
ATOM 1179  H HB3  . CYS A 1 21 ? -1.975  -1.139  -5.280  1.00 0.00 ? 21 CYS A HB3  2  
ATOM 1180  N N    . GLY A 1 22 ? -1.400  0.304   -7.998  1.00 0.00 ? 22 GLY A N    2  
ATOM 1181  C CA   . GLY A 1 22 ? -2.312  0.829   -9.000  1.00 0.00 ? 22 GLY A CA   2  
ATOM 1182  C C    . GLY A 1 22 ? -3.767  0.662   -8.558  1.00 0.00 ? 22 GLY A C    2  
ATOM 1183  O O    . GLY A 1 22 ? -4.375  -0.382  -8.792  1.00 0.00 ? 22 GLY A O    2  
ATOM 1184  H H    . GLY A 1 22 ? -0.829  0.989   -7.546  1.00 0.00 ? 22 GLY A H    2  
ATOM 1185  H HA2  . GLY A 1 22 ? -2.099  1.884   -9.173  1.00 0.00 ? 22 GLY A HA2  2  
ATOM 1186  H HA3  . GLY A 1 22 ? -2.154  0.312   -9.947  1.00 0.00 ? 22 GLY A HA3  2  
ATOM 1187  N N    . TYR A 1 23 ? -4.284  1.706   -7.928  1.00 0.00 ? 23 TYR A N    2  
ATOM 1188  C CA   . TYR A 1 23 ? -5.656  1.688   -7.451  1.00 0.00 ? 23 TYR A CA   2  
ATOM 1189  C C    . TYR A 1 23 ? -6.333  3.042   -7.678  1.00 0.00 ? 23 TYR A C    2  
ATOM 1190  O O    . TYR A 1 23 ? -5.676  4.081   -7.650  1.00 0.00 ? 23 TYR A O    2  
ATOM 1191  C CB   . TYR A 1 23 ? -5.577  1.417   -5.947  1.00 0.00 ? 23 TYR A CB   2  
ATOM 1192  C CG   . TYR A 1 23 ? -5.626  -0.067  -5.579  1.00 0.00 ? 23 TYR A CG   2  
ATOM 1193  C CD1  . TYR A 1 23 ? -6.779  -0.794  -5.797  1.00 0.00 ? 23 TYR A CD1  2  
ATOM 1194  C CD2  . TYR A 1 23 ? -4.518  -0.678  -5.030  1.00 0.00 ? 23 TYR A CD2  2  
ATOM 1195  C CE1  . TYR A 1 23 ? -6.825  -2.191  -5.451  1.00 0.00 ? 23 TYR A CE1  2  
ATOM 1196  C CE2  . TYR A 1 23 ? -4.564  -2.075  -4.683  1.00 0.00 ? 23 TYR A CE2  2  
ATOM 1197  C CZ   . TYR A 1 23 ? -5.715  -2.763  -4.911  1.00 0.00 ? 23 TYR A CZ   2  
ATOM 1198  O OH   . TYR A 1 23 ? -5.758  -4.082  -4.584  1.00 0.00 ? 23 TYR A OH   2  
ATOM 1199  H H    . TYR A 1 23 ? -3.783  2.551   -7.742  1.00 0.00 ? 23 TYR A H    2  
ATOM 1200  H HA   . TYR A 1 23 ? -6.196  0.923   -8.008  1.00 0.00 ? 23 TYR A HA   2  
ATOM 1201  H HB2  . TYR A 1 23 ? -4.654  1.847   -5.559  1.00 0.00 ? 23 TYR A HB2  2  
ATOM 1202  H HB3  . TYR A 1 23 ? -6.401  1.931   -5.452  1.00 0.00 ? 23 TYR A HB3  2  
ATOM 1203  H HD1  . TYR A 1 23 ? -7.654  -0.311  -6.232  1.00 0.00 ? 23 TYR A HD1  2  
ATOM 1204  H HD2  . TYR A 1 23 ? -3.608  -0.104  -4.858  1.00 0.00 ? 23 TYR A HD2  2  
ATOM 1205  H HE1  . TYR A 1 23 ? -7.728  -2.778  -5.618  1.00 0.00 ? 23 TYR A HE1  2  
ATOM 1206  H HE2  . TYR A 1 23 ? -3.696  -2.571  -4.248  1.00 0.00 ? 23 TYR A HE2  2  
ATOM 1207  H HH   . TYR A 1 23 ? -4.872  -4.375  -4.225  1.00 0.00 ? 23 TYR A HH   2  
ATOM 1208  N N    . PRO A 1 24 ? -7.673  2.984   -7.904  1.00 0.00 ? 24 PRO A N    2  
ATOM 1209  C CA   . PRO A 1 24 ? -8.446  4.192   -8.136  1.00 0.00 ? 24 PRO A CA   2  
ATOM 1210  C C    . PRO A 1 24 ? -8.664  4.962   -6.832  1.00 0.00 ? 24 PRO A C    2  
ATOM 1211  O O    . PRO A 1 24 ? -8.025  5.986   -6.597  1.00 0.00 ? 24 PRO A O    2  
ATOM 1212  C CB   . PRO A 1 24 ? -9.743  3.714   -8.767  1.00 0.00 ? 24 PRO A CB   2  
ATOM 1213  C CG   . PRO A 1 24 ? -9.845  2.233   -8.441  1.00 0.00 ? 24 PRO A CG   2  
ATOM 1214  C CD   . PRO A 1 24 ? -8.485  1.771   -7.944  1.00 0.00 ? 24 PRO A CD   2  
ATOM 1215  H HA   . PRO A 1 24 ? -7.947  4.813   -8.740  1.00 0.00 ? 24 PRO A HA   2  
ATOM 1216  H HB2  . PRO A 1 24 ? -10.597 4.261   -8.368  1.00 0.00 ? 24 PRO A HB2  2  
ATOM 1217  H HB3  . PRO A 1 24 ? -9.737  3.877   -9.845  1.00 0.00 ? 24 PRO A HB3  2  
ATOM 1218  H HG2  . PRO A 1 24 ? -10.607 2.060   -7.681  1.00 0.00 ? 24 PRO A HG2  2  
ATOM 1219  H HG3  . PRO A 1 24 ? -10.141 1.667   -9.324  1.00 0.00 ? 24 PRO A HG3  2  
ATOM 1220  H HD2  . PRO A 1 24 ? -8.558  1.311   -6.959  1.00 0.00 ? 24 PRO A HD2  2  
ATOM 1221  H HD3  . PRO A 1 24 ? -8.051  1.026   -8.612  1.00 0.00 ? 24 PRO A HD3  2  
ATOM 1222  N N    . HIS A 1 25 ? -9.570  4.439   -6.017  1.00 0.00 ? 25 HIS A N    2  
ATOM 1223  C CA   . HIS A 1 25 ? -9.880  5.065   -4.743  1.00 0.00 ? 25 HIS A CA   2  
ATOM 1224  C C    . HIS A 1 25 ? -8.946  4.518   -3.662  1.00 0.00 ? 25 HIS A C    2  
ATOM 1225  O O    . HIS A 1 25 ? -9.300  3.581   -2.948  1.00 0.00 ? 25 HIS A O    2  
ATOM 1226  C CB   . HIS A 1 25 ? -11.359 4.885   -4.396  1.00 0.00 ? 25 HIS A CB   2  
ATOM 1227  C CG   . HIS A 1 25 ? -11.743 3.463   -4.062  1.00 0.00 ? 25 HIS A CG   2  
ATOM 1228  N ND1  . HIS A 1 25 ? -12.967 3.127   -3.509  1.00 0.00 ? 25 HIS A ND1  2  
ATOM 1229  C CD2  . HIS A 1 25 ? -11.054 2.296   -4.210  1.00 0.00 ? 25 HIS A CD2  2  
ATOM 1230  C CE1  . HIS A 1 25 ? -13.001 1.814   -3.335  1.00 0.00 ? 25 HIS A CE1  2  
ATOM 1231  N NE2  . HIS A 1 25 ? -11.814 1.301   -3.770  1.00 0.00 ? 25 HIS A NE2  2  
ATOM 1232  H H    . HIS A 1 25 ? -10.086 3.606   -6.216  1.00 0.00 ? 25 HIS A H    2  
ATOM 1233  H HA   . HIS A 1 25 ? -9.695  6.132   -4.865  1.00 0.00 ? 25 HIS A HA   2  
ATOM 1234  H HB2  . HIS A 1 25 ? -11.603 5.525   -3.548  1.00 0.00 ? 25 HIS A HB2  2  
ATOM 1235  H HB3  . HIS A 1 25 ? -11.963 5.226   -5.237  1.00 0.00 ? 25 HIS A HB3  2  
ATOM 1236  H HD1  . HIS A 1 25 ? -13.700 3.767   -3.280  1.00 0.00 ? 25 HIS A HD1  2  
ATOM 1237  H HD2  . HIS A 1 25 ? -10.049 2.197   -4.620  1.00 0.00 ? 25 HIS A HD2  2  
ATOM 1238  H HE1  . HIS A 1 25 ? -13.831 1.245   -2.918  1.00 0.00 ? 25 HIS A HE1  2  
ATOM 1239  H HE2  . HIS A 1 25 ? -11.581 0.329   -3.811  1.00 0.00 ? 25 HIS A HE2  2  
ATOM 1240  N N    . VAL A 1 26 ? -7.772  5.126   -3.576  1.00 0.00 ? 26 VAL A N    2  
ATOM 1241  C CA   . VAL A 1 26 ? -6.785  4.711   -2.594  1.00 0.00 ? 26 VAL A CA   2  
ATOM 1242  C C    . VAL A 1 26 ? -6.898  5.603   -1.355  1.00 0.00 ? 26 VAL A C    2  
ATOM 1243  O O    . VAL A 1 26 ? -7.032  6.820   -1.472  1.00 0.00 ? 26 VAL A O    2  
ATOM 1244  C CB   . VAL A 1 26 ? -5.388  4.728   -3.217  1.00 0.00 ? 26 VAL A CB   2  
ATOM 1245  C CG1  . VAL A 1 26 ? -5.267  3.676   -4.321  1.00 0.00 ? 26 VAL A CG1  2  
ATOM 1246  C CG2  . VAL A 1 26 ? -5.041  6.121   -3.746  1.00 0.00 ? 26 VAL A CG2  2  
ATOM 1247  H H    . VAL A 1 26 ? -7.493  5.887   -4.161  1.00 0.00 ? 26 VAL A H    2  
ATOM 1248  H HA   . VAL A 1 26 ? -7.015  3.685   -2.309  1.00 0.00 ? 26 VAL A HA   2  
ATOM 1249  H HB   . VAL A 1 26 ? -4.670  4.478   -2.436  1.00 0.00 ? 26 VAL A HB   2  
ATOM 1250  H HG11 . VAL A 1 26 ? -6.043  3.842   -5.068  1.00 0.00 ? 26 VAL A HG11 2  
ATOM 1251  H HG12 . VAL A 1 26 ? -4.287  3.754   -4.791  1.00 0.00 ? 26 VAL A HG12 2  
ATOM 1252  H HG13 . VAL A 1 26 ? -5.385  2.682   -3.890  1.00 0.00 ? 26 VAL A HG13 2  
ATOM 1253  H HG21 . VAL A 1 26 ? -5.807  6.830   -3.433  1.00 0.00 ? 26 VAL A HG21 2  
ATOM 1254  H HG22 . VAL A 1 26 ? -4.074  6.431   -3.348  1.00 0.00 ? 26 VAL A HG22 2  
ATOM 1255  H HG23 . VAL A 1 26 ? -4.993  6.094   -4.835  1.00 0.00 ? 26 VAL A HG23 2  
ATOM 1256  N N    . THR A 1 27 ? -6.840  4.962   -0.197  1.00 0.00 ? 27 THR A N    2  
ATOM 1257  C CA   . THR A 1 27 ? -6.935  5.682   1.062   1.00 0.00 ? 27 THR A CA   2  
ATOM 1258  C C    . THR A 1 27 ? -6.178  4.934   2.162   1.00 0.00 ? 27 THR A C    2  
ATOM 1259  O O    . THR A 1 27 ? -5.734  3.806   1.958   1.00 0.00 ? 27 THR A O    2  
ATOM 1260  C CB   . THR A 1 27 ? -8.417  5.890   1.378   1.00 0.00 ? 27 THR A CB   2  
ATOM 1261  O OG1  . THR A 1 27 ? -8.805  4.685   2.032   1.00 0.00 ? 27 THR A OG1  2  
ATOM 1262  C CG2  . THR A 1 27 ? -9.285  5.926   0.118   1.00 0.00 ? 27 THR A CG2  2  
ATOM 1263  H H    . THR A 1 27 ? -6.731  3.972   -0.110  1.00 0.00 ? 27 THR A H    2  
ATOM 1264  H HA   . THR A 1 27 ? -6.449  6.650   0.941   1.00 0.00 ? 27 THR A HA   2  
ATOM 1265  H HB   . THR A 1 27 ? -8.565  6.787   1.978   1.00 0.00 ? 27 THR A HB   2  
ATOM 1266  H HG1  . THR A 1 27 ? -9.776  4.721   2.267   1.00 0.00 ? 27 THR A HG1  2  
ATOM 1267  H HG21 . THR A 1 27 ? -9.074  5.049   -0.494  1.00 0.00 ? 27 THR A HG21 2  
ATOM 1268  H HG22 . THR A 1 27 ? -10.337 5.927   0.402   1.00 0.00 ? 27 THR A HG22 2  
ATOM 1269  H HG23 . THR A 1 27 ? -9.061  6.828   -0.451  1.00 0.00 ? 27 THR A HG23 2  
ATOM 1270  N N    . PRO A 1 28 ? -6.051  5.612   3.334   1.00 0.00 ? 28 PRO A N    2  
ATOM 1271  C CA   . PRO A 1 28 ? -5.356  5.024   4.467   1.00 0.00 ? 28 PRO A CA   2  
ATOM 1272  C C    . PRO A 1 28 ? -6.214  3.950   5.139   1.00 0.00 ? 28 PRO A C    2  
ATOM 1273  O O    . PRO A 1 28 ? -6.236  3.847   6.365   1.00 0.00 ? 28 PRO A O    2  
ATOM 1274  C CB   . PRO A 1 28 ? -5.040  6.193   5.385   1.00 0.00 ? 28 PRO A CB   2  
ATOM 1275  C CG   . PRO A 1 28 ? -5.971  7.318   4.962   1.00 0.00 ? 28 PRO A CG   2  
ATOM 1276  C CD   . PRO A 1 28 ? -6.564  6.950   3.612   1.00 0.00 ? 28 PRO A CD   2  
ATOM 1277  H HA   . PRO A 1 28 ? -4.526  4.558   4.160   1.00 0.00 ? 28 PRO A HA   2  
ATOM 1278  H HB2  . PRO A 1 28 ? -5.200  5.925   6.429   1.00 0.00 ? 28 PRO A HB2  2  
ATOM 1279  H HB3  . PRO A 1 28 ? -3.996  6.493   5.290   1.00 0.00 ? 28 PRO A HB3  2  
ATOM 1280  H HG2  . PRO A 1 28 ? -6.760  7.458   5.701   1.00 0.00 ? 28 PRO A HG2  2  
ATOM 1281  H HG3  . PRO A 1 28 ? -5.426  8.260   4.896   1.00 0.00 ? 28 PRO A HG3  2  
ATOM 1282  H HD2  . PRO A 1 28 ? -7.654  6.958   3.643   1.00 0.00 ? 28 PRO A HD2  2  
ATOM 1283  H HD3  . PRO A 1 28 ? -6.262  7.658   2.840   1.00 0.00 ? 28 PRO A HD3  2  
ATOM 1284  N N    . LYS A 1 29 ? -6.899  3.179   4.308   1.00 0.00 ? 29 LYS A N    2  
ATOM 1285  C CA   . LYS A 1 29 ? -7.756  2.117   4.808   1.00 0.00 ? 29 LYS A CA   2  
ATOM 1286  C C    . LYS A 1 29 ? -8.366  1.361   3.625   1.00 0.00 ? 29 LYS A C    2  
ATOM 1287  O O    . LYS A 1 29 ? -8.387  0.131   3.615   1.00 0.00 ? 29 LYS A O    2  
ATOM 1288  C CB   . LYS A 1 29 ? -8.796  2.680   5.779   1.00 0.00 ? 29 LYS A CB   2  
ATOM 1289  C CG   . LYS A 1 29 ? -9.230  1.619   6.793   1.00 0.00 ? 29 LYS A CG   2  
ATOM 1290  C CD   . LYS A 1 29 ? -10.530 0.942   6.355   1.00 0.00 ? 29 LYS A CD   2  
ATOM 1291  C CE   . LYS A 1 29 ? -11.590 1.027   7.455   1.00 0.00 ? 29 LYS A CE   2  
ATOM 1292  N NZ   . LYS A 1 29 ? -12.359 -0.235  7.532   1.00 0.00 ? 29 LYS A NZ   2  
ATOM 1293  H H    . LYS A 1 29 ? -6.875  3.270   3.313   1.00 0.00 ? 29 LYS A H    2  
ATOM 1294  H HA   . LYS A 1 29 ? -7.128  1.428   5.372   1.00 0.00 ? 29 LYS A HA   2  
ATOM 1295  H HB2  . LYS A 1 29 ? -8.381  3.541   6.304   1.00 0.00 ? 29 LYS A HB2  2  
ATOM 1296  H HB3  . LYS A 1 29 ? -9.664  3.034   5.224   1.00 0.00 ? 29 LYS A HB3  2  
ATOM 1297  H HG2  . LYS A 1 29 ? -8.444  0.871   6.900   1.00 0.00 ? 29 LYS A HG2  2  
ATOM 1298  H HG3  . LYS A 1 29 ? -9.367  2.080   7.771   1.00 0.00 ? 29 LYS A HG3  2  
ATOM 1299  H HD2  . LYS A 1 29 ? -10.904 1.417   5.448   1.00 0.00 ? 29 LYS A HD2  2  
ATOM 1300  H HD3  . LYS A 1 29 ? -10.336 -0.102  6.111   1.00 0.00 ? 29 LYS A HD3  2  
ATOM 1301  H HE2  . LYS A 1 29 ? -11.111 1.227   8.414   1.00 0.00 ? 29 LYS A HE2  2  
ATOM 1302  H HE3  . LYS A 1 29 ? -12.264 1.859   7.256   1.00 0.00 ? 29 LYS A HE3  2  
ATOM 1303  H HZ1  . LYS A 1 29 ? -12.459 -0.621  6.615   1.00 0.00 ? 29 LYS A HZ1  2  
ATOM 1304  H HZ2  . LYS A 1 29 ? -11.874 -0.887  8.116   1.00 0.00 ? 29 LYS A HZ2  2  
ATOM 1305  H HZ3  . LYS A 1 29 ? -13.263 -0.052  7.917   1.00 0.00 ? 29 LYS A HZ3  2  
ATOM 1306  N N    . GLU A 1 30 ? -8.846  2.128   2.658   1.00 0.00 ? 30 GLU A N    2  
ATOM 1307  C CA   . GLU A 1 30 ? -9.454  1.546   1.473   1.00 0.00 ? 30 GLU A CA   2  
ATOM 1308  C C    . GLU A 1 30 ? -8.381  0.925   0.577   1.00 0.00 ? 30 GLU A C    2  
ATOM 1309  O O    . GLU A 1 30 ? -8.598  -0.130  -0.018  1.00 0.00 ? 30 GLU A O    2  
ATOM 1310  C CB   . GLU A 1 30 ? -10.272 2.589   0.708   1.00 0.00 ? 30 GLU A CB   2  
ATOM 1311  C CG   . GLU A 1 30 ? -10.862 1.992   -0.571  1.00 0.00 ? 30 GLU A CG   2  
ATOM 1312  C CD   . GLU A 1 30 ? -12.353 2.313   -0.689  1.00 0.00 ? 30 GLU A CD   2  
ATOM 1313  O OE1  . GLU A 1 30 ? -12.667 3.517   -0.811  1.00 0.00 ? 30 GLU A OE1  2  
ATOM 1314  O OE2  . GLU A 1 30 ? -13.146 1.347   -0.655  1.00 0.00 ? 30 GLU A OE2  2  
ATOM 1315  H H    . GLU A 1 30 ? -8.825  3.128   2.674   1.00 0.00 ? 30 GLU A H    2  
ATOM 1316  H HA   . GLU A 1 30 ? -10.123 0.769   1.843   1.00 0.00 ? 30 GLU A HA   2  
ATOM 1317  H HB2  . GLU A 1 30 ? -11.075 2.963   1.343   1.00 0.00 ? 30 GLU A HB2  2  
ATOM 1318  H HB3  . GLU A 1 30 ? -9.640  3.441   0.459   1.00 0.00 ? 30 GLU A HB3  2  
ATOM 1319  H HG2  . GLU A 1 30 ? -10.332 2.386   -1.438  1.00 0.00 ? 30 GLU A HG2  2  
ATOM 1320  H HG3  . GLU A 1 30 ? -10.718 0.911   -0.573  1.00 0.00 ? 30 GLU A HG3  2  
ATOM 1321  N N    . CYS A 1 31 ? -7.247  1.606   0.507   1.00 0.00 ? 31 CYS A N    2  
ATOM 1322  C CA   . CYS A 1 31 ? -6.140  1.135   -0.308  1.00 0.00 ? 31 CYS A CA   2  
ATOM 1323  C C    . CYS A 1 31 ? -5.486  -0.049  0.409   1.00 0.00 ? 31 CYS A C    2  
ATOM 1324  O O    . CYS A 1 31 ? -4.905  -0.923  -0.232  1.00 0.00 ? 31 CYS A O    2  
ATOM 1325  C CB   . CYS A 1 31 ? -5.135  2.251   -0.598  1.00 0.00 ? 31 CYS A CB   2  
ATOM 1326  S SG   . CYS A 1 31 ? -3.437  1.679   -0.969  1.00 0.00 ? 31 CYS A SG   2  
ATOM 1327  H H    . CYS A 1 31 ? -7.078  2.464   0.993   1.00 0.00 ? 31 CYS A H    2  
ATOM 1328  H HA   . CYS A 1 31 ? -6.564  0.823   -1.262  1.00 0.00 ? 31 CYS A HA   2  
ATOM 1329  H HB2  . CYS A 1 31 ? -5.498  2.838   -1.442  1.00 0.00 ? 31 CYS A HB2  2  
ATOM 1330  H HB3  . CYS A 1 31 ? -5.098  2.920   0.262   1.00 0.00 ? 31 CYS A HB3  2  
ATOM 1331  N N    . ASN A 1 32 ? -5.604  -0.039  1.728   1.00 0.00 ? 32 ASN A N    2  
ATOM 1332  C CA   . ASN A 1 32 ? -5.032  -1.101  2.539   1.00 0.00 ? 32 ASN A CA   2  
ATOM 1333  C C    . ASN A 1 32 ? -6.094  -2.174  2.788   1.00 0.00 ? 32 ASN A C    2  
ATOM 1334  O O    . ASN A 1 32 ? -5.823  -3.179  3.443   1.00 0.00 ? 32 ASN A O    2  
ATOM 1335  C CB   . ASN A 1 32 ? -4.569  -0.569  3.897   1.00 0.00 ? 32 ASN A CB   2  
ATOM 1336  C CG   . ASN A 1 32 ? -3.873  0.785   3.747   1.00 0.00 ? 32 ASN A CG   2  
ATOM 1337  O OD1  . ASN A 1 32 ? -4.443  1.756   3.276   1.00 0.00 ? 32 ASN A OD1  2  
ATOM 1338  N ND2  . ASN A 1 32 ? -2.613  0.796   4.172   1.00 0.00 ? 32 ASN A ND2  2  
ATOM 1339  H H    . ASN A 1 32 ? -6.078  0.676   2.242   1.00 0.00 ? 32 ASN A H    2  
ATOM 1340  H HA   . ASN A 1 32 ? -4.186  -1.477  1.963   1.00 0.00 ? 32 ASN A HA   2  
ATOM 1341  H HB2  . ASN A 1 32 ? -5.425  -0.470  4.564   1.00 0.00 ? 32 ASN A HB2  2  
ATOM 1342  H HB3  . ASN A 1 32 ? -3.887  -1.283  4.358   1.00 0.00 ? 32 ASN A HB3  2  
ATOM 1343  H HD21 . ASN A 1 32 ? -2.205  -0.036  4.548   1.00 0.00 ? 32 ASN A HD21 2  
ATOM 1344  H HD22 . ASN A 1 32 ? -2.073  1.636   4.115   1.00 0.00 ? 32 ASN A HD22 2  
ATOM 1345  N N    . ASN A 1 33 ? -7.279  -1.924  2.253   1.00 0.00 ? 33 ASN A N    2  
ATOM 1346  C CA   . ASN A 1 33 ? -8.383  -2.856  2.410   1.00 0.00 ? 33 ASN A CA   2  
ATOM 1347  C C    . ASN A 1 33 ? -8.543  -3.670  1.124   1.00 0.00 ? 33 ASN A C    2  
ATOM 1348  O O    . ASN A 1 33 ? -8.774  -4.877  1.174   1.00 0.00 ? 33 ASN A O    2  
ATOM 1349  C CB   . ASN A 1 33 ? -9.697  -2.116  2.668   1.00 0.00 ? 33 ASN A CB   2  
ATOM 1350  C CG   . ASN A 1 33 ? -10.883 -3.083  2.652   1.00 0.00 ? 33 ASN A CG   2  
ATOM 1351  O OD1  . ASN A 1 33 ? -10.860 -4.144  3.254   1.00 0.00 ? 33 ASN A OD1  2  
ATOM 1352  N ND2  . ASN A 1 33 ? -11.917 -2.658  1.931   1.00 0.00 ? 33 ASN A ND2  2  
ATOM 1353  H H    . ASN A 1 33 ? -7.491  -1.104  1.722   1.00 0.00 ? 33 ASN A H    2  
ATOM 1354  H HA   . ASN A 1 33 ? -8.115  -3.476  3.265   1.00 0.00 ? 33 ASN A HA   2  
ATOM 1355  H HB2  . ASN A 1 33 ? -9.649  -1.609  3.632   1.00 0.00 ? 33 ASN A HB2  2  
ATOM 1356  H HB3  . ASN A 1 33 ? -9.840  -1.346  1.910   1.00 0.00 ? 33 ASN A HB3  2  
ATOM 1357  H HD21 . ASN A 1 33 ? -11.871 -1.776  1.462   1.00 0.00 ? 33 ASN A HD21 2  
ATOM 1358  H HD22 . ASN A 1 33 ? -12.741 -3.220  1.859   1.00 0.00 ? 33 ASN A HD22 2  
ATOM 1359  N N    . ARG A 1 34 ? -8.415  -2.976  0.002   1.00 0.00 ? 34 ARG A N    2  
ATOM 1360  C CA   . ARG A 1 34 ? -8.543  -3.619  -1.294  1.00 0.00 ? 34 ARG A CA   2  
ATOM 1361  C C    . ARG A 1 34 ? -7.551  -4.778  -1.412  1.00 0.00 ? 34 ARG A C    2  
ATOM 1362  O O    . ARG A 1 34 ? -7.808  -5.750  -2.121  1.00 0.00 ? 34 ARG A O    2  
ATOM 1363  C CB   . ARG A 1 34 ? -8.292  -2.625  -2.430  1.00 0.00 ? 34 ARG A CB   2  
ATOM 1364  C CG   . ARG A 1 34 ? -9.221  -2.899  -3.614  1.00 0.00 ? 34 ARG A CG   2  
ATOM 1365  C CD   . ARG A 1 34 ? -8.948  -4.279  -4.216  1.00 0.00 ? 34 ARG A CD   2  
ATOM 1366  N NE   . ARG A 1 34 ? -9.458  -4.335  -5.605  1.00 0.00 ? 34 ARG A NE   2  
ATOM 1367  C CZ   . ARG A 1 34 ? -9.032  -5.209  -6.527  1.00 0.00 ? 34 ARG A CZ   2  
ATOM 1368  N NH1  . ARG A 1 34 ? -8.086  -6.106  -6.214  1.00 0.00 ? 34 ARG A NH1  2  
ATOM 1369  N NH2  . ARG A 1 34 ? -9.551  -5.187  -7.762  1.00 0.00 ? 34 ARG A NH2  2  
ATOM 1370  H H    . ARG A 1 34 ? -8.227  -1.995  -0.029  1.00 0.00 ? 34 ARG A H    2  
ATOM 1371  H HA   . ARG A 1 34 ? -9.572  -3.979  -1.327  1.00 0.00 ? 34 ARG A HA   2  
ATOM 1372  H HB2  . ARG A 1 34 ? -8.448  -1.608  -2.068  1.00 0.00 ? 34 ARG A HB2  2  
ATOM 1373  H HB3  . ARG A 1 34 ? -7.254  -2.692  -2.754  1.00 0.00 ? 34 ARG A HB3  2  
ATOM 1374  H HG2  . ARG A 1 34 ? -10.259 -2.840  -3.288  1.00 0.00 ? 34 ARG A HG2  2  
ATOM 1375  H HG3  . ARG A 1 34 ? -9.081  -2.132  -4.376  1.00 0.00 ? 34 ARG A HG3  2  
ATOM 1376  H HD2  . ARG A 1 34 ? -7.878  -4.485  -4.205  1.00 0.00 ? 34 ARG A HD2  2  
ATOM 1377  H HD3  . ARG A 1 34 ? -9.428  -5.050  -3.613  1.00 0.00 ? 34 ARG A HD3  2  
ATOM 1378  H HE   . ARG A 1 34 ? -10.164 -3.680  -5.872  1.00 0.00 ? 34 ARG A HE   2  
ATOM 1379  H HH11 . ARG A 1 34 ? -7.699  -6.123  -5.292  1.00 0.00 ? 34 ARG A HH11 2  
ATOM 1380  H HH12 . ARG A 1 34 ? -7.768  -6.758  -6.902  1.00 0.00 ? 34 ARG A HH12 2  
ATOM 1381  H HH21 . ARG A 1 34 ? -10.257 -4.518  -7.995  1.00 0.00 ? 34 ARG A HH21 2  
ATOM 1382  H HH22 . ARG A 1 34 ? -9.233  -5.839  -8.450  1.00 0.00 ? 34 ARG A HH22 2  
ATOM 1383  N N    . GLY A 1 35 ? -6.439  -4.638  -0.706  1.00 0.00 ? 35 GLY A N    2  
ATOM 1384  C CA   . GLY A 1 35 ? -5.408  -5.661  -0.722  1.00 0.00 ? 35 GLY A CA   2  
ATOM 1385  C C    . GLY A 1 35 ? -4.067  -5.081  -1.179  1.00 0.00 ? 35 GLY A C    2  
ATOM 1386  O O    . GLY A 1 35 ? -3.640  -5.313  -2.309  1.00 0.00 ? 35 GLY A O    2  
ATOM 1387  H H    . GLY A 1 35 ? -6.238  -3.844  -0.131  1.00 0.00 ? 35 GLY A H    2  
ATOM 1388  H HA2  . GLY A 1 35 ? -5.301  -6.091  0.274   1.00 0.00 ? 35 GLY A HA2  2  
ATOM 1389  H HA3  . GLY A 1 35 ? -5.704  -6.471  -1.389  1.00 0.00 ? 35 GLY A HA3  2  
ATOM 1390  N N    . CYS A 1 36 ? -3.442  -4.338  -0.278  1.00 0.00 ? 36 CYS A N    2  
ATOM 1391  C CA   . CYS A 1 36 ? -2.160  -3.723  -0.575  1.00 0.00 ? 36 CYS A CA   2  
ATOM 1392  C C    . CYS A 1 36 ? -1.827  -2.739  0.549   1.00 0.00 ? 36 CYS A C    2  
ATOM 1393  O O    . CYS A 1 36 ? -2.366  -2.843  1.649   1.00 0.00 ? 36 CYS A O    2  
ATOM 1394  C CB   . CYS A 1 36 ? -2.161  -3.045  -1.946  1.00 0.00 ? 36 CYS A CB   2  
ATOM 1395  S SG   . CYS A 1 36 ? -0.861  -3.630  -3.093  1.00 0.00 ? 36 CYS A SG   2  
ATOM 1396  H H    . CYS A 1 36 ? -3.797  -4.154  0.638   1.00 0.00 ? 36 CYS A H    2  
ATOM 1397  H HA   . CYS A 1 36 ? -1.427  -4.530  -0.612  1.00 0.00 ? 36 CYS A HA   2  
ATOM 1398  H HB2  . CYS A 1 36 ? -3.134  -3.200  -2.412  1.00 0.00 ? 36 CYS A HB2  2  
ATOM 1399  H HB3  . CYS A 1 36 ? -2.044  -1.970  -1.804  1.00 0.00 ? 36 CYS A HB3  2  
ATOM 1400  N N    . CYS A 1 37 ? -0.941  -1.807  0.232   1.00 0.00 ? 37 CYS A N    2  
ATOM 1401  C CA   . CYS A 1 37 ? -0.530  -0.805  1.201   1.00 0.00 ? 37 CYS A CA   2  
ATOM 1402  C C    . CYS A 1 37 ? -0.876  0.576   0.641   1.00 0.00 ? 37 CYS A C    2  
ATOM 1403  O O    . CYS A 1 37 ? -0.933  0.760   -0.574  1.00 0.00 ? 37 CYS A O    2  
ATOM 1404  C CB   . CYS A 1 37 ? 0.956   -0.926  1.545   1.00 0.00 ? 37 CYS A CB   2  
ATOM 1405  S SG   . CYS A 1 37 ? 1.332   -2.043  2.945   1.00 0.00 ? 37 CYS A SG   2  
ATOM 1406  H H    . CYS A 1 37 ? -0.507  -1.729  -0.665  1.00 0.00 ? 37 CYS A H    2  
ATOM 1407  H HA   . CYS A 1 37 ? -1.091  -1.004  2.114   1.00 0.00 ? 37 CYS A HA   2  
ATOM 1408  H HB2  . CYS A 1 37 ? 1.491   -1.279  0.663   1.00 0.00 ? 37 CYS A HB2  2  
ATOM 1409  H HB3  . CYS A 1 37 ? 1.343   0.066   1.776   1.00 0.00 ? 37 CYS A HB3  2  
ATOM 1410  N N    . PHE A 1 38 ? -1.097  1.511   1.553   1.00 0.00 ? 38 PHE A N    2  
ATOM 1411  C CA   . PHE A 1 38 ? -1.435  2.870   1.165   1.00 0.00 ? 38 PHE A CA   2  
ATOM 1412  C C    . PHE A 1 38 ? -0.372  3.859   1.647   1.00 0.00 ? 38 PHE A C    2  
ATOM 1413  O O    . PHE A 1 38 ? 0.544   3.484   2.377   1.00 0.00 ? 38 PHE A O    2  
ATOM 1414  C CB   . PHE A 1 38 ? -2.769  3.207   1.833   1.00 0.00 ? 38 PHE A CB   2  
ATOM 1415  C CG   . PHE A 1 38 ? -3.199  4.666   1.665   1.00 0.00 ? 38 PHE A CG   2  
ATOM 1416  C CD1  . PHE A 1 38 ? -3.786  5.073   0.508   1.00 0.00 ? 38 PHE A CD1  2  
ATOM 1417  C CD2  . PHE A 1 38 ? -2.993  5.556   2.673   1.00 0.00 ? 38 PHE A CD2  2  
ATOM 1418  C CE1  . PHE A 1 38 ? -4.184  6.427   0.352   1.00 0.00 ? 38 PHE A CE1  2  
ATOM 1419  C CE2  . PHE A 1 38 ? -3.392  6.910   2.517   1.00 0.00 ? 38 PHE A CE2  2  
ATOM 1420  C CZ   . PHE A 1 38 ? -3.979  7.317   1.359   1.00 0.00 ? 38 PHE A CZ   2  
ATOM 1421  H H    . PHE A 1 38 ? -1.048  1.353   2.539   1.00 0.00 ? 38 PHE A H    2  
ATOM 1422  H HA   . PHE A 1 38 ? -1.483  2.893   0.076   1.00 0.00 ? 38 PHE A HA   2  
ATOM 1423  H HB2  . PHE A 1 38 ? -3.545  2.561   1.421   1.00 0.00 ? 38 PHE A HB2  2  
ATOM 1424  H HB3  . PHE A 1 38 ? -2.698  2.980   2.897   1.00 0.00 ? 38 PHE A HB3  2  
ATOM 1425  H HD1  . PHE A 1 38 ? -3.950  4.360   -0.300  1.00 0.00 ? 38 PHE A HD1  2  
ATOM 1426  H HD2  . PHE A 1 38 ? -2.523  5.229   3.601   1.00 0.00 ? 38 PHE A HD2  2  
ATOM 1427  H HE1  . PHE A 1 38 ? -4.654  6.753   -0.576  1.00 0.00 ? 38 PHE A HE1  2  
ATOM 1428  H HE2  . PHE A 1 38 ? -3.227  7.623   3.325   1.00 0.00 ? 38 PHE A HE2  2  
ATOM 1429  H HZ   . PHE A 1 38 ? -4.284  8.356   1.240   1.00 0.00 ? 38 PHE A HZ   2  
ATOM 1430  N N    . ASP A 1 39 ? -0.530  5.103   1.219   1.00 0.00 ? 39 ASP A N    2  
ATOM 1431  C CA   . ASP A 1 39 ? 0.405   6.149   1.598   1.00 0.00 ? 39 ASP A CA   2  
ATOM 1432  C C    . ASP A 1 39 ? -0.013  7.464   0.939   1.00 0.00 ? 39 ASP A C    2  
ATOM 1433  O O    . ASP A 1 39 ? -0.467  7.473   -0.205  1.00 0.00 ? 39 ASP A O    2  
ATOM 1434  C CB   . ASP A 1 39 ? 1.823   5.815   1.131   1.00 0.00 ? 39 ASP A CB   2  
ATOM 1435  C CG   . ASP A 1 39 ? 2.881   6.868   1.471   1.00 0.00 ? 39 ASP A CG   2  
ATOM 1436  O OD1  . ASP A 1 39 ? 3.460   6.754   2.573   1.00 0.00 ? 39 ASP A OD1  2  
ATOM 1437  O OD2  . ASP A 1 39 ? 3.085   7.762   0.623   1.00 0.00 ? 39 ASP A OD2  2  
ATOM 1438  H H    . ASP A 1 39 ? -1.277  5.400   0.625   1.00 0.00 ? 39 ASP A H    2  
ATOM 1439  H HA   . ASP A 1 39 ? 0.358   6.194   2.686   1.00 0.00 ? 39 ASP A HA   2  
ATOM 1440  H HB2  . ASP A 1 39 ? 2.122   4.865   1.574   1.00 0.00 ? 39 ASP A HB2  2  
ATOM 1441  H HB3  . ASP A 1 39 ? 1.810   5.673   0.050   1.00 0.00 ? 39 ASP A HB3  2  
ATOM 1442  N N    . SER A 1 40 ? 0.155   8.544   1.688   1.00 0.00 ? 40 SER A N    2  
ATOM 1443  C CA   . SER A 1 40 ? -0.200  9.863   1.190   1.00 0.00 ? 40 SER A CA   2  
ATOM 1444  C C    . SER A 1 40 ? 0.908   10.864  1.526   1.00 0.00 ? 40 SER A C    2  
ATOM 1445  O O    . SER A 1 40 ? 0.686   12.073  1.494   1.00 0.00 ? 40 SER A O    2  
ATOM 1446  C CB   . SER A 1 40 ? -1.534  10.331  1.774   1.00 0.00 ? 40 SER A CB   2  
ATOM 1447  O OG   . SER A 1 40 ? -1.462  10.522  3.184   1.00 0.00 ? 40 SER A OG   2  
ATOM 1448  H H    . SER A 1 40 ? 0.524   8.529   2.617   1.00 0.00 ? 40 SER A H    2  
ATOM 1449  H HA   . SER A 1 40 ? -0.297  9.747   0.110   1.00 0.00 ? 40 SER A HA   2  
ATOM 1450  H HB2  . SER A 1 40 ? -1.830  11.265  1.296   1.00 0.00 ? 40 SER A HB2  2  
ATOM 1451  H HB3  . SER A 1 40 ? -2.307  9.598   1.546   1.00 0.00 ? 40 SER A HB3  2  
ATOM 1452  H HG   . SER A 1 40 ? -2.382  10.526  3.576   1.00 0.00 ? 40 SER A HG   2  
ATOM 1453  N N    . ARG A 1 41 ? 2.076   10.322  1.839   1.00 0.00 ? 41 ARG A N    2  
ATOM 1454  C CA   . ARG A 1 41 ? 3.218   11.153  2.180   1.00 0.00 ? 41 ARG A CA   2  
ATOM 1455  C C    . ARG A 1 41 ? 3.574   12.072  1.009   1.00 0.00 ? 41 ARG A C    2  
ATOM 1456  O O    . ARG A 1 41 ? 3.859   13.252  1.207   1.00 0.00 ? 41 ARG A O    2  
ATOM 1457  C CB   . ARG A 1 41 ? 4.435   10.297  2.536   1.00 0.00 ? 41 ARG A CB   2  
ATOM 1458  C CG   . ARG A 1 41 ? 5.241   10.935  3.669   1.00 0.00 ? 41 ARG A CG   2  
ATOM 1459  C CD   . ARG A 1 41 ? 6.335   9.987   4.164   1.00 0.00 ? 41 ARG A CD   2  
ATOM 1460  N NE   . ARG A 1 41 ? 6.932   10.511  5.413   1.00 0.00 ? 41 ARG A NE   2  
ATOM 1461  C CZ   . ARG A 1 41 ? 7.862   11.475  5.455   1.00 0.00 ? 41 ARG A CZ   2  
ATOM 1462  N NH1  . ARG A 1 41 ? 8.307   12.025  4.317   1.00 0.00 ? 41 ARG A NH1  2  
ATOM 1463  N NH2  . ARG A 1 41 ? 8.346   11.888  6.634   1.00 0.00 ? 41 ARG A NH2  2  
ATOM 1464  H H    . ARG A 1 41 ? 2.248   9.338   1.862   1.00 0.00 ? 41 ARG A H    2  
ATOM 1465  H HA   . ARG A 1 41 ? 2.894   11.730  3.046   1.00 0.00 ? 41 ARG A HA   2  
ATOM 1466  H HB2  . ARG A 1 41 ? 4.109   9.301   2.833   1.00 0.00 ? 41 ARG A HB2  2  
ATOM 1467  H HB3  . ARG A 1 41 ? 5.069   10.176  1.657   1.00 0.00 ? 41 ARG A HB3  2  
ATOM 1468  H HG2  . ARG A 1 41 ? 5.691   11.865  3.321   1.00 0.00 ? 41 ARG A HG2  2  
ATOM 1469  H HG3  . ARG A 1 41 ? 4.576   11.191  4.494   1.00 0.00 ? 41 ARG A HG3  2  
ATOM 1470  H HD2  . ARG A 1 41 ? 5.917   8.996   4.340   1.00 0.00 ? 41 ARG A HD2  2  
ATOM 1471  H HD3  . ARG A 1 41 ? 7.106   9.877   3.402   1.00 0.00 ? 41 ARG A HD3  2  
ATOM 1472  H HE   . ARG A 1 41 ? 6.621   10.121  6.281   1.00 0.00 ? 41 ARG A HE   2  
ATOM 1473  H HH11 . ARG A 1 41 ? 7.946   11.717  3.437   1.00 0.00 ? 41 ARG A HH11 2  
ATOM 1474  H HH12 . ARG A 1 41 ? 9.002   12.744  4.348   1.00 0.00 ? 41 ARG A HH12 2  
ATOM 1475  H HH21 . ARG A 1 41 ? 8.014   11.477  7.483   1.00 0.00 ? 41 ARG A HH21 2  
ATOM 1476  H HH22 . ARG A 1 41 ? 9.041   12.607  6.665   1.00 0.00 ? 41 ARG A HH22 2  
ATOM 1477  N N    . ILE A 1 42 ? 3.546   11.496  -0.184  1.00 0.00 ? 42 ILE A N    2  
ATOM 1478  C CA   . ILE A 1 42 ? 3.863   12.249  -1.386  1.00 0.00 ? 42 ILE A CA   2  
ATOM 1479  C C    . ILE A 1 42 ? 3.095   11.657  -2.569  1.00 0.00 ? 42 ILE A C    2  
ATOM 1480  O O    . ILE A 1 42 ? 3.066   10.441  -2.750  1.00 0.00 ? 42 ILE A O    2  
ATOM 1481  C CB   . ILE A 1 42 ? 5.376   12.304  -1.600  1.00 0.00 ? 42 ILE A CB   2  
ATOM 1482  C CG1  . ILE A 1 42 ? 6.071   11.128  -0.911  1.00 0.00 ? 42 ILE A CG1  2  
ATOM 1483  C CG2  . ILE A 1 42 ? 5.946   13.650  -1.149  1.00 0.00 ? 42 ILE A CG2  2  
ATOM 1484  C CD1  . ILE A 1 42 ? 5.571   9.793   -1.467  1.00 0.00 ? 42 ILE A CD1  2  
ATOM 1485  H H    . ILE A 1 42 ? 3.313   10.536  -0.335  1.00 0.00 ? 42 ILE A H    2  
ATOM 1486  H HA   . ILE A 1 42 ? 3.522   13.272  -1.230  1.00 0.00 ? 42 ILE A HA   2  
ATOM 1487  H HB   . ILE A 1 42 ? 5.574   12.213  -2.668  1.00 0.00 ? 42 ILE A HB   2  
ATOM 1488  H HG12 . ILE A 1 42 ? 7.149   11.204  -1.053  1.00 0.00 ? 42 ILE A HG12 2  
ATOM 1489  H HG13 . ILE A 1 42 ? 5.887   11.170  0.163   1.00 0.00 ? 42 ILE A HG13 2  
ATOM 1490  H HG21 . ILE A 1 42 ? 5.729   13.800  -0.091  1.00 0.00 ? 42 ILE A HG21 2  
ATOM 1491  H HG22 . ILE A 1 42 ? 7.025   13.659  -1.304  1.00 0.00 ? 42 ILE A HG22 2  
ATOM 1492  H HG23 . ILE A 1 42 ? 5.489   14.451  -1.730  1.00 0.00 ? 42 ILE A HG23 2  
ATOM 1493  H HD11 . ILE A 1 42 ? 5.165   9.945   -2.467  1.00 0.00 ? 42 ILE A HD11 2  
ATOM 1494  H HD12 . ILE A 1 42 ? 6.400   9.086   -1.515  1.00 0.00 ? 42 ILE A HD12 2  
ATOM 1495  H HD13 . ILE A 1 42 ? 4.793   9.397   -0.815  1.00 0.00 ? 42 ILE A HD13 2  
ATOM 1496  N N    . PRO A 1 43 ? 2.475   12.569  -3.366  1.00 0.00 ? 43 PRO A N    2  
ATOM 1497  C CA   . PRO A 1 43 ? 1.709   12.149  -4.527  1.00 0.00 ? 43 PRO A CA   2  
ATOM 1498  C C    . PRO A 1 43 ? 2.634   11.728  -5.671  1.00 0.00 ? 43 PRO A C    2  
ATOM 1499  O O    . PRO A 1 43 ? 2.282   10.863  -6.471  1.00 0.00 ? 43 PRO A O    2  
ATOM 1500  C CB   . PRO A 1 43 ? 0.839   13.346  -4.877  1.00 0.00 ? 43 PRO A CB   2  
ATOM 1501  C CG   . PRO A 1 43 ? 1.481   14.542  -4.194  1.00 0.00 ? 43 PRO A CG   2  
ATOM 1502  C CD   . PRO A 1 43 ? 2.487   14.017  -3.182  1.00 0.00 ? 43 PRO A CD   2  
ATOM 1503  H HA   . PRO A 1 43 ? 1.160   11.343  -4.308  1.00 0.00 ? 43 PRO A HA   2  
ATOM 1504  H HB2  . PRO A 1 43 ? 0.791   13.492  -5.956  1.00 0.00 ? 43 PRO A HB2  2  
ATOM 1505  H HB3  . PRO A 1 43 ? -0.184  13.200  -4.530  1.00 0.00 ? 43 PRO A HB3  2  
ATOM 1506  H HG2  . PRO A 1 43 ? 1.974   15.181  -4.926  1.00 0.00 ? 43 PRO A HG2  2  
ATOM 1507  H HG3  . PRO A 1 43 ? 0.724   15.150  -3.698  1.00 0.00 ? 43 PRO A HG3  2  
ATOM 1508  H HD2  . PRO A 1 43 ? 3.480   14.430  -3.360  1.00 0.00 ? 43 PRO A HD2  2  
ATOM 1509  H HD3  . PRO A 1 43 ? 2.205   14.290  -2.165  1.00 0.00 ? 43 PRO A HD3  2  
ATOM 1510  N N    . GLY A 1 44 ? 3.798   12.358  -5.711  1.00 0.00 ? 44 GLY A N    2  
ATOM 1511  C CA   . GLY A 1 44 ? 4.776   12.059  -6.743  1.00 0.00 ? 44 GLY A CA   2  
ATOM 1512  C C    . GLY A 1 44 ? 4.959   10.549  -6.905  1.00 0.00 ? 44 GLY A C    2  
ATOM 1513  O O    . GLY A 1 44 ? 5.285   10.072  -7.990  1.00 0.00 ? 44 GLY A O    2  
ATOM 1514  H H    . GLY A 1 44 ? 4.076   13.061  -5.056  1.00 0.00 ? 44 GLY A H    2  
ATOM 1515  H HA2  . GLY A 1 44 ? 4.455   12.494  -7.690  1.00 0.00 ? 44 GLY A HA2  2  
ATOM 1516  H HA3  . GLY A 1 44 ? 5.731   12.520  -6.489  1.00 0.00 ? 44 GLY A HA3  2  
ATOM 1517  N N    . VAL A 1 45 ? 4.740   9.838   -5.808  1.00 0.00 ? 45 VAL A N    2  
ATOM 1518  C CA   . VAL A 1 45 ? 4.877   8.392   -5.814  1.00 0.00 ? 45 VAL A CA   2  
ATOM 1519  C C    . VAL A 1 45 ? 3.487   7.753   -5.791  1.00 0.00 ? 45 VAL A C    2  
ATOM 1520  O O    . VAL A 1 45 ? 2.485   8.443   -5.611  1.00 0.00 ? 45 VAL A O    2  
ATOM 1521  C CB   . VAL A 1 45 ? 5.759   7.945   -4.647  1.00 0.00 ? 45 VAL A CB   2  
ATOM 1522  C CG1  . VAL A 1 45 ? 6.748   9.045   -4.255  1.00 0.00 ? 45 VAL A CG1  2  
ATOM 1523  C CG2  . VAL A 1 45 ? 4.910   7.518   -3.448  1.00 0.00 ? 45 VAL A CG2  2  
ATOM 1524  H H    . VAL A 1 45 ? 4.475   10.234  -4.929  1.00 0.00 ? 45 VAL A H    2  
ATOM 1525  H HA   . VAL A 1 45 ? 5.376   8.112   -6.741  1.00 0.00 ? 45 VAL A HA   2  
ATOM 1526  H HB   . VAL A 1 45 ? 6.335   7.079   -4.975  1.00 0.00 ? 45 VAL A HB   2  
ATOM 1527  H HG11 . VAL A 1 45 ? 6.218   9.992   -4.158  1.00 0.00 ? 45 VAL A HG11 2  
ATOM 1528  H HG12 . VAL A 1 45 ? 7.215   8.791   -3.303  1.00 0.00 ? 45 VAL A HG12 2  
ATOM 1529  H HG13 . VAL A 1 45 ? 7.516   9.134   -5.023  1.00 0.00 ? 45 VAL A HG13 2  
ATOM 1530  H HG21 . VAL A 1 45 ? 4.023   8.149   -3.388  1.00 0.00 ? 45 VAL A HG21 2  
ATOM 1531  H HG22 . VAL A 1 45 ? 4.608   6.478   -3.569  1.00 0.00 ? 45 VAL A HG22 2  
ATOM 1532  H HG23 . VAL A 1 45 ? 5.493   7.623   -2.533  1.00 0.00 ? 45 VAL A HG23 2  
ATOM 1533  N N    . PRO A 1 46 ? 3.470   6.406   -5.980  1.00 0.00 ? 46 PRO A N    2  
ATOM 1534  C CA   . PRO A 1 46 ? 2.220   5.666   -5.983  1.00 0.00 ? 46 PRO A CA   2  
ATOM 1535  C C    . PRO A 1 46 ? 1.673   5.508   -4.563  1.00 0.00 ? 46 PRO A C    2  
ATOM 1536  O O    . PRO A 1 46 ? 1.971   4.525   -3.885  1.00 0.00 ? 46 PRO A O    2  
ATOM 1537  C CB   . PRO A 1 46 ? 2.550   4.338   -6.644  1.00 0.00 ? 46 PRO A CB   2  
ATOM 1538  C CG   . PRO A 1 46 ? 4.062   4.198   -6.566  1.00 0.00 ? 46 PRO A CG   2  
ATOM 1539  C CD   . PRO A 1 46 ? 4.637   5.555   -6.196  1.00 0.00 ? 46 PRO A CD   2  
ATOM 1540  H HA   . PRO A 1 46 ? 1.520   6.169   -6.491  1.00 0.00 ? 46 PRO A HA   2  
ATOM 1541  H HB2  . PRO A 1 46 ? 2.054   3.513   -6.132  1.00 0.00 ? 46 PRO A HB2  2  
ATOM 1542  H HB3  . PRO A 1 46 ? 2.209   4.321   -7.679  1.00 0.00 ? 46 PRO A HB3  2  
ATOM 1543  H HG2  . PRO A 1 46 ? 4.338   3.451   -5.822  1.00 0.00 ? 46 PRO A HG2  2  
ATOM 1544  H HG3  . PRO A 1 46 ? 4.464   3.860   -7.521  1.00 0.00 ? 46 PRO A HG3  2  
ATOM 1545  H HD2  . PRO A 1 46 ? 5.253   5.494   -5.299  1.00 0.00 ? 46 PRO A HD2  2  
ATOM 1546  H HD3  . PRO A 1 46 ? 5.271   5.947   -6.992  1.00 0.00 ? 46 PRO A HD3  2  
ATOM 1547  N N    . TRP A 1 47 ? 0.883   6.490   -4.154  1.00 0.00 ? 47 TRP A N    2  
ATOM 1548  C CA   . TRP A 1 47 ? 0.292   6.472   -2.827  1.00 0.00 ? 47 TRP A CA   2  
ATOM 1549  C C    . TRP A 1 47 ? 0.082   5.011   -2.423  1.00 0.00 ? 47 TRP A C    2  
ATOM 1550  O O    . TRP A 1 47 ? 0.565   4.576   -1.379  1.00 0.00 ? 47 TRP A O    2  
ATOM 1551  C CB   . TRP A 1 47 ? -0.998  7.293   -2.790  1.00 0.00 ? 47 TRP A CB   2  
ATOM 1552  C CG   . TRP A 1 47 ? -0.784  8.773   -2.465  1.00 0.00 ? 47 TRP A CG   2  
ATOM 1553  C CD1  . TRP A 1 47 ? 0.296   9.525   -2.716  1.00 0.00 ? 47 TRP A CD1  2  
ATOM 1554  C CD2  . TRP A 1 47 ? -1.723  9.654   -1.813  1.00 0.00 ? 47 TRP A CD2  2  
ATOM 1555  N NE1  . TRP A 1 47 ? 0.122   10.822  -2.276  1.00 0.00 ? 47 TRP A NE1  2  
ATOM 1556  C CE2  . TRP A 1 47 ? -1.144  10.903  -1.709  1.00 0.00 ? 47 TRP A CE2  2  
ATOM 1557  C CE3  . TRP A 1 47 ? -3.019  9.405   -1.327  1.00 0.00 ? 47 TRP A CE3  2  
ATOM 1558  C CZ2  . TRP A 1 47 ? -1.787  12.000  -1.124  1.00 0.00 ? 47 TRP A CZ2  2  
ATOM 1559  C CZ3  . TRP A 1 47 ? -3.648  10.512  -0.744  1.00 0.00 ? 47 TRP A CZ3  2  
ATOM 1560  C CH2  . TRP A 1 47 ? -3.079  11.775  -0.632  1.00 0.00 ? 47 TRP A CH2  2  
ATOM 1561  H H    . TRP A 1 47 ? 0.645   7.285   -4.712  1.00 0.00 ? 47 TRP A H    2  
ATOM 1562  H HA   . TRP A 1 47 ? 0.993   6.950   -2.144  1.00 0.00 ? 47 TRP A HA   2  
ATOM 1563  H HB2  . TRP A 1 47 ? -1.496  7.213   -3.756  1.00 0.00 ? 47 TRP A HB2  2  
ATOM 1564  H HB3  . TRP A 1 47 ? -1.671  6.862   -2.048  1.00 0.00 ? 47 TRP A HB3  2  
ATOM 1565  H HD1  . TRP A 1 47 ? 1.197   9.159   -3.207  1.00 0.00 ? 47 TRP A HD1  2  
ATOM 1566  H HE1  . TRP A 1 47 ? 0.846   11.633  -2.358  1.00 0.00 ? 47 TRP A HE1  2  
ATOM 1567  H HE3  . TRP A 1 47 ? -3.498  8.428   -1.396  1.00 0.00 ? 47 TRP A HE3  2  
ATOM 1568  H HZ2  . TRP A 1 47 ? -1.308  12.976  -1.054  1.00 0.00 ? 47 TRP A HZ2  2  
ATOM 1569  H HZ3  . TRP A 1 47 ? -4.655  10.373  -0.351  1.00 0.00 ? 47 TRP A HZ3  2  
ATOM 1570  H HH2  . TRP A 1 47 ? -3.635  12.587  -0.164  1.00 0.00 ? 47 TRP A HH2  2  
ATOM 1571  N N    . CYS A 1 48 ? -0.640  4.293   -3.271  1.00 0.00 ? 48 CYS A N    2  
ATOM 1572  C CA   . CYS A 1 48 ? -0.920  2.891   -3.015  1.00 0.00 ? 48 CYS A CA   2  
ATOM 1573  C C    . CYS A 1 48 ? 0.163   2.052   -3.697  1.00 0.00 ? 48 CYS A C    2  
ATOM 1574  O O    . CYS A 1 48 ? 0.255   2.031   -4.924  1.00 0.00 ? 48 CYS A O    2  
ATOM 1575  C CB   . CYS A 1 48 ? -2.323  2.499   -3.482  1.00 0.00 ? 48 CYS A CB   2  
ATOM 1576  S SG   . CYS A 1 48 ? -3.034  1.039   -2.638  1.00 0.00 ? 48 CYS A SG   2  
ATOM 1577  H H    . CYS A 1 48 ? -1.030  4.654   -4.118  1.00 0.00 ? 48 CYS A H    2  
ATOM 1578  H HA   . CYS A 1 48 ? -0.889  2.757   -1.934  1.00 0.00 ? 48 CYS A HA   2  
ATOM 1579  H HB2  . CYS A 1 48 ? -2.991  3.348   -3.333  1.00 0.00 ? 48 CYS A HB2  2  
ATOM 1580  H HB3  . CYS A 1 48 ? -2.293  2.303   -4.554  1.00 0.00 ? 48 CYS A HB3  2  
ATOM 1581  N N    . PHE A 1 49 ? 0.955   1.383   -2.873  1.00 0.00 ? 49 PHE A N    2  
ATOM 1582  C CA   . PHE A 1 49 ? 2.028   0.545   -3.382  1.00 0.00 ? 49 PHE A CA   2  
ATOM 1583  C C    . PHE A 1 49 ? 2.063   -0.802  -2.657  1.00 0.00 ? 49 PHE A C    2  
ATOM 1584  O O    . PHE A 1 49 ? 1.449   -0.959  -1.602  1.00 0.00 ? 49 PHE A O    2  
ATOM 1585  C CB   . PHE A 1 49 ? 3.339   1.288   -3.117  1.00 0.00 ? 49 PHE A CB   2  
ATOM 1586  C CG   . PHE A 1 49 ? 3.456   1.859   -1.702  1.00 0.00 ? 49 PHE A CG   2  
ATOM 1587  C CD1  . PHE A 1 49 ? 3.592   1.022   -0.639  1.00 0.00 ? 49 PHE A CD1  2  
ATOM 1588  C CD2  . PHE A 1 49 ? 3.423   3.205   -1.508  1.00 0.00 ? 49 PHE A CD2  2  
ATOM 1589  C CE1  . PHE A 1 49 ? 3.700   1.553   0.673   1.00 0.00 ? 49 PHE A CE1  2  
ATOM 1590  C CE2  . PHE A 1 49 ? 3.531   3.736   -0.195  1.00 0.00 ? 49 PHE A CE2  2  
ATOM 1591  C CZ   . PHE A 1 49 ? 3.667   2.898   0.868   1.00 0.00 ? 49 PHE A CZ   2  
ATOM 1592  H H    . PHE A 1 49 ? 0.873   1.406   -1.877  1.00 0.00 ? 49 PHE A H    2  
ATOM 1593  H HA   . PHE A 1 49 ? 1.835   0.380   -4.442  1.00 0.00 ? 49 PHE A HA   2  
ATOM 1594  H HB2  . PHE A 1 49 ? 4.172   0.607   -3.292  1.00 0.00 ? 49 PHE A HB2  2  
ATOM 1595  H HB3  . PHE A 1 49 ? 3.436   2.102   -3.835  1.00 0.00 ? 49 PHE A HB3  2  
ATOM 1596  H HD1  . PHE A 1 49 ? 3.618   -0.056  -0.795  1.00 0.00 ? 49 PHE A HD1  2  
ATOM 1597  H HD2  . PHE A 1 49 ? 3.314   3.876   -2.360  1.00 0.00 ? 49 PHE A HD2  2  
ATOM 1598  H HE1  . PHE A 1 49 ? 3.809   0.881   1.525   1.00 0.00 ? 49 PHE A HE1  2  
ATOM 1599  H HE2  . PHE A 1 49 ? 3.505   4.814   -0.039  1.00 0.00 ? 49 PHE A HE2  2  
ATOM 1600  H HZ   . PHE A 1 49 ? 3.750   3.306   1.875   1.00 0.00 ? 49 PHE A HZ   2  
ATOM 1601  N N    . LYS A 1 50 ? 2.787   -1.739  -3.251  1.00 0.00 ? 50 LYS A N    2  
ATOM 1602  C CA   . LYS A 1 50 ? 2.910   -3.067  -2.675  1.00 0.00 ? 50 LYS A CA   2  
ATOM 1603  C C    . LYS A 1 50 ? 3.665   -2.975  -1.347  1.00 0.00 ? 50 LYS A C    2  
ATOM 1604  O O    . LYS A 1 50 ? 4.346   -1.985  -1.084  1.00 0.00 ? 50 LYS A O    2  
ATOM 1605  C CB   . LYS A 1 50 ? 3.547   -4.030  -3.679  1.00 0.00 ? 50 LYS A CB   2  
ATOM 1606  C CG   . LYS A 1 50 ? 2.616   -4.279  -4.867  1.00 0.00 ? 50 LYS A CG   2  
ATOM 1607  C CD   . LYS A 1 50 ? 2.691   -5.736  -5.327  1.00 0.00 ? 50 LYS A CD   2  
ATOM 1608  C CE   . LYS A 1 50 ? 2.919   -5.823  -6.837  1.00 0.00 ? 50 LYS A CE   2  
ATOM 1609  N NZ   . LYS A 1 50 ? 1.947   -6.752  -7.455  1.00 0.00 ? 50 LYS A NZ   2  
ATOM 1610  H H    . LYS A 1 50 ? 3.283   -1.603  -4.109  1.00 0.00 ? 50 LYS A H    2  
ATOM 1611  H HA   . LYS A 1 50 ? 1.902   -3.431  -2.475  1.00 0.00 ? 50 LYS A HA   2  
ATOM 1612  H HB2  . LYS A 1 50 ? 4.493   -3.619  -4.033  1.00 0.00 ? 50 LYS A HB2  2  
ATOM 1613  H HB3  . LYS A 1 50 ? 3.776   -4.975  -3.187  1.00 0.00 ? 50 LYS A HB3  2  
ATOM 1614  H HG2  . LYS A 1 50 ? 1.591   -4.035  -4.588  1.00 0.00 ? 50 LYS A HG2  2  
ATOM 1615  H HG3  . LYS A 1 50 ? 2.887   -3.619  -5.691  1.00 0.00 ? 50 LYS A HG3  2  
ATOM 1616  H HD2  . LYS A 1 50 ? 3.501   -6.245  -4.804  1.00 0.00 ? 50 LYS A HD2  2  
ATOM 1617  H HD3  . LYS A 1 50 ? 1.768   -6.253  -5.064  1.00 0.00 ? 50 LYS A HD3  2  
ATOM 1618  H HE2  . LYS A 1 50 ? 2.820   -4.834  -7.284  1.00 0.00 ? 50 LYS A HE2  2  
ATOM 1619  H HE3  . LYS A 1 50 ? 3.935   -6.163  -7.039  1.00 0.00 ? 50 LYS A HE3  2  
ATOM 1620  H HZ1  . LYS A 1 50 ? 1.775   -7.517  -6.834  1.00 0.00 ? 50 LYS A HZ1  2  
ATOM 1621  H HZ2  . LYS A 1 50 ? 1.090   -6.269  -7.633  1.00 0.00 ? 50 LYS A HZ2  2  
ATOM 1622  H HZ3  . LYS A 1 50 ? 2.318   -7.100  -8.316  1.00 0.00 ? 50 LYS A HZ3  2  
ATOM 1623  N N    . PRO A 1 51 ? 3.514   -4.047  -0.524  1.00 0.00 ? 51 PRO A N    2  
ATOM 1624  C CA   . PRO A 1 51 ? 4.173   -4.096  0.769   1.00 0.00 ? 51 PRO A CA   2  
ATOM 1625  C C    . PRO A 1 51 ? 5.668   -4.383  0.613   1.00 0.00 ? 51 PRO A C    2  
ATOM 1626  O O    . PRO A 1 51 ? 6.051   -5.382  0.006   1.00 0.00 ? 51 PRO A O    2  
ATOM 1627  C CB   . PRO A 1 51 ? 3.438   -5.178  1.544   1.00 0.00 ? 51 PRO A CB   2  
ATOM 1628  C CG   . PRO A 1 51 ? 2.706   -6.011  0.505   1.00 0.00 ? 51 PRO A CG   2  
ATOM 1629  C CD   . PRO A 1 51 ? 2.714   -5.237  -0.803  1.00 0.00 ? 51 PRO A CD   2  
ATOM 1630  H HA   . PRO A 1 51 ? 4.111   -3.208  1.224   1.00 0.00 ? 51 PRO A HA   2  
ATOM 1631  H HB2  . PRO A 1 51 ? 4.136   -5.791  2.115   1.00 0.00 ? 51 PRO A HB2  2  
ATOM 1632  H HB3  . PRO A 1 51 ? 2.740   -4.741  2.258   1.00 0.00 ? 51 PRO A HB3  2  
ATOM 1633  H HG2  . PRO A 1 51 ? 3.192   -6.978  0.379   1.00 0.00 ? 51 PRO A HG2  2  
ATOM 1634  H HG3  . PRO A 1 51 ? 1.683   -6.208  0.826   1.00 0.00 ? 51 PRO A HG3  2  
ATOM 1635  H HD2  . PRO A 1 51 ? 3.150   -5.826  -1.610  1.00 0.00 ? 51 PRO A HD2  2  
ATOM 1636  H HD3  . PRO A 1 51 ? 1.704   -4.971  -1.113  1.00 0.00 ? 51 PRO A HD3  2  
ATOM 1637  N N    . LEU A 1 52 ? 6.471   -3.489  1.171   1.00 0.00 ? 52 LEU A N    2  
ATOM 1638  C CA   . LEU A 1 52 ? 7.915   -3.634  1.101   1.00 0.00 ? 52 LEU A CA   2  
ATOM 1639  C C    . LEU A 1 52 ? 8.278   -5.119  1.170   1.00 0.00 ? 52 LEU A C    2  
ATOM 1640  O O    . LEU A 1 52 ? 7.756   -5.851  2.010   1.00 0.00 ? 52 LEU A O    2  
ATOM 1641  C CB   . LEU A 1 52 ? 8.592   -2.784  2.178   1.00 0.00 ? 52 LEU A CB   2  
ATOM 1642  C CG   . LEU A 1 52 ? 10.047  -3.135  2.493   1.00 0.00 ? 52 LEU A CG   2  
ATOM 1643  C CD1  . LEU A 1 52 ? 10.716  -2.023  3.304   1.00 0.00 ? 52 LEU A CD1  2  
ATOM 1644  C CD2  . LEU A 1 52 ? 10.145  -4.492  3.192   1.00 0.00 ? 52 LEU A CD2  2  
ATOM 1645  H H    . LEU A 1 52 ? 6.151   -2.680  1.663   1.00 0.00 ? 52 LEU A H    2  
ATOM 1646  H HA   . LEU A 1 52 ? 8.236   -3.245  0.134   1.00 0.00 ? 52 LEU A HA   2  
ATOM 1647  H HB2  . LEU A 1 52 ? 8.549   -1.740  1.868   1.00 0.00 ? 52 LEU A HB2  2  
ATOM 1648  H HB3  . LEU A 1 52 ? 8.011   -2.868  3.097   1.00 0.00 ? 52 LEU A HB3  2  
ATOM 1649  H HG   . LEU A 1 52 ? 10.590  -3.218  1.552   1.00 0.00 ? 52 LEU A HG   2  
ATOM 1650  H HD11 . LEU A 1 52 ? 10.100  -1.786  4.172   1.00 0.00 ? 52 LEU A HD11 2  
ATOM 1651  H HD12 . LEU A 1 52 ? 11.699  -2.357  3.636   1.00 0.00 ? 52 LEU A HD12 2  
ATOM 1652  H HD13 . LEU A 1 52 ? 10.825  -1.135  2.682   1.00 0.00 ? 52 LEU A HD13 2  
ATOM 1653  H HD21 . LEU A 1 52 ? 9.143   -4.875  3.385   1.00 0.00 ? 52 LEU A HD21 2  
ATOM 1654  H HD22 . LEU A 1 52 ? 10.684  -5.192  2.553   1.00 0.00 ? 52 LEU A HD22 2  
ATOM 1655  H HD23 . LEU A 1 52 ? 10.678  -4.377  4.136   1.00 0.00 ? 52 LEU A HD23 2  
ATOM 1656  N N    . GLN A 1 53 ? 9.172   -5.519  0.278   1.00 0.00 ? 53 GLN A N    2  
ATOM 1657  C CA   . GLN A 1 53 ? 9.611   -6.903  0.228   1.00 0.00 ? 53 GLN A CA   2  
ATOM 1658  C C    . GLN A 1 53 ? 10.286  -7.294  1.544   1.00 0.00 ? 53 GLN A C    2  
ATOM 1659  O O    . GLN A 1 53 ? 11.512  -7.310  1.637   1.00 0.00 ? 53 GLN A O    2  
ATOM 1660  C CB   . GLN A 1 53 ? 10.548  -7.139  -0.959  1.00 0.00 ? 53 GLN A CB   2  
ATOM 1661  C CG   . GLN A 1 53 ? 11.740  -6.181  -0.915  1.00 0.00 ? 53 GLN A CG   2  
ATOM 1662  C CD   . GLN A 1 53 ? 11.618  -5.102  -1.994  1.00 0.00 ? 53 GLN A CD   2  
ATOM 1663  O OE1  . GLN A 1 53 ? 11.793  -5.348  -3.176  1.00 0.00 ? 53 GLN A OE1  2  
ATOM 1664  N NE2  . GLN A 1 53 ? 11.308  -3.898  -1.522  1.00 0.00 ? 53 GLN A NE2  2  
ATOM 1665  H H    . GLN A 1 53 ? 9.592   -4.917  -0.401  1.00 0.00 ? 53 GLN A H    2  
ATOM 1666  H HA   . GLN A 1 53 ? 8.704   -7.490  0.088   1.00 0.00 ? 53 GLN A HA   2  
ATOM 1667  H HB2  . GLN A 1 53 ? 10.904  -8.169  -0.948  1.00 0.00 ? 53 GLN A HB2  2  
ATOM 1668  H HB3  . GLN A 1 53 ? 10.001  -7.001  -1.892  1.00 0.00 ? 53 GLN A HB3  2  
ATOM 1669  H HG2  . GLN A 1 53 ? 11.799  -5.713  0.068   1.00 0.00 ? 53 GLN A HG2  2  
ATOM 1670  H HG3  . GLN A 1 53 ? 12.665  -6.739  -1.058  1.00 0.00 ? 53 GLN A HG3  2  
ATOM 1671  H HE21 . GLN A 1 53 ? 11.178  -3.764  -0.539  1.00 0.00 ? 53 GLN A HE21 2  
ATOM 1672  H HE22 . GLN A 1 53 ? 11.206  -3.126  -2.149  1.00 0.00 ? 53 GLN A HE22 2  
ATOM 1673  N N    . GLU A 1 54 ? 9.455   -7.600  2.530   1.00 0.00 ? 54 GLU A N    2  
ATOM 1674  C CA   . GLU A 1 54 ? 9.955   -7.989  3.837   1.00 0.00 ? 54 GLU A CA   2  
ATOM 1675  C C    . GLU A 1 54 ? 11.051  -9.048  3.692   1.00 0.00 ? 54 GLU A C    2  
ATOM 1676  O O    . GLU A 1 54 ? 10.798  -10.143 3.194   1.00 0.00 ? 54 GLU A O    2  
ATOM 1677  C CB   . GLU A 1 54 ? 8.821   -8.494  4.731   1.00 0.00 ? 54 GLU A CB   2  
ATOM 1678  C CG   . GLU A 1 54 ? 8.557   -9.982  4.494   1.00 0.00 ? 54 GLU A CG   2  
ATOM 1679  C CD   . GLU A 1 54 ? 7.196   -10.395 5.059   1.00 0.00 ? 54 GLU A CD   2  
ATOM 1680  O OE1  . GLU A 1 54 ? 6.193   -10.163 4.350   1.00 0.00 ? 54 GLU A OE1  2  
ATOM 1681  O OE2  . GLU A 1 54 ? 7.190   -10.933 6.188   1.00 0.00 ? 54 GLU A OE2  2  
ATOM 1682  H H    . GLU A 1 54 ? 8.458   -7.584  2.446   1.00 0.00 ? 54 GLU A H    2  
ATOM 1683  H HA   . GLU A 1 54 ? 10.374  -7.081  4.270   1.00 0.00 ? 54 GLU A HA   2  
ATOM 1684  H HB2  . GLU A 1 54 ? 9.076   -8.328  5.777   1.00 0.00 ? 54 GLU A HB2  2  
ATOM 1685  H HB3  . GLU A 1 54 ? 7.914   -7.924  4.530   1.00 0.00 ? 54 GLU A HB3  2  
ATOM 1686  H HG2  . GLU A 1 54 ? 8.591   -10.196 3.426   1.00 0.00 ? 54 GLU A HG2  2  
ATOM 1687  H HG3  . GLU A 1 54 ? 9.344   -10.574 4.963   1.00 0.00 ? 54 GLU A HG3  2  
ATOM 1688  N N    . ALA A 1 55 ? 12.245  -8.682  4.136   1.00 0.00 ? 55 ALA A N    2  
ATOM 1689  C CA   . ALA A 1 55 ? 13.379  -9.587  4.062   1.00 0.00 ? 55 ALA A CA   2  
ATOM 1690  C C    . ALA A 1 55 ? 14.321  -9.313  5.237   1.00 0.00 ? 55 ALA A C    2  
ATOM 1691  O O    . ALA A 1 55 ? 15.388  -8.728  5.059   1.00 0.00 ? 55 ALA A O    2  
ATOM 1692  C CB   . ALA A 1 55 ? 14.074  -9.425  2.709   1.00 0.00 ? 55 ALA A CB   2  
ATOM 1693  H H    . ALA A 1 55 ? 12.442  -7.789  4.541   1.00 0.00 ? 55 ALA A H    2  
ATOM 1694  H HA   . ALA A 1 55 ? 12.998  -10.605 4.142   1.00 0.00 ? 55 ALA A HA   2  
ATOM 1695  H HB1  . ALA A 1 55 ? 14.236  -10.407 2.264   1.00 0.00 ? 55 ALA A HB1  2  
ATOM 1696  H HB2  . ALA A 1 55 ? 15.033  -8.927  2.849   1.00 0.00 ? 55 ALA A HB2  2  
ATOM 1697  H HB3  . ALA A 1 55 ? 13.447  -8.826  2.048   1.00 0.00 ? 55 ALA A HB3  2  
ATOM 1698  N N    . GLU A 1 56 ? 13.892  -9.750  6.412   1.00 0.00 ? 56 GLU A N    2  
ATOM 1699  C CA   . GLU A 1 56 ? 14.684  -9.560  7.616   1.00 0.00 ? 56 GLU A CA   2  
ATOM 1700  C C    . GLU A 1 56 ? 14.732  -10.855 8.429   1.00 0.00 ? 56 GLU A C    2  
ATOM 1701  O O    . GLU A 1 56 ? 13.692  -11.422 8.762   1.00 0.00 ? 56 GLU A O    2  
ATOM 1702  C CB   . GLU A 1 56 ? 14.136  -8.405  8.455   1.00 0.00 ? 56 GLU A CB   2  
ATOM 1703  C CG   . GLU A 1 56 ? 14.666  -7.061  7.952   1.00 0.00 ? 56 GLU A CG   2  
ATOM 1704  C CD   . GLU A 1 56 ? 13.518  -6.091  7.665   1.00 0.00 ? 56 GLU A CD   2  
ATOM 1705  O OE1  . GLU A 1 56 ? 12.636  -6.475  6.867   1.00 0.00 ? 56 GLU A OE1  2  
ATOM 1706  O OE2  . GLU A 1 56 ? 13.548  -4.987  8.251   1.00 0.00 ? 56 GLU A OE2  2  
ATOM 1707  H H    . GLU A 1 56 ? 13.023  -10.226 6.549   1.00 0.00 ? 56 GLU A H    2  
ATOM 1708  H HA   . GLU A 1 56 ? 15.685  -9.305  7.267   1.00 0.00 ? 56 GLU A HA   2  
ATOM 1709  H HB2  . GLU A 1 56 ? 13.046  -8.407  8.417   1.00 0.00 ? 56 GLU A HB2  2  
ATOM 1710  H HB3  . GLU A 1 56 ? 14.418  -8.543  9.499   1.00 0.00 ? 56 GLU A HB3  2  
ATOM 1711  H HG2  . GLU A 1 56 ? 15.336  -6.628  8.695   1.00 0.00 ? 56 GLU A HG2  2  
ATOM 1712  H HG3  . GLU A 1 56 ? 15.252  -7.214  7.045   1.00 0.00 ? 56 GLU A HG3  2  
ATOM 1713  N N    . CYS A 1 57 ? 15.950  -11.285 8.726   1.00 0.00 ? 57 CYS A N    2  
ATOM 1714  C CA   . CYS A 1 57 ? 16.147  -12.502 9.495   1.00 0.00 ? 57 CYS A CA   2  
ATOM 1715  C C    . CYS A 1 57 ? 17.168  -12.214 10.597  1.00 0.00 ? 57 CYS A C    2  
ATOM 1716  O O    . CYS A 1 57 ? 18.334  -11.947 10.314  1.00 0.00 ? 57 CYS A O    2  
ATOM 1717  C CB   . CYS A 1 57 ? 16.582  -13.669 8.605   1.00 0.00 ? 57 CYS A CB   2  
ATOM 1718  S SG   . CYS A 1 57 ? 17.875  -13.257 7.378   1.00 0.00 ? 57 CYS A SG   2  
ATOM 1719  H H    . CYS A 1 57 ? 16.790  -10.818 8.452   1.00 0.00 ? 57 CYS A H    2  
ATOM 1720  H HA   . CYS A 1 57 ? 15.179  -12.763 9.922   1.00 0.00 ? 57 CYS A HA   2  
ATOM 1721  H HB2  . CYS A 1 57 ? 16.947  -14.475 9.241   1.00 0.00 ? 57 CYS A HB2  2  
ATOM 1722  H HB3  . CYS A 1 57 ? 15.708  -14.050 8.077   1.00 0.00 ? 57 CYS A HB3  2  
ATOM 1723  N N    . THR A 1 58 ? 16.691  -12.278 11.832  1.00 0.00 ? 58 THR A N    2  
ATOM 1724  C CA   . THR A 1 58 ? 17.548  -12.028 12.979  1.00 0.00 ? 58 THR A CA   2  
ATOM 1725  C C    . THR A 1 58 ? 17.747  -13.312 13.787  1.00 0.00 ? 58 THR A C    2  
ATOM 1726  O O    . THR A 1 58 ? 18.832  -13.558 14.311  1.00 0.00 ? 58 THR A O    2  
ATOM 1727  C CB   . THR A 1 58 ? 16.929  -10.888 13.791  1.00 0.00 ? 58 THR A CB   2  
ATOM 1728  O OG1  . THR A 1 58 ? 17.896  -10.617 14.802  1.00 0.00 ? 58 THR A OG1  2  
ATOM 1729  C CG2  . THR A 1 58 ? 15.689  -11.331 14.571  1.00 0.00 ? 58 THR A CG2  2  
ATOM 1730  H H    . THR A 1 58 ? 15.741  -12.496 12.054  1.00 0.00 ? 58 THR A H    2  
ATOM 1731  H HA   . THR A 1 58 ? 18.529  -11.724 12.615  1.00 0.00 ? 58 THR A HA   2  
ATOM 1732  H HB   . THR A 1 58 ? 16.703  -10.034 13.153  1.00 0.00 ? 58 THR A HB   2  
ATOM 1733  H HG1  . THR A 1 58 ? 18.256  -9.691  14.691  1.00 0.00 ? 58 THR A HG1  2  
ATOM 1734  H HG21 . THR A 1 58 ? 15.182  -12.126 14.025  1.00 0.00 ? 58 THR A HG21 2  
ATOM 1735  H HG22 . THR A 1 58 ? 15.989  -11.698 15.552  1.00 0.00 ? 58 THR A HG22 2  
ATOM 1736  H HG23 . THR A 1 58 ? 15.014  -10.484 14.691  1.00 0.00 ? 58 THR A HG23 2  
ATOM 1737  N N    . PHE A 1 59 ? 16.681  -14.096 13.862  1.00 0.00 ? 59 PHE A N    2  
ATOM 1738  C CA   . PHE A 1 59 ? 16.725  -15.349 14.598  1.00 0.00 ? 59 PHE A CA   2  
ATOM 1739  C C    . PHE A 1 59 ? 17.847  -16.250 14.079  1.00 0.00 ? 59 PHE A C    2  
ATOM 1740  O O    . PHE A 1 59 ? 17.950  -16.489 12.876  1.00 0.00 ? 59 PHE A O    2  
ATOM 1741  C CB   . PHE A 1 59 ? 15.382  -16.046 14.374  1.00 0.00 ? 59 PHE A CB   2  
ATOM 1742  C CG   . PHE A 1 59 ? 15.286  -17.431 15.016  1.00 0.00 ? 59 PHE A CG   2  
ATOM 1743  C CD1  . PHE A 1 59 ? 15.760  -18.521 14.355  1.00 0.00 ? 59 PHE A CD1  2  
ATOM 1744  C CD2  . PHE A 1 59 ? 14.725  -17.573 16.247  1.00 0.00 ? 59 PHE A CD2  2  
ATOM 1745  C CE1  . PHE A 1 59 ? 15.671  -19.807 14.951  1.00 0.00 ? 59 PHE A CE1  2  
ATOM 1746  C CE2  . PHE A 1 59 ? 14.636  -18.859 16.842  1.00 0.00 ? 59 PHE A CE2  2  
ATOM 1747  C CZ   . PHE A 1 59 ? 15.110  -19.949 16.182  1.00 0.00 ? 59 PHE A CZ   2  
ATOM 1748  H H    . PHE A 1 59 ? 15.802  -13.888 13.433  1.00 0.00 ? 59 PHE A H    2  
ATOM 1749  H HA   . PHE A 1 59 ? 16.913  -15.104 15.643  1.00 0.00 ? 59 PHE A HA   2  
ATOM 1750  H HB2  . PHE A 1 59 ? 14.586  -15.416 14.772  1.00 0.00 ? 59 PHE A HB2  2  
ATOM 1751  H HB3  . PHE A 1 59 ? 15.208  -16.141 13.302  1.00 0.00 ? 59 PHE A HB3  2  
ATOM 1752  H HD1  . PHE A 1 59 ? 16.210  -18.408 13.369  1.00 0.00 ? 59 PHE A HD1  2  
ATOM 1753  H HD2  . PHE A 1 59 ? 14.344  -16.699 16.776  1.00 0.00 ? 59 PHE A HD2  2  
ATOM 1754  H HE1  . PHE A 1 59 ? 16.052  -20.681 14.422  1.00 0.00 ? 59 PHE A HE1  2  
ATOM 1755  H HE2  . PHE A 1 59 ? 14.186  -18.972 17.829  1.00 0.00 ? 59 PHE A HE2  2  
ATOM 1756  H HZ   . PHE A 1 59 ? 15.042  -20.936 16.639  1.00 0.00 ? 59 PHE A HZ   2  
ATOM 1757  N N    . GLU A 1 1  ? 12.417  -15.992 12.893  1.00 0.00 ? 1  GLU A N    3  
ATOM 1758  C CA   . GLU A 1 1  ? 12.102  -15.911 14.309  1.00 0.00 ? 1  GLU A CA   3  
ATOM 1759  C C    . GLU A 1 1  ? 11.128  -14.760 14.571  1.00 0.00 ? 1  GLU A C    3  
ATOM 1760  O O    . GLU A 1 1  ? 9.980   -14.988 14.947  1.00 0.00 ? 1  GLU A O    3  
ATOM 1761  C CB   . GLU A 1 1  ? 13.374  -15.754 15.145  1.00 0.00 ? 1  GLU A CB   3  
ATOM 1762  C CG   . GLU A 1 1  ? 13.961  -17.119 15.510  1.00 0.00 ? 1  GLU A CG   3  
ATOM 1763  C CD   . GLU A 1 1  ? 15.491  -17.082 15.484  1.00 0.00 ? 1  GLU A CD   3  
ATOM 1764  O OE1  . GLU A 1 1  ? 16.047  -17.357 14.399  1.00 0.00 ? 1  GLU A OE1  3  
ATOM 1765  O OE2  . GLU A 1 1  ? 16.070  -16.779 16.550  1.00 0.00 ? 1  GLU A OE2  3  
ATOM 1766  H H    . GLU A 1 1  ? 11.649  -15.814 12.278  1.00 0.00 ? 1  GLU A H    3  
ATOM 1767  H HA   . GLU A 1 1  ? 11.627  -16.861 14.556  1.00 0.00 ? 1  GLU A HA   3  
ATOM 1768  H HB2  . GLU A 1 1  ? 14.110  -15.174 14.589  1.00 0.00 ? 1  GLU A HB2  3  
ATOM 1769  H HB3  . GLU A 1 1  ? 13.149  -15.196 16.054  1.00 0.00 ? 1  GLU A HB3  3  
ATOM 1770  H HG2  . GLU A 1 1  ? 13.618  -17.413 16.502  1.00 0.00 ? 1  GLU A HG2  3  
ATOM 1771  H HG3  . GLU A 1 1  ? 13.600  -17.873 14.811  1.00 0.00 ? 1  GLU A HG3  3  
ATOM 1772  N N    . GLU A 1 2  ? 11.624  -13.549 14.362  1.00 0.00 ? 2  GLU A N    3  
ATOM 1773  C CA   . GLU A 1 2  ? 10.812  -12.362 14.570  1.00 0.00 ? 2  GLU A CA   3  
ATOM 1774  C C    . GLU A 1 2  ? 10.591  -11.630 13.245  1.00 0.00 ? 2  GLU A C    3  
ATOM 1775  O O    . GLU A 1 2  ? 11.519  -11.035 12.699  1.00 0.00 ? 2  GLU A O    3  
ATOM 1776  C CB   . GLU A 1 2  ? 11.450  -11.437 15.609  1.00 0.00 ? 2  GLU A CB   3  
ATOM 1777  C CG   . GLU A 1 2  ? 10.593  -10.189 15.831  1.00 0.00 ? 2  GLU A CG   3  
ATOM 1778  C CD   . GLU A 1 2  ? 10.335  -9.960  17.322  1.00 0.00 ? 2  GLU A CD   3  
ATOM 1779  O OE1  . GLU A 1 2  ? 10.102  -10.971 18.020  1.00 0.00 ? 2  GLU A OE1  3  
ATOM 1780  O OE2  . GLU A 1 2  ? 10.378  -8.779  17.730  1.00 0.00 ? 2  GLU A OE2  3  
ATOM 1781  H H    . GLU A 1 2  ? 12.559  -13.373 14.056  1.00 0.00 ? 2  GLU A H    3  
ATOM 1782  H HA   . GLU A 1 2  ? 9.859   -12.727 14.954  1.00 0.00 ? 2  GLU A HA   3  
ATOM 1783  H HB2  . GLU A 1 2  ? 11.572  -11.972 16.551  1.00 0.00 ? 2  GLU A HB2  3  
ATOM 1784  H HB3  . GLU A 1 2  ? 12.446  -11.144 15.277  1.00 0.00 ? 2  GLU A HB3  3  
ATOM 1785  H HG2  . GLU A 1 2  ? 11.093  -9.319  15.407  1.00 0.00 ? 2  GLU A HG2  3  
ATOM 1786  H HG3  . GLU A 1 2  ? 9.643   -10.298 15.307  1.00 0.00 ? 2  GLU A HG3  3  
ATOM 1787  N N    . TYR A 1 3  ? 9.358   -11.698 12.766  1.00 0.00 ? 3  TYR A N    3  
ATOM 1788  C CA   . TYR A 1 3  ? 9.004   -11.049 11.515  1.00 0.00 ? 3  TYR A CA   3  
ATOM 1789  C C    . TYR A 1 3  ? 7.892   -10.020 11.727  1.00 0.00 ? 3  TYR A C    3  
ATOM 1790  O O    . TYR A 1 3  ? 6.891   -10.308 12.380  1.00 0.00 ? 3  TYR A O    3  
ATOM 1791  C CB   . TYR A 1 3  ? 8.489   -12.158 10.596  1.00 0.00 ? 3  TYR A CB   3  
ATOM 1792  C CG   . TYR A 1 3  ? 7.039   -12.565 10.865  1.00 0.00 ? 3  TYR A CG   3  
ATOM 1793  C CD1  . TYR A 1 3  ? 6.743   -13.410 11.915  1.00 0.00 ? 3  TYR A CD1  3  
ATOM 1794  C CD2  . TYR A 1 3  ? 6.027   -12.088 10.057  1.00 0.00 ? 3  TYR A CD2  3  
ATOM 1795  C CE1  . TYR A 1 3  ? 5.378   -13.793 12.168  1.00 0.00 ? 3  TYR A CE1  3  
ATOM 1796  C CE2  . TYR A 1 3  ? 4.662   -12.471 10.310  1.00 0.00 ? 3  TYR A CE2  3  
ATOM 1797  C CZ   . TYR A 1 3  ? 4.405   -13.305 11.353  1.00 0.00 ? 3  TYR A CZ   3  
ATOM 1798  O OH   . TYR A 1 3  ? 3.116   -13.667 11.592  1.00 0.00 ? 3  TYR A OH   3  
ATOM 1799  H H    . TYR A 1 3  ? 8.609   -12.184 13.216  1.00 0.00 ? 3  TYR A H    3  
ATOM 1800  H HA   . TYR A 1 3  ? 9.892   -10.541 11.137  1.00 0.00 ? 3  TYR A HA   3  
ATOM 1801  H HB2  . TYR A 1 3  ? 8.577   -11.828 9.561   1.00 0.00 ? 3  TYR A HB2  3  
ATOM 1802  H HB3  . TYR A 1 3  ? 9.128   -13.034 10.706  1.00 0.00 ? 3  TYR A HB3  3  
ATOM 1803  H HD1  . TYR A 1 3  ? 7.542   -13.787 12.553  1.00 0.00 ? 3  TYR A HD1  3  
ATOM 1804  H HD2  . TYR A 1 3  ? 6.260   -11.421 9.227   1.00 0.00 ? 3  TYR A HD2  3  
ATOM 1805  H HE1  . TYR A 1 3  ? 5.130   -14.459 12.995  1.00 0.00 ? 3  TYR A HE1  3  
ATOM 1806  H HE2  . TYR A 1 3  ? 3.853   -12.102 9.680   1.00 0.00 ? 3  TYR A HE2  3  
ATOM 1807  H HH   . TYR A 1 3  ? 3.086   -14.382 12.291  1.00 0.00 ? 3  TYR A HH   3  
ATOM 1808  N N    . VAL A 1 4  ? 8.105   -8.841  11.162  1.00 0.00 ? 4  VAL A N    3  
ATOM 1809  C CA   . VAL A 1 4  ? 7.133   -7.767  11.280  1.00 0.00 ? 4  VAL A CA   3  
ATOM 1810  C C    . VAL A 1 4  ? 6.612   -7.401  9.889   1.00 0.00 ? 4  VAL A C    3  
ATOM 1811  O O    . VAL A 1 4  ? 7.366   -6.914  9.048   1.00 0.00 ? 4  VAL A O    3  
ATOM 1812  C CB   . VAL A 1 4  ? 7.753   -6.579  12.018  1.00 0.00 ? 4  VAL A CB   3  
ATOM 1813  C CG1  . VAL A 1 4  ? 8.048   -6.933  13.477  1.00 0.00 ? 4  VAL A CG1  3  
ATOM 1814  C CG2  . VAL A 1 4  ? 9.016   -6.090  11.306  1.00 0.00 ? 4  VAL A CG2  3  
ATOM 1815  H H    . VAL A 1 4  ? 8.922   -8.614  10.632  1.00 0.00 ? 4  VAL A H    3  
ATOM 1816  H HA   . VAL A 1 4  ? 6.303   -8.140  11.879  1.00 0.00 ? 4  VAL A HA   3  
ATOM 1817  H HB   . VAL A 1 4  ? 7.028   -5.765  12.011  1.00 0.00 ? 4  VAL A HB   3  
ATOM 1818  H HG11 . VAL A 1 4  ? 8.599   -7.873  13.519  1.00 0.00 ? 4  VAL A HG11 3  
ATOM 1819  H HG12 . VAL A 1 4  ? 8.646   -6.141  13.929  1.00 0.00 ? 4  VAL A HG12 3  
ATOM 1820  H HG13 . VAL A 1 4  ? 7.110   -7.037  14.023  1.00 0.00 ? 4  VAL A HG13 3  
ATOM 1821  H HG21 . VAL A 1 4  ? 9.731   -6.910  11.230  1.00 0.00 ? 4  VAL A HG21 3  
ATOM 1822  H HG22 . VAL A 1 4  ? 8.758   -5.740  10.307  1.00 0.00 ? 4  VAL A HG22 3  
ATOM 1823  H HG23 . VAL A 1 4  ? 9.460   -5.273  11.875  1.00 0.00 ? 4  VAL A HG23 3  
ATOM 1824  N N    . GLY A 1 5  ? 5.326   -7.650  9.690   1.00 0.00 ? 5  GLY A N    3  
ATOM 1825  C CA   . GLY A 1 5  ? 4.695   -7.352  8.415   1.00 0.00 ? 5  GLY A CA   3  
ATOM 1826  C C    . GLY A 1 5  ? 3.238   -6.929  8.610   1.00 0.00 ? 5  GLY A C    3  
ATOM 1827  O O    . GLY A 1 5  ? 2.455   -6.931  7.661   1.00 0.00 ? 5  GLY A O    3  
ATOM 1828  H H    . GLY A 1 5  ? 4.719   -8.046  10.379  1.00 0.00 ? 5  GLY A H    3  
ATOM 1829  H HA2  . GLY A 1 5  ? 5.244   -6.557  7.910   1.00 0.00 ? 5  GLY A HA2  3  
ATOM 1830  H HA3  . GLY A 1 5  ? 4.739   -8.230  7.770   1.00 0.00 ? 5  GLY A HA3  3  
ATOM 1831  N N    . LEU A 1 6  ? 2.918   -6.576  9.846   1.00 0.00 ? 6  LEU A N    3  
ATOM 1832  C CA   . LEU A 1 6  ? 1.568   -6.152  10.178  1.00 0.00 ? 6  LEU A CA   3  
ATOM 1833  C C    . LEU A 1 6  ? 1.497   -4.624  10.146  1.00 0.00 ? 6  LEU A C    3  
ATOM 1834  O O    . LEU A 1 6  ? 1.772   -3.964  11.147  1.00 0.00 ? 6  LEU A O    3  
ATOM 1835  C CB   . LEU A 1 6  ? 1.128   -6.760  11.511  1.00 0.00 ? 6  LEU A CB   3  
ATOM 1836  C CG   . LEU A 1 6  ? 1.882   -6.276  12.751  1.00 0.00 ? 6  LEU A CG   3  
ATOM 1837  C CD1  . LEU A 1 6  ? 0.934   -5.595  13.740  1.00 0.00 ? 6  LEU A CD1  3  
ATOM 1838  C CD2  . LEU A 1 6  ? 2.661   -7.422  13.400  1.00 0.00 ? 6  LEU A CD2  3  
ATOM 1839  H H    . LEU A 1 6  ? 3.561   -6.578  10.613  1.00 0.00 ? 6  LEU A H    3  
ATOM 1840  H HA   . LEU A 1 6  ? 0.904   -6.545  9.409   1.00 0.00 ? 6  LEU A HA   3  
ATOM 1841  H HB2  . LEU A 1 6  ? 0.067   -6.549  11.651  1.00 0.00 ? 6  LEU A HB2  3  
ATOM 1842  H HB3  . LEU A 1 6  ? 1.232   -7.843  11.446  1.00 0.00 ? 6  LEU A HB3  3  
ATOM 1843  H HG   . LEU A 1 6  ? 2.611   -5.529  12.438  1.00 0.00 ? 6  LEU A HG   3  
ATOM 1844  H HD11 . LEU A 1 6  ? 0.008   -6.167  13.808  1.00 0.00 ? 6  LEU A HD11 3  
ATOM 1845  H HD12 . LEU A 1 6  ? 1.405   -5.548  14.721  1.00 0.00 ? 6  LEU A HD12 3  
ATOM 1846  H HD13 . LEU A 1 6  ? 0.712   -4.586  13.394  1.00 0.00 ? 6  LEU A HD13 3  
ATOM 1847  H HD21 . LEU A 1 6  ? 1.978   -8.240  13.632  1.00 0.00 ? 6  LEU A HD21 3  
ATOM 1848  H HD22 . LEU A 1 6  ? 3.430   -7.774  12.713  1.00 0.00 ? 6  LEU A HD22 3  
ATOM 1849  H HD23 . LEU A 1 6  ? 3.130   -7.068  14.319  1.00 0.00 ? 6  LEU A HD23 3  
ATOM 1850  N N    . SER A 1 7  ? 1.126   -4.105  8.984   1.00 0.00 ? 7  SER A N    3  
ATOM 1851  C CA   . SER A 1 7  ? 1.015   -2.667  8.808   1.00 0.00 ? 7  SER A CA   3  
ATOM 1852  C C    . SER A 1 7  ? 2.367   -2.001  9.071   1.00 0.00 ? 7  SER A C    3  
ATOM 1853  O O    . SER A 1 7  ? 3.163   -2.498  9.867   1.00 0.00 ? 7  SER A O    3  
ATOM 1854  C CB   . SER A 1 7  ? -0.054  -2.080  9.732   1.00 0.00 ? 7  SER A CB   3  
ATOM 1855  O OG   . SER A 1 7  ? 0.458   -1.804  11.034  1.00 0.00 ? 7  SER A OG   3  
ATOM 1856  H H    . SER A 1 7  ? 0.904   -4.648  8.175   1.00 0.00 ? 7  SER A H    3  
ATOM 1857  H HA   . SER A 1 7  ? 0.714   -2.526  7.770   1.00 0.00 ? 7  SER A HA   3  
ATOM 1858  H HB2  . SER A 1 7  ? -0.446  -1.161  9.295   1.00 0.00 ? 7  SER A HB2  3  
ATOM 1859  H HB3  . SER A 1 7  ? -0.888  -2.777  9.811   1.00 0.00 ? 7  SER A HB3  3  
ATOM 1860  H HG   . SER A 1 7  ? 1.047   -0.997  11.005  1.00 0.00 ? 7  SER A HG   3  
ATOM 1861  N N    . ALA A 1 8  ? 2.586   -0.888  8.386   1.00 0.00 ? 8  ALA A N    3  
ATOM 1862  C CA   . ALA A 1 8  ? 3.829   -0.150  8.536   1.00 0.00 ? 8  ALA A CA   3  
ATOM 1863  C C    . ALA A 1 8  ? 4.982   -0.982  7.973   1.00 0.00 ? 8  ALA A C    3  
ATOM 1864  O O    . ALA A 1 8  ? 5.510   -0.676  6.905   1.00 0.00 ? 8  ALA A O    3  
ATOM 1865  C CB   . ALA A 1 8  ? 4.034   0.211   10.008  1.00 0.00 ? 8  ALA A CB   3  
ATOM 1866  H H    . ALA A 1 8  ? 1.933   -0.491  7.741   1.00 0.00 ? 8  ALA A H    3  
ATOM 1867  H HA   . ALA A 1 8  ? 3.739   0.770   7.958   1.00 0.00 ? 8  ALA A HA   3  
ATOM 1868  H HB1  . ALA A 1 8  ? 4.642   1.113   10.079  1.00 0.00 ? 8  ALA A HB1  3  
ATOM 1869  H HB2  . ALA A 1 8  ? 4.541   -0.610  10.516  1.00 0.00 ? 8  ALA A HB2  3  
ATOM 1870  H HB3  . ALA A 1 8  ? 3.067   0.387   10.478  1.00 0.00 ? 8  ALA A HB3  3  
ATOM 1871  N N    . ASN A 1 9  ? 5.339   -2.019  8.716   1.00 0.00 ? 9  ASN A N    3  
ATOM 1872  C CA   . ASN A 1 9  ? 6.421   -2.898  8.305   1.00 0.00 ? 9  ASN A CA   3  
ATOM 1873  C C    . ASN A 1 9  ? 6.208   -3.314  6.848   1.00 0.00 ? 9  ASN A C    3  
ATOM 1874  O O    . ASN A 1 9  ? 7.165   -3.635  6.144   1.00 0.00 ? 9  ASN A O    3  
ATOM 1875  C CB   . ASN A 1 9  ? 6.454   -4.168  9.158   1.00 0.00 ? 9  ASN A CB   3  
ATOM 1876  C CG   . ASN A 1 9  ? 6.397   -3.828  10.649  1.00 0.00 ? 9  ASN A CG   3  
ATOM 1877  O OD1  . ASN A 1 9  ? 7.305   -3.239  11.213  1.00 0.00 ? 9  ASN A OD1  3  
ATOM 1878  N ND2  . ASN A 1 9  ? 5.283   -4.230  11.253  1.00 0.00 ? 9  ASN A ND2  3  
ATOM 1879  H H    . ASN A 1 9  ? 4.905   -2.262  9.584   1.00 0.00 ? 9  ASN A H    3  
ATOM 1880  H HA   . ASN A 1 9  ? 7.332   -2.316  8.444   1.00 0.00 ? 9  ASN A HA   3  
ATOM 1881  H HB2  . ASN A 1 9  ? 5.613   -4.809  8.895   1.00 0.00 ? 9  ASN A HB2  3  
ATOM 1882  H HB3  . ASN A 1 9  ? 7.363   -4.730  8.944   1.00 0.00 ? 9  ASN A HB3  3  
ATOM 1883  H HD21 . ASN A 1 9  ? 4.577   -4.709  10.732  1.00 0.00 ? 9  ASN A HD21 3  
ATOM 1884  H HD22 . ASN A 1 9  ? 5.152   -4.055  12.229  1.00 0.00 ? 9  ASN A HD22 3  
ATOM 1885  N N    . GLN A 1 10 ? 4.948   -3.293  6.438   1.00 0.00 ? 10 GLN A N    3  
ATOM 1886  C CA   . GLN A 1 10 ? 4.598   -3.664  5.077   1.00 0.00 ? 10 GLN A CA   3  
ATOM 1887  C C    . GLN A 1 10 ? 4.631   -2.434  4.167   1.00 0.00 ? 10 GLN A C    3  
ATOM 1888  O O    . GLN A 1 10 ? 5.049   -2.522  3.014   1.00 0.00 ? 10 GLN A O    3  
ATOM 1889  C CB   . GLN A 1 10 ? 3.229   -4.345  5.030   1.00 0.00 ? 10 GLN A CB   3  
ATOM 1890  C CG   . GLN A 1 10 ? 2.252   -3.681  6.002   1.00 0.00 ? 10 GLN A CG   3  
ATOM 1891  C CD   . GLN A 1 10 ? 0.804   -4.015  5.638   1.00 0.00 ? 10 GLN A CD   3  
ATOM 1892  O OE1  . GLN A 1 10 ? -0.013  -3.149  5.376   1.00 0.00 ? 10 GLN A OE1  3  
ATOM 1893  N NE2  . GLN A 1 10 ? 0.534   -5.318  5.636   1.00 0.00 ? 10 GLN A NE2  3  
ATOM 1894  H H    . GLN A 1 10 ? 4.176   -3.030  7.016   1.00 0.00 ? 10 GLN A H    3  
ATOM 1895  H HA   . GLN A 1 10 ? 5.362   -4.376  4.765   1.00 0.00 ? 10 GLN A HA   3  
ATOM 1896  H HB2  . GLN A 1 10 ? 2.829   -4.296  4.017   1.00 0.00 ? 10 GLN A HB2  3  
ATOM 1897  H HB3  . GLN A 1 10 ? 3.335   -5.401  5.280   1.00 0.00 ? 10 GLN A HB3  3  
ATOM 1898  H HG2  . GLN A 1 10 ? 2.462   -4.015  7.018   1.00 0.00 ? 10 GLN A HG2  3  
ATOM 1899  H HG3  . GLN A 1 10 ? 2.395   -2.601  5.985   1.00 0.00 ? 10 GLN A HG3  3  
ATOM 1900  H HE21 . GLN A 1 10 ? 1.251   -5.978  5.861   1.00 0.00 ? 10 GLN A HE21 3  
ATOM 1901  H HE22 . GLN A 1 10 ? -0.387  -5.637  5.411   1.00 0.00 ? 10 GLN A HE22 3  
ATOM 1902  N N    . CYS A 1 11 ? 4.183   -1.316  4.720   1.00 0.00 ? 11 CYS A N    3  
ATOM 1903  C CA   . CYS A 1 11 ? 4.155   -0.071  3.972   1.00 0.00 ? 11 CYS A CA   3  
ATOM 1904  C C    . CYS A 1 11 ? 5.226   0.859   4.548   1.00 0.00 ? 11 CYS A C    3  
ATOM 1905  O O    . CYS A 1 11 ? 4.984   2.050   4.734   1.00 0.00 ? 11 CYS A O    3  
ATOM 1906  C CB   . CYS A 1 11 ? 2.768   0.573   3.997   1.00 0.00 ? 11 CYS A CB   3  
ATOM 1907  S SG   . CYS A 1 11 ? 1.400   -0.567  4.421   1.00 0.00 ? 11 CYS A SG   3  
ATOM 1908  H H    . CYS A 1 11 ? 3.844   -1.254  5.659   1.00 0.00 ? 11 CYS A H    3  
ATOM 1909  H HA   . CYS A 1 11 ? 4.378   -0.323  2.936   1.00 0.00 ? 11 CYS A HA   3  
ATOM 1910  H HB2  . CYS A 1 11 ? 2.775   1.392   4.716   1.00 0.00 ? 11 CYS A HB2  3  
ATOM 1911  H HB3  . CYS A 1 11 ? 2.568   1.010   3.018   1.00 0.00 ? 11 CYS A HB3  3  
ATOM 1912  N N    . ALA A 1 12 ? 6.387   0.278   4.814   1.00 0.00 ? 12 ALA A N    3  
ATOM 1913  C CA   . ALA A 1 12 ? 7.495   1.040   5.364   1.00 0.00 ? 12 ALA A CA   3  
ATOM 1914  C C    . ALA A 1 12 ? 8.482   1.377   4.245   1.00 0.00 ? 12 ALA A C    3  
ATOM 1915  O O    . ALA A 1 12 ? 9.695   1.316   4.442   1.00 0.00 ? 12 ALA A O    3  
ATOM 1916  C CB   . ALA A 1 12 ? 8.148   0.245   6.497   1.00 0.00 ? 12 ALA A CB   3  
ATOM 1917  H H    . ALA A 1 12 ? 6.576   -0.691  4.659   1.00 0.00 ? 12 ALA A H    3  
ATOM 1918  H HA   . ALA A 1 12 ? 7.091   1.966   5.773   1.00 0.00 ? 12 ALA A HA   3  
ATOM 1919  H HB1  . ALA A 1 12 ? 9.199   0.522   6.576   1.00 0.00 ? 12 ALA A HB1  3  
ATOM 1920  H HB2  . ALA A 1 12 ? 7.642   0.468   7.436   1.00 0.00 ? 12 ALA A HB2  3  
ATOM 1921  H HB3  . ALA A 1 12 ? 8.069   -0.821  6.285   1.00 0.00 ? 12 ALA A HB3  3  
ATOM 1922  N N    . VAL A 1 13 ? 7.926   1.727   3.094   1.00 0.00 ? 13 VAL A N    3  
ATOM 1923  C CA   . VAL A 1 13 ? 8.742   2.074   1.943   1.00 0.00 ? 13 VAL A CA   3  
ATOM 1924  C C    . VAL A 1 13 ? 8.952   3.589   1.911   1.00 0.00 ? 13 VAL A C    3  
ATOM 1925  O O    . VAL A 1 13 ? 8.118   4.346   2.407   1.00 0.00 ? 13 VAL A O    3  
ATOM 1926  C CB   . VAL A 1 13 ? 8.100   1.532   0.664   1.00 0.00 ? 13 VAL A CB   3  
ATOM 1927  C CG1  . VAL A 1 13 ? 9.147   0.875   -0.238  1.00 0.00 ? 13 VAL A CG1  3  
ATOM 1928  C CG2  . VAL A 1 13 ? 6.967   0.557   0.990   1.00 0.00 ? 13 VAL A CG2  3  
ATOM 1929  H H    . VAL A 1 13 ? 6.939   1.774   2.942   1.00 0.00 ? 13 VAL A H    3  
ATOM 1930  H HA   . VAL A 1 13 ? 9.710   1.589   2.068   1.00 0.00 ? 13 VAL A HA   3  
ATOM 1931  H HB   . VAL A 1 13 ? 7.672   2.375   0.121   1.00 0.00 ? 13 VAL A HB   3  
ATOM 1932  H HG11 . VAL A 1 13 ? 10.094  0.804   0.297   1.00 0.00 ? 13 VAL A HG11 3  
ATOM 1933  H HG12 . VAL A 1 13 ? 8.811   -0.124  -0.516  1.00 0.00 ? 13 VAL A HG12 3  
ATOM 1934  H HG13 . VAL A 1 13 ? 9.281   1.477   -1.137  1.00 0.00 ? 13 VAL A HG13 3  
ATOM 1935  H HG21 . VAL A 1 13 ? 7.261   -0.074  1.829   1.00 0.00 ? 13 VAL A HG21 3  
ATOM 1936  H HG22 . VAL A 1 13 ? 6.070   1.117   1.253   1.00 0.00 ? 13 VAL A HG22 3  
ATOM 1937  H HG23 . VAL A 1 13 ? 6.763   -0.067  0.119   1.00 0.00 ? 13 VAL A HG23 3  
ATOM 1938  N N    . PRO A 1 14 ? 10.099  3.998   1.307   1.00 0.00 ? 14 PRO A N    3  
ATOM 1939  C CA   . PRO A 1 14 ? 10.429  5.409   1.204   1.00 0.00 ? 14 PRO A CA   3  
ATOM 1940  C C    . PRO A 1 14 ? 9.580   6.094   0.131   1.00 0.00 ? 14 PRO A C    3  
ATOM 1941  O O    . PRO A 1 14 ? 8.857   7.046   0.420   1.00 0.00 ? 14 PRO A O    3  
ATOM 1942  C CB   . PRO A 1 14 ? 11.917  5.444   0.895   1.00 0.00 ? 14 PRO A CB   3  
ATOM 1943  C CG   . PRO A 1 14 ? 12.268  4.058   0.379   1.00 0.00 ? 14 PRO A CG   3  
ATOM 1944  C CD   . PRO A 1 14 ? 11.110  3.131   0.709   1.00 0.00 ? 14 PRO A CD   3  
ATOM 1945  H HA   . PRO A 1 14 ? 10.217  5.879   2.061   1.00 0.00 ? 14 PRO A HA   3  
ATOM 1946  H HB2  . PRO A 1 14 ? 12.144  6.207   0.150   1.00 0.00 ? 14 PRO A HB2  3  
ATOM 1947  H HB3  . PRO A 1 14 ? 12.495  5.687   1.787   1.00 0.00 ? 14 PRO A HB3  3  
ATOM 1948  H HG2  . PRO A 1 14 ? 12.442  4.084   -0.697  1.00 0.00 ? 14 PRO A HG2  3  
ATOM 1949  H HG3  . PRO A 1 14 ? 13.188  3.700   0.842   1.00 0.00 ? 14 PRO A HG3  3  
ATOM 1950  H HD2  . PRO A 1 14 ? 10.729  2.639   -0.187  1.00 0.00 ? 14 PRO A HD2  3  
ATOM 1951  H HD3  . PRO A 1 14 ? 11.416  2.345   1.399   1.00 0.00 ? 14 PRO A HD3  3  
ATOM 1952  N N    . ALA A 1 15 ? 9.696   5.582   -1.086  1.00 0.00 ? 15 ALA A N    3  
ATOM 1953  C CA   . ALA A 1 15 ? 8.948   6.132   -2.204  1.00 0.00 ? 15 ALA A CA   3  
ATOM 1954  C C    . ALA A 1 15 ? 9.606   5.699   -3.515  1.00 0.00 ? 15 ALA A C    3  
ATOM 1955  O O    . ALA A 1 15 ? 8.951   5.644   -4.554  1.00 0.00 ? 15 ALA A O    3  
ATOM 1956  C CB   . ALA A 1 15 ? 8.869   7.654   -2.066  1.00 0.00 ? 15 ALA A CB   3  
ATOM 1957  H H    . ALA A 1 15 ? 10.287  4.808   -1.313  1.00 0.00 ? 15 ALA A H    3  
ATOM 1958  H HA   . ALA A 1 15 ? 7.939   5.723   -2.161  1.00 0.00 ? 15 ALA A HA   3  
ATOM 1959  H HB1  . ALA A 1 15 ? 9.631   7.995   -1.365  1.00 0.00 ? 15 ALA A HB1  3  
ATOM 1960  H HB2  . ALA A 1 15 ? 7.883   7.935   -1.696  1.00 0.00 ? 15 ALA A HB2  3  
ATOM 1961  H HB3  . ALA A 1 15 ? 9.037   8.116   -3.038  1.00 0.00 ? 15 ALA A HB3  3  
ATOM 1962  N N    . LYS A 1 16 ? 10.894  5.402   -3.423  1.00 0.00 ? 16 LYS A N    3  
ATOM 1963  C CA   . LYS A 1 16 ? 11.649  4.975   -4.590  1.00 0.00 ? 16 LYS A CA   3  
ATOM 1964  C C    . LYS A 1 16 ? 11.624  3.448   -4.677  1.00 0.00 ? 16 LYS A C    3  
ATOM 1965  O O    . LYS A 1 16 ? 12.272  2.861   -5.543  1.00 0.00 ? 16 LYS A O    3  
ATOM 1966  C CB   . LYS A 1 16 ? 13.059  5.567   -4.562  1.00 0.00 ? 16 LYS A CB   3  
ATOM 1967  C CG   . LYS A 1 16 ? 13.866  5.006   -3.389  1.00 0.00 ? 16 LYS A CG   3  
ATOM 1968  C CD   . LYS A 1 16 ? 14.716  3.812   -3.829  1.00 0.00 ? 16 LYS A CD   3  
ATOM 1969  C CE   . LYS A 1 16 ? 15.448  3.192   -2.637  1.00 0.00 ? 16 LYS A CE   3  
ATOM 1970  N NZ   . LYS A 1 16 ? 16.703  2.544   -3.080  1.00 0.00 ? 16 LYS A NZ   3  
ATOM 1971  H H    . LYS A 1 16 ? 11.420  5.449   -2.574  1.00 0.00 ? 16 LYS A H    3  
ATOM 1972  H HA   . LYS A 1 16 ? 11.147  5.379   -5.469  1.00 0.00 ? 16 LYS A HA   3  
ATOM 1973  H HB2  . LYS A 1 16 ? 13.570  5.345   -5.498  1.00 0.00 ? 16 LYS A HB2  3  
ATOM 1974  H HB3  . LYS A 1 16 ? 13.000  6.653   -4.481  1.00 0.00 ? 16 LYS A HB3  3  
ATOM 1975  H HG2  . LYS A 1 16 ? 14.510  5.785   -2.981  1.00 0.00 ? 16 LYS A HG2  3  
ATOM 1976  H HG3  . LYS A 1 16 ? 13.190  4.701   -2.590  1.00 0.00 ? 16 LYS A HG3  3  
ATOM 1977  H HD2  . LYS A 1 16 ? 14.079  3.063   -4.300  1.00 0.00 ? 16 LYS A HD2  3  
ATOM 1978  H HD3  . LYS A 1 16 ? 15.439  4.133   -4.578  1.00 0.00 ? 16 LYS A HD3  3  
ATOM 1979  H HE2  . LYS A 1 16 ? 15.670  3.961   -1.898  1.00 0.00 ? 16 LYS A HE2  3  
ATOM 1980  H HE3  . LYS A 1 16 ? 14.805  2.458   -2.150  1.00 0.00 ? 16 LYS A HE3  3  
ATOM 1981  H HZ1  . LYS A 1 16 ? 16.578  2.170   -4.000  1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 1982  H HZ2  . LYS A 1 16 ? 17.440  3.219   -3.092  1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 1983  H HZ3  . LYS A 1 16 ? 16.937  1.804   -2.449  1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 1984  N N    . ASP A 1 17 ? 10.871  2.847   -3.767  1.00 0.00 ? 17 ASP A N    3  
ATOM 1985  C CA   . ASP A 1 17 ? 10.754  1.399   -3.730  1.00 0.00 ? 17 ASP A CA   3  
ATOM 1986  C C    . ASP A 1 17 ? 9.283   1.007   -3.880  1.00 0.00 ? 17 ASP A C    3  
ATOM 1987  O O    . ASP A 1 17 ? 8.921   -0.150  -3.673  1.00 0.00 ? 17 ASP A O    3  
ATOM 1988  C CB   . ASP A 1 17 ? 11.260  0.840   -2.399  1.00 0.00 ? 17 ASP A CB   3  
ATOM 1989  C CG   . ASP A 1 17 ? 12.583  0.075   -2.480  1.00 0.00 ? 17 ASP A CG   3  
ATOM 1990  O OD1  . ASP A 1 17 ? 12.885  -0.420  -3.587  1.00 0.00 ? 17 ASP A OD1  3  
ATOM 1991  O OD2  . ASP A 1 17 ? 13.262  0.004   -1.433  1.00 0.00 ? 17 ASP A OD2  3  
ATOM 1992  H H    . ASP A 1 17 ? 10.348  3.331   -3.066  1.00 0.00 ? 17 ASP A H    3  
ATOM 1993  H HA   . ASP A 1 17 ? 11.367  1.041   -4.557  1.00 0.00 ? 17 ASP A HA   3  
ATOM 1994  H HB2  . ASP A 1 17 ? 11.376  1.664   -1.696  1.00 0.00 ? 17 ASP A HB2  3  
ATOM 1995  H HB3  . ASP A 1 17 ? 10.499  0.176   -1.989  1.00 0.00 ? 17 ASP A HB3  3  
ATOM 1996  N N    . ARG A 1 18 ? 8.474   1.993   -4.238  1.00 0.00 ? 18 ARG A N    3  
ATOM 1997  C CA   . ARG A 1 18 ? 7.050   1.766   -4.417  1.00 0.00 ? 18 ARG A CA   3  
ATOM 1998  C C    . ARG A 1 18 ? 6.790   1.051   -5.745  1.00 0.00 ? 18 ARG A C    3  
ATOM 1999  O O    . ARG A 1 18 ? 7.062   1.599   -6.812  1.00 0.00 ? 18 ARG A O    3  
ATOM 2000  C CB   . ARG A 1 18 ? 6.274   3.084   -4.394  1.00 0.00 ? 18 ARG A CB   3  
ATOM 2001  C CG   . ARG A 1 18 ? 6.789   4.004   -3.286  1.00 0.00 ? 18 ARG A CG   3  
ATOM 2002  C CD   . ARG A 1 18 ? 6.582   3.373   -1.908  1.00 0.00 ? 18 ARG A CD   3  
ATOM 2003  N NE   . ARG A 1 18 ? 6.794   4.385   -0.850  1.00 0.00 ? 18 ARG A NE   3  
ATOM 2004  C CZ   . ARG A 1 18 ? 6.024   5.469   -0.682  1.00 0.00 ? 18 ARG A CZ   3  
ATOM 2005  N NH1  . ARG A 1 18 ? 4.987   5.687   -1.501  1.00 0.00 ? 18 ARG A NH1  3  
ATOM 2006  N NH2  . ARG A 1 18 ? 6.292   6.334   0.306   1.00 0.00 ? 18 ARG A NH2  3  
ATOM 2007  H H    . ARG A 1 18 ? 8.776   2.932   -4.404  1.00 0.00 ? 18 ARG A H    3  
ATOM 2008  H HA   . ARG A 1 18 ? 6.759   1.141   -3.572  1.00 0.00 ? 18 ARG A HA   3  
ATOM 2009  H HB2  . ARG A 1 18 ? 6.369   3.582   -5.359  1.00 0.00 ? 18 ARG A HB2  3  
ATOM 2010  H HB3  . ARG A 1 18 ? 5.214   2.884   -4.242  1.00 0.00 ? 18 ARG A HB3  3  
ATOM 2011  H HG2  . ARG A 1 18 ? 7.849   4.208   -3.441  1.00 0.00 ? 18 ARG A HG2  3  
ATOM 2012  H HG3  . ARG A 1 18 ? 6.270   4.962   -3.333  1.00 0.00 ? 18 ARG A HG3  3  
ATOM 2013  H HD2  . ARG A 1 18 ? 5.574   2.963   -1.835  1.00 0.00 ? 18 ARG A HD2  3  
ATOM 2014  H HD3  . ARG A 1 18 ? 7.274   2.542   -1.772  1.00 0.00 ? 18 ARG A HD3  3  
ATOM 2015  H HE   . ARG A 1 18 ? 7.560   4.252   -0.221  1.00 0.00 ? 18 ARG A HE   3  
ATOM 2016  H HH11 . ARG A 1 18 ? 4.787   5.042   -2.239  1.00 0.00 ? 18 ARG A HH11 3  
ATOM 2017  H HH12 . ARG A 1 18 ? 4.412   6.496   -1.376  1.00 0.00 ? 18 ARG A HH12 3  
ATOM 2018  H HH21 . ARG A 1 18 ? 7.066   6.171   0.917   1.00 0.00 ? 18 ARG A HH21 3  
ATOM 2019  H HH22 . ARG A 1 18 ? 5.717   7.143   0.431   1.00 0.00 ? 18 ARG A HH22 3  
ATOM 2020  N N    . VAL A 1 19 ? 6.266   -0.161  -5.636  1.00 0.00 ? 19 VAL A N    3  
ATOM 2021  C CA   . VAL A 1 19 ? 5.966   -0.955  -6.815  1.00 0.00 ? 19 VAL A CA   3  
ATOM 2022  C C    . VAL A 1 19 ? 4.621   -0.513  -7.394  1.00 0.00 ? 19 VAL A C    3  
ATOM 2023  O O    . VAL A 1 19 ? 4.256   -0.911  -8.499  1.00 0.00 ? 19 VAL A O    3  
ATOM 2024  C CB   . VAL A 1 19 ? 6.006   -2.444  -6.466  1.00 0.00 ? 19 VAL A CB   3  
ATOM 2025  C CG1  . VAL A 1 19 ? 6.257   -3.293  -7.714  1.00 0.00 ? 19 VAL A CG1  3  
ATOM 2026  C CG2  . VAL A 1 19 ? 7.055   -2.728  -5.389  1.00 0.00 ? 19 VAL A CG2  3  
ATOM 2027  H H    . VAL A 1 19 ? 6.047   -0.599  -4.764  1.00 0.00 ? 19 VAL A H    3  
ATOM 2028  H HA   . VAL A 1 19 ? 6.746   -0.760  -7.550  1.00 0.00 ? 19 VAL A HA   3  
ATOM 2029  H HB   . VAL A 1 19 ? 5.031   -2.721  -6.064  1.00 0.00 ? 19 VAL A HB   3  
ATOM 2030  H HG11 . VAL A 1 19 ? 6.164   -2.669  -8.603  1.00 0.00 ? 19 VAL A HG11 3  
ATOM 2031  H HG12 . VAL A 1 19 ? 7.261   -3.715  -7.670  1.00 0.00 ? 19 VAL A HG12 3  
ATOM 2032  H HG13 . VAL A 1 19 ? 5.526   -4.100  -7.758  1.00 0.00 ? 19 VAL A HG13 3  
ATOM 2033  H HG21 . VAL A 1 19 ? 7.837   -1.970  -5.436  1.00 0.00 ? 19 VAL A HG21 3  
ATOM 2034  H HG22 . VAL A 1 19 ? 6.583   -2.702  -4.407  1.00 0.00 ? 19 VAL A HG22 3  
ATOM 2035  H HG23 . VAL A 1 19 ? 7.492   -3.712  -5.557  1.00 0.00 ? 19 VAL A HG23 3  
ATOM 2036  N N    . ASP A 1 20 ? 3.921   0.305   -6.622  1.00 0.00 ? 20 ASP A N    3  
ATOM 2037  C CA   . ASP A 1 20 ? 2.624   0.806   -7.045  1.00 0.00 ? 20 ASP A CA   3  
ATOM 2038  C C    . ASP A 1 20 ? 1.682   -0.374  -7.293  1.00 0.00 ? 20 ASP A C    3  
ATOM 2039  O O    . ASP A 1 20 ? 1.930   -1.196  -8.173  1.00 0.00 ? 20 ASP A O    3  
ATOM 2040  C CB   . ASP A 1 20 ? 2.738   1.602   -8.347  1.00 0.00 ? 20 ASP A CB   3  
ATOM 2041  C CG   . ASP A 1 20 ? 1.414   1.852   -9.070  1.00 0.00 ? 20 ASP A CG   3  
ATOM 2042  O OD1  . ASP A 1 20 ? 0.398   2.006   -8.358  1.00 0.00 ? 20 ASP A OD1  3  
ATOM 2043  O OD2  . ASP A 1 20 ? 1.447   1.885   -10.320 1.00 0.00 ? 20 ASP A OD2  3  
ATOM 2044  H H    . ASP A 1 20 ? 4.225   0.625   -5.725  1.00 0.00 ? 20 ASP A H    3  
ATOM 2045  H HA   . ASP A 1 20 ? 2.285   1.447   -6.231  1.00 0.00 ? 20 ASP A HA   3  
ATOM 2046  H HB2  . ASP A 1 20 ? 3.203   2.563   -8.129  1.00 0.00 ? 20 ASP A HB2  3  
ATOM 2047  H HB3  . ASP A 1 20 ? 3.409   1.070   -9.022  1.00 0.00 ? 20 ASP A HB3  3  
ATOM 2048  N N    . CYS A 1 21 ? 0.621   -0.419  -6.501  1.00 0.00 ? 21 CYS A N    3  
ATOM 2049  C CA   . CYS A 1 21 ? -0.359  -1.485  -6.624  1.00 0.00 ? 21 CYS A CA   3  
ATOM 2050  C C    . CYS A 1 21 ? -1.349  -1.103  -7.726  1.00 0.00 ? 21 CYS A C    3  
ATOM 2051  O O    . CYS A 1 21 ? -1.985  -1.971  -8.322  1.00 0.00 ? 21 CYS A O    3  
ATOM 2052  C CB   . CYS A 1 21 ? -1.065  -1.761  -5.294  1.00 0.00 ? 21 CYS A CB   3  
ATOM 2053  S SG   . CYS A 1 21 ? -1.410  -3.526  -4.960  1.00 0.00 ? 21 CYS A SG   3  
ATOM 2054  H H    . CYS A 1 21 ? 0.426   0.254   -5.787  1.00 0.00 ? 21 CYS A H    3  
ATOM 2055  H HA   . CYS A 1 21 ? 0.191   -2.387  -6.892  1.00 0.00 ? 21 CYS A HA   3  
ATOM 2056  H HB2  . CYS A 1 21 ? -0.451  -1.365  -4.485  1.00 0.00 ? 21 CYS A HB2  3  
ATOM 2057  H HB3  . CYS A 1 21 ? -2.006  -1.211  -5.278  1.00 0.00 ? 21 CYS A HB3  3  
ATOM 2058  N N    . GLY A 1 22 ? -1.447  0.196   -7.965  1.00 0.00 ? 22 GLY A N    3  
ATOM 2059  C CA   . GLY A 1 22 ? -2.348  0.704   -8.986  1.00 0.00 ? 22 GLY A CA   3  
ATOM 2060  C C    . GLY A 1 22 ? -3.807  0.561   -8.549  1.00 0.00 ? 22 GLY A C    3  
ATOM 2061  O O    . GLY A 1 22 ? -4.431  -0.473  -8.784  1.00 0.00 ? 22 GLY A O    3  
ATOM 2062  H H    . GLY A 1 22 ? -0.925  0.896   -7.477  1.00 0.00 ? 22 GLY A H    3  
ATOM 2063  H HA2  . GLY A 1 22 ? -2.125  1.752   -9.184  1.00 0.00 ? 22 GLY A HA2  3  
ATOM 2064  H HA3  . GLY A 1 22 ? -2.189  0.162   -9.918  1.00 0.00 ? 22 GLY A HA3  3  
ATOM 2065  N N    . TYR A 1 23 ? -4.309  1.614   -7.921  1.00 0.00 ? 23 TYR A N    3  
ATOM 2066  C CA   . TYR A 1 23 ? -5.684  1.618   -7.449  1.00 0.00 ? 23 TYR A CA   3  
ATOM 2067  C C    . TYR A 1 23 ? -6.345  2.975   -7.700  1.00 0.00 ? 23 TYR A C    3  
ATOM 2068  O O    . TYR A 1 23 ? -5.680  4.010   -7.664  1.00 0.00 ? 23 TYR A O    3  
ATOM 2069  C CB   . TYR A 1 23 ? -5.613  1.370   -5.942  1.00 0.00 ? 23 TYR A CB   3  
ATOM 2070  C CG   . TYR A 1 23 ? -5.689  -0.108  -5.550  1.00 0.00 ? 23 TYR A CG   3  
ATOM 2071  C CD1  . TYR A 1 23 ? -6.861  -0.812  -5.738  1.00 0.00 ? 23 TYR A CD1  3  
ATOM 2072  C CD2  . TYR A 1 23 ? -4.586  -0.736  -5.009  1.00 0.00 ? 23 TYR A CD2  3  
ATOM 2073  C CE1  . TYR A 1 23 ? -6.933  -2.202  -5.370  1.00 0.00 ? 23 TYR A CE1  3  
ATOM 2074  C CE2  . TYR A 1 23 ? -4.657  -2.126  -4.641  1.00 0.00 ? 23 TYR A CE2  3  
ATOM 2075  C CZ   . TYR A 1 23 ? -5.827  -2.790  -4.840  1.00 0.00 ? 23 TYR A CZ   3  
ATOM 2076  O OH   . TYR A 1 23 ? -5.895  -4.104  -4.492  1.00 0.00 ? 23 TYR A OH   3  
ATOM 2077  H H    . TYR A 1 23 ? -3.795  2.451   -7.734  1.00 0.00 ? 23 TYR A H    3  
ATOM 2078  H HA   . TYR A 1 23 ? -6.230  0.850   -7.997  1.00 0.00 ? 23 TYR A HA   3  
ATOM 2079  H HB2  . TYR A 1 23 ? -4.683  1.789   -5.558  1.00 0.00 ? 23 TYR A HB2  3  
ATOM 2080  H HB3  . TYR A 1 23 ? -6.428  1.906   -5.456  1.00 0.00 ? 23 TYR A HB3  3  
ATOM 2081  H HD1  . TYR A 1 23 ? -7.732  -0.315  -6.165  1.00 0.00 ? 23 TYR A HD1  3  
ATOM 2082  H HD2  . TYR A 1 23 ? -3.660  -0.180  -4.861  1.00 0.00 ? 23 TYR A HD2  3  
ATOM 2083  H HE1  . TYR A 1 23 ? -7.852  -2.770  -5.513  1.00 0.00 ? 23 TYR A HE1  3  
ATOM 2084  H HE2  . TYR A 1 23 ? -3.793  -2.634  -4.213  1.00 0.00 ? 23 TYR A HE2  3  
ATOM 2085  H HH   . TYR A 1 23 ? -6.167  -4.190  -3.533  1.00 0.00 ? 23 TYR A HH   3  
ATOM 2086  N N    . PRO A 1 24 ? -7.680  2.926   -7.955  1.00 0.00 ? 24 PRO A N    3  
ATOM 2087  C CA   . PRO A 1 24 ? -8.438  4.138   -8.212  1.00 0.00 ? 24 PRO A CA   3  
ATOM 2088  C C    . PRO A 1 24 ? -8.679  4.918   -6.918  1.00 0.00 ? 24 PRO A C    3  
ATOM 2089  O O    . PRO A 1 24 ? -8.085  5.974   -6.705  1.00 0.00 ? 24 PRO A O    3  
ATOM 2090  C CB   . PRO A 1 24 ? -9.724  3.666   -8.869  1.00 0.00 ? 24 PRO A CB   3  
ATOM 2091  C CG   . PRO A 1 24 ? -9.845  2.188   -8.536  1.00 0.00 ? 24 PRO A CG   3  
ATOM 2092  C CD   . PRO A 1 24 ? -8.499  1.719   -8.006  1.00 0.00 ? 24 PRO A CD   3  
ATOM 2093  H HA   . PRO A 1 24 ? -7.920  4.752   -8.808  1.00 0.00 ? 24 PRO A HA   3  
ATOM 2094  H HB2  . PRO A 1 24 ? -10.583 4.222   -8.492  1.00 0.00 ? 24 PRO A HB2  3  
ATOM 2095  H HB3  . PRO A 1 24 ? -9.692  3.822   -9.948  1.00 0.00 ? 24 PRO A HB3  3  
ATOM 2096  H HG2  . PRO A 1 24 ? -10.625 2.026   -7.793  1.00 0.00 ? 24 PRO A HG2  3  
ATOM 2097  H HG3  . PRO A 1 24 ? -10.125 1.619   -9.422  1.00 0.00 ? 24 PRO A HG3  3  
ATOM 2098  H HD2  . PRO A 1 24 ? -8.599  1.266   -7.020  1.00 0.00 ? 24 PRO A HD2  3  
ATOM 2099  H HD3  . PRO A 1 24 ? -8.057  0.967   -8.660  1.00 0.00 ? 24 PRO A HD3  3  
ATOM 2100  N N    . HIS A 1 25 ? -9.552  4.368   -6.087  1.00 0.00 ? 25 HIS A N    3  
ATOM 2101  C CA   . HIS A 1 25 ? -9.879  4.999   -4.819  1.00 0.00 ? 25 HIS A CA   3  
ATOM 2102  C C    . HIS A 1 25 ? -8.951  4.467   -3.726  1.00 0.00 ? 25 HIS A C    3  
ATOM 2103  O O    . HIS A 1 25 ? -9.301  3.529   -3.011  1.00 0.00 ? 25 HIS A O    3  
ATOM 2104  C CB   . HIS A 1 25 ? -11.360 4.808   -4.484  1.00 0.00 ? 25 HIS A CB   3  
ATOM 2105  C CG   . HIS A 1 25 ? -11.705 3.422   -3.994  1.00 0.00 ? 25 HIS A CG   3  
ATOM 2106  N ND1  . HIS A 1 25 ? -12.801 3.163   -3.190  1.00 0.00 ? 25 HIS A ND1  3  
ATOM 2107  C CD2  . HIS A 1 25 ? -11.089 2.224   -4.204  1.00 0.00 ? 25 HIS A CD2  3  
ATOM 2108  C CE1  . HIS A 1 25 ? -12.833 1.863   -2.933  1.00 0.00 ? 25 HIS A CE1  3  
ATOM 2109  N NE2  . HIS A 1 25 ? -11.771 1.283   -3.562  1.00 0.00 ? 25 HIS A NE2  3  
ATOM 2110  H H    . HIS A 1 25 ? -10.031 3.509   -6.267  1.00 0.00 ? 25 HIS A H    3  
ATOM 2111  H HA   . HIS A 1 25 ? -9.702  6.067   -4.947  1.00 0.00 ? 25 HIS A HA   3  
ATOM 2112  H HB2  . HIS A 1 25 ? -11.645 5.533   -3.722  1.00 0.00 ? 25 HIS A HB2  3  
ATOM 2113  H HB3  . HIS A 1 25 ? -11.954 5.028   -5.371  1.00 0.00 ? 25 HIS A HB3  3  
ATOM 2114  H HD1  . HIS A 1 25 ? -13.458 3.841   -2.859  1.00 0.00 ? 25 HIS A HD1  3  
ATOM 2115  H HD2  . HIS A 1 25 ? -10.190 2.065   -4.799  1.00 0.00 ? 25 HIS A HD2  3  
ATOM 2116  H HE1  . HIS A 1 25 ? -13.578 1.349   -2.326  1.00 0.00 ? 25 HIS A HE1  3  
ATOM 2117  H HE2  . HIS A 1 25 ? -11.576 0.303   -3.589  1.00 0.00 ? 25 HIS A HE2  3  
ATOM 2118  N N    . VAL A 1 26 ? -7.784  5.088   -3.632  1.00 0.00 ? 26 VAL A N    3  
ATOM 2119  C CA   . VAL A 1 26 ? -6.802  4.688   -2.638  1.00 0.00 ? 26 VAL A CA   3  
ATOM 2120  C C    . VAL A 1 26 ? -6.930  5.591   -1.409  1.00 0.00 ? 26 VAL A C    3  
ATOM 2121  O O    . VAL A 1 26 ? -7.051  6.808   -1.539  1.00 0.00 ? 26 VAL A O    3  
ATOM 2122  C CB   . VAL A 1 26 ? -5.400  4.707   -3.250  1.00 0.00 ? 26 VAL A CB   3  
ATOM 2123  C CG1  . VAL A 1 26 ? -5.265  3.646   -4.344  1.00 0.00 ? 26 VAL A CG1  3  
ATOM 2124  C CG2  . VAL A 1 26 ? -5.056  6.097   -3.789  1.00 0.00 ? 26 VAL A CG2  3  
ATOM 2125  H H    . VAL A 1 26 ? -7.506  5.849   -4.218  1.00 0.00 ? 26 VAL A H    3  
ATOM 2126  H HA   . VAL A 1 26 ? -7.028  3.663   -2.345  1.00 0.00 ? 26 VAL A HA   3  
ATOM 2127  H HB   . VAL A 1 26 ? -4.687  4.468   -2.462  1.00 0.00 ? 26 VAL A HB   3  
ATOM 2128  H HG11 . VAL A 1 26 ? -6.025  3.813   -5.108  1.00 0.00 ? 26 VAL A HG11 3  
ATOM 2129  H HG12 . VAL A 1 26 ? -4.275  3.714   -4.796  1.00 0.00 ? 26 VAL A HG12 3  
ATOM 2130  H HG13 . VAL A 1 26 ? -5.398  2.656   -3.908  1.00 0.00 ? 26 VAL A HG13 3  
ATOM 2131  H HG21 . VAL A 1 26 ? -5.559  6.855   -3.188  1.00 0.00 ? 26 VAL A HG21 3  
ATOM 2132  H HG22 . VAL A 1 26 ? -3.978  6.250   -3.739  1.00 0.00 ? 26 VAL A HG22 3  
ATOM 2133  H HG23 . VAL A 1 26 ? -5.387  6.177   -4.825  1.00 0.00 ? 26 VAL A HG23 3  
ATOM 2134  N N    . THR A 1 27 ? -6.899  4.959   -0.245  1.00 0.00 ? 27 THR A N    3  
ATOM 2135  C CA   . THR A 1 27 ? -7.010  5.690   1.006   1.00 0.00 ? 27 THR A CA   3  
ATOM 2136  C C    . THR A 1 27 ? -6.224  4.980   2.110   1.00 0.00 ? 27 THR A C    3  
ATOM 2137  O O    . THR A 1 27 ? -5.773  3.850   1.928   1.00 0.00 ? 27 THR A O    3  
ATOM 2138  C CB   . THR A 1 27 ? -8.497  5.853   1.328   1.00 0.00 ? 27 THR A CB   3  
ATOM 2139  O OG1  . THR A 1 27 ? -8.857  4.620   1.945   1.00 0.00 ? 27 THR A OG1  3  
ATOM 2140  C CG2  . THR A 1 27 ? -9.366  5.908   0.069   1.00 0.00 ? 27 THR A CG2  3  
ATOM 2141  H H    . THR A 1 27 ? -6.800  3.969   -0.148  1.00 0.00 ? 27 THR A H    3  
ATOM 2142  H HA   . THR A 1 27 ? -6.557  6.672   0.872   1.00 0.00 ? 27 THR A HA   3  
ATOM 2143  H HB   . THR A 1 27 ? -8.665  6.729   1.955   1.00 0.00 ? 27 THR A HB   3  
ATOM 2144  H HG1  . THR A 1 27 ? -9.832  4.619   2.164   1.00 0.00 ? 27 THR A HG1  3  
ATOM 2145  H HG21 . THR A 1 27 ? -9.145  5.047   -0.562  1.00 0.00 ? 27 THR A HG21 3  
ATOM 2146  H HG22 . THR A 1 27 ? -10.418 5.890   0.353   1.00 0.00 ? 27 THR A HG22 3  
ATOM 2147  H HG23 . THR A 1 27 ? -9.153  6.825   -0.480  1.00 0.00 ? 27 THR A HG23 3  
ATOM 2148  N N    . PRO A 1 28 ? -6.081  5.690   3.261   1.00 0.00 ? 28 PRO A N    3  
ATOM 2149  C CA   . PRO A 1 28 ? -5.358  5.139   4.395   1.00 0.00 ? 28 PRO A CA   3  
ATOM 2150  C C    . PRO A 1 28 ? -6.191  4.076   5.114   1.00 0.00 ? 28 PRO A C    3  
ATOM 2151  O O    . PRO A 1 28 ? -6.176  3.996   6.341   1.00 0.00 ? 28 PRO A O    3  
ATOM 2152  C CB   . PRO A 1 28 ? -5.035  6.336   5.274   1.00 0.00 ? 28 PRO A CB   3  
ATOM 2153  C CG   . PRO A 1 28 ? -5.986  7.440   4.841   1.00 0.00 ? 28 PRO A CG   3  
ATOM 2154  C CD   . PRO A 1 28 ? -6.602  7.030   3.513   1.00 0.00 ? 28 PRO A CD   3  
ATOM 2155  H HA   . PRO A 1 28 ? -4.529  4.673   4.085   1.00 0.00 ? 28 PRO A HA   3  
ATOM 2156  H HB2  . PRO A 1 28 ? -5.172  6.095   6.328   1.00 0.00 ? 28 PRO A HB2  3  
ATOM 2157  H HB3  . PRO A 1 28 ? -3.997  6.644   5.150   1.00 0.00 ? 28 PRO A HB3  3  
ATOM 2158  H HG2  . PRO A 1 28 ? -6.762  7.593   5.591   1.00 0.00 ? 28 PRO A HG2  3  
ATOM 2159  H HG3  . PRO A 1 28 ? -5.452  8.385   4.738   1.00 0.00 ? 28 PRO A HG3  3  
ATOM 2160  H HD2  . PRO A 1 28 ? -7.691  7.028   3.565   1.00 0.00 ? 28 PRO A HD2  3  
ATOM 2161  H HD3  . PRO A 1 28 ? -6.322  7.720   2.717   1.00 0.00 ? 28 PRO A HD3  3  
ATOM 2162  N N    . LYS A 1 29 ? -6.898  3.287   4.318   1.00 0.00 ? 29 LYS A N    3  
ATOM 2163  C CA   . LYS A 1 29 ? -7.736  2.232   4.863   1.00 0.00 ? 29 LYS A CA   3  
ATOM 2164  C C    . LYS A 1 29 ? -8.369  1.445   3.714   1.00 0.00 ? 29 LYS A C    3  
ATOM 2165  O O    . LYS A 1 29 ? -8.458  0.219   3.772   1.00 0.00 ? 29 LYS A O    3  
ATOM 2166  C CB   . LYS A 1 29 ? -8.755  2.812   5.846   1.00 0.00 ? 29 LYS A CB   3  
ATOM 2167  C CG   . LYS A 1 29 ? -9.154  1.775   6.898   1.00 0.00 ? 29 LYS A CG   3  
ATOM 2168  C CD   . LYS A 1 29 ? -10.612 1.346   6.720   1.00 0.00 ? 29 LYS A CD   3  
ATOM 2169  C CE   . LYS A 1 29 ? -11.480 1.864   7.869   1.00 0.00 ? 29 LYS A CE   3  
ATOM 2170  N NZ   . LYS A 1 29 ? -12.391 0.802   8.350   1.00 0.00 ? 29 LYS A NZ   3  
ATOM 2171  H H    . LYS A 1 29 ? -6.904  3.359   3.321   1.00 0.00 ? 29 LYS A H    3  
ATOM 2172  H HA   . LYS A 1 29 ? -7.090  1.560   5.428   1.00 0.00 ? 29 LYS A HA   3  
ATOM 2173  H HB2  . LYS A 1 29 ? -8.335  3.690   6.337   1.00 0.00 ? 29 LYS A HB2  3  
ATOM 2174  H HB3  . LYS A 1 29 ? -9.641  3.144   5.304   1.00 0.00 ? 29 LYS A HB3  3  
ATOM 2175  H HG2  . LYS A 1 29 ? -8.503  0.904   6.820   1.00 0.00 ? 29 LYS A HG2  3  
ATOM 2176  H HG3  . LYS A 1 29 ? -9.012  2.190   7.895   1.00 0.00 ? 29 LYS A HG3  3  
ATOM 2177  H HD2  . LYS A 1 29 ? -10.993 1.725   5.772   1.00 0.00 ? 29 LYS A HD2  3  
ATOM 2178  H HD3  . LYS A 1 29 ? -10.672 0.259   6.676   1.00 0.00 ? 29 LYS A HD3  3  
ATOM 2179  H HE2  . LYS A 1 29 ? -10.845 2.205   8.687   1.00 0.00 ? 29 LYS A HE2  3  
ATOM 2180  H HE3  . LYS A 1 29 ? -12.059 2.725   7.535   1.00 0.00 ? 29 LYS A HE3  3  
ATOM 2181  H HZ1  . LYS A 1 29 ? -11.857 -0.001  8.613   1.00 0.00 ? 29 LYS A HZ1  3  
ATOM 2182  H HZ2  . LYS A 1 29 ? -12.903 1.136   9.142   1.00 0.00 ? 29 LYS A HZ2  3  
ATOM 2183  H HZ3  . LYS A 1 29 ? -13.029 0.554   7.621   1.00 0.00 ? 29 LYS A HZ3  3  
ATOM 2184  N N    . GLU A 1 30 ? -8.792  2.181   2.697   1.00 0.00 ? 30 GLU A N    3  
ATOM 2185  C CA   . GLU A 1 30 ? -9.414  1.567   1.536   1.00 0.00 ? 30 GLU A CA   3  
ATOM 2186  C C    . GLU A 1 30 ? -8.351  0.925   0.642   1.00 0.00 ? 30 GLU A C    3  
ATOM 2187  O O    . GLU A 1 30 ? -8.556  -0.166  0.113   1.00 0.00 ? 30 GLU A O    3  
ATOM 2188  C CB   . GLU A 1 30 ? -10.245 2.587   0.755   1.00 0.00 ? 30 GLU A CB   3  
ATOM 2189  C CG   . GLU A 1 30 ? -11.037 1.907   -0.364  1.00 0.00 ? 30 GLU A CG   3  
ATOM 2190  C CD   . GLU A 1 30 ? -12.538 1.937   -0.069  1.00 0.00 ? 30 GLU A CD   3  
ATOM 2191  O OE1  . GLU A 1 30 ? -13.105 3.050   -0.127  1.00 0.00 ? 30 GLU A OE1  3  
ATOM 2192  O OE2  . GLU A 1 30 ? -13.084 0.848   0.207   1.00 0.00 ? 30 GLU A OE2  3  
ATOM 2193  H H    . GLU A 1 30 ? -8.716  3.177   2.658   1.00 0.00 ? 30 GLU A H    3  
ATOM 2194  H HA   . GLU A 1 30 ? -10.075 0.798   1.935   1.00 0.00 ? 30 GLU A HA   3  
ATOM 2195  H HB2  . GLU A 1 30 ? -10.930 3.098   1.432   1.00 0.00 ? 30 GLU A HB2  3  
ATOM 2196  H HB3  . GLU A 1 30 ? -9.589  3.347   0.331   1.00 0.00 ? 30 GLU A HB3  3  
ATOM 2197  H HG2  . GLU A 1 30 ? -10.838 2.409   -1.311  1.00 0.00 ? 30 GLU A HG2  3  
ATOM 2198  H HG3  . GLU A 1 30 ? -10.705 0.875   -0.474  1.00 0.00 ? 30 GLU A HG3  3  
ATOM 2199  N N    . CYS A 1 31 ? -7.238  1.630   0.500   1.00 0.00 ? 31 CYS A N    3  
ATOM 2200  C CA   . CYS A 1 31 ? -6.143  1.143   -0.321  1.00 0.00 ? 31 CYS A CA   3  
ATOM 2201  C C    . CYS A 1 31 ? -5.511  -0.058  0.385   1.00 0.00 ? 31 CYS A C    3  
ATOM 2202  O O    . CYS A 1 31 ? -5.069  -1.003  -0.267  1.00 0.00 ? 31 CYS A O    3  
ATOM 2203  C CB   . CYS A 1 31 ? -5.118  2.242   -0.606  1.00 0.00 ? 31 CYS A CB   3  
ATOM 2204  S SG   . CYS A 1 31 ? -3.425  1.641   -0.957  1.00 0.00 ? 31 CYS A SG   3  
ATOM 2205  H H    . CYS A 1 31 ? -7.079  2.517   0.934   1.00 0.00 ? 31 CYS A H    3  
ATOM 2206  H HA   . CYS A 1 31 ? -6.576  0.847   -1.276  1.00 0.00 ? 31 CYS A HA   3  
ATOM 2207  H HB2  . CYS A 1 31 ? -5.463  2.830   -1.456  1.00 0.00 ? 31 CYS A HB2  3  
ATOM 2208  H HB3  . CYS A 1 31 ? -5.078  2.915   0.251   1.00 0.00 ? 31 CYS A HB3  3  
ATOM 2209  N N    . ASN A 1 32 ? -5.488  0.018   1.707   1.00 0.00 ? 32 ASN A N    3  
ATOM 2210  C CA   . ASN A 1 32 ? -4.917  -1.052  2.509   1.00 0.00 ? 32 ASN A CA   3  
ATOM 2211  C C    . ASN A 1 32 ? -5.984  -2.120  2.760   1.00 0.00 ? 32 ASN A C    3  
ATOM 2212  O O    . ASN A 1 32 ? -5.704  -3.150  3.372   1.00 0.00 ? 32 ASN A O    3  
ATOM 2213  C CB   . ASN A 1 32 ? -4.443  -0.530  3.866   1.00 0.00 ? 32 ASN A CB   3  
ATOM 2214  C CG   . ASN A 1 32 ? -5.416  -0.928  4.978   1.00 0.00 ? 32 ASN A CG   3  
ATOM 2215  O OD1  . ASN A 1 32 ? -6.602  -0.649  4.928   1.00 0.00 ? 32 ASN A OD1  3  
ATOM 2216  N ND2  . ASN A 1 32 ? -4.849  -1.593  5.980   1.00 0.00 ? 32 ASN A ND2  3  
ATOM 2217  H H    . ASN A 1 32 ? -5.850  0.790   2.230   1.00 0.00 ? 32 ASN A H    3  
ATOM 2218  H HA   . ASN A 1 32 ? -4.078  -1.430  1.925   1.00 0.00 ? 32 ASN A HA   3  
ATOM 2219  H HB2  . ASN A 1 32 ? -3.451  -0.927  4.086   1.00 0.00 ? 32 ASN A HB2  3  
ATOM 2220  H HB3  . ASN A 1 32 ? -4.350  0.556   3.830   1.00 0.00 ? 32 ASN A HB3  3  
ATOM 2221  H HD21 . ASN A 1 32 ? -3.868  -1.790  5.959   1.00 0.00 ? 32 ASN A HD21 3  
ATOM 2222  H HD22 . ASN A 1 32 ? -5.403  -1.898  6.755   1.00 0.00 ? 32 ASN A HD22 3  
ATOM 2223  N N    . ASN A 1 33 ? -7.184  -1.838  2.274   1.00 0.00 ? 33 ASN A N    3  
ATOM 2224  C CA   . ASN A 1 33 ? -8.293  -2.762  2.438   1.00 0.00 ? 33 ASN A CA   3  
ATOM 2225  C C    . ASN A 1 33 ? -8.492  -3.549  1.141   1.00 0.00 ? 33 ASN A C    3  
ATOM 2226  O O    . ASN A 1 33 ? -8.760  -4.750  1.174   1.00 0.00 ? 33 ASN A O    3  
ATOM 2227  C CB   . ASN A 1 33 ? -9.593  -2.013  2.740   1.00 0.00 ? 33 ASN A CB   3  
ATOM 2228  C CG   . ASN A 1 33 ? -10.804 -2.938  2.599   1.00 0.00 ? 33 ASN A CG   3  
ATOM 2229  O OD1  . ASN A 1 33 ? -11.068 -3.789  3.433   1.00 0.00 ? 33 ASN A OD1  3  
ATOM 2230  N ND2  . ASN A 1 33 ? -11.523 -2.726  1.501   1.00 0.00 ? 33 ASN A ND2  3  
ATOM 2231  H H    . ASN A 1 33 ? -7.403  -0.998  1.777   1.00 0.00 ? 33 ASN A H    3  
ATOM 2232  H HA   . ASN A 1 33 ? -8.013  -3.401  3.275   1.00 0.00 ? 33 ASN A HA   3  
ATOM 2233  H HB2  . ASN A 1 33 ? -9.557  -1.607  3.751   1.00 0.00 ? 33 ASN A HB2  3  
ATOM 2234  H HB3  . ASN A 1 33 ? -9.696  -1.168  2.060   1.00 0.00 ? 33 ASN A HB3  3  
ATOM 2235  H HD21 . ASN A 1 33 ? -11.251 -2.011  0.856   1.00 0.00 ? 33 ASN A HD21 3  
ATOM 2236  H HD22 . ASN A 1 33 ? -12.335 -3.280  1.319   1.00 0.00 ? 33 ASN A HD22 3  
ATOM 2237  N N    . ARG A 1 34 ? -8.352  -2.842  0.030   1.00 0.00 ? 34 ARG A N    3  
ATOM 2238  C CA   . ARG A 1 34 ? -8.513  -3.460  -1.276  1.00 0.00 ? 34 ARG A CA   3  
ATOM 2239  C C    . ARG A 1 34 ? -7.546  -4.636  -1.429  1.00 0.00 ? 34 ARG A C    3  
ATOM 2240  O O    . ARG A 1 34 ? -7.811  -5.568  -2.187  1.00 0.00 ? 34 ARG A O    3  
ATOM 2241  C CB   . ARG A 1 34 ? -8.259  -2.451  -2.398  1.00 0.00 ? 34 ARG A CB   3  
ATOM 2242  C CG   . ARG A 1 34 ? -9.216  -2.681  -3.569  1.00 0.00 ? 34 ARG A CG   3  
ATOM 2243  C CD   . ARG A 1 34 ? -10.667 -2.741  -3.087  1.00 0.00 ? 34 ARG A CD   3  
ATOM 2244  N NE   . ARG A 1 34 ? -11.168 -4.132  -3.161  1.00 0.00 ? 34 ARG A NE   3  
ATOM 2245  C CZ   . ARG A 1 34 ? -12.226 -4.587  -2.475  1.00 0.00 ? 34 ARG A CZ   3  
ATOM 2246  N NH1  . ARG A 1 34 ? -12.900 -3.764  -1.661  1.00 0.00 ? 34 ARG A NH1  3  
ATOM 2247  N NH2  . ARG A 1 34 ? -12.609 -5.864  -2.604  1.00 0.00 ? 34 ARG A NH2  3  
ATOM 2248  H H    . ARG A 1 34 ? -8.134  -1.866  0.011   1.00 0.00 ? 34 ARG A H    3  
ATOM 2249  H HA   . ARG A 1 34 ? -9.549  -3.798  -1.299  1.00 0.00 ? 34 ARG A HA   3  
ATOM 2250  H HB2  . ARG A 1 34 ? -8.383  -1.438  -2.015  1.00 0.00 ? 34 ARG A HB2  3  
ATOM 2251  H HB3  . ARG A 1 34 ? -7.229  -2.538  -2.743  1.00 0.00 ? 34 ARG A HB3  3  
ATOM 2252  H HG2  . ARG A 1 34 ? -9.104  -1.879  -4.298  1.00 0.00 ? 34 ARG A HG2  3  
ATOM 2253  H HG3  . ARG A 1 34 ? -8.959  -3.611  -4.076  1.00 0.00 ? 34 ARG A HG3  3  
ATOM 2254  H HD2  . ARG A 1 34 ? -10.734 -2.375  -2.063  1.00 0.00 ? 34 ARG A HD2  3  
ATOM 2255  H HD3  . ARG A 1 34 ? -11.290 -2.089  -3.700  1.00 0.00 ? 34 ARG A HD3  3  
ATOM 2256  H HE   . ARG A 1 34 ? -10.687 -4.772  -3.760  1.00 0.00 ? 34 ARG A HE   3  
ATOM 2257  H HH11 . ARG A 1 34 ? -12.615 -2.811  -1.564  1.00 0.00 ? 34 ARG A HH11 3  
ATOM 2258  H HH12 . ARG A 1 34 ? -13.690 -4.104  -1.149  1.00 0.00 ? 34 ARG A HH12 3  
ATOM 2259  H HH21 . ARG A 1 34 ? -12.105 -6.478  -3.212  1.00 0.00 ? 34 ARG A HH21 3  
ATOM 2260  H HH22 . ARG A 1 34 ? -13.398 -6.204  -2.093  1.00 0.00 ? 34 ARG A HH22 3  
ATOM 2261  N N    . GLY A 1 35 ? -6.446  -4.556  -0.695  1.00 0.00 ? 35 GLY A N    3  
ATOM 2262  C CA   . GLY A 1 35 ? -5.438  -5.602  -0.740  1.00 0.00 ? 35 GLY A CA   3  
ATOM 2263  C C    . GLY A 1 35 ? -4.087  -5.043  -1.188  1.00 0.00 ? 35 GLY A C    3  
ATOM 2264  O O    . GLY A 1 35 ? -3.651  -5.287  -2.312  1.00 0.00 ? 35 GLY A O    3  
ATOM 2265  H H    . GLY A 1 35 ? -6.238  -3.795  -0.081  1.00 0.00 ? 35 GLY A H    3  
ATOM 2266  H HA2  . GLY A 1 35 ? -5.339  -6.058  0.245   1.00 0.00 ? 35 GLY A HA2  3  
ATOM 2267  H HA3  . GLY A 1 35 ? -5.756  -6.388  -1.425  1.00 0.00 ? 35 GLY A HA3  3  
ATOM 2268  N N    . CYS A 1 36 ? -3.460  -4.303  -0.285  1.00 0.00 ? 36 CYS A N    3  
ATOM 2269  C CA   . CYS A 1 36 ? -2.166  -3.708  -0.572  1.00 0.00 ? 36 CYS A CA   3  
ATOM 2270  C C    . CYS A 1 36 ? -1.829  -2.725  0.551   1.00 0.00 ? 36 CYS A C    3  
ATOM 2271  O O    . CYS A 1 36 ? -2.363  -2.831  1.654   1.00 0.00 ? 36 CYS A O    3  
ATOM 2272  C CB   . CYS A 1 36 ? -2.147  -3.032  -1.945  1.00 0.00 ? 36 CYS A CB   3  
ATOM 2273  S SG   . CYS A 1 36 ? -0.833  -3.624  -3.073  1.00 0.00 ? 36 CYS A SG   3  
ATOM 2274  H H    . CYS A 1 36 ? -3.821  -4.109  0.628   1.00 0.00 ? 36 CYS A H    3  
ATOM 2275  H HA   . CYS A 1 36 ? -1.445  -4.524  -0.602  1.00 0.00 ? 36 CYS A HA   3  
ATOM 2276  H HB2  . CYS A 1 36 ? -3.114  -3.187  -2.424  1.00 0.00 ? 36 CYS A HB2  3  
ATOM 2277  H HB3  . CYS A 1 36 ? -2.029  -1.958  -1.805  1.00 0.00 ? 36 CYS A HB3  3  
ATOM 2278  N N    . CYS A 1 37 ? -0.944  -1.792  0.232   1.00 0.00 ? 37 CYS A N    3  
ATOM 2279  C CA   . CYS A 1 37 ? -0.529  -0.792  1.201   1.00 0.00 ? 37 CYS A CA   3  
ATOM 2280  C C    . CYS A 1 37 ? -0.864  0.591   0.638   1.00 0.00 ? 37 CYS A C    3  
ATOM 2281  O O    . CYS A 1 37 ? -0.897  0.779   -0.577  1.00 0.00 ? 37 CYS A O    3  
ATOM 2282  C CB   . CYS A 1 37 ? 0.955   -0.922  1.548   1.00 0.00 ? 37 CYS A CB   3  
ATOM 2283  S SG   . CYS A 1 37 ? 1.320   -2.035  2.955   1.00 0.00 ? 37 CYS A SG   3  
ATOM 2284  H H    . CYS A 1 37 ? -0.514  -1.713  -0.667  1.00 0.00 ? 37 CYS A H    3  
ATOM 2285  H HA   . CYS A 1 37 ? -1.094  -0.986  2.113   1.00 0.00 ? 37 CYS A HA   3  
ATOM 2286  H HB2  . CYS A 1 37 ? 1.489   -1.283  0.669   1.00 0.00 ? 37 CYS A HB2  3  
ATOM 2287  H HB3  . CYS A 1 37 ? 1.349   0.069   1.776   1.00 0.00 ? 37 CYS A HB3  3  
ATOM 2288  N N    . PHE A 1 38 ? -1.105  1.523   1.548   1.00 0.00 ? 38 PHE A N    3  
ATOM 2289  C CA   . PHE A 1 38 ? -1.437  2.882   1.158   1.00 0.00 ? 38 PHE A CA   3  
ATOM 2290  C C    . PHE A 1 38 ? -0.367  3.866   1.635   1.00 0.00 ? 38 PHE A C    3  
ATOM 2291  O O    . PHE A 1 38 ? 0.555   3.486   2.355   1.00 0.00 ? 38 PHE A O    3  
ATOM 2292  C CB   . PHE A 1 38 ? -2.767  3.229   1.829   1.00 0.00 ? 38 PHE A CB   3  
ATOM 2293  C CG   . PHE A 1 38 ? -3.185  4.691   1.664   1.00 0.00 ? 38 PHE A CG   3  
ATOM 2294  C CD1  . PHE A 1 38 ? -3.804  5.097   0.523   1.00 0.00 ? 38 PHE A CD1  3  
ATOM 2295  C CD2  . PHE A 1 38 ? -2.938  5.586   2.658   1.00 0.00 ? 38 PHE A CD2  3  
ATOM 2296  C CE1  . PHE A 1 38 ? -4.192  6.454   0.370   1.00 0.00 ? 38 PHE A CE1  3  
ATOM 2297  C CE2  . PHE A 1 38 ? -3.326  6.943   2.505   1.00 0.00 ? 38 PHE A CE2  3  
ATOM 2298  C CZ   . PHE A 1 38 ? -3.945  7.349   1.364   1.00 0.00 ? 38 PHE A CZ   3  
ATOM 2299  H H    . PHE A 1 38 ? -1.077  1.361   2.535   1.00 0.00 ? 38 PHE A H    3  
ATOM 2300  H HA   . PHE A 1 38 ? -1.487  2.903   0.069   1.00 0.00 ? 38 PHE A HA   3  
ATOM 2301  H HB2  . PHE A 1 38 ? -3.548  2.590   1.416   1.00 0.00 ? 38 PHE A HB2  3  
ATOM 2302  H HB3  . PHE A 1 38 ? -2.697  3.000   2.892   1.00 0.00 ? 38 PHE A HB3  3  
ATOM 2303  H HD1  . PHE A 1 38 ? -4.003  4.380   -0.274  1.00 0.00 ? 38 PHE A HD1  3  
ATOM 2304  H HD2  . PHE A 1 38 ? -2.442  5.260   3.573   1.00 0.00 ? 38 PHE A HD2  3  
ATOM 2305  H HE1  . PHE A 1 38 ? -4.689  6.779   -0.545  1.00 0.00 ? 38 PHE A HE1  3  
ATOM 2306  H HE2  . PHE A 1 38 ? -3.127  7.660   3.302   1.00 0.00 ? 38 PHE A HE2  3  
ATOM 2307  H HZ   . PHE A 1 38 ? -4.242  8.391   1.247   1.00 0.00 ? 38 PHE A HZ   3  
ATOM 2308  N N    . ASP A 1 39 ? -0.525  5.113   1.214   1.00 0.00 ? 39 ASP A N    3  
ATOM 2309  C CA   . ASP A 1 39 ? 0.416   6.154   1.590   1.00 0.00 ? 39 ASP A CA   3  
ATOM 2310  C C    . ASP A 1 39 ? 0.006   7.470   0.925   1.00 0.00 ? 39 ASP A C    3  
ATOM 2311  O O    . ASP A 1 39 ? -0.445  7.477   -0.220  1.00 0.00 ? 39 ASP A O    3  
ATOM 2312  C CB   . ASP A 1 39 ? 1.833   5.811   1.125   1.00 0.00 ? 39 ASP A CB   3  
ATOM 2313  C CG   . ASP A 1 39 ? 2.894   6.861   1.455   1.00 0.00 ? 39 ASP A CG   3  
ATOM 2314  O OD1  . ASP A 1 39 ? 3.285   6.920   2.641   1.00 0.00 ? 39 ASP A OD1  3  
ATOM 2315  O OD2  . ASP A 1 39 ? 3.291   7.582   0.514   1.00 0.00 ? 39 ASP A OD2  3  
ATOM 2316  H H    . ASP A 1 39 ? -1.277  5.414   0.629   1.00 0.00 ? 39 ASP A H    3  
ATOM 2317  H HA   . ASP A 1 39 ? 0.369   6.205   2.678   1.00 0.00 ? 39 ASP A HA   3  
ATOM 2318  H HB2  . ASP A 1 39 ? 2.127   4.863   1.577   1.00 0.00 ? 39 ASP A HB2  3  
ATOM 2319  H HB3  . ASP A 1 39 ? 1.818   5.658   0.046   1.00 0.00 ? 39 ASP A HB3  3  
ATOM 2320  N N    . SER A 1 40 ? 0.179   8.552   1.670   1.00 0.00 ? 40 SER A N    3  
ATOM 2321  C CA   . SER A 1 40 ? -0.167  9.870   1.167   1.00 0.00 ? 40 SER A CA   3  
ATOM 2322  C C    . SER A 1 40 ? 0.939   10.869  1.511   1.00 0.00 ? 40 SER A C    3  
ATOM 2323  O O    . SER A 1 40 ? 0.732   12.079  1.438   1.00 0.00 ? 40 SER A O    3  
ATOM 2324  C CB   . SER A 1 40 ? -1.506  10.343  1.736   1.00 0.00 ? 40 SER A CB   3  
ATOM 2325  O OG   . SER A 1 40 ? -1.457  10.503  3.152   1.00 0.00 ? 40 SER A OG   3  
ATOM 2326  H H    . SER A 1 40 ? 0.547   8.537   2.599   1.00 0.00 ? 40 SER A H    3  
ATOM 2327  H HA   . SER A 1 40 ? -0.254  9.753   0.086   1.00 0.00 ? 40 SER A HA   3  
ATOM 2328  H HB2  . SER A 1 40 ? -1.783  11.291  1.274   1.00 0.00 ? 40 SER A HB2  3  
ATOM 2329  H HB3  . SER A 1 40 ? -2.284  9.624   1.480   1.00 0.00 ? 40 SER A HB3  3  
ATOM 2330  H HG   . SER A 1 40 ? -2.204  9.994   3.579   1.00 0.00 ? 40 SER A HG   3  
ATOM 2331  N N    . ARG A 1 41 ? 2.089   10.325  1.881   1.00 0.00 ? 41 ARG A N    3  
ATOM 2332  C CA   . ARG A 1 41 ? 3.229   11.154  2.237   1.00 0.00 ? 41 ARG A CA   3  
ATOM 2333  C C    . ARG A 1 41 ? 3.620   12.052  1.062   1.00 0.00 ? 41 ARG A C    3  
ATOM 2334  O O    . ARG A 1 41 ? 3.968   13.216  1.256   1.00 0.00 ? 41 ARG A O    3  
ATOM 2335  C CB   . ARG A 1 41 ? 4.431   10.295  2.636   1.00 0.00 ? 41 ARG A CB   3  
ATOM 2336  C CG   . ARG A 1 41 ? 5.191   10.925  3.804   1.00 0.00 ? 41 ARG A CG   3  
ATOM 2337  C CD   . ARG A 1 41 ? 6.610   10.362  3.903   1.00 0.00 ? 41 ARG A CD   3  
ATOM 2338  N NE   . ARG A 1 41 ? 7.512   11.364  4.512   1.00 0.00 ? 41 ARG A NE   3  
ATOM 2339  C CZ   . ARG A 1 41 ? 8.848   11.327  4.420   1.00 0.00 ? 41 ARG A CZ   3  
ATOM 2340  N NH1  . ARG A 1 41 ? 9.446   10.336  3.744   1.00 0.00 ? 41 ARG A NH1  3  
ATOM 2341  N NH2  . ARG A 1 41 ? 9.587   12.280  5.005   1.00 0.00 ? 41 ARG A NH2  3  
ATOM 2342  H H    . ARG A 1 41 ? 2.249   9.340   1.938   1.00 0.00 ? 41 ARG A H    3  
ATOM 2343  H HA   . ARG A 1 41 ? 2.888   11.745  3.087   1.00 0.00 ? 41 ARG A HA   3  
ATOM 2344  H HB2  . ARG A 1 41 ? 4.093   9.297   2.913   1.00 0.00 ? 41 ARG A HB2  3  
ATOM 2345  H HB3  . ARG A 1 41 ? 5.099   10.180  1.782   1.00 0.00 ? 41 ARG A HB3  3  
ATOM 2346  H HG2  . ARG A 1 41 ? 5.234   12.007  3.674   1.00 0.00 ? 41 ARG A HG2  3  
ATOM 2347  H HG3  . ARG A 1 41 ? 4.656   10.737  4.735   1.00 0.00 ? 41 ARG A HG3  3  
ATOM 2348  H HD2  . ARG A 1 41 ? 6.608   9.451   4.501   1.00 0.00 ? 41 ARG A HD2  3  
ATOM 2349  H HD3  . ARG A 1 41 ? 6.972   10.090  2.911   1.00 0.00 ? 41 ARG A HD3  3  
ATOM 2350  H HE   . ARG A 1 41 ? 7.098   12.117  5.024   1.00 0.00 ? 41 ARG A HE   3  
ATOM 2351  H HH11 . ARG A 1 41 ? 8.895   9.625   3.308   1.00 0.00 ? 41 ARG A HH11 3  
ATOM 2352  H HH12 . ARG A 1 41 ? 10.443  10.308  3.676   1.00 0.00 ? 41 ARG A HH12 3  
ATOM 2353  H HH21 . ARG A 1 41 ? 9.141   13.019  5.510   1.00 0.00 ? 41 ARG A HH21 3  
ATOM 2354  H HH22 . ARG A 1 41 ? 10.584  12.252  4.937   1.00 0.00 ? 41 ARG A HH22 3  
ATOM 2355  N N    . ILE A 1 42 ? 3.548   11.478  -0.130  1.00 0.00 ? 42 ILE A N    3  
ATOM 2356  C CA   . ILE A 1 42 ? 3.890   12.213  -1.336  1.00 0.00 ? 42 ILE A CA   3  
ATOM 2357  C C    . ILE A 1 42 ? 3.110   11.635  -2.519  1.00 0.00 ? 42 ILE A C    3  
ATOM 2358  O O    . ILE A 1 42 ? 3.079   10.421  -2.712  1.00 0.00 ? 42 ILE A O    3  
ATOM 2359  C CB   . ILE A 1 42 ? 5.406   12.224  -1.545  1.00 0.00 ? 42 ILE A CB   3  
ATOM 2360  C CG1  . ILE A 1 42 ? 6.065   11.036  -0.841  1.00 0.00 ? 42 ILE A CG1  3  
ATOM 2361  C CG2  . ILE A 1 42 ? 6.011   13.559  -1.105  1.00 0.00 ? 42 ILE A CG2  3  
ATOM 2362  C CD1  . ILE A 1 42 ? 5.530   9.710   -1.386  1.00 0.00 ? 42 ILE A CD1  3  
ATOM 2363  H H    . ILE A 1 42 ? 3.263   10.532  -0.278  1.00 0.00 ? 42 ILE A H    3  
ATOM 2364  H HA   . ILE A 1 42 ? 3.578   13.247  -1.188  1.00 0.00 ? 42 ILE A HA   3  
ATOM 2365  H HB   . ILE A 1 42 ? 5.604   12.116  -2.612  1.00 0.00 ? 42 ILE A HB   3  
ATOM 2366  H HG12 . ILE A 1 42 ? 7.145   11.081  -0.979  1.00 0.00 ? 42 ILE A HG12 3  
ATOM 2367  H HG13 . ILE A 1 42 ? 5.878   11.095  0.231   1.00 0.00 ? 42 ILE A HG13 3  
ATOM 2368  H HG21 . ILE A 1 42 ? 5.681   13.791  -0.092  1.00 0.00 ? 42 ILE A HG21 3  
ATOM 2369  H HG22 . ILE A 1 42 ? 7.098   13.489  -1.126  1.00 0.00 ? 42 ILE A HG22 3  
ATOM 2370  H HG23 . ILE A 1 42 ? 5.684   14.347  -1.783  1.00 0.00 ? 42 ILE A HG23 3  
ATOM 2371  H HD11 . ILE A 1 42 ? 5.170   9.855   -2.404  1.00 0.00 ? 42 ILE A HD11 3  
ATOM 2372  H HD12 . ILE A 1 42 ? 6.329   8.968   -1.385  1.00 0.00 ? 42 ILE A HD12 3  
ATOM 2373  H HD13 . ILE A 1 42 ? 4.711   9.363   -0.756  1.00 0.00 ? 42 ILE A HD13 3  
ATOM 2374  N N    . PRO A 1 43 ? 2.483   12.556  -3.299  1.00 0.00 ? 43 PRO A N    3  
ATOM 2375  C CA   . PRO A 1 43 ? 1.706   12.151  -4.457  1.00 0.00 ? 43 PRO A CA   3  
ATOM 2376  C C    . PRO A 1 43 ? 2.618   11.741  -5.614  1.00 0.00 ? 43 PRO A C    3  
ATOM 2377  O O    . PRO A 1 43 ? 2.266   10.871  -6.410  1.00 0.00 ? 43 PRO A O    3  
ATOM 2378  C CB   . PRO A 1 43 ? 0.833   13.352  -4.785  1.00 0.00 ? 43 PRO A CB   3  
ATOM 2379  C CG   . PRO A 1 43 ? 1.483   14.540  -4.095  1.00 0.00 ? 43 PRO A CG   3  
ATOM 2380  C CD   . PRO A 1 43 ? 2.499   14.003  -3.100  1.00 0.00 ? 43 PRO A CD   3  
ATOM 2381  H HA   . PRO A 1 43 ? 1.158   11.343  -4.242  1.00 0.00 ? 43 PRO A HA   3  
ATOM 2382  H HB2  . PRO A 1 43 ? 0.775   13.510  -5.862  1.00 0.00 ? 43 PRO A HB2  3  
ATOM 2383  H HB3  . PRO A 1 43 ? -0.186  13.203  -4.430  1.00 0.00 ? 43 PRO A HB3  3  
ATOM 2384  H HG2  . PRO A 1 43 ? 1.970   15.187  -4.825  1.00 0.00 ? 43 PRO A HG2  3  
ATOM 2385  H HG3  . PRO A 1 43 ? 0.732   15.143  -3.586  1.00 0.00 ? 43 PRO A HG3  3  
ATOM 2386  H HD2  . PRO A 1 43 ? 3.490   14.417  -3.282  1.00 0.00 ? 43 PRO A HD2  3  
ATOM 2387  H HD3  . PRO A 1 43 ? 2.227   14.264  -2.077  1.00 0.00 ? 43 PRO A HD3  3  
ATOM 2388  N N    . GLY A 1 44 ? 3.774   12.387  -5.672  1.00 0.00 ? 44 GLY A N    3  
ATOM 2389  C CA   . GLY A 1 44 ? 4.740   12.100  -6.719  1.00 0.00 ? 44 GLY A CA   3  
ATOM 2390  C C    . GLY A 1 44 ? 4.921   10.591  -6.900  1.00 0.00 ? 44 GLY A C    3  
ATOM 2391  O O    . GLY A 1 44 ? 5.232   10.127  -7.996  1.00 0.00 ? 44 GLY A O    3  
ATOM 2392  H H    . GLY A 1 44 ? 4.053   13.093  -5.021  1.00 0.00 ? 44 GLY A H    3  
ATOM 2393  H HA2  . GLY A 1 44 ? 4.409   12.546  -7.656  1.00 0.00 ? 44 GLY A HA2  3  
ATOM 2394  H HA3  . GLY A 1 44 ? 5.698   12.557  -6.470  1.00 0.00 ? 44 GLY A HA3  3  
ATOM 2395  N N    . VAL A 1 45 ? 4.717   9.868   -5.809  1.00 0.00 ? 45 VAL A N    3  
ATOM 2396  C CA   . VAL A 1 45 ? 4.853   8.422   -5.834  1.00 0.00 ? 45 VAL A CA   3  
ATOM 2397  C C    . VAL A 1 45 ? 3.464   7.782   -5.798  1.00 0.00 ? 45 VAL A C    3  
ATOM 2398  O O    . VAL A 1 45 ? 2.464   8.471   -5.604  1.00 0.00 ? 45 VAL A O    3  
ATOM 2399  C CB   . VAL A 1 45 ? 5.753   7.961   -4.685  1.00 0.00 ? 45 VAL A CB   3  
ATOM 2400  C CG1  . VAL A 1 45 ? 6.737   9.062   -4.284  1.00 0.00 ? 45 VAL A CG1  3  
ATOM 2401  C CG2  . VAL A 1 45 ? 4.921   7.505   -3.486  1.00 0.00 ? 45 VAL A CG2  3  
ATOM 2402  H H    . VAL A 1 45 ? 4.464   10.253  -4.922  1.00 0.00 ? 45 VAL A H    3  
ATOM 2403  H HA   . VAL A 1 45 ? 5.339   8.153   -6.772  1.00 0.00 ? 45 VAL A HA   3  
ATOM 2404  H HB   . VAL A 1 45 ? 6.332   7.106   -5.035  1.00 0.00 ? 45 VAL A HB   3  
ATOM 2405  H HG11 . VAL A 1 45 ? 6.193   9.992   -4.119  1.00 0.00 ? 45 VAL A HG11 3  
ATOM 2406  H HG12 . VAL A 1 45 ? 7.251   8.773   -3.367  1.00 0.00 ? 45 VAL A HG12 3  
ATOM 2407  H HG13 . VAL A 1 45 ? 7.467   9.204   -5.081  1.00 0.00 ? 45 VAL A HG13 3  
ATOM 2408  H HG21 . VAL A 1 45 ? 4.029   8.127   -3.405  1.00 0.00 ? 45 VAL A HG21 3  
ATOM 2409  H HG22 . VAL A 1 45 ? 4.626   6.464   -3.621  1.00 0.00 ? 45 VAL A HG22 3  
ATOM 2410  H HG23 . VAL A 1 45 ? 5.513   7.600   -2.575  1.00 0.00 ? 45 VAL A HG23 3  
ATOM 2411  N N    . PRO A 1 46 ? 3.445   6.436   -5.994  1.00 0.00 ? 46 PRO A N    3  
ATOM 2412  C CA   . PRO A 1 46 ? 2.195   5.696   -5.986  1.00 0.00 ? 46 PRO A CA   3  
ATOM 2413  C C    . PRO A 1 46 ? 1.665   5.531   -4.561  1.00 0.00 ? 46 PRO A C    3  
ATOM 2414  O O    . PRO A 1 46 ? 1.990   4.558   -3.882  1.00 0.00 ? 46 PRO A O    3  
ATOM 2415  C CB   . PRO A 1 46 ? 2.518   4.371   -6.657  1.00 0.00 ? 46 PRO A CB   3  
ATOM 2416  C CG   . PRO A 1 46 ? 4.031   4.231   -6.597  1.00 0.00 ? 46 PRO A CG   3  
ATOM 2417  C CD   . PRO A 1 46 ? 4.610   5.587   -6.227  1.00 0.00 ? 46 PRO A CD   3  
ATOM 2418  H HA   . PRO A 1 46 ? 1.490   6.201   -6.483  1.00 0.00 ? 46 PRO A HA   3  
ATOM 2419  H HB2  . PRO A 1 46 ? 2.029   3.543   -6.143  1.00 0.00 ? 46 PRO A HB2  3  
ATOM 2420  H HB3  . PRO A 1 46 ? 2.166   4.359   -7.688  1.00 0.00 ? 46 PRO A HB3  3  
ATOM 2421  H HG2  . PRO A 1 46 ? 4.316   3.480   -5.859  1.00 0.00 ? 46 PRO A HG2  3  
ATOM 2422  H HG3  . PRO A 1 46 ? 4.422   3.898   -7.558  1.00 0.00 ? 46 PRO A HG3  3  
ATOM 2423  H HD2  . PRO A 1 46 ? 5.236   5.521   -5.338  1.00 0.00 ? 46 PRO A HD2  3  
ATOM 2424  H HD3  . PRO A 1 46 ? 5.234   5.982   -7.028  1.00 0.00 ? 46 PRO A HD3  3  
ATOM 2425  N N    . TRP A 1 47 ? 0.857   6.496   -4.148  1.00 0.00 ? 47 TRP A N    3  
ATOM 2426  C CA   . TRP A 1 47 ? 0.278   6.470   -2.816  1.00 0.00 ? 47 TRP A CA   3  
ATOM 2427  C C    . TRP A 1 47 ? 0.072   5.007   -2.418  1.00 0.00 ? 47 TRP A C    3  
ATOM 2428  O O    . TRP A 1 47 ? 0.564   4.567   -1.380  1.00 0.00 ? 47 TRP A O    3  
ATOM 2429  C CB   . TRP A 1 47 ? -1.012  7.291   -2.762  1.00 0.00 ? 47 TRP A CB   3  
ATOM 2430  C CG   . TRP A 1 47 ? -0.794  8.772   -2.441  1.00 0.00 ? 47 TRP A CG   3  
ATOM 2431  C CD1  . TRP A 1 47 ? 0.289   9.519   -2.691  1.00 0.00 ? 47 TRP A CD1  3  
ATOM 2432  C CD2  . TRP A 1 47 ? -1.733  9.659   -1.797  1.00 0.00 ? 47 TRP A CD2  3  
ATOM 2433  N NE1  . TRP A 1 47 ? 0.119   10.818  -2.257  1.00 0.00 ? 47 TRP A NE1  3  
ATOM 2434  C CE2  . TRP A 1 47 ? -1.150  10.905  -1.696  1.00 0.00 ? 47 TRP A CE2  3  
ATOM 2435  C CE3  . TRP A 1 47 ? -3.031  9.415   -1.315  1.00 0.00 ? 47 TRP A CE3  3  
ATOM 2436  C CZ2  . TRP A 1 47 ? -1.792  12.007  -1.117  1.00 0.00 ? 47 TRP A CZ2  3  
ATOM 2437  C CZ3  . TRP A 1 47 ? -3.659  10.526  -0.739  1.00 0.00 ? 47 TRP A CZ3  3  
ATOM 2438  C CH2  . TRP A 1 47 ? -3.086  11.788  -0.630  1.00 0.00 ? 47 TRP A CH2  3  
ATOM 2439  H H    . TRP A 1 47 ? 0.597   7.285   -4.706  1.00 0.00 ? 47 TRP A H    3  
ATOM 2440  H HA   . TRP A 1 47 ? 0.985   6.945   -2.136  1.00 0.00 ? 47 TRP A HA   3  
ATOM 2441  H HB2  . TRP A 1 47 ? -1.523  7.209   -3.721  1.00 0.00 ? 47 TRP A HB2  3  
ATOM 2442  H HB3  . TRP A 1 47 ? -1.673  6.861   -2.010  1.00 0.00 ? 47 TRP A HB3  3  
ATOM 2443  H HD1  . TRP A 1 47 ? 1.192   9.148   -3.177  1.00 0.00 ? 47 TRP A HD1  3  
ATOM 2444  H HE1  . TRP A 1 47 ? 0.845   11.627  -2.339  1.00 0.00 ? 47 TRP A HE1  3  
ATOM 2445  H HE3  . TRP A 1 47 ? -3.513  8.440   -1.383  1.00 0.00 ? 47 TRP A HE3  3  
ATOM 2446  H HZ2  . TRP A 1 47 ? -1.310  12.982  -1.049  1.00 0.00 ? 47 TRP A HZ2  3  
ATOM 2447  H HZ3  . TRP A 1 47 ? -4.668  10.393  -0.350  1.00 0.00 ? 47 TRP A HZ3  3  
ATOM 2448  H HH2  . TRP A 1 47 ? -3.642  12.604  -0.168  1.00 0.00 ? 47 TRP A HH2  3  
ATOM 2449  N N    . CYS A 1 48 ? -0.655  4.294   -3.265  1.00 0.00 ? 48 CYS A N    3  
ATOM 2450  C CA   . CYS A 1 48 ? -0.932  2.889   -3.016  1.00 0.00 ? 48 CYS A CA   3  
ATOM 2451  C C    . CYS A 1 48 ? 0.147   2.056   -3.711  1.00 0.00 ? 48 CYS A C    3  
ATOM 2452  O O    . CYS A 1 48 ? 0.224   2.033   -4.938  1.00 0.00 ? 48 CYS A O    3  
ATOM 2453  C CB   . CYS A 1 48 ? -2.338  2.500   -3.474  1.00 0.00 ? 48 CYS A CB   3  
ATOM 2454  S SG   . CYS A 1 48 ? -3.028  1.015   -2.657  1.00 0.00 ? 48 CYS A SG   3  
ATOM 2455  H H    . CYS A 1 48 ? -1.051  4.659   -4.108  1.00 0.00 ? 48 CYS A H    3  
ATOM 2456  H HA   . CYS A 1 48 ? -0.892  2.750   -1.935  1.00 0.00 ? 48 CYS A HA   3  
ATOM 2457  H HB2  . CYS A 1 48 ? -3.009  3.340   -3.296  1.00 0.00 ? 48 CYS A HB2  3  
ATOM 2458  H HB3  . CYS A 1 48 ? -2.320  2.329   -4.551  1.00 0.00 ? 48 CYS A HB3  3  
ATOM 2459  N N    . PHE A 1 49 ? 0.953   1.391   -2.896  1.00 0.00 ? 49 PHE A N    3  
ATOM 2460  C CA   . PHE A 1 49 ? 2.024   0.559   -3.417  1.00 0.00 ? 49 PHE A CA   3  
ATOM 2461  C C    . PHE A 1 49 ? 2.060   -0.796  -2.707  1.00 0.00 ? 49 PHE A C    3  
ATOM 2462  O O    . PHE A 1 49 ? 1.459   -0.961  -1.646  1.00 0.00 ? 49 PHE A O    3  
ATOM 2463  C CB   . PHE A 1 49 ? 3.336   1.298   -3.148  1.00 0.00 ? 49 PHE A CB   3  
ATOM 2464  C CG   . PHE A 1 49 ? 3.454   1.861   -1.731  1.00 0.00 ? 49 PHE A CG   3  
ATOM 2465  C CD1  . PHE A 1 49 ? 3.589   1.018   -0.673  1.00 0.00 ? 49 PHE A CD1  3  
ATOM 2466  C CD2  . PHE A 1 49 ? 3.423   3.206   -1.529  1.00 0.00 ? 49 PHE A CD2  3  
ATOM 2467  C CE1  . PHE A 1 49 ? 3.699   1.541   0.643   1.00 0.00 ? 49 PHE A CE1  3  
ATOM 2468  C CE2  . PHE A 1 49 ? 3.533   3.729   -0.213  1.00 0.00 ? 49 PHE A CE2  3  
ATOM 2469  C CZ   . PHE A 1 49 ? 3.668   2.885   0.845   1.00 0.00 ? 49 PHE A CZ   3  
ATOM 2470  H H    . PHE A 1 49 ? 0.883   1.415   -1.899  1.00 0.00 ? 49 PHE A H    3  
ATOM 2471  H HA   . PHE A 1 49 ? 1.827   0.406   -4.478  1.00 0.00 ? 49 PHE A HA   3  
ATOM 2472  H HB2  . PHE A 1 49 ? 4.168   0.617   -3.328  1.00 0.00 ? 49 PHE A HB2  3  
ATOM 2473  H HB3  . PHE A 1 49 ? 3.434   2.116   -3.863  1.00 0.00 ? 49 PHE A HB3  3  
ATOM 2474  H HD1  . PHE A 1 49 ? 3.614   -0.060  -0.835  1.00 0.00 ? 49 PHE A HD1  3  
ATOM 2475  H HD2  . PHE A 1 49 ? 3.315   3.882   -2.377  1.00 0.00 ? 49 PHE A HD2  3  
ATOM 2476  H HE1  . PHE A 1 49 ? 3.807   0.865   1.491   1.00 0.00 ? 49 PHE A HE1  3  
ATOM 2477  H HE2  . PHE A 1 49 ? 3.508   4.807   -0.051  1.00 0.00 ? 49 PHE A HE2  3  
ATOM 2478  H HZ   . PHE A 1 49 ? 3.752   3.287   1.855   1.00 0.00 ? 49 PHE A HZ   3  
ATOM 2479  N N    . LYS A 1 50 ? 2.771   -1.731  -3.320  1.00 0.00 ? 50 LYS A N    3  
ATOM 2480  C CA   . LYS A 1 50 ? 2.894   -3.066  -2.760  1.00 0.00 ? 50 LYS A CA   3  
ATOM 2481  C C    . LYS A 1 50 ? 3.624   -2.986  -1.418  1.00 0.00 ? 50 LYS A C    3  
ATOM 2482  O O    . LYS A 1 50 ? 4.284   -1.990  -1.125  1.00 0.00 ? 50 LYS A O    3  
ATOM 2483  C CB   . LYS A 1 50 ? 3.556   -4.010  -3.765  1.00 0.00 ? 50 LYS A CB   3  
ATOM 2484  C CG   . LYS A 1 50 ? 2.834   -3.969  -5.114  1.00 0.00 ? 50 LYS A CG   3  
ATOM 2485  C CD   . LYS A 1 50 ? 3.200   -5.184  -5.969  1.00 0.00 ? 50 LYS A CD   3  
ATOM 2486  C CE   . LYS A 1 50 ? 2.340   -6.395  -5.597  1.00 0.00 ? 50 LYS A CE   3  
ATOM 2487  N NZ   . LYS A 1 50 ? 2.206   -7.309  -6.753  1.00 0.00 ? 50 LYS A NZ   3  
ATOM 2488  H H    . LYS A 1 50 ? 3.257   -1.588  -4.183  1.00 0.00 ? 50 LYS A H    3  
ATOM 2489  H HA   . LYS A 1 50 ? 1.885   -3.440  -2.583  1.00 0.00 ? 50 LYS A HA   3  
ATOM 2490  H HB2  . LYS A 1 50 ? 4.601   -3.730  -3.900  1.00 0.00 ? 50 LYS A HB2  3  
ATOM 2491  H HB3  . LYS A 1 50 ? 3.547   -5.027  -3.375  1.00 0.00 ? 50 LYS A HB3  3  
ATOM 2492  H HG2  . LYS A 1 50 ? 1.756   -3.945  -4.952  1.00 0.00 ? 50 LYS A HG2  3  
ATOM 2493  H HG3  . LYS A 1 50 ? 3.098   -3.054  -5.644  1.00 0.00 ? 50 LYS A HG3  3  
ATOM 2494  H HD2  . LYS A 1 50 ? 3.062   -4.946  -7.023  1.00 0.00 ? 50 LYS A HD2  3  
ATOM 2495  H HD3  . LYS A 1 50 ? 4.253   -5.426  -5.831  1.00 0.00 ? 50 LYS A HD3  3  
ATOM 2496  H HE2  . LYS A 1 50 ? 2.791   -6.924  -4.757  1.00 0.00 ? 50 LYS A HE2  3  
ATOM 2497  H HE3  . LYS A 1 50 ? 1.354   -6.062  -5.273  1.00 0.00 ? 50 LYS A HE3  3  
ATOM 2498  H HZ1  . LYS A 1 50 ? 2.919   -7.105  -7.424  1.00 0.00 ? 50 LYS A HZ1  3  
ATOM 2499  H HZ2  . LYS A 1 50 ? 2.303   -8.255  -6.442  1.00 0.00 ? 50 LYS A HZ2  3  
ATOM 2500  H HZ3  . LYS A 1 50 ? 1.307   -7.186  -7.173  1.00 0.00 ? 50 LYS A HZ3  3  
ATOM 2501  N N    . PRO A 1 51 ? 3.478   -4.076  -0.618  1.00 0.00 ? 51 PRO A N    3  
ATOM 2502  C CA   . PRO A 1 51 ? 4.116   -4.138  0.686   1.00 0.00 ? 51 PRO A CA   3  
ATOM 2503  C C    . PRO A 1 51 ? 5.618   -4.397  0.549   1.00 0.00 ? 51 PRO A C    3  
ATOM 2504  O O    . PRO A 1 51 ? 6.029   -5.378  -0.070  1.00 0.00 ? 51 PRO A O    3  
ATOM 2505  C CB   . PRO A 1 51 ? 3.387   -5.247  1.428   1.00 0.00 ? 51 PRO A CB   3  
ATOM 2506  C CG   . PRO A 1 51 ? 2.687   -6.072  0.360   1.00 0.00 ? 51 PRO A CG   3  
ATOM 2507  C CD   . PRO A 1 51 ? 2.704   -5.273  -0.933  1.00 0.00 ? 51 PRO A CD   3  
ATOM 2508  H HA   . PRO A 1 51 ? 4.032   -3.260  1.156   1.00 0.00 ? 51 PRO A HA   3  
ATOM 2509  H HB2  . PRO A 1 51 ? 4.085   -5.859  1.999   1.00 0.00 ? 51 PRO A HB2  3  
ATOM 2510  H HB3  . PRO A 1 51 ? 2.670   -4.835  2.137   1.00 0.00 ? 51 PRO A HB3  3  
ATOM 2511  H HG2  . PRO A 1 51 ? 3.192   -7.029  0.225   1.00 0.00 ? 51 PRO A HG2  3  
ATOM 2512  H HG3  . PRO A 1 51 ? 1.662   -6.292  0.660   1.00 0.00 ? 51 PRO A HG3  3  
ATOM 2513  H HD2  . PRO A 1 51 ? 3.163   -5.840  -1.742  1.00 0.00 ? 51 PRO A HD2  3  
ATOM 2514  H HD3  . PRO A 1 51 ? 1.694   -5.019  -1.254  1.00 0.00 ? 51 PRO A HD3  3  
ATOM 2515  N N    . LEU A 1 52 ? 6.396   -3.501  1.137   1.00 0.00 ? 52 LEU A N    3  
ATOM 2516  C CA   . LEU A 1 52 ? 7.844   -3.620  1.089   1.00 0.00 ? 52 LEU A CA   3  
ATOM 2517  C C    . LEU A 1 52 ? 8.233   -5.096  1.187   1.00 0.00 ? 52 LEU A C    3  
ATOM 2518  O O    . LEU A 1 52 ? 7.738   -5.816  2.052   1.00 0.00 ? 52 LEU A O    3  
ATOM 2519  C CB   . LEU A 1 52 ? 8.489   -2.741  2.163   1.00 0.00 ? 52 LEU A CB   3  
ATOM 2520  C CG   . LEU A 1 52 ? 9.935   -3.084  2.530   1.00 0.00 ? 52 LEU A CG   3  
ATOM 2521  C CD1  . LEU A 1 52 ? 10.593  -1.935  3.297   1.00 0.00 ? 52 LEU A CD1  3  
ATOM 2522  C CD2  . LEU A 1 52 ? 10.007  -4.403  3.301   1.00 0.00 ? 52 LEU A CD2  3  
ATOM 2523  H H    . LEU A 1 52 ? 6.054   -2.706  1.639   1.00 0.00 ? 52 LEU A H    3  
ATOM 2524  H HA   . LEU A 1 52 ? 8.171   -3.239  0.122   1.00 0.00 ? 52 LEU A HA   3  
ATOM 2525  H HB2  . LEU A 1 52 ? 8.457   -1.705  1.824   1.00 0.00 ? 52 LEU A HB2  3  
ATOM 2526  H HB3  . LEU A 1 52 ? 7.882   -2.800  3.066   1.00 0.00 ? 52 LEU A HB3  3  
ATOM 2527  H HG   . LEU A 1 52 ? 10.499  -3.219  1.607   1.00 0.00 ? 52 LEU A HG   3  
ATOM 2528  H HD11 . LEU A 1 52 ? 9.825   -1.344  3.796   1.00 0.00 ? 52 LEU A HD11 3  
ATOM 2529  H HD12 . LEU A 1 52 ? 11.279  -2.340  4.040   1.00 0.00 ? 52 LEU A HD12 3  
ATOM 2530  H HD13 . LEU A 1 52 ? 11.143  -1.302  2.601   1.00 0.00 ? 52 LEU A HD13 3  
ATOM 2531  H HD21 . LEU A 1 52 ? 8.997   -4.765  3.497   1.00 0.00 ? 52 LEU A HD21 3  
ATOM 2532  H HD22 . LEU A 1 52 ? 10.548  -5.141  2.709   1.00 0.00 ? 52 LEU A HD22 3  
ATOM 2533  H HD23 . LEU A 1 52 ? 10.525  -4.244  4.246   1.00 0.00 ? 52 LEU A HD23 3  
ATOM 2534  N N    . GLN A 1 53 ? 9.117   -5.502  0.287   1.00 0.00 ? 53 GLN A N    3  
ATOM 2535  C CA   . GLN A 1 53 ? 9.579   -6.880  0.261   1.00 0.00 ? 53 GLN A CA   3  
ATOM 2536  C C    . GLN A 1 53 ? 10.387  -7.193  1.522   1.00 0.00 ? 53 GLN A C    3  
ATOM 2537  O O    . GLN A 1 53 ? 11.608  -7.330  1.464   1.00 0.00 ? 53 GLN A O    3  
ATOM 2538  C CB   . GLN A 1 53 ? 10.400  -7.159  -0.999  1.00 0.00 ? 53 GLN A CB   3  
ATOM 2539  C CG   . GLN A 1 53 ? 11.634  -6.256  -1.061  1.00 0.00 ? 53 GLN A CG   3  
ATOM 2540  C CD   . GLN A 1 53 ? 11.500  -5.221  -2.180  1.00 0.00 ? 53 GLN A CD   3  
ATOM 2541  O OE1  . GLN A 1 53 ? 11.598  -5.525  -3.357  1.00 0.00 ? 53 GLN A OE1  3  
ATOM 2542  N NE2  . GLN A 1 53 ? 11.272  -3.984  -1.748  1.00 0.00 ? 53 GLN A NE2  3  
ATOM 2543  H H    . GLN A 1 53 ? 9.515   -4.910  -0.413  1.00 0.00 ? 53 GLN A H    3  
ATOM 2544  H HA   . GLN A 1 53 ? 8.675   -7.488  0.240   1.00 0.00 ? 53 GLN A HA   3  
ATOM 2545  H HB2  . GLN A 1 53 ? 10.709  -8.204  -1.012  1.00 0.00 ? 53 GLN A HB2  3  
ATOM 2546  H HB3  . GLN A 1 53 ? 9.783   -6.998  -1.883  1.00 0.00 ? 53 GLN A HB3  3  
ATOM 2547  H HG2  . GLN A 1 53 ? 11.766  -5.749  -0.105  1.00 0.00 ? 53 GLN A HG2  3  
ATOM 2548  H HG3  . GLN A 1 53 ? 12.525  -6.862  -1.226  1.00 0.00 ? 53 GLN A HG3  3  
ATOM 2549  H HE21 . GLN A 1 53 ? 11.203  -3.802  -0.767  1.00 0.00 ? 53 GLN A HE21 3  
ATOM 2550  H HE22 . GLN A 1 53 ? 11.170  -3.236  -2.404  1.00 0.00 ? 53 GLN A HE22 3  
ATOM 2551  N N    . GLU A 1 54 ? 9.672   -7.297  2.633   1.00 0.00 ? 54 GLU A N    3  
ATOM 2552  C CA   . GLU A 1 54 ? 10.307  -7.591  3.907   1.00 0.00 ? 54 GLU A CA   3  
ATOM 2553  C C    . GLU A 1 54 ? 11.292  -8.752  3.753   1.00 0.00 ? 54 GLU A C    3  
ATOM 2554  O O    . GLU A 1 54 ? 10.885  -9.889  3.517   1.00 0.00 ? 54 GLU A O    3  
ATOM 2555  C CB   . GLU A 1 54 ? 9.263   -7.897  4.983   1.00 0.00 ? 54 GLU A CB   3  
ATOM 2556  C CG   . GLU A 1 54 ? 8.707   -9.313  4.820   1.00 0.00 ? 54 GLU A CG   3  
ATOM 2557  C CD   . GLU A 1 54 ? 9.502   -10.314 5.662   1.00 0.00 ? 54 GLU A CD   3  
ATOM 2558  O OE1  . GLU A 1 54 ? 10.676  -10.003 5.956   1.00 0.00 ? 54 GLU A OE1  3  
ATOM 2559  O OE2  . GLU A 1 54 ? 8.916   -11.368 5.992   1.00 0.00 ? 54 GLU A OE2  3  
ATOM 2560  H H    . GLU A 1 54 ? 8.679   -7.184  2.673   1.00 0.00 ? 54 GLU A H    3  
ATOM 2561  H HA   . GLU A 1 54 ? 10.845  -6.683  4.179   1.00 0.00 ? 54 GLU A HA   3  
ATOM 2562  H HB2  . GLU A 1 54 ? 9.711   -7.790  5.970   1.00 0.00 ? 54 GLU A HB2  3  
ATOM 2563  H HB3  . GLU A 1 54 ? 8.450   -7.174  4.921   1.00 0.00 ? 54 GLU A HB3  3  
ATOM 2564  H HG2  . GLU A 1 54 ? 7.659   -9.333  5.119   1.00 0.00 ? 54 GLU A HG2  3  
ATOM 2565  H HG3  . GLU A 1 54 ? 8.745   -9.605  3.770   1.00 0.00 ? 54 GLU A HG3  3  
ATOM 2566  N N    . ALA A 1 55 ? 12.569  -8.426  3.892   1.00 0.00 ? 55 ALA A N    3  
ATOM 2567  C CA   . ALA A 1 55 ? 13.615  -9.427  3.771   1.00 0.00 ? 55 ALA A CA   3  
ATOM 2568  C C    . ALA A 1 55 ? 14.670  -9.188  4.853   1.00 0.00 ? 55 ALA A C    3  
ATOM 2569  O O    . ALA A 1 55 ? 15.264  -8.113  4.920   1.00 0.00 ? 55 ALA A O    3  
ATOM 2570  C CB   . ALA A 1 55 ? 14.205  -9.382  2.361   1.00 0.00 ? 55 ALA A CB   3  
ATOM 2571  H H    . ALA A 1 55 ? 12.891  -7.499  4.084   1.00 0.00 ? 55 ALA A H    3  
ATOM 2572  H HA   . ALA A 1 55 ? 13.159  -10.404 3.930   1.00 0.00 ? 55 ALA A HA   3  
ATOM 2573  H HB1  . ALA A 1 55 ? 13.712  -10.127 1.736   1.00 0.00 ? 55 ALA A HB1  3  
ATOM 2574  H HB2  . ALA A 1 55 ? 15.273  -9.595  2.406   1.00 0.00 ? 55 ALA A HB2  3  
ATOM 2575  H HB3  . ALA A 1 55 ? 14.051  -8.391  1.934   1.00 0.00 ? 55 ALA A HB3  3  
ATOM 2576  N N    . GLU A 1 56 ? 14.873  -10.209 5.673   1.00 0.00 ? 56 GLU A N    3  
ATOM 2577  C CA   . GLU A 1 56 ? 15.846  -10.124 6.748   1.00 0.00 ? 56 GLU A CA   3  
ATOM 2578  C C    . GLU A 1 56 ? 15.382  -9.122  7.807   1.00 0.00 ? 56 GLU A C    3  
ATOM 2579  O O    . GLU A 1 56 ? 15.058  -9.506  8.930   1.00 0.00 ? 56 GLU A O    3  
ATOM 2580  C CB   . GLU A 1 56 ? 17.228  -9.749  6.208   1.00 0.00 ? 56 GLU A CB   3  
ATOM 2581  C CG   . GLU A 1 56 ? 18.336  -10.420 7.023   1.00 0.00 ? 56 GLU A CG   3  
ATOM 2582  C CD   . GLU A 1 56 ? 18.914  -11.624 6.275   1.00 0.00 ? 56 GLU A CD   3  
ATOM 2583  O OE1  . GLU A 1 56 ? 19.675  -11.382 5.313   1.00 0.00 ? 56 GLU A OE1  3  
ATOM 2584  O OE2  . GLU A 1 56 ? 18.582  -12.758 6.682   1.00 0.00 ? 56 GLU A OE2  3  
ATOM 2585  H H    . GLU A 1 56 ? 14.386  -11.081 5.612   1.00 0.00 ? 56 GLU A H    3  
ATOM 2586  H HA   . GLU A 1 56 ? 15.891  -11.124 7.179   1.00 0.00 ? 56 GLU A HA   3  
ATOM 2587  H HB2  . GLU A 1 56 ? 17.308  -10.049 5.163   1.00 0.00 ? 56 GLU A HB2  3  
ATOM 2588  H HB3  . GLU A 1 56 ? 17.354  -8.667  6.239   1.00 0.00 ? 56 GLU A HB3  3  
ATOM 2589  H HG2  . GLU A 1 56 ? 19.128  -9.701  7.228   1.00 0.00 ? 56 GLU A HG2  3  
ATOM 2590  H HG3  . GLU A 1 56 ? 17.940  -10.742 7.986   1.00 0.00 ? 56 GLU A HG3  3  
ATOM 2591  N N    . CYS A 1 57 ? 15.363  -7.858  7.412   1.00 0.00 ? 57 CYS A N    3  
ATOM 2592  C CA   . CYS A 1 57 ? 14.943  -6.798  8.313   1.00 0.00 ? 57 CYS A CA   3  
ATOM 2593  C C    . CYS A 1 57 ? 14.263  -5.705  7.486   1.00 0.00 ? 57 CYS A C    3  
ATOM 2594  O O    . CYS A 1 57 ? 13.073  -5.443  7.656   1.00 0.00 ? 57 CYS A O    3  
ATOM 2595  C CB   . CYS A 1 57 ? 16.117  -6.250  9.128   1.00 0.00 ? 57 CYS A CB   3  
ATOM 2596  S SG   . CYS A 1 57 ? 15.641  -5.337  10.640  1.00 0.00 ? 57 CYS A SG   3  
ATOM 2597  H H    . CYS A 1 57 ? 15.628  -7.554  6.497   1.00 0.00 ? 57 CYS A H    3  
ATOM 2598  H HA   . CYS A 1 57 ? 14.241  -7.245  9.016   1.00 0.00 ? 57 CYS A HA   3  
ATOM 2599  H HB2  . CYS A 1 57 ? 16.764  -7.080  9.410   1.00 0.00 ? 57 CYS A HB2  3  
ATOM 2600  H HB3  . CYS A 1 57 ? 16.705  -5.589  8.491   1.00 0.00 ? 57 CYS A HB3  3  
ATOM 2601  N N    . THR A 1 58 ? 15.047  -5.098  6.608   1.00 0.00 ? 58 THR A N    3  
ATOM 2602  C CA   . THR A 1 58 ? 14.535  -4.039  5.754   1.00 0.00 ? 58 THR A CA   3  
ATOM 2603  C C    . THR A 1 58 ? 15.134  -4.151  4.350   1.00 0.00 ? 58 THR A C    3  
ATOM 2604  O O    . THR A 1 58 ? 14.415  -4.059  3.356   1.00 0.00 ? 58 THR A O    3  
ATOM 2605  C CB   . THR A 1 58 ? 14.827  -2.700  6.434   1.00 0.00 ? 58 THR A CB   3  
ATOM 2606  O OG1  . THR A 1 58 ? 14.541  -1.731  5.429   1.00 0.00 ? 58 THR A OG1  3  
ATOM 2607  C CG2  . THR A 1 58 ? 16.316  -2.505  6.728   1.00 0.00 ? 58 THR A CG2  3  
ATOM 2608  H H    . THR A 1 58 ? 16.014  -5.317  6.475   1.00 0.00 ? 58 THR A H    3  
ATOM 2609  H HA   . THR A 1 58 ? 13.458  -4.170  5.653   1.00 0.00 ? 58 THR A HA   3  
ATOM 2610  H HB   . THR A 1 58 ? 14.232  -2.587  7.341   1.00 0.00 ? 58 THR A HB   3  
ATOM 2611  H HG1  . THR A 1 58 ? 13.553  -1.638  5.315   1.00 0.00 ? 58 THR A HG1  3  
ATOM 2612  H HG21 . THR A 1 58 ? 16.692  -3.364  7.283   1.00 0.00 ? 58 THR A HG21 3  
ATOM 2613  H HG22 . THR A 1 58 ? 16.862  -2.411  5.790   1.00 0.00 ? 58 THR A HG22 3  
ATOM 2614  H HG23 . THR A 1 58 ? 16.453  -1.601  7.321   1.00 0.00 ? 58 THR A HG23 3  
ATOM 2615  N N    . PHE A 1 59 ? 16.443  -4.347  4.313   1.00 0.00 ? 59 PHE A N    3  
ATOM 2616  C CA   . PHE A 1 59 ? 17.146  -4.472  3.048   1.00 0.00 ? 59 PHE A CA   3  
ATOM 2617  C C    . PHE A 1 59 ? 18.374  -5.375  3.189   1.00 0.00 ? 59 PHE A C    3  
ATOM 2618  O O    . PHE A 1 59 ? 18.929  -5.507  4.278   1.00 0.00 ? 59 PHE A O    3  
ATOM 2619  C CB   . PHE A 1 59 ? 17.605  -3.067  2.650   1.00 0.00 ? 59 PHE A CB   3  
ATOM 2620  C CG   . PHE A 1 59 ? 18.125  -2.965  1.215   1.00 0.00 ? 59 PHE A CG   3  
ATOM 2621  C CD1  . PHE A 1 59 ? 17.286  -3.196  0.170   1.00 0.00 ? 59 PHE A CD1  3  
ATOM 2622  C CD2  . PHE A 1 59 ? 19.426  -2.644  0.984   1.00 0.00 ? 59 PHE A CD2  3  
ATOM 2623  C CE1  . PHE A 1 59 ? 17.768  -3.101  -1.162  1.00 0.00 ? 59 PHE A CE1  3  
ATOM 2624  C CE2  . PHE A 1 59 ? 19.908  -2.549  -0.348  1.00 0.00 ? 59 PHE A CE2  3  
ATOM 2625  C CZ   . PHE A 1 59 ? 19.069  -2.780  -1.393  1.00 0.00 ? 59 PHE A CZ   3  
ATOM 2626  H H    . PHE A 1 59 ? 17.021  -4.420  5.127   1.00 0.00 ? 59 PHE A H    3  
ATOM 2627  H HA   . PHE A 1 59 ? 16.452  -4.915  2.334   1.00 0.00 ? 59 PHE A HA   3  
ATOM 2628  H HB2  . PHE A 1 59 ? 16.771  -2.375  2.774   1.00 0.00 ? 59 PHE A HB2  3  
ATOM 2629  H HB3  . PHE A 1 59 ? 18.390  -2.745  3.334   1.00 0.00 ? 59 PHE A HB3  3  
ATOM 2630  H HD1  . PHE A 1 59 ? 16.243  -3.453  0.355   1.00 0.00 ? 59 PHE A HD1  3  
ATOM 2631  H HD2  . PHE A 1 59 ? 20.098  -2.459  1.822   1.00 0.00 ? 59 PHE A HD2  3  
ATOM 2632  H HE1  . PHE A 1 59 ? 17.096  -3.286  -2.000  1.00 0.00 ? 59 PHE A HE1  3  
ATOM 2633  H HE2  . PHE A 1 59 ? 20.951  -2.292  -0.533  1.00 0.00 ? 59 PHE A HE2  3  
ATOM 2634  H HZ   . PHE A 1 59 ? 19.440  -2.707  -2.416  1.00 0.00 ? 59 PHE A HZ   3  
ATOM 2635  N N    . GLU A 1 1  ? 6.244   -13.638 13.212  1.00 0.00 ? 1  GLU A N    4  
ATOM 2636  C CA   . GLU A 1 1  ? 6.518   -13.860 14.622  1.00 0.00 ? 1  GLU A CA   4  
ATOM 2637  C C    . GLU A 1 1  ? 5.645   -12.945 15.483  1.00 0.00 ? 1  GLU A C    4  
ATOM 2638  O O    . GLU A 1 1  ? 4.753   -13.415 16.188  1.00 0.00 ? 1  GLU A O    4  
ATOM 2639  C CB   . GLU A 1 1  ? 8.002   -13.653 14.932  1.00 0.00 ? 1  GLU A CB   4  
ATOM 2640  C CG   . GLU A 1 1  ? 8.459   -14.575 16.064  1.00 0.00 ? 1  GLU A CG   4  
ATOM 2641  C CD   . GLU A 1 1  ? 9.936   -14.348 16.394  1.00 0.00 ? 1  GLU A CD   4  
ATOM 2642  O OE1  . GLU A 1 1  ? 10.757  -14.520 15.468  1.00 0.00 ? 1  GLU A OE1  4  
ATOM 2643  O OE2  . GLU A 1 1  ? 10.210  -14.007 17.565  1.00 0.00 ? 1  GLU A OE2  4  
ATOM 2644  H H    . GLU A 1 1  ? 6.888   -14.073 12.583  1.00 0.00 ? 1  GLU A H    4  
ATOM 2645  H HA   . GLU A 1 1  ? 6.256   -14.902 14.806  1.00 0.00 ? 1  GLU A HA   4  
ATOM 2646  H HB2  . GLU A 1 1  ? 8.594   -13.848 14.038  1.00 0.00 ? 1  GLU A HB2  4  
ATOM 2647  H HB3  . GLU A 1 1  ? 8.177   -12.614 15.211  1.00 0.00 ? 1  GLU A HB3  4  
ATOM 2648  H HG2  . GLU A 1 1  ? 7.853   -14.395 16.952  1.00 0.00 ? 1  GLU A HG2  4  
ATOM 2649  H HG3  . GLU A 1 1  ? 8.303   -15.615 15.777  1.00 0.00 ? 1  GLU A HG3  4  
ATOM 2650  N N    . GLU A 1 2  ? 5.932   -11.655 15.397  1.00 0.00 ? 2  GLU A N    4  
ATOM 2651  C CA   . GLU A 1 2  ? 5.184   -10.669 16.160  1.00 0.00 ? 2  GLU A CA   4  
ATOM 2652  C C    . GLU A 1 2  ? 4.872   -9.450  15.290  1.00 0.00 ? 2  GLU A C    4  
ATOM 2653  O O    . GLU A 1 2  ? 5.116   -8.315  15.696  1.00 0.00 ? 2  GLU A O    4  
ATOM 2654  C CB   . GLU A 1 2  ? 5.944   -10.262 17.423  1.00 0.00 ? 2  GLU A CB   4  
ATOM 2655  C CG   . GLU A 1 2  ? 5.022   -10.268 18.644  1.00 0.00 ? 2  GLU A CG   4  
ATOM 2656  C CD   . GLU A 1 2  ? 4.658   -8.842  19.064  1.00 0.00 ? 2  GLU A CD   4  
ATOM 2657  O OE1  . GLU A 1 2  ? 4.076   -8.132  18.216  1.00 0.00 ? 2  GLU A OE1  4  
ATOM 2658  O OE2  . GLU A 1 2  ? 4.971   -8.495  20.223  1.00 0.00 ? 2  GLU A OE2  4  
ATOM 2659  H H    . GLU A 1 2  ? 6.659   -11.280 14.821  1.00 0.00 ? 2  GLU A H    4  
ATOM 2660  H HA   . GLU A 1 2  ? 4.257   -11.167 16.445  1.00 0.00 ? 2  GLU A HA   4  
ATOM 2661  H HB2  . GLU A 1 2  ? 6.776   -10.947 17.588  1.00 0.00 ? 2  GLU A HB2  4  
ATOM 2662  H HB3  . GLU A 1 2  ? 6.371   -9.268  17.291  1.00 0.00 ? 2  GLU A HB3  4  
ATOM 2663  H HG2  . GLU A 1 2  ? 4.114   -10.826 18.416  1.00 0.00 ? 2  GLU A HG2  4  
ATOM 2664  H HG3  . GLU A 1 2  ? 5.512   -10.781 19.472  1.00 0.00 ? 2  GLU A HG3  4  
ATOM 2665  N N    . TYR A 1 3  ? 4.338   -9.726  14.110  1.00 0.00 ? 3  TYR A N    4  
ATOM 2666  C CA   . TYR A 1 3  ? 3.990   -8.666  13.179  1.00 0.00 ? 3  TYR A CA   4  
ATOM 2667  C C    . TYR A 1 3  ? 3.185   -9.214  11.999  1.00 0.00 ? 3  TYR A C    4  
ATOM 2668  O O    . TYR A 1 3  ? 3.709   -9.970  11.183  1.00 0.00 ? 3  TYR A O    4  
ATOM 2669  C CB   . TYR A 1 3  ? 5.317   -8.108  12.661  1.00 0.00 ? 3  TYR A CB   4  
ATOM 2670  C CG   . TYR A 1 3  ? 5.316   -7.788  11.165  1.00 0.00 ? 3  TYR A CG   4  
ATOM 2671  C CD1  . TYR A 1 3  ? 4.264   -7.088  10.610  1.00 0.00 ? 3  TYR A CD1  4  
ATOM 2672  C CD2  . TYR A 1 3  ? 6.366   -8.200  10.370  1.00 0.00 ? 3  TYR A CD2  4  
ATOM 2673  C CE1  . TYR A 1 3  ? 4.262   -6.787  9.201   1.00 0.00 ? 3  TYR A CE1  4  
ATOM 2674  C CE2  . TYR A 1 3  ? 6.365   -7.899  8.962   1.00 0.00 ? 3  TYR A CE2  4  
ATOM 2675  C CZ   . TYR A 1 3  ? 5.313   -7.207  8.447   1.00 0.00 ? 3  TYR A CZ   4  
ATOM 2676  O OH   . TYR A 1 3  ? 5.312   -6.923  7.117   1.00 0.00 ? 3  TYR A OH   4  
ATOM 2677  H H    . TYR A 1 3  ? 4.142   -10.652 13.787  1.00 0.00 ? 3  TYR A H    4  
ATOM 2678  H HA   . TYR A 1 3  ? 3.385   -7.934  13.714  1.00 0.00 ? 3  TYR A HA   4  
ATOM 2679  H HB2  . TYR A 1 3  ? 5.560   -7.201  13.215  1.00 0.00 ? 3  TYR A HB2  4  
ATOM 2680  H HB3  . TYR A 1 3  ? 6.108   -8.829  12.867  1.00 0.00 ? 3  TYR A HB3  4  
ATOM 2681  H HD1  . TYR A 1 3  ? 3.434   -6.762  11.237  1.00 0.00 ? 3  TYR A HD1  4  
ATOM 2682  H HD2  . TYR A 1 3  ? 7.197   -8.753  10.808  1.00 0.00 ? 3  TYR A HD2  4  
ATOM 2683  H HE1  . TYR A 1 3  ? 3.438   -6.234  8.750   1.00 0.00 ? 3  TYR A HE1  4  
ATOM 2684  H HE2  . TYR A 1 3  ? 7.188   -8.218  8.322   1.00 0.00 ? 3  TYR A HE2  4  
ATOM 2685  H HH   . TYR A 1 3  ? 5.810   -6.072  6.948   1.00 0.00 ? 3  TYR A HH   4  
ATOM 2686  N N    . VAL A 1 4  ? 1.924   -8.810  11.946  1.00 0.00 ? 4  VAL A N    4  
ATOM 2687  C CA   . VAL A 1 4  ? 1.042   -9.251  10.879  1.00 0.00 ? 4  VAL A CA   4  
ATOM 2688  C C    . VAL A 1 4  ? -0.346  -8.642  11.087  1.00 0.00 ? 4  VAL A C    4  
ATOM 2689  O O    . VAL A 1 4  ? -1.116  -9.113  11.922  1.00 0.00 ? 4  VAL A O    4  
ATOM 2690  C CB   . VAL A 1 4  ? 1.020   -10.780 10.816  1.00 0.00 ? 4  VAL A CB   4  
ATOM 2691  C CG1  . VAL A 1 4  ? 0.790   -11.382 12.203  1.00 0.00 ? 4  VAL A CG1  4  
ATOM 2692  C CG2  . VAL A 1 4  ? -0.033  -11.273 9.822   1.00 0.00 ? 4  VAL A CG2  4  
ATOM 2693  H H    . VAL A 1 4  ? 1.506   -8.194  12.613  1.00 0.00 ? 4  VAL A H    4  
ATOM 2694  H HA   . VAL A 1 4  ? 1.451   -8.880  9.939   1.00 0.00 ? 4  VAL A HA   4  
ATOM 2695  H HB   . VAL A 1 4  ? 1.996   -11.114 10.463  1.00 0.00 ? 4  VAL A HB   4  
ATOM 2696  H HG11 . VAL A 1 4  ? 1.238   -10.737 12.959  1.00 0.00 ? 4  VAL A HG11 4  
ATOM 2697  H HG12 . VAL A 1 4  ? -0.280  -11.470 12.388  1.00 0.00 ? 4  VAL A HG12 4  
ATOM 2698  H HG13 . VAL A 1 4  ? 1.249   -12.370 12.251  1.00 0.00 ? 4  VAL A HG13 4  
ATOM 2699  H HG21 . VAL A 1 4  ? -0.051  -10.613 8.954   1.00 0.00 ? 4  VAL A HG21 4  
ATOM 2700  H HG22 . VAL A 1 4  ? 0.213   -12.286 9.504   1.00 0.00 ? 4  VAL A HG22 4  
ATOM 2701  H HG23 . VAL A 1 4  ? -1.013  -11.270 10.300  1.00 0.00 ? 4  VAL A HG23 4  
ATOM 2702  N N    . GLY A 1 5  ? -0.624  -7.603  10.312  1.00 0.00 ? 5  GLY A N    4  
ATOM 2703  C CA   . GLY A 1 5  ? -1.905  -6.925  10.400  1.00 0.00 ? 5  GLY A CA   4  
ATOM 2704  C C    . GLY A 1 5  ? -1.758  -5.433  10.096  1.00 0.00 ? 5  GLY A C    4  
ATOM 2705  O O    . GLY A 1 5  ? -1.713  -5.034  8.934   1.00 0.00 ? 5  GLY A O    4  
ATOM 2706  H H    . GLY A 1 5  ? 0.008   -7.227  9.635   1.00 0.00 ? 5  GLY A H    4  
ATOM 2707  H HA2  . GLY A 1 5  ? -2.608  -7.375  9.699   1.00 0.00 ? 5  GLY A HA2  4  
ATOM 2708  H HA3  . GLY A 1 5  ? -2.323  -7.057  11.398  1.00 0.00 ? 5  GLY A HA3  4  
ATOM 2709  N N    . LEU A 1 6  ? -1.686  -4.649  11.162  1.00 0.00 ? 6  LEU A N    4  
ATOM 2710  C CA   . LEU A 1 6  ? -1.545  -3.209  11.024  1.00 0.00 ? 6  LEU A CA   4  
ATOM 2711  C C    . LEU A 1 6  ? -0.586  -2.904  9.872   1.00 0.00 ? 6  LEU A C    4  
ATOM 2712  O O    . LEU A 1 6  ? 0.340   -3.670  9.610   1.00 0.00 ? 6  LEU A O    4  
ATOM 2713  C CB   . LEU A 1 6  ? -1.126  -2.582  12.355  1.00 0.00 ? 6  LEU A CB   4  
ATOM 2714  C CG   . LEU A 1 6  ? 0.349   -2.729  12.731  1.00 0.00 ? 6  LEU A CG   4  
ATOM 2715  C CD1  . LEU A 1 6  ? 1.197   -1.645  12.062  1.00 0.00 ? 6  LEU A CD1  4  
ATOM 2716  C CD2  . LEU A 1 6  ? 0.530   -2.741  14.251  1.00 0.00 ? 6  LEU A CD2  4  
ATOM 2717  H H    . LEU A 1 6  ? -1.723  -4.981  12.104  1.00 0.00 ? 6  LEU A H    4  
ATOM 2718  H HA   . LEU A 1 6  ? -2.526  -2.807  10.773  1.00 0.00 ? 6  LEU A HA   4  
ATOM 2719  H HB2  . LEU A 1 6  ? -1.369  -1.520  12.326  1.00 0.00 ? 6  LEU A HB2  4  
ATOM 2720  H HB3  . LEU A 1 6  ? -1.729  -3.025  13.148  1.00 0.00 ? 6  LEU A HB3  4  
ATOM 2721  H HG   . LEU A 1 6  ? 0.703   -3.690  12.358  1.00 0.00 ? 6  LEU A HG   4  
ATOM 2722  H HD11 . LEU A 1 6  ? 0.544   -0.866  11.667  1.00 0.00 ? 6  LEU A HD11 4  
ATOM 2723  H HD12 . LEU A 1 6  ? 1.877   -1.211  12.796  1.00 0.00 ? 6  LEU A HD12 4  
ATOM 2724  H HD13 . LEU A 1 6  ? 1.772   -2.084  11.248  1.00 0.00 ? 6  LEU A HD13 4  
ATOM 2725  H HD21 . LEU A 1 6  ? -0.311  -2.230  14.720  1.00 0.00 ? 6  LEU A HD21 4  
ATOM 2726  H HD22 . LEU A 1 6  ? 0.571   -3.772  14.603  1.00 0.00 ? 6  LEU A HD22 4  
ATOM 2727  H HD23 . LEU A 1 6  ? 1.457   -2.231  14.511  1.00 0.00 ? 6  LEU A HD23 4  
ATOM 2728  N N    . SER A 1 7  ? -0.841  -1.782  9.213   1.00 0.00 ? 7  SER A N    4  
ATOM 2729  C CA   . SER A 1 7  ? -0.012  -1.366  8.095   1.00 0.00 ? 7  SER A CA   4  
ATOM 2730  C C    . SER A 1 7  ? 1.142   -0.495  8.595   1.00 0.00 ? 7  SER A C    4  
ATOM 2731  O O    . SER A 1 7  ? 0.942   0.393   9.421   1.00 0.00 ? 7  SER A O    4  
ATOM 2732  C CB   . SER A 1 7  ? -0.835  -0.608  7.052   1.00 0.00 ? 7  SER A CB   4  
ATOM 2733  O OG   . SER A 1 7  ? -1.830  0.217   7.652   1.00 0.00 ? 7  SER A OG   4  
ATOM 2734  H H    . SER A 1 7  ? -1.597  -1.165  9.433   1.00 0.00 ? 7  SER A H    4  
ATOM 2735  H HA   . SER A 1 7  ? 0.367   -2.289  7.657   1.00 0.00 ? 7  SER A HA   4  
ATOM 2736  H HB2  . SER A 1 7  ? -0.172  0.008   6.444   1.00 0.00 ? 7  SER A HB2  4  
ATOM 2737  H HB3  . SER A 1 7  ? -1.313  -1.320  6.379   1.00 0.00 ? 7  SER A HB3  4  
ATOM 2738  H HG   . SER A 1 7  ? -2.731  -0.008  7.282   1.00 0.00 ? 7  SER A HG   4  
ATOM 2739  N N    . ALA A 1 8  ? 2.326   -0.781  8.073   1.00 0.00 ? 8  ALA A N    4  
ATOM 2740  C CA   . ALA A 1 8  ? 3.513   -0.035  8.456   1.00 0.00 ? 8  ALA A CA   4  
ATOM 2741  C C    . ALA A 1 8  ? 4.757   -0.776  7.961   1.00 0.00 ? 8  ALA A C    4  
ATOM 2742  O O    . ALA A 1 8  ? 5.403   -0.342  7.009   1.00 0.00 ? 8  ALA A O    4  
ATOM 2743  C CB   . ALA A 1 8  ? 3.521   0.168   9.973   1.00 0.00 ? 8  ALA A CB   4  
ATOM 2744  H H    . ALA A 1 8  ? 2.481   -1.506  7.402   1.00 0.00 ? 8  ALA A H    4  
ATOM 2745  H HA   . ALA A 1 8  ? 3.463   0.939   7.971   1.00 0.00 ? 8  ALA A HA   4  
ATOM 2746  H HB1  . ALA A 1 8  ? 2.720   -0.419  10.422  1.00 0.00 ? 8  ALA A HB1  4  
ATOM 2747  H HB2  . ALA A 1 8  ? 4.480   -0.155  10.377  1.00 0.00 ? 8  ALA A HB2  4  
ATOM 2748  H HB3  . ALA A 1 8  ? 3.368   1.223   10.198  1.00 0.00 ? 8  ALA A HB3  4  
ATOM 2749  N N    . ASN A 1 9  ? 5.055   -1.880  8.629   1.00 0.00 ? 9  ASN A N    4  
ATOM 2750  C CA   . ASN A 1 9  ? 6.210   -2.684  8.269   1.00 0.00 ? 9  ASN A CA   4  
ATOM 2751  C C    . ASN A 1 9  ? 6.133   -3.042  6.783   1.00 0.00 ? 9  ASN A C    4  
ATOM 2752  O O    . ASN A 1 9  ? 7.151   -3.067  6.094   1.00 0.00 ? 9  ASN A O    4  
ATOM 2753  C CB   . ASN A 1 9  ? 6.244   -3.988  9.068   1.00 0.00 ? 9  ASN A CB   4  
ATOM 2754  C CG   . ASN A 1 9  ? 7.345   -3.952  10.130  1.00 0.00 ? 9  ASN A CG   4  
ATOM 2755  O OD1  . ASN A 1 9  ? 7.674   -2.916  10.685  1.00 0.00 ? 9  ASN A OD1  4  
ATOM 2756  N ND2  . ASN A 1 9  ? 7.895   -5.136  10.381  1.00 0.00 ? 9  ASN A ND2  4  
ATOM 2757  H H    . ASN A 1 9  ? 4.524   -2.226  9.403   1.00 0.00 ? 9  ASN A H    4  
ATOM 2758  H HA   . ASN A 1 9  ? 7.075   -2.065  8.504   1.00 0.00 ? 9  ASN A HA   4  
ATOM 2759  H HB2  . ASN A 1 9  ? 5.278   -4.152  9.546   1.00 0.00 ? 9  ASN A HB2  4  
ATOM 2760  H HB3  . ASN A 1 9  ? 6.412   -4.828  8.394   1.00 0.00 ? 9  ASN A HB3  4  
ATOM 2761  H HD21 . ASN A 1 9  ? 7.578   -5.948  9.890   1.00 0.00 ? 9  ASN A HD21 4  
ATOM 2762  H HD22 . ASN A 1 9  ? 8.624   -5.216  11.060  1.00 0.00 ? 9  ASN A HD22 4  
ATOM 2763  N N    . GLN A 1 10 ? 4.916   -3.311  6.334   1.00 0.00 ? 10 GLN A N    4  
ATOM 2764  C CA   . GLN A 1 10 ? 4.693   -3.667  4.943   1.00 0.00 ? 10 GLN A CA   4  
ATOM 2765  C C    . GLN A 1 10 ? 4.712   -2.414  4.065   1.00 0.00 ? 10 GLN A C    4  
ATOM 2766  O O    . GLN A 1 10 ? 5.150   -2.463  2.917   1.00 0.00 ? 10 GLN A O    4  
ATOM 2767  C CB   . GLN A 1 10 ? 3.379   -4.433  4.777   1.00 0.00 ? 10 GLN A CB   4  
ATOM 2768  C CG   . GLN A 1 10 ? 2.993   -5.148  6.074   1.00 0.00 ? 10 GLN A CG   4  
ATOM 2769  C CD   . GLN A 1 10 ? 1.970   -4.331  6.866   1.00 0.00 ? 10 GLN A CD   4  
ATOM 2770  O OE1  . GLN A 1 10 ? 2.304   -3.554  7.745   1.00 0.00 ? 10 GLN A OE1  4  
ATOM 2771  N NE2  . GLN A 1 10 ? 0.708   -4.550  6.507   1.00 0.00 ? 10 GLN A NE2  4  
ATOM 2772  H H    . GLN A 1 10 ? 4.093   -3.289  6.902   1.00 0.00 ? 10 GLN A H    4  
ATOM 2773  H HA   . GLN A 1 10 ? 5.524   -4.320  4.675   1.00 0.00 ? 10 GLN A HA   4  
ATOM 2774  H HB2  . GLN A 1 10 ? 2.586   -3.743  4.488   1.00 0.00 ? 10 GLN A HB2  4  
ATOM 2775  H HB3  . GLN A 1 10 ? 3.478   -5.161  3.972   1.00 0.00 ? 10 GLN A HB3  4  
ATOM 2776  H HG2  . GLN A 1 10 ? 2.580   -6.130  5.843   1.00 0.00 ? 10 GLN A HG2  4  
ATOM 2777  H HG3  . GLN A 1 10 ? 3.883   -5.311  6.682   1.00 0.00 ? 10 GLN A HG3  4  
ATOM 2778  H HE21 . GLN A 1 10 ? 0.502   -5.202  5.777   1.00 0.00 ? 10 GLN A HE21 4  
ATOM 2779  H HE22 . GLN A 1 10 ? -0.034  -4.063  6.967   1.00 0.00 ? 10 GLN A HE22 4  
ATOM 2780  N N    . CYS A 1 11 ? 4.233   -1.321  4.640   1.00 0.00 ? 11 CYS A N    4  
ATOM 2781  C CA   . CYS A 1 11 ? 4.189   -0.057  3.924   1.00 0.00 ? 11 CYS A CA   4  
ATOM 2782  C C    . CYS A 1 11 ? 5.259   0.865   4.511   1.00 0.00 ? 11 CYS A C    4  
ATOM 2783  O O    . CYS A 1 11 ? 5.018   2.055   4.710   1.00 0.00 ? 11 CYS A O    4  
ATOM 2784  C CB   . CYS A 1 11 ? 2.798   0.577   3.979   1.00 0.00 ? 11 CYS A CB   4  
ATOM 2785  S SG   . CYS A 1 11 ? 1.443   -0.580  4.399   1.00 0.00 ? 11 CYS A SG   4  
ATOM 2786  H H    . CYS A 1 11 ? 3.879   -1.289  5.574   1.00 0.00 ? 11 CYS A H    4  
ATOM 2787  H HA   . CYS A 1 11 ? 4.403   -0.281  2.879   1.00 0.00 ? 11 CYS A HA   4  
ATOM 2788  H HB2  . CYS A 1 11 ? 2.809   1.382   4.713   1.00 0.00 ? 11 CYS A HB2  4  
ATOM 2789  H HB3  . CYS A 1 11 ? 2.582   1.030   3.011   1.00 0.00 ? 11 CYS A HB3  4  
ATOM 2790  N N    . ALA A 1 12 ? 6.420   0.281   4.773   1.00 0.00 ? 12 ALA A N    4  
ATOM 2791  C CA   . ALA A 1 12 ? 7.528   1.035   5.333   1.00 0.00 ? 12 ALA A CA   4  
ATOM 2792  C C    . ALA A 1 12 ? 8.509   1.398   4.217   1.00 0.00 ? 12 ALA A C    4  
ATOM 2793  O O    . ALA A 1 12 ? 9.722   1.377   4.420   1.00 0.00 ? 12 ALA A O    4  
ATOM 2794  C CB   . ALA A 1 12 ? 8.188   0.220   6.447   1.00 0.00 ? 12 ALA A CB   4  
ATOM 2795  H H    . ALA A 1 12 ? 6.608   -0.687  4.608   1.00 0.00 ? 12 ALA A H    4  
ATOM 2796  H HA   . ALA A 1 12 ? 7.122   1.952   5.762   1.00 0.00 ? 12 ALA A HA   4  
ATOM 2797  H HB1  . ALA A 1 12 ? 9.187   0.611   6.640   1.00 0.00 ? 12 ALA A HB1  4  
ATOM 2798  H HB2  . ALA A 1 12 ? 7.589   0.293   7.355   1.00 0.00 ? 12 ALA A HB2  4  
ATOM 2799  H HB3  . ALA A 1 12 ? 8.259   -0.823  6.141   1.00 0.00 ? 12 ALA A HB3  4  
ATOM 2800  N N    . VAL A 1 13 ? 7.947   1.723   3.062   1.00 0.00 ? 13 VAL A N    4  
ATOM 2801  C CA   . VAL A 1 13 ? 8.756   2.090   1.912   1.00 0.00 ? 13 VAL A CA   4  
ATOM 2802  C C    . VAL A 1 13 ? 8.945   3.609   1.891   1.00 0.00 ? 13 VAL A C    4  
ATOM 2803  O O    . VAL A 1 13 ? 8.094   4.350   2.381   1.00 0.00 ? 13 VAL A O    4  
ATOM 2804  C CB   . VAL A 1 13 ? 8.122   1.548   0.630   1.00 0.00 ? 13 VAL A CB   4  
ATOM 2805  C CG1  . VAL A 1 13 ? 9.175   0.903   -0.273  1.00 0.00 ? 13 VAL A CG1  4  
ATOM 2806  C CG2  . VAL A 1 13 ? 6.996   0.562   0.950   1.00 0.00 ? 13 VAL A CG2  4  
ATOM 2807  H H    . VAL A 1 13 ? 6.959   1.738   2.905   1.00 0.00 ? 13 VAL A H    4  
ATOM 2808  H HA   . VAL A 1 13 ? 9.731   1.618   2.032   1.00 0.00 ? 13 VAL A HA   4  
ATOM 2809  H HB   . VAL A 1 13 ? 7.687   2.389   0.090   1.00 0.00 ? 13 VAL A HB   4  
ATOM 2810  H HG11 . VAL A 1 13 ? 10.085  0.725   0.300   1.00 0.00 ? 13 VAL A HG11 4  
ATOM 2811  H HG12 . VAL A 1 13 ? 8.795   -0.044  -0.655  1.00 0.00 ? 13 VAL A HG12 4  
ATOM 2812  H HG13 . VAL A 1 13 ? 9.396   1.570   -1.107  1.00 0.00 ? 13 VAL A HG13 4  
ATOM 2813  H HG21 . VAL A 1 13 ? 7.297   -0.076  1.780   1.00 0.00 ? 13 VAL A HG21 4  
ATOM 2814  H HG22 . VAL A 1 13 ? 6.097   1.114   1.224   1.00 0.00 ? 13 VAL A HG22 4  
ATOM 2815  H HG23 . VAL A 1 13 ? 6.792   -0.053  0.073   1.00 0.00 ? 13 VAL A HG23 4  
ATOM 2816  N N    . PRO A 1 14 ? 10.093  4.037   1.302   1.00 0.00 ? 14 PRO A N    4  
ATOM 2817  C CA   . PRO A 1 14 ? 10.404  5.454   1.210   1.00 0.00 ? 14 PRO A CA   4  
ATOM 2818  C C    . PRO A 1 14 ? 9.556   6.132   0.131   1.00 0.00 ? 14 PRO A C    4  
ATOM 2819  O O    . PRO A 1 14 ? 8.826   7.079   0.415   1.00 0.00 ? 14 PRO A O    4  
ATOM 2820  C CB   . PRO A 1 14 ? 11.894  5.512   0.918   1.00 0.00 ? 14 PRO A CB   4  
ATOM 2821  C CG   . PRO A 1 14 ? 12.271  4.134   0.399   1.00 0.00 ? 14 PRO A CG   4  
ATOM 2822  C CD   . PRO A 1 14 ? 11.123  3.188   0.710   1.00 0.00 ? 14 PRO A CD   4  
ATOM 2823  H HA   . PRO A 1 14 ? 10.175  5.915   2.067   1.00 0.00 ? 14 PRO A HA   4  
ATOM 2824  H HB2  . PRO A 1 14 ? 12.118  6.282   0.180   1.00 0.00 ? 14 PRO A HB2  4  
ATOM 2825  H HB3  . PRO A 1 14 ? 12.459  5.758   1.818   1.00 0.00 ? 14 PRO A HB3  4  
ATOM 2826  H HG2  . PRO A 1 14 ? 12.457  4.168   -0.675  1.00 0.00 ? 14 PRO A HG2  4  
ATOM 2827  H HG3  . PRO A 1 14 ? 13.190  3.786   0.870   1.00 0.00 ? 14 PRO A HG3  4  
ATOM 2828  H HD2  . PRO A 1 14 ? 10.760  2.695   -0.192  1.00 0.00 ? 14 PRO A HD2  4  
ATOM 2829  H HD3  . PRO A 1 14 ? 11.432  2.402   1.399   1.00 0.00 ? 14 PRO A HD3  4  
ATOM 2830  N N    . ALA A 1 15 ? 9.683   5.619   -1.084  1.00 0.00 ? 15 ALA A N    4  
ATOM 2831  C CA   . ALA A 1 15 ? 8.938   6.163   -2.207  1.00 0.00 ? 15 ALA A CA   4  
ATOM 2832  C C    . ALA A 1 15 ? 9.613   5.741   -3.514  1.00 0.00 ? 15 ALA A C    4  
ATOM 2833  O O    . ALA A 1 15 ? 8.972   5.701   -4.563  1.00 0.00 ? 15 ALA A O    4  
ATOM 2834  C CB   . ALA A 1 15 ? 8.840   7.684   -2.066  1.00 0.00 ? 15 ALA A CB   4  
ATOM 2835  H H    . ALA A 1 15 ? 10.280  4.848   -1.307  1.00 0.00 ? 15 ALA A H    4  
ATOM 2836  H HA   . ALA A 1 15 ? 7.933   5.742   -2.174  1.00 0.00 ? 15 ALA A HA   4  
ATOM 2837  H HB1  . ALA A 1 15 ? 9.605   8.035   -1.374  1.00 0.00 ? 15 ALA A HB1  4  
ATOM 2838  H HB2  . ALA A 1 15 ? 7.855   7.950   -1.684  1.00 0.00 ? 15 ALA A HB2  4  
ATOM 2839  H HB3  . ALA A 1 15 ? 8.990   8.149   -3.040  1.00 0.00 ? 15 ALA A HB3  4  
ATOM 2840  N N    . LYS A 1 16 ? 10.898  5.438   -3.407  1.00 0.00 ? 16 LYS A N    4  
ATOM 2841  C CA   . LYS A 1 16 ? 11.667  5.020   -4.568  1.00 0.00 ? 16 LYS A CA   4  
ATOM 2842  C C    . LYS A 1 16 ? 11.652  3.493   -4.661  1.00 0.00 ? 16 LYS A C    4  
ATOM 2843  O O    . LYS A 1 16 ? 12.326  2.913   -5.511  1.00 0.00 ? 16 LYS A O    4  
ATOM 2844  C CB   . LYS A 1 16 ? 13.074  5.620   -4.523  1.00 0.00 ? 16 LYS A CB   4  
ATOM 2845  C CG   . LYS A 1 16 ? 13.868  5.066   -3.338  1.00 0.00 ? 16 LYS A CG   4  
ATOM 2846  C CD   . LYS A 1 16 ? 14.749  3.892   -3.769  1.00 0.00 ? 16 LYS A CD   4  
ATOM 2847  C CE   . LYS A 1 16 ? 15.920  4.372   -4.629  1.00 0.00 ? 16 LYS A CE   4  
ATOM 2848  N NZ   . LYS A 1 16 ? 16.003  3.583   -5.878  1.00 0.00 ? 16 LYS A NZ   4  
ATOM 2849  H H    . LYS A 1 16 ? 11.412  5.473   -2.550  1.00 0.00 ? 16 LYS A H    4  
ATOM 2850  H HA   . LYS A 1 16 ? 11.172  5.425   -5.450  1.00 0.00 ? 16 LYS A HA   4  
ATOM 2851  H HB2  . LYS A 1 16 ? 13.598  5.398   -5.452  1.00 0.00 ? 16 LYS A HB2  4  
ATOM 2852  H HB3  . LYS A 1 16 ? 13.008  6.705   -4.446  1.00 0.00 ? 16 LYS A HB3  4  
ATOM 2853  H HG2  . LYS A 1 16 ? 14.489  5.855   -2.912  1.00 0.00 ? 16 LYS A HG2  4  
ATOM 2854  H HG3  . LYS A 1 16 ? 13.182  4.743   -2.555  1.00 0.00 ? 16 LYS A HG3  4  
ATOM 2855  H HD2  . LYS A 1 16 ? 15.128  3.374   -2.888  1.00 0.00 ? 16 LYS A HD2  4  
ATOM 2856  H HD3  . LYS A 1 16 ? 14.153  3.172   -4.330  1.00 0.00 ? 16 LYS A HD3  4  
ATOM 2857  H HE2  . LYS A 1 16 ? 15.796  5.428   -4.866  1.00 0.00 ? 16 LYS A HE2  4  
ATOM 2858  H HE3  . LYS A 1 16 ? 16.851  4.278   -4.070  1.00 0.00 ? 16 LYS A HE3  4  
ATOM 2859  H HZ1  . LYS A 1 16 ? 15.100  3.215   -6.101  1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 2860  H HZ2  . LYS A 1 16 ? 16.316  4.172   -6.624  1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 2861  H HZ3  . LYS A 1 16 ? 16.649  2.830   -5.755  1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 2862  N N    . ASP A 1 17 ? 10.877  2.885   -3.775  1.00 0.00 ? 17 ASP A N    4  
ATOM 2863  C CA   . ASP A 1 17 ? 10.766  1.437   -3.747  1.00 0.00 ? 17 ASP A CA   4  
ATOM 2864  C C    . ASP A 1 17 ? 9.298   1.039   -3.907  1.00 0.00 ? 17 ASP A C    4  
ATOM 2865  O O    . ASP A 1 17 ? 8.940   -0.122  -3.712  1.00 0.00 ? 17 ASP A O    4  
ATOM 2866  C CB   . ASP A 1 17 ? 11.266  0.872   -2.416  1.00 0.00 ? 17 ASP A CB   4  
ATOM 2867  C CG   . ASP A 1 17 ? 12.604  0.132   -2.489  1.00 0.00 ? 17 ASP A CG   4  
ATOM 2868  O OD1  . ASP A 1 17 ? 12.994  -0.224  -3.622  1.00 0.00 ? 17 ASP A OD1  4  
ATOM 2869  O OD2  . ASP A 1 17 ? 13.206  -0.060  -1.410  1.00 0.00 ? 17 ASP A OD2  4  
ATOM 2870  H H    . ASP A 1 17 ? 10.333  3.364   -3.087  1.00 0.00 ? 17 ASP A H    4  
ATOM 2871  H HA   . ASP A 1 17 ? 11.386  1.086   -4.572  1.00 0.00 ? 17 ASP A HA   4  
ATOM 2872  H HB2  . ASP A 1 17 ? 11.360  1.691   -1.703  1.00 0.00 ? 17 ASP A HB2  4  
ATOM 2873  H HB3  . ASP A 1 17 ? 10.513  0.190   -2.021  1.00 0.00 ? 17 ASP A HB3  4  
ATOM 2874  N N    . ARG A 1 18 ? 8.486   2.024   -4.261  1.00 0.00 ? 18 ARG A N    4  
ATOM 2875  C CA   . ARG A 1 18 ? 7.064   1.792   -4.450  1.00 0.00 ? 18 ARG A CA   4  
ATOM 2876  C C    . ARG A 1 18 ? 6.815   1.085   -5.783  1.00 0.00 ? 18 ARG A C    4  
ATOM 2877  O O    . ARG A 1 18 ? 7.097   1.637   -6.846  1.00 0.00 ? 18 ARG A O    4  
ATOM 2878  C CB   . ARG A 1 18 ? 6.283   3.107   -4.424  1.00 0.00 ? 18 ARG A CB   4  
ATOM 2879  C CG   . ARG A 1 18 ? 6.796   4.028   -3.315  1.00 0.00 ? 18 ARG A CG   4  
ATOM 2880  C CD   . ARG A 1 18 ? 6.600   3.390   -1.938  1.00 0.00 ? 18 ARG A CD   4  
ATOM 2881  N NE   . ARG A 1 18 ? 6.833   4.395   -0.877  1.00 0.00 ? 18 ARG A NE   4  
ATOM 2882  C CZ   . ARG A 1 18 ? 6.070   5.480   -0.689  1.00 0.00 ? 18 ARG A CZ   4  
ATOM 2883  N NH1  . ARG A 1 18 ? 5.019   5.707   -1.488  1.00 0.00 ? 18 ARG A NH1  4  
ATOM 2884  N NH2  . ARG A 1 18 ? 6.357   6.338   0.300   1.00 0.00 ? 18 ARG A NH2  4  
ATOM 2885  H H    . ARG A 1 18 ? 8.785   2.966   -4.418  1.00 0.00 ? 18 ARG A H    4  
ATOM 2886  H HA   . ARG A 1 18 ? 6.771   1.161   -3.610  1.00 0.00 ? 18 ARG A HA   4  
ATOM 2887  H HB2  . ARG A 1 18 ? 6.373   3.607   -5.388  1.00 0.00 ? 18 ARG A HB2  4  
ATOM 2888  H HB3  . ARG A 1 18 ? 5.223   2.902   -4.270  1.00 0.00 ? 18 ARG A HB3  4  
ATOM 2889  H HG2  . ARG A 1 18 ? 7.853   4.240   -3.474  1.00 0.00 ? 18 ARG A HG2  4  
ATOM 2890  H HG3  . ARG A 1 18 ? 6.269   4.981   -3.357  1.00 0.00 ? 18 ARG A HG3  4  
ATOM 2891  H HD2  . ARG A 1 18 ? 5.589   2.989   -1.854  1.00 0.00 ? 18 ARG A HD2  4  
ATOM 2892  H HD3  . ARG A 1 18 ? 7.286   2.553   -1.815  1.00 0.00 ? 18 ARG A HD3  4  
ATOM 2893  H HE   . ARG A 1 18 ? 7.610   4.256   -0.262  1.00 0.00 ? 18 ARG A HE   4  
ATOM 2894  H HH11 . ARG A 1 18 ? 4.805   5.067   -2.226  1.00 0.00 ? 18 ARG A HH11 4  
ATOM 2895  H HH12 . ARG A 1 18 ? 4.449   6.517   -1.348  1.00 0.00 ? 18 ARG A HH12 4  
ATOM 2896  H HH21 . ARG A 1 18 ? 7.142   6.169   0.897   1.00 0.00 ? 18 ARG A HH21 4  
ATOM 2897  H HH22 . ARG A 1 18 ? 5.788   7.148   0.441   1.00 0.00 ? 18 ARG A HH22 4  
ATOM 2898  N N    . VAL A 1 19 ? 6.288   -0.127  -5.685  1.00 0.00 ? 19 VAL A N    4  
ATOM 2899  C CA   . VAL A 1 19 ? 5.997   -0.916  -6.870  1.00 0.00 ? 19 VAL A CA   4  
ATOM 2900  C C    . VAL A 1 19 ? 4.650   -0.480  -7.449  1.00 0.00 ? 19 VAL A C    4  
ATOM 2901  O O    . VAL A 1 19 ? 4.281   -0.891  -8.548  1.00 0.00 ? 19 VAL A O    4  
ATOM 2902  C CB   . VAL A 1 19 ? 6.048   -2.407  -6.532  1.00 0.00 ? 19 VAL A CB   4  
ATOM 2903  C CG1  . VAL A 1 19 ? 5.690   -3.259  -7.751  1.00 0.00 ? 19 VAL A CG1  4  
ATOM 2904  C CG2  . VAL A 1 19 ? 7.419   -2.797  -5.975  1.00 0.00 ? 19 VAL A CG2  4  
ATOM 2905  H H    . VAL A 1 19 ? 6.061   -0.570  -4.817  1.00 0.00 ? 19 VAL A H    4  
ATOM 2906  H HA   . VAL A 1 19 ? 6.778   -0.709  -7.602  1.00 0.00 ? 19 VAL A HA   4  
ATOM 2907  H HB   . VAL A 1 19 ? 5.305   -2.601  -5.758  1.00 0.00 ? 19 VAL A HB   4  
ATOM 2908  H HG11 . VAL A 1 19 ? 6.218   -2.880  -8.626  1.00 0.00 ? 19 VAL A HG11 4  
ATOM 2909  H HG12 . VAL A 1 19 ? 5.980   -4.293  -7.570  1.00 0.00 ? 19 VAL A HG12 4  
ATOM 2910  H HG13 . VAL A 1 19 ? 4.615   -3.208  -7.926  1.00 0.00 ? 19 VAL A HG13 4  
ATOM 2911  H HG21 . VAL A 1 19 ? 8.197   -2.260  -6.518  1.00 0.00 ? 19 VAL A HG21 4  
ATOM 2912  H HG22 . VAL A 1 19 ? 7.469   -2.537  -4.918  1.00 0.00 ? 19 VAL A HG22 4  
ATOM 2913  H HG23 . VAL A 1 19 ? 7.568   -3.870  -6.093  1.00 0.00 ? 19 VAL A HG23 4  
ATOM 2914  N N    . ASP A 1 20 ? 3.952   0.346   -6.684  1.00 0.00 ? 20 ASP A N    4  
ATOM 2915  C CA   . ASP A 1 20 ? 2.654   0.842   -7.107  1.00 0.00 ? 20 ASP A CA   4  
ATOM 2916  C C    . ASP A 1 20 ? 1.713   -0.341  -7.342  1.00 0.00 ? 20 ASP A C    4  
ATOM 2917  O O    . ASP A 1 20 ? 1.956   -1.168  -8.220  1.00 0.00 ? 20 ASP A O    4  
ATOM 2918  C CB   . ASP A 1 20 ? 2.764   1.626   -8.417  1.00 0.00 ? 20 ASP A CB   4  
ATOM 2919  C CG   . ASP A 1 20 ? 1.437   1.870   -9.138  1.00 0.00 ? 20 ASP A CG   4  
ATOM 2920  O OD1  . ASP A 1 20 ? 1.045   0.979   -9.922  1.00 0.00 ? 20 ASP A OD1  4  
ATOM 2921  O OD2  . ASP A 1 20 ? 0.844   2.942   -8.889  1.00 0.00 ? 20 ASP A OD2  4  
ATOM 2922  H H    . ASP A 1 20 ? 4.260   0.676   -5.791  1.00 0.00 ? 20 ASP A H    4  
ATOM 2923  H HA   . ASP A 1 20 ? 2.317   1.489   -6.298  1.00 0.00 ? 20 ASP A HA   4  
ATOM 2924  H HB2  . ASP A 1 20 ? 3.230   2.589   -8.208  1.00 0.00 ? 20 ASP A HB2  4  
ATOM 2925  H HB3  . ASP A 1 20 ? 3.432   1.088   -9.089  1.00 0.00 ? 20 ASP A HB3  4  
ATOM 2926  N N    . CYS A 1 21 ? 0.657   -0.384  -6.543  1.00 0.00 ? 21 CYS A N    4  
ATOM 2927  C CA   . CYS A 1 21 ? -0.322  -1.452  -6.653  1.00 0.00 ? 21 CYS A CA   4  
ATOM 2928  C C    . CYS A 1 21 ? -1.326  -1.073  -7.743  1.00 0.00 ? 21 CYS A C    4  
ATOM 2929  O O    . CYS A 1 21 ? -1.975  -1.942  -8.323  1.00 0.00 ? 21 CYS A O    4  
ATOM 2930  C CB   . CYS A 1 21 ? -1.009  -1.729  -5.314  1.00 0.00 ? 21 CYS A CB   4  
ATOM 2931  S SG   . CYS A 1 21 ? -1.332  -3.497  -4.968  1.00 0.00 ? 21 CYS A SG   4  
ATOM 2932  H H    . CYS A 1 21 ? 0.466   0.293   -5.831  1.00 0.00 ? 21 CYS A H    4  
ATOM 2933  H HA   . CYS A 1 21 ? 0.227   -2.353  -6.928  1.00 0.00 ? 21 CYS A HA   4  
ATOM 2934  H HB2  . CYS A 1 21 ? -0.391  -1.323  -4.513  1.00 0.00 ? 21 CYS A HB2  4  
ATOM 2935  H HB3  . CYS A 1 21 ? -1.957  -1.190  -5.290  1.00 0.00 ? 21 CYS A HB3  4  
ATOM 2936  N N    . GLY A 1 22 ? -1.423  0.226   -7.987  1.00 0.00 ? 22 GLY A N    4  
ATOM 2937  C CA   . GLY A 1 22 ? -2.338  0.731   -8.998  1.00 0.00 ? 22 GLY A CA   4  
ATOM 2938  C C    . GLY A 1 22 ? -3.792  0.569   -8.550  1.00 0.00 ? 22 GLY A C    4  
ATOM 2939  O O    . GLY A 1 22 ? -4.407  -0.469  -8.789  1.00 0.00 ? 22 GLY A O    4  
ATOM 2940  H H    . GLY A 1 22 ? -0.892  0.926   -7.511  1.00 0.00 ? 22 GLY A H    4  
ATOM 2941  H HA2  . GLY A 1 22 ? -2.127  1.783   -9.190  1.00 0.00 ? 22 GLY A HA2  4  
ATOM 2942  H HA3  . GLY A 1 22 ? -2.180  0.197   -9.935  1.00 0.00 ? 22 GLY A HA3  4  
ATOM 2943  N N    . TYR A 1 23 ? -4.300  1.612   -7.910  1.00 0.00 ? 23 TYR A N    4  
ATOM 2944  C CA   . TYR A 1 23 ? -5.670  1.599   -7.427  1.00 0.00 ? 23 TYR A CA   4  
ATOM 2945  C C    . TYR A 1 23 ? -6.350  2.948   -7.669  1.00 0.00 ? 23 TYR A C    4  
ATOM 2946  O O    . TYR A 1 23 ? -5.694  3.989   -7.654  1.00 0.00 ? 23 TYR A O    4  
ATOM 2947  C CB   . TYR A 1 23 ? -5.584  1.347   -5.921  1.00 0.00 ? 23 TYR A CB   4  
ATOM 2948  C CG   . TYR A 1 23 ? -5.629  -0.133  -5.534  1.00 0.00 ? 23 TYR A CG   4  
ATOM 2949  C CD1  . TYR A 1 23 ? -6.790  -0.858  -5.710  1.00 0.00 ? 23 TYR A CD1  4  
ATOM 2950  C CD2  . TYR A 1 23 ? -4.507  -0.742  -5.008  1.00 0.00 ? 23 TYR A CD2  4  
ATOM 2951  C CE1  . TYR A 1 23 ? -6.831  -2.250  -5.345  1.00 0.00 ? 23 TYR A CE1  4  
ATOM 2952  C CE2  . TYR A 1 23 ? -4.549  -2.135  -4.644  1.00 0.00 ? 23 TYR A CE2  4  
ATOM 2953  C CZ   . TYR A 1 23 ? -5.709  -2.820  -4.830  1.00 0.00 ? 23 TYR A CZ   4  
ATOM 2954  O OH   . TYR A 1 23 ? -5.748  -4.135  -4.486  1.00 0.00 ? 23 TYR A OH   4  
ATOM 2955  H H    . TYR A 1 23 ? -3.793  2.453   -7.720  1.00 0.00 ? 23 TYR A H    4  
ATOM 2956  H HA   . TYR A 1 23 ? -6.212  0.825   -7.972  1.00 0.00 ? 23 TYR A HA   4  
ATOM 2957  H HB2  . TYR A 1 23 ? -4.660  1.784   -5.542  1.00 0.00 ? 23 TYR A HB2  4  
ATOM 2958  H HB3  . TYR A 1 23 ? -6.407  1.865   -5.428  1.00 0.00 ? 23 TYR A HB3  4  
ATOM 2959  H HD1  . TYR A 1 23 ? -7.675  -0.376  -6.124  1.00 0.00 ? 23 TYR A HD1  4  
ATOM 2960  H HD2  . TYR A 1 23 ? -3.590  -0.170  -4.869  1.00 0.00 ? 23 TYR A HD2  4  
ATOM 2961  H HE1  . TYR A 1 23 ? -7.742  -2.834  -5.479  1.00 0.00 ? 23 TYR A HE1  4  
ATOM 2962  H HE2  . TYR A 1 23 ? -3.671  -2.628  -4.228  1.00 0.00 ? 23 TYR A HE2  4  
ATOM 2963  H HH   . TYR A 1 23 ? -4.980  -4.621  -4.903  1.00 0.00 ? 23 TYR A HH   4  
ATOM 2964  N N    . PRO A 1 24 ? -7.690  2.885   -7.891  1.00 0.00 ? 24 PRO A N    4  
ATOM 2965  C CA   . PRO A 1 24 ? -8.465  4.089   -8.135  1.00 0.00 ? 24 PRO A CA   4  
ATOM 2966  C C    . PRO A 1 24 ? -8.682  4.874   -6.840  1.00 0.00 ? 24 PRO A C    4  
ATOM 2967  O O    . PRO A 1 24 ? -8.033  5.894   -6.612  1.00 0.00 ? 24 PRO A O    4  
ATOM 2968  C CB   . PRO A 1 24 ? -9.763  3.602   -8.759  1.00 0.00 ? 24 PRO A CB   4  
ATOM 2969  C CG   . PRO A 1 24 ? -9.862  2.125   -8.415  1.00 0.00 ? 24 PRO A CG   4  
ATOM 2970  C CD   . PRO A 1 24 ? -8.500  1.671   -7.915  1.00 0.00 ? 24 PRO A CD   4  
ATOM 2971  H HA   . PRO A 1 24 ? -7.968  4.704   -8.748  1.00 0.00 ? 24 PRO A HA   4  
ATOM 2972  H HB2  . PRO A 1 24 ? -10.617 4.153   -8.364  1.00 0.00 ? 24 PRO A HB2  4  
ATOM 2973  H HB3  . PRO A 1 24 ? -9.759  3.753   -9.838  1.00 0.00 ? 24 PRO A HB3  4  
ATOM 2974  H HG2  . PRO A 1 24 ? -10.622 1.960   -7.652  1.00 0.00 ? 24 PRO A HG2  4  
ATOM 2975  H HG3  . PRO A 1 24 ? -10.159 1.548   -9.291  1.00 0.00 ? 24 PRO A HG3  4  
ATOM 2976  H HD2  . PRO A 1 24 ? -8.571  1.222   -6.925  1.00 0.00 ? 24 PRO A HD2  4  
ATOM 2977  H HD3  . PRO A 1 24 ? -8.066  0.919   -8.575  1.00 0.00 ? 24 PRO A HD3  4  
ATOM 2978  N N    . HIS A 1 25 ? -9.597  4.369   -6.025  1.00 0.00 ? 25 HIS A N    4  
ATOM 2979  C CA   . HIS A 1 25 ? -9.907  5.010   -4.759  1.00 0.00 ? 25 HIS A CA   4  
ATOM 2980  C C    . HIS A 1 25 ? -8.965  4.485   -3.674  1.00 0.00 ? 25 HIS A C    4  
ATOM 2981  O O    . HIS A 1 25 ? -9.320  3.574   -2.927  1.00 0.00 ? 25 HIS A O    4  
ATOM 2982  C CB   . HIS A 1 25 ? -11.383 4.825   -4.404  1.00 0.00 ? 25 HIS A CB   4  
ATOM 2983  C CG   . HIS A 1 25 ? -11.758 3.404   -4.054  1.00 0.00 ? 25 HIS A CG   4  
ATOM 2984  N ND1  . HIS A 1 25 ? -12.985 3.064   -3.514  1.00 0.00 ? 25 HIS A ND1  4  
ATOM 2985  C CD2  . HIS A 1 25 ? -11.054 2.242   -4.174  1.00 0.00 ? 25 HIS A CD2  4  
ATOM 2986  C CE1  . HIS A 1 25 ? -13.008 1.753   -3.320  1.00 0.00 ? 25 HIS A CE1  4  
ATOM 2987  N NE2  . HIS A 1 25 ? -11.810 1.246   -3.730  1.00 0.00 ? 25 HIS A NE2  4  
ATOM 2988  H H    . HIS A 1 25 ? -10.120 3.539   -6.218  1.00 0.00 ? 25 HIS A H    4  
ATOM 2989  H HA   . HIS A 1 25 ? -9.729  6.077   -4.897  1.00 0.00 ? 25 HIS A HA   4  
ATOM 2990  H HB2  . HIS A 1 25 ? -11.628 5.472   -3.561  1.00 0.00 ? 25 HIS A HB2  4  
ATOM 2991  H HB3  . HIS A 1 25 ? -11.993 5.154   -5.245  1.00 0.00 ? 25 HIS A HB3  4  
ATOM 2992  H HD1  . HIS A 1 25 ? -13.729 3.699   -3.305  1.00 0.00 ? 25 HIS A HD1  4  
ATOM 2993  H HD2  . HIS A 1 25 ? -10.042 2.148   -4.568  1.00 0.00 ? 25 HIS A HD2  4  
ATOM 2994  H HE1  . HIS A 1 25 ? -13.838 1.181   -2.907  1.00 0.00 ? 25 HIS A HE1  4  
ATOM 2995  H HE2  . HIS A 1 25 ? -11.566 0.276   -3.753  1.00 0.00 ? 25 HIS A HE2  4  
ATOM 2996  N N    . VAL A 1 26 ? -7.784  5.082   -3.620  1.00 0.00 ? 26 VAL A N    4  
ATOM 2997  C CA   . VAL A 1 26 ? -6.789  4.685   -2.638  1.00 0.00 ? 26 VAL A CA   4  
ATOM 2998  C C    . VAL A 1 26 ? -6.907  5.584   -1.406  1.00 0.00 ? 26 VAL A C    4  
ATOM 2999  O O    . VAL A 1 26 ? -7.058  6.799   -1.532  1.00 0.00 ? 26 VAL A O    4  
ATOM 3000  C CB   . VAL A 1 26 ? -5.394  4.713   -3.267  1.00 0.00 ? 26 VAL A CB   4  
ATOM 3001  C CG1  . VAL A 1 26 ? -5.259  3.641   -4.350  1.00 0.00 ? 26 VAL A CG1  4  
ATOM 3002  C CG2  . VAL A 1 26 ? -5.071  6.101   -3.825  1.00 0.00 ? 26 VAL A CG2  4  
ATOM 3003  H H    . VAL A 1 26 ? -7.503  5.822   -4.231  1.00 0.00 ? 26 VAL A H    4  
ATOM 3004  H HA   . VAL A 1 26 ? -7.007  3.658   -2.346  1.00 0.00 ? 26 VAL A HA   4  
ATOM 3005  H HB   . VAL A 1 26 ? -4.669  4.491   -2.484  1.00 0.00 ? 26 VAL A HB   4  
ATOM 3006  H HG11 . VAL A 1 26 ? -6.017  3.802   -5.117  1.00 0.00 ? 26 VAL A HG11 4  
ATOM 3007  H HG12 . VAL A 1 26 ? -4.268  3.702   -4.800  1.00 0.00 ? 26 VAL A HG12 4  
ATOM 3008  H HG13 . VAL A 1 26 ? -5.396  2.656   -3.905  1.00 0.00 ? 26 VAL A HG13 4  
ATOM 3009  H HG21 . VAL A 1 26 ? -5.876  6.790   -3.571  1.00 0.00 ? 26 VAL A HG21 4  
ATOM 3010  H HG22 . VAL A 1 26 ? -4.137  6.458   -3.392  1.00 0.00 ? 26 VAL A HG22 4  
ATOM 3011  H HG23 . VAL A 1 26 ? -4.972  6.042   -4.909  1.00 0.00 ? 26 VAL A HG23 4  
ATOM 3012  N N    . THR A 1 27 ? -6.835  4.953   -0.244  1.00 0.00 ? 27 THR A N    4  
ATOM 3013  C CA   . THR A 1 27 ? -6.933  5.681   1.010   1.00 0.00 ? 27 THR A CA   4  
ATOM 3014  C C    . THR A 1 27 ? -6.175  4.944   2.116   1.00 0.00 ? 27 THR A C    4  
ATOM 3015  O O    . THR A 1 27 ? -5.753  3.803   1.929   1.00 0.00 ? 27 THR A O    4  
ATOM 3016  C CB   . THR A 1 27 ? -8.416  5.887   1.323   1.00 0.00 ? 27 THR A CB   4  
ATOM 3017  O OG1  . THR A 1 27 ? -8.805  4.679   1.971   1.00 0.00 ? 27 THR A OG1  4  
ATOM 3018  C CG2  . THR A 1 27 ? -9.281  5.929   0.062   1.00 0.00 ? 27 THR A CG2  4  
ATOM 3019  H H    . THR A 1 27 ? -6.712  3.966   -0.150  1.00 0.00 ? 27 THR A H    4  
ATOM 3020  H HA   . THR A 1 27 ? -6.450  6.650   0.883   1.00 0.00 ? 27 THR A HA   4  
ATOM 3021  H HB   . THR A 1 27 ? -8.566  6.782   1.928   1.00 0.00 ? 27 THR A HB   4  
ATOM 3022  H HG1  . THR A 1 27 ? -9.777  4.713   2.203   1.00 0.00 ? 27 THR A HG1  4  
ATOM 3023  H HG21 . THR A 1 27 ? -9.067  5.055   -0.554  1.00 0.00 ? 27 THR A HG21 4  
ATOM 3024  H HG22 . THR A 1 27 ? -10.334 5.926   0.343   1.00 0.00 ? 27 THR A HG22 4  
ATOM 3025  H HG23 . THR A 1 27 ? -9.057  6.834   -0.502  1.00 0.00 ? 27 THR A HG23 4  
ATOM 3026  N N    . PRO A 1 28 ? -6.021  5.642   3.272   1.00 0.00 ? 28 PRO A N    4  
ATOM 3027  C CA   . PRO A 1 28 ? -5.322  5.066   4.408   1.00 0.00 ? 28 PRO A CA   4  
ATOM 3028  C C    . PRO A 1 28 ? -6.189  4.021   5.113   1.00 0.00 ? 28 PRO A C    4  
ATOM 3029  O O    . PRO A 1 28 ? -6.191  3.938   6.341   1.00 0.00 ? 28 PRO A O    4  
ATOM 3030  C CB   . PRO A 1 28 ? -4.974  6.248   5.297   1.00 0.00 ? 28 PRO A CB   4  
ATOM 3031  C CG   . PRO A 1 28 ? -5.891  7.380   4.863   1.00 0.00 ? 28 PRO A CG   4  
ATOM 3032  C CD   . PRO A 1 28 ? -6.508  6.995   3.529   1.00 0.00 ? 28 PRO A CD   4  
ATOM 3033  H HA   . PRO A 1 28 ? -4.504  4.579   4.101   1.00 0.00 ? 28 PRO A HA   4  
ATOM 3034  H HB2  . PRO A 1 28 ? -5.126  6.004   6.349   1.00 0.00 ? 28 PRO A HB2  4  
ATOM 3035  H HB3  . PRO A 1 28 ? -3.927  6.528   5.183   1.00 0.00 ? 28 PRO A HB3  4  
ATOM 3036  H HG2  . PRO A 1 28 ? -6.668  7.549   5.609   1.00 0.00 ? 28 PRO A HG2  4  
ATOM 3037  H HG3  . PRO A 1 28 ? -5.331  8.311   4.771   1.00 0.00 ? 28 PRO A HG3  4  
ATOM 3038  H HD2  . PRO A 1 28 ? -7.596  7.022   3.573   1.00 0.00 ? 28 PRO A HD2  4  
ATOM 3039  H HD3  . PRO A 1 28 ? -6.203  7.681   2.739   1.00 0.00 ? 28 PRO A HD3  4  
ATOM 3040  N N    . LYS A 1 29 ? -6.905  3.251   4.307   1.00 0.00 ? 29 LYS A N    4  
ATOM 3041  C CA   . LYS A 1 29 ? -7.775  2.216   4.839   1.00 0.00 ? 29 LYS A CA   4  
ATOM 3042  C C    . LYS A 1 29 ? -8.408  1.443   3.681   1.00 0.00 ? 29 LYS A C    4  
ATOM 3043  O O    . LYS A 1 29 ? -8.533  0.221   3.739   1.00 0.00 ? 29 LYS A O    4  
ATOM 3044  C CB   . LYS A 1 29 ? -8.795  2.818   5.808   1.00 0.00 ? 29 LYS A CB   4  
ATOM 3045  C CG   . LYS A 1 29 ? -9.239  1.787   6.847   1.00 0.00 ? 29 LYS A CG   4  
ATOM 3046  C CD   . LYS A 1 29 ? -10.167 0.743   6.223   1.00 0.00 ? 29 LYS A CD   4  
ATOM 3047  C CE   . LYS A 1 29 ? -11.162 0.207   7.254   1.00 0.00 ? 29 LYS A CE   4  
ATOM 3048  N NZ   . LYS A 1 29 ? -12.540 0.251   6.715   1.00 0.00 ? 29 LYS A NZ   4  
ATOM 3049  H H    . LYS A 1 29 ? -6.898  3.326   3.310   1.00 0.00 ? 29 LYS A H    4  
ATOM 3050  H HA   . LYS A 1 29 ? -7.152  1.529   5.413   1.00 0.00 ? 29 LYS A HA   4  
ATOM 3051  H HB2  . LYS A 1 29 ? -8.360  3.682   6.310   1.00 0.00 ? 29 LYS A HB2  4  
ATOM 3052  H HB3  . LYS A 1 29 ? -9.661  3.176   5.252   1.00 0.00 ? 29 LYS A HB3  4  
ATOM 3053  H HG2  . LYS A 1 29 ? -8.365  1.294   7.272   1.00 0.00 ? 29 LYS A HG2  4  
ATOM 3054  H HG3  . LYS A 1 29 ? -9.751  2.290   7.667   1.00 0.00 ? 29 LYS A HG3  4  
ATOM 3055  H HD2  . LYS A 1 29 ? -10.707 1.186   5.386   1.00 0.00 ? 29 LYS A HD2  4  
ATOM 3056  H HD3  . LYS A 1 29 ? -9.576  -0.080  5.820   1.00 0.00 ? 29 LYS A HD3  4  
ATOM 3057  H HE2  . LYS A 1 29 ? -10.902 -0.818  7.520   1.00 0.00 ? 29 LYS A HE2  4  
ATOM 3058  H HE3  . LYS A 1 29 ? -11.103 0.799   8.167   1.00 0.00 ? 29 LYS A HE3  4  
ATOM 3059  H HZ1  . LYS A 1 29 ? -12.721 1.159   6.338   1.00 0.00 ? 29 LYS A HZ1  4  
ATOM 3060  H HZ2  . LYS A 1 29 ? -12.639 -0.435  5.995   1.00 0.00 ? 29 LYS A HZ2  4  
ATOM 3061  H HZ3  . LYS A 1 29 ? -13.191 0.060   7.450   1.00 0.00 ? 29 LYS A HZ3  4  
ATOM 3062  N N    . GLU A 1 30 ? -8.792  2.188   2.654   1.00 0.00 ? 30 GLU A N    4  
ATOM 3063  C CA   . GLU A 1 30 ? -9.409  1.588   1.484   1.00 0.00 ? 30 GLU A CA   4  
ATOM 3064  C C    . GLU A 1 30 ? -8.343  0.961   0.583   1.00 0.00 ? 30 GLU A C    4  
ATOM 3065  O O    . GLU A 1 30 ? -8.567  -0.094  -0.008  1.00 0.00 ? 30 GLU A O    4  
ATOM 3066  C CB   . GLU A 1 30 ? -10.240 2.617   0.714   1.00 0.00 ? 30 GLU A CB   4  
ATOM 3067  C CG   . GLU A 1 30 ? -10.894 1.985   -0.516  1.00 0.00 ? 30 GLU A CG   4  
ATOM 3068  C CD   . GLU A 1 30 ? -12.367 2.383   -0.620  1.00 0.00 ? 30 GLU A CD   4  
ATOM 3069  O OE1  . GLU A 1 30 ? -12.626 3.606   -0.621  1.00 0.00 ? 30 GLU A OE1  4  
ATOM 3070  O OE2  . GLU A 1 30 ? -13.202 1.456   -0.696  1.00 0.00 ? 30 GLU A OE2  4  
ATOM 3071  H H    . GLU A 1 30 ? -8.687  3.182   2.614   1.00 0.00 ? 30 GLU A H    4  
ATOM 3072  H HA   . GLU A 1 30 ? -10.070 0.813   1.870   1.00 0.00 ? 30 GLU A HA   4  
ATOM 3073  H HB2  . GLU A 1 30 ? -11.009 3.031   1.367   1.00 0.00 ? 30 GLU A HB2  4  
ATOM 3074  H HB3  . GLU A 1 30 ? -9.604  3.447   0.406   1.00 0.00 ? 30 GLU A HB3  4  
ATOM 3075  H HG2  . GLU A 1 30 ? -10.364 2.299   -1.416  1.00 0.00 ? 30 GLU A HG2  4  
ATOM 3076  H HG3  . GLU A 1 30 ? -10.810 0.900   -0.460  1.00 0.00 ? 30 GLU A HG3  4  
ATOM 3077  N N    . CYS A 1 31 ? -7.206  1.637   0.508   1.00 0.00 ? 31 CYS A N    4  
ATOM 3078  C CA   . CYS A 1 31 ? -6.104  1.159   -0.310  1.00 0.00 ? 31 CYS A CA   4  
ATOM 3079  C C    . CYS A 1 31 ? -5.445  -0.018  0.412   1.00 0.00 ? 31 CYS A C    4  
ATOM 3080  O O    . CYS A 1 31 ? -4.883  -0.907  -0.227  1.00 0.00 ? 31 CYS A O    4  
ATOM 3081  C CB   . CYS A 1 31 ? -5.102  2.273   -0.617  1.00 0.00 ? 31 CYS A CB   4  
ATOM 3082  S SG   . CYS A 1 31 ? -3.406  1.699   -0.995  1.00 0.00 ? 31 CYS A SG   4  
ATOM 3083  H H    . CYS A 1 31 ? -7.032  2.494   0.992   1.00 0.00 ? 31 CYS A H    4  
ATOM 3084  H HA   . CYS A 1 31 ? -6.535  0.839   -1.259  1.00 0.00 ? 31 CYS A HA   4  
ATOM 3085  H HB2  . CYS A 1 31 ? -5.472  2.852   -1.464  1.00 0.00 ? 31 CYS A HB2  4  
ATOM 3086  H HB3  . CYS A 1 31 ? -5.060  2.950   0.237   1.00 0.00 ? 31 CYS A HB3  4  
ATOM 3087  N N    . ASN A 1 32 ? -5.536  0.014   1.733   1.00 0.00 ? 32 ASN A N    4  
ATOM 3088  C CA   . ASN A 1 32 ? -4.955  -1.039  2.549   1.00 0.00 ? 32 ASN A CA   4  
ATOM 3089  C C    . ASN A 1 32 ? -6.024  -2.091  2.853   1.00 0.00 ? 32 ASN A C    4  
ATOM 3090  O O    . ASN A 1 32 ? -5.769  -3.048  3.583   1.00 0.00 ? 32 ASN A O    4  
ATOM 3091  C CB   . ASN A 1 32 ? -4.444  -0.486  3.881   1.00 0.00 ? 32 ASN A CB   4  
ATOM 3092  C CG   . ASN A 1 32 ? -5.592  -0.307  4.877   1.00 0.00 ? 32 ASN A CG   4  
ATOM 3093  O OD1  . ASN A 1 32 ? -6.690  -0.806  4.694   1.00 0.00 ? 32 ASN A OD1  4  
ATOM 3094  N ND2  . ASN A 1 32 ? -5.277  0.431   5.938   1.00 0.00 ? 32 ASN A ND2  4  
ATOM 3095  H H    . ASN A 1 32 ? -5.995  0.740   2.245   1.00 0.00 ? 32 ASN A H    4  
ATOM 3096  H HA   . ASN A 1 32 ? -4.133  -1.440  1.957   1.00 0.00 ? 32 ASN A HA   4  
ATOM 3097  H HB2  . ASN A 1 32 ? -3.698  -1.163  4.298   1.00 0.00 ? 32 ASN A HB2  4  
ATOM 3098  H HB3  . ASN A 1 32 ? -3.949  0.471   3.715   1.00 0.00 ? 32 ASN A HB3  4  
ATOM 3099  H HD21 . ASN A 1 32 ? -4.356  0.811   6.027   1.00 0.00 ? 32 ASN A HD21 4  
ATOM 3100  H HD22 . ASN A 1 32 ? -5.960  0.605   6.646   1.00 0.00 ? 32 ASN A HD22 4  
ATOM 3101  N N    . ASN A 1 33 ? -7.199  -1.878  2.278   1.00 0.00 ? 33 ASN A N    4  
ATOM 3102  C CA   . ASN A 1 33 ? -8.308  -2.795  2.479   1.00 0.00 ? 33 ASN A CA   4  
ATOM 3103  C C    . ASN A 1 33 ? -8.492  -3.648  1.222   1.00 0.00 ? 33 ASN A C    4  
ATOM 3104  O O    . ASN A 1 33 ? -8.721  -4.853  1.313   1.00 0.00 ? 33 ASN A O    4  
ATOM 3105  C CB   . ASN A 1 33 ? -9.612  -2.036  2.731   1.00 0.00 ? 33 ASN A CB   4  
ATOM 3106  C CG   . ASN A 1 33 ? -10.821 -2.963  2.590   1.00 0.00 ? 33 ASN A CG   4  
ATOM 3107  O OD1  . ASN A 1 33 ? -11.183 -3.394  1.507   1.00 0.00 ? 33 ASN A OD1  4  
ATOM 3108  N ND2  . ASN A 1 33 ? -11.425 -3.244  3.742   1.00 0.00 ? 33 ASN A ND2  4  
ATOM 3109  H H    . ASN A 1 33 ? -7.398  -1.097  1.686   1.00 0.00 ? 33 ASN A H    4  
ATOM 3110  H HA   . ASN A 1 33 ? -8.033  -3.390  3.350   1.00 0.00 ? 33 ASN A HA   4  
ATOM 3111  H HB2  . ASN A 1 33 ? -9.597  -1.602  3.730   1.00 0.00 ? 33 ASN A HB2  4  
ATOM 3112  H HB3  . ASN A 1 33 ? -9.698  -1.210  2.025   1.00 0.00 ? 33 ASN A HB3  4  
ATOM 3113  H HD21 . ASN A 1 33 ? -11.077 -2.857  4.596   1.00 0.00 ? 33 ASN A HD21 4  
ATOM 3114  H HD22 . ASN A 1 33 ? -12.226 -3.842  3.753   1.00 0.00 ? 33 ASN A HD22 4  
ATOM 3115  N N    . ARG A 1 34 ? -8.385  -2.989  0.078   1.00 0.00 ? 34 ARG A N    4  
ATOM 3116  C CA   . ARG A 1 34 ? -8.537  -3.672  -1.196  1.00 0.00 ? 34 ARG A CA   4  
ATOM 3117  C C    . ARG A 1 34 ? -7.543  -4.830  -1.300  1.00 0.00 ? 34 ARG A C    4  
ATOM 3118  O O    . ARG A 1 34 ? -7.819  -5.832  -1.957  1.00 0.00 ? 34 ARG A O    4  
ATOM 3119  C CB   . ARG A 1 34 ? -8.314  -2.711  -2.366  1.00 0.00 ? 34 ARG A CB   4  
ATOM 3120  C CG   . ARG A 1 34 ? -9.258  -3.031  -3.526  1.00 0.00 ? 34 ARG A CG   4  
ATOM 3121  C CD   . ARG A 1 34 ? -8.937  -4.398  -4.134  1.00 0.00 ? 34 ARG A CD   4  
ATOM 3122  N NE   . ARG A 1 34 ? -9.399  -4.449  -5.539  1.00 0.00 ? 34 ARG A NE   4  
ATOM 3123  C CZ   . ARG A 1 34 ? -10.672 -4.653  -5.904  1.00 0.00 ? 34 ARG A CZ   4  
ATOM 3124  N NH1  . ARG A 1 34 ? -11.617 -4.827  -4.970  1.00 0.00 ? 34 ARG A NH1  4  
ATOM 3125  N NH2  . ARG A 1 34 ? -11.000 -4.684  -7.203  1.00 0.00 ? 34 ARG A NH2  4  
ATOM 3126  H H    . ARG A 1 34 ? -8.199  -2.009  0.012   1.00 0.00 ? 34 ARG A H    4  
ATOM 3127  H HA   . ARG A 1 34 ? -9.565  -4.035  -1.196  1.00 0.00 ? 34 ARG A HA   4  
ATOM 3128  H HB2  . ARG A 1 34 ? -8.474  -1.685  -2.034  1.00 0.00 ? 34 ARG A HB2  4  
ATOM 3129  H HB3  . ARG A 1 34 ? -7.280  -2.779  -2.705  1.00 0.00 ? 34 ARG A HB3  4  
ATOM 3130  H HG2  . ARG A 1 34 ? -10.290 -3.019  -3.174  1.00 0.00 ? 34 ARG A HG2  4  
ATOM 3131  H HG3  . ARG A 1 34 ? -9.174  -2.260  -4.292  1.00 0.00 ? 34 ARG A HG3  4  
ATOM 3132  H HD2  . ARG A 1 34 ? -7.864  -4.582  -4.088  1.00 0.00 ? 34 ARG A HD2  4  
ATOM 3133  H HD3  . ARG A 1 34 ? -9.420  -5.185  -3.555  1.00 0.00 ? 34 ARG A HD3  4  
ATOM 3134  H HE   . ARG A 1 34 ? -8.719  -4.323  -6.261  1.00 0.00 ? 34 ARG A HE   4  
ATOM 3135  H HH11 . ARG A 1 34 ? -11.373 -4.805  -4.001  1.00 0.00 ? 34 ARG A HH11 4  
ATOM 3136  H HH12 . ARG A 1 34 ? -12.568 -4.980  -5.243  1.00 0.00 ? 34 ARG A HH12 4  
ATOM 3137  H HH21 . ARG A 1 34 ? -10.295 -4.554  -7.900  1.00 0.00 ? 34 ARG A HH21 4  
ATOM 3138  H HH22 . ARG A 1 34 ? -11.950 -4.836  -7.475  1.00 0.00 ? 34 ARG A HH22 4  
ATOM 3139  N N    . GLY A 1 35 ? -6.408  -4.654  -0.640  1.00 0.00 ? 35 GLY A N    4  
ATOM 3140  C CA   . GLY A 1 35 ? -5.371  -5.673  -0.650  1.00 0.00 ? 35 GLY A CA   4  
ATOM 3141  C C    . GLY A 1 35 ? -4.038  -5.094  -1.127  1.00 0.00 ? 35 GLY A C    4  
ATOM 3142  O O    . GLY A 1 35 ? -3.621  -5.337  -2.258  1.00 0.00 ? 35 GLY A O    4  
ATOM 3143  H H    . GLY A 1 35 ? -6.191  -3.836  -0.107  1.00 0.00 ? 35 GLY A H    4  
ATOM 3144  H HA2  . GLY A 1 35 ? -5.254  -6.087  0.352   1.00 0.00 ? 35 GLY A HA2  4  
ATOM 3145  H HA3  . GLY A 1 35 ? -5.670  -6.494  -1.301  1.00 0.00 ? 35 GLY A HA3  4  
ATOM 3146  N N    . CYS A 1 36 ? -3.406  -4.338  -0.241  1.00 0.00 ? 36 CYS A N    4  
ATOM 3147  C CA   . CYS A 1 36 ? -2.129  -3.723  -0.558  1.00 0.00 ? 36 CYS A CA   4  
ATOM 3148  C C    . CYS A 1 36 ? -1.782  -2.734  0.558   1.00 0.00 ? 36 CYS A C    4  
ATOM 3149  O O    . CYS A 1 36 ? -2.305  -2.835  1.666   1.00 0.00 ? 36 CYS A O    4  
ATOM 3150  C CB   . CYS A 1 36 ? -2.151  -3.049  -1.931  1.00 0.00 ? 36 CYS A CB   4  
ATOM 3151  S SG   . CYS A 1 36 ? -0.868  -3.638  -3.096  1.00 0.00 ? 36 CYS A SG   4  
ATOM 3152  H H    . CYS A 1 36 ? -3.752  -4.145  0.677   1.00 0.00 ? 36 CYS A H    4  
ATOM 3153  H HA   . CYS A 1 36 ? -1.396  -4.528  -0.603  1.00 0.00 ? 36 CYS A HA   4  
ATOM 3154  H HB2  . CYS A 1 36 ? -3.131  -3.206  -2.382  1.00 0.00 ? 36 CYS A HB2  4  
ATOM 3155  H HB3  . CYS A 1 36 ? -2.031  -1.974  -1.795  1.00 0.00 ? 36 CYS A HB3  4  
ATOM 3156  N N    . CYS A 1 37 ? -0.902  -1.801  0.225   1.00 0.00 ? 37 CYS A N    4  
ATOM 3157  C CA   . CYS A 1 37 ? -0.479  -0.796  1.185   1.00 0.00 ? 37 CYS A CA   4  
ATOM 3158  C C    . CYS A 1 37 ? -0.833  0.583   0.624   1.00 0.00 ? 37 CYS A C    4  
ATOM 3159  O O    . CYS A 1 37 ? -0.898  0.764   -0.591  1.00 0.00 ? 37 CYS A O    4  
ATOM 3160  C CB   . CYS A 1 37 ? 1.012   -0.914  1.509   1.00 0.00 ? 37 CYS A CB   4  
ATOM 3161  S SG   . CYS A 1 37 ? 1.408   -2.039  2.897   1.00 0.00 ? 37 CYS A SG   4  
ATOM 3162  H H    . CYS A 1 37 ? -0.481  -1.726  -0.679  1.00 0.00 ? 37 CYS A H    4  
ATOM 3163  H HA   . CYS A 1 37 ? -1.028  -0.991  2.106   1.00 0.00 ? 37 CYS A HA   4  
ATOM 3164  H HB2  . CYS A 1 37 ? 1.536   -1.260  0.619   1.00 0.00 ? 37 CYS A HB2  4  
ATOM 3165  H HB3  . CYS A 1 37 ? 1.398   0.078   1.742   1.00 0.00 ? 37 CYS A HB3  4  
ATOM 3166  N N    . PHE A 1 38 ? -1.053  1.519   1.535   1.00 0.00 ? 38 PHE A N    4  
ATOM 3167  C CA   . PHE A 1 38 ? -1.399  2.876   1.146   1.00 0.00 ? 38 PHE A CA   4  
ATOM 3168  C C    . PHE A 1 38 ? -0.342  3.871   1.629   1.00 0.00 ? 38 PHE A C    4  
ATOM 3169  O O    . PHE A 1 38 ? 0.575   3.502   2.362   1.00 0.00 ? 38 PHE A O    4  
ATOM 3170  C CB   . PHE A 1 38 ? -2.735  3.206   1.814   1.00 0.00 ? 38 PHE A CB   4  
ATOM 3171  C CG   . PHE A 1 38 ? -3.160  4.668   1.668   1.00 0.00 ? 38 PHE A CG   4  
ATOM 3172  C CD1  . PHE A 1 38 ? -3.765  5.089   0.525   1.00 0.00 ? 38 PHE A CD1  4  
ATOM 3173  C CD2  . PHE A 1 38 ? -2.932  5.547   2.680   1.00 0.00 ? 38 PHE A CD2  4  
ATOM 3174  C CE1  . PHE A 1 38 ? -4.159  6.447   0.389   1.00 0.00 ? 38 PHE A CE1  4  
ATOM 3175  C CE2  . PHE A 1 38 ? -3.326  6.905   2.544   1.00 0.00 ? 38 PHE A CE2  4  
ATOM 3176  C CZ   . PHE A 1 38 ? -3.931  7.326   1.402   1.00 0.00 ? 38 PHE A CZ   4  
ATOM 3177  H H    . PHE A 1 38 ? -0.998  1.363   2.521   1.00 0.00 ? 38 PHE A H    4  
ATOM 3178  H HA   . PHE A 1 38 ? -1.446  2.898   0.058   1.00 0.00 ? 38 PHE A HA   4  
ATOM 3179  H HB2  . PHE A 1 38 ? -3.510  2.568   1.388   1.00 0.00 ? 38 PHE A HB2  4  
ATOM 3180  H HB3  . PHE A 1 38 ? -2.670  2.961   2.875   1.00 0.00 ? 38 PHE A HB3  4  
ATOM 3181  H HD1  . PHE A 1 38 ? -3.948  4.385   -0.286  1.00 0.00 ? 38 PHE A HD1  4  
ATOM 3182  H HD2  . PHE A 1 38 ? -2.446  5.210   3.596   1.00 0.00 ? 38 PHE A HD2  4  
ATOM 3183  H HE1  . PHE A 1 38 ? -4.645  6.784   -0.527  1.00 0.00 ? 38 PHE A HE1  4  
ATOM 3184  H HE2  . PHE A 1 38 ? -3.143  7.609   3.356   1.00 0.00 ? 38 PHE A HE2  4  
ATOM 3185  H HZ   . PHE A 1 38 ? -4.234  8.368   1.297   1.00 0.00 ? 38 PHE A HZ   4  
ATOM 3186  N N    . ASP A 1 39 ? -0.504  5.113   1.198   1.00 0.00 ? 39 ASP A N    4  
ATOM 3187  C CA   . ASP A 1 39 ? 0.425   6.164   1.577   1.00 0.00 ? 39 ASP A CA   4  
ATOM 3188  C C    . ASP A 1 39 ? -0.010  7.481   0.931   1.00 0.00 ? 39 ASP A C    4  
ATOM 3189  O O    . ASP A 1 39 ? -0.529  7.488   -0.184  1.00 0.00 ? 39 ASP A O    4  
ATOM 3190  C CB   . ASP A 1 39 ? 1.842   5.847   1.096   1.00 0.00 ? 39 ASP A CB   4  
ATOM 3191  C CG   . ASP A 1 39 ? 2.888   6.917   1.415   1.00 0.00 ? 39 ASP A CG   4  
ATOM 3192  O OD1  . ASP A 1 39 ? 2.981   7.875   0.618   1.00 0.00 ? 39 ASP A OD1  4  
ATOM 3193  O OD2  . ASP A 1 39 ? 3.572   6.752   2.449   1.00 0.00 ? 39 ASP A OD2  4  
ATOM 3194  H H    . ASP A 1 39 ? -1.252  5.405   0.602   1.00 0.00 ? 39 ASP A H    4  
ATOM 3195  H HA   . ASP A 1 39 ? 0.387   6.201   2.666   1.00 0.00 ? 39 ASP A HA   4  
ATOM 3196  H HB2  . ASP A 1 39 ? 2.159   4.905   1.543   1.00 0.00 ? 39 ASP A HB2  4  
ATOM 3197  H HB3  . ASP A 1 39 ? 1.817   5.695   0.017   1.00 0.00 ? 39 ASP A HB3  4  
ATOM 3198  N N    . SER A 1 40 ? 0.217   8.564   1.660   1.00 0.00 ? 40 SER A N    4  
ATOM 3199  C CA   . SER A 1 40 ? -0.145  9.884   1.171   1.00 0.00 ? 40 SER A CA   4  
ATOM 3200  C C    . SER A 1 40 ? 0.943   10.895  1.540   1.00 0.00 ? 40 SER A C    4  
ATOM 3201  O O    . SER A 1 40 ? 0.714   12.103  1.494   1.00 0.00 ? 40 SER A O    4  
ATOM 3202  C CB   . SER A 1 40 ? -1.496  10.329  1.736   1.00 0.00 ? 40 SER A CB   4  
ATOM 3203  O OG   . SER A 1 40 ? -1.467  10.451  3.155   1.00 0.00 ? 40 SER A OG   4  
ATOM 3204  H H    . SER A 1 40 ? 0.639   8.550   2.566   1.00 0.00 ? 40 SER A H    4  
ATOM 3205  H HA   . SER A 1 40 ? -0.221  9.781   0.089   1.00 0.00 ? 40 SER A HA   4  
ATOM 3206  H HB2  . SER A 1 40 ? -1.776  11.286  1.295   1.00 0.00 ? 40 SER A HB2  4  
ATOM 3207  H HB3  . SER A 1 40 ? -2.263  9.610   1.449   1.00 0.00 ? 40 SER A HB3  4  
ATOM 3208  H HG   . SER A 1 40 ? -2.400  10.479  3.515   1.00 0.00 ? 40 SER A HG   4  
ATOM 3209  N N    . ARG A 1 41 ? 2.103   10.364  1.896   1.00 0.00 ? 41 ARG A N    4  
ATOM 3210  C CA   . ARG A 1 41 ? 3.227   11.205  2.272   1.00 0.00 ? 41 ARG A CA   4  
ATOM 3211  C C    . ARG A 1 41 ? 3.667   12.065  1.085   1.00 0.00 ? 41 ARG A C    4  
ATOM 3212  O O    . ARG A 1 41 ? 4.103   13.201  1.265   1.00 0.00 ? 41 ARG A O    4  
ATOM 3213  C CB   . ARG A 1 41 ? 4.411   10.361  2.748   1.00 0.00 ? 41 ARG A CB   4  
ATOM 3214  C CG   . ARG A 1 41 ? 5.159   11.059  3.886   1.00 0.00 ? 41 ARG A CG   4  
ATOM 3215  C CD   . ARG A 1 41 ? 6.452   11.701  3.380   1.00 0.00 ? 41 ARG A CD   4  
ATOM 3216  N NE   . ARG A 1 41 ? 7.345   12.007  4.520   1.00 0.00 ? 41 ARG A NE   4  
ATOM 3217  C CZ   . ARG A 1 41 ? 8.512   12.656  4.407   1.00 0.00 ? 41 ARG A CZ   4  
ATOM 3218  N NH1  . ARG A 1 41 ? 8.934   13.070  3.204   1.00 0.00 ? 41 ARG A NH1  4  
ATOM 3219  N NH2  . ARG A 1 41 ? 9.256   12.891  5.496   1.00 0.00 ? 41 ARG A NH2  4  
ATOM 3220  H H    . ARG A 1 41 ? 2.281   9.381   1.931   1.00 0.00 ? 41 ARG A H    4  
ATOM 3221  H HA   . ARG A 1 41 ? 2.852   11.824  3.087   1.00 0.00 ? 41 ARG A HA   4  
ATOM 3222  H HB2  . ARG A 1 41 ? 4.056   9.387   3.085   1.00 0.00 ? 41 ARG A HB2  4  
ATOM 3223  H HB3  . ARG A 1 41 ? 5.092   10.182  1.916   1.00 0.00 ? 41 ARG A HB3  4  
ATOM 3224  H HG2  . ARG A 1 41 ? 4.520   11.821  4.332   1.00 0.00 ? 41 ARG A HG2  4  
ATOM 3225  H HG3  . ARG A 1 41 ? 5.389   10.337  4.670   1.00 0.00 ? 41 ARG A HG3  4  
ATOM 3226  H HD2  . ARG A 1 41 ? 6.954   11.028  2.685   1.00 0.00 ? 41 ARG A HD2  4  
ATOM 3227  H HD3  . ARG A 1 41 ? 6.224   12.614  2.830   1.00 0.00 ? 41 ARG A HD3  4  
ATOM 3228  H HE   . ARG A 1 41 ? 7.059   11.712  5.432   1.00 0.00 ? 41 ARG A HE   4  
ATOM 3229  H HH11 . ARG A 1 41 ? 8.379   12.895  2.392   1.00 0.00 ? 41 ARG A HH11 4  
ATOM 3230  H HH12 . ARG A 1 41 ? 9.806   13.554  3.120   1.00 0.00 ? 41 ARG A HH12 4  
ATOM 3231  H HH21 . ARG A 1 41 ? 8.941   12.582  6.393   1.00 0.00 ? 41 ARG A HH21 4  
ATOM 3232  H HH22 . ARG A 1 41 ? 10.127  13.375  5.412   1.00 0.00 ? 41 ARG A HH22 4  
ATOM 3233  N N    . ILE A 1 42 ? 3.537   11.490  -0.101  1.00 0.00 ? 42 ILE A N    4  
ATOM 3234  C CA   . ILE A 1 42 ? 3.915   12.190  -1.317  1.00 0.00 ? 42 ILE A CA   4  
ATOM 3235  C C    . ILE A 1 42 ? 3.131   11.613  -2.498  1.00 0.00 ? 42 ILE A C    4  
ATOM 3236  O O    . ILE A 1 42 ? 3.100   10.399  -2.693  1.00 0.00 ? 42 ILE A O    4  
ATOM 3237  C CB   . ILE A 1 42 ? 5.433   12.150  -1.508  1.00 0.00 ? 42 ILE A CB   4  
ATOM 3238  C CG1  . ILE A 1 42 ? 6.046   10.956  -0.774  1.00 0.00 ? 42 ILE A CG1  4  
ATOM 3239  C CG2  . ILE A 1 42 ? 6.074   13.473  -1.086  1.00 0.00 ? 42 ILE A CG2  4  
ATOM 3240  C CD1  . ILE A 1 42 ? 5.498   9.636   -1.320  1.00 0.00 ? 42 ILE A CD1  4  
ATOM 3241  H H    . ILE A 1 42 ? 3.181   10.566  -0.239  1.00 0.00 ? 42 ILE A H    4  
ATOM 3242  H HA   . ILE A 1 42 ? 3.633   13.236  -1.194  1.00 0.00 ? 42 ILE A HA   4  
ATOM 3243  H HB   . ILE A 1 42 ? 5.640   12.016  -2.570  1.00 0.00 ? 42 ILE A HB   4  
ATOM 3244  H HG12 . ILE A 1 42 ? 7.131   10.976  -0.883  1.00 0.00 ? 42 ILE A HG12 4  
ATOM 3245  H HG13 . ILE A 1 42 ? 5.832   11.030  0.292   1.00 0.00 ? 42 ILE A HG13 4  
ATOM 3246  H HG21 . ILE A 1 42 ? 5.358   14.054  -0.504  1.00 0.00 ? 42 ILE A HG21 4  
ATOM 3247  H HG22 . ILE A 1 42 ? 6.957   13.272  -0.479  1.00 0.00 ? 42 ILE A HG22 4  
ATOM 3248  H HG23 . ILE A 1 42 ? 6.363   14.037  -1.973  1.00 0.00 ? 42 ILE A HG23 4  
ATOM 3249  H HD11 . ILE A 1 42 ? 5.310   9.735   -2.389  1.00 0.00 ? 42 ILE A HD11 4  
ATOM 3250  H HD12 . ILE A 1 42 ? 6.226   8.842   -1.151  1.00 0.00 ? 42 ILE A HD12 4  
ATOM 3251  H HD13 . ILE A 1 42 ? 4.567   9.390   -0.809  1.00 0.00 ? 42 ILE A HD13 4  
ATOM 3252  N N    . PRO A 1 43 ? 2.501   12.534  -3.274  1.00 0.00 ? 43 PRO A N    4  
ATOM 3253  C CA   . PRO A 1 43 ? 1.719   12.129  -4.430  1.00 0.00 ? 43 PRO A CA   4  
ATOM 3254  C C    . PRO A 1 43 ? 2.628   11.721  -5.592  1.00 0.00 ? 43 PRO A C    4  
ATOM 3255  O O    . PRO A 1 43 ? 2.285   10.835  -6.372  1.00 0.00 ? 43 PRO A O    4  
ATOM 3256  C CB   . PRO A 1 43 ? 0.845   13.330  -4.754  1.00 0.00 ? 43 PRO A CB   4  
ATOM 3257  C CG   . PRO A 1 43 ? 1.496   14.517  -4.064  1.00 0.00 ? 43 PRO A CG   4  
ATOM 3258  C CD   . PRO A 1 43 ? 2.515   13.980  -3.074  1.00 0.00 ? 43 PRO A CD   4  
ATOM 3259  H HA   . PRO A 1 43 ? 1.173   11.320  -4.214  1.00 0.00 ? 43 PRO A HA   4  
ATOM 3260  H HB2  . PRO A 1 43 ? 0.783   13.489  -5.831  1.00 0.00 ? 43 PRO A HB2  4  
ATOM 3261  H HB3  . PRO A 1 43 ? -0.173  13.179  -4.395  1.00 0.00 ? 43 PRO A HB3  4  
ATOM 3262  H HG2  . PRO A 1 43 ? 1.979   15.166  -4.796  1.00 0.00 ? 43 PRO A HG2  4  
ATOM 3263  H HG3  . PRO A 1 43 ? 0.746   15.119  -3.552  1.00 0.00 ? 43 PRO A HG3  4  
ATOM 3264  H HD2  . PRO A 1 43 ? 3.506   14.396  -3.260  1.00 0.00 ? 43 PRO A HD2  4  
ATOM 3265  H HD3  . PRO A 1 43 ? 2.248   14.240  -2.050  1.00 0.00 ? 43 PRO A HD3  4  
ATOM 3266  N N    . GLY A 1 44 ? 3.770   12.388  -5.669  1.00 0.00 ? 44 GLY A N    4  
ATOM 3267  C CA   . GLY A 1 44 ? 4.732   12.107  -6.722  1.00 0.00 ? 44 GLY A CA   4  
ATOM 3268  C C    . GLY A 1 44 ? 4.918   10.599  -6.905  1.00 0.00 ? 44 GLY A C    4  
ATOM 3269  O O    . GLY A 1 44 ? 5.245   10.138  -7.998  1.00 0.00 ? 44 GLY A O    4  
ATOM 3270  H H    . GLY A 1 44 ? 4.042   13.108  -5.031  1.00 0.00 ? 44 GLY A H    4  
ATOM 3271  H HA2  . GLY A 1 44 ? 4.392   12.551  -7.658  1.00 0.00 ? 44 GLY A HA2  4  
ATOM 3272  H HA3  . GLY A 1 44 ? 5.688   12.568  -6.479  1.00 0.00 ? 44 GLY A HA3  4  
ATOM 3273  N N    . VAL A 1 45 ? 4.703   9.872   -5.818  1.00 0.00 ? 45 VAL A N    4  
ATOM 3274  C CA   . VAL A 1 45 ? 4.843   8.426   -5.845  1.00 0.00 ? 45 VAL A CA   4  
ATOM 3275  C C    . VAL A 1 45 ? 3.455   7.783   -5.813  1.00 0.00 ? 45 VAL A C    4  
ATOM 3276  O O    . VAL A 1 45 ? 2.453   8.470   -5.624  1.00 0.00 ? 45 VAL A O    4  
ATOM 3277  C CB   . VAL A 1 45 ? 5.742   7.967   -4.695  1.00 0.00 ? 45 VAL A CB   4  
ATOM 3278  C CG1  . VAL A 1 45 ? 6.721   9.070   -4.290  1.00 0.00 ? 45 VAL A CG1  4  
ATOM 3279  C CG2  . VAL A 1 45 ? 4.909   7.506   -3.498  1.00 0.00 ? 45 VAL A CG2  4  
ATOM 3280  H H    . VAL A 1 45 ? 4.437   10.255  -4.933  1.00 0.00 ? 45 VAL A H    4  
ATOM 3281  H HA   . VAL A 1 45 ? 5.332   8.161   -6.782  1.00 0.00 ? 45 VAL A HA   4  
ATOM 3282  H HB   . VAL A 1 45 ? 6.325   7.115   -5.046  1.00 0.00 ? 45 VAL A HB   4  
ATOM 3283  H HG11 . VAL A 1 45 ? 6.179   10.007  -4.160  1.00 0.00 ? 45 VAL A HG11 4  
ATOM 3284  H HG12 . VAL A 1 45 ? 7.207   8.799   -3.353  1.00 0.00 ? 45 VAL A HG12 4  
ATOM 3285  H HG13 . VAL A 1 45 ? 7.475   9.192   -5.068  1.00 0.00 ? 45 VAL A HG13 4  
ATOM 3286  H HG21 . VAL A 1 45 ? 4.005   8.110   -3.430  1.00 0.00 ? 45 VAL A HG21 4  
ATOM 3287  H HG22 . VAL A 1 45 ? 4.637   6.458   -3.627  1.00 0.00 ? 45 VAL A HG22 4  
ATOM 3288  H HG23 . VAL A 1 45 ? 5.492   7.620   -2.584  1.00 0.00 ? 45 VAL A HG23 4  
ATOM 3289  N N    . PRO A 1 46 ? 3.442   6.437   -6.005  1.00 0.00 ? 46 PRO A N    4  
ATOM 3290  C CA   . PRO A 1 46 ? 2.193   5.693   -6.000  1.00 0.00 ? 46 PRO A CA   4  
ATOM 3291  C C    . PRO A 1 46 ? 1.658   5.530   -4.576  1.00 0.00 ? 46 PRO A C    4  
ATOM 3292  O O    . PRO A 1 46 ? 1.971   4.551   -3.899  1.00 0.00 ? 46 PRO A O    4  
ATOM 3293  C CB   . PRO A 1 46 ? 2.523   4.367   -6.666  1.00 0.00 ? 46 PRO A CB   4  
ATOM 3294  C CG   . PRO A 1 46 ? 4.035   4.232   -6.600  1.00 0.00 ? 46 PRO A CG   4  
ATOM 3295  C CD   . PRO A 1 46 ? 4.609   5.590   -6.232  1.00 0.00 ? 46 PRO A CD   4  
ATOM 3296  H HA   . PRO A 1 46 ? 1.488   6.194   -6.501  1.00 0.00 ? 46 PRO A HA   4  
ATOM 3297  H HB2  . PRO A 1 46 ? 2.034   3.539   -6.152  1.00 0.00 ? 46 PRO A HB2  4  
ATOM 3298  H HB3  . PRO A 1 46 ? 2.174   4.351   -7.698  1.00 0.00 ? 46 PRO A HB3  4  
ATOM 3299  H HG2  . PRO A 1 46 ? 4.320   3.484   -5.859  1.00 0.00 ? 46 PRO A HG2  4  
ATOM 3300  H HG3  . PRO A 1 46 ? 4.431   3.897   -7.559  1.00 0.00 ? 46 PRO A HG3  4  
ATOM 3301  H HD2  . PRO A 1 46 ? 5.233   5.528   -5.340  1.00 0.00 ? 46 PRO A HD2  4  
ATOM 3302  H HD3  . PRO A 1 46 ? 5.236   5.985   -7.031  1.00 0.00 ? 46 PRO A HD3  4  
ATOM 3303  N N    . TRP A 1 47 ? 0.860   6.503   -4.162  1.00 0.00 ? 47 TRP A N    4  
ATOM 3304  C CA   . TRP A 1 47 ? 0.279   6.480   -2.831  1.00 0.00 ? 47 TRP A CA   4  
ATOM 3305  C C    . TRP A 1 47 ? 0.071   5.018   -2.431  1.00 0.00 ? 47 TRP A C    4  
ATOM 3306  O O    . TRP A 1 47 ? 0.561   4.579   -1.391  1.00 0.00 ? 47 TRP A O    4  
ATOM 3307  C CB   . TRP A 1 47 ? -1.010  7.302   -2.781  1.00 0.00 ? 47 TRP A CB   4  
ATOM 3308  C CG   . TRP A 1 47 ? -0.794  8.779   -2.446  1.00 0.00 ? 47 TRP A CG   4  
ATOM 3309  C CD1  . TRP A 1 47 ? 0.287   9.532   -2.693  1.00 0.00 ? 47 TRP A CD1  4  
ATOM 3310  C CD2  . TRP A 1 47 ? -1.731  9.658   -1.788  1.00 0.00 ? 47 TRP A CD2  4  
ATOM 3311  N NE1  . TRP A 1 47 ? 0.116   10.826  -2.244  1.00 0.00 ? 47 TRP A NE1  4  
ATOM 3312  C CE2  . TRP A 1 47 ? -1.151  10.905  -1.676  1.00 0.00 ? 47 TRP A CE2  4  
ATOM 3313  C CE3  . TRP A 1 47 ? -3.027  9.407   -1.303  1.00 0.00 ? 47 TRP A CE3  4  
ATOM 3314  C CZ2  . TRP A 1 47 ? -1.792  11.999  -1.083  1.00 0.00 ? 47 TRP A CZ2  4  
ATOM 3315  C CZ3  . TRP A 1 47 ? -3.654  10.511  -0.713  1.00 0.00 ? 47 TRP A CZ3  4  
ATOM 3316  C CH2  . TRP A 1 47 ? -3.083  11.772  -0.593  1.00 0.00 ? 47 TRP A CH2  4  
ATOM 3317  H H    . TRP A 1 47 ? 0.611   7.296   -4.719  1.00 0.00 ? 47 TRP A H    4  
ATOM 3318  H HA   . TRP A 1 47 ? 0.985   6.956   -2.150  1.00 0.00 ? 47 TRP A HA   4  
ATOM 3319  H HB2  . TRP A 1 47 ? -1.513  7.229   -3.746  1.00 0.00 ? 47 TRP A HB2  4  
ATOM 3320  H HB3  . TRP A 1 47 ? -1.679  6.866   -2.039  1.00 0.00 ? 47 TRP A HB3  4  
ATOM 3321  H HD1  . TRP A 1 47 ? 1.188   9.168   -3.187  1.00 0.00 ? 47 TRP A HD1  4  
ATOM 3322  H HE1  . TRP A 1 47 ? 0.840   11.636  -2.321  1.00 0.00 ? 47 TRP A HE1  4  
ATOM 3323  H HE3  . TRP A 1 47 ? -3.507  8.432   -1.379  1.00 0.00 ? 47 TRP A HE3  4  
ATOM 3324  H HZ2  . TRP A 1 47 ? -1.311  12.974  -1.007  1.00 0.00 ? 47 TRP A HZ2  4  
ATOM 3325  H HZ3  . TRP A 1 47 ? -4.661  10.371  -0.320  1.00 0.00 ? 47 TRP A HZ3  4  
ATOM 3326  H HH2  . TRP A 1 47 ? -3.639  12.582  -0.119  1.00 0.00 ? 47 TRP A HH2  4  
ATOM 3327  N N    . CYS A 1 48 ? -0.655  4.303   -3.278  1.00 0.00 ? 48 CYS A N    4  
ATOM 3328  C CA   . CYS A 1 48 ? -0.933  2.900   -3.026  1.00 0.00 ? 48 CYS A CA   4  
ATOM 3329  C C    . CYS A 1 48 ? 0.145   2.064   -3.720  1.00 0.00 ? 48 CYS A C    4  
ATOM 3330  O O    . CYS A 1 48 ? 0.208   2.022   -4.947  1.00 0.00 ? 48 CYS A O    4  
ATOM 3331  C CB   . CYS A 1 48 ? -2.340  2.511   -3.485  1.00 0.00 ? 48 CYS A CB   4  
ATOM 3332  S SG   . CYS A 1 48 ? -3.029  1.024   -2.671  1.00 0.00 ? 48 CYS A SG   4  
ATOM 3333  H H    . CYS A 1 48 ? -1.050  4.668   -4.122  1.00 0.00 ? 48 CYS A H    4  
ATOM 3334  H HA   . CYS A 1 48 ? -0.895  2.762   -1.946  1.00 0.00 ? 48 CYS A HA   4  
ATOM 3335  H HB2  . CYS A 1 48 ? -3.011  3.350   -3.305  1.00 0.00 ? 48 CYS A HB2  4  
ATOM 3336  H HB3  . CYS A 1 48 ? -2.322  2.343   -4.562  1.00 0.00 ? 48 CYS A HB3  4  
ATOM 3337  N N    . PHE A 1 49 ? 0.966   1.421   -2.903  1.00 0.00 ? 49 PHE A N    4  
ATOM 3338  C CA   . PHE A 1 49 ? 2.038   0.589   -3.423  1.00 0.00 ? 49 PHE A CA   4  
ATOM 3339  C C    . PHE A 1 49 ? 2.077   -0.764  -2.709  1.00 0.00 ? 49 PHE A C    4  
ATOM 3340  O O    . PHE A 1 49 ? 1.481   -0.927  -1.646  1.00 0.00 ? 49 PHE A O    4  
ATOM 3341  C CB   . PHE A 1 49 ? 3.349   1.330   -3.156  1.00 0.00 ? 49 PHE A CB   4  
ATOM 3342  C CG   . PHE A 1 49 ? 3.466   1.897   -1.739  1.00 0.00 ? 49 PHE A CG   4  
ATOM 3343  C CD1  . PHE A 1 49 ? 3.602   1.056   -0.679  1.00 0.00 ? 49 PHE A CD1  4  
ATOM 3344  C CD2  . PHE A 1 49 ? 3.435   3.242   -1.540  1.00 0.00 ? 49 PHE A CD2  4  
ATOM 3345  C CE1  . PHE A 1 49 ? 3.711   1.582   0.635   1.00 0.00 ? 49 PHE A CE1  4  
ATOM 3346  C CE2  . PHE A 1 49 ? 3.544   3.768   -0.226  1.00 0.00 ? 49 PHE A CE2  4  
ATOM 3347  C CZ   . PHE A 1 49 ? 3.680   2.927   0.834   1.00 0.00 ? 49 PHE A CZ   4  
ATOM 3348  H H    . PHE A 1 49 ? 0.907   1.461   -1.905  1.00 0.00 ? 49 PHE A H    4  
ATOM 3349  H HA   . PHE A 1 49 ? 1.841   0.433   -4.483  1.00 0.00 ? 49 PHE A HA   4  
ATOM 3350  H HB2  . PHE A 1 49 ? 4.182   0.651   -3.334  1.00 0.00 ? 49 PHE A HB2  4  
ATOM 3351  H HB3  . PHE A 1 49 ? 3.445   2.147   -3.871  1.00 0.00 ? 49 PHE A HB3  4  
ATOM 3352  H HD1  . PHE A 1 49 ? 3.627   -0.022  -0.839  1.00 0.00 ? 49 PHE A HD1  4  
ATOM 3353  H HD2  . PHE A 1 49 ? 3.327   3.916   -2.390  1.00 0.00 ? 49 PHE A HD2  4  
ATOM 3354  H HE1  . PHE A 1 49 ? 3.819   0.907   1.485   1.00 0.00 ? 49 PHE A HE1  4  
ATOM 3355  H HE2  . PHE A 1 49 ? 3.519   4.846   -0.066  1.00 0.00 ? 49 PHE A HE2  4  
ATOM 3356  H HZ   . PHE A 1 49 ? 3.763   3.330   1.844   1.00 0.00 ? 49 PHE A HZ   4  
ATOM 3357  N N    . LYS A 1 50 ? 2.785   -1.701  -3.323  1.00 0.00 ? 50 LYS A N    4  
ATOM 3358  C CA   . LYS A 1 50 ? 2.909   -3.035  -2.760  1.00 0.00 ? 50 LYS A CA   4  
ATOM 3359  C C    . LYS A 1 50 ? 3.657   -2.953  -1.428  1.00 0.00 ? 50 LYS A C    4  
ATOM 3360  O O    . LYS A 1 50 ? 4.329   -1.962  -1.149  1.00 0.00 ? 50 LYS A O    4  
ATOM 3361  C CB   . LYS A 1 50 ? 3.555   -3.985  -3.771  1.00 0.00 ? 50 LYS A CB   4  
ATOM 3362  C CG   . LYS A 1 50 ? 2.812   -3.950  -5.108  1.00 0.00 ? 50 LYS A CG   4  
ATOM 3363  C CD   . LYS A 1 50 ? 3.087   -5.217  -5.921  1.00 0.00 ? 50 LYS A CD   4  
ATOM 3364  C CE   . LYS A 1 50 ? 2.207   -6.375  -5.448  1.00 0.00 ? 50 LYS A CE   4  
ATOM 3365  N NZ   . LYS A 1 50 ? 2.012   -7.357  -6.538  1.00 0.00 ? 50 LYS A NZ   4  
ATOM 3366  H H    . LYS A 1 50 ? 3.266   -1.561  -4.188  1.00 0.00 ? 50 LYS A H    4  
ATOM 3367  H HA   . LYS A 1 50 ? 1.902   -3.404  -2.569  1.00 0.00 ? 50 LYS A HA   4  
ATOM 3368  H HB2  . LYS A 1 50 ? 4.598   -3.706  -3.923  1.00 0.00 ? 50 LYS A HB2  4  
ATOM 3369  H HB3  . LYS A 1 50 ? 3.551   -5.000  -3.375  1.00 0.00 ? 50 LYS A HB3  4  
ATOM 3370  H HG2  . LYS A 1 50 ? 1.741   -3.854  -4.931  1.00 0.00 ? 50 LYS A HG2  4  
ATOM 3371  H HG3  . LYS A 1 50 ? 3.121   -3.074  -5.678  1.00 0.00 ? 50 LYS A HG3  4  
ATOM 3372  H HD2  . LYS A 1 50 ? 2.902   -5.023  -6.978  1.00 0.00 ? 50 LYS A HD2  4  
ATOM 3373  H HD3  . LYS A 1 50 ? 4.138   -5.492  -5.828  1.00 0.00 ? 50 LYS A HD3  4  
ATOM 3374  H HE2  . LYS A 1 50 ? 2.669   -6.863  -4.589  1.00 0.00 ? 50 LYS A HE2  4  
ATOM 3375  H HE3  . LYS A 1 50 ? 1.241   -5.994  -5.117  1.00 0.00 ? 50 LYS A HE3  4  
ATOM 3376  H HZ1  . LYS A 1 50 ? 2.902   -7.635  -6.900  1.00 0.00 ? 50 LYS A HZ1  4  
ATOM 3377  H HZ2  . LYS A 1 50 ? 1.532   -8.159  -6.182  1.00 0.00 ? 50 LYS A HZ2  4  
ATOM 3378  H HZ3  . LYS A 1 50 ? 1.470   -6.941  -7.268  1.00 0.00 ? 50 LYS A HZ3  4  
ATOM 3379  N N    . PRO A 1 51 ? 3.511   -4.037  -0.620  1.00 0.00 ? 51 PRO A N    4  
ATOM 3380  C CA   . PRO A 1 51 ? 4.164   -4.098  0.676   1.00 0.00 ? 51 PRO A CA   4  
ATOM 3381  C C    . PRO A 1 51 ? 5.662   -4.371  0.523   1.00 0.00 ? 51 PRO A C    4  
ATOM 3382  O O    . PRO A 1 51 ? 6.056   -5.367  -0.081  1.00 0.00 ? 51 PRO A O    4  
ATOM 3383  C CB   . PRO A 1 51 ? 3.435   -5.196  1.434   1.00 0.00 ? 51 PRO A CB   4  
ATOM 3384  C CG   . PRO A 1 51 ? 2.714   -6.021  0.380   1.00 0.00 ? 51 PRO A CG   4  
ATOM 3385  C CD   . PRO A 1 51 ? 2.722   -5.230  -0.918  1.00 0.00 ? 51 PRO A CD   4  
ATOM 3386  H HA   . PRO A 1 51 ? 4.094   -3.216  1.142   1.00 0.00 ? 51 PRO A HA   4  
ATOM 3387  H HB2  . PRO A 1 51 ? 4.134   -5.810  2.000   1.00 0.00 ? 51 PRO A HB2  4  
ATOM 3388  H HB3  . PRO A 1 51 ? 2.730   -4.774  2.150   1.00 0.00 ? 51 PRO A HB3  4  
ATOM 3389  H HG2  . PRO A 1 51 ? 3.208   -6.983  0.244   1.00 0.00 ? 51 PRO A HG2  4  
ATOM 3390  H HG3  . PRO A 1 51 ? 1.691   -6.230  0.693   1.00 0.00 ? 51 PRO A HG3  4  
ATOM 3391  H HD2  . PRO A 1 51 ? 3.166   -5.805  -1.730  1.00 0.00 ? 51 PRO A HD2  4  
ATOM 3392  H HD3  . PRO A 1 51 ? 1.711   -4.968  -1.228  1.00 0.00 ? 51 PRO A HD3  4  
ATOM 3393  N N    . LEU A 1 52 ? 6.456   -3.468  1.081   1.00 0.00 ? 52 LEU A N    4  
ATOM 3394  C CA   . LEU A 1 52 ? 7.901   -3.600  1.013   1.00 0.00 ? 52 LEU A CA   4  
ATOM 3395  C C    . LEU A 1 52 ? 8.282   -5.076  1.141   1.00 0.00 ? 52 LEU A C    4  
ATOM 3396  O O    . LEU A 1 52 ? 7.714   -5.799  1.958   1.00 0.00 ? 52 LEU A O    4  
ATOM 3397  C CB   . LEU A 1 52 ? 8.570   -2.700  2.055   1.00 0.00 ? 52 LEU A CB   4  
ATOM 3398  C CG   . LEU A 1 52 ? 10.033  -3.015  2.373   1.00 0.00 ? 52 LEU A CG   4  
ATOM 3399  C CD1  . LEU A 1 52 ? 10.690  -1.860  3.131   1.00 0.00 ? 52 LEU A CD1  4  
ATOM 3400  C CD2  . LEU A 1 52 ? 10.157  -4.340  3.128   1.00 0.00 ? 52 LEU A CD2  4  
ATOM 3401  H H    . LEU A 1 52 ? 6.127   -2.661  1.570   1.00 0.00 ? 52 LEU A H    4  
ATOM 3402  H HA   . LEU A 1 52 ? 8.216   -3.245  0.032   1.00 0.00 ? 52 LEU A HA   4  
ATOM 3403  H HB2  . LEU A 1 52 ? 8.508   -1.668  1.709   1.00 0.00 ? 52 LEU A HB2  4  
ATOM 3404  H HB3  . LEU A 1 52 ? 7.996   -2.761  2.980   1.00 0.00 ? 52 LEU A HB3  4  
ATOM 3405  H HG   . LEU A 1 52 ? 10.570  -3.130  1.432   1.00 0.00 ? 52 LEU A HG   4  
ATOM 3406  H HD11 . LEU A 1 52 ? 10.104  -0.952  2.989   1.00 0.00 ? 52 LEU A HD11 4  
ATOM 3407  H HD12 . LEU A 1 52 ? 10.736  -2.101  4.193   1.00 0.00 ? 52 LEU A HD12 4  
ATOM 3408  H HD13 . LEU A 1 52 ? 11.700  -1.703  2.751   1.00 0.00 ? 52 LEU A HD13 4  
ATOM 3409  H HD21 . LEU A 1 52 ? 9.163   -4.744  3.318   1.00 0.00 ? 52 LEU A HD21 4  
ATOM 3410  H HD22 . LEU A 1 52 ? 10.729  -5.048  2.528   1.00 0.00 ? 52 LEU A HD22 4  
ATOM 3411  H HD23 . LEU A 1 52 ? 10.668  -4.172  4.076   1.00 0.00 ? 52 LEU A HD23 4  
ATOM 3412  N N    . GLN A 1 53 ? 9.240   -5.480  0.320   1.00 0.00 ? 53 GLN A N    4  
ATOM 3413  C CA   . GLN A 1 53 ? 9.703   -6.857  0.331   1.00 0.00 ? 53 GLN A CA   4  
ATOM 3414  C C    . GLN A 1 53 ? 10.261  -7.219  1.709   1.00 0.00 ? 53 GLN A C    4  
ATOM 3415  O O    . GLN A 1 53 ? 11.473  -7.208  1.914   1.00 0.00 ? 53 GLN A O    4  
ATOM 3416  C CB   . GLN A 1 53 ? 10.747  -7.093  -0.762  1.00 0.00 ? 53 GLN A CB   4  
ATOM 3417  C CG   . GLN A 1 53 ? 11.803  -5.986  -0.761  1.00 0.00 ? 53 GLN A CG   4  
ATOM 3418  C CD   . GLN A 1 53 ? 11.499  -4.938  -1.833  1.00 0.00 ? 53 GLN A CD   4  
ATOM 3419  O OE1  . GLN A 1 53 ? 11.406  -5.229  -3.014  1.00 0.00 ? 53 GLN A OE1  4  
ATOM 3420  N NE2  . GLN A 1 53 ? 11.352  -3.704  -1.357  1.00 0.00 ? 53 GLN A NE2  4  
ATOM 3421  H H    . GLN A 1 53 ? 9.697   -4.886  -0.342  1.00 0.00 ? 53 GLN A H    4  
ATOM 3422  H HA   . GLN A 1 53 ? 8.821   -7.461  0.118   1.00 0.00 ? 53 GLN A HA   4  
ATOM 3423  H HB2  . GLN A 1 53 ? 11.228  -8.059  -0.609  1.00 0.00 ? 53 GLN A HB2  4  
ATOM 3424  H HB3  . GLN A 1 53 ? 10.258  -7.133  -1.736  1.00 0.00 ? 53 GLN A HB3  4  
ATOM 3425  H HG2  . GLN A 1 53 ? 11.834  -5.510  0.219   1.00 0.00 ? 53 GLN A HG2  4  
ATOM 3426  H HG3  . GLN A 1 53 ? 12.788  -6.418  -0.937  1.00 0.00 ? 53 GLN A HG3  4  
ATOM 3427  H HE21 . GLN A 1 53 ? 11.441  -3.533  -0.376  1.00 0.00 ? 53 GLN A HE21 4  
ATOM 3428  H HE22 . GLN A 1 53 ? 11.151  -2.949  -1.981  1.00 0.00 ? 53 GLN A HE22 4  
ATOM 3429  N N    . GLU A 1 54 ? 9.348   -7.532  2.617   1.00 0.00 ? 54 GLU A N    4  
ATOM 3430  C CA   . GLU A 1 54 ? 9.734   -7.897  3.970   1.00 0.00 ? 54 GLU A CA   4  
ATOM 3431  C C    . GLU A 1 54 ? 10.729  -9.059  3.944   1.00 0.00 ? 54 GLU A C    4  
ATOM 3432  O O    . GLU A 1 54 ? 10.333  -10.218 3.831   1.00 0.00 ? 54 GLU A O    4  
ATOM 3433  C CB   . GLU A 1 54 ? 8.507   -8.245  4.815   1.00 0.00 ? 54 GLU A CB   4  
ATOM 3434  C CG   . GLU A 1 54 ? 7.677   -9.345  4.149   1.00 0.00 ? 54 GLU A CG   4  
ATOM 3435  C CD   . GLU A 1 54 ? 6.333   -8.798  3.661   1.00 0.00 ? 54 GLU A CD   4  
ATOM 3436  O OE1  . GLU A 1 54 ? 5.422   -8.691  4.510   1.00 0.00 ? 54 GLU A OE1  4  
ATOM 3437  O OE2  . GLU A 1 54 ? 6.248   -8.500  2.450   1.00 0.00 ? 54 GLU A OE2  4  
ATOM 3438  H H    . GLU A 1 54 ? 8.364   -7.539  2.442   1.00 0.00 ? 54 GLU A H    4  
ATOM 3439  H HA   . GLU A 1 54 ? 10.212  -7.009  4.384   1.00 0.00 ? 54 GLU A HA   4  
ATOM 3440  H HB2  . GLU A 1 54 ? 8.823   -8.573  5.805   1.00 0.00 ? 54 GLU A HB2  4  
ATOM 3441  H HB3  . GLU A 1 54 ? 7.893   -7.356  4.955   1.00 0.00 ? 54 GLU A HB3  4  
ATOM 3442  H HG2  . GLU A 1 54 ? 8.230   -9.764  3.308   1.00 0.00 ? 54 GLU A HG2  4  
ATOM 3443  H HG3  . GLU A 1 54 ? 7.508   -10.156 4.856   1.00 0.00 ? 54 GLU A HG3  4  
ATOM 3444  N N    . ALA A 1 55 ? 12.002  -8.708  4.049   1.00 0.00 ? 55 ALA A N    4  
ATOM 3445  C CA   . ALA A 1 55 ? 13.057  -9.707  4.039   1.00 0.00 ? 55 ALA A CA   4  
ATOM 3446  C C    . ALA A 1 55 ? 13.815  -9.656  5.367   1.00 0.00 ? 55 ALA A C    4  
ATOM 3447  O O    . ALA A 1 55 ? 13.384  -8.989  6.306   1.00 0.00 ? 55 ALA A O    4  
ATOM 3448  C CB   . ALA A 1 55 ? 13.972  -9.471  2.836   1.00 0.00 ? 55 ALA A CB   4  
ATOM 3449  H H    . ALA A 1 55 ? 12.316  -7.763  4.141   1.00 0.00 ? 55 ALA A H    4  
ATOM 3450  H HA   . ALA A 1 55 ? 12.587  -10.685 3.935   1.00 0.00 ? 55 ALA A HA   4  
ATOM 3451  H HB1  . ALA A 1 55 ? 14.825  -10.147 2.890   1.00 0.00 ? 55 ALA A HB1  4  
ATOM 3452  H HB2  . ALA A 1 55 ? 13.419  -9.657  1.916   1.00 0.00 ? 55 ALA A HB2  4  
ATOM 3453  H HB3  . ALA A 1 55 ? 14.326  -8.440  2.845   1.00 0.00 ? 55 ALA A HB3  4  
ATOM 3454  N N    . GLU A 1 56 ? 14.931  -10.371 5.403   1.00 0.00 ? 56 GLU A N    4  
ATOM 3455  C CA   . GLU A 1 56 ? 15.752  -10.415 6.600   1.00 0.00 ? 56 GLU A CA   4  
ATOM 3456  C C    . GLU A 1 56 ? 15.784  -9.042  7.274   1.00 0.00 ? 56 GLU A C    4  
ATOM 3457  O O    . GLU A 1 56 ? 16.110  -8.041  6.638   1.00 0.00 ? 56 GLU A O    4  
ATOM 3458  C CB   . GLU A 1 56 ? 17.167  -10.900 6.277   1.00 0.00 ? 56 GLU A CB   4  
ATOM 3459  C CG   . GLU A 1 56 ? 17.193  -12.415 6.068   1.00 0.00 ? 56 GLU A CG   4  
ATOM 3460  C CD   . GLU A 1 56 ? 17.093  -12.766 4.582   1.00 0.00 ? 56 GLU A CD   4  
ATOM 3461  O OE1  . GLU A 1 56 ? 17.996  -12.332 3.834   1.00 0.00 ? 56 GLU A OE1  4  
ATOM 3462  O OE2  . GLU A 1 56 ? 16.115  -13.459 4.227   1.00 0.00 ? 56 GLU A OE2  4  
ATOM 3463  H H    . GLU A 1 56 ? 15.274  -10.911 4.634   1.00 0.00 ? 56 GLU A H    4  
ATOM 3464  H HA   . GLU A 1 56 ? 15.269  -11.139 7.257   1.00 0.00 ? 56 GLU A HA   4  
ATOM 3465  H HB2  . GLU A 1 56 ? 17.530  -10.399 5.379   1.00 0.00 ? 56 GLU A HB2  4  
ATOM 3466  H HB3  . GLU A 1 56 ? 17.843  -10.629 7.088   1.00 0.00 ? 56 GLU A HB3  4  
ATOM 3467  H HG2  . GLU A 1 56 ? 18.115  -12.827 6.481   1.00 0.00 ? 56 GLU A HG2  4  
ATOM 3468  H HG3  . GLU A 1 56 ? 16.368  -12.875 6.610   1.00 0.00 ? 56 GLU A HG3  4  
ATOM 3469  N N    . CYS A 1 57 ? 15.439  -9.038  8.554   1.00 0.00 ? 57 CYS A N    4  
ATOM 3470  C CA   . CYS A 1 57 ? 15.424  -7.804  9.321   1.00 0.00 ? 57 CYS A CA   4  
ATOM 3471  C C    . CYS A 1 57 ? 16.829  -7.198  9.284   1.00 0.00 ? 57 CYS A C    4  
ATOM 3472  O O    . CYS A 1 57 ? 17.810  -7.909  9.076   1.00 0.00 ? 57 CYS A O    4  
ATOM 3473  C CB   . CYS A 1 57 ? 14.940  -8.035  10.754  1.00 0.00 ? 57 CYS A CB   4  
ATOM 3474  S SG   . CYS A 1 57 ? 13.448  -9.085  10.900  1.00 0.00 ? 57 CYS A SG   4  
ATOM 3475  H H    . CYS A 1 57 ? 15.175  -9.856  9.064   1.00 0.00 ? 57 CYS A H    4  
ATOM 3476  H HA   . CYS A 1 57 ? 14.705  -7.144  8.837   1.00 0.00 ? 57 CYS A HA   4  
ATOM 3477  H HB2  . CYS A 1 57 ? 15.746  -8.493  11.326  1.00 0.00 ? 57 CYS A HB2  4  
ATOM 3478  H HB3  . CYS A 1 57 ? 14.732  -7.068  11.212  1.00 0.00 ? 57 CYS A HB3  4  
ATOM 3479  N N    . THR A 1 58 ? 16.879  -5.890  9.489   1.00 0.00 ? 58 THR A N    4  
ATOM 3480  C CA   . THR A 1 58 ? 18.147  -5.180  9.482   1.00 0.00 ? 58 THR A CA   4  
ATOM 3481  C C    . THR A 1 58 ? 18.113  -4.018  10.477  1.00 0.00 ? 58 THR A C    4  
ATOM 3482  O O    . THR A 1 58 ? 18.952  -3.938  11.372  1.00 0.00 ? 58 THR A O    4  
ATOM 3483  C CB   . THR A 1 58 ? 18.436  -4.742  8.045   1.00 0.00 ? 58 THR A CB   4  
ATOM 3484  O OG1  . THR A 1 58 ? 18.775  -5.953  7.374   1.00 0.00 ? 58 THR A OG1  4  
ATOM 3485  C CG2  . THR A 1 58 ? 19.701  -3.888  7.936   1.00 0.00 ? 58 THR A CG2  4  
ATOM 3486  H H    . THR A 1 58 ? 16.076  -5.319  9.658   1.00 0.00 ? 58 THR A H    4  
ATOM 3487  H HA   . THR A 1 58 ? 18.926  -5.865  9.817   1.00 0.00 ? 58 THR A HA   4  
ATOM 3488  H HB   . THR A 1 58 ? 17.578  -4.224  7.616   1.00 0.00 ? 58 THR A HB   4  
ATOM 3489  H HG1  . THR A 1 58 ? 19.656  -6.292  7.705   1.00 0.00 ? 58 THR A HG1  4  
ATOM 3490  H HG21 . THR A 1 58 ? 20.009  -3.567  8.931   1.00 0.00 ? 58 THR A HG21 4  
ATOM 3491  H HG22 . THR A 1 58 ? 20.497  -4.476  7.480   1.00 0.00 ? 58 THR A HG22 4  
ATOM 3492  H HG23 . THR A 1 58 ? 19.496  -3.013  7.319   1.00 0.00 ? 58 THR A HG23 4  
ATOM 3493  N N    . PHE A 1 59 ? 17.134  -3.146  10.285  1.00 0.00 ? 59 PHE A N    4  
ATOM 3494  C CA   . PHE A 1 59 ? 16.980  -1.991  11.154  1.00 0.00 ? 59 PHE A CA   4  
ATOM 3495  C C    . PHE A 1 59 ? 15.858  -2.216  12.170  1.00 0.00 ? 59 PHE A C    4  
ATOM 3496  O O    . PHE A 1 59 ? 14.825  -2.796  11.841  1.00 0.00 ? 59 PHE A O    4  
ATOM 3497  C CB   . PHE A 1 59 ? 16.613  -0.805  10.261  1.00 0.00 ? 59 PHE A CB   4  
ATOM 3498  C CG   . PHE A 1 59 ? 16.090  0.412   11.026  1.00 0.00 ? 59 PHE A CG   4  
ATOM 3499  C CD1  . PHE A 1 59 ? 16.843  0.970   12.013  1.00 0.00 ? 59 PHE A CD1  4  
ATOM 3500  C CD2  . PHE A 1 59 ? 14.873  0.937   10.720  1.00 0.00 ? 59 PHE A CD2  4  
ATOM 3501  C CE1  . PHE A 1 59 ? 16.358  2.099   12.723  1.00 0.00 ? 59 PHE A CE1  4  
ATOM 3502  C CE2  . PHE A 1 59 ? 14.389  2.067   11.431  1.00 0.00 ? 59 PHE A CE2  4  
ATOM 3503  C CZ   . PHE A 1 59 ? 15.141  2.624   12.417  1.00 0.00 ? 59 PHE A CZ   4  
ATOM 3504  H H    . PHE A 1 59 ? 16.456  -3.218  9.554   1.00 0.00 ? 59 PHE A H    4  
ATOM 3505  H HA   . PHE A 1 59 ? 17.924  -1.855  11.682  1.00 0.00 ? 59 PHE A HA   4  
ATOM 3506  H HB2  . PHE A 1 59 ? 17.491  -0.510  9.686   1.00 0.00 ? 59 PHE A HB2  4  
ATOM 3507  H HB3  . PHE A 1 59 ? 15.856  -1.123  9.544   1.00 0.00 ? 59 PHE A HB3  4  
ATOM 3508  H HD1  . PHE A 1 59 ? 17.818  0.549   12.258  1.00 0.00 ? 59 PHE A HD1  4  
ATOM 3509  H HD2  . PHE A 1 59 ? 14.271  0.490   9.930   1.00 0.00 ? 59 PHE A HD2  4  
ATOM 3510  H HE1  . PHE A 1 59 ? 16.961  2.546   13.514  1.00 0.00 ? 59 PHE A HE1  4  
ATOM 3511  H HE2  . PHE A 1 59 ? 13.413  2.487   11.186  1.00 0.00 ? 59 PHE A HE2  4  
ATOM 3512  H HZ   . PHE A 1 59 ? 14.769  3.491   12.963  1.00 0.00 ? 59 PHE A HZ   4  
ATOM 3513  N N    . GLU A 1 1  ? 9.535   -13.862 18.684  1.00 0.00 ? 1  GLU A N    5  
ATOM 3514  C CA   . GLU A 1 1  ? 8.646   -13.139 19.578  1.00 0.00 ? 1  GLU A CA   5  
ATOM 3515  C C    . GLU A 1 1  ? 7.368   -12.732 18.841  1.00 0.00 ? 1  GLU A C    5  
ATOM 3516  O O    . GLU A 1 1  ? 6.948   -11.578 18.910  1.00 0.00 ? 1  GLU A O    5  
ATOM 3517  C CB   . GLU A 1 1  ? 9.346   -11.917 20.177  1.00 0.00 ? 1  GLU A CB   5  
ATOM 3518  C CG   . GLU A 1 1  ? 10.214  -12.314 21.372  1.00 0.00 ? 1  GLU A CG   5  
ATOM 3519  C CD   . GLU A 1 1  ? 10.497  -11.107 22.269  1.00 0.00 ? 1  GLU A CD   5  
ATOM 3520  O OE1  . GLU A 1 1  ? 10.919  -10.071 21.710  1.00 0.00 ? 1  GLU A OE1  5  
ATOM 3521  O OE2  . GLU A 1 1  ? 10.286  -11.247 23.493  1.00 0.00 ? 1  GLU A OE2  5  
ATOM 3522  H H    . GLU A 1 1  ? 10.397  -14.158 19.094  1.00 0.00 ? 1  GLU A H    5  
ATOM 3523  H HA   . GLU A 1 1  ? 8.405   -13.840 20.377  1.00 0.00 ? 1  GLU A HA   5  
ATOM 3524  H HB2  . GLU A 1 1  ? 9.963   -11.438 19.417  1.00 0.00 ? 1  GLU A HB2  5  
ATOM 3525  H HB3  . GLU A 1 1  ? 8.602   -11.185 20.490  1.00 0.00 ? 1  GLU A HB3  5  
ATOM 3526  H HG2  . GLU A 1 1  ? 9.711   -13.090 21.950  1.00 0.00 ? 1  GLU A HG2  5  
ATOM 3527  H HG3  . GLU A 1 1  ? 11.154  -12.738 21.019  1.00 0.00 ? 1  GLU A HG3  5  
ATOM 3528  N N    . GLU A 1 2  ? 6.786   -13.703 18.153  1.00 0.00 ? 2  GLU A N    5  
ATOM 3529  C CA   . GLU A 1 2  ? 5.564   -13.461 17.404  1.00 0.00 ? 2  GLU A CA   5  
ATOM 3530  C C    . GLU A 1 2  ? 5.804   -12.404 16.325  1.00 0.00 ? 2  GLU A C    5  
ATOM 3531  O O    . GLU A 1 2  ? 6.014   -12.738 15.159  1.00 0.00 ? 2  GLU A O    5  
ATOM 3532  C CB   . GLU A 1 2  ? 4.424   -13.045 18.335  1.00 0.00 ? 2  GLU A CB   5  
ATOM 3533  C CG   . GLU A 1 2  ? 3.942   -14.229 19.175  1.00 0.00 ? 2  GLU A CG   5  
ATOM 3534  C CD   . GLU A 1 2  ? 3.228   -13.750 20.441  1.00 0.00 ? 2  GLU A CD   5  
ATOM 3535  O OE1  . GLU A 1 2  ? 1.999   -13.536 20.353  1.00 0.00 ? 2  GLU A OE1  5  
ATOM 3536  O OE2  . GLU A 1 2  ? 3.927   -13.607 21.467  1.00 0.00 ? 2  GLU A OE2  5  
ATOM 3537  H H    . GLU A 1 2  ? 7.134   -14.639 18.102  1.00 0.00 ? 2  GLU A H    5  
ATOM 3538  H HA   . GLU A 1 2  ? 5.315   -14.415 16.939  1.00 0.00 ? 2  GLU A HA   5  
ATOM 3539  H HB2  . GLU A 1 2  ? 4.760   -12.242 18.992  1.00 0.00 ? 2  GLU A HB2  5  
ATOM 3540  H HB3  . GLU A 1 2  ? 3.595   -12.650 17.747  1.00 0.00 ? 2  GLU A HB3  5  
ATOM 3541  H HG2  . GLU A 1 2  ? 3.266   -14.848 18.584  1.00 0.00 ? 2  GLU A HG2  5  
ATOM 3542  H HG3  . GLU A 1 2  ? 4.791   -14.856 19.448  1.00 0.00 ? 2  GLU A HG3  5  
ATOM 3543  N N    . TYR A 1 3  ? 5.766   -11.150 16.750  1.00 0.00 ? 3  TYR A N    5  
ATOM 3544  C CA   . TYR A 1 3  ? 5.976   -10.042 15.835  1.00 0.00 ? 3  TYR A CA   5  
ATOM 3545  C C    . TYR A 1 3  ? 4.978   -10.091 14.676  1.00 0.00 ? 3  TYR A C    5  
ATOM 3546  O O    . TYR A 1 3  ? 4.376   -11.131 14.415  1.00 0.00 ? 3  TYR A O    5  
ATOM 3547  C CB   . TYR A 1 3  ? 7.392   -10.216 15.281  1.00 0.00 ? 3  TYR A CB   5  
ATOM 3548  C CG   . TYR A 1 3  ? 7.877   -9.039  14.431  1.00 0.00 ? 3  TYR A CG   5  
ATOM 3549  C CD1  . TYR A 1 3  ? 8.405   -7.919  15.041  1.00 0.00 ? 3  TYR A CD1  5  
ATOM 3550  C CD2  . TYR A 1 3  ? 7.786   -9.097  13.056  1.00 0.00 ? 3  TYR A CD2  5  
ATOM 3551  C CE1  . TYR A 1 3  ? 8.861   -6.812  14.242  1.00 0.00 ? 3  TYR A CE1  5  
ATOM 3552  C CE2  . TYR A 1 3  ? 8.242   -7.990  12.256  1.00 0.00 ? 3  TYR A CE2  5  
ATOM 3553  C CZ   . TYR A 1 3  ? 8.757   -6.902  12.889  1.00 0.00 ? 3  TYR A CZ   5  
ATOM 3554  O OH   . TYR A 1 3  ? 9.188   -5.856  12.134  1.00 0.00 ? 3  TYR A OH   5  
ATOM 3555  H H    . TYR A 1 3  ? 5.595   -10.887 17.700  1.00 0.00 ? 3  TYR A H    5  
ATOM 3556  H HA   . TYR A 1 3  ? 5.832   -9.115  16.389  1.00 0.00 ? 3  TYR A HA   5  
ATOM 3557  H HB2  . TYR A 1 3  ? 8.082   -10.358 16.113  1.00 0.00 ? 3  TYR A HB2  5  
ATOM 3558  H HB3  . TYR A 1 3  ? 7.427   -11.124 14.679  1.00 0.00 ? 3  TYR A HB3  5  
ATOM 3559  H HD1  . TYR A 1 3  ? 8.477   -7.873  16.128  1.00 0.00 ? 3  TYR A HD1  5  
ATOM 3560  H HD2  . TYR A 1 3  ? 7.368   -9.982  12.574  1.00 0.00 ? 3  TYR A HD2  5  
ATOM 3561  H HE1  . TYR A 1 3  ? 9.281   -5.922  14.710  1.00 0.00 ? 3  TYR A HE1  5  
ATOM 3562  H HE2  . TYR A 1 3  ? 8.176   -8.023  11.169  1.00 0.00 ? 3  TYR A HE2  5  
ATOM 3563  H HH   . TYR A 1 3  ? 10.105  -5.580  12.423  1.00 0.00 ? 3  TYR A HH   5  
ATOM 3564  N N    . VAL A 1 4  ? 4.835   -8.953  14.012  1.00 0.00 ? 4  VAL A N    5  
ATOM 3565  C CA   . VAL A 1 4  ? 3.921   -8.853  12.887  1.00 0.00 ? 4  VAL A CA   5  
ATOM 3566  C C    . VAL A 1 4  ? 4.061   -7.473  12.242  1.00 0.00 ? 4  VAL A C    5  
ATOM 3567  O O    . VAL A 1 4  ? 4.001   -6.454  12.928  1.00 0.00 ? 4  VAL A O    5  
ATOM 3568  C CB   . VAL A 1 4  ? 2.493   -9.157  13.345  1.00 0.00 ? 4  VAL A CB   5  
ATOM 3569  C CG1  . VAL A 1 4  ? 1.984   -8.078  14.303  1.00 0.00 ? 4  VAL A CG1  5  
ATOM 3570  C CG2  . VAL A 1 4  ? 1.554   -9.313  12.147  1.00 0.00 ? 4  VAL A CG2  5  
ATOM 3571  H H    . VAL A 1 4  ? 5.329   -8.112  14.231  1.00 0.00 ? 4  VAL A H    5  
ATOM 3572  H HA   . VAL A 1 4  ? 4.210   -9.612  12.160  1.00 0.00 ? 4  VAL A HA   5  
ATOM 3573  H HB   . VAL A 1 4  ? 2.508   -10.104 13.884  1.00 0.00 ? 4  VAL A HB   5  
ATOM 3574  H HG11 . VAL A 1 4  ? 2.804   -7.411  14.568  1.00 0.00 ? 4  VAL A HG11 5  
ATOM 3575  H HG12 . VAL A 1 4  ? 1.191   -7.507  13.820  1.00 0.00 ? 4  VAL A HG12 5  
ATOM 3576  H HG13 . VAL A 1 4  ? 1.593   -8.549  15.206  1.00 0.00 ? 4  VAL A HG13 5  
ATOM 3577  H HG21 . VAL A 1 4  ? 2.025   -8.891  11.259  1.00 0.00 ? 4  VAL A HG21 5  
ATOM 3578  H HG22 . VAL A 1 4  ? 1.349   -10.371 11.981  1.00 0.00 ? 4  VAL A HG22 5  
ATOM 3579  H HG23 . VAL A 1 4  ? 0.620   -8.788  12.346  1.00 0.00 ? 4  VAL A HG23 5  
ATOM 3580  N N    . GLY A 1 5  ? 4.246   -7.484  10.930  1.00 0.00 ? 5  GLY A N    5  
ATOM 3581  C CA   . GLY A 1 5  ? 4.395   -6.246  10.185  1.00 0.00 ? 5  GLY A CA   5  
ATOM 3582  C C    . GLY A 1 5  ? 3.032   -5.623  9.878   1.00 0.00 ? 5  GLY A C    5  
ATOM 3583  O O    . GLY A 1 5  ? 2.929   -4.730  9.039   1.00 0.00 ? 5  GLY A O    5  
ATOM 3584  H H    . GLY A 1 5  ? 4.294   -8.318  10.379  1.00 0.00 ? 5  GLY A H    5  
ATOM 3585  H HA2  . GLY A 1 5  ? 5.000   -5.543  10.758  1.00 0.00 ? 5  GLY A HA2  5  
ATOM 3586  H HA3  . GLY A 1 5  ? 4.928   -6.440  9.254   1.00 0.00 ? 5  GLY A HA3  5  
ATOM 3587  N N    . LEU A 1 6  ? 2.020   -6.118  10.575  1.00 0.00 ? 6  LEU A N    5  
ATOM 3588  C CA   . LEU A 1 6  ? 0.668   -5.621  10.388  1.00 0.00 ? 6  LEU A CA   5  
ATOM 3589  C C    . LEU A 1 6  ? 0.714   -4.112  10.136  1.00 0.00 ? 6  LEU A C    5  
ATOM 3590  O O    . LEU A 1 6  ? 0.865   -3.328  11.071  1.00 0.00 ? 6  LEU A O    5  
ATOM 3591  C CB   . LEU A 1 6  ? -0.218  -6.020  11.570  1.00 0.00 ? 6  LEU A CB   5  
ATOM 3592  C CG   . LEU A 1 6  ? -1.582  -6.616  11.215  1.00 0.00 ? 6  LEU A CG   5  
ATOM 3593  C CD1  . LEU A 1 6  ? -1.852  -7.887  12.022  1.00 0.00 ? 6  LEU A CD1  5  
ATOM 3594  C CD2  . LEU A 1 6  ? -2.695  -5.580  11.387  1.00 0.00 ? 6  LEU A CD2  5  
ATOM 3595  H H    . LEU A 1 6  ? 2.113   -6.844  11.256  1.00 0.00 ? 6  LEU A H    5  
ATOM 3596  H HA   . LEU A 1 6  ? 0.261   -6.107  9.502   1.00 0.00 ? 6  LEU A HA   5  
ATOM 3597  H HB2  . LEU A 1 6  ? 0.325   -6.743  12.178  1.00 0.00 ? 6  LEU A HB2  5  
ATOM 3598  H HB3  . LEU A 1 6  ? -0.380  -5.139  12.191  1.00 0.00 ? 6  LEU A HB3  5  
ATOM 3599  H HG   . LEU A 1 6  ? -1.567  -6.901  10.163  1.00 0.00 ? 6  LEU A HG   5  
ATOM 3600  H HD11 . LEU A 1 6  ? -1.141  -7.952  12.846  1.00 0.00 ? 6  LEU A HD11 5  
ATOM 3601  H HD12 . LEU A 1 6  ? -2.866  -7.857  12.419  1.00 0.00 ? 6  LEU A HD12 5  
ATOM 3602  H HD13 . LEU A 1 6  ? -1.740  -8.758  11.377  1.00 0.00 ? 6  LEU A HD13 5  
ATOM 3603  H HD21 . LEU A 1 6  ? -2.428  -4.668  10.853  1.00 0.00 ? 6  LEU A HD21 5  
ATOM 3604  H HD22 . LEU A 1 6  ? -3.626  -5.978  10.984  1.00 0.00 ? 6  LEU A HD22 5  
ATOM 3605  H HD23 . LEU A 1 6  ? -2.822  -5.357  12.446  1.00 0.00 ? 6  LEU A HD23 5  
ATOM 3606  N N    . SER A 1 7  ? 0.582   -3.752  8.868   1.00 0.00 ? 7  SER A N    5  
ATOM 3607  C CA   . SER A 1 7  ? 0.607   -2.352  8.482   1.00 0.00 ? 7  SER A CA   5  
ATOM 3608  C C    . SER A 1 7  ? 1.939   -1.720  8.889   1.00 0.00 ? 7  SER A C    5  
ATOM 3609  O O    . SER A 1 7  ? 2.602   -2.198  9.808   1.00 0.00 ? 7  SER A O    5  
ATOM 3610  C CB   . SER A 1 7  ? -0.558  -1.586  9.111   1.00 0.00 ? 7  SER A CB   5  
ATOM 3611  O OG   . SER A 1 7  ? -0.311  -1.265  10.477  1.00 0.00 ? 7  SER A OG   5  
ATOM 3612  H H    . SER A 1 7  ? 0.460   -4.397  8.114   1.00 0.00 ? 7  SER A H    5  
ATOM 3613  H HA   . SER A 1 7  ? 0.498   -2.350  7.397   1.00 0.00 ? 7  SER A HA   5  
ATOM 3614  H HB2  . SER A 1 7  ? -0.735  -0.668  8.550   1.00 0.00 ? 7  SER A HB2  5  
ATOM 3615  H HB3  . SER A 1 7  ? -1.467  -2.183  9.038   1.00 0.00 ? 7  SER A HB3  5  
ATOM 3616  H HG   . SER A 1 7  ? -0.836  -1.873  11.072  1.00 0.00 ? 7  SER A HG   5  
ATOM 3617  N N    . ALA A 1 8  ? 2.292   -0.655  8.185   1.00 0.00 ? 8  ALA A N    5  
ATOM 3618  C CA   . ALA A 1 8  ? 3.534   0.048   8.462   1.00 0.00 ? 8  ALA A CA   5  
ATOM 3619  C C    . ALA A 1 8  ? 4.707   -0.762  7.906   1.00 0.00 ? 8  ALA A C    5  
ATOM 3620  O O    . ALA A 1 8  ? 5.209   -0.470  6.822   1.00 0.00 ? 8  ALA A O    5  
ATOM 3621  C CB   . ALA A 1 8  ? 3.656   0.295   9.967   1.00 0.00 ? 8  ALA A CB   5  
ATOM 3622  H H    . ALA A 1 8  ? 1.748   -0.272  7.438   1.00 0.00 ? 8  ALA A H    5  
ATOM 3623  H HA   . ALA A 1 8  ? 3.492   1.010   7.950   1.00 0.00 ? 8  ALA A HA   5  
ATOM 3624  H HB1  . ALA A 1 8  ? 3.749   1.365   10.153  1.00 0.00 ? 8  ALA A HB1  5  
ATOM 3625  H HB2  . ALA A 1 8  ? 2.768   -0.086  10.471  1.00 0.00 ? 8  ALA A HB2  5  
ATOM 3626  H HB3  . ALA A 1 8  ? 4.539   -0.219  10.348  1.00 0.00 ? 8  ALA A HB3  5  
ATOM 3627  N N    . ASN A 1 9  ? 5.111   -1.763  8.675   1.00 0.00 ? 9  ASN A N    5  
ATOM 3628  C CA   . ASN A 1 9  ? 6.216   -2.616  8.273   1.00 0.00 ? 9  ASN A CA   5  
ATOM 3629  C C    . ASN A 1 9  ? 6.055   -2.992  6.799   1.00 0.00 ? 9  ASN A C    5  
ATOM 3630  O O    . ASN A 1 9  ? 7.029   -3.009  6.049   1.00 0.00 ? 9  ASN A O    5  
ATOM 3631  C CB   . ASN A 1 9  ? 6.239   -3.909  9.091   1.00 0.00 ? 9  ASN A CB   5  
ATOM 3632  C CG   . ASN A 1 9  ? 7.667   -4.275  9.498   1.00 0.00 ? 9  ASN A CG   5  
ATOM 3633  O OD1  . ASN A 1 9  ? 8.462   -4.756  8.708   1.00 0.00 ? 9  ASN A OD1  5  
ATOM 3634  N ND2  . ASN A 1 9  ? 7.948   -4.021  10.773  1.00 0.00 ? 9  ASN A ND2  5  
ATOM 3635  H H    . ASN A 1 9  ? 4.697   -1.993  9.555   1.00 0.00 ? 9  ASN A H    5  
ATOM 3636  H HA   . ASN A 1 9  ? 7.114   -2.027  8.458   1.00 0.00 ? 9  ASN A HA   5  
ATOM 3637  H HB2  . ASN A 1 9  ? 5.621   -3.791  9.981   1.00 0.00 ? 9  ASN A HB2  5  
ATOM 3638  H HB3  . ASN A 1 9  ? 5.804   -4.721  8.507   1.00 0.00 ? 9  ASN A HB3  5  
ATOM 3639  H HD21 . ASN A 1 9  ? 7.249   -3.626  11.370  1.00 0.00 ? 9  ASN A HD21 5  
ATOM 3640  H HD22 . ASN A 1 9  ? 8.857   -4.226  11.136  1.00 0.00 ? 9  ASN A HD22 5  
ATOM 3641  N N    . GLN A 1 10 ? 4.817   -3.284  6.428   1.00 0.00 ? 10 GLN A N    5  
ATOM 3642  C CA   . GLN A 1 10 ? 4.515   -3.659  5.056   1.00 0.00 ? 10 GLN A CA   5  
ATOM 3643  C C    . GLN A 1 10 ? 4.566   -2.430  4.147   1.00 0.00 ? 10 GLN A C    5  
ATOM 3644  O O    . GLN A 1 10 ? 4.974   -2.526  2.990   1.00 0.00 ? 10 GLN A O    5  
ATOM 3645  C CB   . GLN A 1 10 ? 3.155   -4.353  4.964   1.00 0.00 ? 10 GLN A CB   5  
ATOM 3646  C CG   . GLN A 1 10 ? 2.112   -3.632  5.820   1.00 0.00 ? 10 GLN A CG   5  
ATOM 3647  C CD   . GLN A 1 10 ? 0.697   -3.905  5.307   1.00 0.00 ? 10 GLN A CD   5  
ATOM 3648  O OE1  . GLN A 1 10 ? -0.120  -3.012  5.156   1.00 0.00 ? 10 GLN A OE1  5  
ATOM 3649  N NE2  . GLN A 1 10 ? 0.454   -5.187  5.047   1.00 0.00 ? 10 GLN A NE2  5  
ATOM 3650  H H    . GLN A 1 10 ? 4.030   -3.268  7.044   1.00 0.00 ? 10 GLN A H    5  
ATOM 3651  H HA   . GLN A 1 10 ? 5.296   -4.364  4.770   1.00 0.00 ? 10 GLN A HA   5  
ATOM 3652  H HB2  . GLN A 1 10 ? 2.825   -4.377  3.926   1.00 0.00 ? 10 GLN A HB2  5  
ATOM 3653  H HB3  . GLN A 1 10 ? 3.248   -5.388  5.293   1.00 0.00 ? 10 GLN A HB3  5  
ATOM 3654  H HG2  . GLN A 1 10 ? 2.197   -3.961  6.856   1.00 0.00 ? 10 GLN A HG2  5  
ATOM 3655  H HG3  . GLN A 1 10 ? 2.306   -2.559  5.809   1.00 0.00 ? 10 GLN A HG3  5  
ATOM 3656  H HE21 . GLN A 1 10 ? 1.168   -5.871  5.193   1.00 0.00 ? 10 GLN A HE21 5  
ATOM 3657  H HE22 . GLN A 1 10 ? -0.444  -5.466  4.706   1.00 0.00 ? 10 GLN A HE22 5  
ATOM 3658  N N    . CYS A 1 11 ? 4.148   -1.303  4.704   1.00 0.00 ? 11 CYS A N    5  
ATOM 3659  C CA   . CYS A 1 11 ? 4.141   -0.056  3.958   1.00 0.00 ? 11 CYS A CA   5  
ATOM 3660  C C    . CYS A 1 11 ? 5.217   0.860   4.543   1.00 0.00 ? 11 CYS A C    5  
ATOM 3661  O O    . CYS A 1 11 ? 4.976   2.046   4.761   1.00 0.00 ? 11 CYS A O    5  
ATOM 3662  C CB   . CYS A 1 11 ? 2.760   0.603   3.971   1.00 0.00 ? 11 CYS A CB   5  
ATOM 3663  S SG   . CYS A 1 11 ? 1.377   -0.520  4.389   1.00 0.00 ? 11 CYS A SG   5  
ATOM 3664  H H    . CYS A 1 11 ? 3.818   -1.234  5.646   1.00 0.00 ? 11 CYS A H    5  
ATOM 3665  H HA   . CYS A 1 11 ? 4.369   -0.310  2.923   1.00 0.00 ? 11 CYS A HA   5  
ATOM 3666  H HB2  . CYS A 1 11 ? 2.772   1.424   4.688   1.00 0.00 ? 11 CYS A HB2  5  
ATOM 3667  H HB3  . CYS A 1 11 ? 2.572   1.040   2.990   1.00 0.00 ? 11 CYS A HB3  5  
ATOM 3668  N N    . ALA A 1 12 ? 6.382   0.275   4.780   1.00 0.00 ? 12 ALA A N    5  
ATOM 3669  C CA   . ALA A 1 12 ? 7.496   1.024   5.336   1.00 0.00 ? 12 ALA A CA   5  
ATOM 3670  C C    . ALA A 1 12 ? 8.481   1.369   4.218   1.00 0.00 ? 12 ALA A C    5  
ATOM 3671  O O    . ALA A 1 12 ? 9.694   1.302   4.411   1.00 0.00 ? 12 ALA A O    5  
ATOM 3672  C CB   . ALA A 1 12 ? 8.148   0.213   6.458   1.00 0.00 ? 12 ALA A CB   5  
ATOM 3673  H H    . ALA A 1 12 ? 6.570   -0.690  4.600   1.00 0.00 ? 12 ALA A H    5  
ATOM 3674  H HA   . ALA A 1 12 ? 7.098   1.948   5.756   1.00 0.00 ? 12 ALA A HA   5  
ATOM 3675  H HB1  . ALA A 1 12 ? 9.135   -0.121  6.138   1.00 0.00 ? 12 ALA A HB1  5  
ATOM 3676  H HB2  . ALA A 1 12 ? 7.528   -0.653  6.687   1.00 0.00 ? 12 ALA A HB2  5  
ATOM 3677  H HB3  . ALA A 1 12 ? 8.245   0.836   7.347   1.00 0.00 ? 12 ALA A HB3  5  
ATOM 3678  N N    . VAL A 1 13 ? 7.923   1.731   3.072   1.00 0.00 ? 13 VAL A N    5  
ATOM 3679  C CA   . VAL A 1 13 ? 8.738   2.087   1.922   1.00 0.00 ? 13 VAL A CA   5  
ATOM 3680  C C    . VAL A 1 13 ? 8.945   3.603   1.899   1.00 0.00 ? 13 VAL A C    5  
ATOM 3681  O O    . VAL A 1 13 ? 8.109   4.355   2.398   1.00 0.00 ? 13 VAL A O    5  
ATOM 3682  C CB   . VAL A 1 13 ? 8.096   1.552   0.641   1.00 0.00 ? 13 VAL A CB   5  
ATOM 3683  C CG1  . VAL A 1 13 ? 9.140   0.882   -0.256  1.00 0.00 ? 13 VAL A CG1  5  
ATOM 3684  C CG2  . VAL A 1 13 ? 6.951   0.590   0.961   1.00 0.00 ? 13 VAL A CG2  5  
ATOM 3685  H H    . VAL A 1 13 ? 6.936   1.784   2.922   1.00 0.00 ? 13 VAL A H    5  
ATOM 3686  H HA   . VAL A 1 13 ? 9.707   1.603   2.043   1.00 0.00 ? 13 VAL A HA   5  
ATOM 3687  H HB   . VAL A 1 13 ? 7.680   2.398   0.095   1.00 0.00 ? 13 VAL A HB   5  
ATOM 3688  H HG11 . VAL A 1 13 ? 10.051  0.706   0.316   1.00 0.00 ? 13 VAL A HG11 5  
ATOM 3689  H HG12 . VAL A 1 13 ? 8.750   -0.069  -0.620  1.00 0.00 ? 13 VAL A HG12 5  
ATOM 3690  H HG13 . VAL A 1 13 ? 9.362   1.531   -1.103  1.00 0.00 ? 13 VAL A HG13 5  
ATOM 3691  H HG21 . VAL A 1 13 ? 7.220   -0.023  1.822   1.00 0.00 ? 13 VAL A HG21 5  
ATOM 3692  H HG22 . VAL A 1 13 ? 6.050   1.161   1.189   1.00 0.00 ? 13 VAL A HG22 5  
ATOM 3693  H HG23 . VAL A 1 13 ? 6.765   -0.054  0.101   1.00 0.00 ? 13 VAL A HG23 5  
ATOM 3694  N N    . PRO A 1 14 ? 10.092  4.017   1.298   1.00 0.00 ? 14 PRO A N    5  
ATOM 3695  C CA   . PRO A 1 14 ? 10.419  5.430   1.203   1.00 0.00 ? 14 PRO A CA   5  
ATOM 3696  C C    . PRO A 1 14 ? 9.570   6.119   0.133   1.00 0.00 ? 14 PRO A C    5  
ATOM 3697  O O    . PRO A 1 14 ? 8.863   7.083   0.422   1.00 0.00 ? 14 PRO A O    5  
ATOM 3698  C CB   . PRO A 1 14 ? 11.907  5.469   0.895   1.00 0.00 ? 14 PRO A CB   5  
ATOM 3699  C CG   . PRO A 1 14 ? 12.261  4.086   0.371   1.00 0.00 ? 14 PRO A CG   5  
ATOM 3700  C CD   . PRO A 1 14 ? 11.105  3.155   0.695   1.00 0.00 ? 14 PRO A CD   5  
ATOM 3701  H HA   . PRO A 1 14 ? 10.206  5.894   2.062   1.00 0.00 ? 14 PRO A HA   5  
ATOM 3702  H HB2  . PRO A 1 14 ? 12.133  6.237   0.155   1.00 0.00 ? 14 PRO A HB2  5  
ATOM 3703  H HB3  . PRO A 1 14 ? 12.485  5.708   1.788   1.00 0.00 ? 14 PRO A HB3  5  
ATOM 3704  H HG2  . PRO A 1 14 ? 12.436  4.119   -0.704  1.00 0.00 ? 14 PRO A HG2  5  
ATOM 3705  H HG3  . PRO A 1 14 ? 13.181  3.727   0.833   1.00 0.00 ? 14 PRO A HG3  5  
ATOM 3706  H HD2  . PRO A 1 14 ? 10.726  2.667   -0.203  1.00 0.00 ? 14 PRO A HD2  5  
ATOM 3707  H HD3  . PRO A 1 14 ? 11.412  2.366   1.381   1.00 0.00 ? 14 PRO A HD3  5  
ATOM 3708  N N    . ALA A 1 15 ? 9.666   5.596   -1.081  1.00 0.00 ? 15 ALA A N    5  
ATOM 3709  C CA   . ALA A 1 15 ? 8.915   6.149   -2.195  1.00 0.00 ? 15 ALA A CA   5  
ATOM 3710  C C    . ALA A 1 15 ? 9.582   5.737   -3.509  1.00 0.00 ? 15 ALA A C    5  
ATOM 3711  O O    . ALA A 1 15 ? 8.938   5.714   -4.556  1.00 0.00 ? 15 ALA A O    5  
ATOM 3712  C CB   . ALA A 1 15 ? 8.817   7.668   -2.042  1.00 0.00 ? 15 ALA A CB   5  
ATOM 3713  H H    . ALA A 1 15 ? 10.243  4.811   -1.308  1.00 0.00 ? 15 ALA A H    5  
ATOM 3714  H HA   . ALA A 1 15 ? 7.910   5.727   -2.160  1.00 0.00 ? 15 ALA A HA   5  
ATOM 3715  H HB1  . ALA A 1 15 ? 9.739   8.049   -1.601  1.00 0.00 ? 15 ALA A HB1  5  
ATOM 3716  H HB2  . ALA A 1 15 ? 7.976   7.915   -1.395  1.00 0.00 ? 15 ALA A HB2  5  
ATOM 3717  H HB3  . ALA A 1 15 ? 8.669   8.123   -3.021  1.00 0.00 ? 15 ALA A HB3  5  
ATOM 3718  N N    . LYS A 1 16 ? 10.866  5.422   -3.410  1.00 0.00 ? 16 LYS A N    5  
ATOM 3719  C CA   . LYS A 1 16 ? 11.628  5.012   -4.578  1.00 0.00 ? 16 LYS A CA   5  
ATOM 3720  C C    . LYS A 1 16 ? 11.605  3.486   -4.686  1.00 0.00 ? 16 LYS A C    5  
ATOM 3721  O O    . LYS A 1 16 ? 12.233  2.914   -5.576  1.00 0.00 ? 16 LYS A O    5  
ATOM 3722  C CB   . LYS A 1 16 ? 13.038  5.605   -4.532  1.00 0.00 ? 16 LYS A CB   5  
ATOM 3723  C CG   . LYS A 1 16 ? 13.848  5.003   -3.382  1.00 0.00 ? 16 LYS A CG   5  
ATOM 3724  C CD   . LYS A 1 16 ? 14.603  3.753   -3.839  1.00 0.00 ? 16 LYS A CD   5  
ATOM 3725  C CE   . LYS A 1 16 ? 16.113  3.999   -3.855  1.00 0.00 ? 16 LYS A CE   5  
ATOM 3726  N NZ   . LYS A 1 16 ? 16.843  2.727   -4.050  1.00 0.00 ? 16 LYS A NZ   5  
ATOM 3727  H H    . LYS A 1 16 ? 11.382  5.444   -2.554  1.00 0.00 ? 16 LYS A H    5  
ATOM 3728  H HA   . LYS A 1 16 ? 11.131  5.429   -5.454  1.00 0.00 ? 16 LYS A HA   5  
ATOM 3729  H HB2  . LYS A 1 16 ? 13.546  5.417   -5.478  1.00 0.00 ? 16 LYS A HB2  5  
ATOM 3730  H HB3  . LYS A 1 16 ? 12.978  6.686   -4.413  1.00 0.00 ? 16 LYS A HB3  5  
ATOM 3731  H HG2  . LYS A 1 16 ? 14.556  5.742   -3.006  1.00 0.00 ? 16 LYS A HG2  5  
ATOM 3732  H HG3  . LYS A 1 16 ? 13.183  4.750   -2.557  1.00 0.00 ? 16 LYS A HG3  5  
ATOM 3733  H HD2  . LYS A 1 16 ? 14.373  2.922   -3.172  1.00 0.00 ? 16 LYS A HD2  5  
ATOM 3734  H HD3  . LYS A 1 16 ? 14.267  3.464   -4.835  1.00 0.00 ? 16 LYS A HD3  5  
ATOM 3735  H HE2  . LYS A 1 16 ? 16.365  4.696   -4.655  1.00 0.00 ? 16 LYS A HE2  5  
ATOM 3736  H HE3  . LYS A 1 16 ? 16.422  4.463   -2.919  1.00 0.00 ? 16 LYS A HE3  5  
ATOM 3737  H HZ1  . LYS A 1 16 ? 16.256  1.961   -3.785  1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 3738  H HZ2  . LYS A 1 16 ? 17.099  2.633   -5.012  1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 3739  H HZ3  . LYS A 1 16 ? 17.667  2.726   -3.483  1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 3740  N N    . ASP A 1 17 ? 10.875  2.870   -3.768  1.00 0.00 ? 17 ASP A N    5  
ATOM 3741  C CA   . ASP A 1 17 ? 10.762  1.422   -3.750  1.00 0.00 ? 17 ASP A CA   5  
ATOM 3742  C C    . ASP A 1 17 ? 9.294   1.027   -3.919  1.00 0.00 ? 17 ASP A C    5  
ATOM 3743  O O    . ASP A 1 17 ? 8.933   -0.133  -3.726  1.00 0.00 ? 17 ASP A O    5  
ATOM 3744  C CB   . ASP A 1 17 ? 11.256  0.848   -2.420  1.00 0.00 ? 17 ASP A CB   5  
ATOM 3745  C CG   . ASP A 1 17 ? 12.574  0.076   -2.499  1.00 0.00 ? 17 ASP A CG   5  
ATOM 3746  O OD1  . ASP A 1 17 ? 12.589  -0.951  -3.212  1.00 0.00 ? 17 ASP A OD1  5  
ATOM 3747  O OD2  . ASP A 1 17 ? 13.538  0.530   -1.845  1.00 0.00 ? 17 ASP A OD2  5  
ATOM 3748  H H    . ASP A 1 17 ? 10.367  3.343   -3.048  1.00 0.00 ? 17 ASP A H    5  
ATOM 3749  H HA   . ASP A 1 17 ? 11.385  1.076   -4.574  1.00 0.00 ? 17 ASP A HA   5  
ATOM 3750  H HB2  . ASP A 1 17 ? 11.373  1.666   -1.710  1.00 0.00 ? 17 ASP A HB2  5  
ATOM 3751  H HB3  . ASP A 1 17 ? 10.488  0.186   -2.020  1.00 0.00 ? 17 ASP A HB3  5  
ATOM 3752  N N    . ARG A 1 18 ? 8.486   2.014   -4.277  1.00 0.00 ? 18 ARG A N    5  
ATOM 3753  C CA   . ARG A 1 18 ? 7.065   1.784   -4.475  1.00 0.00 ? 18 ARG A CA   5  
ATOM 3754  C C    . ARG A 1 18 ? 6.820   1.095   -5.818  1.00 0.00 ? 18 ARG A C    5  
ATOM 3755  O O    . ARG A 1 18 ? 7.125   1.654   -6.871  1.00 0.00 ? 18 ARG A O    5  
ATOM 3756  C CB   . ARG A 1 18 ? 6.283   3.099   -4.433  1.00 0.00 ? 18 ARG A CB   5  
ATOM 3757  C CG   . ARG A 1 18 ? 6.802   4.010   -3.319  1.00 0.00 ? 18 ARG A CG   5  
ATOM 3758  C CD   . ARG A 1 18 ? 6.580   3.376   -1.945  1.00 0.00 ? 18 ARG A CD   5  
ATOM 3759  N NE   . ARG A 1 18 ? 6.786   4.386   -0.883  1.00 0.00 ? 18 ARG A NE   5  
ATOM 3760  C CZ   . ARG A 1 18 ? 6.019   5.472   -0.719  1.00 0.00 ? 18 ARG A CZ   5  
ATOM 3761  N NH1  . ARG A 1 18 ? 4.989   5.696   -1.547  1.00 0.00 ? 18 ARG A NH1  5  
ATOM 3762  N NH2  . ARG A 1 18 ? 6.280   6.335   0.272   1.00 0.00 ? 18 ARG A NH2  5  
ATOM 3763  H H    . ARG A 1 18 ? 8.787   2.955   -4.432  1.00 0.00 ? 18 ARG A H    5  
ATOM 3764  H HA   . ARG A 1 18 ? 6.768   1.142   -3.645  1.00 0.00 ? 18 ARG A HA   5  
ATOM 3765  H HB2  . ARG A 1 18 ? 6.369   3.607   -5.394  1.00 0.00 ? 18 ARG A HB2  5  
ATOM 3766  H HB3  . ARG A 1 18 ? 5.225   2.892   -4.276  1.00 0.00 ? 18 ARG A HB3  5  
ATOM 3767  H HG2  . ARG A 1 18 ? 7.864   4.204   -3.468  1.00 0.00 ? 18 ARG A HG2  5  
ATOM 3768  H HG3  . ARG A 1 18 ? 6.293   4.973   -3.366  1.00 0.00 ? 18 ARG A HG3  5  
ATOM 3769  H HD2  . ARG A 1 18 ? 5.571   2.970   -1.880  1.00 0.00 ? 18 ARG A HD2  5  
ATOM 3770  H HD3  . ARG A 1 18 ? 7.268   2.543   -1.804  1.00 0.00 ? 18 ARG A HD3  5  
ATOM 3771  H HE   . ARG A 1 18 ? 7.546   4.250   -0.247  1.00 0.00 ? 18 ARG A HE   5  
ATOM 3772  H HH11 . ARG A 1 18 ? 4.794   5.052   -2.287  1.00 0.00 ? 18 ARG A HH11 5  
ATOM 3773  H HH12 . ARG A 1 18 ? 4.416   6.506   -1.425  1.00 0.00 ? 18 ARG A HH12 5  
ATOM 3774  H HH21 . ARG A 1 18 ? 7.048   6.168   0.891   1.00 0.00 ? 18 ARG A HH21 5  
ATOM 3775  H HH22 . ARG A 1 18 ? 5.707   7.145   0.394   1.00 0.00 ? 18 ARG A HH22 5  
ATOM 3776  N N    . VAL A 1 19 ? 6.272   -0.109  -5.739  1.00 0.00 ? 19 VAL A N    5  
ATOM 3777  C CA   . VAL A 1 19 ? 5.983   -0.880  -6.936  1.00 0.00 ? 19 VAL A CA   5  
ATOM 3778  C C    . VAL A 1 19 ? 4.635   -0.438  -7.509  1.00 0.00 ? 19 VAL A C    5  
ATOM 3779  O O    . VAL A 1 19 ? 4.265   -0.835  -8.613  1.00 0.00 ? 19 VAL A O    5  
ATOM 3780  C CB   . VAL A 1 19 ? 6.037   -2.376  -6.621  1.00 0.00 ? 19 VAL A CB   5  
ATOM 3781  C CG1  . VAL A 1 19 ? 5.798   -3.211  -7.881  1.00 0.00 ? 19 VAL A CG1  5  
ATOM 3782  C CG2  . VAL A 1 19 ? 7.365   -2.749  -5.960  1.00 0.00 ? 19 VAL A CG2  5  
ATOM 3783  H H    . VAL A 1 19 ? 6.027   -0.556  -4.879  1.00 0.00 ? 19 VAL A H    5  
ATOM 3784  H HA   . VAL A 1 19 ? 6.763   -0.660  -7.665  1.00 0.00 ? 19 VAL A HA   5  
ATOM 3785  H HB   . VAL A 1 19 ? 5.237   -2.599  -5.914  1.00 0.00 ? 19 VAL A HB   5  
ATOM 3786  H HG11 . VAL A 1 19 ? 6.301   -2.743  -8.727  1.00 0.00 ? 19 VAL A HG11 5  
ATOM 3787  H HG12 . VAL A 1 19 ? 6.194   -4.215  -7.732  1.00 0.00 ? 19 VAL A HG12 5  
ATOM 3788  H HG13 . VAL A 1 19 ? 4.728   -3.268  -8.080  1.00 0.00 ? 19 VAL A HG13 5  
ATOM 3789  H HG21 . VAL A 1 19 ? 7.486   -2.179  -5.039  1.00 0.00 ? 19 VAL A HG21 5  
ATOM 3790  H HG22 . VAL A 1 19 ? 7.370   -3.815  -5.731  1.00 0.00 ? 19 VAL A HG22 5  
ATOM 3791  H HG23 . VAL A 1 19 ? 8.186   -2.520  -6.639  1.00 0.00 ? 19 VAL A HG23 5  
ATOM 3792  N N    . ASP A 1 20 ? 3.937   0.378   -6.733  1.00 0.00 ? 20 ASP A N    5  
ATOM 3793  C CA   . ASP A 1 20 ? 2.637   0.878   -7.149  1.00 0.00 ? 20 ASP A CA   5  
ATOM 3794  C C    . ASP A 1 20 ? 1.690   -0.302  -7.375  1.00 0.00 ? 20 ASP A C    5  
ATOM 3795  O O    . ASP A 1 20 ? 1.927   -1.135  -8.248  1.00 0.00 ? 20 ASP A O    5  
ATOM 3796  C CB   . ASP A 1 20 ? 2.742   1.657   -8.461  1.00 0.00 ? 20 ASP A CB   5  
ATOM 3797  C CG   . ASP A 1 20 ? 1.413   1.887   -9.184  1.00 0.00 ? 20 ASP A CG   5  
ATOM 3798  O OD1  . ASP A 1 20 ? 0.393   2.006   -8.473  1.00 0.00 ? 20 ASP A OD1  5  
ATOM 3799  O OD2  . ASP A 1 20 ? 1.448   1.939   -10.433 1.00 0.00 ? 20 ASP A OD2  5  
ATOM 3800  H H    . ASP A 1 20 ? 4.244   0.696   -5.836  1.00 0.00 ? 20 ASP A H    5  
ATOM 3801  H HA   . ASP A 1 20 ? 2.308   1.528   -6.339  1.00 0.00 ? 20 ASP A HA   5  
ATOM 3802  H HB2  . ASP A 1 20 ? 3.199   2.626   -8.256  1.00 0.00 ? 20 ASP A HB2  5  
ATOM 3803  H HB3  . ASP A 1 20 ? 3.415   1.123   -9.131  1.00 0.00 ? 20 ASP A HB3  5  
ATOM 3804  N N    . CYS A 1 21 ? 0.636   -0.336  -6.572  1.00 0.00 ? 21 CYS A N    5  
ATOM 3805  C CA   . CYS A 1 21 ? -0.348  -1.400  -6.673  1.00 0.00 ? 21 CYS A CA   5  
ATOM 3806  C C    . CYS A 1 21 ? -1.369  -1.010  -7.743  1.00 0.00 ? 21 CYS A C    5  
ATOM 3807  O O    . CYS A 1 21 ? -2.064  -1.868  -8.285  1.00 0.00 ? 21 CYS A O    5  
ATOM 3808  C CB   . CYS A 1 21 ? -1.013  -1.685  -5.325  1.00 0.00 ? 21 CYS A CB   5  
ATOM 3809  S SG   . CYS A 1 21 ? -1.296  -3.458  -4.968  1.00 0.00 ? 21 CYS A SG   5  
ATOM 3810  H H    . CYS A 1 21 ? 0.451   0.345   -5.864  1.00 0.00 ? 21 CYS A H    5  
ATOM 3811  H HA   . CYS A 1 21 ? 0.193   -2.300  -6.964  1.00 0.00 ? 21 CYS A HA   5  
ATOM 3812  H HB2  . CYS A 1 21 ? -0.394  -1.264  -4.533  1.00 0.00 ? 21 CYS A HB2  5  
ATOM 3813  H HB3  . CYS A 1 21 ? -1.971  -1.165  -5.291  1.00 0.00 ? 21 CYS A HB3  5  
ATOM 3814  N N    . GLY A 1 22 ? -1.429  0.286   -8.014  1.00 0.00 ? 22 GLY A N    5  
ATOM 3815  C CA   . GLY A 1 22 ? -2.354  0.800   -9.009  1.00 0.00 ? 22 GLY A CA   5  
ATOM 3816  C C    . GLY A 1 22 ? -3.803  0.631   -8.550  1.00 0.00 ? 22 GLY A C    5  
ATOM 3817  O O    . GLY A 1 22 ? -4.412  -0.413  -8.777  1.00 0.00 ? 22 GLY A O    5  
ATOM 3818  H H    . GLY A 1 22 ? -0.860  0.977   -7.568  1.00 0.00 ? 22 GLY A H    5  
ATOM 3819  H HA2  . GLY A 1 22 ? -2.147  1.855   -9.192  1.00 0.00 ? 22 GLY A HA2  5  
ATOM 3820  H HA3  . GLY A 1 22 ? -2.205  0.278   -9.954  1.00 0.00 ? 22 GLY A HA3  5  
ATOM 3821  N N    . TYR A 1 23 ? -4.314  1.674   -7.912  1.00 0.00 ? 23 TYR A N    5  
ATOM 3822  C CA   . TYR A 1 23 ? -5.681  1.654   -7.419  1.00 0.00 ? 23 TYR A CA   5  
ATOM 3823  C C    . TYR A 1 23 ? -6.365  3.004   -7.644  1.00 0.00 ? 23 TYR A C    5  
ATOM 3824  O O    . TYR A 1 23 ? -5.713  4.047   -7.617  1.00 0.00 ? 23 TYR A O    5  
ATOM 3825  C CB   . TYR A 1 23 ? -5.582  1.390   -5.915  1.00 0.00 ? 23 TYR A CB   5  
ATOM 3826  C CG   . TYR A 1 23 ? -5.606  -0.093  -5.541  1.00 0.00 ? 23 TYR A CG   5  
ATOM 3827  C CD1  . TYR A 1 23 ? -6.753  -0.836  -5.737  1.00 0.00 ? 23 TYR A CD1  5  
ATOM 3828  C CD2  . TYR A 1 23 ? -4.481  -0.689  -5.008  1.00 0.00 ? 23 TYR A CD2  5  
ATOM 3829  C CE1  . TYR A 1 23 ? -6.776  -2.232  -5.384  1.00 0.00 ? 23 TYR A CE1  5  
ATOM 3830  C CE2  . TYR A 1 23 ? -4.504  -2.085  -4.655  1.00 0.00 ? 23 TYR A CE2  5  
ATOM 3831  C CZ   . TYR A 1 23 ? -5.650  -2.787  -4.861  1.00 0.00 ? 23 TYR A CZ   5  
ATOM 3832  O OH   . TYR A 1 23 ? -5.672  -4.106  -4.528  1.00 0.00 ? 23 TYR A OH   5  
ATOM 3833  H H    . TYR A 1 23 ? -3.812  2.520   -7.732  1.00 0.00 ? 23 TYR A H    5  
ATOM 3834  H HA   . TYR A 1 23 ? -6.224  0.884   -7.966  1.00 0.00 ? 23 TYR A HA   5  
ATOM 3835  H HB2  . TYR A 1 23 ? -4.661  1.834   -5.538  1.00 0.00 ? 23 TYR A HB2  5  
ATOM 3836  H HB3  . TYR A 1 23 ? -6.408  1.894   -5.413  1.00 0.00 ? 23 TYR A HB3  5  
ATOM 3837  H HD1  . TYR A 1 23 ? -7.642  -0.365  -6.158  1.00 0.00 ? 23 TYR A HD1  5  
ATOM 3838  H HD2  . TYR A 1 23 ? -3.576  -0.102  -4.853  1.00 0.00 ? 23 TYR A HD2  5  
ATOM 3839  H HE1  . TYR A 1 23 ? -7.675  -2.830  -5.534  1.00 0.00 ? 23 TYR A HE1  5  
ATOM 3840  H HE2  . TYR A 1 23 ? -3.623  -2.567  -4.233  1.00 0.00 ? 23 TYR A HE2  5  
ATOM 3841  H HH   . TYR A 1 23 ? -5.284  -4.235  -3.616  1.00 0.00 ? 23 TYR A HH   5  
ATOM 3842  N N    . PRO A 1 24 ? -7.705  2.939   -7.867  1.00 0.00 ? 24 PRO A N    5  
ATOM 3843  C CA   . PRO A 1 24 ? -8.484  4.144   -8.096  1.00 0.00 ? 24 PRO A CA   5  
ATOM 3844  C C    . PRO A 1 24 ? -8.703  4.912   -6.791  1.00 0.00 ? 24 PRO A C    5  
ATOM 3845  O O    . PRO A 1 24 ? -8.073  5.943   -6.561  1.00 0.00 ? 24 PRO A O    5  
ATOM 3846  C CB   . PRO A 1 24 ? -9.781  3.659   -8.725  1.00 0.00 ? 24 PRO A CB   5  
ATOM 3847  C CG   . PRO A 1 24 ? -9.874  2.178   -8.399  1.00 0.00 ? 24 PRO A CG   5  
ATOM 3848  C CD   . PRO A 1 24 ? -8.510  1.722   -7.906  1.00 0.00 ? 24 PRO A CD   5  
ATOM 3849  H HA   . PRO A 1 24 ? -7.989  4.768   -8.701  1.00 0.00 ? 24 PRO A HA   5  
ATOM 3850  H HB2  . PRO A 1 24 ? -10.636 4.202   -8.323  1.00 0.00 ? 24 PRO A HB2  5  
ATOM 3851  H HB3  . PRO A 1 24 ? -9.777  3.823   -9.803  1.00 0.00 ? 24 PRO A HB3  5  
ATOM 3852  H HG2  . PRO A 1 24 ? -10.634 2.001   -7.638  1.00 0.00 ? 24 PRO A HG2  5  
ATOM 3853  H HG3  . PRO A 1 24 ? -10.169 1.611   -9.282  1.00 0.00 ? 24 PRO A HG3  5  
ATOM 3854  H HD2  . PRO A 1 24 ? -8.579  1.262   -6.920  1.00 0.00 ? 24 PRO A HD2  5  
ATOM 3855  H HD3  . PRO A 1 24 ? -8.075  0.980   -8.575  1.00 0.00 ? 24 PRO A HD3  5  
ATOM 3856  N N    . HIS A 1 25 ? -9.599  4.381   -5.972  1.00 0.00 ? 25 HIS A N    5  
ATOM 3857  C CA   . HIS A 1 25 ? -9.909  5.004   -4.697  1.00 0.00 ? 25 HIS A CA   5  
ATOM 3858  C C    . HIS A 1 25 ? -8.956  4.476   -3.623  1.00 0.00 ? 25 HIS A C    5  
ATOM 3859  O O    . HIS A 1 25 ? -9.290  3.541   -2.897  1.00 0.00 ? 25 HIS A O    5  
ATOM 3860  C CB   . HIS A 1 25 ? -11.381 4.799   -4.335  1.00 0.00 ? 25 HIS A CB   5  
ATOM 3861  C CG   . HIS A 1 25 ? -11.745 3.365   -4.031  1.00 0.00 ? 25 HIS A CG   5  
ATOM 3862  N ND1  . HIS A 1 25 ? -12.984 2.994   -3.539  1.00 0.00 ? 25 HIS A ND1  5  
ATOM 3863  C CD2  . HIS A 1 25 ? -11.021 2.216   -4.156  1.00 0.00 ? 25 HIS A CD2  5  
ATOM 3864  C CE1  . HIS A 1 25 ? -12.994 1.679   -3.377  1.00 0.00 ? 25 HIS A CE1  5  
ATOM 3865  N NE2  . HIS A 1 25 ? -11.776 1.199   -3.759  1.00 0.00 ? 25 HIS A NE2  5  
ATOM 3866  H H    . HIS A 1 25 ? -10.107 3.542   -6.167  1.00 0.00 ? 25 HIS A H    5  
ATOM 3867  H HA   . HIS A 1 25 ? -9.743  6.074   -4.823  1.00 0.00 ? 25 HIS A HA   5  
ATOM 3868  H HB2  . HIS A 1 25 ? -11.622 5.415   -3.469  1.00 0.00 ? 25 HIS A HB2  5  
ATOM 3869  H HB3  . HIS A 1 25 ? -12.000 5.153   -5.160  1.00 0.00 ? 25 HIS A HB3  5  
ATOM 3870  H HD1  . HIS A 1 25 ? -13.744 3.614   -3.340  1.00 0.00 ? 25 HIS A HD1  5  
ATOM 3871  H HD2  . HIS A 1 25 ? -9.995  2.146   -4.519  1.00 0.00 ? 25 HIS A HD2  5  
ATOM 3872  H HE1  . HIS A 1 25 ? -13.829 1.086   -3.005  1.00 0.00 ? 25 HIS A HE1  5  
ATOM 3873  H HE2  . HIS A 1 25 ? -11.517 0.234   -3.797  1.00 0.00 ? 25 HIS A HE2  5  
ATOM 3874  N N    . VAL A 1 26 ? -7.788  5.098   -3.556  1.00 0.00 ? 26 VAL A N    5  
ATOM 3875  C CA   . VAL A 1 26 ? -6.784  4.702   -2.582  1.00 0.00 ? 26 VAL A CA   5  
ATOM 3876  C C    . VAL A 1 26 ? -6.896  5.599   -1.347  1.00 0.00 ? 26 VAL A C    5  
ATOM 3877  O O    . VAL A 1 26 ? -7.078  6.809   -1.469  1.00 0.00 ? 26 VAL A O    5  
ATOM 3878  C CB   . VAL A 1 26 ? -5.394  4.736   -3.221  1.00 0.00 ? 26 VAL A CB   5  
ATOM 3879  C CG1  . VAL A 1 26 ? -5.269  3.677   -4.318  1.00 0.00 ? 26 VAL A CG1  5  
ATOM 3880  C CG2  . VAL A 1 26 ? -5.075  6.130   -3.765  1.00 0.00 ? 26 VAL A CG2  5  
ATOM 3881  H H    . VAL A 1 26 ? -7.524  5.858   -4.150  1.00 0.00 ? 26 VAL A H    5  
ATOM 3882  H HA   . VAL A 1 26 ? -6.996  3.674   -2.290  1.00 0.00 ? 26 VAL A HA   5  
ATOM 3883  H HB   . VAL A 1 26 ? -4.663  4.504   -2.446  1.00 0.00 ? 26 VAL A HB   5  
ATOM 3884  H HG11 . VAL A 1 26 ? -6.054  3.827   -5.059  1.00 0.00 ? 26 VAL A HG11 5  
ATOM 3885  H HG12 . VAL A 1 26 ? -4.294  3.764   -4.798  1.00 0.00 ? 26 VAL A HG12 5  
ATOM 3886  H HG13 . VAL A 1 26 ? -5.370  2.685   -3.878  1.00 0.00 ? 26 VAL A HG13 5  
ATOM 3887  H HG21 . VAL A 1 26 ? -5.577  6.882   -3.157  1.00 0.00 ? 26 VAL A HG21 5  
ATOM 3888  H HG22 . VAL A 1 26 ? -3.998  6.295   -3.731  1.00 0.00 ? 26 VAL A HG22 5  
ATOM 3889  H HG23 . VAL A 1 26 ? -5.421  6.206   -4.796  1.00 0.00 ? 26 VAL A HG23 5  
ATOM 3890  N N    . THR A 1 27 ? -6.784  4.969   -0.187  1.00 0.00 ? 27 THR A N    5  
ATOM 3891  C CA   . THR A 1 27 ? -6.871  5.694   1.069   1.00 0.00 ? 27 THR A CA   5  
ATOM 3892  C C    . THR A 1 27 ? -6.078  4.970   2.159   1.00 0.00 ? 27 THR A C    5  
ATOM 3893  O O    . THR A 1 27 ? -5.603  3.855   1.949   1.00 0.00 ? 27 THR A O    5  
ATOM 3894  C CB   . THR A 1 27 ? -8.351  5.872   1.412   1.00 0.00 ? 27 THR A CB   5  
ATOM 3895  O OG1  . THR A 1 27 ? -8.689  4.681   2.118   1.00 0.00 ? 27 THR A OG1  5  
ATOM 3896  C CG2  . THR A 1 27 ? -9.247  5.836   0.172   1.00 0.00 ? 27 THR A CG2  5  
ATOM 3897  H H    . THR A 1 27 ? -6.637  3.984   -0.097  1.00 0.00 ? 27 THR A H    5  
ATOM 3898  H HA   . THR A 1 27 ? -6.409  6.672   0.934   1.00 0.00 ? 27 THR A HA   5  
ATOM 3899  H HB   . THR A 1 27 ? -8.512  6.786   1.982   1.00 0.00 ? 27 THR A HB   5  
ATOM 3900  H HG1  . THR A 1 27 ? -9.482  4.845   2.705   1.00 0.00 ? 27 THR A HG1  5  
ATOM 3901  H HG21 . THR A 1 27 ? -9.008  4.956   -0.424  1.00 0.00 ? 27 THR A HG21 5  
ATOM 3902  H HG22 . THR A 1 27 ? -10.292 5.794   0.480   1.00 0.00 ? 27 THR A HG22 5  
ATOM 3903  H HG23 . THR A 1 27 ? -9.080  6.734   -0.423  1.00 0.00 ? 27 THR A HG23 5  
ATOM 3904  N N    . PRO A 1 28 ? -5.955  5.652   3.329   1.00 0.00 ? 28 PRO A N    5  
ATOM 3905  C CA   . PRO A 1 28 ? -5.227  5.086   4.453   1.00 0.00 ? 28 PRO A CA   5  
ATOM 3906  C C    . PRO A 1 28 ? -6.044  3.988   5.137   1.00 0.00 ? 28 PRO A C    5  
ATOM 3907  O O    . PRO A 1 28 ? -6.056  3.892   6.364   1.00 0.00 ? 28 PRO A O    5  
ATOM 3908  C CB   . PRO A 1 28 ? -4.933  6.265   5.366   1.00 0.00 ? 28 PRO A CB   5  
ATOM 3909  C CG   . PRO A 1 28 ? -5.903  7.361   4.955   1.00 0.00 ? 28 PRO A CG   5  
ATOM 3910  C CD   . PRO A 1 28 ? -6.503  6.975   3.614   1.00 0.00 ? 28 PRO A CD   5  
ATOM 3911  H HA   . PRO A 1 28 ? -4.388  4.644   4.135   1.00 0.00 ? 28 PRO A HA   5  
ATOM 3912  H HB2  . PRO A 1 28 ? -5.072  5.992   6.412   1.00 0.00 ? 28 PRO A HB2  5  
ATOM 3913  H HB3  . PRO A 1 28 ? -3.901  6.596   5.256   1.00 0.00 ? 28 PRO A HB3  5  
ATOM 3914  H HG2  . PRO A 1 28 ? -6.686  7.478   5.705   1.00 0.00 ? 28 PRO A HG2  5  
ATOM 3915  H HG3  . PRO A 1 28 ? -5.387  8.319   4.881   1.00 0.00 ? 28 PRO A HG3  5  
ATOM 3916  H HD2  . PRO A 1 28 ? -7.592  6.951   3.659   1.00 0.00 ? 28 PRO A HD2  5  
ATOM 3917  H HD3  . PRO A 1 28 ? -6.232  7.691   2.838   1.00 0.00 ? 28 PRO A HD3  5  
ATOM 3918  N N    . LYS A 1 29 ? -6.706  3.187   4.315   1.00 0.00 ? 29 LYS A N    5  
ATOM 3919  C CA   . LYS A 1 29 ? -7.523  2.100   4.827   1.00 0.00 ? 29 LYS A CA   5  
ATOM 3920  C C    . LYS A 1 29 ? -8.132  1.330   3.653   1.00 0.00 ? 29 LYS A C    5  
ATOM 3921  O O    . LYS A 1 29 ? -8.049  0.104   3.599   1.00 0.00 ? 29 LYS A O    5  
ATOM 3922  C CB   . LYS A 1 29 ? -8.559  2.629   5.819   1.00 0.00 ? 29 LYS A CB   5  
ATOM 3923  C CG   . LYS A 1 29 ? -8.932  1.559   6.846   1.00 0.00 ? 29 LYS A CG   5  
ATOM 3924  C CD   . LYS A 1 29 ? -10.442 1.307   6.853   1.00 0.00 ? 29 LYS A CD   5  
ATOM 3925  C CE   . LYS A 1 29 ? -10.980 1.244   8.284   1.00 0.00 ? 29 LYS A CE   5  
ATOM 3926  N NZ   . LYS A 1 29 ? -12.343 1.817   8.350   1.00 0.00 ? 29 LYS A NZ   5  
ATOM 3927  H H    . LYS A 1 29 ? -6.690  3.271   3.319   1.00 0.00 ? 29 LYS A H    5  
ATOM 3928  H HA   . LYS A 1 29 ? -6.865  1.427   5.376   1.00 0.00 ? 29 LYS A HA   5  
ATOM 3929  H HB2  . LYS A 1 29 ? -8.164  3.507   6.331   1.00 0.00 ? 29 LYS A HB2  5  
ATOM 3930  H HB3  . LYS A 1 29 ? -9.452  2.950   5.282   1.00 0.00 ? 29 LYS A HB3  5  
ATOM 3931  H HG2  . LYS A 1 29 ? -8.407  0.631   6.618   1.00 0.00 ? 29 LYS A HG2  5  
ATOM 3932  H HG3  . LYS A 1 29 ? -8.608  1.872   7.839   1.00 0.00 ? 29 LYS A HG3  5  
ATOM 3933  H HD2  . LYS A 1 29 ? -10.948 2.101   6.304   1.00 0.00 ? 29 LYS A HD2  5  
ATOM 3934  H HD3  . LYS A 1 29 ? -10.661 0.373   6.337   1.00 0.00 ? 29 LYS A HD3  5  
ATOM 3935  H HE2  . LYS A 1 29 ? -10.998 0.210   8.627   1.00 0.00 ? 29 LYS A HE2  5  
ATOM 3936  H HE3  . LYS A 1 29 ? -10.317 1.791   8.953   1.00 0.00 ? 29 LYS A HE3  5  
ATOM 3937  H HZ1  . LYS A 1 29 ? -12.882 1.486   7.576   1.00 0.00 ? 29 LYS A HZ1  5  
ATOM 3938  H HZ2  . LYS A 1 29 ? -12.781 1.539   9.205   1.00 0.00 ? 29 LYS A HZ2  5  
ATOM 3939  H HZ3  . LYS A 1 29 ? -12.287 2.815   8.314   1.00 0.00 ? 29 LYS A HZ3  5  
ATOM 3940  N N    . GLU A 1 30 ? -8.733  2.082   2.742   1.00 0.00 ? 30 GLU A N    5  
ATOM 3941  C CA   . GLU A 1 30 ? -9.356  1.486   1.572   1.00 0.00 ? 30 GLU A CA   5  
ATOM 3942  C C    . GLU A 1 30 ? -8.294  0.865   0.663   1.00 0.00 ? 30 GLU A C    5  
ATOM 3943  O O    . GLU A 1 30 ? -8.471  -0.245  0.164   1.00 0.00 ? 30 GLU A O    5  
ATOM 3944  C CB   . GLU A 1 30 ? -10.193 2.517   0.812   1.00 0.00 ? 30 GLU A CB   5  
ATOM 3945  C CG   . GLU A 1 30 ? -10.715 1.937   -0.504  1.00 0.00 ? 30 GLU A CG   5  
ATOM 3946  C CD   . GLU A 1 30 ? -12.132 2.431   -0.798  1.00 0.00 ? 30 GLU A CD   5  
ATOM 3947  O OE1  . GLU A 1 30 ? -12.252 3.616   -1.179  1.00 0.00 ? 30 GLU A OE1  5  
ATOM 3948  O OE2  . GLU A 1 30 ? -13.064 1.614   -0.635  1.00 0.00 ? 30 GLU A OE2  5  
ATOM 3949  H H    . GLU A 1 30 ? -8.796  3.079   2.793   1.00 0.00 ? 30 GLU A H    5  
ATOM 3950  H HA   . GLU A 1 30 ? -10.013 0.708   1.960   1.00 0.00 ? 30 GLU A HA   5  
ATOM 3951  H HB2  . GLU A 1 30 ? -11.032 2.836   1.431   1.00 0.00 ? 30 GLU A HB2  5  
ATOM 3952  H HB3  . GLU A 1 30 ? -9.591  3.403   0.610   1.00 0.00 ? 30 GLU A HB3  5  
ATOM 3953  H HG2  . GLU A 1 30 ? -10.050 2.221   -1.319  1.00 0.00 ? 30 GLU A HG2  5  
ATOM 3954  H HG3  . GLU A 1 30 ? -10.709 0.848   -0.453  1.00 0.00 ? 30 GLU A HG3  5  
ATOM 3955  N N    . CYS A 1 31 ? -7.213  1.608   0.476   1.00 0.00 ? 31 CYS A N    5  
ATOM 3956  C CA   . CYS A 1 31 ? -6.122  1.144   -0.364  1.00 0.00 ? 31 CYS A CA   5  
ATOM 3957  C C    . CYS A 1 31 ? -5.501  -0.091  0.293   1.00 0.00 ? 31 CYS A C    5  
ATOM 3958  O O    . CYS A 1 31 ? -5.049  -1.004  -0.396  1.00 0.00 ? 31 CYS A O    5  
ATOM 3959  C CB   . CYS A 1 31 ? -5.086  2.243   -0.606  1.00 0.00 ? 31 CYS A CB   5  
ATOM 3960  S SG   . CYS A 1 31 ? -3.394  1.641   -0.956  1.00 0.00 ? 31 CYS A SG   5  
ATOM 3961  H H    . CYS A 1 31 ? -7.076  2.510   0.886   1.00 0.00 ? 31 CYS A H    5  
ATOM 3962  H HA   . CYS A 1 31 ? -6.558  0.890   -1.331  1.00 0.00 ? 31 CYS A HA   5  
ATOM 3963  H HB2  . CYS A 1 31 ? -5.418  2.858   -1.442  1.00 0.00 ? 31 CYS A HB2  5  
ATOM 3964  H HB3  . CYS A 1 31 ? -5.052  2.890   0.271   1.00 0.00 ? 31 CYS A HB3  5  
ATOM 3965  N N    . ASN A 1 32 ? -5.500  -0.079  1.618   1.00 0.00 ? 32 ASN A N    5  
ATOM 3966  C CA   . ASN A 1 32 ? -4.942  -1.186  2.375   1.00 0.00 ? 32 ASN A CA   5  
ATOM 3967  C C    . ASN A 1 32 ? -6.042  -2.214  2.653   1.00 0.00 ? 32 ASN A C    5  
ATOM 3968  O O    . ASN A 1 32 ? -5.786  -3.253  3.258   1.00 0.00 ? 32 ASN A O    5  
ATOM 3969  C CB   . ASN A 1 32 ? -4.390  -0.710  3.720   1.00 0.00 ? 32 ASN A CB   5  
ATOM 3970  C CG   . ASN A 1 32 ? -4.102  -1.895  4.645   1.00 0.00 ? 32 ASN A CG   5  
ATOM 3971  O OD1  . ASN A 1 32 ? -3.425  -2.845  4.288   1.00 0.00 ? 32 ASN A OD1  5  
ATOM 3972  N ND2  . ASN A 1 32 ? -4.653  -1.786  5.851   1.00 0.00 ? 32 ASN A ND2  5  
ATOM 3973  H H    . ASN A 1 32 ? -5.870  0.667   2.170   1.00 0.00 ? 32 ASN A H    5  
ATOM 3974  H HA   . ASN A 1 32 ? -4.144  -1.588  1.751   1.00 0.00 ? 32 ASN A HA   5  
ATOM 3975  H HB2  . ASN A 1 32 ? -3.475  -0.139  3.560   1.00 0.00 ? 32 ASN A HB2  5  
ATOM 3976  H HB3  . ASN A 1 32 ? -5.105  -0.039  4.195   1.00 0.00 ? 32 ASN A HB3  5  
ATOM 3977  H HD21 . ASN A 1 32 ? -5.197  -0.979  6.081   1.00 0.00 ? 32 ASN A HD21 5  
ATOM 3978  H HD22 . ASN A 1 32 ? -4.522  -2.510  6.528   1.00 0.00 ? 32 ASN A HD22 5  
ATOM 3979  N N    . ASN A 1 33 ? -7.242  -1.887  2.197   1.00 0.00 ? 33 ASN A N    5  
ATOM 3980  C CA   . ASN A 1 33 ? -8.381  -2.768  2.388   1.00 0.00 ? 33 ASN A CA   5  
ATOM 3981  C C    . ASN A 1 33 ? -8.564  -3.637  1.142   1.00 0.00 ? 33 ASN A C    5  
ATOM 3982  O O    . ASN A 1 33 ? -8.878  -4.821  1.247   1.00 0.00 ? 33 ASN A O    5  
ATOM 3983  C CB   . ASN A 1 33 ? -9.667  -1.968  2.600   1.00 0.00 ? 33 ASN A CB   5  
ATOM 3984  C CG   . ASN A 1 33 ? -10.884 -2.893  2.669   1.00 0.00 ? 33 ASN A CG   5  
ATOM 3985  O OD1  . ASN A 1 33 ? -10.772 -4.108  2.688   1.00 0.00 ? 33 ASN A OD1  5  
ATOM 3986  N ND2  . ASN A 1 33 ? -12.049 -2.253  2.705   1.00 0.00 ? 33 ASN A ND2  5  
ATOM 3987  H H    . ASN A 1 33 ? -7.441  -1.039  1.705   1.00 0.00 ? 33 ASN A H    5  
ATOM 3988  H HA   . ASN A 1 33 ? -8.142  -3.356  3.275   1.00 0.00 ? 33 ASN A HA   5  
ATOM 3989  H HB2  . ASN A 1 33 ? -9.593  -1.389  3.521   1.00 0.00 ? 33 ASN A HB2  5  
ATOM 3990  H HB3  . ASN A 1 33 ? -9.794  -1.255  1.785   1.00 0.00 ? 33 ASN A HB3  5  
ATOM 3991  H HD21 . ASN A 1 33 ? -12.071 -1.253  2.686   1.00 0.00 ? 33 ASN A HD21 5  
ATOM 3992  H HD22 . ASN A 1 33 ? -12.903 -2.771  2.751   1.00 0.00 ? 33 ASN A HD22 5  
ATOM 3993  N N    . ARG A 1 34 ? -8.359  -3.014  -0.009  1.00 0.00 ? 34 ARG A N    5  
ATOM 3994  C CA   . ARG A 1 34 ? -8.498  -3.715  -1.274  1.00 0.00 ? 34 ARG A CA   5  
ATOM 3995  C C    . ARG A 1 34 ? -7.495  -4.867  -1.355  1.00 0.00 ? 34 ARG A C    5  
ATOM 3996  O O    . ARG A 1 34 ? -7.737  -5.859  -2.041  1.00 0.00 ? 34 ARG A O    5  
ATOM 3997  C CB   . ARG A 1 34 ? -8.273  -2.769  -2.456  1.00 0.00 ? 34 ARG A CB   5  
ATOM 3998  C CG   . ARG A 1 34 ? -9.213  -3.106  -3.615  1.00 0.00 ? 34 ARG A CG   5  
ATOM 3999  C CD   . ARG A 1 34 ? -8.850  -4.454  -4.241  1.00 0.00 ? 34 ARG A CD   5  
ATOM 4000  N NE   . ARG A 1 34 ? -9.268  -4.482  -5.661  1.00 0.00 ? 34 ARG A NE   5  
ATOM 4001  C CZ   . ARG A 1 34 ? -8.820  -5.370  -6.558  1.00 0.00 ? 34 ARG A CZ   5  
ATOM 4002  N NH1  . ARG A 1 34 ? -7.938  -6.309  -6.189  1.00 0.00 ? 34 ARG A NH1  5  
ATOM 4003  N NH2  . ARG A 1 34 ? -9.254  -5.319  -7.825  1.00 0.00 ? 34 ARG A NH2  5  
ATOM 4004  H H    . ARG A 1 34 ? -8.104  -2.050  -0.086  1.00 0.00 ? 34 ARG A H    5  
ATOM 4005  H HA   . ARG A 1 34 ? -9.523  -4.086  -1.277  1.00 0.00 ? 34 ARG A HA   5  
ATOM 4006  H HB2  . ARG A 1 34 ? -8.437  -1.739  -2.138  1.00 0.00 ? 34 ARG A HB2  5  
ATOM 4007  H HB3  . ARG A 1 34 ? -7.238  -2.839  -2.791  1.00 0.00 ? 34 ARG A HB3  5  
ATOM 4008  H HG2  . ARG A 1 34 ? -10.243 -3.133  -3.257  1.00 0.00 ? 34 ARG A HG2  5  
ATOM 4009  H HG3  . ARG A 1 34 ? -9.159  -2.323  -4.371  1.00 0.00 ? 34 ARG A HG3  5  
ATOM 4010  H HD2  . ARG A 1 34 ? -7.776  -4.622  -4.166  1.00 0.00 ? 34 ARG A HD2  5  
ATOM 4011  H HD3  . ARG A 1 34 ? -9.338  -5.261  -3.694  1.00 0.00 ? 34 ARG A HD3  5  
ATOM 4012  H HE   . ARG A 1 34 ? -9.925  -3.794  -5.969  1.00 0.00 ? 34 ARG A HE   5  
ATOM 4013  H HH11 . ARG A 1 34 ? -7.614  -6.347  -5.244  1.00 0.00 ? 34 ARG A HH11 5  
ATOM 4014  H HH12 . ARG A 1 34 ? -7.604  -6.972  -6.859  1.00 0.00 ? 34 ARG A HH12 5  
ATOM 4015  H HH21 . ARG A 1 34 ? -9.912  -4.619  -8.101  1.00 0.00 ? 34 ARG A HH21 5  
ATOM 4016  H HH22 . ARG A 1 34 ? -8.920  -5.982  -8.495  1.00 0.00 ? 34 ARG A HH22 5  
ATOM 4017  N N    . GLY A 1 35 ? -6.389  -4.698  -0.645  1.00 0.00 ? 35 GLY A N    5  
ATOM 4018  C CA   . GLY A 1 35 ? -5.348  -5.712  -0.627  1.00 0.00 ? 35 GLY A CA   5  
ATOM 4019  C C    . GLY A 1 35 ? -4.014  -5.137  -1.108  1.00 0.00 ? 35 GLY A C    5  
ATOM 4020  O O    . GLY A 1 35 ? -3.575  -5.424  -2.221  1.00 0.00 ? 35 GLY A O    5  
ATOM 4021  H H    . GLY A 1 35 ? -6.199  -3.888  -0.090  1.00 0.00 ? 35 GLY A H    5  
ATOM 4022  H HA2  . GLY A 1 35 ? -5.236  -6.105  0.383   1.00 0.00 ? 35 GLY A HA2  5  
ATOM 4023  H HA3  . GLY A 1 35 ? -5.639  -6.547  -1.264  1.00 0.00 ? 35 GLY A HA3  5  
ATOM 4024  N N    . CYS A 1 36 ? -3.407  -4.335  -0.245  1.00 0.00 ? 36 CYS A N    5  
ATOM 4025  C CA   . CYS A 1 36 ? -2.132  -3.718  -0.568  1.00 0.00 ? 36 CYS A CA   5  
ATOM 4026  C C    . CYS A 1 36 ? -1.777  -2.737  0.551   1.00 0.00 ? 36 CYS A C    5  
ATOM 4027  O O    . CYS A 1 36 ? -2.289  -2.847  1.664   1.00 0.00 ? 36 CYS A O    5  
ATOM 4028  C CB   . CYS A 1 36 ? -2.165  -3.034  -1.937  1.00 0.00 ? 36 CYS A CB   5  
ATOM 4029  S SG   . CYS A 1 36 ? -0.882  -3.606  -3.110  1.00 0.00 ? 36 CYS A SG   5  
ATOM 4030  H H    . CYS A 1 36 ? -3.771  -4.107  0.658   1.00 0.00 ? 36 CYS A H    5  
ATOM 4031  H HA   . CYS A 1 36 ? -1.399  -4.522  -0.624  1.00 0.00 ? 36 CYS A HA   5  
ATOM 4032  H HB2  . CYS A 1 36 ? -3.145  -3.196  -2.384  1.00 0.00 ? 36 CYS A HB2  5  
ATOM 4033  H HB3  . CYS A 1 36 ? -2.053  -1.960  -1.793  1.00 0.00 ? 36 CYS A HB3  5  
ATOM 4034  N N    . CYS A 1 37 ? -0.902  -1.799  0.217   1.00 0.00 ? 37 CYS A N    5  
ATOM 4035  C CA   . CYS A 1 37 ? -0.473  -0.799  1.180   1.00 0.00 ? 37 CYS A CA   5  
ATOM 4036  C C    . CYS A 1 37 ? -0.816  0.584   0.623   1.00 0.00 ? 37 CYS A C    5  
ATOM 4037  O O    . CYS A 1 37 ? -0.876  0.770   -0.591  1.00 0.00 ? 37 CYS A O    5  
ATOM 4038  C CB   . CYS A 1 37 ? 1.017   -0.930  1.505   1.00 0.00 ? 37 CYS A CB   5  
ATOM 4039  S SG   . CYS A 1 37 ? 1.400   -2.011  2.931   1.00 0.00 ? 37 CYS A SG   5  
ATOM 4040  H H    . CYS A 1 37 ? -0.490  -1.716  -0.690  1.00 0.00 ? 37 CYS A H    5  
ATOM 4041  H HA   . CYS A 1 37 ? -1.024  -0.994  2.100   1.00 0.00 ? 37 CYS A HA   5  
ATOM 4042  H HB2  . CYS A 1 37 ? 1.534   -1.315  0.626   1.00 0.00 ? 37 CYS A HB2  5  
ATOM 4043  H HB3  . CYS A 1 37 ? 1.420   0.064   1.702   1.00 0.00 ? 37 CYS A HB3  5  
ATOM 4044  N N    . PHE A 1 38 ? -1.034  1.518   1.537   1.00 0.00 ? 38 PHE A N    5  
ATOM 4045  C CA   . PHE A 1 38 ? -1.370  2.878   1.152   1.00 0.00 ? 38 PHE A CA   5  
ATOM 4046  C C    . PHE A 1 38 ? -0.305  3.864   1.637   1.00 0.00 ? 38 PHE A C    5  
ATOM 4047  O O    . PHE A 1 38 ? 0.611   3.485   2.365   1.00 0.00 ? 38 PHE A O    5  
ATOM 4048  C CB   . PHE A 1 38 ? -2.703  3.216   1.822   1.00 0.00 ? 38 PHE A CB   5  
ATOM 4049  C CG   . PHE A 1 38 ? -3.118  4.681   1.678   1.00 0.00 ? 38 PHE A CG   5  
ATOM 4050  C CD1  . PHE A 1 38 ? -3.757  5.099   0.552   1.00 0.00 ? 38 PHE A CD1  5  
ATOM 4051  C CD2  . PHE A 1 38 ? -2.848  5.566   2.675   1.00 0.00 ? 38 PHE A CD2  5  
ATOM 4052  C CE1  . PHE A 1 38 ? -4.143  6.459   0.418   1.00 0.00 ? 38 PHE A CE1  5  
ATOM 4053  C CE2  . PHE A 1 38 ? -3.234  6.926   2.541   1.00 0.00 ? 38 PHE A CE2  5  
ATOM 4054  C CZ   . PHE A 1 38 ? -3.873  7.344   1.415   1.00 0.00 ? 38 PHE A CZ   5  
ATOM 4055  H H    . PHE A 1 38 ? -0.983  1.358   2.523   1.00 0.00 ? 38 PHE A H    5  
ATOM 4056  H HA   . PHE A 1 38 ? -1.417  2.903   0.064   1.00 0.00 ? 38 PHE A HA   5  
ATOM 4057  H HB2  . PHE A 1 38 ? -3.483  2.584   1.396   1.00 0.00 ? 38 PHE A HB2  5  
ATOM 4058  H HB3  . PHE A 1 38 ? -2.638  2.970   2.882   1.00 0.00 ? 38 PHE A HB3  5  
ATOM 4059  H HD1  . PHE A 1 38 ? -3.974  4.390   -0.247  1.00 0.00 ? 38 PHE A HD1  5  
ATOM 4060  H HD2  . PHE A 1 38 ? -2.336  5.231   3.577   1.00 0.00 ? 38 PHE A HD2  5  
ATOM 4061  H HE1  . PHE A 1 38 ? -4.655  6.794   -0.484  1.00 0.00 ? 38 PHE A HE1  5  
ATOM 4062  H HE2  . PHE A 1 38 ? -3.017  7.635   3.340   1.00 0.00 ? 38 PHE A HE2  5  
ATOM 4063  H HZ   . PHE A 1 38 ? -4.168  8.388   1.312   1.00 0.00 ? 38 PHE A HZ   5  
ATOM 4064  N N    . ASP A 1 39 ? -0.461  5.109   1.213   1.00 0.00 ? 39 ASP A N    5  
ATOM 4065  C CA   . ASP A 1 39 ? 0.476   6.152   1.594   1.00 0.00 ? 39 ASP A CA   5  
ATOM 4066  C C    . ASP A 1 39 ? 0.032   7.481   0.978   1.00 0.00 ? 39 ASP A C    5  
ATOM 4067  O O    . ASP A 1 39 ? -0.482  7.510   -0.139  1.00 0.00 ? 39 ASP A O    5  
ATOM 4068  C CB   . ASP A 1 39 ? 1.884   5.842   1.084   1.00 0.00 ? 39 ASP A CB   5  
ATOM 4069  C CG   . ASP A 1 39 ? 2.934   6.913   1.388   1.00 0.00 ? 39 ASP A CG   5  
ATOM 4070  O OD1  . ASP A 1 39 ? 3.239   7.083   2.588   1.00 0.00 ? 39 ASP A OD1  5  
ATOM 4071  O OD2  . ASP A 1 39 ? 3.406   7.538   0.414   1.00 0.00 ? 39 ASP A OD2  5  
ATOM 4072  H H    . ASP A 1 39 ? -1.208  5.409   0.620   1.00 0.00 ? 39 ASP A H    5  
ATOM 4073  H HA   . ASP A 1 39 ? 0.456   6.171   2.684   1.00 0.00 ? 39 ASP A HA   5  
ATOM 4074  H HB2  . ASP A 1 39 ? 2.213   4.899   1.520   1.00 0.00 ? 39 ASP A HB2  5  
ATOM 4075  H HB3  . ASP A 1 39 ? 1.839   5.695   0.005   1.00 0.00 ? 39 ASP A HB3  5  
ATOM 4076  N N    . SER A 1 40 ? 0.247   8.548   1.734   1.00 0.00 ? 40 SER A N    5  
ATOM 4077  C CA   . SER A 1 40 ? -0.124  9.876   1.276   1.00 0.00 ? 40 SER A CA   5  
ATOM 4078  C C    . SER A 1 40 ? 0.996   10.870  1.588   1.00 0.00 ? 40 SER A C    5  
ATOM 4079  O O    . SER A 1 40 ? 0.790   12.081  1.534   1.00 0.00 ? 40 SER A O    5  
ATOM 4080  C CB   . SER A 1 40 ? -1.435  10.334  1.920   1.00 0.00 ? 40 SER A CB   5  
ATOM 4081  O OG   . SER A 1 40 ? -1.311  10.489  3.331   1.00 0.00 ? 40 SER A OG   5  
ATOM 4082  H H    . SER A 1 40 ? 0.666   8.516   2.641   1.00 0.00 ? 40 SER A H    5  
ATOM 4083  H HA   . SER A 1 40 ? -0.263  9.782   0.199   1.00 0.00 ? 40 SER A HA   5  
ATOM 4084  H HB2  . SER A 1 40 ? -1.745  11.280  1.476   1.00 0.00 ? 40 SER A HB2  5  
ATOM 4085  H HB3  . SER A 1 40 ? -2.218  9.608   1.702   1.00 0.00 ? 40 SER A HB3  5  
ATOM 4086  H HG   . SER A 1 40 ? -2.074  10.039  3.793   1.00 0.00 ? 40 SER A HG   5  
ATOM 4087  N N    . ARG A 1 41 ? 2.159   10.320  1.909   1.00 0.00 ? 41 ARG A N    5  
ATOM 4088  C CA   . ARG A 1 41 ? 3.312   11.144  2.230   1.00 0.00 ? 41 ARG A CA   5  
ATOM 4089  C C    . ARG A 1 41 ? 3.653   12.062  1.054   1.00 0.00 ? 41 ARG A C    5  
ATOM 4090  O O    . ARG A 1 41 ? 3.965   13.235  1.249   1.00 0.00 ? 41 ARG A O    5  
ATOM 4091  C CB   . ARG A 1 41 ? 4.530   10.279  2.563   1.00 0.00 ? 41 ARG A CB   5  
ATOM 4092  C CG   . ARG A 1 41 ? 5.365   10.915  3.676   1.00 0.00 ? 41 ARG A CG   5  
ATOM 4093  C CD   . ARG A 1 41 ? 6.197   9.859   4.408   1.00 0.00 ? 41 ARG A CD   5  
ATOM 4094  N NE   . ARG A 1 41 ? 6.434   10.282  5.806   1.00 0.00 ? 41 ARG A NE   5  
ATOM 4095  C CZ   . ARG A 1 41 ? 7.397   11.134  6.181   1.00 0.00 ? 41 ARG A CZ   5  
ATOM 4096  N NH1  . ARG A 1 41 ? 8.220   11.661  5.263   1.00 0.00 ? 41 ARG A NH1  5  
ATOM 4097  N NH2  . ARG A 1 41 ? 7.538   11.461  7.473   1.00 0.00 ? 41 ARG A NH2  5  
ATOM 4098  H H    . ARG A 1 41 ? 2.318   9.334   1.951   1.00 0.00 ? 41 ARG A H    5  
ATOM 4099  H HA   . ARG A 1 41 ? 3.008   11.721  3.103   1.00 0.00 ? 41 ARG A HA   5  
ATOM 4100  H HB2  . ARG A 1 41 ? 4.202   9.286   2.871   1.00 0.00 ? 41 ARG A HB2  5  
ATOM 4101  H HB3  . ARG A 1 41 ? 5.143   10.150  1.671   1.00 0.00 ? 41 ARG A HB3  5  
ATOM 4102  H HG2  . ARG A 1 41 ? 6.024   11.673  3.253   1.00 0.00 ? 41 ARG A HG2  5  
ATOM 4103  H HG3  . ARG A 1 41 ? 4.709   11.421  4.384   1.00 0.00 ? 41 ARG A HG3  5  
ATOM 4104  H HD2  . ARG A 1 41 ? 5.679   8.900   4.391   1.00 0.00 ? 41 ARG A HD2  5  
ATOM 4105  H HD3  . ARG A 1 41 ? 7.149   9.716   3.896   1.00 0.00 ? 41 ARG A HD3  5  
ATOM 4106  H HE   . ARG A 1 41 ? 5.837   9.907   6.516   1.00 0.00 ? 41 ARG A HE   5  
ATOM 4107  H HH11 . ARG A 1 41 ? 8.115   11.417  4.299   1.00 0.00 ? 41 ARG A HH11 5  
ATOM 4108  H HH12 . ARG A 1 41 ? 8.939   12.297  5.543   1.00 0.00 ? 41 ARG A HH12 5  
ATOM 4109  H HH21 . ARG A 1 41 ? 6.924   11.068  8.158   1.00 0.00 ? 41 ARG A HH21 5  
ATOM 4110  H HH22 . ARG A 1 41 ? 8.257   12.097  7.752   1.00 0.00 ? 41 ARG A HH22 5  
ATOM 4111  N N    . ILE A 1 42 ? 3.582   11.492  -0.140  1.00 0.00 ? 42 ILE A N    5  
ATOM 4112  C CA   . ILE A 1 42 ? 3.879   12.245  -1.347  1.00 0.00 ? 42 ILE A CA   5  
ATOM 4113  C C    . ILE A 1 42 ? 3.094   11.651  -2.519  1.00 0.00 ? 42 ILE A C    5  
ATOM 4114  O O    . ILE A 1 42 ? 3.038   10.433  -2.680  1.00 0.00 ? 42 ILE A O    5  
ATOM 4115  C CB   . ILE A 1 42 ? 5.389   12.302  -1.584  1.00 0.00 ? 42 ILE A CB   5  
ATOM 4116  C CG1  . ILE A 1 42 ? 6.095   11.122  -0.912  1.00 0.00 ? 42 ILE A CG1  5  
ATOM 4117  C CG2  . ILE A 1 42 ? 5.965   13.646  -1.135  1.00 0.00 ? 42 ILE A CG2  5  
ATOM 4118  C CD1  . ILE A 1 42 ? 5.590   9.790   -1.470  1.00 0.00 ? 42 ILE A CD1  5  
ATOM 4119  H H    . ILE A 1 42 ? 3.327   10.537  -0.289  1.00 0.00 ? 42 ILE A H    5  
ATOM 4120  H HA   . ILE A 1 42 ? 3.539   13.268  -1.186  1.00 0.00 ? 42 ILE A HA   5  
ATOM 4121  H HB   . ILE A 1 42 ? 5.570   12.217  -2.656  1.00 0.00 ? 42 ILE A HB   5  
ATOM 4122  H HG12 . ILE A 1 42 ? 7.171   11.201  -1.068  1.00 0.00 ? 42 ILE A HG12 5  
ATOM 4123  H HG13 . ILE A 1 42 ? 5.925   11.158  0.164   1.00 0.00 ? 42 ILE A HG13 5  
ATOM 4124  H HG21 . ILE A 1 42 ? 5.258   14.441  -1.372  1.00 0.00 ? 42 ILE A HG21 5  
ATOM 4125  H HG22 . ILE A 1 42 ? 6.140   13.625  -0.059  1.00 0.00 ? 42 ILE A HG22 5  
ATOM 4126  H HG23 . ILE A 1 42 ? 6.906   13.830  -1.652  1.00 0.00 ? 42 ILE A HG23 5  
ATOM 4127  H HD11 . ILE A 1 42 ? 5.246   9.933   -2.495  1.00 0.00 ? 42 ILE A HD11 5  
ATOM 4128  H HD12 . ILE A 1 42 ? 6.399   9.060   -1.457  1.00 0.00 ? 42 ILE A HD12 5  
ATOM 4129  H HD13 . ILE A 1 42 ? 4.764   9.429   -0.857  1.00 0.00 ? 42 ILE A HD13 5  
ATOM 4130  N N    . PRO A 1 43 ? 2.491   12.564  -3.327  1.00 0.00 ? 43 PRO A N    5  
ATOM 4131  C CA   . PRO A 1 43 ? 1.712   12.144  -4.479  1.00 0.00 ? 43 PRO A CA   5  
ATOM 4132  C C    . PRO A 1 43 ? 2.623   11.684  -5.619  1.00 0.00 ? 43 PRO A C    5  
ATOM 4133  O O    . PRO A 1 43 ? 2.294   10.743  -6.340  1.00 0.00 ? 43 PRO A O    5  
ATOM 4134  C CB   . PRO A 1 43 ? 0.867   13.353  -4.845  1.00 0.00 ? 43 PRO A CB   5  
ATOM 4135  C CG   . PRO A 1 43 ? 1.537   14.546  -4.182  1.00 0.00 ? 43 PRO A CG   5  
ATOM 4136  C CD   . PRO A 1 43 ? 2.535   14.014  -3.166  1.00 0.00 ? 43 PRO A CD   5  
ATOM 4137  H HA   . PRO A 1 43 ? 1.146   11.353  -4.246  1.00 0.00 ? 43 PRO A HA   5  
ATOM 4138  H HB2  . PRO A 1 43 ? 0.818   13.483  -5.926  1.00 0.00 ? 43 PRO A HB2  5  
ATOM 4139  H HB3  . PRO A 1 43 ? -0.158  13.235  -4.492  1.00 0.00 ? 43 PRO A HB3  5  
ATOM 4140  H HG2  . PRO A 1 43 ? 2.041   15.163  -4.926  1.00 0.00 ? 43 PRO A HG2  5  
ATOM 4141  H HG3  . PRO A 1 43 ? 0.795   15.178  -3.694  1.00 0.00 ? 43 PRO A HG3  5  
ATOM 4142  H HD2  . PRO A 1 43 ? 3.536   14.403  -3.354  1.00 0.00 ? 43 PRO A HD2  5  
ATOM 4143  H HD3  . PRO A 1 43 ? 2.263   14.309  -2.153  1.00 0.00 ? 43 PRO A HD3  5  
ATOM 4144  N N    . GLY A 1 44 ? 3.749   12.370  -5.747  1.00 0.00 ? 44 GLY A N    5  
ATOM 4145  C CA   . GLY A 1 44 ? 4.710   12.044  -6.787  1.00 0.00 ? 44 GLY A CA   5  
ATOM 4146  C C    . GLY A 1 44 ? 4.835   10.529  -6.963  1.00 0.00 ? 44 GLY A C    5  
ATOM 4147  O O    . GLY A 1 44 ? 4.941   10.038  -8.086  1.00 0.00 ? 44 GLY A O    5  
ATOM 4148  H H    . GLY A 1 44 ? 4.009   13.134  -5.156  1.00 0.00 ? 44 GLY A H    5  
ATOM 4149  H HA2  . GLY A 1 44 ? 4.401   12.499  -7.728  1.00 0.00 ? 44 GLY A HA2  5  
ATOM 4150  H HA3  . GLY A 1 44 ? 5.683   12.465  -6.533  1.00 0.00 ? 44 GLY A HA3  5  
ATOM 4151  N N    . VAL A 1 45 ? 4.817   9.831   -5.837  1.00 0.00 ? 45 VAL A N    5  
ATOM 4152  C CA   . VAL A 1 45 ? 4.926   8.382   -5.853  1.00 0.00 ? 45 VAL A CA   5  
ATOM 4153  C C    . VAL A 1 45 ? 3.525   7.769   -5.816  1.00 0.00 ? 45 VAL A C    5  
ATOM 4154  O O    . VAL A 1 45 ? 2.539   8.476   -5.617  1.00 0.00 ? 45 VAL A O    5  
ATOM 4155  C CB   . VAL A 1 45 ? 5.815   7.912   -4.700  1.00 0.00 ? 45 VAL A CB   5  
ATOM 4156  C CG1  . VAL A 1 45 ? 6.925   8.926   -4.415  1.00 0.00 ? 45 VAL A CG1  5  
ATOM 4157  C CG2  . VAL A 1 45 ? 4.986   7.639   -3.444  1.00 0.00 ? 45 VAL A CG2  5  
ATOM 4158  H H    . VAL A 1 45 ? 4.730   10.238  -4.928  1.00 0.00 ? 45 VAL A H    5  
ATOM 4159  H HA   . VAL A 1 45 ? 5.409   8.099   -6.788  1.00 0.00 ? 45 VAL A HA   5  
ATOM 4160  H HB   . VAL A 1 45 ? 6.286   6.976   -5.000  1.00 0.00 ? 45 VAL A HB   5  
ATOM 4161  H HG11 . VAL A 1 45 ? 6.705   9.861   -4.930  1.00 0.00 ? 45 VAL A HG11 5  
ATOM 4162  H HG12 . VAL A 1 45 ? 6.984   9.108   -3.341  1.00 0.00 ? 45 VAL A HG12 5  
ATOM 4163  H HG13 . VAL A 1 45 ? 7.878   8.532   -4.769  1.00 0.00 ? 45 VAL A HG13 5  
ATOM 4164  H HG21 . VAL A 1 45 ? 4.248   8.431   -3.317  1.00 0.00 ? 45 VAL A HG21 5  
ATOM 4165  H HG22 . VAL A 1 45 ? 4.476   6.681   -3.546  1.00 0.00 ? 45 VAL A HG22 5  
ATOM 4166  H HG23 . VAL A 1 45 ? 5.642   7.611   -2.574  1.00 0.00 ? 45 VAL A HG23 5  
ATOM 4167  N N    . PRO A 1 46 ? 3.481   6.424   -6.016  1.00 0.00 ? 46 PRO A N    5  
ATOM 4168  C CA   . PRO A 1 46 ? 2.217   5.707   -6.008  1.00 0.00 ? 46 PRO A CA   5  
ATOM 4169  C C    . PRO A 1 46 ? 1.687   5.547   -4.581  1.00 0.00 ? 46 PRO A C    5  
ATOM 4170  O O    . PRO A 1 46 ? 2.011   4.575   -3.901  1.00 0.00 ? 46 PRO A O    5  
ATOM 4171  C CB   . PRO A 1 46 ? 2.514   4.379   -6.684  1.00 0.00 ? 46 PRO A CB   5  
ATOM 4172  C CG   . PRO A 1 46 ? 4.024   4.211   -6.628  1.00 0.00 ? 46 PRO A CG   5  
ATOM 4173  C CD   . PRO A 1 46 ? 4.629   5.554   -6.255  1.00 0.00 ? 46 PRO A CD   5  
ATOM 4174  H HA   . PRO A 1 46 ? 1.520   6.227   -6.502  1.00 0.00 ? 46 PRO A HA   5  
ATOM 4175  H HB2  . PRO A 1 46 ? 2.010   3.559   -6.172  1.00 0.00 ? 46 PRO A HB2  5  
ATOM 4176  H HB3  . PRO A 1 46 ? 2.159   4.377   -7.715  1.00 0.00 ? 46 PRO A HB3  5  
ATOM 4177  H HG2  . PRO A 1 46 ? 4.296   3.452   -5.894  1.00 0.00 ? 46 PRO A HG2  5  
ATOM 4178  H HG3  . PRO A 1 46 ? 4.406   3.874   -7.591  1.00 0.00 ? 46 PRO A HG3  5  
ATOM 4179  H HD2  . PRO A 1 46 ? 5.256   5.473   -5.368  1.00 0.00 ? 46 PRO A HD2  5  
ATOM 4180  H HD3  . PRO A 1 46 ? 5.259   5.941   -7.057  1.00 0.00 ? 46 PRO A HD3  5  
ATOM 4181  N N    . TRP A 1 47 ? 0.881   6.516   -4.172  1.00 0.00 ? 47 TRP A N    5  
ATOM 4182  C CA   . TRP A 1 47 ? 0.303   6.494   -2.839  1.00 0.00 ? 47 TRP A CA   5  
ATOM 4183  C C    . TRP A 1 47 ? 0.096   5.032   -2.436  1.00 0.00 ? 47 TRP A C    5  
ATOM 4184  O O    . TRP A 1 47 ? 0.587   4.595   -1.397  1.00 0.00 ? 47 TRP A O    5  
ATOM 4185  C CB   . TRP A 1 47 ? -0.986  7.317   -2.787  1.00 0.00 ? 47 TRP A CB   5  
ATOM 4186  C CG   . TRP A 1 47 ? -0.770  8.791   -2.438  1.00 0.00 ? 47 TRP A CG   5  
ATOM 4187  C CD1  . TRP A 1 47 ? 0.306   9.549   -2.689  1.00 0.00 ? 47 TRP A CD1  5  
ATOM 4188  C CD2  . TRP A 1 47 ? -1.701  9.659   -1.759  1.00 0.00 ? 47 TRP A CD2  5  
ATOM 4189  N NE1  . TRP A 1 47 ? 0.137   10.837  -2.224  1.00 0.00 ? 47 TRP A NE1  5  
ATOM 4190  C CE2  . TRP A 1 47 ? -1.123  10.906  -1.641  1.00 0.00 ? 47 TRP A CE2  5  
ATOM 4191  C CE3  . TRP A 1 47 ? -2.991  9.399   -1.262  1.00 0.00 ? 47 TRP A CE3  5  
ATOM 4192  C CZ2  . TRP A 1 47 ? -1.760  11.992  -1.028  1.00 0.00 ? 47 TRP A CZ2  5  
ATOM 4193  C CZ3  . TRP A 1 47 ? -3.614  10.495  -0.652  1.00 0.00 ? 47 TRP A CZ3  5  
ATOM 4194  C CH2  . TRP A 1 47 ? -3.045  11.757  -0.525  1.00 0.00 ? 47 TRP A CH2  5  
ATOM 4195  H H    . TRP A 1 47 ? 0.623   7.303   -4.732  1.00 0.00 ? 47 TRP A H    5  
ATOM 4196  H HA   . TRP A 1 47 ? 1.011   6.970   -2.161  1.00 0.00 ? 47 TRP A HA   5  
ATOM 4197  H HB2  . TRP A 1 47 ? -1.485  7.252   -3.753  1.00 0.00 ? 47 TRP A HB2  5  
ATOM 4198  H HB3  . TRP A 1 47 ? -1.657  6.874   -2.051  1.00 0.00 ? 47 TRP A HB3  5  
ATOM 4199  H HD1  . TRP A 1 47 ? 1.203   9.193   -3.197  1.00 0.00 ? 47 TRP A HD1  5  
ATOM 4200  H HE1  . TRP A 1 47 ? 0.858   11.651  -2.301  1.00 0.00 ? 47 TRP A HE1  5  
ATOM 4201  H HE3  . TRP A 1 47 ? -3.469  8.424   -1.343  1.00 0.00 ? 47 TRP A HE3  5  
ATOM 4202  H HZ2  . TRP A 1 47 ? -1.281  12.968  -0.947  1.00 0.00 ? 47 TRP A HZ2  5  
ATOM 4203  H HZ3  . TRP A 1 47 ? -4.616  10.348  -0.249  1.00 0.00 ? 47 TRP A HZ3  5  
ATOM 4204  H HH2  . TRP A 1 47 ? -3.597  12.559  -0.036  1.00 0.00 ? 47 TRP A HH2  5  
ATOM 4205  N N    . CYS A 1 48 ? -0.632  4.317   -3.281  1.00 0.00 ? 48 CYS A N    5  
ATOM 4206  C CA   . CYS A 1 48 ? -0.910  2.914   -3.027  1.00 0.00 ? 48 CYS A CA   5  
ATOM 4207  C C    . CYS A 1 48 ? 0.162   2.077   -3.729  1.00 0.00 ? 48 CYS A C    5  
ATOM 4208  O O    . CYS A 1 48 ? 0.232   2.055   -4.956  1.00 0.00 ? 48 CYS A O    5  
ATOM 4209  C CB   . CYS A 1 48 ? -2.320  2.526   -3.475  1.00 0.00 ? 48 CYS A CB   5  
ATOM 4210  S SG   . CYS A 1 48 ? -3.007  1.043   -2.652  1.00 0.00 ? 48 CYS A SG   5  
ATOM 4211  H H    . CYS A 1 48 ? -1.027  4.680   -4.125  1.00 0.00 ? 48 CYS A H    5  
ATOM 4212  H HA   . CYS A 1 48 ? -0.863  2.776   -1.947  1.00 0.00 ? 48 CYS A HA   5  
ATOM 4213  H HB2  . CYS A 1 48 ? -2.988  3.368   -3.292  1.00 0.00 ? 48 CYS A HB2  5  
ATOM 4214  H HB3  . CYS A 1 48 ? -2.310  2.355   -4.552  1.00 0.00 ? 48 CYS A HB3  5  
ATOM 4215  N N    . PHE A 1 49 ? 0.970   1.409   -2.919  1.00 0.00 ? 49 PHE A N    5  
ATOM 4216  C CA   . PHE A 1 49 ? 2.035   0.572   -3.446  1.00 0.00 ? 49 PHE A CA   5  
ATOM 4217  C C    . PHE A 1 49 ? 2.063   -0.787  -2.745  1.00 0.00 ? 49 PHE A C    5  
ATOM 4218  O O    . PHE A 1 49 ? 1.475   -0.951  -1.677  1.00 0.00 ? 49 PHE A O    5  
ATOM 4219  C CB   . PHE A 1 49 ? 3.352   1.301   -3.174  1.00 0.00 ? 49 PHE A CB   5  
ATOM 4220  C CG   . PHE A 1 49 ? 3.469   1.868   -1.758  1.00 0.00 ? 49 PHE A CG   5  
ATOM 4221  C CD1  . PHE A 1 49 ? 3.599   1.027   -0.697  1.00 0.00 ? 49 PHE A CD1  5  
ATOM 4222  C CD2  . PHE A 1 49 ? 3.442   3.214   -1.560  1.00 0.00 ? 49 PHE A CD2  5  
ATOM 4223  C CE1  . PHE A 1 49 ? 3.707   1.554   0.617   1.00 0.00 ? 49 PHE A CE1  5  
ATOM 4224  C CE2  . PHE A 1 49 ? 3.550   3.740   -0.246  1.00 0.00 ? 49 PHE A CE2  5  
ATOM 4225  C CZ   . PHE A 1 49 ? 3.680   2.899   0.815   1.00 0.00 ? 49 PHE A CZ   5  
ATOM 4226  H H    . PHE A 1 49 ? 0.906   1.432   -1.921  1.00 0.00 ? 49 PHE A H    5  
ATOM 4227  H HA   . PHE A 1 49 ? 1.836   0.427   -4.508  1.00 0.00 ? 49 PHE A HA   5  
ATOM 4228  H HB2  . PHE A 1 49 ? 4.179   0.612   -3.348  1.00 0.00 ? 49 PHE A HB2  5  
ATOM 4229  H HB3  . PHE A 1 49 ? 3.460   2.116   -3.891  1.00 0.00 ? 49 PHE A HB3  5  
ATOM 4230  H HD1  . PHE A 1 49 ? 3.620   -0.051  -0.856  1.00 0.00 ? 49 PHE A HD1  5  
ATOM 4231  H HD2  . PHE A 1 49 ? 3.337   3.888   -2.410  1.00 0.00 ? 49 PHE A HD2  5  
ATOM 4232  H HE1  . PHE A 1 49 ? 3.812   0.880   1.468   1.00 0.00 ? 49 PHE A HE1  5  
ATOM 4233  H HE2  . PHE A 1 49 ? 3.529   4.818   -0.087  1.00 0.00 ? 49 PHE A HE2  5  
ATOM 4234  H HZ   . PHE A 1 49 ? 3.763   3.303   1.824   1.00 0.00 ? 49 PHE A HZ   5  
ATOM 4235  N N    . LYS A 1 50 ? 2.753   -1.727  -3.373  1.00 0.00 ? 50 LYS A N    5  
ATOM 4236  C CA   . LYS A 1 50 ? 2.866   -3.067  -2.823  1.00 0.00 ? 50 LYS A CA   5  
ATOM 4237  C C    . LYS A 1 50 ? 3.570   -2.999  -1.466  1.00 0.00 ? 50 LYS A C    5  
ATOM 4238  O O    . LYS A 1 50 ? 4.218   -2.003  -1.149  1.00 0.00 ? 50 LYS A O    5  
ATOM 4239  C CB   . LYS A 1 50 ? 3.548   -4.002  -3.823  1.00 0.00 ? 50 LYS A CB   5  
ATOM 4240  C CG   . LYS A 1 50 ? 2.584   -4.410  -4.939  1.00 0.00 ? 50 LYS A CG   5  
ATOM 4241  C CD   . LYS A 1 50 ? 2.663   -5.913  -5.211  1.00 0.00 ? 50 LYS A CD   5  
ATOM 4242  C CE   . LYS A 1 50 ? 2.886   -6.191  -6.699  1.00 0.00 ? 50 LYS A CE   5  
ATOM 4243  N NZ   . LYS A 1 50 ? 1.914   -7.194  -7.190  1.00 0.00 ? 50 LYS A NZ   5  
ATOM 4244  H H    . LYS A 1 50 ? 3.228   -1.586  -4.242  1.00 0.00 ? 50 LYS A H    5  
ATOM 4245  H HA   . LYS A 1 50 ? 1.854   -3.443  -2.669  1.00 0.00 ? 50 LYS A HA   5  
ATOM 4246  H HB2  . LYS A 1 50 ? 4.419   -3.508  -4.254  1.00 0.00 ? 50 LYS A HB2  5  
ATOM 4247  H HB3  . LYS A 1 50 ? 3.910   -4.891  -3.307  1.00 0.00 ? 50 LYS A HB3  5  
ATOM 4248  H HG2  . LYS A 1 50 ? 1.565   -4.141  -4.660  1.00 0.00 ? 50 LYS A HG2  5  
ATOM 4249  H HG3  . LYS A 1 50 ? 2.821   -3.859  -5.849  1.00 0.00 ? 50 LYS A HG3  5  
ATOM 4250  H HD2  . LYS A 1 50 ? 3.477   -6.349  -4.630  1.00 0.00 ? 50 LYS A HD2  5  
ATOM 4251  H HD3  . LYS A 1 50 ? 1.743   -6.396  -4.881  1.00 0.00 ? 50 LYS A HD3  5  
ATOM 4252  H HE2  . LYS A 1 50 ? 2.781   -5.266  -7.267  1.00 0.00 ? 50 LYS A HE2  5  
ATOM 4253  H HE3  . LYS A 1 50 ? 3.902   -6.551  -6.860  1.00 0.00 ? 50 LYS A HE3  5  
ATOM 4254  H HZ1  . LYS A 1 50 ? 1.860   -7.951  -6.539  1.00 0.00 ? 50 LYS A HZ1  5  
ATOM 4255  H HZ2  . LYS A 1 50 ? 1.014   -6.768  -7.282  1.00 0.00 ? 50 LYS A HZ2  5  
ATOM 4256  H HZ3  . LYS A 1 50 ? 2.213   -7.539  -8.079  1.00 0.00 ? 50 LYS A HZ3  5  
ATOM 4257  N N    . PRO A 1 51 ? 3.414   -4.099  -0.682  1.00 0.00 ? 51 PRO A N    5  
ATOM 4258  C CA   . PRO A 1 51 ? 4.027   -4.173  0.633   1.00 0.00 ? 51 PRO A CA   5  
ATOM 4259  C C    . PRO A 1 51 ? 5.533   -4.422  0.523   1.00 0.00 ? 51 PRO A C    5  
ATOM 4260  O O    . PRO A 1 51 ? 5.960   -5.423  -0.051  1.00 0.00 ? 51 PRO A O    5  
ATOM 4261  C CB   . PRO A 1 51 ? 3.291   -5.294  1.348   1.00 0.00 ? 51 PRO A CB   5  
ATOM 4262  C CG   . PRO A 1 51 ? 2.616   -6.111  0.258   1.00 0.00 ? 51 PRO A CG   5  
ATOM 4263  C CD   . PRO A 1 51 ? 2.653   -5.297  -1.025  1.00 0.00 ? 51 PRO A CD   5  
ATOM 4264  H HA   . PRO A 1 51 ? 3.929   -3.301  1.112   1.00 0.00 ? 51 PRO A HA   5  
ATOM 4265  H HB2  . PRO A 1 51 ? 3.981   -5.909  1.926   1.00 0.00 ? 51 PRO A HB2  5  
ATOM 4266  H HB3  . PRO A 1 51 ? 2.557   -4.895  2.049   1.00 0.00 ? 51 PRO A HB3  5  
ATOM 4267  H HG2  . PRO A 1 51 ? 3.128   -7.063  0.122   1.00 0.00 ? 51 PRO A HG2  5  
ATOM 4268  H HG3  . PRO A 1 51 ? 1.587   -6.340  0.535   1.00 0.00 ? 51 PRO A HG3  5  
ATOM 4269  H HD2  . PRO A 1 51 ? 3.131   -5.852  -1.832  1.00 0.00 ? 51 PRO A HD2  5  
ATOM 4270  H HD3  . PRO A 1 51 ? 1.648   -5.044  -1.363  1.00 0.00 ? 51 PRO A HD3  5  
ATOM 4271  N N    . LEU A 1 52 ? 6.296   -3.495  1.083   1.00 0.00 ? 52 LEU A N    5  
ATOM 4272  C CA   . LEU A 1 52 ? 7.745   -3.601  1.054   1.00 0.00 ? 52 LEU A CA   5  
ATOM 4273  C C    . LEU A 1 52 ? 8.148   -5.068  1.217   1.00 0.00 ? 52 LEU A C    5  
ATOM 4274  O O    . LEU A 1 52 ? 7.621   -5.768  2.080   1.00 0.00 ? 52 LEU A O    5  
ATOM 4275  C CB   . LEU A 1 52 ? 8.371   -2.672  2.097   1.00 0.00 ? 52 LEU A CB   5  
ATOM 4276  C CG   . LEU A 1 52 ? 9.819   -2.979  2.485   1.00 0.00 ? 52 LEU A CG   5  
ATOM 4277  C CD1  . LEU A 1 52 ? 10.449  -1.799  3.227   1.00 0.00 ? 52 LEU A CD1  5  
ATOM 4278  C CD2  . LEU A 1 52 ? 9.907   -4.276  3.292   1.00 0.00 ? 52 LEU A CD2  5  
ATOM 4279  H H    . LEU A 1 52 ? 5.941   -2.684  1.548   1.00 0.00 ? 52 LEU A H    5  
ATOM 4280  H HA   . LEU A 1 52 ? 8.079   -3.258  0.075   1.00 0.00 ? 52 LEU A HA   5  
ATOM 4281  H HB2  . LEU A 1 52 ? 8.326   -1.651  1.718   1.00 0.00 ? 52 LEU A HB2  5  
ATOM 4282  H HB3  . LEU A 1 52 ? 7.759   -2.706  2.998   1.00 0.00 ? 52 LEU A HB3  5  
ATOM 4283  H HG   . LEU A 1 52 ? 10.394  -3.129  1.571   1.00 0.00 ? 52 LEU A HG   5  
ATOM 4284  H HD11 . LEU A 1 52 ? 9.813   -1.514  4.064   1.00 0.00 ? 52 LEU A HD11 5  
ATOM 4285  H HD12 . LEU A 1 52 ? 11.433  -2.086  3.599   1.00 0.00 ? 52 LEU A HD12 5  
ATOM 4286  H HD13 . LEU A 1 52 ? 10.552  -0.954  2.545   1.00 0.00 ? 52 LEU A HD13 5  
ATOM 4287  H HD21 . LEU A 1 52 ? 8.905   -4.670  3.458   1.00 0.00 ? 52 LEU A HD21 5  
ATOM 4288  H HD22 . LEU A 1 52 ? 10.498  -5.007  2.740   1.00 0.00 ? 52 LEU A HD22 5  
ATOM 4289  H HD23 . LEU A 1 52 ? 10.382  -4.075  4.252   1.00 0.00 ? 52 LEU A HD23 5  
ATOM 4290  N N    . GLN A 1 53 ? 9.079   -5.490  0.374   1.00 0.00 ? 53 GLN A N    5  
ATOM 4291  C CA   . GLN A 1 53 ? 9.558   -6.861  0.413   1.00 0.00 ? 53 GLN A CA   5  
ATOM 4292  C C    . GLN A 1 53 ? 10.237  -7.148  1.754   1.00 0.00 ? 53 GLN A C    5  
ATOM 4293  O O    . GLN A 1 53 ? 11.463  -7.208  1.833   1.00 0.00 ? 53 GLN A O    5  
ATOM 4294  C CB   . GLN A 1 53 ? 10.507  -7.144  -0.753  1.00 0.00 ? 53 GLN A CB   5  
ATOM 4295  C CG   . GLN A 1 53 ? 11.636  -6.113  -0.804  1.00 0.00 ? 53 GLN A CG   5  
ATOM 4296  C CD   . GLN A 1 53 ? 11.353  -5.041  -1.858  1.00 0.00 ? 53 GLN A CD   5  
ATOM 4297  O OE1  . GLN A 1 53 ? 10.951  -5.323  -2.975  1.00 0.00 ? 53 GLN A OE1  5  
ATOM 4298  N NE2  . GLN A 1 53 ? 11.585  -3.799  -1.443  1.00 0.00 ? 53 GLN A NE2  5  
ATOM 4299  H H    . GLN A 1 53 ? 9.503   -4.914  -0.325  1.00 0.00 ? 53 GLN A H    5  
ATOM 4300  H HA   . GLN A 1 53 ? 8.669   -7.482  0.309   1.00 0.00 ? 53 GLN A HA   5  
ATOM 4301  H HB2  . GLN A 1 53 ? 10.928  -8.144  -0.650  1.00 0.00 ? 53 GLN A HB2  5  
ATOM 4302  H HB3  . GLN A 1 53 ? 9.952   -7.127  -1.691  1.00 0.00 ? 53 GLN A HB3  5  
ATOM 4303  H HG2  . GLN A 1 53 ? 11.750  -5.645  0.174   1.00 0.00 ? 53 GLN A HG2  5  
ATOM 4304  H HG3  . GLN A 1 53 ? 12.579  -6.611  -1.030  1.00 0.00 ? 53 GLN A HG3  5  
ATOM 4305  H HE21 . GLN A 1 53 ? 11.914  -3.636  -0.513  1.00 0.00 ? 53 GLN A HE21 5  
ATOM 4306  H HE22 . GLN A 1 53 ? 11.429  -3.028  -2.061  1.00 0.00 ? 53 GLN A HE22 5  
ATOM 4307  N N    . GLU A 1 54 ? 9.410   -7.317  2.775   1.00 0.00 ? 54 GLU A N    5  
ATOM 4308  C CA   . GLU A 1 54 ? 9.915   -7.596  4.109   1.00 0.00 ? 54 GLU A CA   5  
ATOM 4309  C C    . GLU A 1 54 ? 10.881  -8.782  4.074   1.00 0.00 ? 54 GLU A C    5  
ATOM 4310  O O    . GLU A 1 54 ? 10.454  -9.932  3.978   1.00 0.00 ? 54 GLU A O    5  
ATOM 4311  C CB   . GLU A 1 54 ? 8.767   -7.852  5.088   1.00 0.00 ? 54 GLU A CB   5  
ATOM 4312  C CG   . GLU A 1 54 ? 8.004   -9.125  4.716   1.00 0.00 ? 54 GLU A CG   5  
ATOM 4313  C CD   . GLU A 1 54 ? 8.254   -10.233 5.741   1.00 0.00 ? 54 GLU A CD   5  
ATOM 4314  O OE1  . GLU A 1 54 ? 9.360   -10.229 6.323   1.00 0.00 ? 54 GLU A OE1  5  
ATOM 4315  O OE2  . GLU A 1 54 ? 7.333   -11.060 5.920   1.00 0.00 ? 54 GLU A OE2  5  
ATOM 4316  H H    . GLU A 1 54 ? 8.414   -7.267  2.703   1.00 0.00 ? 54 GLU A H    5  
ATOM 4317  H HA   . GLU A 1 54 ? 10.448  -6.694  4.411   1.00 0.00 ? 54 GLU A HA   5  
ATOM 4318  H HB2  . GLU A 1 54 ? 9.161   -7.942  6.100   1.00 0.00 ? 54 GLU A HB2  5  
ATOM 4319  H HB3  . GLU A 1 54 ? 8.086   -7.001  5.085   1.00 0.00 ? 54 GLU A HB3  5  
ATOM 4320  H HG2  . GLU A 1 54 ? 6.937   -8.910  4.661   1.00 0.00 ? 54 GLU A HG2  5  
ATOM 4321  H HG3  . GLU A 1 54 ? 8.313   -9.463  3.727   1.00 0.00 ? 54 GLU A HG3  5  
ATOM 4322  N N    . ALA A 1 55 ? 12.164  -8.463  4.153   1.00 0.00 ? 55 ALA A N    5  
ATOM 4323  C CA   . ALA A 1 55 ? 13.193  -9.488  4.132   1.00 0.00 ? 55 ALA A CA   5  
ATOM 4324  C C    . ALA A 1 55 ? 14.185  -9.232  5.268   1.00 0.00 ? 55 ALA A C    5  
ATOM 4325  O O    . ALA A 1 55 ? 14.756  -8.147  5.367   1.00 0.00 ? 55 ALA A O    5  
ATOM 4326  C CB   . ALA A 1 55 ? 13.870  -9.503  2.760   1.00 0.00 ? 55 ALA A CB   5  
ATOM 4327  H H    . ALA A 1 55 ? 12.503  -7.525  4.231   1.00 0.00 ? 55 ALA A H    5  
ATOM 4328  H HA   . ALA A 1 55 ? 12.707  -10.450 4.294   1.00 0.00 ? 55 ALA A HA   5  
ATOM 4329  H HB1  . ALA A 1 55 ? 14.437  -10.426 2.644   1.00 0.00 ? 55 ALA A HB1  5  
ATOM 4330  H HB2  . ALA A 1 55 ? 13.112  -9.442  1.980   1.00 0.00 ? 55 ALA A HB2  5  
ATOM 4331  H HB3  . ALA A 1 55 ? 14.544  -8.650  2.678   1.00 0.00 ? 55 ALA A HB3  5  
ATOM 4332  N N    . GLU A 1 56 ? 14.360  -10.251 6.098   1.00 0.00 ? 56 GLU A N    5  
ATOM 4333  C CA   . GLU A 1 56 ? 15.273  -10.150 7.224   1.00 0.00 ? 56 GLU A CA   5  
ATOM 4334  C C    . GLU A 1 56 ? 15.146  -8.778  7.890   1.00 0.00 ? 56 GLU A C    5  
ATOM 4335  O O    . GLU A 1 56 ? 14.186  -8.050  7.641   1.00 0.00 ? 56 GLU A O    5  
ATOM 4336  C CB   . GLU A 1 56 ? 16.715  -10.416 6.786   1.00 0.00 ? 56 GLU A CB   5  
ATOM 4337  C CG   . GLU A 1 56 ? 17.435  -9.109  6.449   1.00 0.00 ? 56 GLU A CG   5  
ATOM 4338  C CD   . GLU A 1 56 ? 18.442  -9.314  5.315   1.00 0.00 ? 56 GLU A CD   5  
ATOM 4339  O OE1  . GLU A 1 56 ? 19.589  -9.691  5.636   1.00 0.00 ? 56 GLU A OE1  5  
ATOM 4340  O OE2  . GLU A 1 56 ? 18.040  -9.089  4.153   1.00 0.00 ? 56 GLU A OE2  5  
ATOM 4341  H H    . GLU A 1 56 ? 13.892  -11.130 6.011   1.00 0.00 ? 56 GLU A H    5  
ATOM 4342  H HA   . GLU A 1 56 ? 14.962  -10.929 7.920   1.00 0.00 ? 56 GLU A HA   5  
ATOM 4343  H HB2  . GLU A 1 56 ? 17.250  -10.936 7.581   1.00 0.00 ? 56 GLU A HB2  5  
ATOM 4344  H HB3  . GLU A 1 56 ? 16.719  -11.072 5.916   1.00 0.00 ? 56 GLU A HB3  5  
ATOM 4345  H HG2  . GLU A 1 56 ? 16.706  -8.351  6.161   1.00 0.00 ? 56 GLU A HG2  5  
ATOM 4346  H HG3  . GLU A 1 56 ? 17.950  -8.735  7.334   1.00 0.00 ? 56 GLU A HG3  5  
ATOM 4347  N N    . CYS A 1 57 ? 16.128  -8.467  8.722   1.00 0.00 ? 57 CYS A N    5  
ATOM 4348  C CA   . CYS A 1 57 ? 16.139  -7.195  9.425   1.00 0.00 ? 57 CYS A CA   5  
ATOM 4349  C C    . CYS A 1 57 ? 14.927  -7.153  10.359  1.00 0.00 ? 57 CYS A C    5  
ATOM 4350  O O    . CYS A 1 57 ? 13.843  -7.608  9.996   1.00 0.00 ? 57 CYS A O    5  
ATOM 4351  C CB   . CYS A 1 57 ? 16.153  -6.012  8.455   1.00 0.00 ? 57 CYS A CB   5  
ATOM 4352  S SG   . CYS A 1 57 ? 17.735  -5.767  7.568   1.00 0.00 ? 57 CYS A SG   5  
ATOM 4353  H H    . CYS A 1 57 ? 16.906  -9.064  8.918   1.00 0.00 ? 57 CYS A H    5  
ATOM 4354  H HA   . CYS A 1 57 ? 17.067  -7.160  9.995   1.00 0.00 ? 57 CYS A HA   5  
ATOM 4355  H HB2  . CYS A 1 57 ? 15.359  -6.152  7.721   1.00 0.00 ? 57 CYS A HB2  5  
ATOM 4356  H HB3  . CYS A 1 57 ? 15.919  -5.103  9.009   1.00 0.00 ? 57 CYS A HB3  5  
ATOM 4357  N N    . THR A 1 58 ? 15.152  -6.602  11.543  1.00 0.00 ? 58 THR A N    5  
ATOM 4358  C CA   . THR A 1 58 ? 14.092  -6.494  12.531  1.00 0.00 ? 58 THR A CA   5  
ATOM 4359  C C    . THR A 1 58 ? 14.174  -5.150  13.257  1.00 0.00 ? 58 THR A C    5  
ATOM 4360  O O    . THR A 1 58 ? 13.189  -4.418  13.329  1.00 0.00 ? 58 THR A O    5  
ATOM 4361  C CB   . THR A 1 58 ? 14.195  -7.699  13.469  1.00 0.00 ? 58 THR A CB   5  
ATOM 4362  O OG1  . THR A 1 58 ? 15.554  -7.689  13.897  1.00 0.00 ? 58 THR A OG1  5  
ATOM 4363  C CG2  . THR A 1 58 ? 14.047  -9.031  12.730  1.00 0.00 ? 58 THR A CG2  5  
ATOM 4364  H H    . THR A 1 58 ? 16.036  -6.234  11.830  1.00 0.00 ? 58 THR A H    5  
ATOM 4365  H HA   . THR A 1 58 ? 13.134  -6.519  12.012  1.00 0.00 ? 58 THR A HA   5  
ATOM 4366  H HB   . THR A 1 58 ? 13.474  -7.622  14.282  1.00 0.00 ? 58 THR A HB   5  
ATOM 4367  H HG1  . THR A 1 58 ? 15.623  -7.280  14.807  1.00 0.00 ? 58 THR A HG1  5  
ATOM 4368  H HG21 . THR A 1 58 ? 13.227  -8.960  12.015  1.00 0.00 ? 58 THR A HG21 5  
ATOM 4369  H HG22 . THR A 1 58 ? 14.972  -9.257  12.200  1.00 0.00 ? 58 THR A HG22 5  
ATOM 4370  H HG23 . THR A 1 58 ? 13.837  -9.823  13.448  1.00 0.00 ? 58 THR A HG23 5  
ATOM 4371  N N    . PHE A 1 59 ? 15.360  -4.867  13.777  1.00 0.00 ? 59 PHE A N    5  
ATOM 4372  C CA   . PHE A 1 59 ? 15.584  -3.624  14.495  1.00 0.00 ? 59 PHE A CA   5  
ATOM 4373  C C    . PHE A 1 59 ? 16.877  -2.948  14.032  1.00 0.00 ? 59 PHE A C    5  
ATOM 4374  O O    . PHE A 1 59 ? 17.347  -3.195  12.923  1.00 0.00 ? 59 PHE A O    5  
ATOM 4375  C CB   . PHE A 1 59 ? 15.711  -3.980  15.978  1.00 0.00 ? 59 PHE A CB   5  
ATOM 4376  C CG   . PHE A 1 59 ? 16.440  -2.924  16.811  1.00 0.00 ? 59 PHE A CG   5  
ATOM 4377  C CD1  . PHE A 1 59 ? 15.781  -1.806  17.219  1.00 0.00 ? 59 PHE A CD1  5  
ATOM 4378  C CD2  . PHE A 1 59 ? 17.746  -3.102  17.144  1.00 0.00 ? 59 PHE A CD2  5  
ATOM 4379  C CE1  . PHE A 1 59 ? 16.456  -0.826  17.993  1.00 0.00 ? 59 PHE A CE1  5  
ATOM 4380  C CE2  . PHE A 1 59 ? 18.422  -2.122  17.918  1.00 0.00 ? 59 PHE A CE2  5  
ATOM 4381  C CZ   . PHE A 1 59 ? 17.763  -1.004  18.326  1.00 0.00 ? 59 PHE A CZ   5  
ATOM 4382  H H    . PHE A 1 59 ? 16.156  -5.468  13.714  1.00 0.00 ? 59 PHE A H    5  
ATOM 4383  H HA   . PHE A 1 59 ? 14.738  -2.970  14.282  1.00 0.00 ? 59 PHE A HA   5  
ATOM 4384  H HB2  . PHE A 1 59 ? 14.714  -4.131  16.391  1.00 0.00 ? 59 PHE A HB2  5  
ATOM 4385  H HB3  . PHE A 1 59 ? 16.241  -4.928  16.069  1.00 0.00 ? 59 PHE A HB3  5  
ATOM 4386  H HD1  . PHE A 1 59 ? 14.733  -1.663  16.952  1.00 0.00 ? 59 PHE A HD1  5  
ATOM 4387  H HD2  . PHE A 1 59 ? 18.274  -3.998  16.818  1.00 0.00 ? 59 PHE A HD2  5  
ATOM 4388  H HE1  . PHE A 1 59 ? 15.928  0.070   18.319  1.00 0.00 ? 59 PHE A HE1  5  
ATOM 4389  H HE2  . PHE A 1 59 ? 19.469  -2.265  18.185  1.00 0.00 ? 59 PHE A HE2  5  
ATOM 4390  H HZ   . PHE A 1 59 ? 18.282  -0.252  18.920  1.00 0.00 ? 59 PHE A HZ   5  
ATOM 4391  N N    . GLU A 1 1  ? 0.342   -6.711  21.738  1.00 0.00 ? 1  GLU A N    6  
ATOM 4392  C CA   . GLU A 1 1  ? 1.225   -6.416  22.853  1.00 0.00 ? 1  GLU A CA   6  
ATOM 4393  C C    . GLU A 1 1  ? 2.620   -6.049  22.344  1.00 0.00 ? 1  GLU A C    6  
ATOM 4394  O O    . GLU A 1 1  ? 3.165   -5.009  22.710  1.00 0.00 ? 1  GLU A O    6  
ATOM 4395  C CB   . GLU A 1 1  ? 1.289   -7.594  23.827  1.00 0.00 ? 1  GLU A CB   6  
ATOM 4396  C CG   . GLU A 1 1  ? 0.463   -7.312  25.084  1.00 0.00 ? 1  GLU A CG   6  
ATOM 4397  C CD   . GLU A 1 1  ? 1.198   -7.783  26.341  1.00 0.00 ? 1  GLU A CD   6  
ATOM 4398  O OE1  . GLU A 1 1  ? 1.630   -8.956  26.339  1.00 0.00 ? 1  GLU A OE1  6  
ATOM 4399  O OE2  . GLU A 1 1  ? 1.312   -6.960  27.274  1.00 0.00 ? 1  GLU A OE2  6  
ATOM 4400  H H    . GLU A 1 1  ? -0.608  -6.422  21.863  1.00 0.00 ? 1  GLU A H    6  
ATOM 4401  H HA   . GLU A 1 1  ? 0.778   -5.559  23.358  1.00 0.00 ? 1  GLU A HA   6  
ATOM 4402  H HB2  . GLU A 1 1  ? 0.918   -8.495  23.339  1.00 0.00 ? 1  GLU A HB2  6  
ATOM 4403  H HB3  . GLU A 1 1  ? 2.325   -7.786  24.105  1.00 0.00 ? 1  GLU A HB3  6  
ATOM 4404  H HG2  . GLU A 1 1  ? 0.258   -6.244  25.157  1.00 0.00 ? 1  GLU A HG2  6  
ATOM 4405  H HG3  . GLU A 1 1  ? -0.500  -7.817  25.011  1.00 0.00 ? 1  GLU A HG3  6  
ATOM 4406  N N    . GLU A 1 2  ? 3.158   -6.924  21.507  1.00 0.00 ? 2  GLU A N    6  
ATOM 4407  C CA   . GLU A 1 2  ? 4.480   -6.706  20.943  1.00 0.00 ? 2  GLU A CA   6  
ATOM 4408  C C    . GLU A 1 2  ? 4.615   -7.441  19.608  1.00 0.00 ? 2  GLU A C    6  
ATOM 4409  O O    . GLU A 1 2  ? 5.461   -8.322  19.464  1.00 0.00 ? 2  GLU A O    6  
ATOM 4410  C CB   . GLU A 1 2  ? 5.572   -7.140  21.922  1.00 0.00 ? 2  GLU A CB   6  
ATOM 4411  C CG   . GLU A 1 2  ? 5.501   -8.645  22.190  1.00 0.00 ? 2  GLU A CG   6  
ATOM 4412  C CD   . GLU A 1 2  ? 5.287   -8.927  23.679  1.00 0.00 ? 2  GLU A CD   6  
ATOM 4413  O OE1  . GLU A 1 2  ? 6.188   -8.556  24.462  1.00 0.00 ? 2  GLU A OE1  6  
ATOM 4414  O OE2  . GLU A 1 2  ? 4.228   -9.508  24.000  1.00 0.00 ? 2  GLU A OE2  6  
ATOM 4415  H H    . GLU A 1 2  ? 2.708   -7.768  21.214  1.00 0.00 ? 2  GLU A H    6  
ATOM 4416  H HA   . GLU A 1 2  ? 4.551   -5.630  20.782  1.00 0.00 ? 2  GLU A HA   6  
ATOM 4417  H HB2  . GLU A 1 2  ? 6.551   -6.885  21.517  1.00 0.00 ? 2  GLU A HB2  6  
ATOM 4418  H HB3  . GLU A 1 2  ? 5.463   -6.595  22.860  1.00 0.00 ? 2  GLU A HB3  6  
ATOM 4419  H HG2  . GLU A 1 2  ? 4.687   -9.083  21.613  1.00 0.00 ? 2  GLU A HG2  6  
ATOM 4420  H HG3  . GLU A 1 2  ? 6.422   -9.122  21.855  1.00 0.00 ? 2  GLU A HG3  6  
ATOM 4421  N N    . TYR A 1 3  ? 3.769   -7.051  18.666  1.00 0.00 ? 3  TYR A N    6  
ATOM 4422  C CA   . TYR A 1 3  ? 3.785   -7.662  17.348  1.00 0.00 ? 3  TYR A CA   6  
ATOM 4423  C C    . TYR A 1 3  ? 2.942   -6.853  16.359  1.00 0.00 ? 3  TYR A C    6  
ATOM 4424  O O    . TYR A 1 3  ? 1.779   -6.555  16.627  1.00 0.00 ? 3  TYR A O    6  
ATOM 4425  C CB   . TYR A 1 3  ? 3.159   -9.048  17.518  1.00 0.00 ? 3  TYR A CB   6  
ATOM 4426  C CG   . TYR A 1 3  ? 3.542   -10.042 16.420  1.00 0.00 ? 3  TYR A CG   6  
ATOM 4427  C CD1  . TYR A 1 3  ? 3.155   -9.814  15.116  1.00 0.00 ? 3  TYR A CD1  6  
ATOM 4428  C CD2  . TYR A 1 3  ? 4.276   -11.169 16.735  1.00 0.00 ? 3  TYR A CD2  6  
ATOM 4429  C CE1  . TYR A 1 3  ? 3.516   -10.750 14.083  1.00 0.00 ? 3  TYR A CE1  6  
ATOM 4430  C CE2  . TYR A 1 3  ? 4.637   -12.105 15.702  1.00 0.00 ? 3  TYR A CE2  6  
ATOM 4431  C CZ   . TYR A 1 3  ? 4.238   -11.849 14.427  1.00 0.00 ? 3  TYR A CZ   6  
ATOM 4432  O OH   . TYR A 1 3  ? 4.579   -12.734 13.451  1.00 0.00 ? 3  TYR A OH   6  
ATOM 4433  H H    . TYR A 1 3  ? 3.084   -6.333  18.791  1.00 0.00 ? 3  TYR A H    6  
ATOM 4434  H HA   . TYR A 1 3  ? 4.817   -7.685  16.999  1.00 0.00 ? 3  TYR A HA   6  
ATOM 4435  H HB2  . TYR A 1 3  ? 3.459   -9.454  18.484  1.00 0.00 ? 3  TYR A HB2  6  
ATOM 4436  H HB3  . TYR A 1 3  ? 2.074   -8.945  17.539  1.00 0.00 ? 3  TYR A HB3  6  
ATOM 4437  H HD1  . TYR A 1 3  ? 2.576   -8.924  14.867  1.00 0.00 ? 3  TYR A HD1  6  
ATOM 4438  H HD2  . TYR A 1 3  ? 4.582   -11.349 17.766  1.00 0.00 ? 3  TYR A HD2  6  
ATOM 4439  H HE1  . TYR A 1 3  ? 3.216   -10.582 13.048  1.00 0.00 ? 3  TYR A HE1  6  
ATOM 4440  H HE2  . TYR A 1 3  ? 5.215   -12.998 15.937  1.00 0.00 ? 3  TYR A HE2  6  
ATOM 4441  H HH   . TYR A 1 3  ? 3.911   -12.697 12.708  1.00 0.00 ? 3  TYR A HH   6  
ATOM 4442  N N    . VAL A 1 4  ? 3.562   -6.521  15.236  1.00 0.00 ? 4  VAL A N    6  
ATOM 4443  C CA   . VAL A 1 4  ? 2.884   -5.753  14.206  1.00 0.00 ? 4  VAL A CA   6  
ATOM 4444  C C    . VAL A 1 4  ? 3.794   -5.634  12.982  1.00 0.00 ? 4  VAL A C    6  
ATOM 4445  O O    . VAL A 1 4  ? 4.634   -4.738  12.913  1.00 0.00 ? 4  VAL A O    6  
ATOM 4446  C CB   . VAL A 1 4  ? 2.453   -4.395  14.764  1.00 0.00 ? 4  VAL A CB   6  
ATOM 4447  C CG1  . VAL A 1 4  ? 3.666   -3.573  15.204  1.00 0.00 ? 4  VAL A CG1  6  
ATOM 4448  C CG2  . VAL A 1 4  ? 1.609   -3.626  13.745  1.00 0.00 ? 4  VAL A CG2  6  
ATOM 4449  H H    . VAL A 1 4  ? 4.508   -6.767  15.025  1.00 0.00 ? 4  VAL A H    6  
ATOM 4450  H HA   . VAL A 1 4  ? 1.986   -6.302  13.923  1.00 0.00 ? 4  VAL A HA   6  
ATOM 4451  H HB   . VAL A 1 4  ? 1.834   -4.575  15.643  1.00 0.00 ? 4  VAL A HB   6  
ATOM 4452  H HG11 . VAL A 1 4  ? 4.518   -4.236  15.354  1.00 0.00 ? 4  VAL A HG11 6  
ATOM 4453  H HG12 . VAL A 1 4  ? 3.907   -2.840  14.434  1.00 0.00 ? 4  VAL A HG12 6  
ATOM 4454  H HG13 . VAL A 1 4  ? 3.437   -3.058  16.137  1.00 0.00 ? 4  VAL A HG13 6  
ATOM 4455  H HG21 . VAL A 1 4  ? 1.985   -3.821  12.741  1.00 0.00 ? 4  VAL A HG21 6  
ATOM 4456  H HG22 . VAL A 1 4  ? 0.571   -3.951  13.814  1.00 0.00 ? 4  VAL A HG22 6  
ATOM 4457  H HG23 . VAL A 1 4  ? 1.671   -2.558  13.955  1.00 0.00 ? 4  VAL A HG23 6  
ATOM 4458  N N    . GLY A 1 5  ? 3.596   -6.551  12.046  1.00 0.00 ? 5  GLY A N    6  
ATOM 4459  C CA   . GLY A 1 5  ? 4.389   -6.560  10.828  1.00 0.00 ? 5  GLY A CA   6  
ATOM 4460  C C    . GLY A 1 5  ? 3.509   -6.322  9.599   1.00 0.00 ? 5  GLY A C    6  
ATOM 4461  O O    . GLY A 1 5  ? 3.997   -6.328  8.471   1.00 0.00 ? 5  GLY A O    6  
ATOM 4462  H H    . GLY A 1 5  ? 2.911   -7.276  12.110  1.00 0.00 ? 5  GLY A H    6  
ATOM 4463  H HA2  . GLY A 1 5  ? 5.157   -5.790  10.884  1.00 0.00 ? 5  GLY A HA2  6  
ATOM 4464  H HA3  . GLY A 1 5  ? 4.902   -7.517  10.732  1.00 0.00 ? 5  GLY A HA3  6  
ATOM 4465  N N    . LEU A 1 6  ? 2.226   -6.118  9.861   1.00 0.00 ? 6  LEU A N    6  
ATOM 4466  C CA   . LEU A 1 6  ? 1.273   -5.877  8.790   1.00 0.00 ? 6  LEU A CA   6  
ATOM 4467  C C    . LEU A 1 6  ? 0.731   -4.451  8.906   1.00 0.00 ? 6  LEU A C    6  
ATOM 4468  O O    . LEU A 1 6  ? -0.477  -4.235  8.830   1.00 0.00 ? 6  LEU A O    6  
ATOM 4469  C CB   . LEU A 1 6  ? 0.183   -6.951  8.792   1.00 0.00 ? 6  LEU A CB   6  
ATOM 4470  C CG   . LEU A 1 6  ? -0.533  -7.178  10.124  1.00 0.00 ? 6  LEU A CG   6  
ATOM 4471  C CD1  . LEU A 1 6  ? -2.044  -6.993  9.973   1.00 0.00 ? 6  LEU A CD1  6  
ATOM 4472  C CD2  . LEU A 1 6  ? -0.179  -8.546  10.711  1.00 0.00 ? 6  LEU A CD2  6  
ATOM 4473  H H    . LEU A 1 6  ? 1.836   -6.115  10.782  1.00 0.00 ? 6  LEU A H    6  
ATOM 4474  H HA   . LEU A 1 6  ? 1.812   -5.967  7.847   1.00 0.00 ? 6  LEU A HA   6  
ATOM 4475  H HB2  . LEU A 1 6  ? -0.562  -6.686  8.042   1.00 0.00 ? 6  LEU A HB2  6  
ATOM 4476  H HB3  . LEU A 1 6  ? 0.630   -7.895  8.477   1.00 0.00 ? 6  LEU A HB3  6  
ATOM 4477  H HG   . LEU A 1 6  ? -0.186  -6.425  10.832  1.00 0.00 ? 6  LEU A HG   6  
ATOM 4478  H HD11 . LEU A 1 6  ? -2.248  -6.018  9.528   1.00 0.00 ? 6  LEU A HD11 6  
ATOM 4479  H HD12 . LEU A 1 6  ? -2.444  -7.776  9.330   1.00 0.00 ? 6  LEU A HD12 6  
ATOM 4480  H HD13 . LEU A 1 6  ? -2.517  -7.050  10.953  1.00 0.00 ? 6  LEU A HD13 6  
ATOM 4481  H HD21 . LEU A 1 6  ? -0.335  -9.317  9.956   1.00 0.00 ? 6  LEU A HD21 6  
ATOM 4482  H HD22 . LEU A 1 6  ? 0.865   -8.549  11.023  1.00 0.00 ? 6  LEU A HD22 6  
ATOM 4483  H HD23 . LEU A 1 6  ? -0.817  -8.748  11.572  1.00 0.00 ? 6  LEU A HD23 6  
ATOM 4484  N N    . SER A 1 7  ? 1.651   -3.516  9.088   1.00 0.00 ? 7  SER A N    6  
ATOM 4485  C CA   . SER A 1 7  ? 1.281   -2.117  9.216   1.00 0.00 ? 7  SER A CA   6  
ATOM 4486  C C    . SER A 1 7  ? 2.527   -1.267  9.472   1.00 0.00 ? 7  SER A C    6  
ATOM 4487  O O    . SER A 1 7  ? 3.204   -1.442  10.484  1.00 0.00 ? 7  SER A O    6  
ATOM 4488  C CB   . SER A 1 7  ? 0.261   -1.916  10.339  1.00 0.00 ? 7  SER A CB   6  
ATOM 4489  O OG   . SER A 1 7  ? 0.582   -2.687  11.494  1.00 0.00 ? 7  SER A OG   6  
ATOM 4490  H H    . SER A 1 7  ? 2.632   -3.700  9.149   1.00 0.00 ? 7  SER A H    6  
ATOM 4491  H HA   . SER A 1 7  ? 0.826   -1.850  8.261   1.00 0.00 ? 7  SER A HA   6  
ATOM 4492  H HB2  . SER A 1 7  ? 0.220   -0.861  10.607  1.00 0.00 ? 7  SER A HB2  6  
ATOM 4493  H HB3  . SER A 1 7  ? -0.730  -2.193  9.981   1.00 0.00 ? 7  SER A HB3  6  
ATOM 4494  H HG   . SER A 1 7  ? 0.536   -3.662  11.278  1.00 0.00 ? 7  SER A HG   6  
ATOM 4495  N N    . ALA A 1 8  ? 2.791   -0.364  8.539   1.00 0.00 ? 8  ALA A N    6  
ATOM 4496  C CA   . ALA A 1 8  ? 3.944   0.513   8.651   1.00 0.00 ? 8  ALA A CA   6  
ATOM 4497  C C    . ALA A 1 8  ? 5.184   -0.211  8.123   1.00 0.00 ? 8  ALA A C    6  
ATOM 4498  O O    . ALA A 1 8  ? 5.688   0.116   7.050   1.00 0.00 ? 8  ALA A O    6  
ATOM 4499  C CB   . ALA A 1 8  ? 4.105   0.961   10.105  1.00 0.00 ? 8  ALA A CB   6  
ATOM 4500  H H    . ALA A 1 8  ? 2.235   -0.228  7.719   1.00 0.00 ? 8  ALA A H    6  
ATOM 4501  H HA   . ALA A 1 8  ? 3.755   1.391   8.033   1.00 0.00 ? 8  ALA A HA   6  
ATOM 4502  H HB1  . ALA A 1 8  ? 4.628   1.917   10.135  1.00 0.00 ? 8  ALA A HB1  6  
ATOM 4503  H HB2  . ALA A 1 8  ? 4.680   0.215   10.654  1.00 0.00 ? 8  ALA A HB2  6  
ATOM 4504  H HB3  . ALA A 1 8  ? 3.122   1.071   10.563  1.00 0.00 ? 8  ALA A HB3  6  
ATOM 4505  N N    . ASN A 1 9  ? 5.640   -1.181  8.902   1.00 0.00 ? 9  ASN A N    6  
ATOM 4506  C CA   . ASN A 1 9  ? 6.812   -1.954  8.527   1.00 0.00 ? 9  ASN A CA   6  
ATOM 4507  C C    . ASN A 1 9  ? 6.609   -2.530  7.124   1.00 0.00 ? 9  ASN A C    6  
ATOM 4508  O O    . ASN A 1 9  ? 7.564   -2.667  6.361   1.00 0.00 ? 9  ASN A O    6  
ATOM 4509  C CB   . ASN A 1 9  ? 7.034   -3.121  9.491   1.00 0.00 ? 9  ASN A CB   6  
ATOM 4510  C CG   . ASN A 1 9  ? 8.190   -2.829  10.449  1.00 0.00 ? 9  ASN A CG   6  
ATOM 4511  O OD1  . ASN A 1 9  ? 8.867   -1.818  10.356  1.00 0.00 ? 9  ASN A OD1  6  
ATOM 4512  N ND2  . ASN A 1 9  ? 8.377   -3.767  11.373  1.00 0.00 ? 9  ASN A ND2  6  
ATOM 4513  H H    . ASN A 1 9  ? 5.224   -1.440  9.774   1.00 0.00 ? 9  ASN A H    6  
ATOM 4514  H HA   . ASN A 1 9  ? 7.645   -1.252  8.573   1.00 0.00 ? 9  ASN A HA   6  
ATOM 4515  H HB2  . ASN A 1 9  ? 6.123   -3.306  10.060  1.00 0.00 ? 9  ASN A HB2  6  
ATOM 4516  H HB3  . ASN A 1 9  ? 7.246   -4.029  8.925   1.00 0.00 ? 9  ASN A HB3  6  
ATOM 4517  H HD21 . ASN A 1 9  ? 7.786   -4.573  11.394  1.00 0.00 ? 9  ASN A HD21 6  
ATOM 4518  H HD22 . ASN A 1 9  ? 9.110   -3.667  12.046  1.00 0.00 ? 9  ASN A HD22 6  
ATOM 4519  N N    . GLN A 1 10 ? 5.359   -2.854  6.827   1.00 0.00 ? 10 GLN A N    6  
ATOM 4520  C CA   . GLN A 1 10 ? 5.019   -3.413  5.530   1.00 0.00 ? 10 GLN A CA   6  
ATOM 4521  C C    . GLN A 1 10 ? 4.862   -2.296  4.496   1.00 0.00 ? 10 GLN A C    6  
ATOM 4522  O O    . GLN A 1 10 ? 5.172   -2.486  3.320   1.00 0.00 ? 10 GLN A O    6  
ATOM 4523  C CB   . GLN A 1 10 ? 3.750   -4.263  5.615   1.00 0.00 ? 10 GLN A CB   6  
ATOM 4524  C CG   . GLN A 1 10 ? 3.836   -5.472  4.681   1.00 0.00 ? 10 GLN A CG   6  
ATOM 4525  C CD   . GLN A 1 10 ? 2.442   -5.999  4.337   1.00 0.00 ? 10 GLN A CD   6  
ATOM 4526  O OE1  . GLN A 1 10 ? 1.452   -5.286  4.377   1.00 0.00 ? 10 GLN A OE1  6  
ATOM 4527  N NE2  . GLN A 1 10 ? 2.418   -7.285  3.998   1.00 0.00 ? 10 GLN A NE2  6  
ATOM 4528  H H    . GLN A 1 10 ? 4.588   -2.740  7.454   1.00 0.00 ? 10 GLN A H    6  
ATOM 4529  H HA   . GLN A 1 10 ? 5.860   -4.052  5.260   1.00 0.00 ? 10 GLN A HA   6  
ATOM 4530  H HB2  . GLN A 1 10 ? 3.603   -4.602  6.641   1.00 0.00 ? 10 GLN A HB2  6  
ATOM 4531  H HB3  . GLN A 1 10 ? 2.883   -3.657  5.352   1.00 0.00 ? 10 GLN A HB3  6  
ATOM 4532  H HG2  . GLN A 1 10 ? 4.359   -5.192  3.766   1.00 0.00 ? 10 GLN A HG2  6  
ATOM 4533  H HG3  . GLN A 1 10 ? 4.421   -6.261  5.154   1.00 0.00 ? 10 GLN A HG3  6  
ATOM 4534  H HE21 . GLN A 1 10 ? 3.267   -7.814  3.985   1.00 0.00 ? 10 GLN A HE21 6  
ATOM 4535  H HE22 . GLN A 1 10 ? 1.552   -7.723  3.755   1.00 0.00 ? 10 GLN A HE22 6  
ATOM 4536  N N    . CYS A 1 11 ? 4.381   -1.156  4.970   1.00 0.00 ? 11 CYS A N    6  
ATOM 4537  C CA   . CYS A 1 11 ? 4.180   -0.009  4.101   1.00 0.00 ? 11 CYS A CA   6  
ATOM 4538  C C    . CYS A 1 11 ? 5.143   1.097   4.535   1.00 0.00 ? 11 CYS A C    6  
ATOM 4539  O O    . CYS A 1 11 ? 4.746   2.254   4.668   1.00 0.00 ? 11 CYS A O    6  
ATOM 4540  C CB   . CYS A 1 11 ? 2.724   0.463   4.116   1.00 0.00 ? 11 CYS A CB   6  
ATOM 4541  S SG   . CYS A 1 11 ? 1.495   -0.850  4.456   1.00 0.00 ? 11 CYS A SG   6  
ATOM 4542  H H    . CYS A 1 11 ? 4.132   -1.010  5.928   1.00 0.00 ? 11 CYS A H    6  
ATOM 4543  H HA   . CYS A 1 11 ? 4.403   -0.342  3.088   1.00 0.00 ? 11 CYS A HA   6  
ATOM 4544  H HB2  . CYS A 1 11 ? 2.618   1.244   4.868   1.00 0.00 ? 11 CYS A HB2  6  
ATOM 4545  H HB3  . CYS A 1 11 ? 2.494   0.915   3.151   1.00 0.00 ? 11 CYS A HB3  6  
ATOM 4546  N N    . ALA A 1 12 ? 6.391   0.703   4.744   1.00 0.00 ? 12 ALA A N    6  
ATOM 4547  C CA   . ALA A 1 12 ? 7.414   1.648   5.160   1.00 0.00 ? 12 ALA A CA   6  
ATOM 4548  C C    . ALA A 1 12 ? 8.485   1.745   4.072   1.00 0.00 ? 12 ALA A C    6  
ATOM 4549  O O    . ALA A 1 12 ? 9.669   1.550   4.343   1.00 0.00 ? 12 ALA A O    6  
ATOM 4550  C CB   . ALA A 1 12 ? 7.990   1.214   6.510   1.00 0.00 ? 12 ALA A CB   6  
ATOM 4551  H H    . ALA A 1 12 ? 6.705   -0.239  4.634   1.00 0.00 ? 12 ALA A H    6  
ATOM 4552  H HA   . ALA A 1 12 ? 6.938   2.621   5.279   1.00 0.00 ? 12 ALA A HA   6  
ATOM 4553  H HB1  . ALA A 1 12 ? 9.045   1.485   6.558   1.00 0.00 ? 12 ALA A HB1  6  
ATOM 4554  H HB2  . ALA A 1 12 ? 7.450   1.714   7.313   1.00 0.00 ? 12 ALA A HB2  6  
ATOM 4555  H HB3  . ALA A 1 12 ? 7.887   0.134   6.619   1.00 0.00 ? 12 ALA A HB3  6  
ATOM 4556  N N    . VAL A 1 13 ? 8.031   2.046   2.865   1.00 0.00 ? 13 VAL A N    6  
ATOM 4557  C CA   . VAL A 1 13 ? 8.936   2.171   1.735   1.00 0.00 ? 13 VAL A CA   6  
ATOM 4558  C C    . VAL A 1 13 ? 9.385   3.628   1.605   1.00 0.00 ? 13 VAL A C    6  
ATOM 4559  O O    . VAL A 1 13 ? 8.658   4.542   1.992   1.00 0.00 ? 13 VAL A O    6  
ATOM 4560  C CB   . VAL A 1 13 ? 8.267   1.637   0.467   1.00 0.00 ? 13 VAL A CB   6  
ATOM 4561  C CG1  . VAL A 1 13 ? 9.262   0.850   -0.388  1.00 0.00 ? 13 VAL A CG1  6  
ATOM 4562  C CG2  . VAL A 1 13 ? 7.043   0.785   0.810   1.00 0.00 ? 13 VAL A CG2  6  
ATOM 4563  H H    . VAL A 1 13 ? 7.066   2.203   2.653   1.00 0.00 ? 13 VAL A H    6  
ATOM 4564  H HA   . VAL A 1 13 ? 9.809   1.552   1.942   1.00 0.00 ? 13 VAL A HA   6  
ATOM 4565  H HB   . VAL A 1 13 ? 7.926   2.492   -0.118  1.00 0.00 ? 13 VAL A HB   6  
ATOM 4566  H HG11 . VAL A 1 13 ? 10.141  0.607   0.208   1.00 0.00 ? 13 VAL A HG11 6  
ATOM 4567  H HG12 . VAL A 1 13 ? 8.793   -0.071  -0.736  1.00 0.00 ? 13 VAL A HG12 6  
ATOM 4568  H HG13 . VAL A 1 13 ? 9.560   1.452   -1.246  1.00 0.00 ? 13 VAL A HG13 6  
ATOM 4569  H HG21 . VAL A 1 13 ? 7.281   0.128   1.647   1.00 0.00 ? 13 VAL A HG21 6  
ATOM 4570  H HG22 . VAL A 1 13 ? 6.212   1.435   1.083   1.00 0.00 ? 13 VAL A HG22 6  
ATOM 4571  H HG23 . VAL A 1 13 ? 6.765   0.183   -0.056  1.00 0.00 ? 13 VAL A HG23 6  
ATOM 4572  N N    . PRO A 1 14 ? 10.612  3.804   1.046   1.00 0.00 ? 14 PRO A N    6  
ATOM 4573  C CA   . PRO A 1 14 ? 11.166  5.134   0.861   1.00 0.00 ? 14 PRO A CA   6  
ATOM 4574  C C    . PRO A 1 14 ? 10.491  5.852   -0.310  1.00 0.00 ? 14 PRO A C    6  
ATOM 4575  O O    . PRO A 1 14 ? 10.849  6.981   -0.640  1.00 0.00 ? 14 PRO A O    6  
ATOM 4576  C CB   . PRO A 1 14 ? 12.654  4.913   0.644   1.00 0.00 ? 14 PRO A CB   6  
ATOM 4577  C CG   . PRO A 1 14 ? 12.806  3.452   0.253   1.00 0.00 ? 14 PRO A CG   6  
ATOM 4578  C CD   . PRO A 1 14 ? 11.500  2.745   0.576   1.00 0.00 ? 14 PRO A CD   6  
ATOM 4579  H HA   . PRO A 1 14 ? 10.989  5.699   1.667   1.00 0.00 ? 14 PRO A HA   6  
ATOM 4580  H HB2  . PRO A 1 14 ? 13.036  5.569   -0.139  1.00 0.00 ? 14 PRO A HB2  6  
ATOM 4581  H HB3  . PRO A 1 14 ? 13.219  5.136   1.549   1.00 0.00 ? 14 PRO A HB3  6  
ATOM 4582  H HG2  . PRO A 1 14 ? 13.036  3.363   -0.809  1.00 0.00 ? 14 PRO A HG2  6  
ATOM 4583  H HG3  . PRO A 1 14 ? 13.633  2.995   0.797   1.00 0.00 ? 14 PRO A HG3  6  
ATOM 4584  H HD2  . PRO A 1 14 ? 11.092  2.246   -0.303  1.00 0.00 ? 14 PRO A HD2  6  
ATOM 4585  H HD3  . PRO A 1 14 ? 11.643  1.980   1.339   1.00 0.00 ? 14 PRO A HD3  6  
ATOM 4586  N N    . ALA A 1 15 ? 9.526   5.166   -0.905  1.00 0.00 ? 15 ALA A N    6  
ATOM 4587  C CA   . ALA A 1 15 ? 8.798   5.724   -2.032  1.00 0.00 ? 15 ALA A CA   6  
ATOM 4588  C C    . ALA A 1 15 ? 9.550   5.408   -3.327  1.00 0.00 ? 15 ALA A C    6  
ATOM 4589  O O    . ALA A 1 15 ? 8.944   5.312   -4.393  1.00 0.00 ? 15 ALA A O    6  
ATOM 4590  C CB   . ALA A 1 15 ? 8.605   7.227   -1.822  1.00 0.00 ? 15 ALA A CB   6  
ATOM 4591  H H    . ALA A 1 15 ? 9.241   4.248   -0.630  1.00 0.00 ? 15 ALA A H    6  
ATOM 4592  H HA   . ALA A 1 15 ? 7.819   5.245   -2.064  1.00 0.00 ? 15 ALA A HA   6  
ATOM 4593  H HB1  . ALA A 1 15 ? 9.350   7.773   -2.401  1.00 0.00 ? 15 ALA A HB1  6  
ATOM 4594  H HB2  . ALA A 1 15 ? 8.721   7.464   -0.764  1.00 0.00 ? 15 ALA A HB2  6  
ATOM 4595  H HB3  . ALA A 1 15 ? 7.607   7.515   -2.151  1.00 0.00 ? 15 ALA A HB3  6  
ATOM 4596  N N    . LYS A 1 16 ? 10.859  5.255   -3.191  1.00 0.00 ? 16 LYS A N    6  
ATOM 4597  C CA   . LYS A 1 16 ? 11.700  4.951   -4.336  1.00 0.00 ? 16 LYS A CA   6  
ATOM 4598  C C    . LYS A 1 16 ? 11.759  3.435   -4.533  1.00 0.00 ? 16 LYS A C    6  
ATOM 4599  O O    . LYS A 1 16 ? 12.509  2.944   -5.375  1.00 0.00 ? 16 LYS A O    6  
ATOM 4600  C CB   . LYS A 1 16 ? 13.074  5.606   -4.181  1.00 0.00 ? 16 LYS A CB   6  
ATOM 4601  C CG   . LYS A 1 16 ? 13.825  5.024   -2.981  1.00 0.00 ? 16 LYS A CG   6  
ATOM 4602  C CD   . LYS A 1 16 ? 14.783  3.915   -3.420  1.00 0.00 ? 16 LYS A CD   6  
ATOM 4603  C CE   . LYS A 1 16 ? 16.075  4.501   -3.994  1.00 0.00 ? 16 LYS A CE   6  
ATOM 4604  N NZ   . LYS A 1 16 ? 17.254  3.804   -3.434  1.00 0.00 ? 16 LYS A NZ   6  
ATOM 4605  H H    . LYS A 1 16 ? 11.344  5.334   -2.320  1.00 0.00 ? 16 LYS A H    6  
ATOM 4606  H HA   . LYS A 1 16 ? 11.229  5.395   -5.214  1.00 0.00 ? 16 LYS A HA   6  
ATOM 4607  H HB2  . LYS A 1 16 ? 13.658  5.455   -5.088  1.00 0.00 ? 16 LYS A HB2  6  
ATOM 4608  H HB3  . LYS A 1 16 ? 12.956  6.682   -4.053  1.00 0.00 ? 16 LYS A HB3  6  
ATOM 4609  H HG2  . LYS A 1 16 ? 14.384  5.815   -2.480  1.00 0.00 ? 16 LYS A HG2  6  
ATOM 4610  H HG3  . LYS A 1 16 ? 13.112  4.629   -2.258  1.00 0.00 ? 16 LYS A HG3  6  
ATOM 4611  H HD2  . LYS A 1 16 ? 15.017  3.274   -2.570  1.00 0.00 ? 16 LYS A HD2  6  
ATOM 4612  H HD3  . LYS A 1 16 ? 14.300  3.287   -4.169  1.00 0.00 ? 16 LYS A HD3  6  
ATOM 4613  H HE2  . LYS A 1 16 ? 16.072  4.409   -5.080  1.00 0.00 ? 16 LYS A HE2  6  
ATOM 4614  H HE3  . LYS A 1 16 ? 16.131  5.565   -3.765  1.00 0.00 ? 16 LYS A HE3  6  
ATOM 4615  H HZ1  . LYS A 1 16 ? 17.238  3.870   -2.437  1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 4616  H HZ2  . LYS A 1 16 ? 17.232  2.841   -3.705  1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 4617  H HZ3  . LYS A 1 16 ? 18.089  4.229   -3.783  1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 4618  N N    . ASP A 1 17 ? 10.959  2.736   -3.741  1.00 0.00 ? 17 ASP A N    6  
ATOM 4619  C CA   . ASP A 1 17 ? 10.912  1.286   -3.817  1.00 0.00 ? 17 ASP A CA   6  
ATOM 4620  C C    . ASP A 1 17 ? 9.454   0.833   -3.923  1.00 0.00 ? 17 ASP A C    6  
ATOM 4621  O O    . ASP A 1 17 ? 9.136   -0.319  -3.631  1.00 0.00 ? 17 ASP A O    6  
ATOM 4622  C CB   . ASP A 1 17 ? 11.515  0.649   -2.564  1.00 0.00 ? 17 ASP A CB   6  
ATOM 4623  C CG   . ASP A 1 17 ? 12.712  -0.269  -2.818  1.00 0.00 ? 17 ASP A CG   6  
ATOM 4624  O OD1  . ASP A 1 17 ? 13.057  -0.436  -4.008  1.00 0.00 ? 17 ASP A OD1  6  
ATOM 4625  O OD2  . ASP A 1 17 ? 13.256  -0.784  -1.816  1.00 0.00 ? 17 ASP A OD2  6  
ATOM 4626  H H    . ASP A 1 17 ? 10.352  3.144   -3.058  1.00 0.00 ? 17 ASP A H    6  
ATOM 4627  H HA   . ASP A 1 17 ? 11.495  1.026   -4.701  1.00 0.00 ? 17 ASP A HA   6  
ATOM 4628  H HB2  . ASP A 1 17 ? 11.822  1.442   -1.883  1.00 0.00 ? 17 ASP A HB2  6  
ATOM 4629  H HB3  . ASP A 1 17 ? 10.739  0.076   -2.056  1.00 0.00 ? 17 ASP A HB3  6  
ATOM 4630  N N    . ARG A 1 18 ? 8.608   1.762   -4.343  1.00 0.00 ? 18 ARG A N    6  
ATOM 4631  C CA   . ARG A 1 18 ? 7.192   1.472   -4.491  1.00 0.00 ? 18 ARG A CA   6  
ATOM 4632  C C    . ARG A 1 18 ? 6.949   0.646   -5.755  1.00 0.00 ? 18 ARG A C    6  
ATOM 4633  O O    . ARG A 1 18 ? 7.569   0.889   -6.790  1.00 0.00 ? 18 ARG A O    6  
ATOM 4634  C CB   . ARG A 1 18 ? 6.371   2.761   -4.567  1.00 0.00 ? 18 ARG A CB   6  
ATOM 4635  C CG   . ARG A 1 18 ? 6.851   3.779   -3.531  1.00 0.00 ? 18 ARG A CG   6  
ATOM 4636  C CD   . ARG A 1 18 ? 6.168   3.550   -2.181  1.00 0.00 ? 18 ARG A CD   6  
ATOM 4637  N NE   . ARG A 1 18 ? 5.772   4.847   -1.588  1.00 0.00 ? 18 ARG A NE   6  
ATOM 4638  C CZ   . ARG A 1 18 ? 5.691   5.077   -0.270  1.00 0.00 ? 18 ARG A CZ   6  
ATOM 4639  N NH1  . ARG A 1 18 ? 5.977   4.099   0.600   1.00 0.00 ? 18 ARG A NH1  6  
ATOM 4640  N NH2  . ARG A 1 18 ? 5.322   6.285   0.177   1.00 0.00 ? 18 ARG A NH2  6  
ATOM 4641  H H    . ARG A 1 18 ? 8.875   2.696   -4.579  1.00 0.00 ? 18 ARG A H    6  
ATOM 4642  H HA   . ARG A 1 18 ? 6.928   0.908   -3.597  1.00 0.00 ? 18 ARG A HA   6  
ATOM 4643  H HB2  . ARG A 1 18 ? 6.451   3.189   -5.567  1.00 0.00 ? 18 ARG A HB2  6  
ATOM 4644  H HB3  . ARG A 1 18 ? 5.318   2.536   -4.401  1.00 0.00 ? 18 ARG A HB3  6  
ATOM 4645  H HG2  . ARG A 1 18 ? 7.932   3.702   -3.413  1.00 0.00 ? 18 ARG A HG2  6  
ATOM 4646  H HG3  . ARG A 1 18 ? 6.640   4.789   -3.883  1.00 0.00 ? 18 ARG A HG3  6  
ATOM 4647  H HD2  . ARG A 1 18 ? 5.291   2.917   -2.310  1.00 0.00 ? 18 ARG A HD2  6  
ATOM 4648  H HD3  . ARG A 1 18 ? 6.844   3.024   -1.507  1.00 0.00 ? 18 ARG A HD3  6  
ATOM 4649  H HE   . ARG A 1 18 ? 5.551   5.599   -2.209  1.00 0.00 ? 18 ARG A HE   6  
ATOM 4650  H HH11 . ARG A 1 18 ? 6.252   3.198   0.265   1.00 0.00 ? 18 ARG A HH11 6  
ATOM 4651  H HH12 . ARG A 1 18 ? 5.917   4.271   1.583   1.00 0.00 ? 18 ARG A HH12 6  
ATOM 4652  H HH21 . ARG A 1 18 ? 5.108   7.015   -0.472  1.00 0.00 ? 18 ARG A HH21 6  
ATOM 4653  H HH22 . ARG A 1 18 ? 5.261   6.457   1.161   1.00 0.00 ? 18 ARG A HH22 6  
ATOM 4654  N N    . VAL A 1 19 ? 6.045   -0.315  -5.631  1.00 0.00 ? 19 VAL A N    6  
ATOM 4655  C CA   . VAL A 1 19 ? 5.713   -1.179  -6.751  1.00 0.00 ? 19 VAL A CA   6  
ATOM 4656  C C    . VAL A 1 19 ? 4.414   -0.693  -7.397  1.00 0.00 ? 19 VAL A C    6  
ATOM 4657  O O    . VAL A 1 19 ? 3.961   -1.258  -8.391  1.00 0.00 ? 19 VAL A O    6  
ATOM 4658  C CB   . VAL A 1 19 ? 5.640   -2.635  -6.285  1.00 0.00 ? 19 VAL A CB   6  
ATOM 4659  C CG1  . VAL A 1 19 ? 5.055   -3.532  -7.378  1.00 0.00 ? 19 VAL A CG1  6  
ATOM 4660  C CG2  . VAL A 1 19 ? 7.015   -3.138  -5.841  1.00 0.00 ? 19 VAL A CG2  6  
ATOM 4661  H H    . VAL A 1 19 ? 5.545   -0.507  -4.786  1.00 0.00 ? 19 VAL A H    6  
ATOM 4662  H HA   . VAL A 1 19 ? 6.519   -1.098  -7.480  1.00 0.00 ? 19 VAL A HA   6  
ATOM 4663  H HB   . VAL A 1 19 ? 4.973   -2.678  -5.424  1.00 0.00 ? 19 VAL A HB   6  
ATOM 4664  H HG11 . VAL A 1 19 ? 5.443   -3.222  -8.348  1.00 0.00 ? 19 VAL A HG11 6  
ATOM 4665  H HG12 . VAL A 1 19 ? 5.337   -4.567  -7.188  1.00 0.00 ? 19 VAL A HG12 6  
ATOM 4666  H HG13 . VAL A 1 19 ? 3.968   -3.445  -7.377  1.00 0.00 ? 19 VAL A HG13 6  
ATOM 4667  H HG21 . VAL A 1 19 ? 7.788   -2.486  -6.246  1.00 0.00 ? 19 VAL A HG21 6  
ATOM 4668  H HG22 . VAL A 1 19 ? 7.069   -3.132  -4.752  1.00 0.00 ? 19 VAL A HG22 6  
ATOM 4669  H HG23 . VAL A 1 19 ? 7.166   -4.153  -6.207  1.00 0.00 ? 19 VAL A HG23 6  
ATOM 4670  N N    . ASP A 1 20 ? 3.851   0.351   -6.806  1.00 0.00 ? 20 ASP A N    6  
ATOM 4671  C CA   . ASP A 1 20 ? 2.613   0.920   -7.311  1.00 0.00 ? 20 ASP A CA   6  
ATOM 4672  C C    . ASP A 1 20 ? 1.603   -0.203  -7.555  1.00 0.00 ? 20 ASP A C    6  
ATOM 4673  O O    . ASP A 1 20 ? 1.662   -0.884  -8.578  1.00 0.00 ? 20 ASP A O    6  
ATOM 4674  C CB   . ASP A 1 20 ? 2.843   1.647   -8.638  1.00 0.00 ? 20 ASP A CB   6  
ATOM 4675  C CG   . ASP A 1 20 ? 1.575   1.935   -9.445  1.00 0.00 ? 20 ASP A CG   6  
ATOM 4676  O OD1  . ASP A 1 20 ? 0.487   1.882   -8.831  1.00 0.00 ? 20 ASP A OD1  6  
ATOM 4677  O OD2  . ASP A 1 20 ? 1.722   2.202   -10.657 1.00 0.00 ? 20 ASP A OD2  6  
ATOM 4678  H H    . ASP A 1 20 ? 4.226   0.805   -5.997  1.00 0.00 ? 20 ASP A H    6  
ATOM 4679  H HA   . ASP A 1 20 ? 2.284   1.618   -6.541  1.00 0.00 ? 20 ASP A HA   6  
ATOM 4680  H HB2  . ASP A 1 20 ? 3.349   2.591   -8.435  1.00 0.00 ? 20 ASP A HB2  6  
ATOM 4681  H HB3  . ASP A 1 20 ? 3.517   1.049   -9.250  1.00 0.00 ? 20 ASP A HB3  6  
ATOM 4682  N N    . CYS A 1 21 ? 0.700   -0.362  -6.599  1.00 0.00 ? 21 CYS A N    6  
ATOM 4683  C CA   . CYS A 1 21 ? -0.321  -1.390  -6.698  1.00 0.00 ? 21 CYS A CA   6  
ATOM 4684  C C    . CYS A 1 21 ? -1.326  -0.968  -7.771  1.00 0.00 ? 21 CYS A C    6  
ATOM 4685  O O    . CYS A 1 21 ? -2.031  -1.806  -8.331  1.00 0.00 ? 21 CYS A O    6  
ATOM 4686  C CB   . CYS A 1 21 ? -0.999  -1.645  -5.350  1.00 0.00 ? 21 CYS A CB   6  
ATOM 4687  S SG   . CYS A 1 21 ? -1.341  -3.405  -4.984  1.00 0.00 ? 21 CYS A SG   6  
ATOM 4688  H H    . CYS A 1 21 ? 0.659   0.196   -5.770  1.00 0.00 ? 21 CYS A H    6  
ATOM 4689  H HA   . CYS A 1 21 ? 0.188   -2.310  -6.985  1.00 0.00 ? 21 CYS A HA   6  
ATOM 4690  H HB2  . CYS A 1 21 ? -0.368  -1.240  -4.559  1.00 0.00 ? 21 CYS A HB2  6  
ATOM 4691  H HB3  . CYS A 1 21 ? -1.939  -1.094  -5.321  1.00 0.00 ? 21 CYS A HB3  6  
ATOM 4692  N N    . GLY A 1 22 ? -1.361  0.332   -8.025  1.00 0.00 ? 22 GLY A N    6  
ATOM 4693  C CA   . GLY A 1 22 ? -2.268  0.876   -9.022  1.00 0.00 ? 22 GLY A CA   6  
ATOM 4694  C C    . GLY A 1 22 ? -3.725  0.701   -8.590  1.00 0.00 ? 22 GLY A C    6  
ATOM 4695  O O    . GLY A 1 22 ? -4.330  -0.340  -8.842  1.00 0.00 ? 22 GLY A O    6  
ATOM 4696  H H    . GLY A 1 22 ? -0.784  1.007   -7.565  1.00 0.00 ? 22 GLY A H    6  
ATOM 4697  H HA2  . GLY A 1 22 ? -2.055  1.934   -9.174  1.00 0.00 ? 22 GLY A HA2  6  
ATOM 4698  H HA3  . GLY A 1 22 ? -2.106  0.377   -9.977  1.00 0.00 ? 22 GLY A HA3  6  
ATOM 4699  N N    . TYR A 1 23 ? -4.247  1.735   -7.947  1.00 0.00 ? 23 TYR A N    6  
ATOM 4700  C CA   . TYR A 1 23 ? -5.622  1.709   -7.478  1.00 0.00 ? 23 TYR A CA   6  
ATOM 4701  C C    . TYR A 1 23 ? -6.307  3.057   -7.710  1.00 0.00 ? 23 TYR A C    6  
ATOM 4702  O O    . TYR A 1 23 ? -5.657  4.101   -7.676  1.00 0.00 ? 23 TYR A O    6  
ATOM 4703  C CB   . TYR A 1 23 ? -5.549  1.439   -5.974  1.00 0.00 ? 23 TYR A CB   6  
ATOM 4704  C CG   . TYR A 1 23 ? -5.594  -0.045  -5.605  1.00 0.00 ? 23 TYR A CG   6  
ATOM 4705  C CD1  . TYR A 1 23 ? -6.742  -0.778  -5.831  1.00 0.00 ? 23 TYR A CD1  6  
ATOM 4706  C CD2  . TYR A 1 23 ? -4.488  -0.651  -5.046  1.00 0.00 ? 23 TYR A CD2  6  
ATOM 4707  C CE1  . TYR A 1 23 ? -6.784  -2.175  -5.484  1.00 0.00 ? 23 TYR A CE1  6  
ATOM 4708  C CE2  . TYR A 1 23 ? -4.530  -2.048  -4.698  1.00 0.00 ? 23 TYR A CE2  6  
ATOM 4709  C CZ   . TYR A 1 23 ? -5.676  -2.741  -4.935  1.00 0.00 ? 23 TYR A CZ   6  
ATOM 4710  O OH   . TYR A 1 23 ? -5.716  -4.060  -4.607  1.00 0.00 ? 23 TYR A OH   6  
ATOM 4711  H H    . TYR A 1 23 ? -3.748  2.578   -7.747  1.00 0.00 ? 23 TYR A H    6  
ATOM 4712  H HA   . TYR A 1 23 ? -6.154  0.939   -8.038  1.00 0.00 ? 23 TYR A HA   6  
ATOM 4713  H HB2  . TYR A 1 23 ? -4.630  1.873   -5.581  1.00 0.00 ? 23 TYR A HB2  6  
ATOM 4714  H HB3  . TYR A 1 23 ? -6.377  1.950   -5.483  1.00 0.00 ? 23 TYR A HB3  6  
ATOM 4715  H HD1  . TYR A 1 23 ? -7.616  -0.299  -6.273  1.00 0.00 ? 23 TYR A HD1  6  
ATOM 4716  H HD2  . TYR A 1 23 ? -3.582  -0.072  -4.867  1.00 0.00 ? 23 TYR A HD2  6  
ATOM 4717  H HE1  . TYR A 1 23 ? -7.684  -2.765  -5.657  1.00 0.00 ? 23 TYR A HE1  6  
ATOM 4718  H HE2  . TYR A 1 23 ? -3.663  -2.539  -4.256  1.00 0.00 ? 23 TYR A HE2  6  
ATOM 4719  H HH   . TYR A 1 23 ? -5.837  -4.614  -5.431  1.00 0.00 ? 23 TYR A HH   6  
ATOM 4720  N N    . PRO A 1 24 ? -7.644  2.990   -7.947  1.00 0.00 ? 24 PRO A N    6  
ATOM 4721  C CA   . PRO A 1 24 ? -8.424  4.193   -8.184  1.00 0.00 ? 24 PRO A CA   6  
ATOM 4722  C C    . PRO A 1 24 ? -8.658  4.960   -6.882  1.00 0.00 ? 24 PRO A C    6  
ATOM 4723  O O    . PRO A 1 24 ? -8.014  5.978   -6.632  1.00 0.00 ? 24 PRO A O    6  
ATOM 4724  C CB   . PRO A 1 24 ? -9.712  3.706   -8.827  1.00 0.00 ? 24 PRO A CB   6  
ATOM 4725  C CG   . PRO A 1 24 ? -9.806  2.224   -8.503  1.00 0.00 ? 24 PRO A CG   6  
ATOM 4726  C CD   . PRO A 1 24 ? -8.447  1.771   -7.995  1.00 0.00 ? 24 PRO A CD   6  
ATOM 4727  H HA   . PRO A 1 24 ? -7.924  4.818   -8.784  1.00 0.00 ? 24 PRO A HA   6  
ATOM 4728  H HB2  . PRO A 1 24 ? -10.573 4.247   -8.434  1.00 0.00 ? 24 PRO A HB2  6  
ATOM 4729  H HB3  . PRO A 1 24 ? -9.697  3.870   -9.905  1.00 0.00 ? 24 PRO A HB3  6  
ATOM 4730  H HG2  . PRO A 1 24 ? -10.573 2.046   -7.750  1.00 0.00 ? 24 PRO A HG2  6  
ATOM 4731  H HG3  . PRO A 1 24 ? -10.091 1.656   -9.389  1.00 0.00 ? 24 PRO A HG3  6  
ATOM 4732  H HD2  . PRO A 1 24 ? -8.525  1.310   -7.011  1.00 0.00 ? 24 PRO A HD2  6  
ATOM 4733  H HD3  . PRO A 1 24 ? -8.002  1.030   -8.660  1.00 0.00 ? 24 PRO A HD3  6  
ATOM 4734  N N    . HIS A 1 25 ? -9.582  4.443   -6.086  1.00 0.00 ? 25 HIS A N    6  
ATOM 4735  C CA   . HIS A 1 25 ? -9.910  5.067   -4.815  1.00 0.00 ? 25 HIS A CA   6  
ATOM 4736  C C    . HIS A 1 25 ? -8.983  4.526   -3.724  1.00 0.00 ? 25 HIS A C    6  
ATOM 4737  O O    . HIS A 1 25 ? -9.340  3.591   -3.009  1.00 0.00 ? 25 HIS A O    6  
ATOM 4738  C CB   . HIS A 1 25 ? -11.391 4.877   -4.482  1.00 0.00 ? 25 HIS A CB   6  
ATOM 4739  C CG   . HIS A 1 25 ? -11.773 3.449   -4.170  1.00 0.00 ? 25 HIS A CG   6  
ATOM 4740  N ND1  . HIS A 1 25 ? -13.016 3.097   -3.674  1.00 0.00 ? 25 HIS A ND1  6  
ATOM 4741  C CD2  . HIS A 1 25 ? -11.063 2.291   -4.291  1.00 0.00 ? 25 HIS A CD2  6  
ATOM 4742  C CE1  . HIS A 1 25 ? -13.042 1.783   -3.506  1.00 0.00 ? 25 HIS A CE1  6  
ATOM 4743  N NE2  . HIS A 1 25 ? -11.831 1.285   -3.888  1.00 0.00 ? 25 HIS A NE2  6  
ATOM 4744  H H    . HIS A 1 25 ? -10.102 3.615   -6.296  1.00 0.00 ? 25 HIS A H    6  
ATOM 4745  H HA   . HIS A 1 25 ? -9.731  6.135   -4.935  1.00 0.00 ? 25 HIS A HA   6  
ATOM 4746  H HB2  . HIS A 1 25 ? -11.645 5.505   -3.628  1.00 0.00 ? 25 HIS A HB2  6  
ATOM 4747  H HB3  . HIS A 1 25 ? -11.990 5.227   -5.323  1.00 0.00 ? 25 HIS A HB3  6  
ATOM 4748  H HD1  . HIS A 1 25 ? -13.766 3.727   -3.476  1.00 0.00 ? 25 HIS A HD1  6  
ATOM 4749  H HD2  . HIS A 1 25 ? -10.040 2.205   -4.656  1.00 0.00 ? 25 HIS A HD2  6  
ATOM 4750  H HE1  . HIS A 1 25 ? -13.883 1.202   -3.128  1.00 0.00 ? 25 HIS A HE1  6  
ATOM 4751  H HE2  . HIS A 1 25 ? -11.584 0.316   -3.922  1.00 0.00 ? 25 HIS A HE2  6  
ATOM 4752  N N    . VAL A 1 26 ? -7.812  5.138   -3.631  1.00 0.00 ? 26 VAL A N    6  
ATOM 4753  C CA   . VAL A 1 26 ? -6.831  4.730   -2.639  1.00 0.00 ? 26 VAL A CA   6  
ATOM 4754  C C    . VAL A 1 26 ? -6.968  5.615   -1.399  1.00 0.00 ? 26 VAL A C    6  
ATOM 4755  O O    . VAL A 1 26 ? -7.078  6.835   -1.512  1.00 0.00 ? 26 VAL A O    6  
ATOM 4756  C CB   . VAL A 1 26 ? -5.427  4.763   -3.246  1.00 0.00 ? 26 VAL A CB   6  
ATOM 4757  C CG1  . VAL A 1 26 ? -5.278  3.705   -4.341  1.00 0.00 ? 26 VAL A CG1  6  
ATOM 4758  C CG2  . VAL A 1 26 ? -5.096  6.157   -3.783  1.00 0.00 ? 26 VAL A CG2  6  
ATOM 4759  H H    . VAL A 1 26 ? -7.530  5.897   -4.216  1.00 0.00 ? 26 VAL A H    6  
ATOM 4760  H HA   . VAL A 1 26 ? -7.054  3.700   -2.361  1.00 0.00 ? 26 VAL A HA   6  
ATOM 4761  H HB   . VAL A 1 26 ? -4.715  4.531   -2.455  1.00 0.00 ? 26 VAL A HB   6  
ATOM 4762  H HG11 . VAL A 1 26 ? -6.028  3.873   -5.114  1.00 0.00 ? 26 VAL A HG11 6  
ATOM 4763  H HG12 . VAL A 1 26 ? -4.282  3.774   -4.779  1.00 0.00 ? 26 VAL A HG12 6  
ATOM 4764  H HG13 . VAL A 1 26 ? -5.417  2.714   -3.909  1.00 0.00 ? 26 VAL A HG13 6  
ATOM 4765  H HG21 . VAL A 1 26 ? -5.832  6.873   -3.415  1.00 0.00 ? 26 VAL A HG21 6  
ATOM 4766  H HG22 . VAL A 1 26 ? -4.102  6.451   -3.442  1.00 0.00 ? 26 VAL A HG22 6  
ATOM 4767  H HG23 . VAL A 1 26 ? -5.116  6.142   -4.872  1.00 0.00 ? 26 VAL A HG23 6  
ATOM 4768  N N    . THR A 1 27 ? -6.956  4.967   -0.243  1.00 0.00 ? 27 THR A N    6  
ATOM 4769  C CA   . THR A 1 27 ? -7.077  5.680   1.017   1.00 0.00 ? 27 THR A CA   6  
ATOM 4770  C C    . THR A 1 27 ? -6.333  4.933   2.126   1.00 0.00 ? 27 THR A C    6  
ATOM 4771  O O    . THR A 1 27 ? -5.879  3.808   1.925   1.00 0.00 ? 27 THR A O    6  
ATOM 4772  C CB   . THR A 1 27 ? -8.566  5.876   1.308   1.00 0.00 ? 27 THR A CB   6  
ATOM 4773  O OG1  . THR A 1 27 ? -8.959  4.659   1.938   1.00 0.00 ? 27 THR A OG1  6  
ATOM 4774  C CG2  . THR A 1 27 ? -9.411  5.926   0.033   1.00 0.00 ? 27 THR A CG2  6  
ATOM 4775  H H    . THR A 1 27 ? -6.866  3.974   -0.160  1.00 0.00 ? 27 THR A H    6  
ATOM 4776  H HA   . THR A 1 27 ? -6.596  6.653   0.908   1.00 0.00 ? 27 THR A HA   6  
ATOM 4777  H HB   . THR A 1 27 ? -8.730  6.764   1.919   1.00 0.00 ? 27 THR A HB   6  
ATOM 4778  H HG1  . THR A 1 27 ? -9.892  4.742   2.289   1.00 0.00 ? 27 THR A HG1  6  
ATOM 4779  H HG21 . THR A 1 27 ? -9.163  5.074   -0.600  1.00 0.00 ? 27 THR A HG21 6  
ATOM 4780  H HG22 . THR A 1 27 ? -10.468 5.888   0.296   1.00 0.00 ? 27 THR A HG22 6  
ATOM 4781  H HG23 . THR A 1 27 ? -9.202  6.851   -0.504  1.00 0.00 ? 27 THR A HG23 6  
ATOM 4782  N N    . PRO A 1 28 ? -6.229  5.607   3.302   1.00 0.00 ? 28 PRO A N    6  
ATOM 4783  C CA   . PRO A 1 28 ? -5.549  5.020   4.444   1.00 0.00 ? 28 PRO A CA   6  
ATOM 4784  C C    . PRO A 1 28 ? -6.411  3.939   5.099   1.00 0.00 ? 28 PRO A C    6  
ATOM 4785  O O    . PRO A 1 28 ? -6.442  3.823   6.323   1.00 0.00 ? 28 PRO A O    6  
ATOM 4786  C CB   . PRO A 1 28 ? -5.254  6.188   5.371   1.00 0.00 ? 28 PRO A CB   6  
ATOM 4787  C CG   . PRO A 1 28 ? -6.185  7.309   4.937   1.00 0.00 ? 28 PRO A CG   6  
ATOM 4788  C CD   . PRO A 1 28 ? -6.755  6.942   3.576   1.00 0.00 ? 28 PRO A CD   6  
ATOM 4789  H HA   . PRO A 1 28 ? -4.711  4.560   4.149   1.00 0.00 ? 28 PRO A HA   6  
ATOM 4790  H HB2  . PRO A 1 28 ? -5.430  5.915   6.411   1.00 0.00 ? 28 PRO A HB2  6  
ATOM 4791  H HB3  . PRO A 1 28 ? -4.211  6.495   5.293   1.00 0.00 ? 28 PRO A HB3  6  
ATOM 4792  H HG2  . PRO A 1 28 ? -6.987  7.441   5.663   1.00 0.00 ? 28 PRO A HG2  6  
ATOM 4793  H HG3  . PRO A 1 28 ? -5.645  8.254   4.883   1.00 0.00 ? 28 PRO A HG3  6  
ATOM 4794  H HD2  . PRO A 1 28 ? -7.844  6.943   3.590   1.00 0.00 ? 28 PRO A HD2  6  
ATOM 4795  H HD3  . PRO A 1 28 ? -6.444  7.654   2.812   1.00 0.00 ? 28 PRO A HD3  6  
ATOM 4796  N N    . LYS A 1 29 ? -7.089  3.175   4.255   1.00 0.00 ? 29 LYS A N    6  
ATOM 4797  C CA   . LYS A 1 29 ? -7.949  2.108   4.737   1.00 0.00 ? 29 LYS A CA   6  
ATOM 4798  C C    . LYS A 1 29 ? -8.543  1.358   3.543   1.00 0.00 ? 29 LYS A C    6  
ATOM 4799  O O    . LYS A 1 29 ? -8.607  0.130   3.546   1.00 0.00 ? 29 LYS A O    6  
ATOM 4800  C CB   . LYS A 1 29 ? -9.001  2.661   5.701   1.00 0.00 ? 29 LYS A CB   6  
ATOM 4801  C CG   . LYS A 1 29 ? -9.459  1.586   6.688   1.00 0.00 ? 29 LYS A CG   6  
ATOM 4802  C CD   . LYS A 1 29 ? -10.797 0.982   6.258   1.00 0.00 ? 29 LYS A CD   6  
ATOM 4803  C CE   . LYS A 1 29 ? -11.930 1.451   7.173   1.00 0.00 ? 29 LYS A CE   6  
ATOM 4804  N NZ   . LYS A 1 29 ? -13.057 0.492   7.137   1.00 0.00 ? 29 LYS A NZ   6  
ATOM 4805  H H    . LYS A 1 29 ? -7.058  3.276   3.261   1.00 0.00 ? 29 LYS A H    6  
ATOM 4806  H HA   . LYS A 1 29 ? -7.325  1.416   5.304   1.00 0.00 ? 29 LYS A HA   6  
ATOM 4807  H HB2  . LYS A 1 29 ? -8.589  3.510   6.247   1.00 0.00 ? 29 LYS A HB2  6  
ATOM 4808  H HB3  . LYS A 1 29 ? -9.857  3.031   5.137   1.00 0.00 ? 29 LYS A HB3  6  
ATOM 4809  H HG2  . LYS A 1 29 ? -8.706  0.802   6.753   1.00 0.00 ? 29 LYS A HG2  6  
ATOM 4810  H HG3  . LYS A 1 29 ? -9.555  2.019   7.684   1.00 0.00 ? 29 LYS A HG3  6  
ATOM 4811  H HD2  . LYS A 1 29 ? -11.015 1.266   5.229   1.00 0.00 ? 29 LYS A HD2  6  
ATOM 4812  H HD3  . LYS A 1 29 ? -10.733 -0.106  6.282   1.00 0.00 ? 29 LYS A HD3  6  
ATOM 4813  H HE2  . LYS A 1 29 ? -11.563 1.552   8.195   1.00 0.00 ? 29 LYS A HE2  6  
ATOM 4814  H HE3  . LYS A 1 29 ? -12.274 2.437   6.860   1.00 0.00 ? 29 LYS A HE3  6  
ATOM 4815  H HZ1  . LYS A 1 29 ? -13.368 0.378   6.194   1.00 0.00 ? 29 LYS A HZ1  6  
ATOM 4816  H HZ2  . LYS A 1 29 ? -12.755 -0.391  7.497   1.00 0.00 ? 29 LYS A HZ2  6  
ATOM 4817  H HZ3  . LYS A 1 29 ? -13.809 0.840   7.697   1.00 0.00 ? 29 LYS A HZ3  6  
ATOM 4818  N N    . GLU A 1 30 ? -8.962  2.129   2.550   1.00 0.00 ? 30 GLU A N    6  
ATOM 4819  C CA   . GLU A 1 30 ? -9.548  1.554   1.352   1.00 0.00 ? 30 GLU A CA   6  
ATOM 4820  C C    . GLU A 1 30 ? -8.459  0.937   0.472   1.00 0.00 ? 30 GLU A C    6  
ATOM 4821  O O    . GLU A 1 30 ? -8.667  -0.112  -0.136  1.00 0.00 ? 30 GLU A O    6  
ATOM 4822  C CB   . GLU A 1 30 ? -10.352 2.600   0.577   1.00 0.00 ? 30 GLU A CB   6  
ATOM 4823  C CG   . GLU A 1 30 ? -10.949 2.000   -0.697  1.00 0.00 ? 30 GLU A CG   6  
ATOM 4824  C CD   . GLU A 1 30 ? -12.377 2.502   -0.922  1.00 0.00 ? 30 GLU A CD   6  
ATOM 4825  O OE1  . GLU A 1 30 ? -12.510 3.691   -1.286  1.00 0.00 ? 30 GLU A OE1  6  
ATOM 4826  O OE2  . GLU A 1 30 ? -13.303 1.686   -0.726  1.00 0.00 ? 30 GLU A OE2  6  
ATOM 4827  H H    . GLU A 1 30 ? -8.906  3.128   2.556   1.00 0.00 ? 30 GLU A H    6  
ATOM 4828  H HA   . GLU A 1 30 ? -10.223 0.775   1.705   1.00 0.00 ? 30 GLU A HA   6  
ATOM 4829  H HB2  . GLU A 1 30 ? -11.150 2.991   1.208   1.00 0.00 ? 30 GLU A HB2  6  
ATOM 4830  H HB3  . GLU A 1 30 ? -9.708  3.441   0.320   1.00 0.00 ? 30 GLU A HB3  6  
ATOM 4831  H HG2  . GLU A 1 30 ? -10.328 2.263   -1.553  1.00 0.00 ? 30 GLU A HG2  6  
ATOM 4832  H HG3  . GLU A 1 30 ? -10.950 0.913   -0.625  1.00 0.00 ? 30 GLU A HG3  6  
ATOM 4833  N N    . CYS A 1 31 ? -7.321  1.615   0.431   1.00 0.00 ? 31 CYS A N    6  
ATOM 4834  C CA   . CYS A 1 31 ? -6.199  1.147   -0.365  1.00 0.00 ? 31 CYS A CA   6  
ATOM 4835  C C    . CYS A 1 31 ? -5.565  -0.045  0.354   1.00 0.00 ? 31 CYS A C    6  
ATOM 4836  O O    . CYS A 1 31 ? -4.965  -0.911  -0.282  1.00 0.00 ? 31 CYS A O    6  
ATOM 4837  C CB   . CYS A 1 31 ? -5.185  2.263   -0.624  1.00 0.00 ? 31 CYS A CB   6  
ATOM 4838  S SG   . CYS A 1 31 ? -3.480  1.688   -0.960  1.00 0.00 ? 31 CYS A SG   6  
ATOM 4839  H H    . CYS A 1 31 ? -7.160  2.468   0.928   1.00 0.00 ? 31 CYS A H    6  
ATOM 4840  H HA   . CYS A 1 31 ? -6.604  0.846   -1.331  1.00 0.00 ? 31 CYS A HA   6  
ATOM 4841  H HB2  . CYS A 1 31 ? -5.527  2.856   -1.472  1.00 0.00 ? 31 CYS A HB2  6  
ATOM 4842  H HB3  . CYS A 1 31 ? -5.166  2.925   0.242   1.00 0.00 ? 31 CYS A HB3  6  
ATOM 4843  N N    . ASN A 1 32 ? -5.718  -0.052  1.670   1.00 0.00 ? 32 ASN A N    6  
ATOM 4844  C CA   . ASN A 1 32 ? -5.168  -1.124  2.482   1.00 0.00 ? 32 ASN A CA   6  
ATOM 4845  C C    . ASN A 1 32 ? -6.245  -2.184  2.718   1.00 0.00 ? 32 ASN A C    6  
ATOM 4846  O O    . ASN A 1 32 ? -5.999  -3.186  3.387   1.00 0.00 ? 32 ASN A O    6  
ATOM 4847  C CB   . ASN A 1 32 ? -4.711  -0.602  3.846   1.00 0.00 ? 32 ASN A CB   6  
ATOM 4848  C CG   . ASN A 1 32 ? -4.056  0.774   3.716   1.00 0.00 ? 32 ASN A CG   6  
ATOM 4849  O OD1  . ASN A 1 32 ? -2.847  0.910   3.631   1.00 0.00 ? 32 ASN A OD1  6  
ATOM 4850  N ND2  . ASN A 1 32 ? -4.920  1.785   3.704   1.00 0.00 ? 32 ASN A ND2  6  
ATOM 4851  H H    . ASN A 1 32 ? -6.207  0.656   2.180   1.00 0.00 ? 32 ASN A H    6  
ATOM 4852  H HA   . ASN A 1 32 ? -4.321  -1.509  1.913   1.00 0.00 ? 32 ASN A HA   6  
ATOM 4853  H HB2  . ASN A 1 32 ? -5.565  -0.540  4.521   1.00 0.00 ? 32 ASN A HB2  6  
ATOM 4854  H HB3  . ASN A 1 32 ? -4.004  -1.304  4.290   1.00 0.00 ? 32 ASN A HB3  6  
ATOM 4855  H HD21 . ASN A 1 32 ? -5.901  1.605   3.777   1.00 0.00 ? 32 ASN A HD21 6  
ATOM 4856  H HD22 . ASN A 1 32 ? -4.589  2.725   3.622   1.00 0.00 ? 32 ASN A HD22 6  
ATOM 4857  N N    . ASN A 1 33 ? -7.417  -1.926  2.156   1.00 0.00 ? 33 ASN A N    6  
ATOM 4858  C CA   . ASN A 1 33 ? -8.533  -2.846  2.297   1.00 0.00 ? 33 ASN A CA   6  
ATOM 4859  C C    . ASN A 1 33 ? -8.667  -3.679  1.021   1.00 0.00 ? 33 ASN A C    6  
ATOM 4860  O O    . ASN A 1 33 ? -8.911  -4.883  1.083   1.00 0.00 ? 33 ASN A O    6  
ATOM 4861  C CB   . ASN A 1 33 ? -9.846  -2.090  2.508   1.00 0.00 ? 33 ASN A CB   6  
ATOM 4862  C CG   . ASN A 1 33 ? -11.047 -3.030  2.379   1.00 0.00 ? 33 ASN A CG   6  
ATOM 4863  O OD1  . ASN A 1 33 ? -10.931 -4.242  2.462   1.00 0.00 ? 33 ASN A OD1  6  
ATOM 4864  N ND2  . ASN A 1 33 ? -12.203 -2.406  2.171   1.00 0.00 ? 33 ASN A ND2  6  
ATOM 4865  H H    . ASN A 1 33 ? -7.609  -1.109  1.614   1.00 0.00 ? 33 ASN A H    6  
ATOM 4866  H HA   . ASN A 1 33 ? -8.294  -3.455  3.169   1.00 0.00 ? 33 ASN A HA   6  
ATOM 4867  H HB2  . ASN A 1 33 ? -9.848  -1.625  3.494   1.00 0.00 ? 33 ASN A HB2  6  
ATOM 4868  H HB3  . ASN A 1 33 ? -9.929  -1.286  1.777   1.00 0.00 ? 33 ASN A HB3  6  
ATOM 4869  H HD21 . ASN A 1 33 ? -12.228 -1.408  2.112   1.00 0.00 ? 33 ASN A HD21 6  
ATOM 4870  H HD22 . ASN A 1 33 ? -13.046 -2.934  2.073   1.00 0.00 ? 33 ASN A HD22 6  
ATOM 4871  N N    . ARG A 1 34 ? -8.500  -3.004  -0.108  1.00 0.00 ? 34 ARG A N    6  
ATOM 4872  C CA   . ARG A 1 34 ? -8.599  -3.667  -1.397  1.00 0.00 ? 34 ARG A CA   6  
ATOM 4873  C C    . ARG A 1 34 ? -7.590  -4.814  -1.483  1.00 0.00 ? 34 ARG A C    6  
ATOM 4874  O O    . ARG A 1 34 ? -7.824  -5.799  -2.181  1.00 0.00 ? 34 ARG A O    6  
ATOM 4875  C CB   . ARG A 1 34 ? -8.344  -2.685  -2.542  1.00 0.00 ? 34 ARG A CB   6  
ATOM 4876  C CG   . ARG A 1 34 ? -9.250  -2.987  -3.737  1.00 0.00 ? 34 ARG A CG   6  
ATOM 4877  C CD   . ARG A 1 34 ? -8.906  -4.343  -4.357  1.00 0.00 ? 34 ARG A CD   6  
ATOM 4878  N NE   . ARG A 1 34 ? -9.350  -4.382  -5.768  1.00 0.00 ? 34 ARG A NE   6  
ATOM 4879  C CZ   . ARG A 1 34 ? -9.124  -5.409  -6.598  1.00 0.00 ? 34 ARG A CZ   6  
ATOM 4880  N NH1  . ARG A 1 34 ? -8.459  -6.488  -6.164  1.00 0.00 ? 34 ARG A NH1  6  
ATOM 4881  N NH2  . ARG A 1 34 ? -9.564  -5.357  -7.863  1.00 0.00 ? 34 ARG A NH2  6  
ATOM 4882  H H    . ARG A 1 34 ? -8.302  -2.025  -0.150  1.00 0.00 ? 34 ARG A H    6  
ATOM 4883  H HA   . ARG A 1 34 ? -9.622  -4.040  -1.441  1.00 0.00 ? 34 ARG A HA   6  
ATOM 4884  H HB2  . ARG A 1 34 ? -8.518  -1.665  -2.198  1.00 0.00 ? 34 ARG A HB2  6  
ATOM 4885  H HB3  . ARG A 1 34 ? -7.299  -2.742  -2.849  1.00 0.00 ? 34 ARG A HB3  6  
ATOM 4886  H HG2  . ARG A 1 34 ? -10.292 -2.984  -3.418  1.00 0.00 ? 34 ARG A HG2  6  
ATOM 4887  H HG3  . ARG A 1 34 ? -9.144  -2.203  -4.487  1.00 0.00 ? 34 ARG A HG3  6  
ATOM 4888  H HD2  . ARG A 1 34 ? -7.831  -4.516  -4.300  1.00 0.00 ? 34 ARG A HD2  6  
ATOM 4889  H HD3  . ARG A 1 34 ? -9.387  -5.143  -3.793  1.00 0.00 ? 34 ARG A HD3  6  
ATOM 4890  H HE   . ARG A 1 34 ? -9.849  -3.592  -6.124  1.00 0.00 ? 34 ARG A HE   6  
ATOM 4891  H HH11 . ARG A 1 34 ? -8.130  -6.527  -5.221  1.00 0.00 ? 34 ARG A HH11 6  
ATOM 4892  H HH12 . ARG A 1 34 ? -8.291  -7.255  -6.784  1.00 0.00 ? 34 ARG A HH12 6  
ATOM 4893  H HH21 . ARG A 1 34 ? -10.061 -4.552  -8.187  1.00 0.00 ? 34 ARG A HH21 6  
ATOM 4894  H HH22 . ARG A 1 34 ? -9.396  -6.124  -8.483  1.00 0.00 ? 34 ARG A HH22 6  
ATOM 4895  N N    . GLY A 1 35 ? -6.490  -4.647  -0.764  1.00 0.00 ? 35 GLY A N    6  
ATOM 4896  C CA   . GLY A 1 35 ? -5.444  -5.656  -0.751  1.00 0.00 ? 35 GLY A CA   6  
ATOM 4897  C C    . GLY A 1 35 ? -4.107  -5.065  -1.201  1.00 0.00 ? 35 GLY A C    6  
ATOM 4898  O O    . GLY A 1 35 ? -3.672  -5.292  -2.329  1.00 0.00 ? 35 GLY A O    6  
ATOM 4899  H H    . GLY A 1 35 ? -6.308  -3.842  -0.199  1.00 0.00 ? 35 GLY A H    6  
ATOM 4900  H HA2  . GLY A 1 35 ? -5.345  -6.068  0.253   1.00 0.00 ? 35 GLY A HA2  6  
ATOM 4901  H HA3  . GLY A 1 35 ? -5.721  -6.480  -1.408  1.00 0.00 ? 35 GLY A HA3  6  
ATOM 4902  N N    . CYS A 1 36 ? -3.491  -4.319  -0.296  1.00 0.00 ? 36 CYS A N    6  
ATOM 4903  C CA   . CYS A 1 36 ? -2.212  -3.694  -0.585  1.00 0.00 ? 36 CYS A CA   6  
ATOM 4904  C C    . CYS A 1 36 ? -1.883  -2.723  0.550   1.00 0.00 ? 36 CYS A C    6  
ATOM 4905  O O    . CYS A 1 36 ? -2.414  -2.849  1.653   1.00 0.00 ? 36 CYS A O    6  
ATOM 4906  C CB   . CYS A 1 36 ? -2.218  -2.998  -1.948  1.00 0.00 ? 36 CYS A CB   6  
ATOM 4907  S SG   . CYS A 1 36 ? -0.899  -3.543  -3.094  1.00 0.00 ? 36 CYS A SG   6  
ATOM 4908  H H    . CYS A 1 36 ? -3.851  -4.139  0.620   1.00 0.00 ? 36 CYS A H    6  
ATOM 4909  H HA   . CYS A 1 36 ? -1.475  -4.496  -0.634  1.00 0.00 ? 36 CYS A HA   6  
ATOM 4910  H HB2  . CYS A 1 36 ? -3.185  -3.167  -2.422  1.00 0.00 ? 36 CYS A HB2  6  
ATOM 4911  H HB3  . CYS A 1 36 ? -2.122  -1.924  -1.792  1.00 0.00 ? 36 CYS A HB3  6  
ATOM 4912  N N    . CYS A 1 37 ? -1.009  -1.776  0.242   1.00 0.00 ? 37 CYS A N    6  
ATOM 4913  C CA   . CYS A 1 37 ? -0.603  -0.784  1.223   1.00 0.00 ? 37 CYS A CA   6  
ATOM 4914  C C    . CYS A 1 37 ? -0.941  0.603   0.672   1.00 0.00 ? 37 CYS A C    6  
ATOM 4915  O O    . CYS A 1 37 ? -0.966  0.803   -0.541  1.00 0.00 ? 37 CYS A O    6  
ATOM 4916  C CB   . CYS A 1 37 ? 0.880   -0.912  1.577   1.00 0.00 ? 37 CYS A CB   6  
ATOM 4917  S SG   . CYS A 1 37 ? 1.247   -2.082  2.935   1.00 0.00 ? 37 CYS A SG   6  
ATOM 4918  H H    . CYS A 1 37 ? -0.582  -1.681  -0.657  1.00 0.00 ? 37 CYS A H    6  
ATOM 4919  H HA   . CYS A 1 37 ? -1.173  -0.989  2.130   1.00 0.00 ? 37 CYS A HA   6  
ATOM 4920  H HB2  . CYS A 1 37 ? 1.425   -1.227  0.687   1.00 0.00 ? 37 CYS A HB2  6  
ATOM 4921  H HB3  . CYS A 1 37 ? 1.259   0.072   1.851   1.00 0.00 ? 37 CYS A HB3  6  
ATOM 4922  N N    . PHE A 1 38 ? -1.194  1.524   1.590   1.00 0.00 ? 38 PHE A N    6  
ATOM 4923  C CA   . PHE A 1 38 ? -1.529  2.886   1.211   1.00 0.00 ? 38 PHE A CA   6  
ATOM 4924  C C    . PHE A 1 38 ? -0.483  3.873   1.732   1.00 0.00 ? 38 PHE A C    6  
ATOM 4925  O O    . PHE A 1 38 ? 0.418   3.493   2.477   1.00 0.00 ? 38 PHE A O    6  
ATOM 4926  C CB   . PHE A 1 38 ? -2.881  3.209   1.852   1.00 0.00 ? 38 PHE A CB   6  
ATOM 4927  C CG   . PHE A 1 38 ? -3.309  4.669   1.699   1.00 0.00 ? 38 PHE A CG   6  
ATOM 4928  C CD1  . PHE A 1 38 ? -3.885  5.091   0.541   1.00 0.00 ? 38 PHE A CD1  6  
ATOM 4929  C CD2  . PHE A 1 38 ? -3.115  5.546   2.720   1.00 0.00 ? 38 PHE A CD2  6  
ATOM 4930  C CE1  . PHE A 1 38 ? -4.283  6.447   0.399   1.00 0.00 ? 38 PHE A CE1  6  
ATOM 4931  C CE2  . PHE A 1 38 ? -3.512  6.902   2.578   1.00 0.00 ? 38 PHE A CE2  6  
ATOM 4932  C CZ   . PHE A 1 38 ? -4.088  7.323   1.420   1.00 0.00 ? 38 PHE A CZ   6  
ATOM 4933  H H    . PHE A 1 38 ? -1.172  1.352   2.575   1.00 0.00 ? 38 PHE A H    6  
ATOM 4934  H HA   . PHE A 1 38 ? -1.551  2.923   0.122   1.00 0.00 ? 38 PHE A HA   6  
ATOM 4935  H HB2  . PHE A 1 38 ? -3.644  2.568   1.410   1.00 0.00 ? 38 PHE A HB2  6  
ATOM 4936  H HB3  . PHE A 1 38 ? -2.836  2.963   2.914   1.00 0.00 ? 38 PHE A HB3  6  
ATOM 4937  H HD1  . PHE A 1 38 ? -4.041  4.388   -0.277  1.00 0.00 ? 38 PHE A HD1  6  
ATOM 4938  H HD2  . PHE A 1 38 ? -2.653  5.208   3.648   1.00 0.00 ? 38 PHE A HD2  6  
ATOM 4939  H HE1  . PHE A 1 38 ? -4.744  6.785   -0.529  1.00 0.00 ? 38 PHE A HE1  6  
ATOM 4940  H HE2  . PHE A 1 38 ? -3.356  7.604   3.396   1.00 0.00 ? 38 PHE A HE2  6  
ATOM 4941  H HZ   . PHE A 1 38 ? -4.393  8.364   1.311   1.00 0.00 ? 38 PHE A HZ   6  
ATOM 4942  N N    . ASP A 1 39 ? -0.637  5.122   1.318   1.00 0.00 ? 39 ASP A N    6  
ATOM 4943  C CA   . ASP A 1 39 ? 0.284   6.167   1.732   1.00 0.00 ? 39 ASP A CA   6  
ATOM 4944  C C    . ASP A 1 39 ? -0.142  7.495   1.102   1.00 0.00 ? 39 ASP A C    6  
ATOM 4945  O O    . ASP A 1 39 ? -0.619  7.524   -0.031  1.00 0.00 ? 39 ASP A O    6  
ATOM 4946  C CB   . ASP A 1 39 ? 1.710   5.860   1.271   1.00 0.00 ? 39 ASP A CB   6  
ATOM 4947  C CG   . ASP A 1 39 ? 2.732   6.963   1.552   1.00 0.00 ? 39 ASP A CG   6  
ATOM 4948  O OD1  . ASP A 1 39 ? 3.255   6.976   2.687   1.00 0.00 ? 39 ASP A OD1  6  
ATOM 4949  O OD2  . ASP A 1 39 ? 2.967   7.768   0.625   1.00 0.00 ? 39 ASP A OD2  6  
ATOM 4950  H H    . ASP A 1 39 ? -1.373  5.424   0.711   1.00 0.00 ? 39 ASP A H    6  
ATOM 4951  H HA   . ASP A 1 39 ? 0.226   6.185   2.821   1.00 0.00 ? 39 ASP A HA   6  
ATOM 4952  H HB2  . ASP A 1 39 ? 2.043   4.944   1.758   1.00 0.00 ? 39 ASP A HB2  6  
ATOM 4953  H HB3  . ASP A 1 39 ? 1.694   5.664   0.199   1.00 0.00 ? 39 ASP A HB3  6  
ATOM 4954  N N    . SER A 1 40 ? 0.047   8.562   1.864   1.00 0.00 ? 40 SER A N    6  
ATOM 4955  C CA   . SER A 1 40 ? -0.310  9.890   1.395   1.00 0.00 ? 40 SER A CA   6  
ATOM 4956  C C    . SER A 1 40 ? 0.825   10.873  1.688   1.00 0.00 ? 40 SER A C    6  
ATOM 4957  O O    . SER A 1 40 ? 0.634   12.086  1.621   1.00 0.00 ? 40 SER A O    6  
ATOM 4958  C CB   . SER A 1 40 ? -1.610  10.372  2.043   1.00 0.00 ? 40 SER A CB   6  
ATOM 4959  O OG   . SER A 1 40 ? -1.452  10.615  3.438   1.00 0.00 ? 40 SER A OG   6  
ATOM 4960  H H    . SER A 1 40 ? 0.437   8.530   2.785   1.00 0.00 ? 40 SER A H    6  
ATOM 4961  H HA   . SER A 1 40 ? -0.458  9.786   0.320   1.00 0.00 ? 40 SER A HA   6  
ATOM 4962  H HB2  . SER A 1 40 ? -1.943  11.286  1.551   1.00 0.00 ? 40 SER A HB2  6  
ATOM 4963  H HB3  . SER A 1 40 ? -2.389  9.626   1.891   1.00 0.00 ? 40 SER A HB3  6  
ATOM 4964  H HG   . SER A 1 40 ? -0.669  10.101  3.789   1.00 0.00 ? 40 SER A HG   6  
ATOM 4965  N N    . ARG A 1 41 ? 1.983   10.312  2.006   1.00 0.00 ? 41 ARG A N    6  
ATOM 4966  C CA   . ARG A 1 41 ? 3.149   11.123  2.310   1.00 0.00 ? 41 ARG A CA   6  
ATOM 4967  C C    . ARG A 1 41 ? 3.478   12.041  1.131   1.00 0.00 ? 41 ARG A C    6  
ATOM 4968  O O    . ARG A 1 41 ? 3.636   13.249  1.305   1.00 0.00 ? 41 ARG A O    6  
ATOM 4969  C CB   . ARG A 1 41 ? 4.364   10.247  2.619   1.00 0.00 ? 41 ARG A CB   6  
ATOM 4970  C CG   . ARG A 1 41 ? 5.177   10.827  3.779   1.00 0.00 ? 41 ARG A CG   6  
ATOM 4971  C CD   . ARG A 1 41 ? 6.467   11.477  3.273   1.00 0.00 ? 41 ARG A CD   6  
ATOM 4972  N NE   . ARG A 1 41 ? 7.613   11.038  4.101   1.00 0.00 ? 41 ARG A NE   6  
ATOM 4973  C CZ   . ARG A 1 41 ? 8.769   11.708  4.198   1.00 0.00 ? 41 ARG A CZ   6  
ATOM 4974  N NH1  . ARG A 1 41 ? 8.941   12.851  3.520   1.00 0.00 ? 41 ARG A NH1  6  
ATOM 4975  N NH2  . ARG A 1 41 ? 9.754   11.235  4.973   1.00 0.00 ? 41 ARG A NH2  6  
ATOM 4976  H H    . ARG A 1 41 ? 2.130   9.324   2.058   1.00 0.00 ? 41 ARG A H    6  
ATOM 4977  H HA   . ARG A 1 41 ? 2.865   11.701  3.189   1.00 0.00 ? 41 ARG A HA   6  
ATOM 4978  H HB2  . ARG A 1 41 ? 4.035   9.238   2.870   1.00 0.00 ? 41 ARG A HB2  6  
ATOM 4979  H HB3  . ARG A 1 41 ? 4.994   10.166  1.734   1.00 0.00 ? 41 ARG A HB3  6  
ATOM 4980  H HG2  . ARG A 1 41 ? 4.579   11.565  4.314   1.00 0.00 ? 41 ARG A HG2  6  
ATOM 4981  H HG3  . ARG A 1 41 ? 5.418   10.036  4.490   1.00 0.00 ? 41 ARG A HG3  6  
ATOM 4982  H HD2  . ARG A 1 41 ? 6.636   11.206  2.231   1.00 0.00 ? 41 ARG A HD2  6  
ATOM 4983  H HD3  . ARG A 1 41 ? 6.375   12.562  3.310   1.00 0.00 ? 41 ARG A HD3  6  
ATOM 4984  H HE   . ARG A 1 41 ? 7.518   10.189  4.620   1.00 0.00 ? 41 ARG A HE   6  
ATOM 4985  H HH11 . ARG A 1 41 ? 8.205   13.204  2.941   1.00 0.00 ? 41 ARG A HH11 6  
ATOM 4986  H HH12 . ARG A 1 41 ? 9.804   13.350  3.592   1.00 0.00 ? 41 ARG A HH12 6  
ATOM 4987  H HH21 . ARG A 1 41 ? 9.627   10.382  5.480   1.00 0.00 ? 41 ARG A HH21 6  
ATOM 4988  H HH22 . ARG A 1 41 ? 10.618  11.734  5.046   1.00 0.00 ? 41 ARG A HH22 6  
ATOM 4989  N N    . ILE A 1 42 ? 3.572   11.434  -0.043  1.00 0.00 ? 42 ILE A N    6  
ATOM 4990  C CA   . ILE A 1 42 ? 3.879   12.181  -1.250  1.00 0.00 ? 42 ILE A CA   6  
ATOM 4991  C C    . ILE A 1 42 ? 3.078   11.606  -2.420  1.00 0.00 ? 42 ILE A C    6  
ATOM 4992  O O    . ILE A 1 42 ? 2.995   10.389  -2.581  1.00 0.00 ? 42 ILE A O    6  
ATOM 4993  C CB   . ILE A 1 42 ? 5.390   12.208  -1.494  1.00 0.00 ? 42 ILE A CB   6  
ATOM 4994  C CG1  . ILE A 1 42 ? 6.079   11.038  -0.790  1.00 0.00 ? 42 ILE A CG1  6  
ATOM 4995  C CG2  . ILE A 1 42 ? 5.987   13.556  -1.084  1.00 0.00 ? 42 ILE A CG2  6  
ATOM 4996  C CD1  . ILE A 1 42 ? 5.561   9.698   -1.318  1.00 0.00 ? 42 ILE A CD1  6  
ATOM 4997  H H    . ILE A 1 42 ? 3.442   10.451  -0.176  1.00 0.00 ? 42 ILE A H    6  
ATOM 4998  H HA   . ILE A 1 42 ? 3.561   13.211  -1.087  1.00 0.00 ? 42 ILE A HA   6  
ATOM 4999  H HB   . ILE A 1 42 ? 5.565   12.090  -2.563  1.00 0.00 ? 42 ILE A HB   6  
ATOM 5000  H HG12 . ILE A 1 42 ? 7.157   11.101  -0.944  1.00 0.00 ? 42 ILE A HG12 6  
ATOM 5001  H HG13 . ILE A 1 42 ? 5.906   11.101  0.284   1.00 0.00 ? 42 ILE A HG13 6  
ATOM 5002  H HG21 . ILE A 1 42 ? 5.404   13.978  -0.266  1.00 0.00 ? 42 ILE A HG21 6  
ATOM 5003  H HG22 . ILE A 1 42 ? 7.018   13.412  -0.760  1.00 0.00 ? 42 ILE A HG22 6  
ATOM 5004  H HG23 . ILE A 1 42 ? 5.966   14.237  -1.935  1.00 0.00 ? 42 ILE A HG23 6  
ATOM 5005  H HD11 . ILE A 1 42 ? 5.038   9.857   -2.261  1.00 0.00 ? 42 ILE A HD11 6  
ATOM 5006  H HD12 . ILE A 1 42 ? 6.400   9.021   -1.478  1.00 0.00 ? 42 ILE A HD12 6  
ATOM 5007  H HD13 . ILE A 1 42 ? 4.876   9.262   -0.591  1.00 0.00 ? 42 ILE A HD13 6  
ATOM 5008  N N    . PRO A 1 43 ? 2.493   12.531  -3.227  1.00 0.00 ? 43 PRO A N    6  
ATOM 5009  C CA   . PRO A 1 43 ? 1.702   12.128  -4.376  1.00 0.00 ? 43 PRO A CA   6  
ATOM 5010  C C    . PRO A 1 43 ? 2.599   11.648  -5.519  1.00 0.00 ? 43 PRO A C    6  
ATOM 5011  O O    . PRO A 1 43 ? 2.253   10.706  -6.231  1.00 0.00 ? 43 PRO A O    6  
ATOM 5012  C CB   . PRO A 1 43 ? 0.883   13.356  -4.740  1.00 0.00 ? 43 PRO A CB   6  
ATOM 5013  C CG   . PRO A 1 43 ? 1.582   14.533  -4.080  1.00 0.00 ? 43 PRO A CG   6  
ATOM 5014  C CD   . PRO A 1 43 ? 2.571   13.980  -3.067  1.00 0.00 ? 43 PRO A CD   6  
ATOM 5015  H HA   . PRO A 1 43 ? 1.119   11.350  -4.141  1.00 0.00 ? 43 PRO A HA   6  
ATOM 5016  H HB2  . PRO A 1 43 ? 0.834   13.487  -5.821  1.00 0.00 ? 43 PRO A HB2  6  
ATOM 5017  H HB3  . PRO A 1 43 ? -0.143  13.261  -4.384  1.00 0.00 ? 43 PRO A HB3  6  
ATOM 5018  H HG2  . PRO A 1 43 ? 2.097   15.138  -4.826  1.00 0.00 ? 43 PRO A HG2  6  
ATOM 5019  H HG3  . PRO A 1 43 ? 0.856   15.182  -3.590  1.00 0.00 ? 43 PRO A HG3  6  
ATOM 5020  H HD2  . PRO A 1 43 ? 3.579   14.347  -3.257  1.00 0.00 ? 43 PRO A HD2  6  
ATOM 5021  H HD3  . PRO A 1 43 ? 2.308   14.281  -2.053  1.00 0.00 ? 43 PRO A HD3  6  
ATOM 5022  N N    . GLY A 1 44 ? 3.734   12.316  -5.658  1.00 0.00 ? 44 GLY A N    6  
ATOM 5023  C CA   . GLY A 1 44 ? 4.684   11.970  -6.702  1.00 0.00 ? 44 GLY A CA   6  
ATOM 5024  C C    . GLY A 1 44 ? 4.783   10.452  -6.871  1.00 0.00 ? 44 GLY A C    6  
ATOM 5025  O O    . GLY A 1 44 ? 4.796   9.948   -7.993  1.00 0.00 ? 44 GLY A O    6  
ATOM 5026  H H    . GLY A 1 44 ? 4.008   13.081  -5.075  1.00 0.00 ? 44 GLY A H    6  
ATOM 5027  H HA2  . GLY A 1 44 ? 4.377   12.425  -7.644  1.00 0.00 ? 44 GLY A HA2  6  
ATOM 5028  H HA3  . GLY A 1 44 ? 5.664   12.376  -6.456  1.00 0.00 ? 44 GLY A HA3  6  
ATOM 5029  N N    . VAL A 1 45 ? 4.849   9.766   -5.740  1.00 0.00 ? 45 VAL A N    6  
ATOM 5030  C CA   . VAL A 1 45 ? 4.947   8.316   -5.748  1.00 0.00 ? 45 VAL A CA   6  
ATOM 5031  C C    . VAL A 1 45 ? 3.540   7.715   -5.717  1.00 0.00 ? 45 VAL A C    6  
ATOM 5032  O O    . VAL A 1 45 ? 2.558   8.433   -5.537  1.00 0.00 ? 45 VAL A O    6  
ATOM 5033  C CB   . VAL A 1 45 ? 5.825   7.844   -4.588  1.00 0.00 ? 45 VAL A CB   6  
ATOM 5034  C CG1  . VAL A 1 45 ? 6.906   8.877   -4.263  1.00 0.00 ? 45 VAL A CG1  6  
ATOM 5035  C CG2  . VAL A 1 45 ? 4.979   7.528   -3.353  1.00 0.00 ? 45 VAL A CG2  6  
ATOM 5036  H H    . VAL A 1 45 ? 4.838   10.183  -4.831  1.00 0.00 ? 45 VAL A H    6  
ATOM 5037  H HA   . VAL A 1 45 ? 5.432   8.025   -6.680  1.00 0.00 ? 45 VAL A HA   6  
ATOM 5038  H HB   . VAL A 1 45 ? 6.323   6.924   -4.897  1.00 0.00 ? 45 VAL A HB   6  
ATOM 5039  H HG11 . VAL A 1 45 ? 7.126   9.465   -5.154  1.00 0.00 ? 45 VAL A HG11 6  
ATOM 5040  H HG12 . VAL A 1 45 ? 6.551   9.536   -3.471  1.00 0.00 ? 45 VAL A HG12 6  
ATOM 5041  H HG13 . VAL A 1 45 ? 7.810   8.365   -3.932  1.00 0.00 ? 45 VAL A HG13 6  
ATOM 5042  H HG21 . VAL A 1 45 ? 4.226   8.304   -3.221  1.00 0.00 ? 45 VAL A HG21 6  
ATOM 5043  H HG22 . VAL A 1 45 ? 4.488   6.564   -3.486  1.00 0.00 ? 45 VAL A HG22 6  
ATOM 5044  H HG23 . VAL A 1 45 ? 5.621   7.490   -2.473  1.00 0.00 ? 45 VAL A HG23 6  
ATOM 5045  N N    . PRO A 1 46 ? 3.487   6.368   -5.898  1.00 0.00 ? 46 PRO A N    6  
ATOM 5046  C CA   . PRO A 1 46 ? 2.217   5.662   -5.892  1.00 0.00 ? 46 PRO A CA   6  
ATOM 5047  C C    . PRO A 1 46 ? 1.672   5.526   -4.469  1.00 0.00 ? 46 PRO A C    6  
ATOM 5048  O O    . PRO A 1 46 ? 2.011   4.581   -3.758  1.00 0.00 ? 46 PRO A O    6  
ATOM 5049  C CB   . PRO A 1 46 ? 2.510   4.321   -6.547  1.00 0.00 ? 46 PRO A CB   6  
ATOM 5050  C CG   . PRO A 1 46 ? 4.017   4.141   -6.473  1.00 0.00 ? 46 PRO A CG   6  
ATOM 5051  C CD   . PRO A 1 46 ? 4.630   5.485   -6.113  1.00 0.00 ? 46 PRO A CD   6  
ATOM 5052  H HA   . PRO A 1 46 ? 1.529   6.180   -6.401  1.00 0.00 ? 46 PRO A HA   6  
ATOM 5053  H HB2  . PRO A 1 46 ? 1.994   3.513   -6.028  1.00 0.00 ? 46 PRO A HB2  6  
ATOM 5054  H HB3  . PRO A 1 46 ? 2.165   4.308   -7.581  1.00 0.00 ? 46 PRO A HB3  6  
ATOM 5055  H HG2  . PRO A 1 46 ? 4.276   3.391   -5.726  1.00 0.00 ? 46 PRO A HG2  6  
ATOM 5056  H HG3  . PRO A 1 46 ? 4.406   3.787   -7.428  1.00 0.00 ? 46 PRO A HG3  6  
ATOM 5057  H HD2  . PRO A 1 46 ? 5.248   5.412   -5.218  1.00 0.00 ? 46 PRO A HD2  6  
ATOM 5058  H HD3  . PRO A 1 46 ? 5.271   5.855   -6.914  1.00 0.00 ? 46 PRO A HD3  6  
ATOM 5059  N N    . TRP A 1 47 ? 0.836   6.484   -4.096  1.00 0.00 ? 47 TRP A N    6  
ATOM 5060  C CA   . TRP A 1 47 ? 0.241   6.484   -2.771  1.00 0.00 ? 47 TRP A CA   6  
ATOM 5061  C C    . TRP A 1 47 ? 0.020   5.029   -2.352  1.00 0.00 ? 47 TRP A C    6  
ATOM 5062  O O    . TRP A 1 47 ? 0.460   4.614   -1.281  1.00 0.00 ? 47 TRP A O    6  
ATOM 5063  C CB   . TRP A 1 47 ? -1.044  7.314   -2.747  1.00 0.00 ? 47 TRP A CB   6  
ATOM 5064  C CG   . TRP A 1 47 ? -0.828  8.785   -2.386  1.00 0.00 ? 47 TRP A CG   6  
ATOM 5065  C CD1  . TRP A 1 47 ? 0.260   9.537   -2.604  1.00 0.00 ? 47 TRP A CD1  6  
ATOM 5066  C CD2  . TRP A 1 47 ? -1.773  9.658   -1.731  1.00 0.00 ? 47 TRP A CD2  6  
ATOM 5067  N NE1  . TRP A 1 47 ? 0.086   10.824  -2.139  1.00 0.00 ? 47 TRP A NE1  6  
ATOM 5068  C CE2  . TRP A 1 47 ? -1.189  10.900  -1.592  1.00 0.00 ? 47 TRP A CE2  6  
ATOM 5069  C CE3  . TRP A 1 47 ? -3.078  9.405   -1.273  1.00 0.00 ? 47 TRP A CE3  6  
ATOM 5070  C CZ2  . TRP A 1 47 ? -1.836  11.988  -0.994  1.00 0.00 ? 47 TRP A CZ2  6  
ATOM 5071  C CZ3  . TRP A 1 47 ? -3.711  10.503  -0.677  1.00 0.00 ? 47 TRP A CZ3  6  
ATOM 5072  C CH2  . TRP A 1 47 ? -3.137  11.760  -0.529  1.00 0.00 ? 47 TRP A CH2  6  
ATOM 5073  H H    . TRP A 1 47 ? 0.566   7.249   -4.681  1.00 0.00 ? 47 TRP A H    6  
ATOM 5074  H HA   . TRP A 1 47 ? 0.943   6.965   -2.090  1.00 0.00 ? 47 TRP A HA   6  
ATOM 5075  H HB2  . TRP A 1 47 ? -1.520  7.257   -3.726  1.00 0.00 ? 47 TRP A HB2  6  
ATOM 5076  H HB3  . TRP A 1 47 ? -1.736  6.873   -2.030  1.00 0.00 ? 47 TRP A HB3  6  
ATOM 5077  H HD1  . TRP A 1 47 ? 1.168   9.176   -3.087  1.00 0.00 ? 47 TRP A HD1  6  
ATOM 5078  H HE1  . TRP A 1 47 ? 0.815   11.633  -2.192  1.00 0.00 ? 47 TRP A HE1  6  
ATOM 5079  H HE3  . TRP A 1 47 ? -3.560  8.433   -1.371  1.00 0.00 ? 47 TRP A HE3  6  
ATOM 5080  H HZ2  . TRP A 1 47 ? -1.353  12.961  -0.895  1.00 0.00 ? 47 TRP A HZ2  6  
ATOM 5081  H HZ3  . TRP A 1 47 ? -4.725  10.362  -0.303  1.00 0.00 ? 47 TRP A HZ3  6  
ATOM 5082  H HH2  . TRP A 1 47 ? -3.697  12.565  -0.053  1.00 0.00 ? 47 TRP A HH2  6  
ATOM 5083  N N    . CYS A 1 48 ? -0.660  4.294   -3.219  1.00 0.00 ? 48 CYS A N    6  
ATOM 5084  C CA   . CYS A 1 48 ? -0.944  2.894   -2.953  1.00 0.00 ? 48 CYS A CA   6  
ATOM 5085  C C    . CYS A 1 48 ? 0.145   2.048   -3.615  1.00 0.00 ? 48 CYS A C    6  
ATOM 5086  O O    . CYS A 1 48 ? 0.219   1.973   -4.841  1.00 0.00 ? 48 CYS A O    6  
ATOM 5087  C CB   . CYS A 1 48 ? -2.343  2.499   -3.431  1.00 0.00 ? 48 CYS A CB   6  
ATOM 5088  S SG   . CYS A 1 48 ? -3.043  1.017   -2.617  1.00 0.00 ? 48 CYS A SG   6  
ATOM 5089  H H    . CYS A 1 48 ? -1.014  4.638   -4.089  1.00 0.00 ? 48 CYS A H    6  
ATOM 5090  H HA   . CYS A 1 48 ? -0.924  2.771   -1.870  1.00 0.00 ? 48 CYS A HA   6  
ATOM 5091  H HB2  . CYS A 1 48 ? -3.018  3.339   -3.268  1.00 0.00 ? 48 CYS A HB2  6  
ATOM 5092  H HB3  . CYS A 1 48 ? -2.307  2.323   -4.506  1.00 0.00 ? 48 CYS A HB3  6  
ATOM 5093  N N    . PHE A 1 49 ? 0.965   1.432   -2.775  1.00 0.00 ? 49 PHE A N    6  
ATOM 5094  C CA   . PHE A 1 49 ? 2.047   0.595   -3.264  1.00 0.00 ? 49 PHE A CA   6  
ATOM 5095  C C    . PHE A 1 49 ? 2.054   -0.761  -2.555  1.00 0.00 ? 49 PHE A C    6  
ATOM 5096  O O    . PHE A 1 49 ? 1.450   -0.914  -1.494  1.00 0.00 ? 49 PHE A O    6  
ATOM 5097  C CB   . PHE A 1 49 ? 3.354   1.326   -2.954  1.00 0.00 ? 49 PHE A CB   6  
ATOM 5098  C CG   . PHE A 1 49 ? 3.431   1.888   -1.533  1.00 0.00 ? 49 PHE A CG   6  
ATOM 5099  C CD1  . PHE A 1 49 ? 3.570   1.044   -0.475  1.00 0.00 ? 49 PHE A CD1  6  
ATOM 5100  C CD2  . PHE A 1 49 ? 3.360   3.230   -1.327  1.00 0.00 ? 49 PHE A CD2  6  
ATOM 5101  C CE1  . PHE A 1 49 ? 3.641   1.565   0.844   1.00 0.00 ? 49 PHE A CE1  6  
ATOM 5102  C CE2  . PHE A 1 49 ? 3.431   3.751   -0.008  1.00 0.00 ? 49 PHE A CE2  6  
ATOM 5103  C CZ   . PHE A 1 49 ? 3.570   2.908   1.050   1.00 0.00 ? 49 PHE A CZ   6  
ATOM 5104  H H    . PHE A 1 49 ? 0.898   1.498   -1.780  1.00 0.00 ? 49 PHE A H    6  
ATOM 5105  H HA   . PHE A 1 49 ? 1.882   0.443   -4.331  1.00 0.00 ? 49 PHE A HA   6  
ATOM 5106  H HB2  . PHE A 1 49 ? 4.188   0.641   -3.108  1.00 0.00 ? 49 PHE A HB2  6  
ATOM 5107  H HB3  . PHE A 1 49 ? 3.478   2.144   -3.664  1.00 0.00 ? 49 PHE A HB3  6  
ATOM 5108  H HD1  . PHE A 1 49 ? 3.626   -0.032  -0.640  1.00 0.00 ? 49 PHE A HD1  6  
ATOM 5109  H HD2  . PHE A 1 49 ? 3.248   3.906   -2.175  1.00 0.00 ? 49 PHE A HD2  6  
ATOM 5110  H HE1  . PHE A 1 49 ? 3.752   0.889   1.692   1.00 0.00 ? 49 PHE A HE1  6  
ATOM 5111  H HE2  . PHE A 1 49 ? 3.374   4.827   0.156   1.00 0.00 ? 49 PHE A HE2  6  
ATOM 5112  H HZ   . PHE A 1 49 ? 3.625   3.308   2.062   1.00 0.00 ? 49 PHE A HZ   6  
ATOM 5113  N N    . LYS A 1 50 ? 2.744   -1.711  -3.169  1.00 0.00 ? 50 LYS A N    6  
ATOM 5114  C CA   . LYS A 1 50 ? 2.838   -3.048  -2.610  1.00 0.00 ? 50 LYS A CA   6  
ATOM 5115  C C    . LYS A 1 50 ? 3.627   -2.995  -1.300  1.00 0.00 ? 50 LYS A C    6  
ATOM 5116  O O    . LYS A 1 50 ? 4.273   -1.991  -1.001  1.00 0.00 ? 50 LYS A O    6  
ATOM 5117  C CB   . LYS A 1 50 ? 3.421   -4.020  -3.639  1.00 0.00 ? 50 LYS A CB   6  
ATOM 5118  C CG   . LYS A 1 50 ? 2.677   -3.917  -4.972  1.00 0.00 ? 50 LYS A CG   6  
ATOM 5119  C CD   . LYS A 1 50 ? 2.912   -5.164  -5.828  1.00 0.00 ? 50 LYS A CD   6  
ATOM 5120  C CE   . LYS A 1 50 ? 2.027   -6.322  -5.364  1.00 0.00 ? 50 LYS A CE   6  
ATOM 5121  N NZ   . LYS A 1 50 ? 1.896   -7.336  -6.434  1.00 0.00 ? 50 LYS A NZ   6  
ATOM 5122  H H    . LYS A 1 50 ? 3.233   -1.578  -4.032  1.00 0.00 ? 50 LYS A H    6  
ATOM 5123  H HA   . LYS A 1 50 ? 1.825   -3.382  -2.389  1.00 0.00 ? 50 LYS A HA   6  
ATOM 5124  H HB2  . LYS A 1 50 ? 4.478   -3.804  -3.791  1.00 0.00 ? 50 LYS A HB2  6  
ATOM 5125  H HB3  . LYS A 1 50 ? 3.356   -5.039  -3.259  1.00 0.00 ? 50 LYS A HB3  6  
ATOM 5126  H HG2  . LYS A 1 50 ? 1.610   -3.793  -4.788  1.00 0.00 ? 50 LYS A HG2  6  
ATOM 5127  H HG3  . LYS A 1 50 ? 3.012   -3.032  -5.512  1.00 0.00 ? 50 LYS A HG3  6  
ATOM 5128  H HD2  . LYS A 1 50 ? 2.701   -4.936  -6.873  1.00 0.00 ? 50 LYS A HD2  6  
ATOM 5129  H HD3  . LYS A 1 50 ? 3.960   -5.456  -5.771  1.00 0.00 ? 50 LYS A HD3  6  
ATOM 5130  H HE2  . LYS A 1 50 ? 2.455   -6.779  -4.472  1.00 0.00 ? 50 LYS A HE2  6  
ATOM 5131  H HE3  . LYS A 1 50 ? 1.041   -5.947  -5.088  1.00 0.00 ? 50 LYS A HE3  6  
ATOM 5132  H HZ1  . LYS A 1 50 ? 2.803   -7.564  -6.789  1.00 0.00 ? 50 LYS A HZ1  6  
ATOM 5133  H HZ2  . LYS A 1 50 ? 1.467   -8.159  -6.063  1.00 0.00 ? 50 LYS A HZ2  6  
ATOM 5134  H HZ3  . LYS A 1 50 ? 1.331   -6.969  -7.173  1.00 0.00 ? 50 LYS A HZ3  6  
ATOM 5135  N N    . PRO A 1 51 ? 3.547   -4.116  -0.534  1.00 0.00 ? 51 PRO A N    6  
ATOM 5136  C CA   . PRO A 1 51 ? 4.245   -4.205  0.737   1.00 0.00 ? 51 PRO A CA   6  
ATOM 5137  C C    . PRO A 1 51 ? 5.746   -4.416  0.524   1.00 0.00 ? 51 PRO A C    6  
ATOM 5138  O O    . PRO A 1 51 ? 6.156   -5.381  -0.120  1.00 0.00 ? 51 PRO A O    6  
ATOM 5139  C CB   . PRO A 1 51 ? 3.581   -5.360  1.470   1.00 0.00 ? 51 PRO A CB   6  
ATOM 5140  C CG   . PRO A 1 51 ? 2.855   -6.167  0.406   1.00 0.00 ? 51 PRO A CG   6  
ATOM 5141  C CD   . PRO A 1 51 ? 2.792   -5.323  -0.857  1.00 0.00 ? 51 PRO A CD   6  
ATOM 5142  H HA   . PRO A 1 51 ? 4.159   -3.347  1.242   1.00 0.00 ? 51 PRO A HA   6  
ATOM 5143  H HB2  . PRO A 1 51 ? 4.321   -5.971  1.987   1.00 0.00 ? 51 PRO A HB2  6  
ATOM 5144  H HB3  . PRO A 1 51 ? 2.886   -4.994  2.225   1.00 0.00 ? 51 PRO A HB3  6  
ATOM 5145  H HG2  . PRO A 1 51 ? 3.379   -7.103  0.213   1.00 0.00 ? 51 PRO A HG2  6  
ATOM 5146  H HG3  . PRO A 1 51 ? 1.852   -6.426  0.742   1.00 0.00 ? 51 PRO A HG3  6  
ATOM 5147  H HD2  . PRO A 1 51 ? 3.229   -5.848  -1.706  1.00 0.00 ? 51 PRO A HD2  6  
ATOM 5148  H HD3  . PRO A 1 51 ? 1.762   -5.086  -1.124  1.00 0.00 ? 51 PRO A HD3  6  
ATOM 5149  N N    . LEU A 1 52 ? 6.524   -3.498  1.078   1.00 0.00 ? 52 LEU A N    6  
ATOM 5150  C CA   . LEU A 1 52 ? 7.970   -3.571  0.957   1.00 0.00 ? 52 LEU A CA   6  
ATOM 5151  C C    . LEU A 1 52 ? 8.403   -5.038  0.942   1.00 0.00 ? 52 LEU A C    6  
ATOM 5152  O O    . LEU A 1 52 ? 7.806   -5.872  1.622   1.00 0.00 ? 52 LEU A O    6  
ATOM 5153  C CB   . LEU A 1 52 ? 8.642   -2.743  2.054   1.00 0.00 ? 52 LEU A CB   6  
ATOM 5154  C CG   . LEU A 1 52 ? 10.133  -3.005  2.274   1.00 0.00 ? 52 LEU A CG   6  
ATOM 5155  C CD1  . LEU A 1 52 ? 10.768  -1.894  3.113   1.00 0.00 ? 52 LEU A CD1  6  
ATOM 5156  C CD2  . LEU A 1 52 ? 10.362  -4.388  2.888   1.00 0.00 ? 52 LEU A CD2  6  
ATOM 5157  H H    . LEU A 1 52 ? 6.183   -2.716  1.600   1.00 0.00 ? 52 LEU A H    6  
ATOM 5158  H HA   . LEU A 1 52 ? 8.241   -3.121  0.002   1.00 0.00 ? 52 LEU A HA   6  
ATOM 5159  H HB2  . LEU A 1 52 ? 8.511   -1.687  1.816   1.00 0.00 ? 52 LEU A HB2  6  
ATOM 5160  H HB3  . LEU A 1 52 ? 8.119   -2.926  2.992   1.00 0.00 ? 52 LEU A HB3  6  
ATOM 5161  H HG   . LEU A 1 52 ? 10.629  -2.998  1.303   1.00 0.00 ? 52 LEU A HG   6  
ATOM 5162  H HD11 . LEU A 1 52 ? 10.108  -1.645  3.945   1.00 0.00 ? 52 LEU A HD11 6  
ATOM 5163  H HD12 . LEU A 1 52 ? 11.728  -2.234  3.500   1.00 0.00 ? 52 LEU A HD12 6  
ATOM 5164  H HD13 . LEU A 1 52 ? 10.918  -1.011  2.492   1.00 0.00 ? 52 LEU A HD13 6  
ATOM 5165  H HD21 . LEU A 1 52 ? 9.400   -4.857  3.096   1.00 0.00 ? 52 LEU A HD21 6  
ATOM 5166  H HD22 . LEU A 1 52 ? 10.925  -5.007  2.189   1.00 0.00 ? 52 LEU A HD22 6  
ATOM 5167  H HD23 . LEU A 1 52 ? 10.924  -4.285  3.816   1.00 0.00 ? 52 LEU A HD23 6  
ATOM 5168  N N    . GLN A 1 53 ? 9.438   -5.309  0.161   1.00 0.00 ? 53 GLN A N    6  
ATOM 5169  C CA   . GLN A 1 53 ? 9.957   -6.662  0.049   1.00 0.00 ? 53 GLN A CA   6  
ATOM 5170  C C    . GLN A 1 53 ? 10.391  -7.179  1.422   1.00 0.00 ? 53 GLN A C    6  
ATOM 5171  O O    . GLN A 1 53 ? 11.569  -7.117  1.769   1.00 0.00 ? 53 GLN A O    6  
ATOM 5172  C CB   . GLN A 1 53 ? 11.114  -6.724  -0.951  1.00 0.00 ? 53 GLN A CB   6  
ATOM 5173  C CG   . GLN A 1 53 ? 10.654  -7.310  -2.287  1.00 0.00 ? 53 GLN A CG   6  
ATOM 5174  C CD   . GLN A 1 53 ? 10.238  -6.202  -3.257  1.00 0.00 ? 53 GLN A CD   6  
ATOM 5175  O OE1  . GLN A 1 53 ? 10.700  -6.122  -4.383  1.00 0.00 ? 53 GLN A OE1  6  
ATOM 5176  N NE2  . GLN A 1 53 ? 9.342   -5.355  -2.759  1.00 0.00 ? 53 GLN A NE2  6  
ATOM 5177  H H    . GLN A 1 53 ? 9.918   -4.625  -0.389  1.00 0.00 ? 53 GLN A H    6  
ATOM 5178  H HA   . GLN A 1 53 ? 9.128   -7.261  -0.328  1.00 0.00 ? 53 GLN A HA   6  
ATOM 5179  H HB2  . GLN A 1 53 ? 11.518  -5.723  -1.108  1.00 0.00 ? 53 GLN A HB2  6  
ATOM 5180  H HB3  . GLN A 1 53 ? 11.921  -7.332  -0.542  1.00 0.00 ? 53 GLN A HB3  6  
ATOM 5181  H HG2  . GLN A 1 53 ? 11.458  -7.900  -2.726  1.00 0.00 ? 53 GLN A HG2  6  
ATOM 5182  H HG3  . GLN A 1 53 ? 9.815   -7.987  -2.122  1.00 0.00 ? 53 GLN A HG3  6  
ATOM 5183  H HE21 . GLN A 1 53 ? 9.003   -5.477  -1.827  1.00 0.00 ? 53 GLN A HE21 6  
ATOM 5184  H HE22 . GLN A 1 53 ? 9.008   -4.596  -3.318  1.00 0.00 ? 53 GLN A HE22 6  
ATOM 5185  N N    . GLU A 1 54 ? 9.415   -7.679  2.166   1.00 0.00 ? 54 GLU A N    6  
ATOM 5186  C CA   . GLU A 1 54 ? 9.680   -8.207  3.493   1.00 0.00 ? 54 GLU A CA   6  
ATOM 5187  C C    . GLU A 1 54 ? 10.925  -9.096  3.471   1.00 0.00 ? 54 GLU A C    6  
ATOM 5188  O O    . GLU A 1 54 ? 10.943  -10.130 2.805   1.00 0.00 ? 54 GLU A O    6  
ATOM 5189  C CB   . GLU A 1 54 ? 8.470   -8.972  4.031   1.00 0.00 ? 54 GLU A CB   6  
ATOM 5190  C CG   . GLU A 1 54 ? 8.457   -10.412 3.514   1.00 0.00 ? 54 GLU A CG   6  
ATOM 5191  C CD   . GLU A 1 54 ? 7.108   -11.081 3.789   1.00 0.00 ? 54 GLU A CD   6  
ATOM 5192  O OE1  . GLU A 1 54 ? 6.700   -11.071 4.970   1.00 0.00 ? 54 GLU A OE1  6  
ATOM 5193  O OE2  . GLU A 1 54 ? 6.516   -11.587 2.811   1.00 0.00 ? 54 GLU A OE2  6  
ATOM 5194  H H    . GLU A 1 54 ? 8.459   -7.726  1.876   1.00 0.00 ? 54 GLU A H    6  
ATOM 5195  H HA   . GLU A 1 54 ? 9.860   -7.334  4.121   1.00 0.00 ? 54 GLU A HA   6  
ATOM 5196  H HB2  . GLU A 1 54 ? 8.491   -8.973  5.121   1.00 0.00 ? 54 GLU A HB2  6  
ATOM 5197  H HB3  . GLU A 1 54 ? 7.552   -8.466  3.731   1.00 0.00 ? 54 GLU A HB3  6  
ATOM 5198  H HG2  . GLU A 1 54 ? 8.659   -10.419 2.443   1.00 0.00 ? 54 GLU A HG2  6  
ATOM 5199  H HG3  . GLU A 1 54 ? 9.254   -10.981 3.993   1.00 0.00 ? 54 GLU A HG3  6  
ATOM 5200  N N    . ALA A 1 55 ? 11.937  -8.661  4.208   1.00 0.00 ? 55 ALA A N    6  
ATOM 5201  C CA   . ALA A 1 55 ? 13.183  -9.404  4.281   1.00 0.00 ? 55 ALA A CA   6  
ATOM 5202  C C    . ALA A 1 55 ? 13.598  -9.553  5.746   1.00 0.00 ? 55 ALA A C    6  
ATOM 5203  O O    . ALA A 1 55 ? 13.600  -10.658 6.286   1.00 0.00 ? 55 ALA A O    6  
ATOM 5204  C CB   . ALA A 1 55 ? 14.250  -8.698  3.442   1.00 0.00 ? 55 ALA A CB   6  
ATOM 5205  H H    . ALA A 1 55 ? 11.915  -7.819  4.747   1.00 0.00 ? 55 ALA A H    6  
ATOM 5206  H HA   . ALA A 1 55 ? 13.005  -10.394 3.861   1.00 0.00 ? 55 ALA A HA   6  
ATOM 5207  H HB1  . ALA A 1 55 ? 14.870  -8.077  4.090   1.00 0.00 ? 55 ALA A HB1  6  
ATOM 5208  H HB2  . ALA A 1 55 ? 14.874  -9.441  2.946   1.00 0.00 ? 55 ALA A HB2  6  
ATOM 5209  H HB3  . ALA A 1 55 ? 13.767  -8.071  2.693   1.00 0.00 ? 55 ALA A HB3  6  
ATOM 5210  N N    . GLU A 1 56 ? 13.940  -8.423  6.349   1.00 0.00 ? 56 GLU A N    6  
ATOM 5211  C CA   . GLU A 1 56 ? 14.355  -8.414  7.741   1.00 0.00 ? 56 GLU A CA   6  
ATOM 5212  C C    . GLU A 1 56 ? 13.453  -9.331  8.571   1.00 0.00 ? 56 GLU A C    6  
ATOM 5213  O O    . GLU A 1 56 ? 12.241  -9.133  8.622   1.00 0.00 ? 56 GLU A O    6  
ATOM 5214  C CB   . GLU A 1 56 ? 14.356  -6.991  8.304   1.00 0.00 ? 56 GLU A CB   6  
ATOM 5215  C CG   . GLU A 1 56 ? 15.772  -6.554  8.687   1.00 0.00 ? 56 GLU A CG   6  
ATOM 5216  C CD   . GLU A 1 56 ? 15.864  -6.243  10.182  1.00 0.00 ? 56 GLU A CD   6  
ATOM 5217  O OE1  . GLU A 1 56 ? 15.938  -7.218  10.961  1.00 0.00 ? 56 GLU A OE1  6  
ATOM 5218  O OE2  . GLU A 1 56 ? 15.857  -5.038  10.513  1.00 0.00 ? 56 GLU A OE2  6  
ATOM 5219  H H    . GLU A 1 56 ? 13.936  -7.528  5.903   1.00 0.00 ? 56 GLU A H    6  
ATOM 5220  H HA   . GLU A 1 56 ? 15.375  -8.799  7.742   1.00 0.00 ? 56 GLU A HA   6  
ATOM 5221  H HB2  . GLU A 1 56 ? 13.948  -6.303  7.563   1.00 0.00 ? 56 GLU A HB2  6  
ATOM 5222  H HB3  . GLU A 1 56 ? 13.707  -6.941  9.178   1.00 0.00 ? 56 GLU A HB3  6  
ATOM 5223  H HG2  . GLU A 1 56 ? 16.481  -7.341  8.431   1.00 0.00 ? 56 GLU A HG2  6  
ATOM 5224  H HG3  . GLU A 1 56 ? 16.053  -5.673  8.111   1.00 0.00 ? 56 GLU A HG3  6  
ATOM 5225  N N    . CYS A 1 57 ? 14.081  -10.314 9.199   1.00 0.00 ? 57 CYS A N    6  
ATOM 5226  C CA   . CYS A 1 57 ? 13.350  -11.261 10.024  1.00 0.00 ? 57 CYS A CA   6  
ATOM 5227  C C    . CYS A 1 57 ? 13.065  -10.602 11.375  1.00 0.00 ? 57 CYS A C    6  
ATOM 5228  O O    . CYS A 1 57 ? 13.676  -9.592  11.718  1.00 0.00 ? 57 CYS A O    6  
ATOM 5229  C CB   . CYS A 1 57 ? 14.112  -12.579 10.181  1.00 0.00 ? 57 CYS A CB   6  
ATOM 5230  S SG   . CYS A 1 57 ? 15.783  -12.417 10.908  1.00 0.00 ? 57 CYS A SG   6  
ATOM 5231  H H    . CYS A 1 57 ? 15.068  -10.468 9.152   1.00 0.00 ? 57 CYS A H    6  
ATOM 5232  H HA   . CYS A 1 57 ? 12.422  -11.484 9.497   1.00 0.00 ? 57 CYS A HA   6  
ATOM 5233  H HB2  . CYS A 1 57 ? 13.523  -13.251 10.806  1.00 0.00 ? 57 CYS A HB2  6  
ATOM 5234  H HB3  . CYS A 1 57 ? 14.201  -13.050 9.202   1.00 0.00 ? 57 CYS A HB3  6  
ATOM 5235  N N    . THR A 1 58 ? 12.135  -11.202 12.105  1.00 0.00 ? 58 THR A N    6  
ATOM 5236  C CA   . THR A 1 58 ? 11.761  -10.686 13.410  1.00 0.00 ? 58 THR A CA   6  
ATOM 5237  C C    . THR A 1 58 ? 13.007  -10.434 14.262  1.00 0.00 ? 58 THR A C    6  
ATOM 5238  O O    . THR A 1 58 ? 14.076  -10.972 13.978  1.00 0.00 ? 58 THR A O    6  
ATOM 5239  C CB   . THR A 1 58 ? 10.780  -11.673 14.046  1.00 0.00 ? 58 THR A CB   6  
ATOM 5240  O OG1  . THR A 1 58 ? 9.559   -11.447 13.348  1.00 0.00 ? 58 THR A OG1  6  
ATOM 5241  C CG2  . THR A 1 58 ? 10.451  -11.319 15.497  1.00 0.00 ? 58 THR A CG2  6  
ATOM 5242  H H    . THR A 1 58 ? 11.643  -12.024 11.818  1.00 0.00 ? 58 THR A H    6  
ATOM 5243  H HA   . THR A 1 58 ? 11.269  -9.723  13.271  1.00 0.00 ? 58 THR A HA   6  
ATOM 5244  H HB   . THR A 1 58 ? 11.152  -12.695 13.968  1.00 0.00 ? 58 THR A HB   6  
ATOM 5245  H HG1  . THR A 1 58 ? 9.718   -11.474 12.361  1.00 0.00 ? 58 THR A HG1  6  
ATOM 5246  H HG21 . THR A 1 58 ? 10.015  -10.321 15.538  1.00 0.00 ? 58 THR A HG21 6  
ATOM 5247  H HG22 . THR A 1 58 ? 9.740   -12.043 15.895  1.00 0.00 ? 58 THR A HG22 6  
ATOM 5248  H HG23 . THR A 1 58 ? 11.364  -11.342 16.093  1.00 0.00 ? 58 THR A HG23 6  
ATOM 5249  N N    . PHE A 1 59 ? 12.828  -9.617  15.289  1.00 0.00 ? 59 PHE A N    6  
ATOM 5250  C CA   . PHE A 1 59 ? 13.925  -9.287  16.183  1.00 0.00 ? 59 PHE A CA   6  
ATOM 5251  C C    . PHE A 1 59 ? 15.122  -8.739  15.404  1.00 0.00 ? 59 PHE A C    6  
ATOM 5252  O O    . PHE A 1 59 ? 15.822  -9.489  14.724  1.00 0.00 ? 59 PHE A O    6  
ATOM 5253  C CB   . PHE A 1 59 ? 14.337  -10.585 16.882  1.00 0.00 ? 59 PHE A CB   6  
ATOM 5254  C CG   . PHE A 1 59 ? 14.586  -10.430 18.384  1.00 0.00 ? 59 PHE A CG   6  
ATOM 5255  C CD1  . PHE A 1 59 ? 13.574  -10.040 19.204  1.00 0.00 ? 59 PHE A CD1  6  
ATOM 5256  C CD2  . PHE A 1 59 ? 15.819  -10.684 18.898  1.00 0.00 ? 59 PHE A CD2  6  
ATOM 5257  C CE1  . PHE A 1 59 ? 13.805  -9.897  20.598  1.00 0.00 ? 59 PHE A CE1  6  
ATOM 5258  C CE2  . PHE A 1 59 ? 16.050  -10.541 20.292  1.00 0.00 ? 59 PHE A CE2  6  
ATOM 5259  C CZ   . PHE A 1 59 ? 15.038  -10.151 21.112  1.00 0.00 ? 59 PHE A CZ   6  
ATOM 5260  H H    . PHE A 1 59 ? 11.956  -9.183  15.513  1.00 0.00 ? 59 PHE A H    6  
ATOM 5261  H HA   . PHE A 1 59 ? 13.563  -8.525  16.873  1.00 0.00 ? 59 PHE A HA   6  
ATOM 5262  H HB2  . PHE A 1 59 ? 13.559  -11.332 16.728  1.00 0.00 ? 59 PHE A HB2  6  
ATOM 5263  H HB3  . PHE A 1 59 ? 15.243  -10.967 16.411  1.00 0.00 ? 59 PHE A HB3  6  
ATOM 5264  H HD1  . PHE A 1 59 ? 12.586  -9.837  18.791  1.00 0.00 ? 59 PHE A HD1  6  
ATOM 5265  H HD2  . PHE A 1 59 ? 16.630  -10.997 18.241  1.00 0.00 ? 59 PHE A HD2  6  
ATOM 5266  H HE1  . PHE A 1 59 ? 12.994  -9.584  21.255  1.00 0.00 ? 59 PHE A HE1  6  
ATOM 5267  H HE2  . PHE A 1 59 ? 17.038  -10.745 20.705  1.00 0.00 ? 59 PHE A HE2  6  
ATOM 5268  H HZ   . PHE A 1 59 ? 15.215  -10.041 22.182  1.00 0.00 ? 59 PHE A HZ   6  
ATOM 5269  N N    . GLU A 1 1  ? 8.371   -13.477 17.651  1.00 0.00 ? 1  GLU A N    7  
ATOM 5270  C CA   . GLU A 1 1  ? 7.221   -13.947 18.404  1.00 0.00 ? 1  GLU A CA   7  
ATOM 5271  C C    . GLU A 1 1  ? 6.222   -12.808 18.615  1.00 0.00 ? 1  GLU A C    7  
ATOM 5272  O O    . GLU A 1 1  ? 5.856   -12.500 19.748  1.00 0.00 ? 1  GLU A O    7  
ATOM 5273  C CB   . GLU A 1 1  ? 7.652   -14.552 19.742  1.00 0.00 ? 1  GLU A CB   7  
ATOM 5274  C CG   . GLU A 1 1  ? 8.249   -15.948 19.545  1.00 0.00 ? 1  GLU A CG   7  
ATOM 5275  C CD   . GLU A 1 1  ? 7.397   -17.011 20.242  1.00 0.00 ? 1  GLU A CD   7  
ATOM 5276  O OE1  . GLU A 1 1  ? 7.584   -17.175 21.467  1.00 0.00 ? 1  GLU A OE1  7  
ATOM 5277  O OE2  . GLU A 1 1  ? 6.579   -17.636 19.533  1.00 0.00 ? 1  GLU A OE2  7  
ATOM 5278  H H    . GLU A 1 1  ? 8.153   -12.911 16.855  1.00 0.00 ? 1  GLU A H    7  
ATOM 5279  H HA   . GLU A 1 1  ? 6.771   -14.726 17.789  1.00 0.00 ? 1  GLU A HA   7  
ATOM 5280  H HB2  . GLU A 1 1  ? 8.386   -13.903 20.219  1.00 0.00 ? 1  GLU A HB2  7  
ATOM 5281  H HB3  . GLU A 1 1  ? 6.795   -14.611 20.412  1.00 0.00 ? 1  GLU A HB3  7  
ATOM 5282  H HG2  . GLU A 1 1  ? 8.317   -16.171 18.481  1.00 0.00 ? 1  GLU A HG2  7  
ATOM 5283  H HG3  . GLU A 1 1  ? 9.264   -15.972 19.942  1.00 0.00 ? 1  GLU A HG3  7  
ATOM 5284  N N    . GLU A 1 2  ? 5.809   -12.213 17.505  1.00 0.00 ? 2  GLU A N    7  
ATOM 5285  C CA   . GLU A 1 2  ? 4.859   -11.115 17.554  1.00 0.00 ? 2  GLU A CA   7  
ATOM 5286  C C    . GLU A 1 2  ? 4.297   -10.837 16.158  1.00 0.00 ? 2  GLU A C    7  
ATOM 5287  O O    . GLU A 1 2  ? 3.087   -10.694 15.989  1.00 0.00 ? 2  GLU A O    7  
ATOM 5288  C CB   . GLU A 1 2  ? 5.502   -9.860  18.146  1.00 0.00 ? 2  GLU A CB   7  
ATOM 5289  C CG   . GLU A 1 2  ? 4.894   -9.523  19.509  1.00 0.00 ? 2  GLU A CG   7  
ATOM 5290  C CD   . GLU A 1 2  ? 5.918   -8.828  20.409  1.00 0.00 ? 2  GLU A CD   7  
ATOM 5291  O OE1  . GLU A 1 2  ? 6.031   -7.589  20.290  1.00 0.00 ? 2  GLU A OE1  7  
ATOM 5292  O OE2  . GLU A 1 2  ? 6.565   -9.553  21.196  1.00 0.00 ? 2  GLU A OE2  7  
ATOM 5293  H H    . GLU A 1 2  ? 6.112   -12.470 16.587  1.00 0.00 ? 2  GLU A H    7  
ATOM 5294  H HA   . GLU A 1 2  ? 4.060   -11.452 18.214  1.00 0.00 ? 2  GLU A HA   7  
ATOM 5295  H HB2  . GLU A 1 2  ? 6.577   -10.012 18.251  1.00 0.00 ? 2  GLU A HB2  7  
ATOM 5296  H HB3  . GLU A 1 2  ? 5.365   -9.020  17.464  1.00 0.00 ? 2  GLU A HB3  7  
ATOM 5297  H HG2  . GLU A 1 2  ? 4.026   -8.877  19.374  1.00 0.00 ? 2  GLU A HG2  7  
ATOM 5298  H HG3  . GLU A 1 2  ? 4.542   -10.435 19.989  1.00 0.00 ? 2  GLU A HG3  7  
ATOM 5299  N N    . TYR A 1 3  ? 5.203   -10.768 15.193  1.00 0.00 ? 3  TYR A N    7  
ATOM 5300  C CA   . TYR A 1 3  ? 4.813   -10.510 13.818  1.00 0.00 ? 3  TYR A CA   7  
ATOM 5301  C C    . TYR A 1 3  ? 4.079   -9.172  13.698  1.00 0.00 ? 3  TYR A C    7  
ATOM 5302  O O    . TYR A 1 3  ? 3.918   -8.458  14.686  1.00 0.00 ? 3  TYR A O    7  
ATOM 5303  C CB   . TYR A 1 3  ? 3.855   -11.639 13.431  1.00 0.00 ? 3  TYR A CB   7  
ATOM 5304  C CG   . TYR A 1 3  ? 3.844   -11.961 11.936  1.00 0.00 ? 3  TYR A CG   7  
ATOM 5305  C CD1  . TYR A 1 3  ? 5.034   -12.141 11.260  1.00 0.00 ? 3  TYR A CD1  7  
ATOM 5306  C CD2  . TYR A 1 3  ? 2.644   -12.072 11.263  1.00 0.00 ? 3  TYR A CD2  7  
ATOM 5307  C CE1  . TYR A 1 3  ? 5.023   -12.444 9.852   1.00 0.00 ? 3  TYR A CE1  7  
ATOM 5308  C CE2  . TYR A 1 3  ? 2.634   -12.375 9.855   1.00 0.00 ? 3  TYR A CE2  7  
ATOM 5309  C CZ   . TYR A 1 3  ? 3.824   -12.547 9.219   1.00 0.00 ? 3  TYR A CZ   7  
ATOM 5310  O OH   . TYR A 1 3  ? 3.814   -12.833 7.890   1.00 0.00 ? 3  TYR A OH   7  
ATOM 5311  H H    . TYR A 1 3  ? 6.185   -10.885 15.339  1.00 0.00 ? 3  TYR A H    7  
ATOM 5312  H HA   . TYR A 1 3  ? 5.718   -10.475 13.212  1.00 0.00 ? 3  TYR A HA   7  
ATOM 5313  H HB2  . TYR A 1 3  ? 4.128   -12.538 13.984  1.00 0.00 ? 3  TYR A HB2  7  
ATOM 5314  H HB3  . TYR A 1 3  ? 2.846   -11.368 13.742  1.00 0.00 ? 3  TYR A HB3  7  
ATOM 5315  H HD1  . TYR A 1 3  ? 5.981   -12.053 11.791  1.00 0.00 ? 3  TYR A HD1  7  
ATOM 5316  H HD2  . TYR A 1 3  ? 1.705   -11.930 11.797  1.00 0.00 ? 3  TYR A HD2  7  
ATOM 5317  H HE1  . TYR A 1 3  ? 5.956   -12.588 9.306   1.00 0.00 ? 3  TYR A HE1  7  
ATOM 5318  H HE2  . TYR A 1 3  ? 1.693   -12.466 9.312   1.00 0.00 ? 3  TYR A HE2  7  
ATOM 5319  H HH   . TYR A 1 3  ? 4.585   -12.385 7.438   1.00 0.00 ? 3  TYR A HH   7  
ATOM 5320  N N    . VAL A 1 4  ? 3.655   -8.874  12.479  1.00 0.00 ? 4  VAL A N    7  
ATOM 5321  C CA   . VAL A 1 4  ? 2.942   -7.635  12.217  1.00 0.00 ? 4  VAL A CA   7  
ATOM 5322  C C    . VAL A 1 4  ? 1.740   -7.924  11.316  1.00 0.00 ? 4  VAL A C    7  
ATOM 5323  O O    . VAL A 1 4  ? 1.365   -9.080  11.127  1.00 0.00 ? 4  VAL A O    7  
ATOM 5324  C CB   . VAL A 1 4  ? 3.898   -6.597  11.624  1.00 0.00 ? 4  VAL A CB   7  
ATOM 5325  C CG1  . VAL A 1 4  ? 4.026   -6.772  10.109  1.00 0.00 ? 4  VAL A CG1  7  
ATOM 5326  C CG2  . VAL A 1 4  ? 3.452   -5.177  11.976  1.00 0.00 ? 4  VAL A CG2  7  
ATOM 5327  H H    . VAL A 1 4  ? 3.790   -9.461  11.680  1.00 0.00 ? 4  VAL A H    7  
ATOM 5328  H HA   . VAL A 1 4  ? 2.582   -7.255  13.172  1.00 0.00 ? 4  VAL A HA   7  
ATOM 5329  H HB   . VAL A 1 4  ? 4.882   -6.758  12.064  1.00 0.00 ? 4  VAL A HB   7  
ATOM 5330  H HG11 . VAL A 1 4  ? 4.155   -7.829  9.875   1.00 0.00 ? 4  VAL A HG11 7  
ATOM 5331  H HG12 . VAL A 1 4  ? 3.125   -6.399  9.623   1.00 0.00 ? 4  VAL A HG12 7  
ATOM 5332  H HG13 . VAL A 1 4  ? 4.890   -6.212  9.751   1.00 0.00 ? 4  VAL A HG13 7  
ATOM 5333  H HG21 . VAL A 1 4  ? 2.496   -5.215  12.498  1.00 0.00 ? 4  VAL A HG21 7  
ATOM 5334  H HG22 . VAL A 1 4  ? 4.198   -4.710  12.619  1.00 0.00 ? 4  VAL A HG22 7  
ATOM 5335  H HG23 . VAL A 1 4  ? 3.344   -4.593  11.063  1.00 0.00 ? 4  VAL A HG23 7  
ATOM 5336  N N    . GLY A 1 5  ? 1.169   -6.853  10.783  1.00 0.00 ? 5  GLY A N    7  
ATOM 5337  C CA   . GLY A 1 5  ? 0.017   -6.977  9.907   1.00 0.00 ? 5  GLY A CA   7  
ATOM 5338  C C    . GLY A 1 5  ? -0.545  -5.601  9.543   1.00 0.00 ? 5  GLY A C    7  
ATOM 5339  O O    . GLY A 1 5  ? -1.058  -5.408  8.441   1.00 0.00 ? 5  GLY A O    7  
ATOM 5340  H H    . GLY A 1 5  ? 1.481   -5.916  10.942  1.00 0.00 ? 5  GLY A H    7  
ATOM 5341  H HA2  . GLY A 1 5  ? 0.302   -7.509  8.999   1.00 0.00 ? 5  GLY A HA2  7  
ATOM 5342  H HA3  . GLY A 1 5  ? -0.754  -7.571  10.396  1.00 0.00 ? 5  GLY A HA3  7  
ATOM 5343  N N    . LEU A 1 6  ? -0.430  -4.681  10.489  1.00 0.00 ? 6  LEU A N    7  
ATOM 5344  C CA   . LEU A 1 6  ? -0.921  -3.329  10.281  1.00 0.00 ? 6  LEU A CA   7  
ATOM 5345  C C    . LEU A 1 6  ? -0.033  -2.621  9.256   1.00 0.00 ? 6  LEU A C    7  
ATOM 5346  O O    . LEU A 1 6  ? 1.133   -2.976  9.088   1.00 0.00 ? 6  LEU A O    7  
ATOM 5347  C CB   . LEU A 1 6  ? -1.031  -2.589  11.616  1.00 0.00 ? 6  LEU A CB   7  
ATOM 5348  C CG   . LEU A 1 6  ? 0.276   -2.032  12.184  1.00 0.00 ? 6  LEU A CG   7  
ATOM 5349  C CD1  . LEU A 1 6  ? 1.351   -3.118  12.253  1.00 0.00 ? 6  LEU A CD1  7  
ATOM 5350  C CD2  . LEU A 1 6  ? 0.744   -0.812  11.387  1.00 0.00 ? 6  LEU A CD2  7  
ATOM 5351  H H    . LEU A 1 6  ? -0.012  -4.846  11.382  1.00 0.00 ? 6  LEU A H    7  
ATOM 5352  H HA   . LEU A 1 6  ? -1.928  -3.406  9.871   1.00 0.00 ? 6  LEU A HA   7  
ATOM 5353  H HB2  . LEU A 1 6  ? -1.732  -1.763  11.493  1.00 0.00 ? 6  LEU A HB2  7  
ATOM 5354  H HB3  . LEU A 1 6  ? -1.463  -3.267  12.351  1.00 0.00 ? 6  LEU A HB3  7  
ATOM 5355  H HG   . LEU A 1 6  ? 0.090   -1.697  13.204  1.00 0.00 ? 6  LEU A HG   7  
ATOM 5356  H HD11 . LEU A 1 6  ? 0.984   -3.954  12.848  1.00 0.00 ? 6  LEU A HD11 7  
ATOM 5357  H HD12 . LEU A 1 6  ? 1.584   -3.463  11.245  1.00 0.00 ? 6  LEU A HD12 7  
ATOM 5358  H HD13 . LEU A 1 6  ? 2.250   -2.711  12.714  1.00 0.00 ? 6  LEU A HD13 7  
ATOM 5359  H HD21 . LEU A 1 6  ? -0.123  -0.274  11.004  1.00 0.00 ? 6  LEU A HD21 7  
ATOM 5360  H HD22 . LEU A 1 6  ? 1.323   -0.154  12.036  1.00 0.00 ? 6  LEU A HD22 7  
ATOM 5361  H HD23 . LEU A 1 6  ? 1.366   -1.139  10.554  1.00 0.00 ? 6  LEU A HD23 7  
ATOM 5362  N N    . SER A 1 7  ? -0.618  -1.631  8.598   1.00 0.00 ? 7  SER A N    7  
ATOM 5363  C CA   . SER A 1 7  ? 0.106   -0.869  7.594   1.00 0.00 ? 7  SER A CA   7  
ATOM 5364  C C    . SER A 1 7  ? 1.222   -0.059  8.256   1.00 0.00 ? 7  SER A C    7  
ATOM 5365  O O    . SER A 1 7  ? 0.953   0.855   9.034   1.00 0.00 ? 7  SER A O    7  
ATOM 5366  C CB   . SER A 1 7  ? -0.835  0.057   6.821   1.00 0.00 ? 7  SER A CB   7  
ATOM 5367  O OG   . SER A 1 7  ? -1.526  0.957   7.683   1.00 0.00 ? 7  SER A OG   7  
ATOM 5368  H H    . SER A 1 7  ? -1.566  -1.348  8.741   1.00 0.00 ? 7  SER A H    7  
ATOM 5369  H HA   . SER A 1 7  ? 0.523   -1.612  6.914   1.00 0.00 ? 7  SER A HA   7  
ATOM 5370  H HB2  . SER A 1 7  ? -0.263  0.625   6.087   1.00 0.00 ? 7  SER A HB2  7  
ATOM 5371  H HB3  . SER A 1 7  ? -1.558  -0.542  6.267   1.00 0.00 ? 7  SER A HB3  7  
ATOM 5372  H HG   . SER A 1 7  ? -1.226  1.895   7.509   1.00 0.00 ? 7  SER A HG   7  
ATOM 5373  N N    . ALA A 1 8  ? 2.452   -0.424  7.923   1.00 0.00 ? 8  ALA A N    7  
ATOM 5374  C CA   . ALA A 1 8  ? 3.610   0.258   8.475   1.00 0.00 ? 8  ALA A CA   7  
ATOM 5375  C C    . ALA A 1 8  ? 4.885   -0.405  7.950   1.00 0.00 ? 8  ALA A C    7  
ATOM 5376  O O    . ALA A 1 8  ? 5.378   -0.050  6.880   1.00 0.00 ? 8  ALA A O    7  
ATOM 5377  C CB   . ALA A 1 8  ? 3.532   0.242   10.003  1.00 0.00 ? 8  ALA A CB   7  
ATOM 5378  H H    . ALA A 1 8  ? 2.662   -1.169  7.289   1.00 0.00 ? 8  ALA A H    7  
ATOM 5379  H HA   . ALA A 1 8  ? 3.581   1.292   8.133   1.00 0.00 ? 8  ALA A HA   7  
ATOM 5380  H HB1  . ALA A 1 8  ? 3.321   -0.772  10.345  1.00 0.00 ? 8  ALA A HB1  7  
ATOM 5381  H HB2  . ALA A 1 8  ? 2.736   0.909   10.333  1.00 0.00 ? 8  ALA A HB2  7  
ATOM 5382  H HB3  . ALA A 1 8  ? 4.482   0.576   10.419  1.00 0.00 ? 8  ALA A HB3  7  
ATOM 5383  N N    . ASN A 1 9  ? 5.382   -1.357  8.726   1.00 0.00 ? 9  ASN A N    7  
ATOM 5384  C CA   . ASN A 1 9  ? 6.590   -2.073  8.353   1.00 0.00 ? 9  ASN A CA   7  
ATOM 5385  C C    . ASN A 1 9  ? 6.490   -2.505  6.889   1.00 0.00 ? 9  ASN A C    7  
ATOM 5386  O O    . ASN A 1 9  ? 7.408   -2.271  6.104   1.00 0.00 ? 9  ASN A O    7  
ATOM 5387  C CB   . ASN A 1 9  ? 6.771   -3.330  9.205   1.00 0.00 ? 9  ASN A CB   7  
ATOM 5388  C CG   . ASN A 1 9  ? 8.252   -3.690  9.344   1.00 0.00 ? 9  ASN A CG   7  
ATOM 5389  O OD1  . ASN A 1 9  ? 8.998   -3.740  8.380   1.00 0.00 ? 9  ASN A OD1  7  
ATOM 5390  N ND2  . ASN A 1 9  ? 8.634   -3.939  10.593  1.00 0.00 ? 9  ASN A ND2  7  
ATOM 5391  H H    . ASN A 1 9  ? 4.975   -1.640  9.595   1.00 0.00 ? 9  ASN A H    7  
ATOM 5392  H HA   . ASN A 1 9  ? 7.405   -1.369  8.525   1.00 0.00 ? 9  ASN A HA   7  
ATOM 5393  H HB2  . ASN A 1 9  ? 6.339   -3.170  10.193  1.00 0.00 ? 9  ASN A HB2  7  
ATOM 5394  H HB3  . ASN A 1 9  ? 6.232   -4.162  8.752   1.00 0.00 ? 9  ASN A HB3  7  
ATOM 5395  H HD21 . ASN A 1 9  ? 7.971   -3.881  11.339  1.00 0.00 ? 9  ASN A HD21 7  
ATOM 5396  H HD22 . ASN A 1 9  ? 9.584   -4.183  10.786  1.00 0.00 ? 9  ASN A HD22 7  
ATOM 5397  N N    . GLN A 1 10 ? 5.366   -3.128  6.565   1.00 0.00 ? 10 GLN A N    7  
ATOM 5398  C CA   . GLN A 1 10 ? 5.134   -3.595  5.208   1.00 0.00 ? 10 GLN A CA   7  
ATOM 5399  C C    . GLN A 1 10 ? 4.967   -2.407  4.259   1.00 0.00 ? 10 GLN A C    7  
ATOM 5400  O O    . GLN A 1 10 ? 5.294   -2.501  3.077   1.00 0.00 ? 10 GLN A O    7  
ATOM 5401  C CB   . GLN A 1 10 ? 3.916   -4.520  5.148   1.00 0.00 ? 10 GLN A CB   7  
ATOM 5402  C CG   . GLN A 1 10 ? 2.721   -3.902  5.876   1.00 0.00 ? 10 GLN A CG   7  
ATOM 5403  C CD   . GLN A 1 10 ? 2.277   -4.782  7.046   1.00 0.00 ? 10 GLN A CD   7  
ATOM 5404  O OE1  . GLN A 1 10 ? 2.728   -4.640  8.170   1.00 0.00 ? 10 GLN A OE1  7  
ATOM 5405  N NE2  . GLN A 1 10 ? 1.369   -5.698  6.720   1.00 0.00 ? 10 GLN A NE2  7  
ATOM 5406  H H    . GLN A 1 10 ? 4.624   -3.315  7.209   1.00 0.00 ? 10 GLN A H    7  
ATOM 5407  H HA   . GLN A 1 10 ? 6.026   -4.161  4.940   1.00 0.00 ? 10 GLN A HA   7  
ATOM 5408  H HB2  . GLN A 1 10 ? 3.653   -4.713  4.108   1.00 0.00 ? 10 GLN A HB2  7  
ATOM 5409  H HB3  . GLN A 1 10 ? 4.163   -5.482  5.598   1.00 0.00 ? 10 GLN A HB3  7  
ATOM 5410  H HG2  . GLN A 1 10 ? 2.987   -2.911  6.243   1.00 0.00 ? 10 GLN A HG2  7  
ATOM 5411  H HG3  . GLN A 1 10 ? 1.894   -3.772  5.179   1.00 0.00 ? 10 GLN A HG3  7  
ATOM 5412  H HE21 . GLN A 1 10 ? 1.040   -5.762  5.778   1.00 0.00 ? 10 GLN A HE21 7  
ATOM 5413  H HE22 . GLN A 1 10 ? 1.015   -6.322  7.416   1.00 0.00 ? 10 GLN A HE22 7  
ATOM 5414  N N    . CYS A 1 11 ? 4.458   -1.316  4.812   1.00 0.00 ? 11 CYS A N    7  
ATOM 5415  C CA   . CYS A 1 11 ? 4.244   -0.110  4.029   1.00 0.00 ? 11 CYS A CA   7  
ATOM 5416  C C    . CYS A 1 11 ? 5.242   0.951   4.498   1.00 0.00 ? 11 CYS A C    7  
ATOM 5417  O O    . CYS A 1 11 ? 4.878   2.112   4.681   1.00 0.00 ? 11 CYS A O    7  
ATOM 5418  C CB   . CYS A 1 11 ? 2.798   0.381   4.131   1.00 0.00 ? 11 CYS A CB   7  
ATOM 5419  S SG   . CYS A 1 11 ? 1.569   -0.923  4.501   1.00 0.00 ? 11 CYS A SG   7  
ATOM 5420  H H    . CYS A 1 11 ? 4.195   -1.247  5.774   1.00 0.00 ? 11 CYS A H    7  
ATOM 5421  H HA   . CYS A 1 11 ? 4.423   -0.377  2.988   1.00 0.00 ? 11 CYS A HA   7  
ATOM 5422  H HB2  . CYS A 1 11 ? 2.743   1.144   4.908   1.00 0.00 ? 11 CYS A HB2  7  
ATOM 5423  H HB3  . CYS A 1 11 ? 2.526   0.862   3.192   1.00 0.00 ? 11 CYS A HB3  7  
ATOM 5424  N N    . ALA A 1 12 ? 6.479   0.514   4.679   1.00 0.00 ? 12 ALA A N    7  
ATOM 5425  C CA   . ALA A 1 12 ? 7.532   1.412   5.123   1.00 0.00 ? 12 ALA A CA   7  
ATOM 5426  C C    . ALA A 1 12 ? 8.584   1.542   4.020   1.00 0.00 ? 12 ALA A C    7  
ATOM 5427  O O    . ALA A 1 12 ? 9.769   1.308   4.257   1.00 0.00 ? 12 ALA A O    7  
ATOM 5428  C CB   . ALA A 1 12 ? 8.124   0.895   6.436   1.00 0.00 ? 12 ALA A CB   7  
ATOM 5429  H H    . ALA A 1 12 ? 6.766   -0.432  4.528   1.00 0.00 ? 12 ALA A H    7  
ATOM 5430  H HA   . ALA A 1 12 ? 7.082   2.388   5.302   1.00 0.00 ? 12 ALA A HA   7  
ATOM 5431  H HB1  . ALA A 1 12 ? 9.208   0.822   6.342   1.00 0.00 ? 12 ALA A HB1  7  
ATOM 5432  H HB2  . ALA A 1 12 ? 7.875   1.584   7.243   1.00 0.00 ? 12 ALA A HB2  7  
ATOM 5433  H HB3  . ALA A 1 12 ? 7.711   -0.089  6.658   1.00 0.00 ? 12 ALA A HB3  7  
ATOM 5434  N N    . VAL A 1 13 ? 8.114   1.914   2.839   1.00 0.00 ? 13 VAL A N    7  
ATOM 5435  C CA   . VAL A 1 13 ? 9.000   2.078   1.699   1.00 0.00 ? 13 VAL A CA   7  
ATOM 5436  C C    . VAL A 1 13 ? 9.427   3.544   1.597   1.00 0.00 ? 13 VAL A C    7  
ATOM 5437  O O    . VAL A 1 13 ? 8.690   4.439   2.007   1.00 0.00 ? 13 VAL A O    7  
ATOM 5438  C CB   . VAL A 1 13 ? 8.319   1.564   0.429   1.00 0.00 ? 13 VAL A CB   7  
ATOM 5439  C CG1  . VAL A 1 13 ? 9.310   0.804   -0.455  1.00 0.00 ? 13 VAL A CG1  7  
ATOM 5440  C CG2  . VAL A 1 13 ? 7.109   0.692   0.770   1.00 0.00 ? 13 VAL A CG2  7  
ATOM 5441  H H    . VAL A 1 13 ? 7.150   2.102   2.655   1.00 0.00 ? 13 VAL A H    7  
ATOM 5442  H HA   . VAL A 1 13 ? 9.884   1.467   1.879   1.00 0.00 ? 13 VAL A HA   7  
ATOM 5443  H HB   . VAL A 1 13 ? 7.962   2.427   -0.133  1.00 0.00 ? 13 VAL A HB   7  
ATOM 5444  H HG11 . VAL A 1 13 ? 10.197  0.552   0.126   1.00 0.00 ? 13 VAL A HG11 7  
ATOM 5445  H HG12 . VAL A 1 13 ? 8.843   -0.110  -0.822  1.00 0.00 ? 13 VAL A HG12 7  
ATOM 5446  H HG13 . VAL A 1 13 ? 9.596   1.430   -1.301  1.00 0.00 ? 13 VAL A HG13 7  
ATOM 5447  H HG21 . VAL A 1 13 ? 7.322   0.108   1.666   1.00 0.00 ? 13 VAL A HG21 7  
ATOM 5448  H HG22 . VAL A 1 13 ? 6.242   1.328   0.949   1.00 0.00 ? 13 VAL A HG22 7  
ATOM 5449  H HG23 . VAL A 1 13 ? 6.900   0.019   -0.061  1.00 0.00 ? 13 VAL A HG23 7  
ATOM 5450  N N    . PRO A 1 14 ? 10.647  3.749   1.032   1.00 0.00 ? 14 PRO A N    7  
ATOM 5451  C CA   . PRO A 1 14 ? 11.181  5.091   0.871   1.00 0.00 ? 14 PRO A CA   7  
ATOM 5452  C C    . PRO A 1 14 ? 10.487  5.822   -0.280  1.00 0.00 ? 14 PRO A C    7  
ATOM 5453  O O    . PRO A 1 14 ? 10.842  6.954   -0.604  1.00 0.00 ? 14 PRO A O    7  
ATOM 5454  C CB   . PRO A 1 14 ? 12.670  4.896   0.639   1.00 0.00 ? 14 PRO A CB   7  
ATOM 5455  C CG   . PRO A 1 14 ? 12.841  3.446   0.216   1.00 0.00 ? 14 PRO A CG   7  
ATOM 5456  C CD   . PRO A 1 14 ? 11.547  2.713   0.534   1.00 0.00 ? 14 PRO A CD   7  
ATOM 5457  H HA   . PRO A 1 14 ? 11.001  5.636   1.689   1.00 0.00 ? 14 PRO A HA   7  
ATOM 5458  H HB2  . PRO A 1 14 ? 13.037  5.573   -0.133  1.00 0.00 ? 14 PRO A HB2  7  
ATOM 5459  H HB3  . PRO A 1 14 ? 13.238  5.108   1.545   1.00 0.00 ? 14 PRO A HB3  7  
ATOM 5460  H HG2  . PRO A 1 14 ? 13.064  3.382   -0.849  1.00 0.00 ? 14 PRO A HG2  7  
ATOM 5461  H HG3  . PRO A 1 14 ? 13.678  2.990   0.745   1.00 0.00 ? 14 PRO A HG3  7  
ATOM 5462  H HD2  . PRO A 1 14 ? 11.140  2.226   -0.352  1.00 0.00 ? 14 PRO A HD2  7  
ATOM 5463  H HD3  . PRO A 1 14 ? 11.706  1.934   1.280   1.00 0.00 ? 14 PRO A HD3  7  
ATOM 5464  N N    . ALA A 1 15 ? 9.510   5.145   -0.866  1.00 0.00 ? 15 ALA A N    7  
ATOM 5465  C CA   . ALA A 1 15 ? 8.763   5.717   -1.973  1.00 0.00 ? 15 ALA A CA   7  
ATOM 5466  C C    . ALA A 1 15 ? 9.511   5.447   -3.280  1.00 0.00 ? 15 ALA A C    7  
ATOM 5467  O O    . ALA A 1 15 ? 8.906   5.409   -4.350  1.00 0.00 ? 15 ALA A O    7  
ATOM 5468  C CB   . ALA A 1 15 ? 8.543   7.210   -1.724  1.00 0.00 ? 15 ALA A CB   7  
ATOM 5469  H H    . ALA A 1 15 ? 9.227   4.225   -0.595  1.00 0.00 ? 15 ALA A H    7  
ATOM 5470  H HA   . ALA A 1 15 ? 7.793   5.221   -2.010  1.00 0.00 ? 15 ALA A HA   7  
ATOM 5471  H HB1  . ALA A 1 15 ? 8.773   7.443   -0.685  1.00 0.00 ? 15 ALA A HB1  7  
ATOM 5472  H HB2  . ALA A 1 15 ? 7.504   7.464   -1.933  1.00 0.00 ? 15 ALA A HB2  7  
ATOM 5473  H HB3  . ALA A 1 15 ? 9.197   7.788   -2.379  1.00 0.00 ? 15 ALA A HB3  7  
ATOM 5474  N N    . LYS A 1 16 ? 10.818  5.267   -3.151  1.00 0.00 ? 16 LYS A N    7  
ATOM 5475  C CA   . LYS A 1 16 ? 11.655  5.002   -4.308  1.00 0.00 ? 16 LYS A CA   7  
ATOM 5476  C C    . LYS A 1 16 ? 11.715  3.493   -4.554  1.00 0.00 ? 16 LYS A C    7  
ATOM 5477  O O    . LYS A 1 16 ? 12.452  3.031   -5.425  1.00 0.00 ? 16 LYS A O    7  
ATOM 5478  C CB   . LYS A 1 16 ? 13.029  5.652   -4.136  1.00 0.00 ? 16 LYS A CB   7  
ATOM 5479  C CG   . LYS A 1 16 ? 13.799  5.009   -2.981  1.00 0.00 ? 16 LYS A CG   7  
ATOM 5480  C CD   . LYS A 1 16 ? 14.389  3.660   -3.399  1.00 0.00 ? 16 LYS A CD   7  
ATOM 5481  C CE   . LYS A 1 16 ? 15.831  3.517   -2.909  1.00 0.00 ? 16 LYS A CE   7  
ATOM 5482  N NZ   . LYS A 1 16 ? 16.185  2.089   -2.749  1.00 0.00 ? 16 LYS A NZ   7  
ATOM 5483  H H    . LYS A 1 16 ? 11.303  5.299   -2.277  1.00 0.00 ? 16 LYS A H    7  
ATOM 5484  H HA   . LYS A 1 16 ? 11.181  5.474   -5.169  1.00 0.00 ? 16 LYS A HA   7  
ATOM 5485  H HB2  . LYS A 1 16 ? 13.601  5.554   -5.058  1.00 0.00 ? 16 LYS A HB2  7  
ATOM 5486  H HB3  . LYS A 1 16 ? 12.909  6.719   -3.948  1.00 0.00 ? 16 LYS A HB3  7  
ATOM 5487  H HG2  . LYS A 1 16 ? 14.599  5.675   -2.656  1.00 0.00 ? 16 LYS A HG2  7  
ATOM 5488  H HG3  . LYS A 1 16 ? 13.134  4.871   -2.128  1.00 0.00 ? 16 LYS A HG3  7  
ATOM 5489  H HD2  . LYS A 1 16 ? 13.781  2.852   -2.992  1.00 0.00 ? 16 LYS A HD2  7  
ATOM 5490  H HD3  . LYS A 1 16 ? 14.358  3.567   -4.484  1.00 0.00 ? 16 LYS A HD3  7  
ATOM 5491  H HE2  . LYS A 1 16 ? 16.511  3.990   -3.619  1.00 0.00 ? 16 LYS A HE2  7  
ATOM 5492  H HE3  . LYS A 1 16 ? 15.952  4.037   -1.958  1.00 0.00 ? 16 LYS A HE3  7  
ATOM 5493  H HZ1  . LYS A 1 16 ? 15.398  1.589   -2.389  1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 5494  H HZ2  . LYS A 1 16 ? 16.444  1.709   -3.637  1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 5495  H HZ3  . LYS A 1 16 ? 16.953  2.005   -2.114  1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 5496  N N    . ASP A 1 17 ? 10.931  2.766   -3.771  1.00 0.00 ? 17 ASP A N    7  
ATOM 5497  C CA   . ASP A 1 17 ? 10.886  1.319   -3.893  1.00 0.00 ? 17 ASP A CA   7  
ATOM 5498  C C    . ASP A 1 17 ? 9.429   0.865   -3.992  1.00 0.00 ? 17 ASP A C    7  
ATOM 5499  O O    . ASP A 1 17 ? 9.116   -0.294  -3.723  1.00 0.00 ? 17 ASP A O    7  
ATOM 5500  C CB   . ASP A 1 17 ? 11.510  0.644   -2.670  1.00 0.00 ? 17 ASP A CB   7  
ATOM 5501  C CG   . ASP A 1 17 ? 12.700  -0.269  -2.972  1.00 0.00 ? 17 ASP A CG   7  
ATOM 5502  O OD1  . ASP A 1 17 ? 12.561  -1.095  -3.900  1.00 0.00 ? 17 ASP A OD1  7  
ATOM 5503  O OD2  . ASP A 1 17 ? 13.722  -0.121  -2.269  1.00 0.00 ? 17 ASP A OD2  7  
ATOM 5504  H H    . ASP A 1 17 ? 10.335  3.150   -3.066  1.00 0.00 ? 17 ASP A H    7  
ATOM 5505  H HA   . ASP A 1 17 ? 11.456  1.090   -4.793  1.00 0.00 ? 17 ASP A HA   7  
ATOM 5506  H HB2  . ASP A 1 17 ? 11.832  1.416   -1.972  1.00 0.00 ? 17 ASP A HB2  7  
ATOM 5507  H HB3  . ASP A 1 17 ? 10.741  0.059   -2.166  1.00 0.00 ? 17 ASP A HB3  7  
ATOM 5508  N N    . ARG A 1 18 ? 8.575   1.802   -4.378  1.00 0.00 ? 18 ARG A N    7  
ATOM 5509  C CA   . ARG A 1 18 ? 7.158   1.513   -4.516  1.00 0.00 ? 18 ARG A CA   7  
ATOM 5510  C C    . ARG A 1 18 ? 6.900   0.722   -5.800  1.00 0.00 ? 18 ARG A C    7  
ATOM 5511  O O    . ARG A 1 18 ? 7.446   1.046   -6.853  1.00 0.00 ? 18 ARG A O    7  
ATOM 5512  C CB   . ARG A 1 18 ? 6.333   2.801   -4.543  1.00 0.00 ? 18 ARG A CB   7  
ATOM 5513  C CG   . ARG A 1 18 ? 6.838   3.798   -3.499  1.00 0.00 ? 18 ARG A CG   7  
ATOM 5514  C CD   . ARG A 1 18 ? 6.170   3.559   -2.144  1.00 0.00 ? 18 ARG A CD   7  
ATOM 5515  N NE   . ARG A 1 18 ? 5.744   4.848   -1.555  1.00 0.00 ? 18 ARG A NE   7  
ATOM 5516  C CZ   . ARG A 1 18 ? 5.686   5.090   -0.238  1.00 0.00 ? 18 ARG A CZ   7  
ATOM 5517  N NH1  . ARG A 1 18 ? 6.027   4.132   0.635   1.00 0.00 ? 18 ARG A NH1  7  
ATOM 5518  N NH2  . ARG A 1 18 ? 5.287   6.289   0.206   1.00 0.00 ? 18 ARG A NH2  7  
ATOM 5519  H H    . ARG A 1 18 ? 8.837   2.742   -4.595  1.00 0.00 ? 18 ARG A H    7  
ATOM 5520  H HA   . ARG A 1 18 ? 6.907   0.922   -3.634  1.00 0.00 ? 18 ARG A HA   7  
ATOM 5521  H HB2  . ARG A 1 18 ? 6.385   3.249   -5.535  1.00 0.00 ? 18 ARG A HB2  7  
ATOM 5522  H HB3  . ARG A 1 18 ? 5.285   2.570   -4.353  1.00 0.00 ? 18 ARG A HB3  7  
ATOM 5523  H HG2  . ARG A 1 18 ? 7.920   3.707   -3.397  1.00 0.00 ? 18 ARG A HG2  7  
ATOM 5524  H HG3  . ARG A 1 18 ? 6.635   4.815   -3.834  1.00 0.00 ? 18 ARG A HG3  7  
ATOM 5525  H HD2  . ARG A 1 18 ? 5.309   2.902   -2.264  1.00 0.00 ? 18 ARG A HD2  7  
ATOM 5526  H HD3  . ARG A 1 18 ? 6.864   3.054   -1.471  1.00 0.00 ? 18 ARG A HD3  7  
ATOM 5527  H HE   . ARG A 1 18 ? 5.483   5.585   -2.178  1.00 0.00 ? 18 ARG A HE   7  
ATOM 5528  H HH11 . ARG A 1 18 ? 6.324   3.236   0.304   1.00 0.00 ? 18 ARG A HH11 7  
ATOM 5529  H HH12 . ARG A 1 18 ? 5.983   4.312   1.618   1.00 0.00 ? 18 ARG A HH12 7  
ATOM 5530  H HH21 . ARG A 1 18 ? 5.033   7.004   -0.445  1.00 0.00 ? 18 ARG A HH21 7  
ATOM 5531  H HH22 . ARG A 1 18 ? 5.244   6.470   1.189   1.00 0.00 ? 18 ARG A HH22 7  
ATOM 5532  N N    . VAL A 1 19 ? 6.066   -0.300  -5.670  1.00 0.00 ? 19 VAL A N    7  
ATOM 5533  C CA   . VAL A 1 19 ? 5.729   -1.139  -6.807  1.00 0.00 ? 19 VAL A CA   7  
ATOM 5534  C C    . VAL A 1 19 ? 4.424   -0.643  -7.433  1.00 0.00 ? 19 VAL A C    7  
ATOM 5535  O O    . VAL A 1 19 ? 3.978   -1.172  -8.450  1.00 0.00 ? 19 VAL A O    7  
ATOM 5536  C CB   . VAL A 1 19 ? 5.664   -2.605  -6.375  1.00 0.00 ? 19 VAL A CB   7  
ATOM 5537  C CG1  . VAL A 1 19 ? 5.206   -3.498  -7.530  1.00 0.00 ? 19 VAL A CG1  7  
ATOM 5538  C CG2  . VAL A 1 19 ? 7.012   -3.073  -5.821  1.00 0.00 ? 19 VAL A CG2  7  
ATOM 5539  H H    . VAL A 1 19 ? 5.626   -0.557  -4.810  1.00 0.00 ? 19 VAL A H    7  
ATOM 5540  H HA   . VAL A 1 19 ? 6.530   -1.038  -7.540  1.00 0.00 ? 19 VAL A HA   7  
ATOM 5541  H HB   . VAL A 1 19 ? 4.927   -2.687  -5.576  1.00 0.00 ? 19 VAL A HB   7  
ATOM 5542  H HG11 . VAL A 1 19 ? 5.580   -3.095  -8.471  1.00 0.00 ? 19 VAL A HG11 7  
ATOM 5543  H HG12 . VAL A 1 19 ? 5.596   -4.506  -7.386  1.00 0.00 ? 19 VAL A HG12 7  
ATOM 5544  H HG13 . VAL A 1 19 ? 4.117   -3.530  -7.554  1.00 0.00 ? 19 VAL A HG13 7  
ATOM 5545  H HG21 . VAL A 1 19 ? 7.816   -2.526  -6.312  1.00 0.00 ? 19 VAL A HG21 7  
ATOM 5546  H HG22 . VAL A 1 19 ? 7.048   -2.886  -4.747  1.00 0.00 ? 19 VAL A HG22 7  
ATOM 5547  H HG23 . VAL A 1 19 ? 7.130   -4.141  -6.007  1.00 0.00 ? 19 VAL A HG23 7  
ATOM 5548  N N    . ASP A 1 20 ? 3.849   0.369   -6.800  1.00 0.00 ? 20 ASP A N    7  
ATOM 5549  C CA   . ASP A 1 20 ? 2.604   0.943   -7.282  1.00 0.00 ? 20 ASP A CA   7  
ATOM 5550  C C    . ASP A 1 20 ? 1.595   -0.178  -7.535  1.00 0.00 ? 20 ASP A C    7  
ATOM 5551  O O    . ASP A 1 20 ? 1.645   -0.842  -8.570  1.00 0.00 ? 20 ASP A O    7  
ATOM 5552  C CB   . ASP A 1 20 ? 2.817   1.694   -8.598  1.00 0.00 ? 20 ASP A CB   7  
ATOM 5553  C CG   . ASP A 1 20 ? 1.538   2.010   -9.376  1.00 0.00 ? 20 ASP A CG   7  
ATOM 5554  O OD1  . ASP A 1 20 ? 0.489   2.147   -8.711  1.00 0.00 ? 20 ASP A OD1  7  
ATOM 5555  O OD2  . ASP A 1 20 ? 1.639   2.108   -10.618 1.00 0.00 ? 20 ASP A OD2  7  
ATOM 5556  H H    . ASP A 1 20 ? 4.218   0.794   -5.974  1.00 0.00 ? 20 ASP A H    7  
ATOM 5557  H HA   . ASP A 1 20 ? 2.281   1.626   -6.496  1.00 0.00 ? 20 ASP A HA   7  
ATOM 5558  H HB2  . ASP A 1 20 ? 3.336   2.629   -8.386  1.00 0.00 ? 20 ASP A HB2  7  
ATOM 5559  H HB3  . ASP A 1 20 ? 3.475   1.102   -9.234  1.00 0.00 ? 20 ASP A HB3  7  
ATOM 5560  N N    . CYS A 1 21 ? 0.701   -0.355  -6.573  1.00 0.00 ? 21 CYS A N    7  
ATOM 5561  C CA   . CYS A 1 21 ? -0.318  -1.385  -6.679  1.00 0.00 ? 21 CYS A CA   7  
ATOM 5562  C C    . CYS A 1 21 ? -1.316  -0.964  -7.760  1.00 0.00 ? 21 CYS A C    7  
ATOM 5563  O O    . CYS A 1 21 ? -2.012  -1.804  -8.329  1.00 0.00 ? 21 CYS A O    7  
ATOM 5564  C CB   . CYS A 1 21 ? -1.006  -1.640  -5.336  1.00 0.00 ? 21 CYS A CB   7  
ATOM 5565  S SG   . CYS A 1 21 ? -1.333  -3.402  -4.964  1.00 0.00 ? 21 CYS A SG   7  
ATOM 5566  H H    . CYS A 1 21 ? 0.667   0.189   -5.735  1.00 0.00 ? 21 CYS A H    7  
ATOM 5567  H HA   . CYS A 1 21 ? 0.194   -2.305  -6.962  1.00 0.00 ? 21 CYS A HA   7  
ATOM 5568  H HB2  . CYS A 1 21 ? -0.386  -1.225  -4.542  1.00 0.00 ? 21 CYS A HB2  7  
ATOM 5569  H HB3  . CYS A 1 21 ? -1.952  -1.098  -5.319  1.00 0.00 ? 21 CYS A HB3  7  
ATOM 5570  N N    . GLY A 1 22 ? -1.354  0.336   -8.011  1.00 0.00 ? 22 GLY A N    7  
ATOM 5571  C CA   . GLY A 1 22 ? -2.255  0.879   -9.014  1.00 0.00 ? 22 GLY A CA   7  
ATOM 5572  C C    . GLY A 1 22 ? -3.715  0.708   -8.589  1.00 0.00 ? 22 GLY A C    7  
ATOM 5573  O O    . GLY A 1 22 ? -4.325  -0.326  -8.858  1.00 0.00 ? 22 GLY A O    7  
ATOM 5574  H H    . GLY A 1 22 ? -0.785  1.013   -7.544  1.00 0.00 ? 22 GLY A H    7  
ATOM 5575  H HA2  . GLY A 1 22 ? -2.039  1.936   -9.168  1.00 0.00 ? 22 GLY A HA2  7  
ATOM 5576  H HA3  . GLY A 1 22 ? -2.088  0.378   -9.967  1.00 0.00 ? 22 GLY A HA3  7  
ATOM 5577  N N    . TYR A 1 23 ? -4.232  1.736   -7.934  1.00 0.00 ? 23 TYR A N    7  
ATOM 5578  C CA   . TYR A 1 23 ? -5.609  1.712   -7.470  1.00 0.00 ? 23 TYR A CA   7  
ATOM 5579  C C    . TYR A 1 23 ? -6.290  3.062   -7.706  1.00 0.00 ? 23 TYR A C    7  
ATOM 5580  O O    . TYR A 1 23 ? -5.638  4.105   -7.674  1.00 0.00 ? 23 TYR A O    7  
ATOM 5581  C CB   . TYR A 1 23 ? -5.542  1.444   -5.965  1.00 0.00 ? 23 TYR A CB   7  
ATOM 5582  C CG   . TYR A 1 23 ? -5.593  -0.040  -5.595  1.00 0.00 ? 23 TYR A CG   7  
ATOM 5583  C CD1  . TYR A 1 23 ? -6.744  -0.768  -5.819  1.00 0.00 ? 23 TYR A CD1  7  
ATOM 5584  C CD2  . TYR A 1 23 ? -4.488  -0.650  -5.038  1.00 0.00 ? 23 TYR A CD2  7  
ATOM 5585  C CE1  . TYR A 1 23 ? -6.792  -2.164  -5.471  1.00 0.00 ? 23 TYR A CE1  7  
ATOM 5586  C CE2  . TYR A 1 23 ? -4.536  -2.047  -4.690  1.00 0.00 ? 23 TYR A CE2  7  
ATOM 5587  C CZ   . TYR A 1 23 ? -5.686  -2.735  -4.923  1.00 0.00 ? 23 TYR A CZ   7  
ATOM 5588  O OH   . TYR A 1 23 ? -5.731  -4.054  -4.594  1.00 0.00 ? 23 TYR A OH   7  
ATOM 5589  H H    . TYR A 1 23 ? -3.728  2.573   -7.720  1.00 0.00 ? 23 TYR A H    7  
ATOM 5590  H HA   . TYR A 1 23 ? -6.139  0.943   -8.031  1.00 0.00 ? 23 TYR A HA   7  
ATOM 5591  H HB2  . TYR A 1 23 ? -4.622  1.875   -5.570  1.00 0.00 ? 23 TYR A HB2  7  
ATOM 5592  H HB3  . TYR A 1 23 ? -6.370  1.958   -5.478  1.00 0.00 ? 23 TYR A HB3  7  
ATOM 5593  H HD1  . TYR A 1 23 ? -7.617  -0.285  -6.259  1.00 0.00 ? 23 TYR A HD1  7  
ATOM 5594  H HD2  . TYR A 1 23 ? -3.579  -0.076  -4.861  1.00 0.00 ? 23 TYR A HD2  7  
ATOM 5595  H HE1  . TYR A 1 23 ? -7.695  -2.751  -5.642  1.00 0.00 ? 23 TYR A HE1  7  
ATOM 5596  H HE2  . TYR A 1 23 ? -3.671  -2.541  -4.249  1.00 0.00 ? 23 TYR A HE2  7  
ATOM 5597  H HH   . TYR A 1 23 ? -5.815  -4.610  -5.421  1.00 0.00 ? 23 TYR A HH   7  
ATOM 5598  N N    . PRO A 1 24 ? -7.628  2.997   -7.943  1.00 0.00 ? 24 PRO A N    7  
ATOM 5599  C CA   . PRO A 1 24 ? -8.405  4.201   -8.184  1.00 0.00 ? 24 PRO A CA   7  
ATOM 5600  C C    . PRO A 1 24 ? -8.638  4.972   -6.883  1.00 0.00 ? 24 PRO A C    7  
ATOM 5601  O O    . PRO A 1 24 ? -7.982  5.981   -6.629  1.00 0.00 ? 24 PRO A O    7  
ATOM 5602  C CB   . PRO A 1 24 ? -9.694  3.715   -8.826  1.00 0.00 ? 24 PRO A CB   7  
ATOM 5603  C CG   . PRO A 1 24 ? -9.791  2.234   -8.498  1.00 0.00 ? 24 PRO A CG   7  
ATOM 5604  C CD   . PRO A 1 24 ? -8.433  1.780   -7.988  1.00 0.00 ? 24 PRO A CD   7  
ATOM 5605  H HA   . PRO A 1 24 ? -7.903  4.823   -8.784  1.00 0.00 ? 24 PRO A HA   7  
ATOM 5606  H HB2  . PRO A 1 24 ? -10.554 4.259   -8.435  1.00 0.00 ? 24 PRO A HB2  7  
ATOM 5607  H HB3  . PRO A 1 24 ? -9.678  3.876   -9.903  1.00 0.00 ? 24 PRO A HB3  7  
ATOM 5608  H HG2  . PRO A 1 24 ? -10.559 2.059   -7.745  1.00 0.00 ? 24 PRO A HG2  7  
ATOM 5609  H HG3  . PRO A 1 24 ? -10.076 1.665   -9.382  1.00 0.00 ? 24 PRO A HG3  7  
ATOM 5610  H HD2  . PRO A 1 24 ? -8.513  1.321   -7.003  1.00 0.00 ? 24 PRO A HD2  7  
ATOM 5611  H HD3  . PRO A 1 24 ? -7.990  1.036   -8.651  1.00 0.00 ? 24 PRO A HD3  7  
ATOM 5612  N N    . HIS A 1 25 ? -9.574  4.467   -6.093  1.00 0.00 ? 25 HIS A N    7  
ATOM 5613  C CA   . HIS A 1 25 ? -9.902  5.096   -4.825  1.00 0.00 ? 25 HIS A CA   7  
ATOM 5614  C C    . HIS A 1 25 ? -8.982  4.553   -3.730  1.00 0.00 ? 25 HIS A C    7  
ATOM 5615  O O    . HIS A 1 25 ? -9.347  3.625   -3.010  1.00 0.00 ? 25 HIS A O    7  
ATOM 5616  C CB   . HIS A 1 25 ? -11.385 4.915   -4.496  1.00 0.00 ? 25 HIS A CB   7  
ATOM 5617  C CG   . HIS A 1 25 ? -11.774 3.492   -4.175  1.00 0.00 ? 25 HIS A CG   7  
ATOM 5618  N ND1  . HIS A 1 25 ? -13.018 3.150   -3.675  1.00 0.00 ? 25 HIS A ND1  7  
ATOM 5619  C CD2  . HIS A 1 25 ? -11.072 2.329   -4.289  1.00 0.00 ? 25 HIS A CD2  7  
ATOM 5620  C CE1  . HIS A 1 25 ? -13.051 1.837   -3.498  1.00 0.00 ? 25 HIS A CE1  7  
ATOM 5621  N NE2  . HIS A 1 25 ? -11.844 1.330   -3.880  1.00 0.00 ? 25 HIS A NE2  7  
ATOM 5622  H H    . HIS A 1 25 ? -10.103 3.646   -6.306  1.00 0.00 ? 25 HIS A H    7  
ATOM 5623  H HA   . HIS A 1 25 ? -9.716  6.163   -4.947  1.00 0.00 ? 25 HIS A HA   7  
ATOM 5624  H HB2  . HIS A 1 25 ? -11.639 5.551   -3.648  1.00 0.00 ? 25 HIS A HB2  7  
ATOM 5625  H HB3  . HIS A 1 25 ? -11.979 5.262   -5.342  1.00 0.00 ? 25 HIS A HB3  7  
ATOM 5626  H HD1  . HIS A 1 25 ? -13.765 3.785   -3.479  1.00 0.00 ? 25 HIS A HD1  7  
ATOM 5627  H HD2  . HIS A 1 25 ? -10.049 2.235   -4.655  1.00 0.00 ? 25 HIS A HD2  7  
ATOM 5628  H HE1  . HIS A 1 25 ? -13.896 1.263   -3.116  1.00 0.00 ? 25 HIS A HE1  7  
ATOM 5629  H HE2  . HIS A 1 25 ? -11.603 0.360   -3.908  1.00 0.00 ? 25 HIS A HE2  7  
ATOM 5630  N N    . VAL A 1 26 ? -7.805  5.155   -3.637  1.00 0.00 ? 26 VAL A N    7  
ATOM 5631  C CA   . VAL A 1 26 ? -6.830  4.744   -2.642  1.00 0.00 ? 26 VAL A CA   7  
ATOM 5632  C C    . VAL A 1 26 ? -6.970  5.628   -1.401  1.00 0.00 ? 26 VAL A C    7  
ATOM 5633  O O    . VAL A 1 26 ? -7.085  6.847   -1.513  1.00 0.00 ? 26 VAL A O    7  
ATOM 5634  C CB   . VAL A 1 26 ? -5.423  4.776   -3.243  1.00 0.00 ? 26 VAL A CB   7  
ATOM 5635  C CG1  . VAL A 1 26 ? -5.268  3.712   -4.332  1.00 0.00 ? 26 VAL A CG1  7  
ATOM 5636  C CG2  . VAL A 1 26 ? -5.090  6.167   -3.785  1.00 0.00 ? 26 VAL A CG2  7  
ATOM 5637  H H    . VAL A 1 26 ? -7.516  5.910   -4.226  1.00 0.00 ? 26 VAL A H    7  
ATOM 5638  H HA   . VAL A 1 26 ? -7.056  3.714   -2.366  1.00 0.00 ? 26 VAL A HA   7  
ATOM 5639  H HB   . VAL A 1 26 ? -4.714  4.547   -2.448  1.00 0.00 ? 26 VAL A HB   7  
ATOM 5640  H HG11 . VAL A 1 26 ? -6.006  3.884   -5.116  1.00 0.00 ? 26 VAL A HG11 7  
ATOM 5641  H HG12 . VAL A 1 26 ? -4.266  3.770   -4.756  1.00 0.00 ? 26 VAL A HG12 7  
ATOM 5642  H HG13 . VAL A 1 26 ? -5.422  2.723   -3.898  1.00 0.00 ? 26 VAL A HG13 7  
ATOM 5643  H HG21 . VAL A 1 26 ? -5.552  6.924   -3.151  1.00 0.00 ? 26 VAL A HG21 7  
ATOM 5644  H HG22 . VAL A 1 26 ? -4.009  6.306   -3.789  1.00 0.00 ? 26 VAL A HG22 7  
ATOM 5645  H HG23 . VAL A 1 26 ? -5.472  6.262   -4.801  1.00 0.00 ? 26 VAL A HG23 7  
ATOM 5646  N N    . THR A 1 27 ? -6.955  4.979   -0.246  1.00 0.00 ? 27 THR A N    7  
ATOM 5647  C CA   . THR A 1 27 ? -7.079  5.691   1.014   1.00 0.00 ? 27 THR A CA   7  
ATOM 5648  C C    . THR A 1 27 ? -6.331  4.947   2.122   1.00 0.00 ? 27 THR A C    7  
ATOM 5649  O O    . THR A 1 27 ? -5.874  3.822   1.922   1.00 0.00 ? 27 THR A O    7  
ATOM 5650  C CB   . THR A 1 27 ? -8.569  5.878   1.307   1.00 0.00 ? 27 THR A CB   7  
ATOM 5651  O OG1  . THR A 1 27 ? -8.951  4.666   1.951   1.00 0.00 ? 27 THR A OG1  7  
ATOM 5652  C CG2  . THR A 1 27 ? -9.416  5.908   0.034   1.00 0.00 ? 27 THR A CG2  7  
ATOM 5653  H H    . THR A 1 27 ? -6.861  3.986   -0.164  1.00 0.00 ? 27 THR A H    7  
ATOM 5654  H HA   . THR A 1 27 ? -6.604  6.666   0.906   1.00 0.00 ? 27 THR A HA   7  
ATOM 5655  H HB   . THR A 1 27 ? -8.738  6.771   1.908   1.00 0.00 ? 27 THR A HB   7  
ATOM 5656  H HG1  . THR A 1 27 ? -9.914  4.710   2.219   1.00 0.00 ? 27 THR A HG1  7  
ATOM 5657  H HG21 . THR A 1 27 ? -9.160  5.054   -0.594  1.00 0.00 ? 27 THR A HG21 7  
ATOM 5658  H HG22 . THR A 1 27 ? -10.473 5.859   0.299   1.00 0.00 ? 27 THR A HG22 7  
ATOM 5659  H HG23 . THR A 1 27 ? -9.221  6.831   -0.512  1.00 0.00 ? 27 THR A HG23 7  
ATOM 5660  N N    . PRO A 1 28 ? -6.226  5.622   3.298   1.00 0.00 ? 28 PRO A N    7  
ATOM 5661  C CA   . PRO A 1 28 ? -5.541  5.038   4.439   1.00 0.00 ? 28 PRO A CA   7  
ATOM 5662  C C    . PRO A 1 28 ? -6.398  3.955   5.097   1.00 0.00 ? 28 PRO A C    7  
ATOM 5663  O O    . PRO A 1 28 ? -6.435  3.847   6.322   1.00 0.00 ? 28 PRO A O    7  
ATOM 5664  C CB   . PRO A 1 28 ? -5.247  6.208   5.363   1.00 0.00 ? 28 PRO A CB   7  
ATOM 5665  C CG   . PRO A 1 28 ? -6.182  7.326   4.931   1.00 0.00 ? 28 PRO A CG   7  
ATOM 5666  C CD   . PRO A 1 28 ? -6.754  6.956   3.572   1.00 0.00 ? 28 PRO A CD   7  
ATOM 5667  H HA   . PRO A 1 28 ? -4.702  4.580   4.143   1.00 0.00 ? 28 PRO A HA   7  
ATOM 5668  H HB2  . PRO A 1 28 ? -5.420  5.935   6.405   1.00 0.00 ? 28 PRO A HB2  7  
ATOM 5669  H HB3  . PRO A 1 28 ? -4.205  6.517   5.283   1.00 0.00 ? 28 PRO A HB3  7  
ATOM 5670  H HG2  . PRO A 1 28 ? -6.983  7.457   5.659   1.00 0.00 ? 28 PRO A HG2  7  
ATOM 5671  H HG3  . PRO A 1 28 ? -5.645  8.272   4.874   1.00 0.00 ? 28 PRO A HG3  7  
ATOM 5672  H HD2  . PRO A 1 28 ? -7.844  6.954   3.588   1.00 0.00 ? 28 PRO A HD2  7  
ATOM 5673  H HD3  . PRO A 1 28 ? -6.447  7.668   2.806   1.00 0.00 ? 28 PRO A HD3  7  
ATOM 5674  N N    . LYS A 1 29 ? -7.067  3.181   4.255   1.00 0.00 ? 29 LYS A N    7  
ATOM 5675  C CA   . LYS A 1 29 ? -7.922  2.111   4.740   1.00 0.00 ? 29 LYS A CA   7  
ATOM 5676  C C    . LYS A 1 29 ? -8.509  1.353   3.548   1.00 0.00 ? 29 LYS A C    7  
ATOM 5677  O O    . LYS A 1 29 ? -8.534  0.123   3.542   1.00 0.00 ? 29 LYS A O    7  
ATOM 5678  C CB   . LYS A 1 29 ? -8.979  2.663   5.699   1.00 0.00 ? 29 LYS A CB   7  
ATOM 5679  C CG   . LYS A 1 29 ? -9.424  1.593   6.699   1.00 0.00 ? 29 LYS A CG   7  
ATOM 5680  C CD   . LYS A 1 29 ? -10.941 1.396   6.651   1.00 0.00 ? 29 LYS A CD   7  
ATOM 5681  C CE   . LYS A 1 29 ? -11.534 1.364   8.061   1.00 0.00 ? 29 LYS A CE   7  
ATOM 5682  N NZ   . LYS A 1 29 ? -12.996 1.595   8.013   1.00 0.00 ? 29 LYS A NZ   7  
ATOM 5683  H H    . LYS A 1 29 ? -7.032  3.276   3.260   1.00 0.00 ? 29 LYS A H    7  
ATOM 5684  H HA   . LYS A 1 29 ? -7.296  1.426   5.311   1.00 0.00 ? 29 LYS A HA   7  
ATOM 5685  H HB2  . LYS A 1 29 ? -8.576  3.522   6.236   1.00 0.00 ? 29 LYS A HB2  7  
ATOM 5686  H HB3  . LYS A 1 29 ? -9.840  3.017   5.132   1.00 0.00 ? 29 LYS A HB3  7  
ATOM 5687  H HG2  . LYS A 1 29 ? -8.924  0.651   6.475   1.00 0.00 ? 29 LYS A HG2  7  
ATOM 5688  H HG3  . LYS A 1 29 ? -9.123  1.883   7.705   1.00 0.00 ? 29 LYS A HG3  7  
ATOM 5689  H HD2  . LYS A 1 29 ? -11.398 2.202   6.078   1.00 0.00 ? 29 LYS A HD2  7  
ATOM 5690  H HD3  . LYS A 1 29 ? -11.174 0.465   6.133   1.00 0.00 ? 29 LYS A HD3  7  
ATOM 5691  H HE2  . LYS A 1 29 ? -11.327 0.401   8.527   1.00 0.00 ? 29 LYS A HE2  7  
ATOM 5692  H HE3  . LYS A 1 29 ? -11.060 2.126   8.679   1.00 0.00 ? 29 LYS A HE3  7  
ATOM 5693  H HZ1  . LYS A 1 29 ? -13.360 1.250   7.148   1.00 0.00 ? 29 LYS A HZ1  7  
ATOM 5694  H HZ2  . LYS A 1 29 ? -13.434 1.115   8.774   1.00 0.00 ? 29 LYS A HZ2  7  
ATOM 5695  H HZ3  . LYS A 1 29 ? -13.181 2.575   8.086   1.00 0.00 ? 29 LYS A HZ3  7  
ATOM 5696  N N    . GLU A 1 30 ? -8.967  2.119   2.568   1.00 0.00 ? 30 GLU A N    7  
ATOM 5697  C CA   . GLU A 1 30 ? -9.552  1.534   1.374   1.00 0.00 ? 30 GLU A CA   7  
ATOM 5698  C C    . GLU A 1 30 ? -8.462  0.912   0.498   1.00 0.00 ? 30 GLU A C    7  
ATOM 5699  O O    . GLU A 1 30 ? -8.652  -0.166  -0.063  1.00 0.00 ? 30 GLU A O    7  
ATOM 5700  C CB   . GLU A 1 30 ? -10.356 2.575   0.591   1.00 0.00 ? 30 GLU A CB   7  
ATOM 5701  C CG   . GLU A 1 30 ? -10.932 1.972   -0.691  1.00 0.00 ? 30 GLU A CG   7  
ATOM 5702  C CD   . GLU A 1 30 ? -12.424 2.285   -0.822  1.00 0.00 ? 30 GLU A CD   7  
ATOM 5703  O OE1  . GLU A 1 30 ? -12.740 3.481   -1.004  1.00 0.00 ? 30 GLU A OE1  7  
ATOM 5704  O OE2  . GLU A 1 30 ? -13.216 1.322   -0.737  1.00 0.00 ? 30 GLU A OE2  7  
ATOM 5705  H H    . GLU A 1 30 ? -8.943  3.118   2.582   1.00 0.00 ? 30 GLU A H    7  
ATOM 5706  H HA   . GLU A 1 30 ? -10.228 0.757   1.732   1.00 0.00 ? 30 GLU A HA   7  
ATOM 5707  H HB2  . GLU A 1 30 ? -11.165 2.958   1.213   1.00 0.00 ? 30 GLU A HB2  7  
ATOM 5708  H HB3  . GLU A 1 30 ? -9.716  3.423   0.344   1.00 0.00 ? 30 GLU A HB3  7  
ATOM 5709  H HG2  . GLU A 1 30 ? -10.397 2.367   -1.555  1.00 0.00 ? 30 GLU A HG2  7  
ATOM 5710  H HG3  . GLU A 1 30 ? -10.782 0.893   -0.689  1.00 0.00 ? 30 GLU A HG3  7  
ATOM 5711  N N    . CYS A 1 31 ? -7.345  1.618   0.410   1.00 0.00 ? 31 CYS A N    7  
ATOM 5712  C CA   . CYS A 1 31 ? -6.224  1.149   -0.388  1.00 0.00 ? 31 CYS A CA   7  
ATOM 5713  C C    . CYS A 1 31 ? -5.600  -0.054  0.323   1.00 0.00 ? 31 CYS A C    7  
ATOM 5714  O O    . CYS A 1 31 ? -5.058  -0.949  -0.324  1.00 0.00 ? 31 CYS A O    7  
ATOM 5715  C CB   . CYS A 1 31 ? -5.202  2.259   -0.636  1.00 0.00 ? 31 CYS A CB   7  
ATOM 5716  S SG   . CYS A 1 31 ? -3.493  1.677   -0.935  1.00 0.00 ? 31 CYS A SG   7  
ATOM 5717  H H    . CYS A 1 31 ? -7.198  2.494   0.869   1.00 0.00 ? 31 CYS A H    7  
ATOM 5718  H HA   . CYS A 1 31 ? -6.630  0.858   -1.357  1.00 0.00 ? 31 CYS A HA   7  
ATOM 5719  H HB2  . CYS A 1 31 ? -5.526  2.847   -1.495  1.00 0.00 ? 31 CYS A HB2  7  
ATOM 5720  H HB3  . CYS A 1 31 ? -5.197  2.928   0.225   1.00 0.00 ? 31 CYS A HB3  7  
ATOM 5721  N N    . ASN A 1 32 ? -5.696  -0.036  1.644   1.00 0.00 ? 32 ASN A N    7  
ATOM 5722  C CA   . ASN A 1 32 ? -5.147  -1.113  2.449   1.00 0.00 ? 32 ASN A CA   7  
ATOM 5723  C C    . ASN A 1 32 ? -6.235  -2.158  2.706   1.00 0.00 ? 32 ASN A C    7  
ATOM 5724  O O    . ASN A 1 32 ? -6.001  -3.145  3.401   1.00 0.00 ? 32 ASN A O    7  
ATOM 5725  C CB   . ASN A 1 32 ? -4.660  -0.596  3.804   1.00 0.00 ? 32 ASN A CB   7  
ATOM 5726  C CG   . ASN A 1 32 ? -5.616  -1.008  4.925   1.00 0.00 ? 32 ASN A CG   7  
ATOM 5727  O OD1  . ASN A 1 32 ? -6.787  -0.667  4.934   1.00 0.00 ? 32 ASN A OD1  7  
ATOM 5728  N ND2  . ASN A 1 32 ? -5.053  -1.761  5.866   1.00 0.00 ? 32 ASN A ND2  7  
ATOM 5729  H H    . ASN A 1 32 ? -6.138  0.696   2.163   1.00 0.00 ? 32 ASN A H    7  
ATOM 5730  H HA   . ASN A 1 32 ? -4.316  -1.511  1.867   1.00 0.00 ? 32 ASN A HA   7  
ATOM 5731  H HB2  . ASN A 1 32 ? -3.663  -0.986  4.009   1.00 0.00 ? 32 ASN A HB2  7  
ATOM 5732  H HB3  . ASN A 1 32 ? -4.576  0.491   3.774   1.00 0.00 ? 32 ASN A HB3  7  
ATOM 5733  H HD21 . ASN A 1 32 ? -4.086  -2.006  5.799   1.00 0.00 ? 32 ASN A HD21 7  
ATOM 5734  H HD22 . ASN A 1 32 ? -5.597  -2.081  6.642   1.00 0.00 ? 32 ASN A HD22 7  
ATOM 5735  N N    . ASN A 1 33 ? -7.401  -1.904  2.131   1.00 0.00 ? 33 ASN A N    7  
ATOM 5736  C CA   . ASN A 1 33 ? -8.527  -2.810  2.288   1.00 0.00 ? 33 ASN A CA   7  
ATOM 5737  C C    . ASN A 1 33 ? -8.683  -3.647  1.018   1.00 0.00 ? 33 ASN A C    7  
ATOM 5738  O O    . ASN A 1 33 ? -8.964  -4.843  1.089   1.00 0.00 ? 33 ASN A O    7  
ATOM 5739  C CB   . ASN A 1 33 ? -9.829  -2.038  2.510   1.00 0.00 ? 33 ASN A CB   7  
ATOM 5740  C CG   . ASN A 1 33 ? -11.042 -2.961  2.384   1.00 0.00 ? 33 ASN A CG   7  
ATOM 5741  O OD1  . ASN A 1 33 ? -11.618 -3.131  1.322   1.00 0.00 ? 33 ASN A OD1  7  
ATOM 5742  N ND2  . ASN A 1 33 ? -11.397 -3.547  3.524   1.00 0.00 ? 33 ASN A ND2  7  
ATOM 5743  H H    . ASN A 1 33 ? -7.583  -1.098  1.567   1.00 0.00 ? 33 ASN A H    7  
ATOM 5744  H HA   . ASN A 1 33 ? -8.285  -3.417  3.161   1.00 0.00 ? 33 ASN A HA   7  
ATOM 5745  H HB2  . ASN A 1 33 ? -9.819  -1.576  3.497   1.00 0.00 ? 33 ASN A HB2  7  
ATOM 5746  H HB3  . ASN A 1 33 ? -9.905  -1.230  1.781   1.00 0.00 ? 33 ASN A HB3  7  
ATOM 5747  H HD21 . ASN A 1 33 ? -10.881 -3.364  4.361   1.00 0.00 ? 33 ASN A HD21 7  
ATOM 5748  H HD22 . ASN A 1 33 ? -12.179 -4.169  3.544   1.00 0.00 ? 33 ASN A HD22 7  
ATOM 5749  N N    . ARG A 1 34 ? -8.496  -2.987  -0.115  1.00 0.00 ? 34 ARG A N    7  
ATOM 5750  C CA   . ARG A 1 34 ? -8.613  -3.655  -1.400  1.00 0.00 ? 34 ARG A CA   7  
ATOM 5751  C C    . ARG A 1 34 ? -7.606  -4.804  -1.494  1.00 0.00 ? 34 ARG A C    7  
ATOM 5752  O O    . ARG A 1 34 ? -7.844  -5.786  -2.195  1.00 0.00 ? 34 ARG A O    7  
ATOM 5753  C CB   . ARG A 1 34 ? -8.372  -2.679  -2.553  1.00 0.00 ? 34 ARG A CB   7  
ATOM 5754  C CG   . ARG A 1 34 ? -9.281  -2.999  -3.741  1.00 0.00 ? 34 ARG A CG   7  
ATOM 5755  C CD   . ARG A 1 34 ? -8.922  -4.353  -4.357  1.00 0.00 ? 34 ARG A CD   7  
ATOM 5756  N NE   . ARG A 1 34 ? -9.303  -4.375  -5.787  1.00 0.00 ? 34 ARG A NE   7  
ATOM 5757  C CZ   . ARG A 1 34 ? -9.140  -5.435  -6.591  1.00 0.00 ? 34 ARG A CZ   7  
ATOM 5758  N NH1  . ARG A 1 34 ? -8.603  -6.564  -6.111  1.00 0.00 ? 34 ARG A NH1  7  
ATOM 5759  N NH2  . ARG A 1 34 ? -9.514  -5.365  -7.876  1.00 0.00 ? 34 ARG A NH2  7  
ATOM 5760  H H    . ARG A 1 34 ? -8.268  -2.014  -0.164  1.00 0.00 ? 34 ARG A H    7  
ATOM 5761  H HA   . ARG A 1 34 ? -9.637  -4.028  -1.428  1.00 0.00 ? 34 ARG A HA   7  
ATOM 5762  H HB2  . ARG A 1 34 ? -8.555  -1.659  -2.215  1.00 0.00 ? 34 ARG A HB2  7  
ATOM 5763  H HB3  . ARG A 1 34 ? -7.329  -2.729  -2.865  1.00 0.00 ? 34 ARG A HB3  7  
ATOM 5764  H HG2  . ARG A 1 34 ? -10.321 -3.008  -3.416  1.00 0.00 ? 34 ARG A HG2  7  
ATOM 5765  H HG3  . ARG A 1 34 ? -9.189  -2.217  -4.495  1.00 0.00 ? 34 ARG A HG3  7  
ATOM 5766  H HD2  . ARG A 1 34 ? -7.852  -4.536  -4.254  1.00 0.00 ? 34 ARG A HD2  7  
ATOM 5767  H HD3  . ARG A 1 34 ? -9.436  -5.152  -3.823  1.00 0.00 ? 34 ARG A HD3  7  
ATOM 5768  H HE   . ARG A 1 34 ? -9.706  -3.548  -6.178  1.00 0.00 ? 34 ARG A HE   7  
ATOM 5769  H HH11 . ARG A 1 34 ? -8.323  -6.617  -5.152  1.00 0.00 ? 34 ARG A HH11 7  
ATOM 5770  H HH12 . ARG A 1 34 ? -8.481  -7.355  -6.711  1.00 0.00 ? 34 ARG A HH12 7  
ATOM 5771  H HH21 . ARG A 1 34 ? -9.915  -4.522  -8.235  1.00 0.00 ? 34 ARG A HH21 7  
ATOM 5772  H HH22 . ARG A 1 34 ? -9.393  -6.155  -8.476  1.00 0.00 ? 34 ARG A HH22 7  
ATOM 5773  N N    . GLY A 1 35 ? -6.503  -4.641  -0.779  1.00 0.00 ? 35 GLY A N    7  
ATOM 5774  C CA   . GLY A 1 35 ? -5.459  -5.652  -0.774  1.00 0.00 ? 35 GLY A CA   7  
ATOM 5775  C C    . GLY A 1 35 ? -4.118  -5.058  -1.209  1.00 0.00 ? 35 GLY A C    7  
ATOM 5776  O O    . GLY A 1 35 ? -3.672  -5.281  -2.334  1.00 0.00 ? 35 GLY A O    7  
ATOM 5777  H H    . GLY A 1 35 ? -6.317  -3.839  -0.212  1.00 0.00 ? 35 GLY A H    7  
ATOM 5778  H HA2  . GLY A 1 35 ? -5.365  -6.078  0.225   1.00 0.00 ? 35 GLY A HA2  7  
ATOM 5779  H HA3  . GLY A 1 35 ? -5.734  -6.468  -1.443  1.00 0.00 ? 35 GLY A HA3  7  
ATOM 5780  N N    . CYS A 1 36 ? -3.512  -4.314  -0.295  1.00 0.00 ? 36 CYS A N    7  
ATOM 5781  C CA   . CYS A 1 36 ? -2.231  -3.687  -0.571  1.00 0.00 ? 36 CYS A CA   7  
ATOM 5782  C C    . CYS A 1 36 ? -1.916  -2.717  0.570   1.00 0.00 ? 36 CYS A C    7  
ATOM 5783  O O    . CYS A 1 36 ? -2.463  -2.842  1.664   1.00 0.00 ? 36 CYS A O    7  
ATOM 5784  C CB   . CYS A 1 36 ? -2.224  -2.988  -1.932  1.00 0.00 ? 36 CYS A CB   7  
ATOM 5785  S SG   . CYS A 1 36 ? -0.906  -3.543  -3.073  1.00 0.00 ? 36 CYS A SG   7  
ATOM 5786  H H    . CYS A 1 36 ? -3.881  -4.138  0.617   1.00 0.00 ? 36 CYS A H    7  
ATOM 5787  H HA   . CYS A 1 36 ? -1.493  -4.487  -0.613  1.00 0.00 ? 36 CYS A HA   7  
ATOM 5788  H HB2  . CYS A 1 36 ? -3.190  -3.147  -2.411  1.00 0.00 ? 36 CYS A HB2  7  
ATOM 5789  H HB3  . CYS A 1 36 ? -2.120  -1.915  -1.773  1.00 0.00 ? 36 CYS A HB3  7  
ATOM 5790  N N    . CYS A 1 37 ? -1.035  -1.772  0.274   1.00 0.00 ? 37 CYS A N    7  
ATOM 5791  C CA   . CYS A 1 37 ? -0.641  -0.782  1.262   1.00 0.00 ? 37 CYS A CA   7  
ATOM 5792  C C    . CYS A 1 37 ? -0.967  0.606   0.706   1.00 0.00 ? 37 CYS A C    7  
ATOM 5793  O O    . CYS A 1 37 ? -0.960  0.811   -0.507  1.00 0.00 ? 37 CYS A O    7  
ATOM 5794  C CB   . CYS A 1 37 ? 0.837   -0.914  1.637   1.00 0.00 ? 37 CYS A CB   7  
ATOM 5795  S SG   . CYS A 1 37 ? 1.184   -2.106  2.981   1.00 0.00 ? 37 CYS A SG   7  
ATOM 5796  H H    . CYS A 1 37 ? -0.595  -1.677  -0.618  1.00 0.00 ? 37 CYS A H    7  
ATOM 5797  H HA   . CYS A 1 37 ? -1.223  -0.986  2.160   1.00 0.00 ? 37 CYS A HA   7  
ATOM 5798  H HB2  . CYS A 1 37 ? 1.397   -1.214  0.751   1.00 0.00 ? 37 CYS A HB2  7  
ATOM 5799  H HB3  . CYS A 1 37 ? 1.211   0.066   1.934   1.00 0.00 ? 37 CYS A HB3  7  
ATOM 5800  N N    . PHE A 1 38 ? -1.244  1.524   1.621   1.00 0.00 ? 38 PHE A N    7  
ATOM 5801  C CA   . PHE A 1 38 ? -1.571  2.887   1.238   1.00 0.00 ? 38 PHE A CA   7  
ATOM 5802  C C    . PHE A 1 38 ? -0.520  3.870   1.757   1.00 0.00 ? 38 PHE A C    7  
ATOM 5803  O O    . PHE A 1 38 ? 0.373   3.489   2.512   1.00 0.00 ? 38 PHE A O    7  
ATOM 5804  C CB   . PHE A 1 38 ? -2.922  3.219   1.875   1.00 0.00 ? 38 PHE A CB   7  
ATOM 5805  C CG   . PHE A 1 38 ? -3.339  4.683   1.724   1.00 0.00 ? 38 PHE A CG   7  
ATOM 5806  C CD1  . PHE A 1 38 ? -3.923  5.108   0.571   1.00 0.00 ? 38 PHE A CD1  7  
ATOM 5807  C CD2  . PHE A 1 38 ? -3.125  5.560   2.741   1.00 0.00 ? 38 PHE A CD2  7  
ATOM 5808  C CE1  . PHE A 1 38 ? -4.311  6.466   0.431   1.00 0.00 ? 38 PHE A CE1  7  
ATOM 5809  C CE2  . PHE A 1 38 ? -3.513  6.918   2.600   1.00 0.00 ? 38 PHE A CE2  7  
ATOM 5810  C CZ   . PHE A 1 38 ? -4.097  7.343   1.448   1.00 0.00 ? 38 PHE A CZ   7  
ATOM 5811  H H    . PHE A 1 38 ? -1.246  1.350   2.605   1.00 0.00 ? 38 PHE A H    7  
ATOM 5812  H HA   . PHE A 1 38 ? -1.591  2.921   0.148   1.00 0.00 ? 38 PHE A HA   7  
ATOM 5813  H HB2  . PHE A 1 38 ? -3.688  2.585   1.429   1.00 0.00 ? 38 PHE A HB2  7  
ATOM 5814  H HB3  . PHE A 1 38 ? -2.882  2.971   2.936   1.00 0.00 ? 38 PHE A HB3  7  
ATOM 5815  H HD1  . PHE A 1 38 ? -4.095  4.405   -0.244  1.00 0.00 ? 38 PHE A HD1  7  
ATOM 5816  H HD2  . PHE A 1 38 ? -2.657  5.219   3.664   1.00 0.00 ? 38 PHE A HD2  7  
ATOM 5817  H HE1  . PHE A 1 38 ? -4.779  6.807   -0.493  1.00 0.00 ? 38 PHE A HE1  7  
ATOM 5818  H HE2  . PHE A 1 38 ? -3.341  7.621   3.416   1.00 0.00 ? 38 PHE A HE2  7  
ATOM 5819  H HZ   . PHE A 1 38 ? -4.394  8.386   1.340   1.00 0.00 ? 38 PHE A HZ   7  
ATOM 5820  N N    . ASP A 1 39 ? -0.662  5.117   1.333   1.00 0.00 ? 39 ASP A N    7  
ATOM 5821  C CA   . ASP A 1 39 ? 0.264   6.158   1.746   1.00 0.00 ? 39 ASP A CA   7  
ATOM 5822  C C    . ASP A 1 39 ? -0.135  7.480   1.086   1.00 0.00 ? 39 ASP A C    7  
ATOM 5823  O O    . ASP A 1 39 ? -0.592  7.496   -0.056  1.00 0.00 ? 39 ASP A O    7  
ATOM 5824  C CB   . ASP A 1 39 ? 1.693   5.827   1.314   1.00 0.00 ? 39 ASP A CB   7  
ATOM 5825  C CG   . ASP A 1 39 ? 2.741   6.879   1.683   1.00 0.00 ? 39 ASP A CG   7  
ATOM 5826  O OD1  . ASP A 1 39 ? 3.131   6.900   2.870   1.00 0.00 ? 39 ASP A OD1  7  
ATOM 5827  O OD2  . ASP A 1 39 ? 3.128   7.640   0.769   1.00 0.00 ? 39 ASP A OD2  7  
ATOM 5828  H H    . ASP A 1 39 ? -1.392  5.420   0.719   1.00 0.00 ? 39 ASP A H    7  
ATOM 5829  H HA   . ASP A 1 39 ? 0.187   6.195   2.832   1.00 0.00 ? 39 ASP A HA   7  
ATOM 5830  H HB2  . ASP A 1 39 ? 1.981   4.876   1.763   1.00 0.00 ? 39 ASP A HB2  7  
ATOM 5831  H HB3  . ASP A 1 39 ? 1.707   5.686   0.233   1.00 0.00 ? 39 ASP A HB3  7  
ATOM 5832  N N    . SER A 1 40 ? 0.053   8.558   1.834   1.00 0.00 ? 40 SER A N    7  
ATOM 5833  C CA   . SER A 1 40 ? -0.281  9.882   1.336   1.00 0.00 ? 40 SER A CA   7  
ATOM 5834  C C    . SER A 1 40 ? 0.860   10.856  1.633   1.00 0.00 ? 40 SER A C    7  
ATOM 5835  O O    . SER A 1 40 ? 0.677   12.071  1.567   1.00 0.00 ? 40 SER A O    7  
ATOM 5836  C CB   . SER A 1 40 ? -1.587  10.389  1.953   1.00 0.00 ? 40 SER A CB   7  
ATOM 5837  O OG   . SER A 1 40 ? -1.448  10.663  3.344   1.00 0.00 ? 40 SER A OG   7  
ATOM 5838  H H    . SER A 1 40 ? 0.425   8.537   2.762   1.00 0.00 ? 40 SER A H    7  
ATOM 5839  H HA   . SER A 1 40 ? -0.411  9.761   0.261   1.00 0.00 ? 40 SER A HA   7  
ATOM 5840  H HB2  . SER A 1 40 ? -1.905  11.294  1.435   1.00 0.00 ? 40 SER A HB2  7  
ATOM 5841  H HB3  . SER A 1 40 ? -2.370  9.645   1.806   1.00 0.00 ? 40 SER A HB3  7  
ATOM 5842  H HG   . SER A 1 40 ? -0.484  10.627  3.606   1.00 0.00 ? 40 SER A HG   7  
ATOM 5843  N N    . ARG A 1 41 ? 2.013   10.287  1.955   1.00 0.00 ? 41 ARG A N    7  
ATOM 5844  C CA   . ARG A 1 41 ? 3.184   11.090  2.263   1.00 0.00 ? 41 ARG A CA   7  
ATOM 5845  C C    . ARG A 1 41 ? 3.510   12.022  1.094   1.00 0.00 ? 41 ARG A C    7  
ATOM 5846  O O    . ARG A 1 41 ? 3.689   13.224  1.285   1.00 0.00 ? 41 ARG A O    7  
ATOM 5847  C CB   . ARG A 1 41 ? 4.397   10.206  2.556   1.00 0.00 ? 41 ARG A CB   7  
ATOM 5848  C CG   . ARG A 1 41 ? 5.263   10.811  3.663   1.00 0.00 ? 41 ARG A CG   7  
ATOM 5849  C CD   . ARG A 1 41 ? 6.553   11.400  3.089   1.00 0.00 ? 41 ARG A CD   7  
ATOM 5850  N NE   . ARG A 1 41 ? 6.414   12.864  2.929   1.00 0.00 ? 41 ARG A NE   7  
ATOM 5851  C CZ   . ARG A 1 41 ? 7.271   13.629  2.239   1.00 0.00 ? 41 ARG A CZ   7  
ATOM 5852  N NH1  . ARG A 1 41 ? 8.334   13.074  1.642   1.00 0.00 ? 41 ARG A NH1  7  
ATOM 5853  N NH2  . ARG A 1 41 ? 7.065   14.950  2.147   1.00 0.00 ? 41 ARG A NH2  7  
ATOM 5854  H H    . ARG A 1 41 ? 2.153   9.298   2.007   1.00 0.00 ? 41 ARG A H    7  
ATOM 5855  H HA   . ARG A 1 41 ? 2.906   11.658  3.151   1.00 0.00 ? 41 ARG A HA   7  
ATOM 5856  H HB2  . ARG A 1 41 ? 4.063   9.211   2.853   1.00 0.00 ? 41 ARG A HB2  7  
ATOM 5857  H HB3  . ARG A 1 41 ? 4.991   10.085  1.650   1.00 0.00 ? 41 ARG A HB3  7  
ATOM 5858  H HG2  . ARG A 1 41 ? 4.703   11.589  4.182   1.00 0.00 ? 41 ARG A HG2  7  
ATOM 5859  H HG3  . ARG A 1 41 ? 5.504   10.045  4.400   1.00 0.00 ? 41 ARG A HG3  7  
ATOM 5860  H HD2  . ARG A 1 41 ? 7.390   11.176  3.751   1.00 0.00 ? 41 ARG A HD2  7  
ATOM 5861  H HD3  . ARG A 1 41 ? 6.776   10.940  2.126   1.00 0.00 ? 41 ARG A HD3  7  
ATOM 5862  H HE   . ARG A 1 41 ? 5.631   13.311  3.362   1.00 0.00 ? 41 ARG A HE   7  
ATOM 5863  H HH11 . ARG A 1 41 ? 8.487   12.088  1.711   1.00 0.00 ? 41 ARG A HH11 7  
ATOM 5864  H HH12 . ARG A 1 41 ? 8.973   13.645  1.127   1.00 0.00 ? 41 ARG A HH12 7  
ATOM 5865  H HH21 . ARG A 1 41 ? 6.271   15.365  2.592   1.00 0.00 ? 41 ARG A HH21 7  
ATOM 5866  H HH22 . ARG A 1 41 ? 7.704   15.521  1.632   1.00 0.00 ? 41 ARG A HH22 7  
ATOM 5867  N N    . ILE A 1 42 ? 3.578   11.432  -0.090  1.00 0.00 ? 42 ILE A N    7  
ATOM 5868  C CA   . ILE A 1 42 ? 3.881   12.194  -1.290  1.00 0.00 ? 42 ILE A CA   7  
ATOM 5869  C C    . ILE A 1 42 ? 3.092   11.617  -2.467  1.00 0.00 ? 42 ILE A C    7  
ATOM 5870  O O    . ILE A 1 42 ? 3.018   10.401  -2.634  1.00 0.00 ? 42 ILE A O    7  
ATOM 5871  C CB   . ILE A 1 42 ? 5.391   12.243  -1.527  1.00 0.00 ? 42 ILE A CB   7  
ATOM 5872  C CG1  . ILE A 1 42 ? 6.092   11.067  -0.844  1.00 0.00 ? 42 ILE A CG1  7  
ATOM 5873  C CG2  . ILE A 1 42 ? 5.972   13.589  -1.090  1.00 0.00 ? 42 ILE A CG2  7  
ATOM 5874  C CD1  . ILE A 1 42 ? 5.586   9.732   -1.393  1.00 0.00 ? 42 ILE A CD1  7  
ATOM 5875  H H    . ILE A 1 42 ? 3.432   10.453  -0.237  1.00 0.00 ? 42 ILE A H    7  
ATOM 5876  H HA   . ILE A 1 42 ? 3.548   13.217  -1.119  1.00 0.00 ? 42 ILE A HA   7  
ATOM 5877  H HB   . ILE A 1 42 ? 5.572   12.147  -2.598  1.00 0.00 ? 42 ILE A HB   7  
ATOM 5878  H HG12 . ILE A 1 42 ? 7.169   11.142  -0.997  1.00 0.00 ? 42 ILE A HG12 7  
ATOM 5879  H HG13 . ILE A 1 42 ? 5.919   11.111  0.231   1.00 0.00 ? 42 ILE A HG13 7  
ATOM 5880  H HG21 . ILE A 1 42 ? 5.364   14.397  -1.498  1.00 0.00 ? 42 ILE A HG21 7  
ATOM 5881  H HG22 . ILE A 1 42 ? 5.971   13.648  -0.001  1.00 0.00 ? 42 ILE A HG22 7  
ATOM 5882  H HG23 . ILE A 1 42 ? 6.993   13.681  -1.458  1.00 0.00 ? 42 ILE A HG23 7  
ATOM 5883  H HD11 . ILE A 1 42 ? 5.080   9.899   -2.344  1.00 0.00 ? 42 ILE A HD11 7  
ATOM 5884  H HD12 . ILE A 1 42 ? 6.429   9.057   -1.544  1.00 0.00 ? 42 ILE A HD12 7  
ATOM 5885  H HD13 . ILE A 1 42 ? 4.887   9.288   -0.684  1.00 0.00 ? 42 ILE A HD13 7  
ATOM 5886  N N    . PRO A 1 43 ? 2.506   12.542  -3.274  1.00 0.00 ? 43 PRO A N    7  
ATOM 5887  C CA   . PRO A 1 43 ? 1.725   12.138  -4.431  1.00 0.00 ? 43 PRO A CA   7  
ATOM 5888  C C    . PRO A 1 43 ? 2.633   11.669  -5.570  1.00 0.00 ? 43 PRO A C    7  
ATOM 5889  O O    . PRO A 1 43 ? 2.314   10.709  -6.269  1.00 0.00 ? 43 PRO A O    7  
ATOM 5890  C CB   . PRO A 1 43 ? 0.900   13.362  -4.795  1.00 0.00 ? 43 PRO A CB   7  
ATOM 5891  C CG   . PRO A 1 43 ? 1.586   14.542  -4.125  1.00 0.00 ? 43 PRO A CG   7  
ATOM 5892  C CD   . PRO A 1 43 ? 2.571   13.991  -3.108  1.00 0.00 ? 43 PRO A CD   7  
ATOM 5893  H HA   . PRO A 1 43 ? 1.146   11.355  -4.203  1.00 0.00 ? 43 PRO A HA   7  
ATOM 5894  H HB2  . PRO A 1 43 ? 0.858   13.497  -5.876  1.00 0.00 ? 43 PRO A HB2  7  
ATOM 5895  H HB3  . PRO A 1 43 ? -0.128  13.258  -4.447  1.00 0.00 ? 43 PRO A HB3  7  
ATOM 5896  H HG2  . PRO A 1 43 ? 2.102   15.154  -4.865  1.00 0.00 ? 43 PRO A HG2  7  
ATOM 5897  H HG3  . PRO A 1 43 ? 0.852   15.183  -3.638  1.00 0.00 ? 43 PRO A HG3  7  
ATOM 5898  H HD2  . PRO A 1 43 ? 3.579   14.365  -3.290  1.00 0.00 ? 43 PRO A HD2  7  
ATOM 5899  H HD3  . PRO A 1 43 ? 2.300   14.286  -2.094  1.00 0.00 ? 43 PRO A HD3  7  
ATOM 5900  N N    . GLY A 1 44 ? 3.749   12.369  -5.721  1.00 0.00 ? 44 GLY A N    7  
ATOM 5901  C CA   . GLY A 1 44 ? 4.706   12.036  -6.762  1.00 0.00 ? 44 GLY A CA   7  
ATOM 5902  C C    . GLY A 1 44 ? 4.875   10.521  -6.888  1.00 0.00 ? 44 GLY A C    7  
ATOM 5903  O O    . GLY A 1 44 ? 5.124   10.009  -7.978  1.00 0.00 ? 44 GLY A O    7  
ATOM 5904  H H    . GLY A 1 44 ? 4.001   13.149  -5.148  1.00 0.00 ? 44 GLY A H    7  
ATOM 5905  H HA2  . GLY A 1 44 ? 4.371   12.449  -7.714  1.00 0.00 ? 44 GLY A HA2  7  
ATOM 5906  H HA3  . GLY A 1 44 ? 5.668   12.496  -6.537  1.00 0.00 ? 44 GLY A HA3  7  
ATOM 5907  N N    . VAL A 1 45 ? 4.732   9.846   -5.756  1.00 0.00 ? 45 VAL A N    7  
ATOM 5908  C CA   . VAL A 1 45 ? 4.866   8.400   -5.726  1.00 0.00 ? 45 VAL A CA   7  
ATOM 5909  C C    . VAL A 1 45 ? 3.475   7.764   -5.688  1.00 0.00 ? 45 VAL A C    7  
ATOM 5910  O O    . VAL A 1 45 ? 2.475   8.458   -5.510  1.00 0.00 ? 45 VAL A O    7  
ATOM 5911  C CB   . VAL A 1 45 ? 5.747   7.980   -4.548  1.00 0.00 ? 45 VAL A CB   7  
ATOM 5912  C CG1  . VAL A 1 45 ? 6.740   9.086   -4.185  1.00 0.00 ? 45 VAL A CG1  7  
ATOM 5913  C CG2  . VAL A 1 45 ? 4.895   7.590   -3.338  1.00 0.00 ? 45 VAL A CG2  7  
ATOM 5914  H H    . VAL A 1 45 ? 4.529   10.270  -4.874  1.00 0.00 ? 45 VAL A H    7  
ATOM 5915  H HA   . VAL A 1 45 ? 5.366   8.096   -6.646  1.00 0.00 ? 45 VAL A HA   7  
ATOM 5916  H HB   . VAL A 1 45 ? 6.318   7.103   -4.852  1.00 0.00 ? 45 VAL A HB   7  
ATOM 5917  H HG11 . VAL A 1 45 ? 6.197   10.004  -3.961  1.00 0.00 ? 45 VAL A HG11 7  
ATOM 5918  H HG12 . VAL A 1 45 ? 7.317   8.783   -3.311  1.00 0.00 ? 45 VAL A HG12 7  
ATOM 5919  H HG13 . VAL A 1 45 ? 7.415   9.258   -5.024  1.00 0.00 ? 45 VAL A HG13 7  
ATOM 5920  H HG21 . VAL A 1 45 ? 4.132   8.349   -3.170  1.00 0.00 ? 45 VAL A HG21 7  
ATOM 5921  H HG22 . VAL A 1 45 ? 4.416   6.629   -3.526  1.00 0.00 ? 45 VAL A HG22 7  
ATOM 5922  H HG23 . VAL A 1 45 ? 5.531   7.512   -2.456  1.00 0.00 ? 45 VAL A HG23 7  
ATOM 5923  N N    . PRO A 1 46 ? 3.454   6.415   -5.863  1.00 0.00 ? 46 PRO A N    7  
ATOM 5924  C CA   . PRO A 1 46 ? 2.202   5.678   -5.851  1.00 0.00 ? 46 PRO A CA   7  
ATOM 5925  C C    . PRO A 1 46 ? 1.663   5.536   -4.426  1.00 0.00 ? 46 PRO A C    7  
ATOM 5926  O O    . PRO A 1 46 ? 2.002   4.586   -3.722  1.00 0.00 ? 46 PRO A O    7  
ATOM 5927  C CB   . PRO A 1 46 ? 2.526   4.342   -6.499  1.00 0.00 ? 46 PRO A CB   7  
ATOM 5928  C CG   . PRO A 1 46 ? 4.038   4.199   -6.428  1.00 0.00 ? 46 PRO A CG   7  
ATOM 5929  C CD   . PRO A 1 46 ? 4.618   5.560   -6.076  1.00 0.00 ? 46 PRO A CD   7  
ATOM 5930  H HA   . PRO A 1 46 ? 1.501   6.176   -6.360  1.00 0.00 ? 46 PRO A HA   7  
ATOM 5931  H HB2  . PRO A 1 46 ? 2.032   3.523   -5.975  1.00 0.00 ? 46 PRO A HB2  7  
ATOM 5932  H HB3  . PRO A 1 46 ? 2.179   4.314   -7.532  1.00 0.00 ? 46 PRO A HB3  7  
ATOM 5933  H HG2  . PRO A 1 46 ? 4.317   3.460   -5.677  1.00 0.00 ? 46 PRO A HG2  7  
ATOM 5934  H HG3  . PRO A 1 46 ? 4.434   3.850   -7.381  1.00 0.00 ? 46 PRO A HG3  7  
ATOM 5935  H HD2  . PRO A 1 46 ? 5.239   5.506   -5.182  1.00 0.00 ? 46 PRO A HD2  7  
ATOM 5936  H HD3  . PRO A 1 46 ? 5.248   5.941   -6.880  1.00 0.00 ? 46 PRO A HD3  7  
ATOM 5937  N N    . TRP A 1 47 ? 0.833   6.495   -4.043  1.00 0.00 ? 47 TRP A N    7  
ATOM 5938  C CA   . TRP A 1 47 ? 0.244   6.489   -2.715  1.00 0.00 ? 47 TRP A CA   7  
ATOM 5939  C C    . TRP A 1 47 ? 0.023   5.033   -2.302  1.00 0.00 ? 47 TRP A C    7  
ATOM 5940  O O    . TRP A 1 47 ? 0.463   4.613   -1.233  1.00 0.00 ? 47 TRP A O    7  
ATOM 5941  C CB   . TRP A 1 47 ? -1.039  7.321   -2.681  1.00 0.00 ? 47 TRP A CB   7  
ATOM 5942  C CG   . TRP A 1 47 ? -0.814  8.800   -2.357  1.00 0.00 ? 47 TRP A CG   7  
ATOM 5943  C CD1  . TRP A 1 47 ? 0.273   9.543   -2.607  1.00 0.00 ? 47 TRP A CD1  7  
ATOM 5944  C CD2  . TRP A 1 47 ? -1.747  9.690   -1.709  1.00 0.00 ? 47 TRP A CD2  7  
ATOM 5945  N NE1  . TRP A 1 47 ? 0.109   10.841  -2.169  1.00 0.00 ? 47 TRP A NE1  7  
ATOM 5946  C CE2  . TRP A 1 47 ? -1.159  10.934  -1.606  1.00 0.00 ? 47 TRP A CE2  7  
ATOM 5947  C CE3  . TRP A 1 47 ? -3.047  9.452   -1.227  1.00 0.00 ? 47 TRP A CE3  7  
ATOM 5948  C CZ2  . TRP A 1 47 ? -1.794  12.037  -1.024  1.00 0.00 ? 47 TRP A CZ2  7  
ATOM 5949  C CZ3  . TRP A 1 47 ? -3.668  10.565  -0.648  1.00 0.00 ? 47 TRP A CZ3  7  
ATOM 5950  C CH2  . TRP A 1 47 ? -3.089  11.824  -0.537  1.00 0.00 ? 47 TRP A CH2  7  
ATOM 5951  H H    . TRP A 1 47 ? 0.563   7.265   -4.622  1.00 0.00 ? 47 TRP A H    7  
ATOM 5952  H HA   . TRP A 1 47 ? 0.950   6.966   -2.035  1.00 0.00 ? 47 TRP A HA   7  
ATOM 5953  H HB2  . TRP A 1 47 ? -1.537  7.243   -3.647  1.00 0.00 ? 47 TRP A HB2  7  
ATOM 5954  H HB3  . TRP A 1 47 ? -1.716  6.897   -1.939  1.00 0.00 ? 47 TRP A HB3  7  
ATOM 5955  H HD1  . TRP A 1 47 ? 1.173   9.168   -3.094  1.00 0.00 ? 47 TRP A HD1  7  
ATOM 5956  H HE1  . TRP A 1 47 ? 0.840   11.646  -2.250  1.00 0.00 ? 47 TRP A HE1  7  
ATOM 5957  H HE3  . TRP A 1 47 ? -3.533  8.480   -1.297  1.00 0.00 ? 47 TRP A HE3  7  
ATOM 5958  H HZ2  . TRP A 1 47 ? -1.307  13.010  -0.955  1.00 0.00 ? 47 TRP A HZ2  7  
ATOM 5959  H HZ3  . TRP A 1 47 ? -4.678  10.435  -0.258  1.00 0.00 ? 47 TRP A HZ3  7  
ATOM 5960  H HH2  . TRP A 1 47 ? -3.640  12.641  -0.072  1.00 0.00 ? 47 TRP A HH2  7  
ATOM 5961  N N    . CYS A 1 48 ? -0.658  4.301   -3.172  1.00 0.00 ? 48 CYS A N    7  
ATOM 5962  C CA   . CYS A 1 48 ? -0.942  2.900   -2.911  1.00 0.00 ? 48 CYS A CA   7  
ATOM 5963  C C    . CYS A 1 48 ? 0.151   2.057   -3.572  1.00 0.00 ? 48 CYS A C    7  
ATOM 5964  O O    . CYS A 1 48 ? 0.242   2.002   -4.797  1.00 0.00 ? 48 CYS A O    7  
ATOM 5965  C CB   . CYS A 1 48 ? -2.338  2.506   -3.397  1.00 0.00 ? 48 CYS A CB   7  
ATOM 5966  S SG   . CYS A 1 48 ? -3.036  1.014   -2.601  1.00 0.00 ? 48 CYS A SG   7  
ATOM 5967  H H    . CYS A 1 48 ? -1.012  4.650   -4.040  1.00 0.00 ? 48 CYS A H    7  
ATOM 5968  H HA   . CYS A 1 48 ? -0.927  2.774   -1.829  1.00 0.00 ? 48 CYS A HA   7  
ATOM 5969  H HB2  . CYS A 1 48 ? -3.016  3.343   -3.227  1.00 0.00 ? 48 CYS A HB2  7  
ATOM 5970  H HB3  . CYS A 1 48 ? -2.300  2.342   -4.474  1.00 0.00 ? 48 CYS A HB3  7  
ATOM 5971  N N    . PHE A 1 49 ? 0.953   1.421   -2.730  1.00 0.00 ? 49 PHE A N    7  
ATOM 5972  C CA   . PHE A 1 49 ? 2.036   0.584   -3.216  1.00 0.00 ? 49 PHE A CA   7  
ATOM 5973  C C    . PHE A 1 49 ? 2.049   -0.767  -2.499  1.00 0.00 ? 49 PHE A C    7  
ATOM 5974  O O    . PHE A 1 49 ? 1.460   -0.912  -1.429  1.00 0.00 ? 49 PHE A O    7  
ATOM 5975  C CB   . PHE A 1 49 ? 3.342   1.321   -2.914  1.00 0.00 ? 49 PHE A CB   7  
ATOM 5976  C CG   . PHE A 1 49 ? 3.423   1.886   -1.495  1.00 0.00 ? 49 PHE A CG   7  
ATOM 5977  C CD1  . PHE A 1 49 ? 3.563   1.046   -0.435  1.00 0.00 ? 49 PHE A CD1  7  
ATOM 5978  C CD2  . PHE A 1 49 ? 3.357   3.230   -1.293  1.00 0.00 ? 49 PHE A CD2  7  
ATOM 5979  C CE1  . PHE A 1 49 ? 3.638   1.570   0.883   1.00 0.00 ? 49 PHE A CE1  7  
ATOM 5980  C CE2  . PHE A 1 49 ? 3.432   3.754   0.025   1.00 0.00 ? 49 PHE A CE2  7  
ATOM 5981  C CZ   . PHE A 1 49 ? 3.571   2.914   1.084   1.00 0.00 ? 49 PHE A CZ   7  
ATOM 5982  H H    . PHE A 1 49 ? 0.872   1.472   -1.734  1.00 0.00 ? 49 PHE A H    7  
ATOM 5983  H HA   . PHE A 1 49 ? 1.869   0.426   -4.282  1.00 0.00 ? 49 PHE A HA   7  
ATOM 5984  H HB2  . PHE A 1 49 ? 4.177   0.639   -3.071  1.00 0.00 ? 49 PHE A HB2  7  
ATOM 5985  H HB3  . PHE A 1 49 ? 3.460   2.138   -3.627  1.00 0.00 ? 49 PHE A HB3  7  
ATOM 5986  H HD1  . PHE A 1 49 ? 3.616   -0.031  -0.597  1.00 0.00 ? 49 PHE A HD1  7  
ATOM 5987  H HD2  . PHE A 1 49 ? 3.245   3.904   -2.142  1.00 0.00 ? 49 PHE A HD2  7  
ATOM 5988  H HE1  . PHE A 1 49 ? 3.750   0.896   1.732   1.00 0.00 ? 49 PHE A HE1  7  
ATOM 5989  H HE2  . PHE A 1 49 ? 3.379   4.831   0.186   1.00 0.00 ? 49 PHE A HE2  7  
ATOM 5990  H HZ   . PHE A 1 49 ? 3.630   3.316   2.096   1.00 0.00 ? 49 PHE A HZ   7  
ATOM 5991  N N    . LYS A 1 50 ? 2.727   -1.723  -3.116  1.00 0.00 ? 50 LYS A N    7  
ATOM 5992  C CA   . LYS A 1 50 ? 2.825   -3.058  -2.550  1.00 0.00 ? 50 LYS A CA   7  
ATOM 5993  C C    . LYS A 1 50 ? 3.601   -2.992  -1.233  1.00 0.00 ? 50 LYS A C    7  
ATOM 5994  O O    . LYS A 1 50 ? 4.280   -2.005  -0.957  1.00 0.00 ? 50 LYS A O    7  
ATOM 5995  C CB   . LYS A 1 50 ? 3.423   -4.030  -3.569  1.00 0.00 ? 50 LYS A CB   7  
ATOM 5996  C CG   . LYS A 1 50 ? 2.682   -3.948  -4.905  1.00 0.00 ? 50 LYS A CG   7  
ATOM 5997  C CD   . LYS A 1 50 ? 2.998   -5.161  -5.782  1.00 0.00 ? 50 LYS A CD   7  
ATOM 5998  C CE   . LYS A 1 50 ? 2.100   -6.347  -5.422  1.00 0.00 ? 50 LYS A CE   7  
ATOM 5999  N NZ   . LYS A 1 50 ? 2.019   -7.298  -6.553  1.00 0.00 ? 50 LYS A NZ   7  
ATOM 6000  H H    . LYS A 1 50 ? 3.204   -1.597  -3.987  1.00 0.00 ? 50 LYS A H    7  
ATOM 6001  H HA   . LYS A 1 50 ? 1.811   -3.397  -2.337  1.00 0.00 ? 50 LYS A HA   7  
ATOM 6002  H HB2  . LYS A 1 50 ? 4.478   -3.802  -3.720  1.00 0.00 ? 50 LYS A HB2  7  
ATOM 6003  H HB3  . LYS A 1 50 ? 3.370   -5.047  -3.181  1.00 0.00 ? 50 LYS A HB3  7  
ATOM 6004  H HG2  . LYS A 1 50 ? 1.608   -3.893  -4.727  1.00 0.00 ? 50 LYS A HG2  7  
ATOM 6005  H HG3  . LYS A 1 50 ? 2.966   -3.034  -5.427  1.00 0.00 ? 50 LYS A HG3  7  
ATOM 6006  H HD2  . LYS A 1 50 ? 2.860   -4.902  -6.832  1.00 0.00 ? 50 LYS A HD2  7  
ATOM 6007  H HD3  . LYS A 1 50 ? 4.044   -5.442  -5.659  1.00 0.00 ? 50 LYS A HD3  7  
ATOM 6008  H HE2  . LYS A 1 50 ? 2.493   -6.853  -4.540  1.00 0.00 ? 50 LYS A HE2  7  
ATOM 6009  H HE3  . LYS A 1 50 ? 1.102   -5.990  -5.166  1.00 0.00 ? 50 LYS A HE3  7  
ATOM 6010  H HZ1  . LYS A 1 50 ? 1.776   -6.804  -7.388  1.00 0.00 ? 50 LYS A HZ1  7  
ATOM 6011  H HZ2  . LYS A 1 50 ? 2.905   -7.746  -6.676  1.00 0.00 ? 50 LYS A HZ2  7  
ATOM 6012  H HZ3  . LYS A 1 50 ? 1.321   -7.987  -6.359  1.00 0.00 ? 50 LYS A HZ3  7  
ATOM 6013  N N    . PRO A 1 51 ? 3.471   -4.086  -0.435  1.00 0.00 ? 51 PRO A N    7  
ATOM 6014  C CA   . PRO A 1 51 ? 4.153   -4.162  0.846   1.00 0.00 ? 51 PRO A CA   7  
ATOM 6015  C C    . PRO A 1 51 ? 5.646   -4.434  0.658   1.00 0.00 ? 51 PRO A C    7  
ATOM 6016  O O    . PRO A 1 51 ? 6.030   -5.481  0.138   1.00 0.00 ? 51 PRO A O    7  
ATOM 6017  C CB   . PRO A 1 51 ? 3.439   -5.268  1.606   1.00 0.00 ? 51 PRO A CB   7  
ATOM 6018  C CG   . PRO A 1 51 ? 2.695   -6.080  0.559   1.00 0.00 ? 51 PRO A CG   7  
ATOM 6019  C CD   . PRO A 1 51 ? 2.676   -5.274  -0.730  1.00 0.00 ? 51 PRO A CD   7  
ATOM 6020  H HA   . PRO A 1 51 ? 4.093   -3.286  1.324   1.00 0.00 ? 51 PRO A HA   7  
ATOM 6021  H HB2  . PRO A 1 51 ? 4.150   -5.890  2.150   1.00 0.00 ? 51 PRO A HB2  7  
ATOM 6022  H HB3  . PRO A 1 51 ? 2.749   -4.854  2.342   1.00 0.00 ? 51 PRO A HB3  7  
ATOM 6023  H HG2  . PRO A 1 51 ? 3.185   -7.041  0.401   1.00 0.00 ? 51 PRO A HG2  7  
ATOM 6024  H HG3  . PRO A 1 51 ? 1.678   -6.292  0.891   1.00 0.00 ? 51 PRO A HG3  7  
ATOM 6025  H HD2  . PRO A 1 51 ? 3.102   -5.840  -1.558  1.00 0.00 ? 51 PRO A HD2  7  
ATOM 6026  H HD3  . PRO A 1 51 ? 1.658   -5.008  -1.016  1.00 0.00 ? 51 PRO A HD3  7  
ATOM 6027  N N    . LEU A 1 52 ? 6.450   -3.474  1.091   1.00 0.00 ? 52 LEU A N    7  
ATOM 6028  C CA   . LEU A 1 52 ? 7.893   -3.596  0.977   1.00 0.00 ? 52 LEU A CA   7  
ATOM 6029  C C    . LEU A 1 52 ? 8.289   -5.067  1.128   1.00 0.00 ? 52 LEU A C    7  
ATOM 6030  O O    . LEU A 1 52 ? 7.846   -5.740  2.057   1.00 0.00 ? 52 LEU A O    7  
ATOM 6031  C CB   . LEU A 1 52 ? 8.590   -2.666  1.971   1.00 0.00 ? 52 LEU A CB   7  
ATOM 6032  C CG   . LEU A 1 52 ? 10.115  -2.779  2.040   1.00 0.00 ? 52 LEU A CG   7  
ATOM 6033  C CD1  . LEU A 1 52 ? 10.704  -1.703  2.953   1.00 0.00 ? 52 LEU A CD1  7  
ATOM 6034  C CD2  . LEU A 1 52 ? 10.542  -4.186  2.462   1.00 0.00 ? 52 LEU A CD2  7  
ATOM 6035  H H    . LEU A 1 52 ? 6.130   -2.625  1.513   1.00 0.00 ? 52 LEU A H    7  
ATOM 6036  H HA   . LEU A 1 52 ? 8.171   -3.265  -0.024  1.00 0.00 ? 52 LEU A HA   7  
ATOM 6037  H HB2  . LEU A 1 52 ? 8.333   -1.638  1.718   1.00 0.00 ? 52 LEU A HB2  7  
ATOM 6038  H HB3  . LEU A 1 52 ? 8.187   -2.861  2.965   1.00 0.00 ? 52 LEU A HB3  7  
ATOM 6039  H HG   . LEU A 1 52 ? 10.515  -2.608  1.040   1.00 0.00 ? 52 LEU A HG   7  
ATOM 6040  H HD11 . LEU A 1 52 ? 10.265  -0.736  2.706   1.00 0.00 ? 52 LEU A HD11 7  
ATOM 6041  H HD12 . LEU A 1 52 ? 10.483  -1.947  3.992   1.00 0.00 ? 52 LEU A HD12 7  
ATOM 6042  H HD13 . LEU A 1 52 ? 11.784  -1.658  2.812   1.00 0.00 ? 52 LEU A HD13 7  
ATOM 6043  H HD21 . LEU A 1 52 ? 9.725   -4.668  3.000   1.00 0.00 ? 52 LEU A HD21 7  
ATOM 6044  H HD22 . LEU A 1 52 ? 10.790  -4.772  1.577   1.00 0.00 ? 52 LEU A HD22 7  
ATOM 6045  H HD23 . LEU A 1 52 ? 11.415  -4.121  3.112   1.00 0.00 ? 52 LEU A HD23 7  
ATOM 6046  N N    . GLN A 1 53 ? 9.119   -5.521  0.200   1.00 0.00 ? 53 GLN A N    7  
ATOM 6047  C CA   . GLN A 1 53 ? 9.579   -6.899  0.218   1.00 0.00 ? 53 GLN A CA   7  
ATOM 6048  C C    . GLN A 1 53 ? 10.397  -7.169  1.483   1.00 0.00 ? 53 GLN A C    7  
ATOM 6049  O O    . GLN A 1 53 ? 11.625  -7.212  1.435   1.00 0.00 ? 53 GLN A O    7  
ATOM 6050  C CB   . GLN A 1 53 ? 10.390  -7.223  -1.038  1.00 0.00 ? 53 GLN A CB   7  
ATOM 6051  C CG   . GLN A 1 53 ? 11.565  -6.256  -1.197  1.00 0.00 ? 53 GLN A CG   7  
ATOM 6052  C CD   . GLN A 1 53 ? 11.347  -5.319  -2.387  1.00 0.00 ? 53 GLN A CD   7  
ATOM 6053  O OE1  . GLN A 1 53 ? 11.421  -5.710  -3.540  1.00 0.00 ? 53 GLN A OE1  7  
ATOM 6054  N NE2  . GLN A 1 53 ? 11.075  -4.063  -2.044  1.00 0.00 ? 53 GLN A NE2  7  
ATOM 6055  H H    . GLN A 1 53 ? 9.474   -4.967  -0.553  1.00 0.00 ? 53 GLN A H    7  
ATOM 6056  H HA   . GLN A 1 53 ? 8.674   -7.507  0.226   1.00 0.00 ? 53 GLN A HA   7  
ATOM 6057  H HB2  . GLN A 1 53 ? 10.762  -8.246  -0.982  1.00 0.00 ? 53 GLN A HB2  7  
ATOM 6058  H HB3  . GLN A 1 53 ? 9.746   -7.166  -1.916  1.00 0.00 ? 53 GLN A HB3  7  
ATOM 6059  H HG2  . GLN A 1 53 ? 11.684  -5.670  -0.285  1.00 0.00 ? 53 GLN A HG2  7  
ATOM 6060  H HG3  . GLN A 1 53 ? 12.488  -6.819  -1.337  1.00 0.00 ? 53 GLN A HG3  7  
ATOM 6061  H HE21 . GLN A 1 53 ? 11.028  -3.808  -1.078  1.00 0.00 ? 53 GLN A HE21 7  
ATOM 6062  H HE22 . GLN A 1 53 ? 10.916  -3.375  -2.751  1.00 0.00 ? 53 GLN A HE22 7  
ATOM 6063  N N    . GLU A 1 54 ? 9.682   -7.343  2.585   1.00 0.00 ? 54 GLU A N    7  
ATOM 6064  C CA   . GLU A 1 54 ? 10.326  -7.607  3.861   1.00 0.00 ? 54 GLU A CA   7  
ATOM 6065  C C    . GLU A 1 54 ? 11.374  -8.712  3.708   1.00 0.00 ? 54 GLU A C    7  
ATOM 6066  O O    . GLU A 1 54 ? 11.039  -9.848  3.374   1.00 0.00 ? 54 GLU A O    7  
ATOM 6067  C CB   . GLU A 1 54 ? 9.295   -7.974  4.930   1.00 0.00 ? 54 GLU A CB   7  
ATOM 6068  C CG   . GLU A 1 54 ? 8.960   -9.466  4.880   1.00 0.00 ? 54 GLU A CG   7  
ATOM 6069  C CD   . GLU A 1 54 ? 7.758   -9.788  5.771   1.00 0.00 ? 54 GLU A CD   7  
ATOM 6070  O OE1  . GLU A 1 54 ? 6.785   -9.006  5.715   1.00 0.00 ? 54 GLU A OE1  7  
ATOM 6071  O OE2  . GLU A 1 54 ? 7.840   -10.809 6.487   1.00 0.00 ? 54 GLU A OE2  7  
ATOM 6072  H H    . GLU A 1 54 ? 8.683   -7.307  2.616   1.00 0.00 ? 54 GLU A H    7  
ATOM 6073  H HA   . GLU A 1 54 ? 10.813  -6.672  4.139   1.00 0.00 ? 54 GLU A HA   7  
ATOM 6074  H HB2  . GLU A 1 54 ? 9.682   -7.717  5.916   1.00 0.00 ? 54 GLU A HB2  7  
ATOM 6075  H HB3  . GLU A 1 54 ? 8.388   -7.389  4.781   1.00 0.00 ? 54 GLU A HB3  7  
ATOM 6076  H HG2  . GLU A 1 54 ? 8.745   -9.760  3.853   1.00 0.00 ? 54 GLU A HG2  7  
ATOM 6077  H HG3  . GLU A 1 54 ? 9.824   -10.047 5.204   1.00 0.00 ? 54 GLU A HG3  7  
ATOM 6078  N N    . ALA A 1 55 ? 12.620  -8.341  3.959   1.00 0.00 ? 55 ALA A N    7  
ATOM 6079  C CA   . ALA A 1 55 ? 13.719  -9.286  3.854   1.00 0.00 ? 55 ALA A CA   7  
ATOM 6080  C C    . ALA A 1 55 ? 14.886  -8.803  4.718   1.00 0.00 ? 55 ALA A C    7  
ATOM 6081  O O    . ALA A 1 55 ? 15.640  -7.920  4.312   1.00 0.00 ? 55 ALA A O    7  
ATOM 6082  C CB   . ALA A 1 55 ? 14.111  -9.451  2.384   1.00 0.00 ? 55 ALA A CB   7  
ATOM 6083  H H    . ALA A 1 55 ? 12.884  -7.415  4.230   1.00 0.00 ? 55 ALA A H    7  
ATOM 6084  H HA   . ALA A 1 55 ? 13.369  -10.245 4.233   1.00 0.00 ? 55 ALA A HA   7  
ATOM 6085  H HB1  . ALA A 1 55 ? 13.591  -10.312 1.964   1.00 0.00 ? 55 ALA A HB1  7  
ATOM 6086  H HB2  . ALA A 1 55 ? 15.188  -9.605  2.310   1.00 0.00 ? 55 ALA A HB2  7  
ATOM 6087  H HB3  . ALA A 1 55 ? 13.834  -8.553  1.831   1.00 0.00 ? 55 ALA A HB3  7  
ATOM 6088  N N    . GLU A 1 56 ? 14.998  -9.404  5.893   1.00 0.00 ? 56 GLU A N    7  
ATOM 6089  C CA   . GLU A 1 56 ? 16.060  -9.047  6.818   1.00 0.00 ? 56 GLU A CA   7  
ATOM 6090  C C    . GLU A 1 56 ? 16.001  -7.553  7.143   1.00 0.00 ? 56 GLU A C    7  
ATOM 6091  O O    . GLU A 1 56 ? 16.621  -6.740  6.460   1.00 0.00 ? 56 GLU A O    7  
ATOM 6092  C CB   . GLU A 1 56 ? 17.430  -9.431  6.254   1.00 0.00 ? 56 GLU A CB   7  
ATOM 6093  C CG   . GLU A 1 56 ? 18.435  -9.683  7.380   1.00 0.00 ? 56 GLU A CG   7  
ATOM 6094  C CD   . GLU A 1 56 ? 19.827  -9.979  6.817   1.00 0.00 ? 56 GLU A CD   7  
ATOM 6095  O OE1  . GLU A 1 56 ? 20.578  -9.001  6.615   1.00 0.00 ? 56 GLU A OE1  7  
ATOM 6096  O OE2  . GLU A 1 56 ? 20.108  -11.178 6.601   1.00 0.00 ? 56 GLU A OE2  7  
ATOM 6097  H H    . GLU A 1 56 ? 14.381  -10.122 6.216   1.00 0.00 ? 56 GLU A H    7  
ATOM 6098  H HA   . GLU A 1 56 ? 15.869  -9.630  7.719   1.00 0.00 ? 56 GLU A HA   7  
ATOM 6099  H HB2  . GLU A 1 56 ? 17.336  -10.326 5.639   1.00 0.00 ? 56 GLU A HB2  7  
ATOM 6100  H HB3  . GLU A 1 56 ? 17.797  -8.636  5.606   1.00 0.00 ? 56 GLU A HB3  7  
ATOM 6101  H HG2  . GLU A 1 56 ? 18.482  -8.810  8.033   1.00 0.00 ? 56 GLU A HG2  7  
ATOM 6102  H HG3  . GLU A 1 56 ? 18.100  -10.521 7.991   1.00 0.00 ? 56 GLU A HG3  7  
ATOM 6103  N N    . CYS A 1 57 ? 15.249  -7.237  8.187   1.00 0.00 ? 57 CYS A N    7  
ATOM 6104  C CA   . CYS A 1 57 ? 15.100  -5.856  8.612   1.00 0.00 ? 57 CYS A CA   7  
ATOM 6105  C C    . CYS A 1 57 ? 14.666  -5.848  10.079  1.00 0.00 ? 57 CYS A C    7  
ATOM 6106  O O    . CYS A 1 57 ? 15.405  -5.385  10.946  1.00 0.00 ? 57 CYS A O    7  
ATOM 6107  C CB   . CYS A 1 57 ? 14.117  -5.093  7.722   1.00 0.00 ? 57 CYS A CB   7  
ATOM 6108  S SG   . CYS A 1 57 ? 13.892  -3.331  8.160   1.00 0.00 ? 57 CYS A SG   7  
ATOM 6109  H H    . CYS A 1 57 ? 14.747  -7.905  8.738   1.00 0.00 ? 57 CYS A H    7  
ATOM 6110  H HA   . CYS A 1 57 ? 16.076  -5.385  8.495   1.00 0.00 ? 57 CYS A HA   7  
ATOM 6111  H HB2  . CYS A 1 57 ? 14.460  -5.155  6.689   1.00 0.00 ? 57 CYS A HB2  7  
ATOM 6112  H HB3  . CYS A 1 57 ? 13.148  -5.590  7.766   1.00 0.00 ? 57 CYS A HB3  7  
ATOM 6113  N N    . THR A 1 58 ? 13.469  -6.366  10.312  1.00 0.00 ? 58 THR A N    7  
ATOM 6114  C CA   . THR A 1 58 ? 12.928  -6.425  11.659  1.00 0.00 ? 58 THR A CA   7  
ATOM 6115  C C    . THR A 1 58 ? 13.973  -6.977  12.630  1.00 0.00 ? 58 THR A C    7  
ATOM 6116  O O    . THR A 1 58 ? 14.122  -6.472  13.741  1.00 0.00 ? 58 THR A O    7  
ATOM 6117  C CB   . THR A 1 58 ? 11.641  -7.252  11.616  1.00 0.00 ? 58 THR A CB   7  
ATOM 6118  O OG1  . THR A 1 58 ? 11.410  -7.606  12.977  1.00 0.00 ? 58 THR A OG1  7  
ATOM 6119  C CG2  . THR A 1 58 ? 11.832  -8.595  10.909  1.00 0.00 ? 58 THR A CG2  7  
ATOM 6120  H H    . THR A 1 58 ? 12.874  -6.741  9.601   1.00 0.00 ? 58 THR A H    7  
ATOM 6121  H HA   . THR A 1 58 ? 12.697  -5.410  11.981  1.00 0.00 ? 58 THR A HA   7  
ATOM 6122  H HB   . THR A 1 58 ? 10.829  -6.684  11.162  1.00 0.00 ? 58 THR A HB   7  
ATOM 6123  H HG1  . THR A 1 58 ? 10.432  -7.561  13.181  1.00 0.00 ? 58 THR A HG1  7  
ATOM 6124  H HG21 . THR A 1 58 ? 12.769  -8.583  10.353  1.00 0.00 ? 58 THR A HG21 7  
ATOM 6125  H HG22 . THR A 1 58 ? 11.858  -9.395  11.649  1.00 0.00 ? 58 THR A HG22 7  
ATOM 6126  H HG23 . THR A 1 58 ? 11.003  -8.764  10.221  1.00 0.00 ? 58 THR A HG23 7  
ATOM 6127  N N    . PHE A 1 59 ? 14.670  -8.008  12.175  1.00 0.00 ? 59 PHE A N    7  
ATOM 6128  C CA   . PHE A 1 59 ? 15.697  -8.635  12.990  1.00 0.00 ? 59 PHE A CA   7  
ATOM 6129  C C    . PHE A 1 59 ? 17.033  -8.684  12.246  1.00 0.00 ? 59 PHE A C    7  
ATOM 6130  O O    . PHE A 1 59 ? 17.063  -8.711  11.016  1.00 0.00 ? 59 PHE A O    7  
ATOM 6131  C CB   . PHE A 1 59 ? 15.232  -10.064 13.274  1.00 0.00 ? 59 PHE A CB   7  
ATOM 6132  C CG   . PHE A 1 59 ? 15.855  -10.684 14.527  1.00 0.00 ? 59 PHE A CG   7  
ATOM 6133  C CD1  . PHE A 1 59 ? 17.158  -11.074 14.517  1.00 0.00 ? 59 PHE A CD1  7  
ATOM 6134  C CD2  . PHE A 1 59 ? 15.106  -10.844 15.651  1.00 0.00 ? 59 PHE A CD2  7  
ATOM 6135  C CE1  . PHE A 1 59 ? 17.736  -11.649 15.680  1.00 0.00 ? 59 PHE A CE1  7  
ATOM 6136  C CE2  . PHE A 1 59 ? 15.684  -11.419 16.813  1.00 0.00 ? 59 PHE A CE2  7  
ATOM 6137  C CZ   . PHE A 1 59 ? 16.986  -11.809 16.803  1.00 0.00 ? 59 PHE A CZ   7  
ATOM 6138  H H    . PHE A 1 59 ? 14.543  -8.414  11.270  1.00 0.00 ? 59 PHE A H    7  
ATOM 6139  H HA   . PHE A 1 59 ? 15.808  -8.032  13.891  1.00 0.00 ? 59 PHE A HA   7  
ATOM 6140  H HB2  . PHE A 1 59 ? 14.148  -10.069 13.380  1.00 0.00 ? 59 PHE A HB2  7  
ATOM 6141  H HB3  . PHE A 1 59 ? 15.471  -10.691 12.414  1.00 0.00 ? 59 PHE A HB3  7  
ATOM 6142  H HD1  . PHE A 1 59 ? 17.758  -10.946 13.616  1.00 0.00 ? 59 PHE A HD1  7  
ATOM 6143  H HD2  . PHE A 1 59 ? 14.062  -10.531 15.659  1.00 0.00 ? 59 PHE A HD2  7  
ATOM 6144  H HE1  . PHE A 1 59 ? 18.780  -11.962 15.672  1.00 0.00 ? 59 PHE A HE1  7  
ATOM 6145  H HE2  . PHE A 1 59 ? 15.083  -11.547 17.714  1.00 0.00 ? 59 PHE A HE2  7  
ATOM 6146  H HZ   . PHE A 1 59 ? 17.430  -12.251 17.696  1.00 0.00 ? 59 PHE A HZ   7  
ATOM 6147  N N    . GLU A 1 1  ? 12.289  -15.756 12.989  1.00 0.00 ? 1  GLU A N    8  
ATOM 6148  C CA   . GLU A 1 1  ? 11.520  -16.233 14.127  1.00 0.00 ? 1  GLU A CA   8  
ATOM 6149  C C    . GLU A 1 1  ? 10.865  -15.057 14.854  1.00 0.00 ? 1  GLU A C    8  
ATOM 6150  O O    . GLU A 1 1  ? 10.918  -14.974 16.081  1.00 0.00 ? 1  GLU A O    8  
ATOM 6151  C CB   . GLU A 1 1  ? 12.398  -17.046 15.079  1.00 0.00 ? 1  GLU A CB   8  
ATOM 6152  C CG   . GLU A 1 1  ? 12.004  -18.525 15.060  1.00 0.00 ? 1  GLU A CG   8  
ATOM 6153  C CD   . GLU A 1 1  ? 13.114  -19.396 15.653  1.00 0.00 ? 1  GLU A CD   8  
ATOM 6154  O OE1  . GLU A 1 1  ? 13.075  -19.602 16.885  1.00 0.00 ? 1  GLU A OE1  8  
ATOM 6155  O OE2  . GLU A 1 1  ? 13.975  -19.835 14.861  1.00 0.00 ? 1  GLU A OE2  8  
ATOM 6156  H H    . GLU A 1 1  ? 11.897  -14.968 12.514  1.00 0.00 ? 1  GLU A H    8  
ATOM 6157  H HA   . GLU A 1 1  ? 10.752  -16.882 13.706  1.00 0.00 ? 1  GLU A HA   8  
ATOM 6158  H HB2  . GLU A 1 1  ? 13.445  -16.941 14.794  1.00 0.00 ? 1  GLU A HB2  8  
ATOM 6159  H HB3  . GLU A 1 1  ? 12.303  -16.654 16.092  1.00 0.00 ? 1  GLU A HB3  8  
ATOM 6160  H HG2  . GLU A 1 1  ? 11.084  -18.667 15.625  1.00 0.00 ? 1  GLU A HG2  8  
ATOM 6161  H HG3  . GLU A 1 1  ? 11.801  -18.837 14.035  1.00 0.00 ? 1  GLU A HG3  8  
ATOM 6162  N N    . GLU A 1 2  ? 10.262  -14.177 14.068  1.00 0.00 ? 2  GLU A N    8  
ATOM 6163  C CA   . GLU A 1 2  ? 9.597   -13.010 14.622  1.00 0.00 ? 2  GLU A CA   8  
ATOM 6164  C C    . GLU A 1 2  ? 9.066   -12.118 13.498  1.00 0.00 ? 2  GLU A C    8  
ATOM 6165  O O    . GLU A 1 2  ? 9.628   -11.059 13.224  1.00 0.00 ? 2  GLU A O    8  
ATOM 6166  C CB   . GLU A 1 2  ? 10.537  -12.230 15.544  1.00 0.00 ? 2  GLU A CB   8  
ATOM 6167  C CG   . GLU A 1 2  ? 9.842   -11.872 16.859  1.00 0.00 ? 2  GLU A CG   8  
ATOM 6168  C CD   . GLU A 1 2  ? 10.755  -12.151 18.055  1.00 0.00 ? 2  GLU A CD   8  
ATOM 6169  O OE1  . GLU A 1 2  ? 11.884  -11.614 18.045  1.00 0.00 ? 2  GLU A OE1  8  
ATOM 6170  O OE2  . GLU A 1 2  ? 10.303  -12.894 18.952  1.00 0.00 ? 2  GLU A OE2  8  
ATOM 6171  H H    . GLU A 1 2  ? 10.224  -14.252 13.072  1.00 0.00 ? 2  GLU A H    8  
ATOM 6172  H HA   . GLU A 1 2  ? 8.766   -13.401 15.208  1.00 0.00 ? 2  GLU A HA   8  
ATOM 6173  H HB2  . GLU A 1 2  ? 11.427  -12.824 15.749  1.00 0.00 ? 2  GLU A HB2  8  
ATOM 6174  H HB3  . GLU A 1 2  ? 10.870  -11.320 15.044  1.00 0.00 ? 2  GLU A HB3  8  
ATOM 6175  H HG2  . GLU A 1 2  ? 9.560   -10.819 16.850  1.00 0.00 ? 2  GLU A HG2  8  
ATOM 6176  H HG3  . GLU A 1 2  ? 8.922   -12.447 16.957  1.00 0.00 ? 2  GLU A HG3  8  
ATOM 6177  N N    . TYR A 1 3  ? 7.990   -12.579 12.879  1.00 0.00 ? 3  TYR A N    8  
ATOM 6178  C CA   . TYR A 1 3  ? 7.377   -11.837 11.791  1.00 0.00 ? 3  TYR A CA   8  
ATOM 6179  C C    . TYR A 1 3  ? 5.851   -11.865 11.899  1.00 0.00 ? 3  TYR A C    8  
ATOM 6180  O O    . TYR A 1 3  ? 5.245   -12.936 11.907  1.00 0.00 ? 3  TYR A O    8  
ATOM 6181  C CB   . TYR A 1 3  ? 7.798   -12.549 10.504  1.00 0.00 ? 3  TYR A CB   8  
ATOM 6182  C CG   . TYR A 1 3  ? 7.011   -12.114 9.266   1.00 0.00 ? 3  TYR A CG   8  
ATOM 6183  C CD1  . TYR A 1 3  ? 7.310   -10.921 8.641   1.00 0.00 ? 3  TYR A CD1  8  
ATOM 6184  C CD2  . TYR A 1 3  ? 6.001   -12.916 8.774   1.00 0.00 ? 3  TYR A CD2  8  
ATOM 6185  C CE1  . TYR A 1 3  ? 6.569   -10.512 7.476   1.00 0.00 ? 3  TYR A CE1  8  
ATOM 6186  C CE2  . TYR A 1 3  ? 5.260   -12.507 7.609   1.00 0.00 ? 3  TYR A CE2  8  
ATOM 6187  C CZ   . TYR A 1 3  ? 5.581   -11.325 7.018   1.00 0.00 ? 3  TYR A CZ   8  
ATOM 6188  O OH   . TYR A 1 3  ? 4.881   -10.939 5.917   1.00 0.00 ? 3  TYR A OH   8  
ATOM 6189  H H    . TYR A 1 3  ? 7.539   -13.442 13.108  1.00 0.00 ? 3  TYR A H    8  
ATOM 6190  H HA   . TYR A 1 3  ? 7.719   -10.804 11.854  1.00 0.00 ? 3  TYR A HA   8  
ATOM 6191  H HB2  . TYR A 1 3  ? 8.859   -12.366 10.330  1.00 0.00 ? 3  TYR A HB2  8  
ATOM 6192  H HB3  . TYR A 1 3  ? 7.678   -13.623 10.639  1.00 0.00 ? 3  TYR A HB3  8  
ATOM 6193  H HD1  . TYR A 1 3  ? 8.108   -10.287 9.030   1.00 0.00 ? 3  TYR A HD1  8  
ATOM 6194  H HD2  . TYR A 1 3  ? 5.765   -13.859 9.267   1.00 0.00 ? 3  TYR A HD2  8  
ATOM 6195  H HE1  . TYR A 1 3  ? 6.795   -9.571  6.974   1.00 0.00 ? 3  TYR A HE1  8  
ATOM 6196  H HE2  . TYR A 1 3  ? 4.460   -13.131 7.210   1.00 0.00 ? 3  TYR A HE2  8  
ATOM 6197  H HH   . TYR A 1 3  ? 5.502   -10.554 5.235   1.00 0.00 ? 3  TYR A HH   8  
ATOM 6198  N N    . VAL A 1 4  ? 5.273   -10.676 11.980  1.00 0.00 ? 4  VAL A N    8  
ATOM 6199  C CA   . VAL A 1 4  ? 3.829   -10.551 12.088  1.00 0.00 ? 4  VAL A CA   8  
ATOM 6200  C C    . VAL A 1 4  ? 3.445   -9.070  12.045  1.00 0.00 ? 4  VAL A C    8  
ATOM 6201  O O    . VAL A 1 4  ? 2.933   -8.530  13.023  1.00 0.00 ? 4  VAL A O    8  
ATOM 6202  C CB   . VAL A 1 4  ? 3.335   -11.260 13.350  1.00 0.00 ? 4  VAL A CB   8  
ATOM 6203  C CG1  . VAL A 1 4  ? 4.034   -10.711 14.596  1.00 0.00 ? 4  VAL A CG1  8  
ATOM 6204  C CG2  . VAL A 1 4  ? 1.815   -11.151 13.481  1.00 0.00 ? 4  VAL A CG2  8  
ATOM 6205  H H    . VAL A 1 4  ? 5.773   -9.809  11.973  1.00 0.00 ? 4  VAL A H    8  
ATOM 6206  H HA   . VAL A 1 4  ? 3.391   -11.052 11.225  1.00 0.00 ? 4  VAL A HA   8  
ATOM 6207  H HB   . VAL A 1 4  ? 3.589   -12.316 13.262  1.00 0.00 ? 4  VAL A HB   8  
ATOM 6208  H HG11 . VAL A 1 4  ? 5.114   -10.777 14.465  1.00 0.00 ? 4  VAL A HG11 8  
ATOM 6209  H HG12 . VAL A 1 4  ? 3.748   -9.670  14.744  1.00 0.00 ? 4  VAL A HG12 8  
ATOM 6210  H HG13 . VAL A 1 4  ? 3.737   -11.297 15.466  1.00 0.00 ? 4  VAL A HG13 8  
ATOM 6211  H HG21 . VAL A 1 4  ? 1.448   -10.371 12.814  1.00 0.00 ? 4  VAL A HG21 8  
ATOM 6212  H HG22 . VAL A 1 4  ? 1.358   -12.104 13.212  1.00 0.00 ? 4  VAL A HG22 8  
ATOM 6213  H HG23 . VAL A 1 4  ? 1.556   -10.901 14.509  1.00 0.00 ? 4  VAL A HG23 8  
ATOM 6214  N N    . GLY A 1 5  ? 3.708   -8.457  10.900  1.00 0.00 ? 5  GLY A N    8  
ATOM 6215  C CA   . GLY A 1 5  ? 3.396   -7.049  10.717  1.00 0.00 ? 5  GLY A CA   8  
ATOM 6216  C C    . GLY A 1 5  ? 2.571   -6.832  9.447   1.00 0.00 ? 5  GLY A C    8  
ATOM 6217  O O    . GLY A 1 5  ? 3.063   -7.040  8.339   1.00 0.00 ? 5  GLY A O    8  
ATOM 6218  H H    . GLY A 1 5  ? 4.125   -8.904  10.109  1.00 0.00 ? 5  GLY A H    8  
ATOM 6219  H HA2  . GLY A 1 5  ? 2.844   -6.680  11.581  1.00 0.00 ? 5  GLY A HA2  8  
ATOM 6220  H HA3  . GLY A 1 5  ? 4.319   -6.473  10.658  1.00 0.00 ? 5  GLY A HA3  8  
ATOM 6221  N N    . LEU A 1 6  ? 1.330   -6.415  9.650   1.00 0.00 ? 6  LEU A N    8  
ATOM 6222  C CA   . LEU A 1 6  ? 0.432   -6.167  8.535   1.00 0.00 ? 6  LEU A CA   8  
ATOM 6223  C C    . LEU A 1 6  ? -0.033  -4.710  8.575   1.00 0.00 ? 6  LEU A C    8  
ATOM 6224  O O    . LEU A 1 6  ? -1.222  -4.429  8.429   1.00 0.00 ? 6  LEU A O    8  
ATOM 6225  C CB   . LEU A 1 6  ? -0.716  -7.179  8.536   1.00 0.00 ? 6  LEU A CB   8  
ATOM 6226  C CG   . LEU A 1 6  ? -1.406  -7.409  9.882   1.00 0.00 ? 6  LEU A CG   8  
ATOM 6227  C CD1  . LEU A 1 6  ? -2.899  -7.683  9.694   1.00 0.00 ? 6  LEU A CD1  8  
ATOM 6228  C CD2  . LEU A 1 6  ? -0.714  -8.525  10.668  1.00 0.00 ? 6  LEU A CD2  8  
ATOM 6229  H H    . LEU A 1 6  ? 0.937   -6.249  10.554  1.00 0.00 ? 6  LEU A H    8  
ATOM 6230  H HA   . LEU A 1 6  ? 0.999   -6.324  7.617   1.00 0.00 ? 6  LEU A HA   8  
ATOM 6231  H HB2  . LEU A 1 6  ? -1.467  -6.848  7.818   1.00 0.00 ? 6  LEU A HB2  8  
ATOM 6232  H HB3  . LEU A 1 6  ? -0.333  -8.134  8.178   1.00 0.00 ? 6  LEU A HB3  8  
ATOM 6233  H HG   . LEU A 1 6  ? -1.317  -6.497  10.472  1.00 0.00 ? 6  LEU A HG   8  
ATOM 6234  H HD11 . LEU A 1 6  ? -3.172  -7.510  8.652   1.00 0.00 ? 6  LEU A HD11 8  
ATOM 6235  H HD12 . LEU A 1 6  ? -3.116  -8.717  9.959   1.00 0.00 ? 6  LEU A HD12 8  
ATOM 6236  H HD13 . LEU A 1 6  ? -3.474  -7.015  10.335  1.00 0.00 ? 6  LEU A HD13 8  
ATOM 6237  H HD21 . LEU A 1 6  ? 0.085   -8.954  10.064  1.00 0.00 ? 6  LEU A HD21 8  
ATOM 6238  H HD22 . LEU A 1 6  ? -0.294  -8.115  11.587  1.00 0.00 ? 6  LEU A HD22 8  
ATOM 6239  H HD23 . LEU A 1 6  ? -1.439  -9.300  10.914  1.00 0.00 ? 6  LEU A HD23 8  
ATOM 6240  N N    . SER A 1 7  ? 0.929   -3.821  8.773   1.00 0.00 ? 7  SER A N    8  
ATOM 6241  C CA   . SER A 1 7  ? 0.634   -2.399  8.834   1.00 0.00 ? 7  SER A CA   8  
ATOM 6242  C C    . SER A 1 7  ? 1.896   -1.618  9.203   1.00 0.00 ? 7  SER A C    8  
ATOM 6243  O O    . SER A 1 7  ? 2.496   -1.859  10.249  1.00 0.00 ? 7  SER A O    8  
ATOM 6244  C CB   . SER A 1 7  ? -0.482  -2.111  9.840   1.00 0.00 ? 7  SER A CB   8  
ATOM 6245  O OG   . SER A 1 7  ? -0.276  -2.791  11.075  1.00 0.00 ? 7  SER A OG   8  
ATOM 6246  H H    . SER A 1 7  ? 1.894   -4.057  8.891   1.00 0.00 ? 7  SER A H    8  
ATOM 6247  H HA   . SER A 1 7  ? 0.297   -2.131  7.832   1.00 0.00 ? 7  SER A HA   8  
ATOM 6248  H HB2  . SER A 1 7  ? -0.539  -1.038  10.022  1.00 0.00 ? 7  SER A HB2  8  
ATOM 6249  H HB3  . SER A 1 7  ? -1.440  -2.413  9.416   1.00 0.00 ? 7  SER A HB3  8  
ATOM 6250  H HG   . SER A 1 7  ? -1.072  -2.671  11.669  1.00 0.00 ? 7  SER A HG   8  
ATOM 6251  N N    . ALA A 1 8  ? 2.262   -0.697  8.324   1.00 0.00 ? 8  ALA A N    8  
ATOM 6252  C CA   . ALA A 1 8  ? 3.442   0.122   8.544   1.00 0.00 ? 8  ALA A CA   8  
ATOM 6253  C C    . ALA A 1 8  ? 4.680   -0.634  8.057   1.00 0.00 ? 8  ALA A C    8  
ATOM 6254  O O    . ALA A 1 8  ? 5.314   -0.232  7.083   1.00 0.00 ? 8  ALA A O    8  
ATOM 6255  C CB   . ALA A 1 8  ? 3.533   0.498   10.024  1.00 0.00 ? 8  ALA A CB   8  
ATOM 6256  H H    . ALA A 1 8  ? 1.768   -0.506  7.475   1.00 0.00 ? 8  ALA A H    8  
ATOM 6257  H HA   . ALA A 1 8  ? 3.328   1.033   7.957   1.00 0.00 ? 8  ALA A HA   8  
ATOM 6258  H HB1  . ALA A 1 8  ? 3.937   1.506   10.119  1.00 0.00 ? 8  ALA A HB1  8  
ATOM 6259  H HB2  . ALA A 1 8  ? 4.188   -0.205  10.538  1.00 0.00 ? 8  ALA A HB2  8  
ATOM 6260  H HB3  . ALA A 1 8  ? 2.539   0.462   10.470  1.00 0.00 ? 8  ALA A HB3  8  
ATOM 6261  N N    . ASN A 1 9  ? 4.986   -1.716  8.758   1.00 0.00 ? 9  ASN A N    8  
ATOM 6262  C CA   . ASN A 1 9  ? 6.137   -2.532  8.409   1.00 0.00 ? 9  ASN A CA   8  
ATOM 6263  C C    . ASN A 1 9  ? 6.043   -2.936  6.937   1.00 0.00 ? 9  ASN A C    8  
ATOM 6264  O O    . ASN A 1 9  ? 7.054   -2.993  6.239   1.00 0.00 ? 9  ASN A O    8  
ATOM 6265  C CB   . ASN A 1 9  ? 6.181   -3.810  9.249   1.00 0.00 ? 9  ASN A CB   8  
ATOM 6266  C CG   . ASN A 1 9  ? 7.368   -4.688  8.849   1.00 0.00 ? 9  ASN A CG   8  
ATOM 6267  O OD1  . ASN A 1 9  ? 8.253   -4.284  8.113   1.00 0.00 ? 9  ASN A OD1  8  
ATOM 6268  N ND2  . ASN A 1 9  ? 7.337   -5.911  9.372   1.00 0.00 ? 9  ASN A ND2  8  
ATOM 6269  H H    . ASN A 1 9  ? 4.465   -2.036  9.549   1.00 0.00 ? 9  ASN A H    8  
ATOM 6270  H HA   . ASN A 1 9  ? 7.005   -1.905  8.615   1.00 0.00 ? 9  ASN A HA   8  
ATOM 6271  H HB2  . ASN A 1 9  ? 6.254   -3.553  10.306  1.00 0.00 ? 9  ASN A HB2  8  
ATOM 6272  H HB3  . ASN A 1 9  ? 5.252   -4.366  9.120   1.00 0.00 ? 9  ASN A HB3  8  
ATOM 6273  H HD21 . ASN A 1 9  ? 6.581   -6.180  9.969   1.00 0.00 ? 9  ASN A HD21 8  
ATOM 6274  H HD22 . ASN A 1 9  ? 8.069   -6.560  9.170   1.00 0.00 ? 9  ASN A HD22 8  
ATOM 6275  N N    . GLN A 1 10 ? 4.819   -3.207  6.508   1.00 0.00 ? 10 GLN A N    8  
ATOM 6276  C CA   . GLN A 1 10 ? 4.579   -3.604  5.131   1.00 0.00 ? 10 GLN A CA   8  
ATOM 6277  C C    . GLN A 1 10 ? 4.617   -2.382  4.211   1.00 0.00 ? 10 GLN A C    8  
ATOM 6278  O O    . GLN A 1 10 ? 5.110   -2.461  3.087   1.00 0.00 ? 10 GLN A O    8  
ATOM 6279  C CB   . GLN A 1 10 ? 3.250   -4.349  4.999   1.00 0.00 ? 10 GLN A CB   8  
ATOM 6280  C CG   . GLN A 1 10 ? 2.151   -3.659  5.809   1.00 0.00 ? 10 GLN A CG   8  
ATOM 6281  C CD   . GLN A 1 10 ? 0.768   -3.966  5.232   1.00 0.00 ? 10 GLN A CD   8  
ATOM 6282  O OE1  . GLN A 1 10 ? -0.124  -3.133  5.212   1.00 0.00 ? 10 GLN A OE1  8  
ATOM 6283  N NE2  . GLN A 1 10 ? 0.640   -5.204  4.763   1.00 0.00 ? 10 GLN A NE2  8  
ATOM 6284  H H    . GLN A 1 10 ? 4.001   -3.158  7.082   1.00 0.00 ? 10 GLN A H    8  
ATOM 6285  H HA   . GLN A 1 10 ? 5.395   -4.282  4.879   1.00 0.00 ? 10 GLN A HA   8  
ATOM 6286  H HB2  . GLN A 1 10 ? 2.957   -4.396  3.950   1.00 0.00 ? 10 GLN A HB2  8  
ATOM 6287  H HB3  . GLN A 1 10 ? 3.368   -5.377  5.342   1.00 0.00 ? 10 GLN A HB3  8  
ATOM 6288  H HG2  . GLN A 1 10 ? 2.197   -3.989  6.847   1.00 0.00 ? 10 GLN A HG2  8  
ATOM 6289  H HG3  . GLN A 1 10 ? 2.318   -2.581  5.810   1.00 0.00 ? 10 GLN A HG3  8  
ATOM 6290  H HE21 . GLN A 1 10 ? 1.412   -5.838  4.810   1.00 0.00 ? 10 GLN A HE21 8  
ATOM 6291  H HE22 . GLN A 1 10 ? -0.228  -5.501  4.365   1.00 0.00 ? 10 GLN A HE22 8  
ATOM 6292  N N    . CYS A 1 11 ? 4.089   -1.280  4.723   1.00 0.00 ? 11 CYS A N    8  
ATOM 6293  C CA   . CYS A 1 11 ? 4.056   -0.043  3.962   1.00 0.00 ? 11 CYS A CA   8  
ATOM 6294  C C    . CYS A 1 11 ? 5.111   0.904   4.537   1.00 0.00 ? 11 CYS A C    8  
ATOM 6295  O O    . CYS A 1 11 ? 4.863   2.100   4.685   1.00 0.00 ? 11 CYS A O    8  
ATOM 6296  C CB   . CYS A 1 11 ? 2.661   0.587   3.966   1.00 0.00 ? 11 CYS A CB   8  
ATOM 6297  S SG   . CYS A 1 11 ? 1.299   -0.569  4.362   1.00 0.00 ? 11 CYS A SG   8  
ATOM 6298  H H    . CYS A 1 11 ? 3.690   -1.224  5.638   1.00 0.00 ? 11 CYS A H    8  
ATOM 6299  H HA   . CYS A 1 11 ? 4.292   -0.303  2.930   1.00 0.00 ? 11 CYS A HA   8  
ATOM 6300  H HB2  . CYS A 1 11 ? 2.648   1.403   4.689   1.00 0.00 ? 11 CYS A HB2  8  
ATOM 6301  H HB3  . CYS A 1 11 ? 2.473   1.026   2.986   1.00 0.00 ? 11 CYS A HB3  8  
ATOM 6302  N N    . ALA A 1 12 ? 6.266   0.334   4.847   1.00 0.00 ? 12 ALA A N    8  
ATOM 6303  C CA   . ALA A 1 12 ? 7.360   1.112   5.403   1.00 0.00 ? 12 ALA A CA   8  
ATOM 6304  C C    . ALA A 1 12 ? 8.365   1.435   4.296   1.00 0.00 ? 12 ALA A C    8  
ATOM 6305  O O    . ALA A 1 12 ? 9.574   1.386   4.516   1.00 0.00 ? 12 ALA A O    8  
ATOM 6306  C CB   . ALA A 1 12 ? 7.996   0.342   6.562   1.00 0.00 ? 12 ALA A CB   8  
ATOM 6307  H H    . ALA A 1 12 ? 6.460   -0.640  4.723   1.00 0.00 ? 12 ALA A H    8  
ATOM 6308  H HA   . ALA A 1 12 ? 6.943   2.043   5.787   1.00 0.00 ? 12 ALA A HA   8  
ATOM 6309  H HB1  . ALA A 1 12 ? 9.078   0.311   6.427   1.00 0.00 ? 12 ALA A HB1  8  
ATOM 6310  H HB2  . ALA A 1 12 ? 7.761   0.841   7.502   1.00 0.00 ? 12 ALA A HB2  8  
ATOM 6311  H HB3  . ALA A 1 12 ? 7.604   -0.674  6.582   1.00 0.00 ? 12 ALA A HB3  8  
ATOM 6312  N N    . VAL A 1 13 ? 7.828   1.757   3.128   1.00 0.00 ? 13 VAL A N    8  
ATOM 6313  C CA   . VAL A 1 13 ? 8.663   2.088   1.986   1.00 0.00 ? 13 VAL A CA   8  
ATOM 6314  C C    . VAL A 1 13 ? 8.874   3.603   1.936   1.00 0.00 ? 13 VAL A C    8  
ATOM 6315  O O    . VAL A 1 13 ? 8.034   4.366   2.408   1.00 0.00 ? 13 VAL A O    8  
ATOM 6316  C CB   . VAL A 1 13 ? 8.042   1.529   0.705   1.00 0.00 ? 13 VAL A CB   8  
ATOM 6317  C CG1  . VAL A 1 13 ? 9.098   0.837   -0.160  1.00 0.00 ? 13 VAL A CG1  8  
ATOM 6318  C CG2  . VAL A 1 13 ? 6.887   0.578   1.025   1.00 0.00 ? 13 VAL A CG2  8  
ATOM 6319  H H    . VAL A 1 13 ? 6.843   1.795   2.957   1.00 0.00 ? 13 VAL A H    8  
ATOM 6320  H HA   . VAL A 1 13 ? 9.628   1.604   2.133   1.00 0.00 ? 13 VAL A HA   8  
ATOM 6321  H HB   . VAL A 1 13 ? 7.638   2.366   0.135   1.00 0.00 ? 13 VAL A HB   8  
ATOM 6322  H HG11 . VAL A 1 13 ? 10.018  0.722   0.413   1.00 0.00 ? 13 VAL A HG11 8  
ATOM 6323  H HG12 . VAL A 1 13 ? 8.734   -0.145  -0.462  1.00 0.00 ? 13 VAL A HG12 8  
ATOM 6324  H HG13 . VAL A 1 13 ? 9.295   1.441   -1.046  1.00 0.00 ? 13 VAL A HG13 8  
ATOM 6325  H HG21 . VAL A 1 13 ? 7.145   -0.027  1.894   1.00 0.00 ? 13 VAL A HG21 8  
ATOM 6326  H HG22 . VAL A 1 13 ? 5.988   1.157   1.239   1.00 0.00 ? 13 VAL A HG22 8  
ATOM 6327  H HG23 . VAL A 1 13 ? 6.705   -0.073  0.170   1.00 0.00 ? 13 VAL A HG23 8  
ATOM 6328  N N    . PRO A 1 14 ? 10.032  4.002   1.344   1.00 0.00 ? 14 PRO A N    8  
ATOM 6329  C CA   . PRO A 1 14 ? 10.365  5.411   1.227   1.00 0.00 ? 14 PRO A CA   8  
ATOM 6330  C C    . PRO A 1 14 ? 9.533   6.082   0.131   1.00 0.00 ? 14 PRO A C    8  
ATOM 6331  O O    . PRO A 1 14 ? 8.793   7.027   0.399   1.00 0.00 ? 14 PRO A O    8  
ATOM 6332  C CB   . PRO A 1 14 ? 11.857  5.441   0.941   1.00 0.00 ? 14 PRO A CB   8  
ATOM 6333  C CG   . PRO A 1 14 ? 12.215  4.047   0.450   1.00 0.00 ? 14 PRO A CG   8  
ATOM 6334  C CD   . PRO A 1 14 ? 11.051  3.126   0.774   1.00 0.00 ? 14 PRO A CD   8  
ATOM 6335  H HA   . PRO A 1 14 ? 10.140  5.893   2.074   1.00 0.00 ? 14 PRO A HA   8  
ATOM 6336  H HB2  . PRO A 1 14 ? 12.097  6.193   0.190   1.00 0.00 ? 14 PRO A HB2  8  
ATOM 6337  H HB3  . PRO A 1 14 ? 12.422  5.696   1.838   1.00 0.00 ? 14 PRO A HB3  8  
ATOM 6338  H HG2  . PRO A 1 14 ? 12.406  4.058   -0.623  1.00 0.00 ? 14 PRO A HG2  8  
ATOM 6339  H HG3  . PRO A 1 14 ? 13.127  3.695   0.932   1.00 0.00 ? 14 PRO A HG3  8  
ATOM 6340  H HD2  . PRO A 1 14 ? 10.684  2.621   -0.120  1.00 0.00 ? 14 PRO A HD2  8  
ATOM 6341  H HD3  . PRO A 1 14 ? 11.345  2.349   1.480   1.00 0.00 ? 14 PRO A HD3  8  
ATOM 6342  N N    . ALA A 1 15 ? 9.683   5.565   -1.080  1.00 0.00 ? 15 ALA A N    8  
ATOM 6343  C CA   . ALA A 1 15 ? 8.955   6.102   -2.217  1.00 0.00 ? 15 ALA A CA   8  
ATOM 6344  C C    . ALA A 1 15 ? 9.634   5.650   -3.512  1.00 0.00 ? 15 ALA A C    8  
ATOM 6345  O O    . ALA A 1 15 ? 9.001   5.600   -4.565  1.00 0.00 ? 15 ALA A O    8  
ATOM 6346  C CB   . ALA A 1 15 ? 8.877   7.625   -2.101  1.00 0.00 ? 15 ALA A CB   8  
ATOM 6347  H H    . ALA A 1 15 ? 10.287  4.796   -1.289  1.00 0.00 ? 15 ALA A H    8  
ATOM 6348  H HA   . ALA A 1 15 ? 7.944   5.695   -2.186  1.00 0.00 ? 15 ALA A HA   8  
ATOM 6349  H HB1  . ALA A 1 15 ? 9.602   7.971   -1.365  1.00 0.00 ? 15 ALA A HB1  8  
ATOM 6350  H HB2  . ALA A 1 15 ? 7.874   7.915   -1.787  1.00 0.00 ? 15 ALA A HB2  8  
ATOM 6351  H HB3  . ALA A 1 15 ? 9.098   8.075   -3.069  1.00 0.00 ? 15 ALA A HB3  8  
ATOM 6352  N N    . LYS A 1 16 ? 10.915  5.332   -3.390  1.00 0.00 ? 16 LYS A N    8  
ATOM 6353  C CA   . LYS A 1 16 ? 11.687  4.886   -4.537  1.00 0.00 ? 16 LYS A CA   8  
ATOM 6354  C C    . LYS A 1 16 ? 11.650  3.358   -4.609  1.00 0.00 ? 16 LYS A C    8  
ATOM 6355  O O    . LYS A 1 16 ? 12.308  2.757   -5.457  1.00 0.00 ? 16 LYS A O    8  
ATOM 6356  C CB   . LYS A 1 16 ? 13.102  5.466   -4.488  1.00 0.00 ? 16 LYS A CB   8  
ATOM 6357  C CG   . LYS A 1 16 ? 13.886  4.900   -3.302  1.00 0.00 ? 16 LYS A CG   8  
ATOM 6358  C CD   . LYS A 1 16 ? 14.684  3.661   -3.712  1.00 0.00 ? 16 LYS A CD   8  
ATOM 6359  C CE   . LYS A 1 16 ? 16.166  3.997   -3.890  1.00 0.00 ? 16 LYS A CE   8  
ATOM 6360  N NZ   . LYS A 1 16 ? 17.010  2.854   -3.474  1.00 0.00 ? 16 LYS A NZ   8  
ATOM 6361  H H    . LYS A 1 16 ? 11.423  5.376   -2.530  1.00 0.00 ? 16 LYS A H    8  
ATOM 6362  H HA   . LYS A 1 16 ? 11.206  5.286   -5.430  1.00 0.00 ? 16 LYS A HA   8  
ATOM 6363  H HB2  . LYS A 1 16 ? 13.626  5.237   -5.417  1.00 0.00 ? 16 LYS A HB2  8  
ATOM 6364  H HB3  . LYS A 1 16 ? 13.052  6.552   -4.411  1.00 0.00 ? 16 LYS A HB3  8  
ATOM 6365  H HG2  . LYS A 1 16 ? 14.563  5.661   -2.913  1.00 0.00 ? 16 LYS A HG2  8  
ATOM 6366  H HG3  . LYS A 1 16 ? 13.198  4.644   -2.496  1.00 0.00 ? 16 LYS A HG3  8  
ATOM 6367  H HD2  . LYS A 1 16 ? 14.571  2.884   -2.956  1.00 0.00 ? 16 LYS A HD2  8  
ATOM 6368  H HD3  . LYS A 1 16 ? 14.284  3.258   -4.643  1.00 0.00 ? 16 LYS A HD3  8  
ATOM 6369  H HE2  . LYS A 1 16 ? 16.366  4.244   -4.933  1.00 0.00 ? 16 LYS A HE2  8  
ATOM 6370  H HE3  . LYS A 1 16 ? 16.418  4.877   -3.300  1.00 0.00 ? 16 LYS A HE3  8  
ATOM 6371  H HZ1  . LYS A 1 16 ? 16.706  2.524   -2.580  1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 6372  H HZ2  . LYS A 1 16 ? 16.930  2.118   -4.146  1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 6373  H HZ3  . LYS A 1 16 ? 17.963  3.149   -3.414  1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 6374  N N    . ASP A 1 17 ? 10.875  2.774   -3.707  1.00 0.00 ? 17 ASP A N    8  
ATOM 6375  C CA   . ASP A 1 17 ? 10.744  1.328   -3.657  1.00 0.00 ? 17 ASP A CA   8  
ATOM 6376  C C    . ASP A 1 17 ? 9.273   0.947   -3.831  1.00 0.00 ? 17 ASP A C    8  
ATOM 6377  O O    . ASP A 1 17 ? 8.897   -0.205  -3.621  1.00 0.00 ? 17 ASP A O    8  
ATOM 6378  C CB   . ASP A 1 17 ? 11.218  0.778   -2.310  1.00 0.00 ? 17 ASP A CB   8  
ATOM 6379  C CG   . ASP A 1 17 ? 12.551  0.028   -2.351  1.00 0.00 ? 17 ASP A CG   8  
ATOM 6380  O OD1  . ASP A 1 17 ? 13.255  0.178   -3.373  1.00 0.00 ? 17 ASP A OD1  8  
ATOM 6381  O OD2  . ASP A 1 17 ? 12.836  -0.677  -1.359  1.00 0.00 ? 17 ASP A OD2  8  
ATOM 6382  H H    . ASP A 1 17 ? 10.344  3.271   -3.020  1.00 0.00 ? 17 ASP A H    8  
ATOM 6383  H HA   . ASP A 1 17 ? 11.370  0.955   -4.467  1.00 0.00 ? 17 ASP A HA   8  
ATOM 6384  H HB2  . ASP A 1 17 ? 11.306  1.607   -1.607  1.00 0.00 ? 17 ASP A HB2  8  
ATOM 6385  H HB3  . ASP A 1 17 ? 10.453  0.108   -1.919  1.00 0.00 ? 17 ASP A HB3  8  
ATOM 6386  N N    . ARG A 1 18 ? 8.480   1.937   -4.214  1.00 0.00 ? 18 ARG A N    8  
ATOM 6387  C CA   . ARG A 1 18 ? 7.058   1.721   -4.419  1.00 0.00 ? 18 ARG A CA   8  
ATOM 6388  C C    . ARG A 1 18 ? 6.816   1.012   -5.753  1.00 0.00 ? 18 ARG A C    8  
ATOM 6389  O O    . ARG A 1 18 ? 7.155   1.540   -6.811  1.00 0.00 ? 18 ARG A O    8  
ATOM 6390  C CB   . ARG A 1 18 ? 6.291   3.045   -4.407  1.00 0.00 ? 18 ARG A CB   8  
ATOM 6391  C CG   . ARG A 1 18 ? 6.809   3.968   -3.302  1.00 0.00 ? 18 ARG A CG   8  
ATOM 6392  C CD   . ARG A 1 18 ? 6.589   3.347   -1.921  1.00 0.00 ? 18 ARG A CD   8  
ATOM 6393  N NE   . ARG A 1 18 ? 6.836   4.356   -0.867  1.00 0.00 ? 18 ARG A NE   8  
ATOM 6394  C CZ   . ARG A 1 18 ? 6.091   5.455   -0.689  1.00 0.00 ? 18 ARG A CZ   8  
ATOM 6395  N NH1  . ARG A 1 18 ? 5.046   5.693   -1.494  1.00 0.00 ? 18 ARG A NH1  8  
ATOM 6396  N NH2  . ARG A 1 18 ? 6.389   6.316   0.294   1.00 0.00 ? 18 ARG A NH2  8  
ATOM 6397  H H    . ARG A 1 18 ? 8.793   2.872   -4.382  1.00 0.00 ? 18 ARG A H    8  
ATOM 6398  H HA   . ARG A 1 18 ? 6.747   1.096   -3.581  1.00 0.00 ? 18 ARG A HA   8  
ATOM 6399  H HB2  . ARG A 1 18 ? 6.393   3.537   -5.374  1.00 0.00 ? 18 ARG A HB2  8  
ATOM 6400  H HB3  . ARG A 1 18 ? 5.229   2.853   -4.257  1.00 0.00 ? 18 ARG A HB3  8  
ATOM 6401  H HG2  . ARG A 1 18 ? 7.871   4.161   -3.452  1.00 0.00 ? 18 ARG A HG2  8  
ATOM 6402  H HG3  . ARG A 1 18 ? 6.299   4.929   -3.357  1.00 0.00 ? 18 ARG A HG3  8  
ATOM 6403  H HD2  . ARG A 1 18 ? 5.570   2.968   -1.841  1.00 0.00 ? 18 ARG A HD2  8  
ATOM 6404  H HD3  . ARG A 1 18 ? 7.257   2.496   -1.785  1.00 0.00 ? 18 ARG A HD3  8  
ATOM 6405  H HE   . ARG A 1 18 ? 7.608   4.208   -0.248  1.00 0.00 ? 18 ARG A HE   8  
ATOM 6406  H HH11 . ARG A 1 18 ? 4.824   5.051   -2.227  1.00 0.00 ? 18 ARG A HH11 8  
ATOM 6407  H HH12 . ARG A 1 18 ? 4.490   6.514   -1.361  1.00 0.00 ? 18 ARG A HH12 8  
ATOM 6408  H HH21 . ARG A 1 18 ? 7.169   6.138   0.894   1.00 0.00 ? 18 ARG A HH21 8  
ATOM 6409  H HH22 . ARG A 1 18 ? 5.833   7.136   0.426   1.00 0.00 ? 18 ARG A HH22 8  
ATOM 6410  N N    . VAL A 1 19 ? 6.232   -0.174  -5.659  1.00 0.00 ? 19 VAL A N    8  
ATOM 6411  C CA   . VAL A 1 19 ? 5.940   -0.960  -6.846  1.00 0.00 ? 19 VAL A CA   8  
ATOM 6412  C C    . VAL A 1 19 ? 4.595   -0.520  -7.427  1.00 0.00 ? 19 VAL A C    8  
ATOM 6413  O O    . VAL A 1 19 ? 4.219   -0.942  -8.520  1.00 0.00 ? 19 VAL A O    8  
ATOM 6414  C CB   . VAL A 1 19 ? 5.986   -2.452  -6.509  1.00 0.00 ? 19 VAL A CB   8  
ATOM 6415  C CG1  . VAL A 1 19 ? 6.258   -3.289  -7.761  1.00 0.00 ? 19 VAL A CG1  8  
ATOM 6416  C CG2  . VAL A 1 19 ? 7.025   -2.737  -5.423  1.00 0.00 ? 19 VAL A CG2  8  
ATOM 6417  H H    . VAL A 1 19 ? 5.959   -0.596  -4.795  1.00 0.00 ? 19 VAL A H    8  
ATOM 6418  H HA   . VAL A 1 19 ? 6.723   -0.755  -7.577  1.00 0.00 ? 19 VAL A HA   8  
ATOM 6419  H HB   . VAL A 1 19 ? 5.009   -2.738  -6.121  1.00 0.00 ? 19 VAL A HB   8  
ATOM 6420  H HG11 . VAL A 1 19 ? 7.056   -2.825  -8.342  1.00 0.00 ? 19 VAL A HG11 8  
ATOM 6421  H HG12 . VAL A 1 19 ? 6.560   -4.294  -7.467  1.00 0.00 ? 19 VAL A HG12 8  
ATOM 6422  H HG13 . VAL A 1 19 ? 5.353   -3.343  -8.365  1.00 0.00 ? 19 VAL A HG13 8  
ATOM 6423  H HG21 . VAL A 1 19 ? 7.776   -1.947  -5.422  1.00 0.00 ? 19 VAL A HG21 8  
ATOM 6424  H HG22 . VAL A 1 19 ? 6.534   -2.773  -4.450  1.00 0.00 ? 19 VAL A HG22 8  
ATOM 6425  H HG23 . VAL A 1 19 ? 7.507   -3.695  -5.622  1.00 0.00 ? 19 VAL A HG23 8  
ATOM 6426  N N    . ASP A 1 20 ? 3.908   0.323   -6.671  1.00 0.00 ? 20 ASP A N    8  
ATOM 6427  C CA   . ASP A 1 20 ? 2.613   0.826   -7.098  1.00 0.00 ? 20 ASP A CA   8  
ATOM 6428  C C    . ASP A 1 20 ? 1.662   -0.352  -7.319  1.00 0.00 ? 20 ASP A C    8  
ATOM 6429  O O    . ASP A 1 20 ? 1.910   -1.203  -8.172  1.00 0.00 ? 20 ASP A O    8  
ATOM 6430  C CB   . ASP A 1 20 ? 2.727   1.595   -8.415  1.00 0.00 ? 20 ASP A CB   8  
ATOM 6431  C CG   . ASP A 1 20 ? 1.403   1.829   -9.144  1.00 0.00 ? 20 ASP A CG   8  
ATOM 6432  O OD1  . ASP A 1 20 ? 0.508   2.436   -8.517  1.00 0.00 ? 20 ASP A OD1  8  
ATOM 6433  O OD2  . ASP A 1 20 ? 1.315   1.395   -10.313 1.00 0.00 ? 20 ASP A OD2  8  
ATOM 6434  H H    . ASP A 1 20 ? 4.221   0.662   -5.784  1.00 0.00 ? 20 ASP A H    8  
ATOM 6435  H HA   . ASP A 1 20 ? 2.282   1.483   -6.294  1.00 0.00 ? 20 ASP A HA   8  
ATOM 6436  H HB2  . ASP A 1 20 ? 3.190   2.562   -8.215  1.00 0.00 ? 20 ASP A HB2  8  
ATOM 6437  H HB3  . ASP A 1 20 ? 3.399   1.052   -9.079  1.00 0.00 ? 20 ASP A HB3  8  
ATOM 6438  N N    . CYS A 1 21 ? 0.592   -0.363  -6.537  1.00 0.00 ? 21 CYS A N    8  
ATOM 6439  C CA   . CYS A 1 21 ? -0.397  -1.423  -6.637  1.00 0.00 ? 21 CYS A CA   8  
ATOM 6440  C C    . CYS A 1 21 ? -1.388  -1.051  -7.742  1.00 0.00 ? 21 CYS A C    8  
ATOM 6441  O O    . CYS A 1 21 ? -2.006  -1.926  -8.347  1.00 0.00 ? 21 CYS A O    8  
ATOM 6442  C CB   . CYS A 1 21 ? -1.099  -1.669  -5.300  1.00 0.00 ? 21 CYS A CB   8  
ATOM 6443  S SG   . CYS A 1 21 ? -1.531  -3.417  -4.971  1.00 0.00 ? 21 CYS A SG   8  
ATOM 6444  H H    . CYS A 1 21 ? 0.398   0.333   -5.846  1.00 0.00 ? 21 CYS A H    8  
ATOM 6445  H HA   . CYS A 1 21 ? 0.144   -2.333  -6.893  1.00 0.00 ? 21 CYS A HA   8  
ATOM 6446  H HB2  . CYS A 1 21 ? -0.455  -1.311  -4.496  1.00 0.00 ? 21 CYS A HB2  8  
ATOM 6447  H HB3  . CYS A 1 21 ? -2.010  -1.072  -5.268  1.00 0.00 ? 21 CYS A HB3  8  
ATOM 6448  N N    . GLY A 1 22 ? -1.510  0.248   -7.971  1.00 0.00 ? 22 GLY A N    8  
ATOM 6449  C CA   . GLY A 1 22 ? -2.416  0.746   -8.993  1.00 0.00 ? 22 GLY A CA   8  
ATOM 6450  C C    . GLY A 1 22 ? -3.873  0.606   -8.549  1.00 0.00 ? 22 GLY A C    8  
ATOM 6451  O O    . GLY A 1 22 ? -4.507  -0.418  -8.800  1.00 0.00 ? 22 GLY A O    8  
ATOM 6452  H H    . GLY A 1 22 ? -1.004  0.953   -7.475  1.00 0.00 ? 22 GLY A H    8  
ATOM 6453  H HA2  . GLY A 1 22 ? -2.194  1.793   -9.201  1.00 0.00 ? 22 GLY A HA2  8  
ATOM 6454  H HA3  . GLY A 1 22 ? -2.260  0.196   -9.921  1.00 0.00 ? 22 GLY A HA3  8  
ATOM 6455  N N    . TYR A 1 23 ? -4.362  1.650   -7.896  1.00 0.00 ? 23 TYR A N    8  
ATOM 6456  C CA   . TYR A 1 23 ? -5.733  1.656   -7.415  1.00 0.00 ? 23 TYR A CA   8  
ATOM 6457  C C    . TYR A 1 23 ? -6.385  3.023   -7.633  1.00 0.00 ? 23 TYR A C    8  
ATOM 6458  O O    . TYR A 1 23 ? -5.713  4.052   -7.575  1.00 0.00 ? 23 TYR A O    8  
ATOM 6459  C CB   . TYR A 1 23 ? -5.654  1.377   -5.912  1.00 0.00 ? 23 TYR A CB   8  
ATOM 6460  C CG   . TYR A 1 23 ? -5.759  -0.106  -5.549  1.00 0.00 ? 23 TYR A CG   8  
ATOM 6461  C CD1  . TYR A 1 23 ? -6.942  -0.785  -5.756  1.00 0.00 ? 23 TYR A CD1  8  
ATOM 6462  C CD2  . TYR A 1 23 ? -4.670  -0.764  -5.014  1.00 0.00 ? 23 TYR A CD2  8  
ATOM 6463  C CE1  . TYR A 1 23 ? -7.041  -2.180  -5.414  1.00 0.00 ? 23 TYR A CE1  8  
ATOM 6464  C CE2  . TYR A 1 23 ? -4.769  -2.159  -4.672  1.00 0.00 ? 23 TYR A CE2  8  
ATOM 6465  C CZ   . TYR A 1 23 ? -5.949  -2.798  -4.889  1.00 0.00 ? 23 TYR A CZ   8  
ATOM 6466  O OH   . TYR A 1 23 ? -6.043  -4.116  -4.566  1.00 0.00 ? 23 TYR A OH   8  
ATOM 6467  H H    . TYR A 1 23 ? -3.840  2.479   -7.695  1.00 0.00 ? 23 TYR A H    8  
ATOM 6468  H HA   . TYR A 1 23 ? -6.289  0.903   -7.973  1.00 0.00 ? 23 TYR A HA   8  
ATOM 6469  H HB2  . TYR A 1 23 ? -4.712  1.768   -5.530  1.00 0.00 ? 23 TYR A HB2  8  
ATOM 6470  H HB3  . TYR A 1 23 ? -6.453  1.921   -5.409  1.00 0.00 ? 23 TYR A HB3  8  
ATOM 6471  H HD1  . TYR A 1 23 ? -7.802  -0.265  -6.178  1.00 0.00 ? 23 TYR A HD1  8  
ATOM 6472  H HD2  . TYR A 1 23 ? -3.735  -0.227  -4.851  1.00 0.00 ? 23 TYR A HD2  8  
ATOM 6473  H HE1  . TYR A 1 23 ? -7.970  -2.728  -5.572  1.00 0.00 ? 23 TYR A HE1  8  
ATOM 6474  H HE2  . TYR A 1 23 ? -3.917  -2.691  -4.249  1.00 0.00 ? 23 TYR A HE2  8  
ATOM 6475  H HH   . TYR A 1 23 ? -5.982  -4.676  -5.392  1.00 0.00 ? 23 TYR A HH   8  
ATOM 6476  N N    . PRO A 1 24 ? -7.721  2.989   -7.887  1.00 0.00 ? 24 PRO A N    8  
ATOM 6477  C CA   . PRO A 1 24 ? -8.471  4.213   -8.115  1.00 0.00 ? 24 PRO A CA   8  
ATOM 6478  C C    . PRO A 1 24 ? -8.704  4.965   -6.803  1.00 0.00 ? 24 PRO A C    8  
ATOM 6479  O O    . PRO A 1 24 ? -8.063  5.983   -6.544  1.00 0.00 ? 24 PRO A O    8  
ATOM 6480  C CB   . PRO A 1 24 ? -9.762  3.765   -8.780  1.00 0.00 ? 24 PRO A CB   8  
ATOM 6481  C CG   . PRO A 1 24 ? -9.892  2.280   -8.480  1.00 0.00 ? 24 PRO A CG   8  
ATOM 6482  C CD   . PRO A 1 24 ? -8.549  1.790   -7.964  1.00 0.00 ? 24 PRO A CD   8  
ATOM 6483  H HA   . PRO A 1 24 ? -7.950  4.836   -8.698  1.00 0.00 ? 24 PRO A HA   8  
ATOM 6484  H HB2  . PRO A 1 24 ? -10.615 4.319   -8.389  1.00 0.00 ? 24 PRO A HB2  8  
ATOM 6485  H HB3  . PRO A 1 24 ? -9.730  3.945   -9.855  1.00 0.00 ? 24 PRO A HB3  8  
ATOM 6486  H HG2  . PRO A 1 24 ? -10.672 2.108   -7.739  1.00 0.00 ? 24 PRO A HG2  8  
ATOM 6487  H HG3  . PRO A 1 24 ? -10.178 1.733   -9.379  1.00 0.00 ? 24 PRO A HG3  8  
ATOM 6488  H HD2  . PRO A 1 24 ? -8.650  1.315   -6.988  1.00 0.00 ? 24 PRO A HD2  8  
ATOM 6489  H HD3  . PRO A 1 24 ? -8.113  1.049   -8.634  1.00 0.00 ? 24 PRO A HD3  8  
ATOM 6490  N N    . HIS A 1 25 ? -9.623  4.435   -6.009  1.00 0.00 ? 25 HIS A N    8  
ATOM 6491  C CA   . HIS A 1 25 ? -9.949  5.044   -4.731  1.00 0.00 ? 25 HIS A CA   8  
ATOM 6492  C C    . HIS A 1 25 ? -9.005  4.508   -3.652  1.00 0.00 ? 25 HIS A C    8  
ATOM 6493  O O    . HIS A 1 25 ? -9.355  3.584   -2.920  1.00 0.00 ? 25 HIS A O    8  
ATOM 6494  C CB   . HIS A 1 25 ? -11.425 4.829   -4.387  1.00 0.00 ? 25 HIS A CB   8  
ATOM 6495  C CG   . HIS A 1 25 ? -11.771 3.403   -4.033  1.00 0.00 ? 25 HIS A CG   8  
ATOM 6496  N ND1  . HIS A 1 25 ? -12.961 3.051   -3.419  1.00 0.00 ? 25 HIS A ND1  8  
ATOM 6497  C CD2  . HIS A 1 25 ? -11.074 2.245   -4.213  1.00 0.00 ? 25 HIS A CD2  8  
ATOM 6498  C CE1  . HIS A 1 25 ? -12.967 1.738   -3.241  1.00 0.00 ? 25 HIS A CE1  8  
ATOM 6499  N NE2  . HIS A 1 25 ? -11.797 1.240   -3.734  1.00 0.00 ? 25 HIS A NE2  8  
ATOM 6500  H H    . HIS A 1 25 ? -10.140 3.607   -6.227  1.00 0.00 ? 25 HIS A H    8  
ATOM 6501  H HA   . HIS A 1 25 ? -9.787  6.116   -4.844  1.00 0.00 ? 25 HIS A HA   8  
ATOM 6502  H HB2  . HIS A 1 25 ? -11.690 5.475   -3.551  1.00 0.00 ? 25 HIS A HB2  8  
ATOM 6503  H HB3  . HIS A 1 25 ? -12.034 5.140   -5.236  1.00 0.00 ? 25 HIS A HB3  8  
ATOM 6504  H HD1  . HIS A 1 25 ? -13.691 3.680   -3.154  1.00 0.00 ? 25 HIS A HD1  8  
ATOM 6505  H HD2  . HIS A 1 25 ? -10.089 2.159   -4.673  1.00 0.00 ? 25 HIS A HD2  8  
ATOM 6506  H HE1  . HIS A 1 25 ? -13.767 1.157   -2.782  1.00 0.00 ? 25 HIS A HE1  8  
ATOM 6507  H HE2  . HIS A 1 25 ? -11.553 0.271   -3.785  1.00 0.00 ? 25 HIS A HE2  8  
ATOM 6508  N N    . VAL A 1 26 ? -7.828  5.112   -3.589  1.00 0.00 ? 26 VAL A N    8  
ATOM 6509  C CA   . VAL A 1 26 ? -6.831  4.708   -2.612  1.00 0.00 ? 26 VAL A CA   8  
ATOM 6510  C C    . VAL A 1 26 ? -6.948  5.597   -1.373  1.00 0.00 ? 26 VAL A C    8  
ATOM 6511  O O    . VAL A 1 26 ? -7.134  6.808   -1.488  1.00 0.00 ? 26 VAL A O    8  
ATOM 6512  C CB   . VAL A 1 26 ? -5.437  4.741   -3.243  1.00 0.00 ? 26 VAL A CB   8  
ATOM 6513  C CG1  . VAL A 1 26 ? -5.305  3.681   -4.338  1.00 0.00 ? 26 VAL A CG1  8  
ATOM 6514  C CG2  . VAL A 1 26 ? -5.114  6.134   -3.787  1.00 0.00 ? 26 VAL A CG2  8  
ATOM 6515  H H    . VAL A 1 26 ? -7.551  5.863   -4.189  1.00 0.00 ? 26 VAL A H    8  
ATOM 6516  H HA   . VAL A 1 26 ? -7.048  3.679   -2.328  1.00 0.00 ? 26 VAL A HA   8  
ATOM 6517  H HB   . VAL A 1 26 ? -4.711  4.510   -2.463  1.00 0.00 ? 26 VAL A HB   8  
ATOM 6518  H HG11 . VAL A 1 26 ? -6.087  3.828   -5.083  1.00 0.00 ? 26 VAL A HG11 8  
ATOM 6519  H HG12 . VAL A 1 26 ? -4.328  3.769   -4.813  1.00 0.00 ? 26 VAL A HG12 8  
ATOM 6520  H HG13 . VAL A 1 26 ? -5.406  2.689   -3.897  1.00 0.00 ? 26 VAL A HG13 8  
ATOM 6521  H HG21 . VAL A 1 26 ? -5.894  6.832   -3.484  1.00 0.00 ? 26 VAL A HG21 8  
ATOM 6522  H HG22 . VAL A 1 26 ? -4.155  6.466   -3.390  1.00 0.00 ? 26 VAL A HG22 8  
ATOM 6523  H HG23 . VAL A 1 26 ? -5.064  6.096   -4.875  1.00 0.00 ? 26 VAL A HG23 8  
ATOM 6524  N N    . THR A 1 27 ? -6.833  4.962   -0.216  1.00 0.00 ? 27 THR A N    8  
ATOM 6525  C CA   . THR A 1 27 ? -6.924  5.681   1.044   1.00 0.00 ? 27 THR A CA   8  
ATOM 6526  C C    . THR A 1 27 ? -6.107  4.968   2.124   1.00 0.00 ? 27 THR A C    8  
ATOM 6527  O O    . THR A 1 27 ? -5.631  3.854   1.914   1.00 0.00 ? 27 THR A O    8  
ATOM 6528  C CB   . THR A 1 27 ? -8.405  5.827   1.400   1.00 0.00 ? 27 THR A CB   8  
ATOM 6529  O OG1  . THR A 1 27 ? -8.728  4.602   2.052   1.00 0.00 ? 27 THR A OG1  8  
ATOM 6530  C CG2  . THR A 1 27 ? -9.305  5.840   0.163   1.00 0.00 ? 27 THR A CG2  8  
ATOM 6531  H H    . THR A 1 27 ? -6.682  3.978   -0.130  1.00 0.00 ? 27 THR A H    8  
ATOM 6532  H HA   . THR A 1 27 ? -6.483  6.668   0.909   1.00 0.00 ? 27 THR A HA   8  
ATOM 6533  H HB   . THR A 1 27 ? -8.572  6.713   2.013   1.00 0.00 ? 27 THR A HB   8  
ATOM 6534  H HG1  . THR A 1 27 ? -9.694  4.597   2.310   1.00 0.00 ? 27 THR A HG1  8  
ATOM 6535  H HG21 . THR A 1 27 ? -9.082  4.973   -0.458  1.00 0.00 ? 27 THR A HG21 8  
ATOM 6536  H HG22 . THR A 1 27 ? -10.349 5.806   0.473   1.00 0.00 ? 27 THR A HG22 8  
ATOM 6537  H HG23 . THR A 1 27 ? -9.126  6.752   -0.408  1.00 0.00 ? 27 THR A HG23 8  
ATOM 6538  N N    . PRO A 1 28 ? -5.967  5.659   3.288   1.00 0.00 ? 28 PRO A N    8  
ATOM 6539  C CA   . PRO A 1 28 ? -5.216  5.104   4.401   1.00 0.00 ? 28 PRO A CA   8  
ATOM 6540  C C    . PRO A 1 28 ? -6.014  4.007   5.108   1.00 0.00 ? 28 PRO A C    8  
ATOM 6541  O O    . PRO A 1 28 ? -6.000  3.916   6.335   1.00 0.00 ? 28 PRO A O    8  
ATOM 6542  C CB   . PRO A 1 28 ? -4.912  6.291   5.301   1.00 0.00 ? 28 PRO A CB   8  
ATOM 6543  C CG   . PRO A 1 28 ? -5.894  7.380   4.901   1.00 0.00 ? 28 PRO A CG   8  
ATOM 6544  C CD   . PRO A 1 28 ? -6.517  6.981   3.573   1.00 0.00 ? 28 PRO A CD   8  
ATOM 6545  H HA   . PRO A 1 28 ? -4.380  4.665   4.072   1.00 0.00 ? 28 PRO A HA   8  
ATOM 6546  H HB2  . PRO A 1 28 ? -5.030  6.025   6.351   1.00 0.00 ? 28 PRO A HB2  8  
ATOM 6547  H HB3  . PRO A 1 28 ? -3.883  6.626   5.170   1.00 0.00 ? 28 PRO A HB3  8  
ATOM 6548  H HG2  . PRO A 1 28 ? -6.664  7.498   5.663   1.00 0.00 ? 28 PRO A HG2  8  
ATOM 6549  H HG3  . PRO A 1 28 ? -5.385  8.339   4.811   1.00 0.00 ? 28 PRO A HG3  8  
ATOM 6550  H HD2  . PRO A 1 28 ? -7.605  6.951   3.638   1.00 0.00 ? 28 PRO A HD2  8  
ATOM 6551  H HD3  . PRO A 1 28 ? -6.264  7.693   2.787   1.00 0.00 ? 28 PRO A HD3  8  
ATOM 6552  N N    . LYS A 1 29 ? -6.692  3.201   4.304   1.00 0.00 ? 29 LYS A N    8  
ATOM 6553  C CA   . LYS A 1 29 ? -7.495  2.113   4.837   1.00 0.00 ? 29 LYS A CA   8  
ATOM 6554  C C    . LYS A 1 29 ? -8.123  1.334   3.680   1.00 0.00 ? 29 LYS A C    8  
ATOM 6555  O O    . LYS A 1 29 ? -8.068  0.106   3.653   1.00 0.00 ? 29 LYS A O    8  
ATOM 6556  C CB   . LYS A 1 29 ? -8.514  2.645   5.846   1.00 0.00 ? 29 LYS A CB   8  
ATOM 6557  C CG   . LYS A 1 29 ? -9.166  1.499   6.623   1.00 0.00 ? 29 LYS A CG   8  
ATOM 6558  C CD   . LYS A 1 29 ? -8.123  0.468   7.057   1.00 0.00 ? 29 LYS A CD   8  
ATOM 6559  C CE   . LYS A 1 29 ? -8.605  -0.321  8.276   1.00 0.00 ? 29 LYS A CE   8  
ATOM 6560  N NZ   . LYS A 1 29 ? -8.553  0.522   9.492   1.00 0.00 ? 29 LYS A NZ   8  
ATOM 6561  H H    . LYS A 1 29 ? -6.698  3.281   3.307   1.00 0.00 ? 29 LYS A H    8  
ATOM 6562  H HA   . LYS A 1 29 ? -6.823  1.447   5.379   1.00 0.00 ? 29 LYS A HA   8  
ATOM 6563  H HB2  . LYS A 1 29 ? -8.024  3.327   6.541   1.00 0.00 ? 29 LYS A HB2  8  
ATOM 6564  H HB3  . LYS A 1 29 ? -9.281  3.219   5.326   1.00 0.00 ? 29 LYS A HB3  8  
ATOM 6565  H HG2  . LYS A 1 29 ? -9.678  1.895   7.500   1.00 0.00 ? 29 LYS A HG2  8  
ATOM 6566  H HG3  . LYS A 1 29 ? -9.922  1.018   6.003   1.00 0.00 ? 29 LYS A HG3  8  
ATOM 6567  H HD2  . LYS A 1 29 ? -7.919  -0.217  6.234   1.00 0.00 ? 29 LYS A HD2  8  
ATOM 6568  H HD3  . LYS A 1 29 ? -7.185  0.971   7.293   1.00 0.00 ? 29 LYS A HD3  8  
ATOM 6569  H HE2  . LYS A 1 29 ? -9.625  -0.669  8.111   1.00 0.00 ? 29 LYS A HE2  8  
ATOM 6570  H HE3  . LYS A 1 29 ? -7.984  -1.206  8.413   1.00 0.00 ? 29 LYS A HE3  8  
ATOM 6571  H HZ1  . LYS A 1 29 ? -8.285  1.452   9.242   1.00 0.00 ? 29 LYS A HZ1  8  
ATOM 6572  H HZ2  . LYS A 1 29 ? -9.454  0.539   9.925   1.00 0.00 ? 29 LYS A HZ2  8  
ATOM 6573  H HZ3  . LYS A 1 29 ? -7.883  0.143   10.131  1.00 0.00 ? 29 LYS A HZ3  8  
ATOM 6574  N N    . GLU A 1 30 ? -8.706  2.080   2.754   1.00 0.00 ? 30 GLU A N    8  
ATOM 6575  C CA   . GLU A 1 30 ? -9.344  1.475   1.597   1.00 0.00 ? 30 GLU A CA   8  
ATOM 6576  C C    . GLU A 1 30 ? -8.292  0.853   0.676   1.00 0.00 ? 30 GLU A C    8  
ATOM 6577  O O    . GLU A 1 30 ? -8.477  -0.256  0.177   1.00 0.00 ? 30 GLU A O    8  
ATOM 6578  C CB   . GLU A 1 30 ? -10.198 2.497   0.844   1.00 0.00 ? 30 GLU A CB   8  
ATOM 6579  C CG   . GLU A 1 30 ? -10.912 1.846   -0.342  1.00 0.00 ? 30 GLU A CG   8  
ATOM 6580  C CD   . GLU A 1 30 ? -12.296 1.335   0.064   1.00 0.00 ? 30 GLU A CD   8  
ATOM 6581  O OE1  . GLU A 1 30 ? -12.371 0.689   1.131   1.00 0.00 ? 30 GLU A OE1  8  
ATOM 6582  O OE2  . GLU A 1 30 ? -13.246 1.602   -0.702  1.00 0.00 ? 30 GLU A OE2  8  
ATOM 6583  H H    . GLU A 1 30 ? -8.746  3.079   2.784   1.00 0.00 ? 30 GLU A H    8  
ATOM 6584  H HA   . GLU A 1 30 ? -9.991  0.695   1.999   1.00 0.00 ? 30 GLU A HA   8  
ATOM 6585  H HB2  . GLU A 1 30 ? -10.932 2.932   1.522   1.00 0.00 ? 30 GLU A HB2  8  
ATOM 6586  H HB3  . GLU A 1 30 ? -9.567  3.313   0.491   1.00 0.00 ? 30 GLU A HB3  8  
ATOM 6587  H HG2  . GLU A 1 30 ? -11.011 2.569   -1.152  1.00 0.00 ? 30 GLU A HG2  8  
ATOM 6588  H HG3  . GLU A 1 30 ? -10.312 1.020   -0.724  1.00 0.00 ? 30 GLU A HG3  8  
ATOM 6589  N N    . CYS A 1 31 ? -7.213  1.595   0.477   1.00 0.00 ? 31 CYS A N    8  
ATOM 6590  C CA   . CYS A 1 31 ? -6.132  1.131   -0.375  1.00 0.00 ? 31 CYS A CA   8  
ATOM 6591  C C    . CYS A 1 31 ? -5.488  -0.090  0.286   1.00 0.00 ? 31 CYS A C    8  
ATOM 6592  O O    . CYS A 1 31 ? -5.096  -1.035  -0.396  1.00 0.00 ? 31 CYS A O    8  
ATOM 6593  C CB   . CYS A 1 31 ? -5.110  2.237   -0.647  1.00 0.00 ? 31 CYS A CB   8  
ATOM 6594  S SG   . CYS A 1 31 ? -3.416  1.646   -1.004  1.00 0.00 ? 31 CYS A SG   8  
ATOM 6595  H H    . CYS A 1 31 ? -7.070  2.496   0.887   1.00 0.00 ? 31 CYS A H    8  
ATOM 6596  H HA   . CYS A 1 31 ? -6.581  0.861   -1.331  1.00 0.00 ? 31 CYS A HA   8  
ATOM 6597  H HB2  . CYS A 1 31 ? -5.457  2.833   -1.491  1.00 0.00 ? 31 CYS A HB2  8  
ATOM 6598  H HB3  . CYS A 1 31 ? -5.075  2.900   0.218   1.00 0.00 ? 31 CYS A HB3  8  
ATOM 6599  N N    . ASN A 1 32 ? -5.400  -0.029  1.607   1.00 0.00 ? 32 ASN A N    8  
ATOM 6600  C CA   . ASN A 1 32 ? -4.811  -1.118  2.368   1.00 0.00 ? 32 ASN A CA   8  
ATOM 6601  C C    . ASN A 1 32 ? -5.869  -2.197  2.610   1.00 0.00 ? 32 ASN A C    8  
ATOM 6602  O O    . ASN A 1 32 ? -5.556  -3.280  3.101   1.00 0.00 ? 32 ASN A O    8  
ATOM 6603  C CB   . ASN A 1 32 ? -4.313  -0.631  3.730   1.00 0.00 ? 32 ASN A CB   8  
ATOM 6604  C CG   . ASN A 1 32 ? -4.155  -1.799  4.706   1.00 0.00 ? 32 ASN A CG   8  
ATOM 6605  O OD1  . ASN A 1 32 ? -3.542  -2.811  4.409   1.00 0.00 ? 32 ASN A OD1  8  
ATOM 6606  N ND2  . ASN A 1 32 ? -4.742  -1.603  5.883   1.00 0.00 ? 32 ASN A ND2  8  
ATOM 6607  H H    . ASN A 1 32 ? -5.722  0.743   2.154   1.00 0.00 ? 32 ASN A H    8  
ATOM 6608  H HA   . ASN A 1 32 ? -3.982  -1.477  1.759   1.00 0.00 ? 32 ASN A HA   8  
ATOM 6609  H HB2  . ASN A 1 32 ? -3.357  -0.122  3.610   1.00 0.00 ? 32 ASN A HB2  8  
ATOM 6610  H HB3  . ASN A 1 32 ? -5.013  0.097   4.139   1.00 0.00 ? 32 ASN A HB3  8  
ATOM 6611  H HD21 . ASN A 1 32 ? -5.230  -0.749  6.062   1.00 0.00 ? 32 ASN A HD21 8  
ATOM 6612  H HD22 . ASN A 1 32 ? -4.696  -2.310  6.589   1.00 0.00 ? 32 ASN A HD22 8  
ATOM 6613  N N    . ASN A 1 33 ? -7.101  -1.863  2.253   1.00 0.00 ? 33 ASN A N    8  
ATOM 6614  C CA   . ASN A 1 33 ? -8.207  -2.789  2.425   1.00 0.00 ? 33 ASN A CA   8  
ATOM 6615  C C    . ASN A 1 33 ? -8.413  -3.577  1.130   1.00 0.00 ? 33 ASN A C    8  
ATOM 6616  O O    . ASN A 1 33 ? -8.657  -4.782  1.165   1.00 0.00 ? 33 ASN A O    8  
ATOM 6617  C CB   . ASN A 1 33 ? -9.507  -2.043  2.736   1.00 0.00 ? 33 ASN A CB   8  
ATOM 6618  C CG   . ASN A 1 33 ? -10.697 -3.004  2.762   1.00 0.00 ? 33 ASN A CG   8  
ATOM 6619  O OD1  . ASN A 1 33 ? -11.004 -3.680  1.794   1.00 0.00 ? 33 ASN A OD1  8  
ATOM 6620  N ND2  . ASN A 1 33 ? -11.349 -3.026  3.921   1.00 0.00 ? 33 ASN A ND2  8  
ATOM 6621  H H    . ASN A 1 33 ? -7.347  -0.979  1.854   1.00 0.00 ? 33 ASN A H    8  
ATOM 6622  H HA   . ASN A 1 33 ? -7.919  -3.427  3.260   1.00 0.00 ? 33 ASN A HA   8  
ATOM 6623  H HB2  . ASN A 1 33 ? -9.420  -1.540  3.699   1.00 0.00 ? 33 ASN A HB2  8  
ATOM 6624  H HB3  . ASN A 1 33 ? -9.675  -1.270  1.986   1.00 0.00 ? 33 ASN A HB3  8  
ATOM 6625  H HD21 . ASN A 1 33 ? -11.045 -2.446  4.677   1.00 0.00 ? 33 ASN A HD21 8  
ATOM 6626  H HD22 . ASN A 1 33 ? -12.142 -3.624  4.037   1.00 0.00 ? 33 ASN A HD22 8  
ATOM 6627  N N    . ARG A 1 34 ? -8.306  -2.865  0.018   1.00 0.00 ? 34 ARG A N    8  
ATOM 6628  C CA   . ARG A 1 34 ? -8.478  -3.483  -1.286  1.00 0.00 ? 34 ARG A CA   8  
ATOM 6629  C C    . ARG A 1 34 ? -7.506  -4.653  -1.451  1.00 0.00 ? 34 ARG A C    8  
ATOM 6630  O O    . ARG A 1 34 ? -7.739  -5.549  -2.260  1.00 0.00 ? 34 ARG A O    8  
ATOM 6631  C CB   . ARG A 1 34 ? -8.243  -2.471  -2.410  1.00 0.00 ? 34 ARG A CB   8  
ATOM 6632  C CG   . ARG A 1 34 ? -9.232  -2.686  -3.557  1.00 0.00 ? 34 ARG A CG   8  
ATOM 6633  C CD   . ARG A 1 34 ? -10.667 -2.779  -3.032  1.00 0.00 ? 34 ARG A CD   8  
ATOM 6634  N NE   . ARG A 1 34 ? -11.130 -4.184  -3.071  1.00 0.00 ? 34 ARG A NE   8  
ATOM 6635  C CZ   . ARG A 1 34 ? -12.386 -4.568  -2.803  1.00 0.00 ? 34 ARG A CZ   8  
ATOM 6636  N NH1  . ARG A 1 34 ? -13.310 -3.656  -2.475  1.00 0.00 ? 34 ARG A NH1  8  
ATOM 6637  N NH2  . ARG A 1 34 ? -12.716 -5.866  -2.863  1.00 0.00 ? 34 ARG A NH2  8  
ATOM 6638  H H    . ARG A 1 34 ? -8.108  -1.885  -0.002  1.00 0.00 ? 34 ARG A H    8  
ATOM 6639  H HA   . ARG A 1 34 ? -9.512  -3.827  -1.298  1.00 0.00 ? 34 ARG A HA   8  
ATOM 6640  H HB2  . ARG A 1 34 ? -8.346  -1.459  -2.020  1.00 0.00 ? 34 ARG A HB2  8  
ATOM 6641  H HB3  . ARG A 1 34 ? -7.223  -2.567  -2.783  1.00 0.00 ? 34 ARG A HB3  8  
ATOM 6642  H HG2  . ARG A 1 34 ? -9.154  -1.864  -4.268  1.00 0.00 ? 34 ARG A HG2  8  
ATOM 6643  H HG3  . ARG A 1 34 ? -8.979  -3.599  -4.095  1.00 0.00 ? 34 ARG A HG3  8  
ATOM 6644  H HD2  . ARG A 1 34 ? -10.715 -2.399  -2.012  1.00 0.00 ? 34 ARG A HD2  8  
ATOM 6645  H HD3  . ARG A 1 34 ? -11.325 -2.153  -3.636  1.00 0.00 ? 34 ARG A HD3  8  
ATOM 6646  H HE   . ARG A 1 34 ? -10.465 -4.890  -3.313  1.00 0.00 ? 34 ARG A HE   8  
ATOM 6647  H HH11 . ARG A 1 34 ? -13.064 -2.688  -2.430  1.00 0.00 ? 34 ARG A HH11 8  
ATOM 6648  H HH12 . ARG A 1 34 ? -14.247 -3.943  -2.275  1.00 0.00 ? 34 ARG A HH12 8  
ATOM 6649  H HH21 . ARG A 1 34 ? -12.026 -6.547  -3.108  1.00 0.00 ? 34 ARG A HH21 8  
ATOM 6650  H HH22 . ARG A 1 34 ? -13.653 -6.153  -2.663  1.00 0.00 ? 34 ARG A HH22 8  
ATOM 6651  N N    . GLY A 1 35 ? -6.436  -4.607  -0.670  1.00 0.00 ? 35 GLY A N    8  
ATOM 6652  C CA   . GLY A 1 35 ? -5.428  -5.652  -0.719  1.00 0.00 ? 35 GLY A CA   8  
ATOM 6653  C C    . GLY A 1 35 ? -4.083  -5.095  -1.189  1.00 0.00 ? 35 GLY A C    8  
ATOM 6654  O O    . GLY A 1 35 ? -3.653  -5.363  -2.310  1.00 0.00 ? 35 GLY A O    8  
ATOM 6655  H H    . GLY A 1 35 ? -6.254  -3.874  -0.014  1.00 0.00 ? 35 GLY A H    8  
ATOM 6656  H HA2  . GLY A 1 35 ? -5.315  -6.100  0.268   1.00 0.00 ? 35 GLY A HA2  8  
ATOM 6657  H HA3  . GLY A 1 35 ? -5.753  -6.444  -1.393  1.00 0.00 ? 35 GLY A HA3  8  
ATOM 6658  N N    . CYS A 1 36 ? -3.456  -4.329  -0.308  1.00 0.00 ? 36 CYS A N    8  
ATOM 6659  C CA   . CYS A 1 36 ? -2.168  -3.732  -0.618  1.00 0.00 ? 36 CYS A CA   8  
ATOM 6660  C C    . CYS A 1 36 ? -1.807  -2.757  0.504   1.00 0.00 ? 36 CYS A C    8  
ATOM 6661  O O    . CYS A 1 36 ? -2.300  -2.885  1.624   1.00 0.00 ? 36 CYS A O    8  
ATOM 6662  C CB   . CYS A 1 36 ? -2.177  -3.047  -1.987  1.00 0.00 ? 36 CYS A CB   8  
ATOM 6663  S SG   . CYS A 1 36 ? -0.845  -3.582  -3.121  1.00 0.00 ? 36 CYS A SG   8  
ATOM 6664  H H    . CYS A 1 36 ? -3.812  -4.116  0.602   1.00 0.00 ? 36 CYS A H    8  
ATOM 6665  H HA   . CYS A 1 36 ? -1.448  -4.548  -0.669  1.00 0.00 ? 36 CYS A HA   8  
ATOM 6666  H HB2  . CYS A 1 36 ? -3.139  -3.234  -2.465  1.00 0.00 ? 36 CYS A HB2  8  
ATOM 6667  H HB3  . CYS A 1 36 ? -2.099  -1.970  -1.839  1.00 0.00 ? 36 CYS A HB3  8  
ATOM 6668  N N    . CYS A 1 37 ? -0.950  -1.805  0.166   1.00 0.00 ? 37 CYS A N    8  
ATOM 6669  C CA   . CYS A 1 37 ? -0.517  -0.810  1.132   1.00 0.00 ? 37 CYS A CA   8  
ATOM 6670  C C    . CYS A 1 37 ? -0.848  0.576   0.574   1.00 0.00 ? 37 CYS A C    8  
ATOM 6671  O O    . CYS A 1 37 ? -0.891  0.766   -0.640  1.00 0.00 ? 37 CYS A O    8  
ATOM 6672  C CB   . CYS A 1 37 ? 0.970   -0.952  1.463   1.00 0.00 ? 37 CYS A CB   8  
ATOM 6673  S SG   . CYS A 1 37 ? 1.339   -2.046  2.883   1.00 0.00 ? 37 CYS A SG   8  
ATOM 6674  H H    . CYS A 1 37 ? -0.554  -1.709  -0.747  1.00 0.00 ? 37 CYS A H    8  
ATOM 6675  H HA   . CYS A 1 37 ? -1.074  -1.001  2.049   1.00 0.00 ? 37 CYS A HA   8  
ATOM 6676  H HB2  . CYS A 1 37 ? 1.489   -1.333  0.584   1.00 0.00 ? 37 CYS A HB2  8  
ATOM 6677  H HB3  . CYS A 1 37 ? 1.378   0.038   1.670   1.00 0.00 ? 37 CYS A HB3  8  
ATOM 6678  N N    . PHE A 1 38 ? -1.073  1.508   1.488   1.00 0.00 ? 38 PHE A N    8  
ATOM 6679  C CA   . PHE A 1 38 ? -1.399  2.871   1.103   1.00 0.00 ? 38 PHE A CA   8  
ATOM 6680  C C    . PHE A 1 38 ? -0.329  3.849   1.592   1.00 0.00 ? 38 PHE A C    8  
ATOM 6681  O O    . PHE A 1 38 ? 0.587   3.462   2.316   1.00 0.00 ? 38 PHE A O    8  
ATOM 6682  C CB   . PHE A 1 38 ? -2.732  3.218   1.769   1.00 0.00 ? 38 PHE A CB   8  
ATOM 6683  C CG   . PHE A 1 38 ? -3.138  4.685   1.622   1.00 0.00 ? 38 PHE A CG   8  
ATOM 6684  C CD1  . PHE A 1 38 ? -3.788  5.103   0.503   1.00 0.00 ? 38 PHE A CD1  8  
ATOM 6685  C CD2  . PHE A 1 38 ? -2.848  5.573   2.611   1.00 0.00 ? 38 PHE A CD2  8  
ATOM 6686  C CE1  . PHE A 1 38 ? -4.165  6.465   0.367   1.00 0.00 ? 38 PHE A CE1  8  
ATOM 6687  C CE2  . PHE A 1 38 ? -3.224  6.936   2.475   1.00 0.00 ? 38 PHE A CE2  8  
ATOM 6688  C CZ   . PHE A 1 38 ? -3.875  7.353   1.356   1.00 0.00 ? 38 PHE A CZ   8  
ATOM 6689  H H    . PHE A 1 38 ? -1.037  1.345   2.474   1.00 0.00 ? 38 PHE A H    8  
ATOM 6690  H HA   . PHE A 1 38 ? -1.443  2.897   0.014   1.00 0.00 ? 38 PHE A HA   8  
ATOM 6691  H HB2  . PHE A 1 38 ? -3.514  2.591   1.341   1.00 0.00 ? 38 PHE A HB2  8  
ATOM 6692  H HB3  . PHE A 1 38 ? -2.672  2.972   2.829   1.00 0.00 ? 38 PHE A HB3  8  
ATOM 6693  H HD1  . PHE A 1 38 ? -4.021  4.391   -0.289  1.00 0.00 ? 38 PHE A HD1  8  
ATOM 6694  H HD2  . PHE A 1 38 ? -2.326  5.239   3.508   1.00 0.00 ? 38 PHE A HD2  8  
ATOM 6695  H HE1  . PHE A 1 38 ? -4.686  6.799   -0.530  1.00 0.00 ? 38 PHE A HE1  8  
ATOM 6696  H HE2  . PHE A 1 38 ? -2.992  7.647   3.267   1.00 0.00 ? 38 PHE A HE2  8  
ATOM 6697  H HZ   . PHE A 1 38 ? -4.164  8.399   1.251   1.00 0.00 ? 38 PHE A HZ   8  
ATOM 6698  N N    . ASP A 1 39 ? -0.480  5.098   1.176   1.00 0.00 ? 39 ASP A N    8  
ATOM 6699  C CA   . ASP A 1 39 ? 0.462   6.135   1.562   1.00 0.00 ? 39 ASP A CA   8  
ATOM 6700  C C    . ASP A 1 39 ? 0.029   7.467   0.945   1.00 0.00 ? 39 ASP A C    8  
ATOM 6701  O O    . ASP A 1 39 ? -0.453  7.503   -0.186  1.00 0.00 ? 39 ASP A O    8  
ATOM 6702  C CB   . ASP A 1 39 ? 1.870   5.815   1.057   1.00 0.00 ? 39 ASP A CB   8  
ATOM 6703  C CG   . ASP A 1 39 ? 2.929   6.871   1.383   1.00 0.00 ? 39 ASP A CG   8  
ATOM 6704  O OD1  . ASP A 1 39 ? 3.175   7.073   2.591   1.00 0.00 ? 39 ASP A OD1  8  
ATOM 6705  O OD2  . ASP A 1 39 ? 3.468   7.451   0.416   1.00 0.00 ? 39 ASP A OD2  8  
ATOM 6706  H H    . ASP A 1 39 ? -1.228  5.405   0.587   1.00 0.00 ? 39 ASP A H    8  
ATOM 6707  H HA   . ASP A 1 39 ? 0.437   6.153   2.651   1.00 0.00 ? 39 ASP A HA   8  
ATOM 6708  H HB2  . ASP A 1 39 ? 2.185   4.863   1.482   1.00 0.00 ? 39 ASP A HB2  8  
ATOM 6709  H HB3  . ASP A 1 39 ? 1.831   5.684   -0.025  1.00 0.00 ? 39 ASP A HB3  8  
ATOM 6710  N N    . SER A 1 40 ? 0.216   8.528   1.715   1.00 0.00 ? 40 SER A N    8  
ATOM 6711  C CA   . SER A 1 40 ? -0.149  9.858   1.259   1.00 0.00 ? 40 SER A CA   8  
ATOM 6712  C C    . SER A 1 40 ? 0.959   10.854  1.609   1.00 0.00 ? 40 SER A C    8  
ATOM 6713  O O    . SER A 1 40 ? 0.740   12.064  1.589   1.00 0.00 ? 40 SER A O    8  
ATOM 6714  C CB   . SER A 1 40 ? -1.477  10.305  1.871   1.00 0.00 ? 40 SER A CB   8  
ATOM 6715  O OG   . SER A 1 40 ? -1.393  10.445  3.286   1.00 0.00 ? 40 SER A OG   8  
ATOM 6716  H H    . SER A 1 40 ? 0.609   8.489   2.634   1.00 0.00 ? 40 SER A H    8  
ATOM 6717  H HA   . SER A 1 40 ? -0.258  9.772   0.178   1.00 0.00 ? 40 SER A HA   8  
ATOM 6718  H HB2  . SER A 1 40 ? -1.778  11.256  1.430   1.00 0.00 ? 40 SER A HB2  8  
ATOM 6719  H HB3  . SER A 1 40 ? -2.253  9.581   1.623   1.00 0.00 ? 40 SER A HB3  8  
ATOM 6720  H HG   . SER A 1 40 ? -2.149  11.007  3.620   1.00 0.00 ? 40 SER A HG   8  
ATOM 6721  N N    . ARG A 1 41 ? 2.125   10.308  1.921   1.00 0.00 ? 41 ARG A N    8  
ATOM 6722  C CA   . ARG A 1 41 ? 3.267   11.133  2.275   1.00 0.00 ? 41 ARG A CA   8  
ATOM 6723  C C    . ARG A 1 41 ? 3.668   12.019  1.094   1.00 0.00 ? 41 ARG A C    8  
ATOM 6724  O O    . ARG A 1 41 ? 4.050   13.173  1.281   1.00 0.00 ? 41 ARG A O    8  
ATOM 6725  C CB   . ARG A 1 41 ? 4.463   10.271  2.686   1.00 0.00 ? 41 ARG A CB   8  
ATOM 6726  C CG   . ARG A 1 41 ? 5.239   10.922  3.834   1.00 0.00 ? 41 ARG A CG   8  
ATOM 6727  C CD   . ARG A 1 41 ? 6.380   10.018  4.305   1.00 0.00 ? 41 ARG A CD   8  
ATOM 6728  N NE   . ARG A 1 41 ? 7.678   10.707  4.126   1.00 0.00 ? 41 ARG A NE   8  
ATOM 6729  C CZ   . ARG A 1 41 ? 8.864   10.084  4.122   1.00 0.00 ? 41 ARG A CZ   8  
ATOM 6730  N NH1  . ARG A 1 41 ? 8.924   8.756   4.288   1.00 0.00 ? 41 ARG A NH1  8  
ATOM 6731  N NH2  . ARG A 1 41 ? 9.991   10.790  3.952   1.00 0.00 ? 41 ARG A NH2  8  
ATOM 6732  H H    . ARG A 1 41 ? 2.295   9.322   1.934   1.00 0.00 ? 41 ARG A H    8  
ATOM 6733  H HA   . ARG A 1 41 ? 2.926   11.733  3.118   1.00 0.00 ? 41 ARG A HA   8  
ATOM 6734  H HB2  . ARG A 1 41 ? 4.116   9.284   2.991   1.00 0.00 ? 41 ARG A HB2  8  
ATOM 6735  H HB3  . ARG A 1 41 ? 5.124   10.128  1.831   1.00 0.00 ? 41 ARG A HB3  8  
ATOM 6736  H HG2  . ARG A 1 41 ? 5.640   11.881  3.508   1.00 0.00 ? 41 ARG A HG2  8  
ATOM 6737  H HG3  . ARG A 1 41 ? 4.563   11.124  4.665   1.00 0.00 ? 41 ARG A HG3  8  
ATOM 6738  H HD2  . ARG A 1 41 ? 6.239   9.758   5.354   1.00 0.00 ? 41 ARG A HD2  8  
ATOM 6739  H HD3  . ARG A 1 41 ? 6.373   9.085   3.742   1.00 0.00 ? 41 ARG A HD3  8  
ATOM 6740  H HE   . ARG A 1 41 ? 7.668   11.699  3.999   1.00 0.00 ? 41 ARG A HE   8  
ATOM 6741  H HH11 . ARG A 1 41 ? 8.084   8.229   4.415   1.00 0.00 ? 41 ARG A HH11 8  
ATOM 6742  H HH12 . ARG A 1 41 ? 9.810   8.291   4.286   1.00 0.00 ? 41 ARG A HH12 8  
ATOM 6743  H HH21 . ARG A 1 41 ? 9.946   11.781  3.828   1.00 0.00 ? 41 ARG A HH21 8  
ATOM 6744  H HH22 . ARG A 1 41 ? 10.876  10.325  3.950   1.00 0.00 ? 41 ARG A HH22 8  
ATOM 6745  N N    . ILE A 1 42 ? 3.568   11.445  -0.096  1.00 0.00 ? 42 ILE A N    8  
ATOM 6746  C CA   . ILE A 1 42 ? 3.916   12.169  -1.307  1.00 0.00 ? 42 ILE A CA   8  
ATOM 6747  C C    . ILE A 1 42 ? 3.128   11.591  -2.485  1.00 0.00 ? 42 ILE A C    8  
ATOM 6748  O O    . ILE A 1 42 ? 3.077   10.375  -2.666  1.00 0.00 ? 42 ILE A O    8  
ATOM 6749  C CB   . ILE A 1 42 ? 5.431   12.163  -1.519  1.00 0.00 ? 42 ILE A CB   8  
ATOM 6750  C CG1  . ILE A 1 42 ? 6.079   10.972  -0.810  1.00 0.00 ? 42 ILE A CG1  8  
ATOM 6751  C CG2  . ILE A 1 42 ? 6.050   13.493  -1.086  1.00 0.00 ? 42 ILE A CG2  8  
ATOM 6752  C CD1  . ILE A 1 42 ? 5.541   9.648   -1.359  1.00 0.00 ? 42 ILE A CD1  8  
ATOM 6753  H H    . ILE A 1 42 ? 3.257   10.506  -0.239  1.00 0.00 ? 42 ILE A H    8  
ATOM 6754  H HA   . ILE A 1 42 ? 3.614   13.207  -1.166  1.00 0.00 ? 42 ILE A HA   8  
ATOM 6755  H HB   . ILE A 1 42 ? 5.627   12.049  -2.585  1.00 0.00 ? 42 ILE A HB   8  
ATOM 6756  H HG12 . ILE A 1 42 ? 7.161   11.011  -0.941  1.00 0.00 ? 42 ILE A HG12 8  
ATOM 6757  H HG13 . ILE A 1 42 ? 5.885   11.031  0.261   1.00 0.00 ? 42 ILE A HG13 8  
ATOM 6758  H HG21 . ILE A 1 42 ? 5.337   14.043  -0.472  1.00 0.00 ? 42 ILE A HG21 8  
ATOM 6759  H HG22 . ILE A 1 42 ? 6.955   13.302  -0.509  1.00 0.00 ? 42 ILE A HG22 8  
ATOM 6760  H HG23 . ILE A 1 42 ? 6.300   14.082  -1.969  1.00 0.00 ? 42 ILE A HG23 8  
ATOM 6761  H HD11 . ILE A 1 42 ? 5.268   9.774   -2.407  1.00 0.00 ? 42 ILE A HD11 8  
ATOM 6762  H HD12 . ILE A 1 42 ? 6.310   8.881   -1.274  1.00 0.00 ? 42 ILE A HD12 8  
ATOM 6763  H HD13 . ILE A 1 42 ? 4.663   9.348   -0.787  1.00 0.00 ? 42 ILE A HD13 8  
ATOM 6764  N N    . PRO A 1 43 ? 2.518   12.514  -3.276  1.00 0.00 ? 43 PRO A N    8  
ATOM 6765  C CA   . PRO A 1 43 ? 1.735   12.108  -4.431  1.00 0.00 ? 43 PRO A CA   8  
ATOM 6766  C C    . PRO A 1 43 ? 2.643   11.671  -5.582  1.00 0.00 ? 43 PRO A C    8  
ATOM 6767  O O    . PRO A 1 43 ? 2.297   10.768  -6.342  1.00 0.00 ? 43 PRO A O    8  
ATOM 6768  C CB   . PRO A 1 43 ? 0.883   13.320  -4.774  1.00 0.00 ? 43 PRO A CB   8  
ATOM 6769  C CG   . PRO A 1 43 ? 1.551   14.505  -4.095  1.00 0.00 ? 43 PRO A CG   8  
ATOM 6770  C CD   . PRO A 1 43 ? 2.556   13.962  -3.092  1.00 0.00 ? 43 PRO A CD   8  
ATOM 6771  H HA   . PRO A 1 43 ? 1.174   11.312  -4.208  1.00 0.00 ? 43 PRO A HA   8  
ATOM 6772  H HB2  . PRO A 1 43 ? 0.829   13.467  -5.852  1.00 0.00 ? 43 PRO A HB2  8  
ATOM 6773  H HB3  . PRO A 1 43 ? -0.139  13.191  -4.418  1.00 0.00 ? 43 PRO A HB3  8  
ATOM 6774  H HG2  . PRO A 1 43 ? 2.049   15.135  -4.831  1.00 0.00 ? 43 PRO A HG2  8  
ATOM 6775  H HG3  . PRO A 1 43 ? 0.809   15.126  -3.593  1.00 0.00 ? 43 PRO A HG3  8  
ATOM 6776  H HD2  . PRO A 1 43 ? 3.555   14.358  -3.278  1.00 0.00 ? 43 PRO A HD2  8  
ATOM 6777  H HD3  . PRO A 1 43 ? 2.288   14.239  -2.073  1.00 0.00 ? 43 PRO A HD3  8  
ATOM 6778  N N    . GLY A 1 44 ? 3.787   12.333  -5.676  1.00 0.00 ? 44 GLY A N    8  
ATOM 6779  C CA   . GLY A 1 44 ? 4.747   12.024  -6.721  1.00 0.00 ? 44 GLY A CA   8  
ATOM 6780  C C    . GLY A 1 44 ? 4.860   10.513  -6.934  1.00 0.00 ? 44 GLY A C    8  
ATOM 6781  O O    . GLY A 1 44 ? 4.948   10.046  -8.068  1.00 0.00 ? 44 GLY A O    8  
ATOM 6782  H H    . GLY A 1 44 ? 4.061   13.067  -5.054  1.00 0.00 ? 44 GLY A H    8  
ATOM 6783  H HA2  . GLY A 1 44 ? 4.444   12.504  -7.652  1.00 0.00 ? 44 GLY A HA2  8  
ATOM 6784  H HA3  . GLY A 1 44 ? 5.723   12.431  -6.456  1.00 0.00 ? 44 GLY A HA3  8  
ATOM 6785  N N    . VAL A 1 45 ? 4.853   9.790   -5.823  1.00 0.00 ? 45 VAL A N    8  
ATOM 6786  C CA   . VAL A 1 45 ? 4.953   8.341   -5.873  1.00 0.00 ? 45 VAL A CA   8  
ATOM 6787  C C    . VAL A 1 45 ? 3.549   7.735   -5.834  1.00 0.00 ? 45 VAL A C    8  
ATOM 6788  O O    . VAL A 1 45 ? 2.566   8.449   -5.640  1.00 0.00 ? 45 VAL A O    8  
ATOM 6789  C CB   . VAL A 1 45 ? 5.852   7.839   -4.742  1.00 0.00 ? 45 VAL A CB   8  
ATOM 6790  C CG1  . VAL A 1 45 ? 6.961   8.848   -4.434  1.00 0.00 ? 45 VAL A CG1  8  
ATOM 6791  C CG2  . VAL A 1 45 ? 5.033   7.525   -3.489  1.00 0.00 ? 45 VAL A CG2  8  
ATOM 6792  H H    . VAL A 1 45 ? 4.781   10.177  -4.904  1.00 0.00 ? 45 VAL A H    8  
ATOM 6793  H HA   . VAL A 1 45 ? 5.423   8.076   -6.821  1.00 0.00 ? 45 VAL A HA   8  
ATOM 6794  H HB   . VAL A 1 45 ? 6.324   6.914   -5.074  1.00 0.00 ? 45 VAL A HB   8  
ATOM 6795  H HG11 . VAL A 1 45 ? 6.860   9.711   -5.092  1.00 0.00 ? 45 VAL A HG11 8  
ATOM 6796  H HG12 . VAL A 1 45 ? 6.879   9.172   -3.396  1.00 0.00 ? 45 VAL A HG12 8  
ATOM 6797  H HG13 . VAL A 1 45 ? 7.932   8.381   -4.593  1.00 0.00 ? 45 VAL A HG13 8  
ATOM 6798  H HG21 . VAL A 1 45 ? 4.233   8.258   -3.384  1.00 0.00 ? 45 VAL A HG21 8  
ATOM 6799  H HG22 . VAL A 1 45 ? 4.603   6.527   -3.576  1.00 0.00 ? 45 VAL A HG22 8  
ATOM 6800  H HG23 . VAL A 1 45 ? 5.679   7.566   -2.612  1.00 0.00 ? 45 VAL A HG23 8  
ATOM 6801  N N    . PRO A 1 46 ? 3.497   6.390   -6.027  1.00 0.00 ? 46 PRO A N    8  
ATOM 6802  C CA   . PRO A 1 46 ? 2.230   5.680   -6.015  1.00 0.00 ? 46 PRO A CA   8  
ATOM 6803  C C    . PRO A 1 46 ? 1.698   5.531   -4.588  1.00 0.00 ? 46 PRO A C    8  
ATOM 6804  O O    . PRO A 1 46 ? 2.044   4.580   -3.889  1.00 0.00 ? 46 PRO A O    8  
ATOM 6805  C CB   . PRO A 1 46 ? 2.520   4.346   -6.683  1.00 0.00 ? 46 PRO A CB   8  
ATOM 6806  C CG   . PRO A 1 46 ? 4.028   4.170   -6.625  1.00 0.00 ? 46 PRO A CG   8  
ATOM 6807  C CD   . PRO A 1 46 ? 4.641   5.512   -6.259  1.00 0.00 ? 46 PRO A CD   8  
ATOM 6808  H HA   . PRO A 1 46 ? 1.536   6.201   -6.513  1.00 0.00 ? 46 PRO A HA   8  
ATOM 6809  H HB2  . PRO A 1 46 ? 2.011   3.532   -6.167  1.00 0.00 ? 46 PRO A HB2  8  
ATOM 6810  H HB3  . PRO A 1 46 ? 2.166   4.340   -7.714  1.00 0.00 ? 46 PRO A HB3  8  
ATOM 6811  H HG2  . PRO A 1 46 ? 4.296   3.414   -5.886  1.00 0.00 ? 46 PRO A HG2  8  
ATOM 6812  H HG3  . PRO A 1 46 ? 4.410   3.825   -7.586  1.00 0.00 ? 46 PRO A HG3  8  
ATOM 6813  H HD2  . PRO A 1 46 ? 5.267   5.433   -5.370  1.00 0.00 ? 46 PRO A HD2  8  
ATOM 6814  H HD3  . PRO A 1 46 ? 5.273   5.890   -7.062  1.00 0.00 ? 46 PRO A HD3  8  
ATOM 6815  N N    . TRP A 1 47 ? 0.864   6.485   -4.199  1.00 0.00 ? 47 TRP A N    8  
ATOM 6816  C CA   . TRP A 1 47 ? 0.281   6.472   -2.868  1.00 0.00 ? 47 TRP A CA   8  
ATOM 6817  C C    . TRP A 1 47 ? 0.063   5.013   -2.462  1.00 0.00 ? 47 TRP A C    8  
ATOM 6818  O O    . TRP A 1 47 ? 0.528   4.582   -1.408  1.00 0.00 ? 47 TRP A O    8  
ATOM 6819  C CB   . TRP A 1 47 ? -1.002  7.303   -2.824  1.00 0.00 ? 47 TRP A CB   8  
ATOM 6820  C CG   . TRP A 1 47 ? -0.780  8.774   -2.464  1.00 0.00 ? 47 TRP A CG   8  
ATOM 6821  C CD1  . TRP A 1 47 ? 0.305   9.525   -2.698  1.00 0.00 ? 47 TRP A CD1  8  
ATOM 6822  C CD2  . TRP A 1 47 ? -1.713  9.645   -1.791  1.00 0.00 ? 47 TRP A CD2  8  
ATOM 6823  N NE1  . TRP A 1 47 ? 0.140   10.812  -2.227  1.00 0.00 ? 47 TRP A NE1  8  
ATOM 6824  C CE2  . TRP A 1 47 ? -1.126  10.887  -1.658  1.00 0.00 ? 47 TRP A CE2  8  
ATOM 6825  C CE3  . TRP A 1 47 ? -3.010  9.392   -1.311  1.00 0.00 ? 47 TRP A CE3  8  
ATOM 6826  C CZ2  . TRP A 1 47 ? -1.763  11.974  -1.046  1.00 0.00 ? 47 TRP A CZ2  8  
ATOM 6827  C CZ3  . TRP A 1 47 ? -3.632  10.488  -0.702  1.00 0.00 ? 47 TRP A CZ3  8  
ATOM 6828  C CH2  . TRP A 1 47 ? -3.055  11.745  -0.560  1.00 0.00 ? 47 TRP A CH2  8  
ATOM 6829  H H    . TRP A 1 47 ? 0.588   7.255   -4.774  1.00 0.00 ? 47 TRP A H    8  
ATOM 6830  H HA   . TRP A 1 47 ? 0.990   6.946   -2.189  1.00 0.00 ? 47 TRP A HA   8  
ATOM 6831  H HB2  . TRP A 1 47 ? -1.492  7.249   -3.797  1.00 0.00 ? 47 TRP A HB2  8  
ATOM 6832  H HB3  . TRP A 1 47 ? -1.685  6.861   -2.098  1.00 0.00 ? 47 TRP A HB3  8  
ATOM 6833  H HD1  . TRP A 1 47 ? 1.204   9.166   -3.197  1.00 0.00 ? 47 TRP A HD1  8  
ATOM 6834  H HE1  . TRP A 1 47 ? 0.868   11.620  -2.290  1.00 0.00 ? 47 TRP A HE1  8  
ATOM 6835  H HE3  . TRP A 1 47 ? -3.495  8.420   -1.403  1.00 0.00 ? 47 TRP A HE3  8  
ATOM 6836  H HZ2  . TRP A 1 47 ? -1.278  12.945  -0.953  1.00 0.00 ? 47 TRP A HZ2  8  
ATOM 6837  H HZ3  . TRP A 1 47 ? -4.640  10.346  -0.311  1.00 0.00 ? 47 TRP A HZ3  8  
ATOM 6838  H HH2  . TRP A 1 47 ? -3.607  12.549  -0.072  1.00 0.00 ? 47 TRP A HH2  8  
ATOM 6839  N N    . CYS A 1 48 ? -0.646  4.293   -3.320  1.00 0.00 ? 48 CYS A N    8  
ATOM 6840  C CA   . CYS A 1 48 ? -0.931  2.892   -3.064  1.00 0.00 ? 48 CYS A CA   8  
ATOM 6841  C C    . CYS A 1 48 ? 0.143   2.048   -3.754  1.00 0.00 ? 48 CYS A C    8  
ATOM 6842  O O    . CYS A 1 48 ? 0.207   2.002   -4.981  1.00 0.00 ? 48 CYS A O    8  
ATOM 6843  C CB   . CYS A 1 48 ? -2.340  2.509   -3.522  1.00 0.00 ? 48 CYS A CB   8  
ATOM 6844  S SG   . CYS A 1 48 ? -3.030  1.017   -2.717  1.00 0.00 ? 48 CYS A SG   8  
ATOM 6845  H H    . CYS A 1 48 ? -1.020  4.651   -4.175  1.00 0.00 ? 48 CYS A H    8  
ATOM 6846  H HA   . CYS A 1 48 ? -0.894  2.757   -1.983  1.00 0.00 ? 48 CYS A HA   8  
ATOM 6847  H HB2  . CYS A 1 48 ? -3.009  3.348   -3.333  1.00 0.00 ? 48 CYS A HB2  8  
ATOM 6848  H HB3  . CYS A 1 48 ? -2.325  2.349   -4.600  1.00 0.00 ? 48 CYS A HB3  8  
ATOM 6849  N N    . PHE A 1 49 ? 0.959   1.402   -2.935  1.00 0.00 ? 49 PHE A N    8  
ATOM 6850  C CA   . PHE A 1 49 ? 2.027   0.563   -3.451  1.00 0.00 ? 49 PHE A CA   8  
ATOM 6851  C C    . PHE A 1 49 ? 2.049   -0.794  -2.745  1.00 0.00 ? 49 PHE A C    8  
ATOM 6852  O O    . PHE A 1 49 ? 1.434   -0.960  -1.692  1.00 0.00 ? 49 PHE A O    8  
ATOM 6853  C CB   . PHE A 1 49 ? 3.343   1.291   -3.171  1.00 0.00 ? 49 PHE A CB   8  
ATOM 6854  C CG   . PHE A 1 49 ? 3.451   1.860   -1.755  1.00 0.00 ? 49 PHE A CG   8  
ATOM 6855  C CD1  . PHE A 1 49 ? 3.555   1.019   -0.691  1.00 0.00 ? 49 PHE A CD1  8  
ATOM 6856  C CD2  . PHE A 1 49 ? 3.443   3.206   -1.560  1.00 0.00 ? 49 PHE A CD2  8  
ATOM 6857  C CE1  . PHE A 1 49 ? 3.655   1.547   0.624   1.00 0.00 ? 49 PHE A CE1  8  
ATOM 6858  C CE2  . PHE A 1 49 ? 3.543   3.733   -0.245  1.00 0.00 ? 49 PHE A CE2  8  
ATOM 6859  C CZ   . PHE A 1 49 ? 3.647   2.893   0.819   1.00 0.00 ? 49 PHE A CZ   8  
ATOM 6860  H H    . PHE A 1 49 ? 0.900   1.445   -1.937  1.00 0.00 ? 49 PHE A H    8  
ATOM 6861  H HA   . PHE A 1 49 ? 1.837   0.414   -4.514  1.00 0.00 ? 49 PHE A HA   8  
ATOM 6862  H HB2  . PHE A 1 49 ? 4.171   0.602   -3.339  1.00 0.00 ? 49 PHE A HB2  8  
ATOM 6863  H HB3  . PHE A 1 49 ? 3.456   2.105   -3.888  1.00 0.00 ? 49 PHE A HB3  8  
ATOM 6864  H HD1  . PHE A 1 49 ? 3.561   -0.060  -0.847  1.00 0.00 ? 49 PHE A HD1  8  
ATOM 6865  H HD2  . PHE A 1 49 ? 3.360   3.879   -2.413  1.00 0.00 ? 49 PHE A HD2  8  
ATOM 6866  H HE1  . PHE A 1 49 ? 3.738   0.873   1.477   1.00 0.00 ? 49 PHE A HE1  8  
ATOM 6867  H HE2  . PHE A 1 49 ? 3.537   4.812   -0.089  1.00 0.00 ? 49 PHE A HE2  8  
ATOM 6868  H HZ   . PHE A 1 49 ? 3.724   3.298   1.828   1.00 0.00 ? 49 PHE A HZ   8  
ATOM 6869  N N    . LYS A 1 50 ? 2.763   -1.730  -3.352  1.00 0.00 ? 50 LYS A N    8  
ATOM 6870  C CA   . LYS A 1 50 ? 2.873   -3.067  -2.794  1.00 0.00 ? 50 LYS A CA   8  
ATOM 6871  C C    . LYS A 1 50 ? 3.575   -2.993  -1.437  1.00 0.00 ? 50 LYS A C    8  
ATOM 6872  O O    . LYS A 1 50 ? 4.227   -1.998  -1.125  1.00 0.00 ? 50 LYS A O    8  
ATOM 6873  C CB   . LYS A 1 50 ? 3.555   -4.009  -3.789  1.00 0.00 ? 50 LYS A CB   8  
ATOM 6874  C CG   . LYS A 1 50 ? 2.601   -4.393  -4.922  1.00 0.00 ? 50 LYS A CG   8  
ATOM 6875  C CD   . LYS A 1 50 ? 2.722   -5.881  -5.259  1.00 0.00 ? 50 LYS A CD   8  
ATOM 6876  C CE   . LYS A 1 50 ? 2.933   -6.087  -6.760  1.00 0.00 ? 50 LYS A CE   8  
ATOM 6877  N NZ   . LYS A 1 50 ? 1.986   -7.098  -7.282  1.00 0.00 ? 50 LYS A NZ   8  
ATOM 6878  H H    . LYS A 1 50 ? 3.260   -1.587  -4.207  1.00 0.00 ? 50 LYS A H    8  
ATOM 6879  H HA   . LYS A 1 50 ? 1.860   -3.441  -2.639  1.00 0.00 ? 50 LYS A HA   8  
ATOM 6880  H HB2  . LYS A 1 50 ? 4.441   -3.527  -4.202  1.00 0.00 ? 50 LYS A HB2  8  
ATOM 6881  H HB3  . LYS A 1 50 ? 3.892   -4.907  -3.272  1.00 0.00 ? 50 LYS A HB3  8  
ATOM 6882  H HG2  . LYS A 1 50 ? 1.576   -4.165  -4.632  1.00 0.00 ? 50 LYS A HG2  8  
ATOM 6883  H HG3  . LYS A 1 50 ? 2.823   -3.797  -5.807  1.00 0.00 ? 50 LYS A HG3  8  
ATOM 6884  H HD2  . LYS A 1 50 ? 3.556   -6.316  -4.708  1.00 0.00 ? 50 LYS A HD2  8  
ATOM 6885  H HD3  . LYS A 1 50 ? 1.821   -6.404  -4.939  1.00 0.00 ? 50 LYS A HD3  8  
ATOM 6886  H HE2  . LYS A 1 50 ? 2.793   -5.143  -7.286  1.00 0.00 ? 50 LYS A HE2  8  
ATOM 6887  H HE3  . LYS A 1 50 ? 3.957   -6.409  -6.949  1.00 0.00 ? 50 LYS A HE3  8  
ATOM 6888  H HZ1  . LYS A 1 50 ? 1.052   -6.838  -7.037  1.00 0.00 ? 50 LYS A HZ1  8  
ATOM 6889  H HZ2  . LYS A 1 50 ? 2.067   -7.147  -8.278  1.00 0.00 ? 50 LYS A HZ2  8  
ATOM 6890  H HZ3  . LYS A 1 50 ? 2.199   -7.991  -6.886  1.00 0.00 ? 50 LYS A HZ3  8  
ATOM 6891  N N    . PRO A 1 51 ? 3.414   -4.087  -0.645  1.00 0.00 ? 51 PRO A N    8  
ATOM 6892  C CA   . PRO A 1 51 ? 4.025   -4.156  0.671   1.00 0.00 ? 51 PRO A CA   8  
ATOM 6893  C C    . PRO A 1 51 ? 5.530   -4.412  0.565   1.00 0.00 ? 51 PRO A C    8  
ATOM 6894  O O    . PRO A 1 51 ? 5.953   -5.414  -0.008  1.00 0.00 ? 51 PRO A O    8  
ATOM 6895  C CB   . PRO A 1 51 ? 3.283   -5.269  1.392   1.00 0.00 ? 51 PRO A CB   8  
ATOM 6896  C CG   . PRO A 1 51 ? 2.606   -6.090  0.306   1.00 0.00 ? 51 PRO A CG   8  
ATOM 6897  C CD   . PRO A 1 51 ? 2.648   -5.284  -0.982  1.00 0.00 ? 51 PRO A CD   8  
ATOM 6898  H HA   . PRO A 1 51 ? 3.929   -3.280  1.144   1.00 0.00 ? 51 PRO A HA   8  
ATOM 6899  H HB2  . PRO A 1 51 ? 3.969   -5.883  1.975   1.00 0.00 ? 51 PRO A HB2  8  
ATOM 6900  H HB3  . PRO A 1 51 ? 2.549   -4.862  2.089   1.00 0.00 ? 51 PRO A HB3  8  
ATOM 6901  H HG2  . PRO A 1 51 ? 3.115   -7.045  0.177   1.00 0.00 ? 51 PRO A HG2  8  
ATOM 6902  H HG3  . PRO A 1 51 ? 1.575   -6.313  0.583   1.00 0.00 ? 51 PRO A HG3  8  
ATOM 6903  H HD2  . PRO A 1 51 ? 3.125   -5.846  -1.785  1.00 0.00 ? 51 PRO A HD2  8  
ATOM 6904  H HD3  . PRO A 1 51 ? 1.645   -5.030  -1.323  1.00 0.00 ? 51 PRO A HD3  8  
ATOM 6905  N N    . LEU A 1 52 ? 6.296   -3.487  1.125   1.00 0.00 ? 52 LEU A N    8  
ATOM 6906  C CA   . LEU A 1 52 ? 7.744   -3.600  1.100   1.00 0.00 ? 52 LEU A CA   8  
ATOM 6907  C C    . LEU A 1 52 ? 8.139   -5.073  1.218   1.00 0.00 ? 52 LEU A C    8  
ATOM 6908  O O    . LEU A 1 52 ? 7.717   -5.760  2.147   1.00 0.00 ? 52 LEU A O    8  
ATOM 6909  C CB   . LEU A 1 52 ? 8.370   -2.708  2.175   1.00 0.00 ? 52 LEU A CB   8  
ATOM 6910  C CG   . LEU A 1 52 ? 9.857   -2.934  2.452   1.00 0.00 ? 52 LEU A CG   8  
ATOM 6911  C CD1  . LEU A 1 52 ? 10.432  -1.808  3.313   1.00 0.00 ? 52 LEU A CD1  8  
ATOM 6912  C CD2  . LEU A 1 52 ? 10.095  -4.311  3.075   1.00 0.00 ? 52 LEU A CD2  8  
ATOM 6913  H H    . LEU A 1 52 ? 5.943   -2.674  1.588   1.00 0.00 ? 52 LEU A H    8  
ATOM 6914  H HA   . LEU A 1 52 ? 8.084   -3.227  0.134   1.00 0.00 ? 52 LEU A HA   8  
ATOM 6915  H HB2  . LEU A 1 52 ? 8.229   -1.667  1.882   1.00 0.00 ? 52 LEU A HB2  8  
ATOM 6916  H HB3  . LEU A 1 52 ? 7.821   -2.854  3.105   1.00 0.00 ? 52 LEU A HB3  8  
ATOM 6917  H HG   . LEU A 1 52 ? 10.389  -2.915  1.500   1.00 0.00 ? 52 LEU A HG   8  
ATOM 6918  H HD11 . LEU A 1 52 ? 9.695   -1.509  4.059   1.00 0.00 ? 52 LEU A HD11 8  
ATOM 6919  H HD12 . LEU A 1 52 ? 11.334  -2.159  3.815   1.00 0.00 ? 52 LEU A HD12 8  
ATOM 6920  H HD13 . LEU A 1 52 ? 10.676  -0.955  2.681   1.00 0.00 ? 52 LEU A HD13 8  
ATOM 6921  H HD21 . LEU A 1 52 ? 9.147   -4.722  3.422   1.00 0.00 ? 52 LEU A HD21 8  
ATOM 6922  H HD22 . LEU A 1 52 ? 10.529  -4.978  2.329   1.00 0.00 ? 52 LEU A HD22 8  
ATOM 6923  H HD23 . LEU A 1 52 ? 10.780  -4.215  3.917   1.00 0.00 ? 52 LEU A HD23 8  
ATOM 6924  N N    . GLN A 1 53 ? 8.944   -5.516  0.263   1.00 0.00 ? 53 GLN A N    8  
ATOM 6925  C CA   . GLN A 1 53 ? 9.400   -6.895  0.248   1.00 0.00 ? 53 GLN A CA   8  
ATOM 6926  C C    . GLN A 1 53 ? 10.342  -7.156  1.426   1.00 0.00 ? 53 GLN A C    8  
ATOM 6927  O O    . GLN A 1 53 ? 11.538  -7.365  1.233   1.00 0.00 ? 53 GLN A O    8  
ATOM 6928  C CB   . GLN A 1 53 ? 10.077  -7.234  -1.081  1.00 0.00 ? 53 GLN A CB   8  
ATOM 6929  C CG   . GLN A 1 53 ? 11.334  -6.387  -1.288  1.00 0.00 ? 53 GLN A CG   8  
ATOM 6930  C CD   . GLN A 1 53 ? 11.153  -5.413  -2.453  1.00 0.00 ? 53 GLN A CD   8  
ATOM 6931  O OE1  . GLN A 1 53 ? 11.042  -5.797  -3.606  1.00 0.00 ? 53 GLN A OE1  8  
ATOM 6932  N NE2  . GLN A 1 53 ? 11.131  -4.133  -2.090  1.00 0.00 ? 53 GLN A NE2  8  
ATOM 6933  H H    . GLN A 1 53 ? 9.283   -4.950  -0.489  1.00 0.00 ? 53 GLN A H    8  
ATOM 6934  H HA   . GLN A 1 53 ? 8.499   -7.499  0.355   1.00 0.00 ? 53 GLN A HA   8  
ATOM 6935  H HB2  . GLN A 1 53 ? 10.340  -8.292  -1.100  1.00 0.00 ? 53 GLN A HB2  8  
ATOM 6936  H HB3  . GLN A 1 53 ? 9.381   -7.064  -1.902  1.00 0.00 ? 53 GLN A HB3  8  
ATOM 6937  H HG2  . GLN A 1 53 ? 11.557  -5.833  -0.376  1.00 0.00 ? 53 GLN A HG2  8  
ATOM 6938  H HG3  . GLN A 1 53 ? 12.187  -7.038  -1.482  1.00 0.00 ? 53 GLN A HG3  8  
ATOM 6939  H HE21 . GLN A 1 53 ? 11.228  -3.886  -1.126  1.00 0.00 ? 53 GLN A HE21 8  
ATOM 6940  H HE22 . GLN A 1 53 ? 11.016  -3.420  -2.781  1.00 0.00 ? 53 GLN A HE22 8  
ATOM 6941  N N    . GLU A 1 54 ? 9.766   -7.133  2.619   1.00 0.00 ? 54 GLU A N    8  
ATOM 6942  C CA   . GLU A 1 54 ? 10.539  -7.364  3.827   1.00 0.00 ? 54 GLU A CA   8  
ATOM 6943  C C    . GLU A 1 54 ? 11.493  -8.544  3.630   1.00 0.00 ? 54 GLU A C    8  
ATOM 6944  O O    . GLU A 1 54 ? 11.054  -9.667  3.383   1.00 0.00 ? 54 GLU A O    8  
ATOM 6945  C CB   . GLU A 1 54 ? 9.622   -7.596  5.029   1.00 0.00 ? 54 GLU A CB   8  
ATOM 6946  C CG   . GLU A 1 54 ? 9.129   -9.044  5.072   1.00 0.00 ? 54 GLU A CG   8  
ATOM 6947  C CD   . GLU A 1 54 ? 8.494   -9.447  3.740   1.00 0.00 ? 54 GLU A CD   8  
ATOM 6948  O OE1  . GLU A 1 54 ? 7.806   -8.582  3.155   1.00 0.00 ? 54 GLU A OE1  8  
ATOM 6949  O OE2  . GLU A 1 54 ? 8.710   -10.610 3.337   1.00 0.00 ? 54 GLU A OE2  8  
ATOM 6950  H H    . GLU A 1 54 ? 8.792   -6.962  2.767   1.00 0.00 ? 54 GLU A H    8  
ATOM 6951  H HA   . GLU A 1 54 ? 11.111  -6.449  3.985   1.00 0.00 ? 54 GLU A HA   8  
ATOM 6952  H HB2  . GLU A 1 54 ? 10.156  -7.362  5.950   1.00 0.00 ? 54 GLU A HB2  8  
ATOM 6953  H HB3  . GLU A 1 54 ? 8.769   -6.919  4.976   1.00 0.00 ? 54 GLU A HB3  8  
ATOM 6954  H HG2  . GLU A 1 54 ? 9.963   -9.709  5.298   1.00 0.00 ? 54 GLU A HG2  8  
ATOM 6955  H HG3  . GLU A 1 54 ? 8.402   -9.161  5.876   1.00 0.00 ? 54 GLU A HG3  8  
ATOM 6956  N N    . ALA A 1 55 ? 12.779  -8.250  3.746   1.00 0.00 ? 55 ALA A N    8  
ATOM 6957  C CA   . ALA A 1 55 ? 13.799  -9.273  3.583   1.00 0.00 ? 55 ALA A CA   8  
ATOM 6958  C C    . ALA A 1 55 ? 15.143  -8.729  4.070   1.00 0.00 ? 55 ALA A C    8  
ATOM 6959  O O    . ALA A 1 55 ? 16.182  -9.009  3.475   1.00 0.00 ? 55 ALA A O    8  
ATOM 6960  C CB   . ALA A 1 55 ? 13.846  -9.719  2.120   1.00 0.00 ? 55 ALA A CB   8  
ATOM 6961  H H    . ALA A 1 55 ? 13.128  -7.335  3.946   1.00 0.00 ? 55 ALA A H    8  
ATOM 6962  H HA   . ALA A 1 55 ? 13.515  -10.125 4.201   1.00 0.00 ? 55 ALA A HA   8  
ATOM 6963  H HB1  . ALA A 1 55 ? 12.830  -9.877  1.756   1.00 0.00 ? 55 ALA A HB1  8  
ATOM 6964  H HB2  . ALA A 1 55 ? 14.409  -10.649 2.042   1.00 0.00 ? 55 ALA A HB2  8  
ATOM 6965  H HB3  . ALA A 1 55 ? 14.331  -8.949  1.521   1.00 0.00 ? 55 ALA A HB3  8  
ATOM 6966  N N    . GLU A 1 56 ? 15.079  -7.962  5.148   1.00 0.00 ? 56 GLU A N    8  
ATOM 6967  C CA   . GLU A 1 56 ? 16.279  -7.376  5.722   1.00 0.00 ? 56 GLU A CA   8  
ATOM 6968  C C    . GLU A 1 56 ? 16.002  -6.886  7.145   1.00 0.00 ? 56 GLU A C    8  
ATOM 6969  O O    . GLU A 1 56 ? 14.865  -6.935  7.612   1.00 0.00 ? 56 GLU A O    8  
ATOM 6970  C CB   . GLU A 1 56 ? 16.809  -6.241  4.844   1.00 0.00 ? 56 GLU A CB   8  
ATOM 6971  C CG   . GLU A 1 56 ? 15.775  -5.121  4.713   1.00 0.00 ? 56 GLU A CG   8  
ATOM 6972  C CD   . GLU A 1 56 ? 14.952  -5.281  3.433   1.00 0.00 ? 56 GLU A CD   8  
ATOM 6973  O OE1  . GLU A 1 56 ? 15.576  -5.577  2.391   1.00 0.00 ? 56 GLU A OE1  8  
ATOM 6974  O OE2  . GLU A 1 56 ? 13.718  -5.104  3.526   1.00 0.00 ? 56 GLU A OE2  8  
ATOM 6975  H H    . GLU A 1 56 ? 14.230  -7.739  5.627   1.00 0.00 ? 56 GLU A H    8  
ATOM 6976  H HA   . GLU A 1 56 ? 17.012  -8.182  5.745   1.00 0.00 ? 56 GLU A HA   8  
ATOM 6977  H HB2  . GLU A 1 56 ? 17.729  -5.843  5.274   1.00 0.00 ? 56 GLU A HB2  8  
ATOM 6978  H HB3  . GLU A 1 56 ? 17.059  -6.627  3.856   1.00 0.00 ? 56 GLU A HB3  8  
ATOM 6979  H HG2  . GLU A 1 56 ? 15.113  -5.129  5.579   1.00 0.00 ? 56 GLU A HG2  8  
ATOM 6980  H HG3  . GLU A 1 56 ? 16.279  -4.155  4.707   1.00 0.00 ? 56 GLU A HG3  8  
ATOM 6981  N N    . CYS A 1 57 ? 17.060  -6.424  7.794   1.00 0.00 ? 57 CYS A N    8  
ATOM 6982  C CA   . CYS A 1 57 ? 16.946  -5.925  9.154   1.00 0.00 ? 57 CYS A CA   8  
ATOM 6983  C C    . CYS A 1 57 ? 16.395  -4.499  9.097   1.00 0.00 ? 57 CYS A C    8  
ATOM 6984  O O    . CYS A 1 57 ? 15.378  -4.197  9.720   1.00 0.00 ? 57 CYS A O    8  
ATOM 6985  C CB   . CYS A 1 57 ? 18.282  -5.992  9.896   1.00 0.00 ? 57 CYS A CB   8  
ATOM 6986  S SG   . CYS A 1 57 ? 19.161  -7.590  9.751   1.00 0.00 ? 57 CYS A SG   8  
ATOM 6987  H H    . CYS A 1 57 ? 17.982  -6.388  7.407   1.00 0.00 ? 57 CYS A H    8  
ATOM 6988  H HA   . CYS A 1 57 ? 16.252  -6.587  9.673   1.00 0.00 ? 57 CYS A HA   8  
ATOM 6989  H HB2  . CYS A 1 57 ? 18.931  -5.201  9.520   1.00 0.00 ? 57 CYS A HB2  8  
ATOM 6990  H HB3  . CYS A 1 57 ? 18.106  -5.785  10.952  1.00 0.00 ? 57 CYS A HB3  8  
ATOM 6991  N N    . THR A 1 58 ? 17.091  -3.659  8.345   1.00 0.00 ? 58 THR A N    8  
ATOM 6992  C CA   . THR A 1 58 ? 16.685  -2.272  8.199   1.00 0.00 ? 58 THR A CA   8  
ATOM 6993  C C    . THR A 1 58 ? 16.581  -1.600  9.569   1.00 0.00 ? 58 THR A C    8  
ATOM 6994  O O    . THR A 1 58 ? 15.488  -1.461  10.115  1.00 0.00 ? 58 THR A O    8  
ATOM 6995  C CB   . THR A 1 58 ? 15.376  -2.243  7.407   1.00 0.00 ? 58 THR A CB   8  
ATOM 6996  O OG1  . THR A 1 58 ? 15.776  -2.506  6.065   1.00 0.00 ? 58 THR A OG1  8  
ATOM 6997  C CG2  . THR A 1 58 ? 14.759  -0.845  7.345   1.00 0.00 ? 58 THR A CG2  8  
ATOM 6998  H H    . THR A 1 58 ? 17.917  -3.913  7.841   1.00 0.00 ? 58 THR A H    8  
ATOM 6999  H HA   . THR A 1 58 ? 17.459  -1.744  7.641   1.00 0.00 ? 58 THR A HA   8  
ATOM 7000  H HB   . THR A 1 58 ? 14.664  -2.966  7.806   1.00 0.00 ? 58 THR A HB   8  
ATOM 7001  H HG1  . THR A 1 58 ? 16.500  -1.871  5.794   1.00 0.00 ? 58 THR A HG1  8  
ATOM 7002  H HG21 . THR A 1 58 ? 14.888  -0.348  8.307   1.00 0.00 ? 58 THR A HG21 8  
ATOM 7003  H HG22 . THR A 1 58 ? 15.254  -0.263  6.567   1.00 0.00 ? 58 THR A HG22 8  
ATOM 7004  H HG23 . THR A 1 58 ? 13.696  -0.926  7.118   1.00 0.00 ? 58 THR A HG23 8  
ATOM 7005  N N    . PHE A 1 59 ? 17.734  -1.200  10.085  1.00 0.00 ? 59 PHE A N    8  
ATOM 7006  C CA   . PHE A 1 59 ? 17.786  -0.545  11.382  1.00 0.00 ? 59 PHE A CA   8  
ATOM 7007  C C    . PHE A 1 59 ? 16.834  -1.216  12.374  1.00 0.00 ? 59 PHE A C    8  
ATOM 7008  O O    . PHE A 1 59 ? 17.156  -2.260  12.940  1.00 0.00 ? 59 PHE A O    8  
ATOM 7009  C CB   . PHE A 1 59 ? 17.344  0.904   11.169  1.00 0.00 ? 59 PHE A CB   8  
ATOM 7010  C CG   . PHE A 1 59 ? 17.277  1.729   12.456  1.00 0.00 ? 59 PHE A CG   8  
ATOM 7011  C CD1  . PHE A 1 59 ? 18.418  2.029   13.133  1.00 0.00 ? 59 PHE A CD1  8  
ATOM 7012  C CD2  . PHE A 1 59 ? 16.075  2.162   12.923  1.00 0.00 ? 59 PHE A CD2  8  
ATOM 7013  C CE1  . PHE A 1 59 ? 18.355  2.794   14.327  1.00 0.00 ? 59 PHE A CE1  8  
ATOM 7014  C CE2  . PHE A 1 59 ? 16.012  2.928   14.118  1.00 0.00 ? 59 PHE A CE2  8  
ATOM 7015  C CZ   . PHE A 1 59 ? 17.153  3.228   14.794  1.00 0.00 ? 59 PHE A CZ   8  
ATOM 7016  H H    . PHE A 1 59 ? 18.619  -1.316  9.635   1.00 0.00 ? 59 PHE A H    8  
ATOM 7017  H HA   . PHE A 1 59 ? 18.810  -0.633  11.747  1.00 0.00 ? 59 PHE A HA   8  
ATOM 7018  H HB2  . PHE A 1 59 ? 18.035  1.386   10.477  1.00 0.00 ? 59 PHE A HB2  8  
ATOM 7019  H HB3  . PHE A 1 59 ? 16.363  0.908   10.695  1.00 0.00 ? 59 PHE A HB3  8  
ATOM 7020  H HD1  . PHE A 1 59 ? 19.381  1.681   12.758  1.00 0.00 ? 59 PHE A HD1  8  
ATOM 7021  H HD2  . PHE A 1 59 ? 15.160  1.922   12.381  1.00 0.00 ? 59 PHE A HD2  8  
ATOM 7022  H HE1  . PHE A 1 59 ? 19.269  3.035   14.869  1.00 0.00 ? 59 PHE A HE1  8  
ATOM 7023  H HE2  . PHE A 1 59 ? 15.049  3.275   14.492  1.00 0.00 ? 59 PHE A HE2  8  
ATOM 7024  H HZ   . PHE A 1 59 ? 17.105  3.815   15.711  1.00 0.00 ? 59 PHE A HZ   8  
ATOM 7025  N N    . GLU A 1 1  ? 4.560   -13.662 19.968  1.00 0.00 ? 1  GLU A N    9  
ATOM 7026  C CA   . GLU A 1 1  ? 5.572   -12.717 20.409  1.00 0.00 ? 1  GLU A CA   9  
ATOM 7027  C C    . GLU A 1 1  ? 5.185   -11.295 19.999  1.00 0.00 ? 1  GLU A C    9  
ATOM 7028  O O    . GLU A 1 1  ? 4.792   -10.487 20.839  1.00 0.00 ? 1  GLU A O    9  
ATOM 7029  C CB   . GLU A 1 1  ? 6.950   -13.091 19.859  1.00 0.00 ? 1  GLU A CB   9  
ATOM 7030  C CG   . GLU A 1 1  ? 7.805   -13.764 20.935  1.00 0.00 ? 1  GLU A CG   9  
ATOM 7031  C CD   . GLU A 1 1  ? 8.525   -14.992 20.374  1.00 0.00 ? 1  GLU A CD   9  
ATOM 7032  O OE1  . GLU A 1 1  ? 7.810   -15.926 19.952  1.00 0.00 ? 1  GLU A OE1  9  
ATOM 7033  O OE2  . GLU A 1 1  ? 9.775   -14.969 20.380  1.00 0.00 ? 1  GLU A OE2  9  
ATOM 7034  H H    . GLU A 1 1  ? 4.107   -14.170 20.700  1.00 0.00 ? 1  GLU A H    9  
ATOM 7035  H HA   . GLU A 1 1  ? 5.588   -12.797 21.496  1.00 0.00 ? 1  GLU A HA   9  
ATOM 7036  H HB2  . GLU A 1 1  ? 6.835   -13.762 19.008  1.00 0.00 ? 1  GLU A HB2  9  
ATOM 7037  H HB3  . GLU A 1 1  ? 7.455   -12.197 19.494  1.00 0.00 ? 1  GLU A HB3  9  
ATOM 7038  H HG2  . GLU A 1 1  ? 8.537   -13.053 21.320  1.00 0.00 ? 1  GLU A HG2  9  
ATOM 7039  H HG3  . GLU A 1 1  ? 7.175   -14.059 21.774  1.00 0.00 ? 1  GLU A HG3  9  
ATOM 7040  N N    . GLU A 1 2  ? 5.311   -11.032 18.706  1.00 0.00 ? 2  GLU A N    9  
ATOM 7041  C CA   . GLU A 1 2  ? 4.979   -9.721  18.173  1.00 0.00 ? 2  GLU A CA   9  
ATOM 7042  C C    . GLU A 1 2  ? 5.214   -9.688  16.662  1.00 0.00 ? 2  GLU A C    9  
ATOM 7043  O O    . GLU A 1 2  ? 6.352   -9.580  16.209  1.00 0.00 ? 2  GLU A O    9  
ATOM 7044  C CB   . GLU A 1 2  ? 5.781   -8.624  18.877  1.00 0.00 ? 2  GLU A CB   9  
ATOM 7045  C CG   . GLU A 1 2  ? 4.853   -7.569  19.482  1.00 0.00 ? 2  GLU A CG   9  
ATOM 7046  C CD   . GLU A 1 2  ? 5.611   -6.270  19.764  1.00 0.00 ? 2  GLU A CD   9  
ATOM 7047  O OE1  . GLU A 1 2  ? 6.248   -6.205  20.837  1.00 0.00 ? 2  GLU A OE1  9  
ATOM 7048  O OE2  . GLU A 1 2  ? 5.535   -5.370  18.899  1.00 0.00 ? 2  GLU A OE2  9  
ATOM 7049  H H    . GLU A 1 2  ? 5.631   -11.694 18.029  1.00 0.00 ? 2  GLU A H    9  
ATOM 7050  H HA   . GLU A 1 2  ? 3.919   -9.581  18.387  1.00 0.00 ? 2  GLU A HA   9  
ATOM 7051  H HB2  . GLU A 1 2  ? 6.396   -9.065  19.661  1.00 0.00 ? 2  GLU A HB2  9  
ATOM 7052  H HB3  . GLU A 1 2  ? 6.460   -8.153  18.167  1.00 0.00 ? 2  GLU A HB3  9  
ATOM 7053  H HG2  . GLU A 1 2  ? 4.027   -7.372  18.799  1.00 0.00 ? 2  GLU A HG2  9  
ATOM 7054  H HG3  . GLU A 1 2  ? 4.419   -7.949  20.407  1.00 0.00 ? 2  GLU A HG3  9  
ATOM 7055  N N    . TYR A 1 3  ? 4.118   -9.781  15.923  1.00 0.00 ? 3  TYR A N    9  
ATOM 7056  C CA   . TYR A 1 3  ? 4.190   -9.763  14.472  1.00 0.00 ? 3  TYR A CA   9  
ATOM 7057  C C    . TYR A 1 3  ? 2.803   -9.944  13.852  1.00 0.00 ? 3  TYR A C    9  
ATOM 7058  O O    . TYR A 1 3  ? 2.275   -11.054 13.815  1.00 0.00 ? 3  TYR A O    9  
ATOM 7059  C CB   . TYR A 1 3  ? 5.070   -10.951 14.078  1.00 0.00 ? 3  TYR A CB   9  
ATOM 7060  C CG   . TYR A 1 3  ? 5.015   -11.299 12.590  1.00 0.00 ? 3  TYR A CG   9  
ATOM 7061  C CD1  . TYR A 1 3  ? 5.644   -10.488 11.667  1.00 0.00 ? 3  TYR A CD1  9  
ATOM 7062  C CD2  . TYR A 1 3  ? 4.337   -12.426 12.169  1.00 0.00 ? 3  TYR A CD2  9  
ATOM 7063  C CE1  . TYR A 1 3  ? 5.592   -10.816 10.266  1.00 0.00 ? 3  TYR A CE1  9  
ATOM 7064  C CE2  . TYR A 1 3  ? 4.285   -12.754 10.768  1.00 0.00 ? 3  TYR A CE2  9  
ATOM 7065  C CZ   . TYR A 1 3  ? 4.915   -11.933 9.886   1.00 0.00 ? 3  TYR A CZ   9  
ATOM 7066  O OH   . TYR A 1 3  ? 4.867   -12.243 8.563   1.00 0.00 ? 3  TYR A OH   9  
ATOM 7067  H H    . TYR A 1 3  ? 3.195   -9.868  16.299  1.00 0.00 ? 3  TYR A H    9  
ATOM 7068  H HA   . TYR A 1 3  ? 4.592   -8.797  14.167  1.00 0.00 ? 3  TYR A HA   9  
ATOM 7069  H HB2  . TYR A 1 3  ? 6.102   -10.731 14.352  1.00 0.00 ? 3  TYR A HB2  9  
ATOM 7070  H HB3  . TYR A 1 3  ? 4.766   -11.823 14.657  1.00 0.00 ? 3  TYR A HB3  9  
ATOM 7071  H HD1  . TYR A 1 3  ? 6.179   -9.599  11.999  1.00 0.00 ? 3  TYR A HD1  9  
ATOM 7072  H HD2  . TYR A 1 3  ? 3.840   -13.067 12.898  1.00 0.00 ? 3  TYR A HD2  9  
ATOM 7073  H HE1  . TYR A 1 3  ? 6.084   -10.184 9.527   1.00 0.00 ? 3  TYR A HE1  9  
ATOM 7074  H HE2  . TYR A 1 3  ? 3.753   -13.640 10.423  1.00 0.00 ? 3  TYR A HE2  9  
ATOM 7075  H HH   . TYR A 1 3  ? 5.239   -13.159 8.412   1.00 0.00 ? 3  TYR A HH   9  
ATOM 7076  N N    . VAL A 1 4  ? 2.251   -8.835  13.381  1.00 0.00 ? 4  VAL A N    9  
ATOM 7077  C CA   . VAL A 1 4  ? 0.936   -8.857  12.764  1.00 0.00 ? 4  VAL A CA   9  
ATOM 7078  C C    . VAL A 1 4  ? 0.605   -7.463  12.227  1.00 0.00 ? 4  VAL A C    9  
ATOM 7079  O O    . VAL A 1 4  ? -0.477  -6.937  12.481  1.00 0.00 ? 4  VAL A O    9  
ATOM 7080  C CB   . VAL A 1 4  ? -0.102  -9.375  13.763  1.00 0.00 ? 4  VAL A CB   9  
ATOM 7081  C CG1  . VAL A 1 4  ? -0.158  -8.483  15.005  1.00 0.00 ? 4  VAL A CG1  9  
ATOM 7082  C CG2  . VAL A 1 4  ? -1.480  -9.493  13.110  1.00 0.00 ? 4  VAL A CG2  9  
ATOM 7083  H H    . VAL A 1 4  ? 2.687   -7.936  13.415  1.00 0.00 ? 4  VAL A H    9  
ATOM 7084  H HA   . VAL A 1 4  ? 0.976   -9.555  11.928  1.00 0.00 ? 4  VAL A HA   9  
ATOM 7085  H HB   . VAL A 1 4  ? 0.206   -10.371 14.079  1.00 0.00 ? 4  VAL A HB   9  
ATOM 7086  H HG11 . VAL A 1 4  ? 0.755   -7.892  15.070  1.00 0.00 ? 4  VAL A HG11 9  
ATOM 7087  H HG12 . VAL A 1 4  ? -1.018  -7.817  14.936  1.00 0.00 ? 4  VAL A HG12 9  
ATOM 7088  H HG13 . VAL A 1 4  ? -0.252  -9.106  15.895  1.00 0.00 ? 4  VAL A HG13 9  
ATOM 7089  H HG21 . VAL A 1 4  ? -1.520  -8.854  12.227  1.00 0.00 ? 4  VAL A HG21 9  
ATOM 7090  H HG22 . VAL A 1 4  ? -1.656  -10.528 12.817  1.00 0.00 ? 4  VAL A HG22 9  
ATOM 7091  H HG23 . VAL A 1 4  ? -2.247  -9.181  13.819  1.00 0.00 ? 4  VAL A HG23 9  
ATOM 7092  N N    . GLY A 1 5  ? 1.558   -6.905  11.494  1.00 0.00 ? 5  GLY A N    9  
ATOM 7093  C CA   . GLY A 1 5  ? 1.381   -5.583  10.919  1.00 0.00 ? 5  GLY A CA   9  
ATOM 7094  C C    . GLY A 1 5  ? 0.999   -4.564  11.995  1.00 0.00 ? 5  GLY A C    9  
ATOM 7095  O O    . GLY A 1 5  ? -0.048  -3.924  11.904  1.00 0.00 ? 5  GLY A O    9  
ATOM 7096  H H    . GLY A 1 5  ? 2.435   -7.340  11.293  1.00 0.00 ? 5  GLY A H    9  
ATOM 7097  H HA2  . GLY A 1 5  ? 2.303   -5.270  10.429  1.00 0.00 ? 5  GLY A HA2  9  
ATOM 7098  H HA3  . GLY A 1 5  ? 0.607   -5.616  10.153  1.00 0.00 ? 5  GLY A HA3  9  
ATOM 7099  N N    . LEU A 1 6  ? 1.867   -4.445  12.988  1.00 0.00 ? 6  LEU A N    9  
ATOM 7100  C CA   . LEU A 1 6  ? 1.633   -3.515  14.080  1.00 0.00 ? 6  LEU A CA   9  
ATOM 7101  C C    . LEU A 1 6  ? 2.309   -2.180  13.760  1.00 0.00 ? 6  LEU A C    9  
ATOM 7102  O O    . LEU A 1 6  ? 2.672   -1.431  14.666  1.00 0.00 ? 6  LEU A O    9  
ATOM 7103  C CB   . LEU A 1 6  ? 2.079   -4.126  15.409  1.00 0.00 ? 6  LEU A CB   9  
ATOM 7104  C CG   . LEU A 1 6  ? 3.488   -4.723  15.435  1.00 0.00 ? 6  LEU A CG   9  
ATOM 7105  C CD1  . LEU A 1 6  ? 3.481   -6.167  14.930  1.00 0.00 ? 6  LEU A CD1  9  
ATOM 7106  C CD2  . LEU A 1 6  ? 4.468   -3.847  14.653  1.00 0.00 ? 6  LEU A CD2  9  
ATOM 7107  H H    . LEU A 1 6  ? 2.716   -4.969  13.054  1.00 0.00 ? 6  LEU A H    9  
ATOM 7108  H HA   . LEU A 1 6  ? 0.558   -3.351  14.144  1.00 0.00 ? 6  LEU A HA   9  
ATOM 7109  H HB2  . LEU A 1 6  ? 2.017   -3.357  16.179  1.00 0.00 ? 6  LEU A HB2  9  
ATOM 7110  H HB3  . LEU A 1 6  ? 1.370   -4.908  15.683  1.00 0.00 ? 6  LEU A HB3  9  
ATOM 7111  H HG   . LEU A 1 6  ? 3.830   -4.745  16.469  1.00 0.00 ? 6  LEU A HG   9  
ATOM 7112  H HD11 . LEU A 1 6  ? 2.451   -6.507  14.815  1.00 0.00 ? 6  LEU A HD11 9  
ATOM 7113  H HD12 . LEU A 1 6  ? 3.990   -6.218  13.968  1.00 0.00 ? 6  LEU A HD12 9  
ATOM 7114  H HD13 . LEU A 1 6  ? 3.996   -6.805  15.648  1.00 0.00 ? 6  LEU A HD13 9  
ATOM 7115  H HD21 . LEU A 1 6  ? 4.127   -3.751  13.622  1.00 0.00 ? 6  LEU A HD21 9  
ATOM 7116  H HD22 . LEU A 1 6  ? 4.519   -2.859  15.112  1.00 0.00 ? 6  LEU A HD22 9  
ATOM 7117  H HD23 . LEU A 1 6  ? 5.457   -4.305  14.668  1.00 0.00 ? 6  LEU A HD23 9  
ATOM 7118  N N    . SER A 1 7  ? 2.456   -1.922  12.469  1.00 0.00 ? 7  SER A N    9  
ATOM 7119  C CA   . SER A 1 7  ? 3.081   -0.690  12.018  1.00 0.00 ? 7  SER A CA   9  
ATOM 7120  C C    . SER A 1 7  ? 3.060   -0.621  10.490  1.00 0.00 ? 7  SER A C    9  
ATOM 7121  O O    . SER A 1 7  ? 2.397   -1.426  9.838   1.00 0.00 ? 7  SER A O    9  
ATOM 7122  C CB   . SER A 1 7  ? 4.517   -0.580  12.534  1.00 0.00 ? 7  SER A CB   9  
ATOM 7123  O OG   . SER A 1 7  ? 5.337   -1.646  12.062  1.00 0.00 ? 7  SER A OG   9  
ATOM 7124  H H    . SER A 1 7  ? 2.157   -2.536  11.738  1.00 0.00 ? 7  SER A H    9  
ATOM 7125  H HA   . SER A 1 7  ? 2.480   0.112   12.446  1.00 0.00 ? 7  SER A HA   9  
ATOM 7126  H HB2  . SER A 1 7  ? 4.944   0.372   12.219  1.00 0.00 ? 7  SER A HB2  9  
ATOM 7127  H HB3  . SER A 1 7  ? 4.512   -0.583  13.624  1.00 0.00 ? 7  SER A HB3  9  
ATOM 7128  H HG   . SER A 1 7  ? 4.766   -2.413  11.768  1.00 0.00 ? 7  SER A HG   9  
ATOM 7129  N N    . ALA A 1 8  ? 3.792   0.350   9.963   1.00 0.00 ? 8  ALA A N    9  
ATOM 7130  C CA   . ALA A 1 8  ? 3.865   0.535   8.524   1.00 0.00 ? 8  ALA A CA   9  
ATOM 7131  C C    . ALA A 1 8  ? 5.095   -0.198  7.981   1.00 0.00 ? 8  ALA A C    9  
ATOM 7132  O O    . ALA A 1 8  ? 5.675   0.215   6.978   1.00 0.00 ? 8  ALA A O    9  
ATOM 7133  C CB   . ALA A 1 8  ? 3.888   2.030   8.201   1.00 0.00 ? 8  ALA A CB   9  
ATOM 7134  H H    . ALA A 1 8  ? 4.328   1.001   10.500  1.00 0.00 ? 8  ALA A H    9  
ATOM 7135  H HA   . ALA A 1 8  ? 2.969   0.095   8.086   1.00 0.00 ? 8  ALA A HA   9  
ATOM 7136  H HB1  . ALA A 1 8  ? 4.921   2.370   8.128   1.00 0.00 ? 8  ALA A HB1  9  
ATOM 7137  H HB2  . ALA A 1 8  ? 3.380   2.580   8.993   1.00 0.00 ? 8  ALA A HB2  9  
ATOM 7138  H HB3  . ALA A 1 8  ? 3.380   2.205   7.253   1.00 0.00 ? 8  ALA A HB3  9  
ATOM 7139  N N    . ASN A 1 9  ? 5.455   -1.271  8.669   1.00 0.00 ? 9  ASN A N    9  
ATOM 7140  C CA   . ASN A 1 9  ? 6.605   -2.064  8.269   1.00 0.00 ? 9  ASN A CA   9  
ATOM 7141  C C    . ASN A 1 9  ? 6.447   -2.483  6.806   1.00 0.00 ? 9  ASN A C    9  
ATOM 7142  O O    . ASN A 1 9  ? 7.319   -2.213  5.982   1.00 0.00 ? 9  ASN A O    9  
ATOM 7143  C CB   . ASN A 1 9  ? 6.719   -3.335  9.114   1.00 0.00 ? 9  ASN A CB   9  
ATOM 7144  C CG   . ASN A 1 9  ? 8.070   -4.018  8.898   1.00 0.00 ? 9  ASN A CG   9  
ATOM 7145  O OD1  . ASN A 1 9  ? 8.263   -4.793  7.976   1.00 0.00 ? 9  ASN A OD1  9  
ATOM 7146  N ND2  . ASN A 1 9  ? 8.993   -3.689  9.797   1.00 0.00 ? 9  ASN A ND2  9  
ATOM 7147  H H    . ASN A 1 9  ? 4.978   -1.600  9.484   1.00 0.00 ? 9  ASN A H    9  
ATOM 7148  H HA   . ASN A 1 9  ? 7.468   -1.418  8.427   1.00 0.00 ? 9  ASN A HA   9  
ATOM 7149  H HB2  . ASN A 1 9  ? 6.597   -3.086  10.169  1.00 0.00 ? 9  ASN A HB2  9  
ATOM 7150  H HB3  . ASN A 1 9  ? 5.914   -4.022  8.854   1.00 0.00 ? 9  ASN A HB3  9  
ATOM 7151  H HD21 . ASN A 1 9  ? 8.770   -3.046  10.530  1.00 0.00 ? 9  ASN A HD21 9  
ATOM 7152  H HD22 . ASN A 1 9  ? 9.910   -4.084  9.741   1.00 0.00 ? 9  ASN A HD22 9  
ATOM 7153  N N    . GLN A 1 10 ? 5.327   -3.135  6.528   1.00 0.00 ? 10 GLN A N    9  
ATOM 7154  C CA   . GLN A 1 10 ? 5.043   -3.593  5.179   1.00 0.00 ? 10 GLN A CA   9  
ATOM 7155  C C    . GLN A 1 10 ? 4.884   -2.399  4.235   1.00 0.00 ? 10 GLN A C    9  
ATOM 7156  O O    . GLN A 1 10 ? 5.165   -2.504  3.042   1.00 0.00 ? 10 GLN A O    9  
ATOM 7157  C CB   . GLN A 1 10 ? 3.799   -4.482  5.152   1.00 0.00 ? 10 GLN A CB   9  
ATOM 7158  C CG   . GLN A 1 10 ? 2.582   -3.740  5.709   1.00 0.00 ? 10 GLN A CG   9  
ATOM 7159  C CD   . GLN A 1 10 ? 2.125   -4.354  7.034   1.00 0.00 ? 10 GLN A CD   9  
ATOM 7160  O OE1  . GLN A 1 10 ? 1.621   -5.464  7.092   1.00 0.00 ? 10 GLN A OE1  9  
ATOM 7161  N NE2  . GLN A 1 10 ? 2.327   -3.572  8.091   1.00 0.00 ? 10 GLN A NE2  9  
ATOM 7162  H H    . GLN A 1 10 ? 4.623   -3.350  7.205   1.00 0.00 ? 10 GLN A H    9  
ATOM 7163  H HA   . GLN A 1 10 ? 5.911   -4.184  4.885   1.00 0.00 ? 10 GLN A HA   9  
ATOM 7164  H HB2  . GLN A 1 10 ? 3.598   -4.802  4.130   1.00 0.00 ? 10 GLN A HB2  9  
ATOM 7165  H HB3  . GLN A 1 10 ? 3.979   -5.384  5.738   1.00 0.00 ? 10 GLN A HB3  9  
ATOM 7166  H HG2  . GLN A 1 10 ? 2.830   -2.689  5.857   1.00 0.00 ? 10 GLN A HG2  9  
ATOM 7167  H HG3  . GLN A 1 10 ? 1.767   -3.777  4.986   1.00 0.00 ? 10 GLN A HG3  9  
ATOM 7168  H HE21 . GLN A 1 10 ? 2.745   -2.671  7.974   1.00 0.00 ? 10 GLN A HE21 9  
ATOM 7169  H HE22 . GLN A 1 10 ? 2.060   -3.885  9.002   1.00 0.00 ? 10 GLN A HE22 9  
ATOM 7170  N N    . CYS A 1 11 ? 4.434   -1.291  4.805   1.00 0.00 ? 11 CYS A N    9  
ATOM 7171  C CA   . CYS A 1 11 ? 4.234   -0.078  4.030   1.00 0.00 ? 11 CYS A CA   9  
ATOM 7172  C C    . CYS A 1 11 ? 5.232   0.974   4.518   1.00 0.00 ? 11 CYS A C    9  
ATOM 7173  O O    . CYS A 1 11 ? 4.865   2.125   4.745   1.00 0.00 ? 11 CYS A O    9  
ATOM 7174  C CB   . CYS A 1 11 ? 2.790   0.420   4.121   1.00 0.00 ? 11 CYS A CB   9  
ATOM 7175  S SG   . CYS A 1 11 ? 1.554   -0.875  4.502   1.00 0.00 ? 11 CYS A SG   9  
ATOM 7176  H H    . CYS A 1 11 ? 4.208   -1.214  5.776   1.00 0.00 ? 11 CYS A H    9  
ATOM 7177  H HA   . CYS A 1 11 ? 4.423   -0.338  2.989   1.00 0.00 ? 11 CYS A HA   9  
ATOM 7178  H HB2  . CYS A 1 11 ? 2.735   1.192   4.888   1.00 0.00 ? 11 CYS A HB2  9  
ATOM 7179  H HB3  . CYS A 1 11 ? 2.523   0.890   3.175   1.00 0.00 ? 11 CYS A HB3  9  
ATOM 7180  N N    . ALA A 1 12 ? 6.476   0.540   4.663   1.00 0.00 ? 12 ALA A N    9  
ATOM 7181  C CA   . ALA A 1 12 ? 7.530   1.430   5.120   1.00 0.00 ? 12 ALA A CA   9  
ATOM 7182  C C    . ALA A 1 12 ? 8.583   1.573   4.019   1.00 0.00 ? 12 ALA A C    9  
ATOM 7183  O O    . ALA A 1 12 ? 9.772   1.371   4.263   1.00 0.00 ? 12 ALA A O    9  
ATOM 7184  C CB   . ALA A 1 12 ? 8.120   0.895   6.426   1.00 0.00 ? 12 ALA A CB   9  
ATOM 7185  H H    . ALA A 1 12 ? 6.767   -0.398  4.476   1.00 0.00 ? 12 ALA A H    9  
ATOM 7186  H HA   . ALA A 1 12 ? 7.081   2.405   5.310   1.00 0.00 ? 12 ALA A HA   9  
ATOM 7187  H HB1  . ALA A 1 12 ? 9.169   1.185   6.496   1.00 0.00 ? 12 ALA A HB1  9  
ATOM 7188  H HB2  . ALA A 1 12 ? 7.571   1.312   7.270   1.00 0.00 ? 12 ALA A HB2  9  
ATOM 7189  H HB3  . ALA A 1 12 ? 8.041   -0.192  6.442   1.00 0.00 ? 12 ALA A HB3  9  
ATOM 7190  N N    . VAL A 1 13 ? 8.109   1.920   2.832   1.00 0.00 ? 13 VAL A N    9  
ATOM 7191  C CA   . VAL A 1 13 ? 8.995   2.092   1.693   1.00 0.00 ? 13 VAL A CA   9  
ATOM 7192  C C    . VAL A 1 13 ? 9.405   3.562   1.589   1.00 0.00 ? 13 VAL A C    9  
ATOM 7193  O O    . VAL A 1 13 ? 8.651   4.450   1.983   1.00 0.00 ? 13 VAL A O    9  
ATOM 7194  C CB   . VAL A 1 13 ? 8.323   1.567   0.423   1.00 0.00 ? 13 VAL A CB   9  
ATOM 7195  C CG1  . VAL A 1 13 ? 9.323   0.814   -0.456  1.00 0.00 ? 13 VAL A CG1  9  
ATOM 7196  C CG2  . VAL A 1 13 ? 7.120   0.686   0.763   1.00 0.00 ? 13 VAL A CG2  9  
ATOM 7197  H H    . VAL A 1 13 ? 7.141   2.082   2.642   1.00 0.00 ? 13 VAL A H    9  
ATOM 7198  H HA   . VAL A 1 13 ? 9.886   1.491   1.876   1.00 0.00 ? 13 VAL A HA   9  
ATOM 7199  H HB   . VAL A 1 13 ? 7.959   2.426   -0.143  1.00 0.00 ? 13 VAL A HB   9  
ATOM 7200  H HG11 . VAL A 1 13 ? 10.206  0.564   0.131   1.00 0.00 ? 13 VAL A HG11 9  
ATOM 7201  H HG12 . VAL A 1 13 ? 8.863   -0.101  -0.829  1.00 0.00 ? 13 VAL A HG12 9  
ATOM 7202  H HG13 . VAL A 1 13 ? 9.613   1.444   -1.298  1.00 0.00 ? 13 VAL A HG13 9  
ATOM 7203  H HG21 . VAL A 1 13 ? 7.331   0.116   1.668   1.00 0.00 ? 13 VAL A HG21 9  
ATOM 7204  H HG22 . VAL A 1 13 ? 6.243   1.313   0.926   1.00 0.00 ? 13 VAL A HG22 9  
ATOM 7205  H HG23 . VAL A 1 13 ? 6.927   -0.001  -0.061  1.00 0.00 ? 13 VAL A HG23 9  
ATOM 7206  N N    . PRO A 1 14 ? 10.632  3.779   1.043   1.00 0.00 ? 14 PRO A N    9  
ATOM 7207  C CA   . PRO A 1 14 ? 11.151  5.127   0.882   1.00 0.00 ? 14 PRO A CA   9  
ATOM 7208  C C    . PRO A 1 14 ? 10.467  5.843   -0.284  1.00 0.00 ? 14 PRO A C    9  
ATOM 7209  O O    . PRO A 1 14 ? 10.814  6.977   -0.611  1.00 0.00 ? 14 PRO A O    9  
ATOM 7210  C CB   . PRO A 1 14 ? 12.647  4.949   0.674   1.00 0.00 ? 14 PRO A CB   9  
ATOM 7211  C CG   . PRO A 1 14 ? 12.841  3.499   0.263   1.00 0.00 ? 14 PRO A CG   9  
ATOM 7212  C CD   . PRO A 1 14 ? 11.553  2.752   0.565   1.00 0.00 ? 14 PRO A CD   9  
ATOM 7213  H HA   . PRO A 1 14 ? 10.952  5.675   1.694   1.00 0.00 ? 14 PRO A HA   9  
ATOM 7214  H HB2  . PRO A 1 14 ? 13.017  5.626   -0.095  1.00 0.00 ? 14 PRO A HB2  9  
ATOM 7215  H HB3  . PRO A 1 14 ? 13.197  5.174   1.588   1.00 0.00 ? 14 PRO A HB3  9  
ATOM 7216  H HG2  . PRO A 1 14 ? 13.082  3.432   -0.798  1.00 0.00 ? 14 PRO A HG2  9  
ATOM 7217  H HG3  . PRO A 1 14 ? 13.676  3.056   0.808   1.00 0.00 ? 14 PRO A HG3  9  
ATOM 7218  H HD2  . PRO A 1 14 ? 11.165  2.255   -0.324  1.00 0.00 ? 14 PRO A HD2  9  
ATOM 7219  H HD3  . PRO A 1 14 ? 11.709  1.980   1.318   1.00 0.00 ? 14 PRO A HD3  9  
ATOM 7220  N N    . ALA A 1 15 ? 9.506   5.152   -0.879  1.00 0.00 ? 15 ALA A N    9  
ATOM 7221  C CA   . ALA A 1 15 ? 8.769   5.707   -2.002  1.00 0.00 ? 15 ALA A CA   9  
ATOM 7222  C C    . ALA A 1 15 ? 9.535   5.429   -3.297  1.00 0.00 ? 15 ALA A C    9  
ATOM 7223  O O    . ALA A 1 15 ? 8.952   5.431   -4.380  1.00 0.00 ? 15 ALA A O    9  
ATOM 7224  C CB   . ALA A 1 15 ? 8.538   7.202   -1.771  1.00 0.00 ? 15 ALA A CB   9  
ATOM 7225  H H    . ALA A 1 15 ? 9.229   4.230   -0.607  1.00 0.00 ? 15 ALA A H    9  
ATOM 7226  H HA   . ALA A 1 15 ? 7.803   5.205   -2.046  1.00 0.00 ? 15 ALA A HA   9  
ATOM 7227  H HB1  . ALA A 1 15 ? 8.727   7.441   -0.724  1.00 0.00 ? 15 ALA A HB1  9  
ATOM 7228  H HB2  . ALA A 1 15 ? 7.507   7.453   -2.021  1.00 0.00 ? 15 ALA A HB2  9  
ATOM 7229  H HB3  . ALA A 1 15 ? 9.215   7.777   -2.403  1.00 0.00 ? 15 ALA A HB3  9  
ATOM 7230  N N    . LYS A 1 16 ? 10.831  5.198   -3.142  1.00 0.00 ? 16 LYS A N    9  
ATOM 7231  C CA   . LYS A 1 16 ? 11.683  4.919   -4.286  1.00 0.00 ? 16 LYS A CA   9  
ATOM 7232  C C    . LYS A 1 16 ? 11.723  3.409   -4.530  1.00 0.00 ? 16 LYS A C    9  
ATOM 7233  O O    . LYS A 1 16 ? 12.461  2.935   -5.392  1.00 0.00 ? 16 LYS A O    9  
ATOM 7234  C CB   . LYS A 1 16 ? 13.064  5.547   -4.091  1.00 0.00 ? 16 LYS A CB   9  
ATOM 7235  C CG   . LYS A 1 16 ? 13.778  4.936   -2.883  1.00 0.00 ? 16 LYS A CG   9  
ATOM 7236  C CD   . LYS A 1 16 ? 14.128  3.469   -3.137  1.00 0.00 ? 16 LYS A CD   9  
ATOM 7237  C CE   . LYS A 1 16 ? 15.401  3.071   -2.387  1.00 0.00 ? 16 LYS A CE   9  
ATOM 7238  N NZ   . LYS A 1 16 ? 15.836  1.714   -2.787  1.00 0.00 ? 16 LYS A NZ   9  
ATOM 7239  H H    . LYS A 1 16 ? 11.298  5.198   -2.258  1.00 0.00 ? 16 LYS A H    9  
ATOM 7240  H HA   . LYS A 1 16 ? 11.231  5.398   -5.154  1.00 0.00 ? 16 LYS A HA   9  
ATOM 7241  H HB2  . LYS A 1 16 ? 13.666  5.398   -4.987  1.00 0.00 ? 16 LYS A HB2  9  
ATOM 7242  H HB3  . LYS A 1 16 ? 12.962  6.623   -3.952  1.00 0.00 ? 16 LYS A HB3  9  
ATOM 7243  H HG2  . LYS A 1 16 ? 14.687  5.499   -2.671  1.00 0.00 ? 16 LYS A HG2  9  
ATOM 7244  H HG3  . LYS A 1 16 ? 13.142  5.015   -2.002  1.00 0.00 ? 16 LYS A HG3  9  
ATOM 7245  H HD2  . LYS A 1 16 ? 13.301  2.834   -2.821  1.00 0.00 ? 16 LYS A HD2  9  
ATOM 7246  H HD3  . LYS A 1 16 ? 14.266  3.304   -4.206  1.00 0.00 ? 16 LYS A HD3  9  
ATOM 7247  H HE2  . LYS A 1 16 ? 16.193  3.789   -2.595  1.00 0.00 ? 16 LYS A HE2  9  
ATOM 7248  H HE3  . LYS A 1 16 ? 15.220  3.099   -1.312  1.00 0.00 ? 16 LYS A HE3  9  
ATOM 7249  H HZ1  . LYS A 1 16 ? 15.096  1.260   -3.284  1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 7250  H HZ2  . LYS A 1 16 ? 16.641  1.782   -3.376  1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 7251  H HZ3  . LYS A 1 16 ? 16.063  1.182   -1.971  1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 7252  N N    . ASP A 1 17 ? 10.918  2.695   -3.756  1.00 0.00 ? 17 ASP A N    9  
ATOM 7253  C CA   . ASP A 1 17 ? 10.853  1.248   -3.878  1.00 0.00 ? 17 ASP A CA   9  
ATOM 7254  C C    . ASP A 1 17 ? 9.389   0.816   -3.980  1.00 0.00 ? 17 ASP A C    9  
ATOM 7255  O O    . ASP A 1 17 ? 9.057   -0.335  -3.699  1.00 0.00 ? 17 ASP A O    9  
ATOM 7256  C CB   . ASP A 1 17 ? 11.463  0.564   -2.653  1.00 0.00 ? 17 ASP A CB   9  
ATOM 7257  C CG   . ASP A 1 17 ? 12.681  -0.315  -2.944  1.00 0.00 ? 17 ASP A CG   9  
ATOM 7258  O OD1  . ASP A 1 17 ? 12.999  -0.466  -4.144  1.00 0.00 ? 17 ASP A OD1  9  
ATOM 7259  O OD2  . ASP A 1 17 ? 13.266  -0.818  -1.960  1.00 0.00 ? 17 ASP A OD2  9  
ATOM 7260  H H    . ASP A 1 17 ? 10.321  3.088   -3.057  1.00 0.00 ? 17 ASP A H    9  
ATOM 7261  H HA   . ASP A 1 17 ? 11.422  1.010   -4.776  1.00 0.00 ? 17 ASP A HA   9  
ATOM 7262  H HB2  . ASP A 1 17 ? 11.751  1.331   -1.933  1.00 0.00 ? 17 ASP A HB2  9  
ATOM 7263  H HB3  . ASP A 1 17 ? 10.697  -0.048  -2.178  1.00 0.00 ? 17 ASP A HB3  9  
ATOM 7264  N N    . ARG A 1 18 ? 8.552   1.761   -4.383  1.00 0.00 ? 18 ARG A N    9  
ATOM 7265  C CA   . ARG A 1 18 ? 7.132   1.491   -4.526  1.00 0.00 ? 18 ARG A CA   9  
ATOM 7266  C C    . ARG A 1 18 ? 6.870   0.684   -5.799  1.00 0.00 ? 18 ARG A C    9  
ATOM 7267  O O    . ARG A 1 18 ? 7.433   0.978   -6.852  1.00 0.00 ? 18 ARG A O    9  
ATOM 7268  C CB   . ARG A 1 18 ? 6.327   2.792   -4.581  1.00 0.00 ? 18 ARG A CB   9  
ATOM 7269  C CG   . ARG A 1 18 ? 6.833   3.793   -3.541  1.00 0.00 ? 18 ARG A CG   9  
ATOM 7270  C CD   . ARG A 1 18 ? 6.179   3.547   -2.180  1.00 0.00 ? 18 ARG A CD   9  
ATOM 7271  N NE   . ARG A 1 18 ? 5.783   4.835   -1.568  1.00 0.00 ? 18 ARG A NE   9  
ATOM 7272  C CZ   . ARG A 1 18 ? 5.717   5.050   -0.247  1.00 0.00 ? 18 ARG A CZ   9  
ATOM 7273  N NH1  . ARG A 1 18 ? 6.022   4.064   0.609   1.00 0.00 ? 18 ARG A NH1  9  
ATOM 7274  N NH2  . ARG A 1 18 ? 5.348   6.251   0.219   1.00 0.00 ? 18 ARG A NH2  9  
ATOM 7275  H H    . ARG A 1 18 ? 8.830   2.694   -4.610  1.00 0.00 ? 18 ARG A H    9  
ATOM 7276  H HA   . ARG A 1 18 ? 6.865   0.920   -3.637  1.00 0.00 ? 18 ARG A HA   9  
ATOM 7277  H HB2  . ARG A 1 18 ? 6.402   3.228   -5.578  1.00 0.00 ? 18 ARG A HB2  9  
ATOM 7278  H HB3  . ARG A 1 18 ? 5.273   2.580   -4.405  1.00 0.00 ? 18 ARG A HB3  9  
ATOM 7279  H HG2  . ARG A 1 18 ? 7.915   3.712   -3.448  1.00 0.00 ? 18 ARG A HG2  9  
ATOM 7280  H HG3  . ARG A 1 18 ? 6.617   4.809   -3.873  1.00 0.00 ? 18 ARG A HG3  9  
ATOM 7281  H HD2  . ARG A 1 18 ? 5.304   2.907   -2.298  1.00 0.00 ? 18 ARG A HD2  9  
ATOM 7282  H HD3  . ARG A 1 18 ? 6.872   3.021   -1.524  1.00 0.00 ? 18 ARG A HD3  9  
ATOM 7283  H HE   . ARG A 1 18 ? 5.549   5.592   -2.178  1.00 0.00 ? 18 ARG A HE   9  
ATOM 7284  H HH11 . ARG A 1 18 ? 6.297   3.168   0.261   1.00 0.00 ? 18 ARG A HH11 9  
ATOM 7285  H HH12 . ARG A 1 18 ? 5.973   4.225   1.595   1.00 0.00 ? 18 ARG A HH12 9  
ATOM 7286  H HH21 . ARG A 1 18 ? 5.121   6.987   -0.419  1.00 0.00 ? 18 ARG A HH21 9  
ATOM 7287  H HH22 . ARG A 1 18 ? 5.299   6.412   1.205   1.00 0.00 ? 18 ARG A HH22 9  
ATOM 7288  N N    . VAL A 1 19 ? 6.014   -0.318  -5.660  1.00 0.00 ? 19 VAL A N    9  
ATOM 7289  C CA   . VAL A 1 19 ? 5.671   -1.171  -6.786  1.00 0.00 ? 19 VAL A CA   9  
ATOM 7290  C C    . VAL A 1 19 ? 4.370   -0.673  -7.418  1.00 0.00 ? 19 VAL A C    9  
ATOM 7291  O O    . VAL A 1 19 ? 3.889   -1.250  -8.393  1.00 0.00 ? 19 VAL A O    9  
ATOM 7292  C CB   . VAL A 1 19 ? 5.596   -2.630  -6.333  1.00 0.00 ? 19 VAL A CB   9  
ATOM 7293  C CG1  . VAL A 1 19 ? 5.517   -3.574  -7.535  1.00 0.00 ? 19 VAL A CG1  9  
ATOM 7294  C CG2  . VAL A 1 19 ? 6.780   -2.987  -5.432  1.00 0.00 ? 19 VAL A CG2  9  
ATOM 7295  H H    . VAL A 1 19 ? 5.560   -0.551  -4.800  1.00 0.00 ? 19 VAL A H    9  
ATOM 7296  H HA   . VAL A 1 19 ? 6.473   -1.086  -7.519  1.00 0.00 ? 19 VAL A HA   9  
ATOM 7297  H HB   . VAL A 1 19 ? 4.683   -2.754  -5.751  1.00 0.00 ? 19 VAL A HB   9  
ATOM 7298  H HG11 . VAL A 1 19 ? 5.796   -3.033  -8.440  1.00 0.00 ? 19 VAL A HG11 9  
ATOM 7299  H HG12 . VAL A 1 19 ? 6.201   -4.409  -7.386  1.00 0.00 ? 19 VAL A HG12 9  
ATOM 7300  H HG13 . VAL A 1 19 ? 4.499   -3.950  -7.636  1.00 0.00 ? 19 VAL A HG13 9  
ATOM 7301  H HG21 . VAL A 1 19 ? 6.949   -2.180  -4.719  1.00 0.00 ? 19 VAL A HG21 9  
ATOM 7302  H HG22 . VAL A 1 19 ? 6.561   -3.909  -4.893  1.00 0.00 ? 19 VAL A HG22 9  
ATOM 7303  H HG23 . VAL A 1 19 ? 7.672   -3.126  -6.043  1.00 0.00 ? 19 VAL A HG23 9  
ATOM 7304  N N    . ASP A 1 20 ? 3.837   0.393   -6.839  1.00 0.00 ? 20 ASP A N    9  
ATOM 7305  C CA   . ASP A 1 20 ? 2.601   0.974   -7.334  1.00 0.00 ? 20 ASP A CA   9  
ATOM 7306  C C    . ASP A 1 20 ? 1.583   -0.140  -7.586  1.00 0.00 ? 20 ASP A C    9  
ATOM 7307  O O    . ASP A 1 20 ? 1.606   -0.779  -8.637  1.00 0.00 ? 20 ASP A O    9  
ATOM 7308  C CB   . ASP A 1 20 ? 2.830   1.714   -8.654  1.00 0.00 ? 20 ASP A CB   9  
ATOM 7309  C CG   . ASP A 1 20 ? 1.561   2.023   -9.450  1.00 0.00 ? 20 ASP A CG   9  
ATOM 7310  O OD1  . ASP A 1 20 ? 1.121   1.117   -10.191 1.00 0.00 ? 20 ASP A OD1  9  
ATOM 7311  O OD2  . ASP A 1 20 ? 1.059   3.158   -9.300  1.00 0.00 ? 20 ASP A OD2  9  
ATOM 7312  H H    . ASP A 1 20 ? 4.235   0.856   -6.047  1.00 0.00 ? 20 ASP A H    9  
ATOM 7313  H HA   . ASP A 1 20 ? 2.278   1.666   -6.555  1.00 0.00 ? 20 ASP A HA   9  
ATOM 7314  H HB2  . ASP A 1 20 ? 3.346   2.650   -8.443  1.00 0.00 ? 20 ASP A HB2  9  
ATOM 7315  H HB3  . ASP A 1 20 ? 3.495   1.116   -9.277  1.00 0.00 ? 20 ASP A HB3  9  
ATOM 7316  N N    . CYS A 1 21 ? 0.715   -0.338  -6.605  1.00 0.00 ? 21 CYS A N    9  
ATOM 7317  C CA   . CYS A 1 21 ? -0.309  -1.364  -6.708  1.00 0.00 ? 21 CYS A CA   9  
ATOM 7318  C C    . CYS A 1 21 ? -1.312  -0.936  -7.782  1.00 0.00 ? 21 CYS A C    9  
ATOM 7319  O O    . CYS A 1 21 ? -1.998  -1.774  -8.365  1.00 0.00 ? 21 CYS A O    9  
ATOM 7320  C CB   . CYS A 1 21 ? -0.990  -1.620  -5.362  1.00 0.00 ? 21 CYS A CB   9  
ATOM 7321  S SG   . CYS A 1 21 ? -1.289  -3.384  -4.978  1.00 0.00 ? 21 CYS A SG   9  
ATOM 7322  H H    . CYS A 1 21 ? 0.704   0.187   -5.754  1.00 0.00 ? 21 CYS A H    9  
ATOM 7323  H HA   . CYS A 1 21 ? 0.198   -2.284  -6.997  1.00 0.00 ? 21 CYS A HA   9  
ATOM 7324  H HB2  . CYS A 1 21 ? -0.374  -1.191  -4.572  1.00 0.00 ? 21 CYS A HB2  9  
ATOM 7325  H HB3  . CYS A 1 21 ? -1.943  -1.093  -5.346  1.00 0.00 ? 21 CYS A HB3  9  
ATOM 7326  N N    . GLY A 1 22 ? -1.364  0.368   -8.011  1.00 0.00 ? 22 GLY A N    9  
ATOM 7327  C CA   . GLY A 1 22 ? -2.272  0.917   -9.004  1.00 0.00 ? 22 GLY A CA   9  
ATOM 7328  C C    . GLY A 1 22 ? -3.729  0.740   -8.573  1.00 0.00 ? 22 GLY A C    9  
ATOM 7329  O O    . GLY A 1 22 ? -4.333  -0.301  -8.828  1.00 0.00 ? 22 GLY A O    9  
ATOM 7330  H H    . GLY A 1 22 ? -0.803  1.043   -7.532  1.00 0.00 ? 22 GLY A H    9  
ATOM 7331  H HA2  . GLY A 1 22 ? -2.058  1.976   -9.151  1.00 0.00 ? 22 GLY A HA2  9  
ATOM 7332  H HA3  . GLY A 1 22 ? -2.109  0.424   -9.962  1.00 0.00 ? 22 GLY A HA3  9  
ATOM 7333  N N    . TYR A 1 23 ? -4.251  1.772   -7.927  1.00 0.00 ? 23 TYR A N    9  
ATOM 7334  C CA   . TYR A 1 23 ? -5.627  1.743   -7.459  1.00 0.00 ? 23 TYR A CA   9  
ATOM 7335  C C    . TYR A 1 23 ? -6.311  3.093   -7.686  1.00 0.00 ? 23 TYR A C    9  
ATOM 7336  O O    . TYR A 1 23 ? -5.664  4.137   -7.641  1.00 0.00 ? 23 TYR A O    9  
ATOM 7337  C CB   . TYR A 1 23 ? -5.554  1.468   -5.956  1.00 0.00 ? 23 TYR A CB   9  
ATOM 7338  C CG   . TYR A 1 23 ? -5.583  -0.018  -5.593  1.00 0.00 ? 23 TYR A CG   9  
ATOM 7339  C CD1  . TYR A 1 23 ? -6.727  -0.759  -5.813  1.00 0.00 ? 23 TYR A CD1  9  
ATOM 7340  C CD2  . TYR A 1 23 ? -4.467  -0.617  -5.046  1.00 0.00 ? 23 TYR A CD2  9  
ATOM 7341  C CE1  . TYR A 1 23 ? -6.754  -2.158  -5.471  1.00 0.00 ? 23 TYR A CE1  9  
ATOM 7342  C CE2  . TYR A 1 23 ? -4.495  -2.016  -4.705  1.00 0.00 ? 23 TYR A CE2  9  
ATOM 7343  C CZ   . TYR A 1 23 ? -5.637  -2.717  -4.934  1.00 0.00 ? 23 TYR A CZ   9  
ATOM 7344  O OH   . TYR A 1 23 ? -5.663  -4.038  -4.612  1.00 0.00 ? 23 TYR A OH   9  
ATOM 7345  H H    . TYR A 1 23 ? -3.753  2.615   -7.724  1.00 0.00 ? 23 TYR A H    9  
ATOM 7346  H HA   . TYR A 1 23 ? -6.158  0.975   -8.021  1.00 0.00 ? 23 TYR A HA   9  
ATOM 7347  H HB2  . TYR A 1 23 ? -4.640  1.910   -5.559  1.00 0.00 ? 23 TYR A HB2  9  
ATOM 7348  H HB3  . TYR A 1 23 ? -6.389  1.968   -5.464  1.00 0.00 ? 23 TYR A HB3  9  
ATOM 7349  H HD1  . TYR A 1 23 ? -7.609  -0.286  -6.244  1.00 0.00 ? 23 TYR A HD1  9  
ATOM 7350  H HD2  . TYR A 1 23 ? -3.564  -0.032  -4.873  1.00 0.00 ? 23 TYR A HD2  9  
ATOM 7351  H HE1  . TYR A 1 23 ? -7.651  -2.755  -5.640  1.00 0.00 ? 23 TYR A HE1  9  
ATOM 7352  H HE2  . TYR A 1 23 ? -3.620  -2.501  -4.272  1.00 0.00 ? 23 TYR A HE2  9  
ATOM 7353  H HH   . TYR A 1 23 ? -4.902  -4.513  -5.054  1.00 0.00 ? 23 TYR A HH   9  
ATOM 7354  N N    . PRO A 1 24 ? -7.647  3.025   -7.931  1.00 0.00 ? 24 PRO A N    9  
ATOM 7355  C CA   . PRO A 1 24 ? -8.427  4.228   -8.166  1.00 0.00 ? 24 PRO A CA   9  
ATOM 7356  C C    . PRO A 1 24 ? -8.671  4.987   -6.859  1.00 0.00 ? 24 PRO A C    9  
ATOM 7357  O O    . PRO A 1 24 ? -8.036  6.008   -6.603  1.00 0.00 ? 24 PRO A O    9  
ATOM 7358  C CB   . PRO A 1 24 ? -9.711  3.744   -8.820  1.00 0.00 ? 24 PRO A CB   9  
ATOM 7359  C CG   . PRO A 1 24 ? -9.805  2.260   -8.506  1.00 0.00 ? 24 PRO A CG   9  
ATOM 7360  C CD   . PRO A 1 24 ? -8.448  1.805   -7.993  1.00 0.00 ? 24 PRO A CD   9  
ATOM 7361  H HA   . PRO A 1 24 ? -7.924  4.858   -8.758  1.00 0.00 ? 24 PRO A HA   9  
ATOM 7362  H HB2  . PRO A 1 24 ? -10.575 4.281   -8.429  1.00 0.00 ? 24 PRO A HB2  9  
ATOM 7363  H HB3  . PRO A 1 24 ? -9.690  3.915   -9.896  1.00 0.00 ? 24 PRO A HB3  9  
ATOM 7364  H HG2  . PRO A 1 24 ? -10.577 2.075   -7.759  1.00 0.00 ? 24 PRO A HG2  9  
ATOM 7365  H HG3  . PRO A 1 24 ? -10.083 1.698   -9.397  1.00 0.00 ? 24 PRO A HG3  9  
ATOM 7366  H HD2  . PRO A 1 24 ? -8.532  1.337   -7.012  1.00 0.00 ? 24 PRO A HD2  9  
ATOM 7367  H HD3  . PRO A 1 24 ? -7.998  1.070   -8.659  1.00 0.00 ? 24 PRO A HD3  9  
ATOM 7368  N N    . HIS A 1 25 ? -9.592  4.457   -6.068  1.00 0.00 ? 25 HIS A N    9  
ATOM 7369  C CA   . HIS A 1 25 ? -9.927  5.071   -4.794  1.00 0.00 ? 25 HIS A CA   9  
ATOM 7370  C C    . HIS A 1 25 ? -9.001  4.530   -3.704  1.00 0.00 ? 25 HIS A C    9  
ATOM 7371  O O    . HIS A 1 25 ? -9.353  3.586   -2.997  1.00 0.00 ? 25 HIS A O    9  
ATOM 7372  C CB   . HIS A 1 25 ? -11.409 4.870   -4.468  1.00 0.00 ? 25 HIS A CB   9  
ATOM 7373  C CG   . HIS A 1 25 ? -11.778 3.442   -4.144  1.00 0.00 ? 25 HIS A CG   9  
ATOM 7374  N ND1  . HIS A 1 25 ? -13.006 3.088   -3.613  1.00 0.00 ? 25 HIS A ND1  9  
ATOM 7375  C CD2  . HIS A 1 25 ? -11.069 2.285   -4.282  1.00 0.00 ? 25 HIS A CD2  9  
ATOM 7376  C CE1  . HIS A 1 25 ? -13.024 1.774   -3.442  1.00 0.00 ? 25 HIS A CE1  9  
ATOM 7377  N NE2  . HIS A 1 25 ? -11.823 1.278   -3.858  1.00 0.00 ? 25 HIS A NE2  9  
ATOM 7378  H H    . HIS A 1 25 ? -10.104 3.626   -6.284  1.00 0.00 ? 25 HIS A H    9  
ATOM 7379  H HA   . HIS A 1 25 ? -9.754  6.141   -4.908  1.00 0.00 ? 25 HIS A HA   9  
ATOM 7380  H HB2  . HIS A 1 25 ? -11.673 5.504   -3.621  1.00 0.00 ? 25 HIS A HB2  9  
ATOM 7381  H HB3  . HIS A 1 25 ? -12.006 5.206   -5.315  1.00 0.00 ? 25 HIS A HB3  9  
ATOM 7382  H HD1  . HIS A 1 25 ? -13.752 3.716   -3.394  1.00 0.00 ? 25 HIS A HD1  9  
ATOM 7383  H HD2  . HIS A 1 25 ? -10.056 2.202   -4.676  1.00 0.00 ? 25 HIS A HD2  9  
ATOM 7384  H HE1  . HIS A 1 25 ? -13.853 1.191   -3.041  1.00 0.00 ? 25 HIS A HE1  9  
ATOM 7385  H HE2  . HIS A 1 25 ? -11.575 0.310   -3.897  1.00 0.00 ? 25 HIS A HE2  9  
ATOM 7386  N N    . VAL A 1 26 ? -7.835  5.151   -3.601  1.00 0.00 ? 26 VAL A N    9  
ATOM 7387  C CA   . VAL A 1 26 ? -6.855  4.743   -2.608  1.00 0.00 ? 26 VAL A CA   9  
ATOM 7388  C C    . VAL A 1 26 ? -6.998  5.624   -1.365  1.00 0.00 ? 26 VAL A C    9  
ATOM 7389  O O    . VAL A 1 26 ? -7.162  6.838   -1.475  1.00 0.00 ? 26 VAL A O    9  
ATOM 7390  C CB   . VAL A 1 26 ? -5.450  4.785   -3.212  1.00 0.00 ? 26 VAL A CB   9  
ATOM 7391  C CG1  . VAL A 1 26 ? -5.291  3.726   -4.305  1.00 0.00 ? 26 VAL A CG1  9  
ATOM 7392  C CG2  . VAL A 1 26 ? -5.125  6.181   -3.749  1.00 0.00 ? 26 VAL A CG2  9  
ATOM 7393  H H    . VAL A 1 26 ? -7.557  5.918   -4.179  1.00 0.00 ? 26 VAL A H    9  
ATOM 7394  H HA   . VAL A 1 26 ? -7.074  3.711   -2.334  1.00 0.00 ? 26 VAL A HA   9  
ATOM 7395  H HB   . VAL A 1 26 ? -4.738  4.558   -2.419  1.00 0.00 ? 26 VAL A HB   9  
ATOM 7396  H HG11 . VAL A 1 26 ? -6.019  3.908   -5.096  1.00 0.00 ? 26 VAL A HG11 9  
ATOM 7397  H HG12 . VAL A 1 26 ? -4.284  3.780   -4.719  1.00 0.00 ? 26 VAL A HG12 9  
ATOM 7398  H HG13 . VAL A 1 26 ? -5.457  2.737   -3.879  1.00 0.00 ? 26 VAL A HG13 9  
ATOM 7399  H HG21 . VAL A 1 26 ? -5.823  6.904   -3.326  1.00 0.00 ? 26 VAL A HG21 9  
ATOM 7400  H HG22 . VAL A 1 26 ? -4.107  6.450   -3.468  1.00 0.00 ? 26 VAL A HG22 9  
ATOM 7401  H HG23 . VAL A 1 26 ? -5.215  6.182   -4.835  1.00 0.00 ? 26 VAL A HG23 9  
ATOM 7402  N N    . THR A 1 27 ? -6.931  4.977   -0.210  1.00 0.00 ? 27 THR A N    9  
ATOM 7403  C CA   . THR A 1 27 ? -7.051  5.686   1.052   1.00 0.00 ? 27 THR A CA   9  
ATOM 7404  C C    . THR A 1 27 ? -6.275  4.956   2.150   1.00 0.00 ? 27 THR A C    9  
ATOM 7405  O O    . THR A 1 27 ? -5.785  3.849   1.936   1.00 0.00 ? 27 THR A O    9  
ATOM 7406  C CB   . THR A 1 27 ? -8.541  5.846   1.365   1.00 0.00 ? 27 THR A CB   9  
ATOM 7407  O OG1  . THR A 1 27 ? -8.887  4.635   2.032   1.00 0.00 ? 27 THR A OG1  9  
ATOM 7408  C CG2  . THR A 1 27 ? -9.408  5.838   0.105   1.00 0.00 ? 27 THR A CG2  9  
ATOM 7409  H H    . THR A 1 27 ? -6.798  3.990   -0.129  1.00 0.00 ? 27 THR A H    9  
ATOM 7410  H HA   . THR A 1 27 ? -6.596  6.670   0.938   1.00 0.00 ? 27 THR A HA   9  
ATOM 7411  H HB   . THR A 1 27 ? -8.720  6.744   1.956   1.00 0.00 ? 27 THR A HB   9  
ATOM 7412  H HG1  . THR A 1 27 ? -9.812  4.702   2.404   1.00 0.00 ? 27 THR A HG1  9  
ATOM 7413  H HG21 . THR A 1 27 ? -9.152  4.973   -0.508  1.00 0.00 ? 27 THR A HG21 9  
ATOM 7414  H HG22 . THR A 1 27 ? -10.459 5.784   0.388   1.00 0.00 ? 27 THR A HG22 9  
ATOM 7415  H HG23 . THR A 1 27 ? -9.231  6.751   -0.464  1.00 0.00 ? 27 THR A HG23 9  
ATOM 7416  N N    . PRO A 1 28 ? -6.184  5.624   3.331   1.00 0.00 ? 28 PRO A N    9  
ATOM 7417  C CA   . PRO A 1 28 ? -5.475  5.051   4.462   1.00 0.00 ? 28 PRO A CA   9  
ATOM 7418  C C    . PRO A 1 28 ? -6.295  3.937   5.116   1.00 0.00 ? 28 PRO A C    9  
ATOM 7419  O O    . PRO A 1 28 ? -6.332  3.825   6.340   1.00 0.00 ? 28 PRO A O    9  
ATOM 7420  C CB   . PRO A 1 28 ? -5.213  6.222   5.396   1.00 0.00 ? 28 PRO A CB   9  
ATOM 7421  C CG   . PRO A 1 28 ? -6.184  7.314   4.979   1.00 0.00 ? 28 PRO A CG   9  
ATOM 7422  C CD   . PRO A 1 28 ? -6.752  6.938   3.619   1.00 0.00 ? 28 PRO A CD   9  
ATOM 7423  H HA   . PRO A 1 28 ? -4.624  4.622   4.158   1.00 0.00 ? 28 PRO A HA   9  
ATOM 7424  H HB2  . PRO A 1 28 ? -5.371  5.935   6.436   1.00 0.00 ? 28 PRO A HB2  9  
ATOM 7425  H HB3  . PRO A 1 28 ? -4.181  6.564   5.313   1.00 0.00 ? 28 PRO A HB3  9  
ATOM 7426  H HG2  . PRO A 1 28 ? -6.984  7.413   5.712   1.00 0.00 ? 28 PRO A HG2  9  
ATOM 7427  H HG3  . PRO A 1 28 ? -5.677  8.277   4.928   1.00 0.00 ? 28 PRO A HG3  9  
ATOM 7428  H HD2  . PRO A 1 28 ? -7.841  6.903   3.641   1.00 0.00 ? 28 PRO A HD2  9  
ATOM 7429  H HD3  . PRO A 1 28 ? -6.472  7.666   2.858   1.00 0.00 ? 28 PRO A HD3  9  
ATOM 7430  N N    . LYS A 1 29 ? -6.932  3.141   4.270   1.00 0.00 ? 29 LYS A N    9  
ATOM 7431  C CA   . LYS A 1 29 ? -7.749  2.039   4.749   1.00 0.00 ? 29 LYS A CA   9  
ATOM 7432  C C    . LYS A 1 29 ? -8.332  1.284   3.554   1.00 0.00 ? 29 LYS A C    9  
ATOM 7433  O O    . LYS A 1 29 ? -8.242  0.059   3.485   1.00 0.00 ? 29 LYS A O    9  
ATOM 7434  C CB   . LYS A 1 29 ? -8.807  2.545   5.732   1.00 0.00 ? 29 LYS A CB   9  
ATOM 7435  C CG   . LYS A 1 29 ? -9.184  1.458   6.740   1.00 0.00 ? 29 LYS A CG   9  
ATOM 7436  C CD   . LYS A 1 29 ? -10.691 1.195   6.726   1.00 0.00 ? 29 LYS A CD   9  
ATOM 7437  C CE   . LYS A 1 29 ? -11.211 0.909   8.136   1.00 0.00 ? 29 LYS A CE   9  
ATOM 7438  N NZ   . LYS A 1 29 ? -12.568 0.321   8.079   1.00 0.00 ? 29 LYS A NZ   9  
ATOM 7439  H H    . LYS A 1 29 ? -6.897  3.239   3.275   1.00 0.00 ? 29 LYS A H    9  
ATOM 7440  H HA   . LYS A 1 29 ? -7.095  1.363   5.300   1.00 0.00 ? 29 LYS A HA   9  
ATOM 7441  H HB2  . LYS A 1 29 ? -8.429  3.421   6.260   1.00 0.00 ? 29 LYS A HB2  9  
ATOM 7442  H HB3  . LYS A 1 29 ? -9.695  2.862   5.185   1.00 0.00 ? 29 LYS A HB3  9  
ATOM 7443  H HG2  . LYS A 1 29 ? -8.649  0.538   6.505   1.00 0.00 ? 29 LYS A HG2  9  
ATOM 7444  H HG3  . LYS A 1 29 ? -8.873  1.761   7.740   1.00 0.00 ? 29 LYS A HG3  9  
ATOM 7445  H HD2  . LYS A 1 29 ? -11.210 2.060   6.311   1.00 0.00 ? 29 LYS A HD2  9  
ATOM 7446  H HD3  . LYS A 1 29 ? -10.910 0.349   6.075   1.00 0.00 ? 29 LYS A HD3  9  
ATOM 7447  H HE2  . LYS A 1 29 ? -10.534 0.225   8.648   1.00 0.00 ? 29 LYS A HE2  9  
ATOM 7448  H HE3  . LYS A 1 29 ? -11.232 1.831   8.717   1.00 0.00 ? 29 LYS A HE3  9  
ATOM 7449  H HZ1  . LYS A 1 29 ? -12.576 -0.436  7.426   1.00 0.00 ? 29 LYS A HZ1  9  
ATOM 7450  H HZ2  . LYS A 1 29 ? -12.824 -0.016  8.984   1.00 0.00 ? 29 LYS A HZ2  9  
ATOM 7451  H HZ3  . LYS A 1 29 ? -13.222 1.020   7.786   1.00 0.00 ? 29 LYS A HZ3  9  
ATOM 7452  N N    . GLU A 1 30 ? -8.916  2.045   2.640   1.00 0.00 ? 30 GLU A N    9  
ATOM 7453  C CA   . GLU A 1 30 ? -9.513  1.463   1.451   1.00 0.00 ? 30 GLU A CA   9  
ATOM 7454  C C    . GLU A 1 30 ? -8.431  0.848   0.560   1.00 0.00 ? 30 GLU A C    9  
ATOM 7455  O O    . GLU A 1 30 ? -8.596  -0.260  0.052   1.00 0.00 ? 30 GLU A O    9  
ATOM 7456  C CB   . GLU A 1 30 ? -10.330 2.503   0.682   1.00 0.00 ? 30 GLU A CB   9  
ATOM 7457  C CG   . GLU A 1 30 ? -10.869 1.920   -0.626  1.00 0.00 ? 30 GLU A CG   9  
ATOM 7458  C CD   . GLU A 1 30 ? -12.353 2.249   -0.802  1.00 0.00 ? 30 GLU A CD   9  
ATOM 7459  O OE1  . GLU A 1 30 ? -12.641 3.425   -1.113  1.00 0.00 ? 30 GLU A OE1  9  
ATOM 7460  O OE2  . GLU A 1 30 ? -13.167 1.317   -0.622  1.00 0.00 ? 30 GLU A OE2  9  
ATOM 7461  H H    . GLU A 1 30 ? -8.984  3.041   2.703   1.00 0.00 ? 30 GLU A H    9  
ATOM 7462  H HA   . GLU A 1 30 ? -10.181 0.682   1.815   1.00 0.00 ? 30 GLU A HA   9  
ATOM 7463  H HB2  . GLU A 1 30 ? -11.159 2.848   1.300   1.00 0.00 ? 30 GLU A HB2  9  
ATOM 7464  H HB3  . GLU A 1 30 ? -9.709  3.373   0.467   1.00 0.00 ? 30 GLU A HB3  9  
ATOM 7465  H HG2  . GLU A 1 30 ? -10.302 2.318   -1.467  1.00 0.00 ? 30 GLU A HG2  9  
ATOM 7466  H HG3  . GLU A 1 30 ? -10.730 0.839   -0.630  1.00 0.00 ? 30 GLU A HG3  9  
ATOM 7467  N N    . CYS A 1 31 ? -7.348  1.594   0.399   1.00 0.00 ? 31 CYS A N    9  
ATOM 7468  C CA   . CYS A 1 31 ? -6.240  1.137   -0.422  1.00 0.00 ? 31 CYS A CA   9  
ATOM 7469  C C    . CYS A 1 31 ? -5.637  -0.107  0.235   1.00 0.00 ? 31 CYS A C    9  
ATOM 7470  O O    . CYS A 1 31 ? -5.187  -1.021  -0.454  1.00 0.00 ? 31 CYS A O    9  
ATOM 7471  C CB   . CYS A 1 31 ? -5.196  2.236   -0.626  1.00 0.00 ? 31 CYS A CB   9  
ATOM 7472  S SG   . CYS A 1 31 ? -3.492  1.633   -0.913  1.00 0.00 ? 31 CYS A SG   9  
ATOM 7473  H H    . CYS A 1 31 ? -7.222  2.494   0.816   1.00 0.00 ? 31 CYS A H    9  
ATOM 7474  H HA   . CYS A 1 31 ? -6.653  0.895   -1.401  1.00 0.00 ? 31 CYS A HA   9  
ATOM 7475  H HB2  . CYS A 1 31 ? -5.497  2.850   -1.476  1.00 0.00 ? 31 CYS A HB2  9  
ATOM 7476  H HB3  . CYS A 1 31 ? -5.194  2.884   0.250   1.00 0.00 ? 31 CYS A HB3  9  
ATOM 7477  N N    . ASN A 1 32 ? -5.649  -0.101  1.560   1.00 0.00 ? 32 ASN A N    9  
ATOM 7478  C CA   . ASN A 1 32 ? -5.109  -1.218  2.318   1.00 0.00 ? 32 ASN A CA   9  
ATOM 7479  C C    . ASN A 1 32 ? -6.215  -2.248  2.558   1.00 0.00 ? 32 ASN A C    9  
ATOM 7480  O O    . ASN A 1 32 ? -5.975  -3.292  3.161   1.00 0.00 ? 32 ASN A O    9  
ATOM 7481  C CB   . ASN A 1 32 ? -4.588  -0.757  3.681   1.00 0.00 ? 32 ASN A CB   9  
ATOM 7482  C CG   . ASN A 1 32 ? -4.305  -1.954  4.592   1.00 0.00 ? 32 ASN A CG   9  
ATOM 7483  O OD1  . ASN A 1 32 ? -3.542  -2.849  4.266   1.00 0.00 ? 32 ASN A OD1  9  
ATOM 7484  N ND2  . ASN A 1 32 ? -4.959  -1.919  5.749   1.00 0.00 ? 32 ASN A ND2  9  
ATOM 7485  H H    . ASN A 1 32 ? -6.017  0.646   2.113   1.00 0.00 ? 32 ASN A H    9  
ATOM 7486  H HA   . ASN A 1 32 ? -4.297  -1.612  1.708   1.00 0.00 ? 32 ASN A HA   9  
ATOM 7487  H HB2  . ASN A 1 32 ? -3.677  -0.174  3.548   1.00 0.00 ? 32 ASN A HB2  9  
ATOM 7488  H HB3  . ASN A 1 32 ? -5.320  -0.102  4.152   1.00 0.00 ? 32 ASN A HB3  9  
ATOM 7489  H HD21 . ASN A 1 32 ? -5.571  -1.155  5.955   1.00 0.00 ? 32 ASN A HD21 9  
ATOM 7490  H HD22 . ASN A 1 32 ? -4.841  -2.657  6.413   1.00 0.00 ? 32 ASN A HD22 9  
ATOM 7491  N N    . ASN A 1 33 ? -7.403  -1.917  2.074   1.00 0.00 ? 33 ASN A N    9  
ATOM 7492  C CA   . ASN A 1 33 ? -8.546  -2.800  2.228   1.00 0.00 ? 33 ASN A CA   9  
ATOM 7493  C C    . ASN A 1 33 ? -8.705  -3.647  0.963   1.00 0.00 ? 33 ASN A C    9  
ATOM 7494  O O    . ASN A 1 33 ? -9.039  -4.828  1.041   1.00 0.00 ? 33 ASN A O    9  
ATOM 7495  C CB   . ASN A 1 33 ? -9.836  -2.001  2.428   1.00 0.00 ? 33 ASN A CB   9  
ATOM 7496  C CG   . ASN A 1 33 ? -11.052 -2.928  2.478   1.00 0.00 ? 33 ASN A CG   9  
ATOM 7497  O OD1  . ASN A 1 33 ? -11.149 -3.823  3.301   1.00 0.00 ? 33 ASN A OD1  9  
ATOM 7498  N ND2  . ASN A 1 33 ? -11.972 -2.664  1.555   1.00 0.00 ? 33 ASN A ND2  9  
ATOM 7499  H H    . ASN A 1 33 ? -7.590  -1.065  1.584   1.00 0.00 ? 33 ASN A H    9  
ATOM 7500  H HA   . ASN A 1 33 ? -8.326  -3.403  3.109   1.00 0.00 ? 33 ASN A HA   9  
ATOM 7501  H HB2  . ASN A 1 33 ? -9.773  -1.427  3.352   1.00 0.00 ? 33 ASN A HB2  9  
ATOM 7502  H HB3  . ASN A 1 33 ? -9.954  -1.285  1.615   1.00 0.00 ? 33 ASN A HB3  9  
ATOM 7503  H HD21 . ASN A 1 33 ? -11.831 -1.914  0.909   1.00 0.00 ? 33 ASN A HD21 9  
ATOM 7504  H HD22 . ASN A 1 33 ? -12.805 -3.216  1.507   1.00 0.00 ? 33 ASN A HD22 9  
ATOM 7505  N N    . ARG A 1 34 ? -8.460  -3.009  -0.172  1.00 0.00 ? 34 ARG A N    9  
ATOM 7506  C CA   . ARG A 1 34 ? -8.572  -3.689  -1.451  1.00 0.00 ? 34 ARG A CA   9  
ATOM 7507  C C    . ARG A 1 34 ? -7.558  -4.832  -1.535  1.00 0.00 ? 34 ARG A C    9  
ATOM 7508  O O    . ARG A 1 34 ? -7.777  -5.810  -2.249  1.00 0.00 ? 34 ARG A O    9  
ATOM 7509  C CB   . ARG A 1 34 ? -8.336  -2.721  -2.612  1.00 0.00 ? 34 ARG A CB   9  
ATOM 7510  C CG   . ARG A 1 34 ? -9.254  -3.046  -3.792  1.00 0.00 ? 34 ARG A CG   9  
ATOM 7511  C CD   . ARG A 1 34 ? -8.881  -4.390  -4.423  1.00 0.00 ? 34 ARG A CD   9  
ATOM 7512  N NE   . ARG A 1 34 ? -9.387  -4.455  -5.811  1.00 0.00 ? 34 ARG A NE   9  
ATOM 7513  C CZ   . ARG A 1 34 ? -9.307  -5.543  -6.590  1.00 0.00 ? 34 ARG A CZ   9  
ATOM 7514  N NH1  . ARG A 1 34 ? -8.740  -6.663  -6.120  1.00 0.00 ? 34 ARG A NH1  9  
ATOM 7515  N NH2  . ARG A 1 34 ? -9.794  -5.511  -7.838  1.00 0.00 ? 34 ARG A NH2  9  
ATOM 7516  H H    . ARG A 1 34 ? -8.189  -2.048  -0.226  1.00 0.00 ? 34 ARG A H    9  
ATOM 7517  H HA   . ARG A 1 34 ? -9.593  -4.069  -1.477  1.00 0.00 ? 34 ARG A HA   9  
ATOM 7518  H HB2  . ARG A 1 34 ? -8.515  -1.698  -2.279  1.00 0.00 ? 34 ARG A HB2  9  
ATOM 7519  H HB3  . ARG A 1 34 ? -7.295  -2.775  -2.930  1.00 0.00 ? 34 ARG A HB3  9  
ATOM 7520  H HG2  . ARG A 1 34 ? -10.290 -3.074  -3.455  1.00 0.00 ? 34 ARG A HG2  9  
ATOM 7521  H HG3  . ARG A 1 34 ? -9.183  -2.257  -4.541  1.00 0.00 ? 34 ARG A HG3  9  
ATOM 7522  H HD2  . ARG A 1 34 ? -7.798  -4.516  -4.415  1.00 0.00 ? 34 ARG A HD2  9  
ATOM 7523  H HD3  . ARG A 1 34 ? -9.301  -5.206  -3.835  1.00 0.00 ? 34 ARG A HD3  9  
ATOM 7524  H HE   . ARG A 1 34 ? -9.816  -3.637  -6.193  1.00 0.00 ? 34 ARG A HE   9  
ATOM 7525  H HH11 . ARG A 1 34 ? -8.377  -6.687  -5.189  1.00 0.00 ? 34 ARG A HH11 9  
ATOM 7526  H HH12 . ARG A 1 34 ? -8.680  -7.475  -6.701  1.00 0.00 ? 34 ARG A HH12 9  
ATOM 7527  H HH21 . ARG A 1 34 ? -10.217 -4.676  -8.188  1.00 0.00 ? 34 ARG A HH21 9  
ATOM 7528  H HH22 . ARG A 1 34 ? -9.734  -6.323  -8.419  1.00 0.00 ? 34 ARG A HH22 9  
ATOM 7529  N N    . GLY A 1 35 ? -6.469  -4.670  -0.797  1.00 0.00 ? 35 GLY A N    9  
ATOM 7530  C CA   . GLY A 1 35 ? -5.421  -5.676  -0.779  1.00 0.00 ? 35 GLY A CA   9  
ATOM 7531  C C    . GLY A 1 35 ? -4.081  -5.080  -1.215  1.00 0.00 ? 35 GLY A C    9  
ATOM 7532  O O    . GLY A 1 35 ? -3.622  -5.324  -2.330  1.00 0.00 ? 35 GLY A O    9  
ATOM 7533  H H    . GLY A 1 35 ? -6.299  -3.872  -0.219  1.00 0.00 ? 35 GLY A H    9  
ATOM 7534  H HA2  . GLY A 1 35 ? -5.329  -6.093  0.224   1.00 0.00 ? 35 GLY A HA2  9  
ATOM 7535  H HA3  . GLY A 1 35 ? -5.690  -6.499  -1.442  1.00 0.00 ? 35 GLY A HA3  9  
ATOM 7536  N N    . CYS A 1 36 ? -3.492  -4.309  -0.313  1.00 0.00 ? 36 CYS A N    9  
ATOM 7537  C CA   . CYS A 1 36 ? -2.214  -3.676  -0.590  1.00 0.00 ? 36 CYS A CA   9  
ATOM 7538  C C    . CYS A 1 36 ? -1.898  -2.710  0.554   1.00 0.00 ? 36 CYS A C    9  
ATOM 7539  O O    . CYS A 1 36 ? -2.438  -2.844  1.651   1.00 0.00 ? 36 CYS A O    9  
ATOM 7540  C CB   . CYS A 1 36 ? -2.215  -2.970  -1.948  1.00 0.00 ? 36 CYS A CB   9  
ATOM 7541  S SG   . CYS A 1 36 ? -0.874  -3.486  -3.081  1.00 0.00 ? 36 CYS A SG   9  
ATOM 7542  H H    . CYS A 1 36 ? -3.872  -4.116  0.592   1.00 0.00 ? 36 CYS A H    9  
ATOM 7543  H HA   . CYS A 1 36 ? -1.473  -4.474  -0.639  1.00 0.00 ? 36 CYS A HA   9  
ATOM 7544  H HB2  . CYS A 1 36 ? -3.173  -3.152  -2.435  1.00 0.00 ? 36 CYS A HB2  9  
ATOM 7545  H HB3  . CYS A 1 36 ? -2.139  -1.896  -1.783  1.00 0.00 ? 36 CYS A HB3  9  
ATOM 7546  N N    . CYS A 1 37 ? -1.024  -1.759  0.259   1.00 0.00 ? 37 CYS A N    9  
ATOM 7547  C CA   . CYS A 1 37 ? -0.630  -0.772  1.250   1.00 0.00 ? 37 CYS A CA   9  
ATOM 7548  C C    . CYS A 1 37 ? -0.953  0.618   0.698   1.00 0.00 ? 37 CYS A C    9  
ATOM 7549  O O    . CYS A 1 37 ? -0.947  0.825   -0.515  1.00 0.00 ? 37 CYS A O    9  
ATOM 7550  C CB   . CYS A 1 37 ? 0.847   -0.907  1.626   1.00 0.00 ? 37 CYS A CB   9  
ATOM 7551  S SG   . CYS A 1 37 ? 1.188   -2.080  2.989   1.00 0.00 ? 37 CYS A SG   9  
ATOM 7552  H H    . CYS A 1 37 ? -0.589  -1.657  -0.636  1.00 0.00 ? 37 CYS A H    9  
ATOM 7553  H HA   . CYS A 1 37 ? -1.214  -0.977  2.147   1.00 0.00 ? 37 CYS A HA   9  
ATOM 7554  H HB2  . CYS A 1 37 ? 1.405   -1.223  0.745   1.00 0.00 ? 37 CYS A HB2  9  
ATOM 7555  H HB3  . CYS A 1 37 ? 1.227   0.075   1.908   1.00 0.00 ? 37 CYS A HB3  9  
ATOM 7556  N N    . PHE A 1 38 ? -1.227  1.535   1.614   1.00 0.00 ? 38 PHE A N    9  
ATOM 7557  C CA   . PHE A 1 38 ? -1.552  2.899   1.235   1.00 0.00 ? 38 PHE A CA   9  
ATOM 7558  C C    . PHE A 1 38 ? -0.498  3.879   1.753   1.00 0.00 ? 38 PHE A C    9  
ATOM 7559  O O    . PHE A 1 38 ? 0.397   3.493   2.503   1.00 0.00 ? 38 PHE A O    9  
ATOM 7560  C CB   . PHE A 1 38 ? -2.901  3.233   1.876   1.00 0.00 ? 38 PHE A CB   9  
ATOM 7561  C CG   . PHE A 1 38 ? -3.312  4.699   1.732   1.00 0.00 ? 38 PHE A CG   9  
ATOM 7562  C CD1  . PHE A 1 38 ? -3.938  5.122   0.601   1.00 0.00 ? 38 PHE A CD1  9  
ATOM 7563  C CD2  . PHE A 1 38 ? -3.053  5.580   2.736   1.00 0.00 ? 38 PHE A CD2  9  
ATOM 7564  C CE1  . PHE A 1 38 ? -4.320  6.483   0.467   1.00 0.00 ? 38 PHE A CE1  9  
ATOM 7565  C CE2  . PHE A 1 38 ? -3.435  6.941   2.602   1.00 0.00 ? 38 PHE A CE2  9  
ATOM 7566  C CZ   . PHE A 1 38 ? -4.060  7.364   1.471   1.00 0.00 ? 38 PHE A CZ   9  
ATOM 7567  H H    . PHE A 1 38 ? -1.230  1.358   2.599   1.00 0.00 ? 38 PHE A H    9  
ATOM 7568  H HA   . PHE A 1 38 ? -1.575  2.935   0.145   1.00 0.00 ? 38 PHE A HA   9  
ATOM 7569  H HB2  . PHE A 1 38 ? -3.670  2.604   1.428   1.00 0.00 ? 38 PHE A HB2  9  
ATOM 7570  H HB3  . PHE A 1 38 ? -2.860  2.980   2.935   1.00 0.00 ? 38 PHE A HB3  9  
ATOM 7571  H HD1  . PHE A 1 38 ? -4.145  4.416   -0.204  1.00 0.00 ? 38 PHE A HD1  9  
ATOM 7572  H HD2  . PHE A 1 38 ? -2.552  5.241   3.642   1.00 0.00 ? 38 PHE A HD2  9  
ATOM 7573  H HE1  . PHE A 1 38 ? -4.821  6.822   -0.440  1.00 0.00 ? 38 PHE A HE1  9  
ATOM 7574  H HE2  . PHE A 1 38 ? -3.228  7.647   3.406   1.00 0.00 ? 38 PHE A HE2  9  
ATOM 7575  H HZ   . PHE A 1 38 ? -4.354  8.409   1.368   1.00 0.00 ? 38 PHE A HZ   9  
ATOM 7576  N N    . ASP A 1 39 ? -0.639  5.127   1.333   1.00 0.00 ? 39 ASP A N    9  
ATOM 7577  C CA   . ASP A 1 39 ? 0.290   6.165   1.746   1.00 0.00 ? 39 ASP A CA   9  
ATOM 7578  C C    . ASP A 1 39 ? -0.114  7.492   1.100   1.00 0.00 ? 39 ASP A C    9  
ATOM 7579  O O    . ASP A 1 39 ? -0.576  7.516   -0.040  1.00 0.00 ? 39 ASP A O    9  
ATOM 7580  C CB   . ASP A 1 39 ? 1.716   5.837   1.300   1.00 0.00 ? 39 ASP A CB   9  
ATOM 7581  C CG   . ASP A 1 39 ? 2.766   6.890   1.662   1.00 0.00 ? 39 ASP A CG   9  
ATOM 7582  O OD1  . ASP A 1 39 ? 3.131   6.941   2.856   1.00 0.00 ? 39 ASP A OD1  9  
ATOM 7583  O OD2  . ASP A 1 39 ? 3.179   7.621   0.735   1.00 0.00 ? 39 ASP A OD2  9  
ATOM 7584  H H    . ASP A 1 39 ? -1.370  5.433   0.723   1.00 0.00 ? 39 ASP A H    9  
ATOM 7585  H HA   . ASP A 1 39 ? 0.223   6.194   2.834   1.00 0.00 ? 39 ASP A HA   9  
ATOM 7586  H HB2  . ASP A 1 39 ? 2.010   4.886   1.745   1.00 0.00 ? 39 ASP A HB2  9  
ATOM 7587  H HB3  . ASP A 1 39 ? 1.720   5.698   0.219   1.00 0.00 ? 39 ASP A HB3  9  
ATOM 7588  N N    . SER A 1 40 ? 0.076   8.564   1.855   1.00 0.00 ? 40 SER A N    9  
ATOM 7589  C CA   . SER A 1 40 ? -0.263  9.891   1.370   1.00 0.00 ? 40 SER A CA   9  
ATOM 7590  C C    . SER A 1 40 ? 0.883   10.862  1.661   1.00 0.00 ? 40 SER A C    9  
ATOM 7591  O O    . SER A 1 40 ? 0.698   12.078  1.611   1.00 0.00 ? 40 SER A O    9  
ATOM 7592  C CB   . SER A 1 40 ? -1.560  10.395  2.005   1.00 0.00 ? 40 SER A CB   9  
ATOM 7593  O OG   . SER A 1 40 ? -1.407  10.656  3.397   1.00 0.00 ? 40 SER A OG   9  
ATOM 7594  H H    . SER A 1 40 ? 0.452   8.536   2.781   1.00 0.00 ? 40 SER A H    9  
ATOM 7595  H HA   . SER A 1 40 ? -0.405  9.778   0.295   1.00 0.00 ? 40 SER A HA   9  
ATOM 7596  H HB2  . SER A 1 40 ? -1.882  11.305  1.499   1.00 0.00 ? 40 SER A HB2  9  
ATOM 7597  H HB3  . SER A 1 40 ? -2.347  9.654   1.859   1.00 0.00 ? 40 SER A HB3  9  
ATOM 7598  H HG   . SER A 1 40 ? -1.851  11.520  3.634   1.00 0.00 ? 40 SER A HG   9  
ATOM 7599  N N    . ARG A 1 41 ? 2.040   10.290  1.958   1.00 0.00 ? 41 ARG A N    9  
ATOM 7600  C CA   . ARG A 1 41 ? 3.216   11.091  2.256   1.00 0.00 ? 41 ARG A CA   9  
ATOM 7601  C C    . ARG A 1 41 ? 3.537   12.021  1.085   1.00 0.00 ? 41 ARG A C    9  
ATOM 7602  O O    . ARG A 1 41 ? 3.695   13.226  1.269   1.00 0.00 ? 41 ARG A O    9  
ATOM 7603  C CB   . ARG A 1 41 ? 4.429   10.203  2.541   1.00 0.00 ? 41 ARG A CB   9  
ATOM 7604  C CG   . ARG A 1 41 ? 5.310   10.812  3.633   1.00 0.00 ? 41 ARG A CG   9  
ATOM 7605  C CD   . ARG A 1 41 ? 6.541   11.491  3.029   1.00 0.00 ? 41 ARG A CD   9  
ATOM 7606  N NE   . ARG A 1 41 ? 7.320   12.165  4.092   1.00 0.00 ? 41 ARG A NE   9  
ATOM 7607  C CZ   . ARG A 1 41 ? 8.241   13.111  3.863   1.00 0.00 ? 41 ARG A CZ   9  
ATOM 7608  N NH1  . ARG A 1 41 ? 8.505   13.500  2.608   1.00 0.00 ? 41 ARG A NH1  9  
ATOM 7609  N NH2  . ARG A 1 41 ? 8.900   13.667  4.889   1.00 0.00 ? 41 ARG A NH2  9  
ATOM 7610  H H    . ARG A 1 41 ? 2.182   9.301   1.996   1.00 0.00 ? 41 ARG A H    9  
ATOM 7611  H HA   . ARG A 1 41 ? 2.947   11.660  3.146   1.00 0.00 ? 41 ARG A HA   9  
ATOM 7612  H HB2  . ARG A 1 41 ? 4.095   9.212   2.849   1.00 0.00 ? 41 ARG A HB2  9  
ATOM 7613  H HB3  . ARG A 1 41 ? 5.011   10.073  1.629   1.00 0.00 ? 41 ARG A HB3  9  
ATOM 7614  H HG2  . ARG A 1 41 ? 4.735   11.539  4.207   1.00 0.00 ? 41 ARG A HG2  9  
ATOM 7615  H HG3  . ARG A 1 41 ? 5.624   10.034  4.328   1.00 0.00 ? 41 ARG A HG3  9  
ATOM 7616  H HD2  . ARG A 1 41 ? 7.163   10.753  2.524   1.00 0.00 ? 41 ARG A HD2  9  
ATOM 7617  H HD3  . ARG A 1 41 ? 6.233   12.217  2.276   1.00 0.00 ? 41 ARG A HD3  9  
ATOM 7618  H HE   . ARG A 1 41 ? 7.148   11.898  5.040   1.00 0.00 ? 41 ARG A HE   9  
ATOM 7619  H HH11 . ARG A 1 41 ? 8.013   13.085  1.842   1.00 0.00 ? 41 ARG A HH11 9  
ATOM 7620  H HH12 . ARG A 1 41 ? 9.192   14.206  2.437   1.00 0.00 ? 41 ARG A HH12 9  
ATOM 7621  H HH21 . ARG A 1 41 ? 8.703   13.377  5.826   1.00 0.00 ? 41 ARG A HH21 9  
ATOM 7622  H HH22 . ARG A 1 41 ? 9.587   14.373  4.718   1.00 0.00 ? 41 ARG A HH22 9  
ATOM 7623  N N    . ILE A 1 42 ? 3.623   11.425  -0.096  1.00 0.00 ? 42 ILE A N    9  
ATOM 7624  C CA   . ILE A 1 42 ? 3.922   12.184  -1.298  1.00 0.00 ? 42 ILE A CA   9  
ATOM 7625  C C    . ILE A 1 42 ? 3.119   11.615  -2.469  1.00 0.00 ? 42 ILE A C    9  
ATOM 7626  O O    . ILE A 1 42 ? 3.050   10.400  -2.647  1.00 0.00 ? 42 ILE A O    9  
ATOM 7627  C CB   . ILE A 1 42 ? 5.431   12.221  -1.547  1.00 0.00 ? 42 ILE A CB   9  
ATOM 7628  C CG1  . ILE A 1 42 ? 6.129   11.046  -0.859  1.00 0.00 ? 42 ILE A CG1  9  
ATOM 7629  C CG2  . ILE A 1 42 ? 6.024   13.566  -1.126  1.00 0.00 ? 42 ILE A CG2  9  
ATOM 7630  C CD1  . ILE A 1 42 ? 5.619   9.710   -1.403  1.00 0.00 ? 42 ILE A CD1  9  
ATOM 7631  H H    . ILE A 1 42 ? 3.493   10.443  -0.238  1.00 0.00 ? 42 ILE A H    9  
ATOM 7632  H HA   . ILE A 1 42 ? 3.599   13.211  -1.124  1.00 0.00 ? 42 ILE A HA   9  
ATOM 7633  H HB   . ILE A 1 42 ? 5.603   12.114  -2.618  1.00 0.00 ? 42 ILE A HB   9  
ATOM 7634  H HG12 . ILE A 1 42 ? 7.206   11.118  -1.011  1.00 0.00 ? 42 ILE A HG12 9  
ATOM 7635  H HG13 . ILE A 1 42 ? 5.956   11.095  0.216   1.00 0.00 ? 42 ILE A HG13 9  
ATOM 7636  H HG21 . ILE A 1 42 ? 5.283   14.129  -0.558  1.00 0.00 ? 42 ILE A HG21 9  
ATOM 7637  H HG22 . ILE A 1 42 ? 6.905   13.397  -0.506  1.00 0.00 ? 42 ILE A HG22 9  
ATOM 7638  H HG23 . ILE A 1 42 ? 6.308   14.132  -2.013  1.00 0.00 ? 42 ILE A HG23 9  
ATOM 7639  H HD11 . ILE A 1 42 ? 5.102   9.876   -2.348  1.00 0.00 ? 42 ILE A HD11 9  
ATOM 7640  H HD12 . ILE A 1 42 ? 6.462   9.038   -1.563  1.00 0.00 ? 42 ILE A HD12 9  
ATOM 7641  H HD13 . ILE A 1 42 ? 4.930   9.264   -0.685  1.00 0.00 ? 42 ILE A HD13 9  
ATOM 7642  N N    . PRO A 1 43 ? 2.515   12.545  -3.257  1.00 0.00 ? 43 PRO A N    9  
ATOM 7643  C CA   . PRO A 1 43 ? 1.719   12.148  -4.406  1.00 0.00 ? 43 PRO A CA   9  
ATOM 7644  C C    . PRO A 1 43 ? 2.613   11.696  -5.563  1.00 0.00 ? 43 PRO A C    9  
ATOM 7645  O O    . PRO A 1 43 ? 2.278   10.755  -6.280  1.00 0.00 ? 43 PRO A O    9  
ATOM 7646  C CB   . PRO A 1 43 ? 0.881   13.370  -4.745  1.00 0.00 ? 43 PRO A CB   9  
ATOM 7647  C CG   . PRO A 1 43 ? 1.570   14.547  -4.073  1.00 0.00 ? 43 PRO A CG   9  
ATOM 7648  C CD   . PRO A 1 43 ? 2.574   13.992  -3.077  1.00 0.00 ? 43 PRO A CD   9  
ATOM 7649  H HA   . PRO A 1 43 ? 1.149   11.359  -4.178  1.00 0.00 ? 43 PRO A HA   9  
ATOM 7650  H HB2  . PRO A 1 43 ? 0.822   13.516  -5.824  1.00 0.00 ? 43 PRO A HB2  9  
ATOM 7651  H HB3  . PRO A 1 43 ? -0.141  13.256  -4.382  1.00 0.00 ? 43 PRO A HB3  9  
ATOM 7652  H HG2  . PRO A 1 43 ? 2.071   15.170  -4.814  1.00 0.00 ? 43 PRO A HG2  9  
ATOM 7653  H HG3  . PRO A 1 43 ? 0.839   15.178  -3.568  1.00 0.00 ? 43 PRO A HG3  9  
ATOM 7654  H HD2  . PRO A 1 43 ? 3.576   14.375  -3.270  1.00 0.00 ? 43 PRO A HD2  9  
ATOM 7655  H HD3  . PRO A 1 43 ? 2.317   14.275  -2.056  1.00 0.00 ? 43 PRO A HD3  9  
ATOM 7656  N N    . GLY A 1 44 ? 3.733   12.390  -5.709  1.00 0.00 ? 44 GLY A N    9  
ATOM 7657  C CA   . GLY A 1 44 ? 4.677   12.072  -6.766  1.00 0.00 ? 44 GLY A CA   9  
ATOM 7658  C C    . GLY A 1 44 ? 4.855   10.559  -6.907  1.00 0.00 ? 44 GLY A C    9  
ATOM 7659  O O    . GLY A 1 44 ? 5.120   10.060  -7.999  1.00 0.00 ? 44 GLY A O    9  
ATOM 7660  H H    . GLY A 1 44 ? 3.998   13.154  -5.121  1.00 0.00 ? 44 GLY A H    9  
ATOM 7661  H HA2  . GLY A 1 44 ? 4.326   12.489  -7.710  1.00 0.00 ? 44 GLY A HA2  9  
ATOM 7662  H HA3  . GLY A 1 44 ? 5.640   12.536  -6.551  1.00 0.00 ? 44 GLY A HA3  9  
ATOM 7663  N N    . VAL A 1 45 ? 4.700   9.870   -5.785  1.00 0.00 ? 45 VAL A N    9  
ATOM 7664  C CA   . VAL A 1 45 ? 4.840   8.424   -5.769  1.00 0.00 ? 45 VAL A CA   9  
ATOM 7665  C C    . VAL A 1 45 ? 3.452   7.782   -5.717  1.00 0.00 ? 45 VAL A C    9  
ATOM 7666  O O    . VAL A 1 45 ? 2.452   8.473   -5.531  1.00 0.00 ? 45 VAL A O    9  
ATOM 7667  C CB   . VAL A 1 45 ? 5.740   7.998   -4.607  1.00 0.00 ? 45 VAL A CB   9  
ATOM 7668  C CG1  . VAL A 1 45 ? 6.717   9.114   -4.233  1.00 0.00 ? 45 VAL A CG1  9  
ATOM 7669  C CG2  . VAL A 1 45 ? 4.907   7.570   -3.397  1.00 0.00 ? 45 VAL A CG2  9  
ATOM 7670  H H    . VAL A 1 45 ? 4.484   10.284  -4.900  1.00 0.00 ? 45 VAL A H    9  
ATOM 7671  H HA   . VAL A 1 45 ? 5.328   8.131   -6.699  1.00 0.00 ? 45 VAL A HA   9  
ATOM 7672  H HB   . VAL A 1 45 ? 6.323   7.137   -4.933  1.00 0.00 ? 45 VAL A HB   9  
ATOM 7673  H HG11 . VAL A 1 45 ? 6.161   10.023  -4.003  1.00 0.00 ? 45 VAL A HG11 9  
ATOM 7674  H HG12 . VAL A 1 45 ? 7.297   8.812   -3.360  1.00 0.00 ? 45 VAL A HG12 9  
ATOM 7675  H HG13 . VAL A 1 45 ? 7.391   9.302   -5.069  1.00 0.00 ? 45 VAL A HG13 9  
ATOM 7676  H HG21 . VAL A 1 45 ? 4.122   8.305   -3.218  1.00 0.00 ? 45 VAL A HG21 9  
ATOM 7677  H HG22 . VAL A 1 45 ? 4.456   6.597   -3.592  1.00 0.00 ? 45 VAL A HG22 9  
ATOM 7678  H HG23 . VAL A 1 45 ? 5.549   7.504   -2.519  1.00 0.00 ? 45 VAL A HG23 9  
ATOM 7679  N N    . PRO A 1 46 ? 3.436   6.434   -5.889  1.00 0.00 ? 46 PRO A N    9  
ATOM 7680  C CA   . PRO A 1 46 ? 2.187   5.691   -5.864  1.00 0.00 ? 46 PRO A CA   9  
ATOM 7681  C C    . PRO A 1 46 ? 1.662   5.550   -4.433  1.00 0.00 ? 46 PRO A C    9  
ATOM 7682  O O    . PRO A 1 46 ? 2.019   4.607   -3.728  1.00 0.00 ? 46 PRO A O    9  
ATOM 7683  C CB   . PRO A 1 46 ? 2.510   4.355   -6.512  1.00 0.00 ? 46 PRO A CB   9  
ATOM 7684  C CG   . PRO A 1 46 ? 4.023   4.219   -6.455  1.00 0.00 ? 46 PRO A CG   9  
ATOM 7685  C CD   . PRO A 1 46 ? 4.601   5.583   -6.112  1.00 0.00 ? 46 PRO A CD   9  
ATOM 7686  H HA   . PRO A 1 46 ? 1.479   6.186   -6.367  1.00 0.00 ? 46 PRO A HA   9  
ATOM 7687  H HB2  . PRO A 1 46 ? 2.025   3.536   -5.983  1.00 0.00 ? 46 PRO A HB2  9  
ATOM 7688  H HB3  . PRO A 1 46 ? 2.154   4.324   -7.542  1.00 0.00 ? 46 PRO A HB3  9  
ATOM 7689  H HG2  . PRO A 1 46 ? 4.313   3.482   -5.706  1.00 0.00 ? 46 PRO A HG2  9  
ATOM 7690  H HG3  . PRO A 1 46 ? 4.412   3.870   -7.412  1.00 0.00 ? 46 PRO A HG3  9  
ATOM 7691  H HD2  . PRO A 1 46 ? 5.231   5.534   -5.224  1.00 0.00 ? 46 PRO A HD2  9  
ATOM 7692  H HD3  . PRO A 1 46 ? 5.222   5.965   -6.922  1.00 0.00 ? 46 PRO A HD3  9  
ATOM 7693  N N    . TRP A 1 47 ? 0.824   6.500   -4.048  1.00 0.00 ? 47 TRP A N    9  
ATOM 7694  C CA   . TRP A 1 47 ? 0.246   6.494   -2.715  1.00 0.00 ? 47 TRP A CA   9  
ATOM 7695  C C    . TRP A 1 47 ? 0.027   5.037   -2.302  1.00 0.00 ? 47 TRP A C    9  
ATOM 7696  O O    . TRP A 1 47 ? 0.476   4.615   -1.237  1.00 0.00 ? 47 TRP A O    9  
ATOM 7697  C CB   . TRP A 1 47 ? -1.035  7.328   -2.668  1.00 0.00 ? 47 TRP A CB   9  
ATOM 7698  C CG   . TRP A 1 47 ? -0.805  8.804   -2.341  1.00 0.00 ? 47 TRP A CG   9  
ATOM 7699  C CD1  . TRP A 1 47 ? 0.283   9.545   -2.592  1.00 0.00 ? 47 TRP A CD1  9  
ATOM 7700  C CD2  . TRP A 1 47 ? -1.734  9.695   -1.688  1.00 0.00 ? 47 TRP A CD2  9  
ATOM 7701  N NE1  . TRP A 1 47 ? 0.124   10.843  -2.150  1.00 0.00 ? 47 TRP A NE1  9  
ATOM 7702  C CE2  . TRP A 1 47 ? -1.142  10.937  -1.583  1.00 0.00 ? 47 TRP A CE2  9  
ATOM 7703  C CE3  . TRP A 1 47 ? -3.033  9.459   -1.202  1.00 0.00 ? 47 TRP A CE3  9  
ATOM 7704  C CZ2  . TRP A 1 47 ? -1.773  12.041  -0.996  1.00 0.00 ? 47 TRP A CZ2  9  
ATOM 7705  C CZ3  . TRP A 1 47 ? -3.650  10.572  -0.618  1.00 0.00 ? 47 TRP A CZ3  9  
ATOM 7706  C CH2  . TRP A 1 47 ? -3.067  11.829  -0.505  1.00 0.00 ? 47 TRP A CH2  9  
ATOM 7707  H H    . TRP A 1 47 ? 0.539   7.263   -4.628  1.00 0.00 ? 47 TRP A H    9  
ATOM 7708  H HA   . TRP A 1 47 ? 0.959   6.969   -2.040  1.00 0.00 ? 47 TRP A HA   9  
ATOM 7709  H HB2  . TRP A 1 47 ? -1.540  7.254   -3.631  1.00 0.00 ? 47 TRP A HB2  9  
ATOM 7710  H HB3  . TRP A 1 47 ? -1.707  6.901   -1.923  1.00 0.00 ? 47 TRP A HB3  9  
ATOM 7711  H HD1  . TRP A 1 47 ? 1.181   9.170   -3.083  1.00 0.00 ? 47 TRP A HD1  9  
ATOM 7712  H HE1  . TRP A 1 47 ? 0.856   11.647  -2.231  1.00 0.00 ? 47 TRP A HE1  9  
ATOM 7713  H HE3  . TRP A 1 47 ? -3.522  8.488   -1.273  1.00 0.00 ? 47 TRP A HE3  9  
ATOM 7714  H HZ2  . TRP A 1 47 ? -1.283  13.012  -0.926  1.00 0.00 ? 47 TRP A HZ2  9  
ATOM 7715  H HZ3  . TRP A 1 47 ? -4.658  10.444  -0.225  1.00 0.00 ? 47 TRP A HZ3  9  
ATOM 7716  H HH2  . TRP A 1 47 ? -3.615  12.647  -0.036  1.00 0.00 ? 47 TRP A HH2  9  
ATOM 7717  N N    . CYS A 1 48 ? -0.663  4.307   -3.166  1.00 0.00 ? 48 CYS A N    9  
ATOM 7718  C CA   . CYS A 1 48 ? -0.947  2.907   -2.905  1.00 0.00 ? 48 CYS A CA   9  
ATOM 7719  C C    . CYS A 1 48 ? 0.141   2.063   -3.571  1.00 0.00 ? 48 CYS A C    9  
ATOM 7720  O O    . CYS A 1 48 ? 0.218   1.999   -4.797  1.00 0.00 ? 48 CYS A O    9  
ATOM 7721  C CB   . CYS A 1 48 ? -2.347  2.515   -3.383  1.00 0.00 ? 48 CYS A CB   9  
ATOM 7722  S SG   . CYS A 1 48 ? -3.033  1.011   -2.597  1.00 0.00 ? 48 CYS A SG   9  
ATOM 7723  H H    . CYS A 1 48 ? -1.025  4.658   -4.030  1.00 0.00 ? 48 CYS A H    9  
ATOM 7724  H HA   . CYS A 1 48 ? -0.927  2.780   -1.822  1.00 0.00 ? 48 CYS A HA   9  
ATOM 7725  H HB2  . CYS A 1 48 ? -3.026  3.347   -3.197  1.00 0.00 ? 48 CYS A HB2  9  
ATOM 7726  H HB3  . CYS A 1 48 ? -2.317  2.362   -4.462  1.00 0.00 ? 48 CYS A HB3  9  
ATOM 7727  N N    . PHE A 1 49 ? 0.955   1.436   -2.735  1.00 0.00 ? 49 PHE A N    9  
ATOM 7728  C CA   . PHE A 1 49 ? 2.036   0.599   -3.228  1.00 0.00 ? 49 PHE A CA   9  
ATOM 7729  C C    . PHE A 1 49 ? 2.050   -0.754  -2.515  1.00 0.00 ? 49 PHE A C    9  
ATOM 7730  O O    . PHE A 1 49 ? 1.458   -0.904  -1.447  1.00 0.00 ? 49 PHE A O    9  
ATOM 7731  C CB   . PHE A 1 49 ? 3.343   1.334   -2.928  1.00 0.00 ? 49 PHE A CB   9  
ATOM 7732  C CG   . PHE A 1 49 ? 3.428   1.899   -1.508  1.00 0.00 ? 49 PHE A CG   9  
ATOM 7733  C CD1  . PHE A 1 49 ? 3.562   1.058   -0.448  1.00 0.00 ? 49 PHE A CD1  9  
ATOM 7734  C CD2  . PHE A 1 49 ? 3.369   3.243   -1.307  1.00 0.00 ? 49 PHE A CD2  9  
ATOM 7735  C CE1  . PHE A 1 49 ? 3.640   1.582   0.869   1.00 0.00 ? 49 PHE A CE1  9  
ATOM 7736  C CE2  . PHE A 1 49 ? 3.448   3.768   0.010   1.00 0.00 ? 49 PHE A CE2  9  
ATOM 7737  C CZ   . PHE A 1 49 ? 3.582   2.926   1.070   1.00 0.00 ? 49 PHE A CZ   9  
ATOM 7738  H H    . PHE A 1 49 ? 0.886   1.493   -1.739  1.00 0.00 ? 49 PHE A H    9  
ATOM 7739  H HA   . PHE A 1 49 ? 1.865   0.445   -4.294  1.00 0.00 ? 49 PHE A HA   9  
ATOM 7740  H HB2  . PHE A 1 49 ? 4.177   0.650   -3.086  1.00 0.00 ? 49 PHE A HB2  9  
ATOM 7741  H HB3  . PHE A 1 49 ? 3.462   2.150   -3.640  1.00 0.00 ? 49 PHE A HB3  9  
ATOM 7742  H HD1  . PHE A 1 49 ? 3.609   -0.019  -0.610  1.00 0.00 ? 49 PHE A HD1  9  
ATOM 7743  H HD2  . PHE A 1 49 ? 3.262   3.917   -2.157  1.00 0.00 ? 49 PHE A HD2  9  
ATOM 7744  H HE1  . PHE A 1 49 ? 3.748   0.908   1.719   1.00 0.00 ? 49 PHE A HE1  9  
ATOM 7745  H HE2  . PHE A 1 49 ? 3.401   4.844   0.172   1.00 0.00 ? 49 PHE A HE2  9  
ATOM 7746  H HZ   . PHE A 1 49 ? 3.642   3.329   2.082   1.00 0.00 ? 49 PHE A HZ   9  
ATOM 7747  N N    . LYS A 1 50 ? 2.732   -1.707  -3.135  1.00 0.00 ? 50 LYS A N    9  
ATOM 7748  C CA   . LYS A 1 50 ? 2.830   -3.043  -2.573  1.00 0.00 ? 50 LYS A CA   9  
ATOM 7749  C C    . LYS A 1 50 ? 3.592   -2.979  -1.247  1.00 0.00 ? 50 LYS A C    9  
ATOM 7750  O O    . LYS A 1 50 ? 4.270   -1.993  -0.964  1.00 0.00 ? 50 LYS A O    9  
ATOM 7751  C CB   . LYS A 1 50 ? 3.445   -4.007  -3.589  1.00 0.00 ? 50 LYS A CB   9  
ATOM 7752  C CG   . LYS A 1 50 ? 2.481   -4.271  -4.748  1.00 0.00 ? 50 LYS A CG   9  
ATOM 7753  C CD   . LYS A 1 50 ? 2.442   -5.759  -5.101  1.00 0.00 ? 50 LYS A CD   9  
ATOM 7754  C CE   . LYS A 1 50 ? 2.605   -5.969  -6.608  1.00 0.00 ? 50 LYS A CE   9  
ATOM 7755  N NZ   . LYS A 1 50 ? 1.632   -6.970  -7.100  1.00 0.00 ? 50 LYS A NZ   9  
ATOM 7756  H H    . LYS A 1 50 ? 3.210   -1.577  -4.003  1.00 0.00 ? 50 LYS A H    9  
ATOM 7757  H HA   . LYS A 1 50 ? 1.816   -3.389  -2.373  1.00 0.00 ? 50 LYS A HA   9  
ATOM 7758  H HB2  . LYS A 1 50 ? 4.376   -3.592  -3.974  1.00 0.00 ? 50 LYS A HB2  9  
ATOM 7759  H HB3  . LYS A 1 50 ? 3.695   -4.948  -3.098  1.00 0.00 ? 50 LYS A HB3  9  
ATOM 7760  H HG2  . LYS A 1 50 ? 1.480   -3.932  -4.477  1.00 0.00 ? 50 LYS A HG2  9  
ATOM 7761  H HG3  . LYS A 1 50 ? 2.788   -3.694  -5.620  1.00 0.00 ? 50 LYS A HG3  9  
ATOM 7762  H HD2  . LYS A 1 50 ? 3.237   -6.283  -4.570  1.00 0.00 ? 50 LYS A HD2  9  
ATOM 7763  H HD3  . LYS A 1 50 ? 1.498   -6.192  -4.770  1.00 0.00 ? 50 LYS A HD3  9  
ATOM 7764  H HE2  . LYS A 1 50 ? 2.459   -5.023  -7.131  1.00 0.00 ? 50 LYS A HE2  9  
ATOM 7765  H HE3  . LYS A 1 50 ? 3.619   -6.301  -6.828  1.00 0.00 ? 50 LYS A HE3  9  
ATOM 7766  H HZ1  . LYS A 1 50 ? 0.727   -6.768  -6.724  1.00 0.00 ? 50 LYS A HZ1  9  
ATOM 7767  H HZ2  . LYS A 1 50 ? 1.593   -6.934  -8.099  1.00 0.00 ? 50 LYS A HZ2  9  
ATOM 7768  H HZ3  . LYS A 1 50 ? 1.917   -7.883  -6.810  1.00 0.00 ? 50 LYS A HZ3  9  
ATOM 7769  N N    . PRO A 1 51 ? 3.450   -4.072  -0.450  1.00 0.00 ? 51 PRO A N    9  
ATOM 7770  C CA   . PRO A 1 51 ? 4.116   -4.149  0.839   1.00 0.00 ? 51 PRO A CA   9  
ATOM 7771  C C    . PRO A 1 51 ? 5.611   -4.425  0.668   1.00 0.00 ? 51 PRO A C    9  
ATOM 7772  O O    . PRO A 1 51 ? 5.998   -5.477  0.160   1.00 0.00 ? 51 PRO A O    9  
ATOM 7773  C CB   . PRO A 1 51 ? 3.391   -5.253  1.591   1.00 0.00 ? 51 PRO A CB   9  
ATOM 7774  C CG   . PRO A 1 51 ? 2.657   -6.063  0.536   1.00 0.00 ? 51 PRO A CG   9  
ATOM 7775  C CD   . PRO A 1 51 ? 2.655   -5.258  -0.753  1.00 0.00 ? 51 PRO A CD   9  
ATOM 7776  H HA   . PRO A 1 51 ? 4.053   -3.272  1.316   1.00 0.00 ? 51 PRO A HA   9  
ATOM 7777  H HB2  . PRO A 1 51 ? 4.094   -5.876  2.144   1.00 0.00 ? 51 PRO A HB2  9  
ATOM 7778  H HB3  . PRO A 1 51 ? 2.694   -4.836  2.319   1.00 0.00 ? 51 PRO A HB3  9  
ATOM 7779  H HG2  . PRO A 1 51 ? 3.146   -7.025  0.384   1.00 0.00 ? 51 PRO A HG2  9  
ATOM 7780  H HG3  . PRO A 1 51 ? 1.636   -6.273  0.857   1.00 0.00 ? 51 PRO A HG3  9  
ATOM 7781  H HD2  . PRO A 1 51 ? 3.089   -5.826  -1.576  1.00 0.00 ? 51 PRO A HD2  9  
ATOM 7782  H HD3  . PRO A 1 51 ? 1.641   -4.989  -1.051  1.00 0.00 ? 51 PRO A HD3  9  
ATOM 7783  N N    . LEU A 1 52 ? 6.412   -3.462  1.100   1.00 0.00 ? 52 LEU A N    9  
ATOM 7784  C CA   . LEU A 1 52 ? 7.856   -3.589  1.001   1.00 0.00 ? 52 LEU A CA   9  
ATOM 7785  C C    . LEU A 1 52 ? 8.248   -5.057  1.174   1.00 0.00 ? 52 LEU A C    9  
ATOM 7786  O O    . LEU A 1 52 ? 7.774   -5.726  2.091   1.00 0.00 ? 52 LEU A O    9  
ATOM 7787  C CB   . LEU A 1 52 ? 8.546   -2.647  1.991   1.00 0.00 ? 52 LEU A CB   9  
ATOM 7788  C CG   . LEU A 1 52 ? 10.065  -2.785  2.100   1.00 0.00 ? 52 LEU A CG   9  
ATOM 7789  C CD1  . LEU A 1 52 ? 10.654  -1.681  2.980   1.00 0.00 ? 52 LEU A CD1  9  
ATOM 7790  C CD2  . LEU A 1 52 ? 10.456  -4.180  2.593   1.00 0.00 ? 52 LEU A CD2  9  
ATOM 7791  H H    . LEU A 1 52 ? 6.090   -2.610  1.512   1.00 0.00 ? 52 LEU A H    9  
ATOM 7792  H HA   . LEU A 1 52 ? 8.144   -3.270  -0.001  1.00 0.00 ? 52 LEU A HA   9  
ATOM 7793  H HB2  . LEU A 1 52 ? 8.313   -1.621  1.707   1.00 0.00 ? 52 LEU A HB2  9  
ATOM 7794  H HB3  . LEU A 1 52 ? 8.114   -2.811  2.978   1.00 0.00 ? 52 LEU A HB3  9  
ATOM 7795  H HG   . LEU A 1 52 ? 10.492  -2.664  1.104   1.00 0.00 ? 52 LEU A HG   9  
ATOM 7796  H HD11 . LEU A 1 52 ? 9.848   -1.062  3.375   1.00 0.00 ? 52 LEU A HD11 9  
ATOM 7797  H HD12 . LEU A 1 52 ? 11.206  -2.130  3.806   1.00 0.00 ? 52 LEU A HD12 9  
ATOM 7798  H HD13 . LEU A 1 52 ? 11.328  -1.063  2.386   1.00 0.00 ? 52 LEU A HD13 9  
ATOM 7799  H HD21 . LEU A 1 52 ? 9.602   -4.642  3.088   1.00 0.00 ? 52 LEU A HD21 9  
ATOM 7800  H HD22 . LEU A 1 52 ? 10.759  -4.793  1.744   1.00 0.00 ? 52 LEU A HD22 9  
ATOM 7801  H HD23 . LEU A 1 52 ? 11.284  -4.098  3.297   1.00 0.00 ? 52 LEU A HD23 9  
ATOM 7802  N N    . GLN A 1 53 ? 9.111   -5.516  0.279   1.00 0.00 ? 53 GLN A N    9  
ATOM 7803  C CA   . GLN A 1 53 ? 9.573   -6.893  0.322   1.00 0.00 ? 53 GLN A CA   9  
ATOM 7804  C C    . GLN A 1 53 ? 10.369  -7.147  1.603   1.00 0.00 ? 53 GLN A C    9  
ATOM 7805  O O    . GLN A 1 53 ? 11.596  -7.231  1.570   1.00 0.00 ? 53 GLN A O    9  
ATOM 7806  C CB   . GLN A 1 53 ? 10.405  -7.231  -0.917  1.00 0.00 ? 53 GLN A CB   9  
ATOM 7807  C CG   . GLN A 1 53 ? 11.561  -6.242  -1.087  1.00 0.00 ? 53 GLN A CG   9  
ATOM 7808  C CD   . GLN A 1 53 ? 11.260  -5.232  -2.196  1.00 0.00 ? 53 GLN A CD   9  
ATOM 7809  O OE1  . GLN A 1 53 ? 11.154  -5.568  -3.364  1.00 0.00 ? 53 GLN A OE1  9  
ATOM 7810  N NE2  . GLN A 1 53 ? 11.130  -3.980  -1.767  1.00 0.00 ? 53 GLN A NE2  9  
ATOM 7811  H H    . GLN A 1 53 ? 9.493   -4.965  -0.463  1.00 0.00 ? 53 GLN A H    9  
ATOM 7812  H HA   . GLN A 1 53 ? 8.668   -7.501  0.321   1.00 0.00 ? 53 GLN A HA   9  
ATOM 7813  H HB2  . GLN A 1 53 ? 10.798  -8.244  -0.830  1.00 0.00 ? 53 GLN A HB2  9  
ATOM 7814  H HB3  . GLN A 1 53 ? 9.771   -7.209  -1.803  1.00 0.00 ? 53 GLN A HB3  9  
ATOM 7815  H HG2  . GLN A 1 53 ? 11.735  -5.716  -0.148  1.00 0.00 ? 53 GLN A HG2  9  
ATOM 7816  H HG3  . GLN A 1 53 ? 12.476  -6.785  -1.323  1.00 0.00 ? 53 GLN A HG3  9  
ATOM 7817  H HE21 . GLN A 1 53 ? 11.229  -3.772  -0.794  1.00 0.00 ? 53 GLN A HE21 9  
ATOM 7818  H HE22 . GLN A 1 53 ? 10.932  -3.247  -2.417  1.00 0.00 ? 53 GLN A HE22 9  
ATOM 7819  N N    . GLU A 1 54 ? 9.638   -7.262  2.703   1.00 0.00 ? 54 GLU A N    9  
ATOM 7820  C CA   . GLU A 1 54 ? 10.261  -7.505  3.993   1.00 0.00 ? 54 GLU A CA   9  
ATOM 7821  C C    . GLU A 1 54 ? 11.194  -8.715  3.913   1.00 0.00 ? 54 GLU A C    9  
ATOM 7822  O O    . GLU A 1 54 ? 10.743  -9.857  3.993   1.00 0.00 ? 54 GLU A O    9  
ATOM 7823  C CB   . GLU A 1 54 ? 9.206   -7.697  5.084   1.00 0.00 ? 54 GLU A CB   9  
ATOM 7824  C CG   . GLU A 1 54 ? 8.447   -9.011  4.887   1.00 0.00 ? 54 GLU A CG   9  
ATOM 7825  C CD   . GLU A 1 54 ? 8.900   -10.063 5.900   1.00 0.00 ? 54 GLU A CD   9  
ATOM 7826  O OE1  . GLU A 1 54 ? 8.827   -9.755  7.109   1.00 0.00 ? 54 GLU A OE1  9  
ATOM 7827  O OE2  . GLU A 1 54 ? 9.310   -11.152 5.443   1.00 0.00 ? 54 GLU A OE2  9  
ATOM 7828  H H    . GLU A 1 54 ? 8.641   -7.192  2.721   1.00 0.00 ? 54 GLU A H    9  
ATOM 7829  H HA   . GLU A 1 54 ? 10.839  -6.606  4.209   1.00 0.00 ? 54 GLU A HA   9  
ATOM 7830  H HB2  . GLU A 1 54 ? 9.685   -7.693  6.063   1.00 0.00 ? 54 GLU A HB2  9  
ATOM 7831  H HB3  . GLU A 1 54 ? 8.505   -6.862  5.068   1.00 0.00 ? 54 GLU A HB3  9  
ATOM 7832  H HG2  . GLU A 1 54 ? 7.376   -8.836  4.993   1.00 0.00 ? 54 GLU A HG2  9  
ATOM 7833  H HG3  . GLU A 1 54 ? 8.610   -9.381  3.875   1.00 0.00 ? 54 GLU A HG3  9  
ATOM 7834  N N    . ALA A 1 55 ? 12.477  -8.424  3.757   1.00 0.00 ? 55 ALA A N    9  
ATOM 7835  C CA   . ALA A 1 55 ? 13.477  -9.474  3.665   1.00 0.00 ? 55 ALA A CA   9  
ATOM 7836  C C    . ALA A 1 55 ? 14.802  -8.961  4.232   1.00 0.00 ? 55 ALA A C    9  
ATOM 7837  O O    . ALA A 1 55 ? 15.242  -9.407  5.291   1.00 0.00 ? 55 ALA A O    9  
ATOM 7838  C CB   . ALA A 1 55 ? 13.604  -9.933  2.211   1.00 0.00 ? 55 ALA A CB   9  
ATOM 7839  H H    . ALA A 1 55 ? 12.835  -7.492  3.693   1.00 0.00 ? 55 ALA A H    9  
ATOM 7840  H HA   . ALA A 1 55 ? 13.133  -10.313 4.269   1.00 0.00 ? 55 ALA A HA   9  
ATOM 7841  H HB1  . ALA A 1 55 ? 12.801  -10.634 1.980   1.00 0.00 ? 55 ALA A HB1  9  
ATOM 7842  H HB2  . ALA A 1 55 ? 14.567  -10.423 2.067   1.00 0.00 ? 55 ALA A HB2  9  
ATOM 7843  H HB3  . ALA A 1 55 ? 13.533  -9.069  1.550   1.00 0.00 ? 55 ALA A HB3  9  
ATOM 7844  N N    . GLU A 1 56 ? 15.401  -8.031  3.502   1.00 0.00 ? 56 GLU A N    9  
ATOM 7845  C CA   . GLU A 1 56 ? 16.667  -7.453  3.919   1.00 0.00 ? 56 GLU A CA   9  
ATOM 7846  C C    . GLU A 1 56 ? 16.651  -5.937  3.715   1.00 0.00 ? 56 GLU A C    9  
ATOM 7847  O O    . GLU A 1 56 ? 15.619  -5.364  3.369   1.00 0.00 ? 56 GLU A O    9  
ATOM 7848  C CB   . GLU A 1 56 ? 17.837  -8.095  3.170   1.00 0.00 ? 56 GLU A CB   9  
ATOM 7849  C CG   . GLU A 1 56 ? 18.339  -9.342  3.902   1.00 0.00 ? 56 GLU A CG   9  
ATOM 7850  C CD   . GLU A 1 56 ? 19.753  -9.126  4.445   1.00 0.00 ? 56 GLU A CD   9  
ATOM 7851  O OE1  . GLU A 1 56 ? 20.599  -8.659  3.653   1.00 0.00 ? 56 GLU A OE1  9  
ATOM 7852  O OE2  . GLU A 1 56 ? 19.955  -9.434  5.640   1.00 0.00 ? 56 GLU A OE2  9  
ATOM 7853  H H    . GLU A 1 56 ? 15.036  -7.674  2.642   1.00 0.00 ? 56 GLU A H    9  
ATOM 7854  H HA   . GLU A 1 56 ? 16.754  -7.682  4.982   1.00 0.00 ? 56 GLU A HA   9  
ATOM 7855  H HB2  . GLU A 1 56 ? 17.523  -8.363  2.161   1.00 0.00 ? 56 GLU A HB2  9  
ATOM 7856  H HB3  . GLU A 1 56 ? 18.649  -7.375  3.071   1.00 0.00 ? 56 GLU A HB3  9  
ATOM 7857  H HG2  . GLU A 1 56 ? 17.663  -9.582  4.723   1.00 0.00 ? 56 GLU A HG2  9  
ATOM 7858  H HG3  . GLU A 1 56 ? 18.332  -10.194 3.223   1.00 0.00 ? 56 GLU A HG3  9  
ATOM 7859  N N    . CYS A 1 57 ? 17.808  -5.330  3.937   1.00 0.00 ? 57 CYS A N    9  
ATOM 7860  C CA   . CYS A 1 57 ? 17.940  -3.891  3.782   1.00 0.00 ? 57 CYS A CA   9  
ATOM 7861  C C    . CYS A 1 57 ? 17.516  -3.521  2.359   1.00 0.00 ? 57 CYS A C    9  
ATOM 7862  O O    . CYS A 1 57 ? 17.722  -4.294  1.425   1.00 0.00 ? 57 CYS A O    9  
ATOM 7863  C CB   . CYS A 1 57 ? 19.360  -3.416  4.096   1.00 0.00 ? 57 CYS A CB   9  
ATOM 7864  S SG   . CYS A 1 57 ? 19.722  -3.205  5.877   1.00 0.00 ? 57 CYS A SG   9  
ATOM 7865  H H    . CYS A 1 57 ? 18.643  -5.803  4.219   1.00 0.00 ? 57 CYS A H    9  
ATOM 7866  H HA   . CYS A 1 57 ? 17.275  -3.435  4.515   1.00 0.00 ? 57 CYS A HA   9  
ATOM 7867  H HB2  . CYS A 1 57 ? 20.068  -4.132  3.678   1.00 0.00 ? 57 CYS A HB2  9  
ATOM 7868  H HB3  . CYS A 1 57 ? 19.531  -2.466  3.590   1.00 0.00 ? 57 CYS A HB3  9  
ATOM 7869  N N    . THR A 1 58 ? 16.931  -2.338  2.239   1.00 0.00 ? 58 THR A N    9  
ATOM 7870  C CA   . THR A 1 58 ? 16.476  -1.856  0.946   1.00 0.00 ? 58 THR A CA   9  
ATOM 7871  C C    . THR A 1 58 ? 17.632  -1.845  -0.056  1.00 0.00 ? 58 THR A C    9  
ATOM 7872  O O    . THR A 1 58 ? 17.558  -2.488  -1.102  1.00 0.00 ? 58 THR A O    9  
ATOM 7873  C CB   . THR A 1 58 ? 15.837  -0.481  1.152   1.00 0.00 ? 58 THR A CB   9  
ATOM 7874  O OG1  . THR A 1 58 ? 16.853  0.280   1.799   1.00 0.00 ? 58 THR A OG1  9  
ATOM 7875  C CG2  . THR A 1 58 ? 14.693  -0.513  2.167   1.00 0.00 ? 58 THR A CG2  9  
ATOM 7876  H H    . THR A 1 58 ? 16.767  -1.715  3.004   1.00 0.00 ? 58 THR A H    9  
ATOM 7877  H HA   . THR A 1 58 ? 15.728  -2.551  0.564   1.00 0.00 ? 58 THR A HA   9  
ATOM 7878  H HB   . THR A 1 58 ? 15.505  -0.060  0.203   1.00 0.00 ? 58 THR A HB   9  
ATOM 7879  H HG1  . THR A 1 58 ? 17.333  0.848   1.131   1.00 0.00 ? 58 THR A HG1  9  
ATOM 7880  H HG21 . THR A 1 58 ? 14.350  -1.540  2.295   1.00 0.00 ? 58 THR A HG21 9  
ATOM 7881  H HG22 . THR A 1 58 ? 15.044  -0.125  3.123   1.00 0.00 ? 58 THR A HG22 9  
ATOM 7882  H HG23 . THR A 1 58 ? 13.869  0.103   1.805   1.00 0.00 ? 58 THR A HG23 9  
ATOM 7883  N N    . PHE A 1 59 ? 18.674  -1.108  0.299   1.00 0.00 ? 59 PHE A N    9  
ATOM 7884  C CA   . PHE A 1 59 ? 19.844  -1.004  -0.556  1.00 0.00 ? 59 PHE A CA   9  
ATOM 7885  C C    . PHE A 1 59 ? 20.476  -2.378  -0.789  1.00 0.00 ? 59 PHE A C    9  
ATOM 7886  O O    . PHE A 1 59 ? 20.603  -3.173  0.141   1.00 0.00 ? 59 PHE A O    9  
ATOM 7887  C CB   . PHE A 1 59 ? 20.851  -0.110  0.170   1.00 0.00 ? 59 PHE A CB   9  
ATOM 7888  C CG   . PHE A 1 59 ? 22.216  -0.026  -0.515  1.00 0.00 ? 59 PHE A CG   9  
ATOM 7889  C CD1  . PHE A 1 59 ? 22.335  0.593   -1.721  1.00 0.00 ? 59 PHE A CD1  9  
ATOM 7890  C CD2  . PHE A 1 59 ? 23.311  -0.570  0.080   1.00 0.00 ? 59 PHE A CD2  9  
ATOM 7891  C CE1  . PHE A 1 59 ? 23.601  0.671   -2.357  1.00 0.00 ? 59 PHE A CE1  9  
ATOM 7892  C CE2  . PHE A 1 59 ? 24.578  -0.492  -0.557  1.00 0.00 ? 59 PHE A CE2  9  
ATOM 7893  C CZ   . PHE A 1 59 ? 24.697  0.127   -1.762  1.00 0.00 ? 59 PHE A CZ   9  
ATOM 7894  H H    . PHE A 1 59 ? 18.726  -0.588  1.152   1.00 0.00 ? 59 PHE A H    9  
ATOM 7895  H HA   . PHE A 1 59 ? 19.513  -0.592  -1.509  1.00 0.00 ? 59 PHE A HA   9  
ATOM 7896  H HB2  . PHE A 1 59 ? 20.436  0.894   0.255   1.00 0.00 ? 59 PHE A HB2  9  
ATOM 7897  H HB3  . PHE A 1 59 ? 20.988  -0.485  1.185   1.00 0.00 ? 59 PHE A HB3  9  
ATOM 7898  H HD1  . PHE A 1 59 ? 21.457  1.029   -2.198  1.00 0.00 ? 59 PHE A HD1  9  
ATOM 7899  H HD2  . PHE A 1 59 ? 23.217  -1.066  1.046   1.00 0.00 ? 59 PHE A HD2  9  
ATOM 7900  H HE1  . PHE A 1 59 ? 23.696  1.167   -3.323  1.00 0.00 ? 59 PHE A HE1  9  
ATOM 7901  H HE2  . PHE A 1 59 ? 25.456  -0.927  -0.079  1.00 0.00 ? 59 PHE A HE2  9  
ATOM 7902  H HZ   . PHE A 1 59 ? 25.669  0.187   -2.251  1.00 0.00 ? 59 PHE A HZ   9  
ATOM 7903  N N    . GLU A 1 1  ? 10.762  -12.266 17.995  1.00 0.00 ? 1  GLU A N    10 
ATOM 7904  C CA   . GLU A 1 1  ? 10.317  -12.441 16.623  1.00 0.00 ? 1  GLU A CA   10 
ATOM 7905  C C    . GLU A 1 1  ? 9.542   -11.208 16.155  1.00 0.00 ? 1  GLU A C    10 
ATOM 7906  O O    . GLU A 1 1  ? 9.319   -10.279 16.930  1.00 0.00 ? 1  GLU A O    10 
ATOM 7907  C CB   . GLU A 1 1  ? 9.471   -13.708 16.478  1.00 0.00 ? 1  GLU A CB   10 
ATOM 7908  C CG   . GLU A 1 1  ? 10.347  -14.961 16.521  1.00 0.00 ? 1  GLU A CG   10 
ATOM 7909  C CD   . GLU A 1 1  ? 9.520   -16.197 16.881  1.00 0.00 ? 1  GLU A CD   10 
ATOM 7910  O OE1  . GLU A 1 1  ? 8.558   -16.473 16.132  1.00 0.00 ? 1  GLU A OE1  10 
ATOM 7911  O OE2  . GLU A 1 1  ? 9.868   -16.838 17.896  1.00 0.00 ? 1  GLU A OE2  10 
ATOM 7912  H H    . GLU A 1 1  ? 10.747  -13.096 18.553  1.00 0.00 ? 1  GLU A H    10 
ATOM 7913  H HA   . GLU A 1 1  ? 11.228  -12.552 16.034  1.00 0.00 ? 1  GLU A HA   10 
ATOM 7914  H HB2  . GLU A 1 1  ? 8.732   -13.749 17.278  1.00 0.00 ? 1  GLU A HB2  10 
ATOM 7915  H HB3  . GLU A 1 1  ? 8.921   -13.677 15.537  1.00 0.00 ? 1  GLU A HB3  10 
ATOM 7916  H HG2  . GLU A 1 1  ? 10.826  -15.108 15.553  1.00 0.00 ? 1  GLU A HG2  10 
ATOM 7917  H HG3  . GLU A 1 1  ? 11.144  -14.827 17.253  1.00 0.00 ? 1  GLU A HG3  10 
ATOM 7918  N N    . GLU A 1 2  ? 9.154   -11.238 14.888  1.00 0.00 ? 2  GLU A N    10 
ATOM 7919  C CA   . GLU A 1 2  ? 8.409   -10.134 14.308  1.00 0.00 ? 2  GLU A CA   10 
ATOM 7920  C C    . GLU A 1 2  ? 6.906   -10.415 14.373  1.00 0.00 ? 2  GLU A C    10 
ATOM 7921  O O    . GLU A 1 2  ? 6.487   -11.452 14.883  1.00 0.00 ? 2  GLU A O    10 
ATOM 7922  C CB   . GLU A 1 2  ? 8.855   -9.868  12.869  1.00 0.00 ? 2  GLU A CB   10 
ATOM 7923  C CG   . GLU A 1 2  ? 9.998   -8.852  12.828  1.00 0.00 ? 2  GLU A CG   10 
ATOM 7924  C CD   . GLU A 1 2  ? 10.912  -9.103  11.626  1.00 0.00 ? 2  GLU A CD   10 
ATOM 7925  O OE1  . GLU A 1 2  ? 11.282  -10.281 11.431  1.00 0.00 ? 2  GLU A OE1  10 
ATOM 7926  O OE2  . GLU A 1 2  ? 11.219  -8.111  10.930  1.00 0.00 ? 2  GLU A OE2  10 
ATOM 7927  H H    . GLU A 1 2  ? 9.339   -11.997 14.264  1.00 0.00 ? 2  GLU A H    10 
ATOM 7928  H HA   . GLU A 1 2  ? 8.650   -9.266  14.922  1.00 0.00 ? 2  GLU A HA   10 
ATOM 7929  H HB2  . GLU A 1 2  ? 9.176   -10.801 12.405  1.00 0.00 ? 2  GLU A HB2  10 
ATOM 7930  H HB3  . GLU A 1 2  ? 8.012   -9.496  12.286  1.00 0.00 ? 2  GLU A HB3  10 
ATOM 7931  H HG2  . GLU A 1 2  ? 9.590   -7.842  12.774  1.00 0.00 ? 2  GLU A HG2  10 
ATOM 7932  H HG3  . GLU A 1 2  ? 10.577  -8.913  13.749  1.00 0.00 ? 2  GLU A HG3  10 
ATOM 7933  N N    . TYR A 1 3  ? 6.137   -9.471  13.849  1.00 0.00 ? 3  TYR A N    10 
ATOM 7934  C CA   . TYR A 1 3  ? 4.690   -9.604  13.842  1.00 0.00 ? 3  TYR A CA   10 
ATOM 7935  C C    . TYR A 1 3  ? 4.174   -9.903  12.433  1.00 0.00 ? 3  TYR A C    10 
ATOM 7936  O O    . TYR A 1 3  ? 3.352   -10.799 12.245  1.00 0.00 ? 3  TYR A O    10 
ATOM 7937  C CB   . TYR A 1 3  ? 4.140   -8.252  14.298  1.00 0.00 ? 3  TYR A CB   10 
ATOM 7938  C CG   . TYR A 1 3  ? 2.679   -8.295  14.752  1.00 0.00 ? 3  TYR A CG   10 
ATOM 7939  C CD1  . TYR A 1 3  ? 1.664   -8.175  13.824  1.00 0.00 ? 3  TYR A CD1  10 
ATOM 7940  C CD2  . TYR A 1 3  ? 2.377   -8.454  16.089  1.00 0.00 ? 3  TYR A CD2  10 
ATOM 7941  C CE1  . TYR A 1 3  ? 0.290   -8.216  14.252  1.00 0.00 ? 3  TYR A CE1  10 
ATOM 7942  C CE2  . TYR A 1 3  ? 1.003   -8.494  16.516  1.00 0.00 ? 3  TYR A CE2  10 
ATOM 7943  C CZ   . TYR A 1 3  ? 0.027   -8.373  15.577  1.00 0.00 ? 3  TYR A CZ   10 
ATOM 7944  O OH   . TYR A 1 3  ? -1.271  -8.412  15.981  1.00 0.00 ? 3  TYR A OH   10 
ATOM 7945  H H    . TYR A 1 3  ? 6.486   -8.630  13.436  1.00 0.00 ? 3  TYR A H    10 
ATOM 7946  H HA   . TYR A 1 3  ? 4.425   -10.431 14.501  1.00 0.00 ? 3  TYR A HA   10 
ATOM 7947  H HB2  . TYR A 1 3  ? 4.754   -7.879  15.118  1.00 0.00 ? 3  TYR A HB2  10 
ATOM 7948  H HB3  . TYR A 1 3  ? 4.234   -7.538  13.479  1.00 0.00 ? 3  TYR A HB3  10 
ATOM 7949  H HD1  . TYR A 1 3  ? 1.903   -8.049  12.768  1.00 0.00 ? 3  TYR A HD1  10 
ATOM 7950  H HD2  . TYR A 1 3  ? 3.179   -8.548  16.821  1.00 0.00 ? 3  TYR A HD2  10 
ATOM 7951  H HE1  . TYR A 1 3  ? -0.521  -8.122  13.530  1.00 0.00 ? 3  TYR A HE1  10 
ATOM 7952  H HE2  . TYR A 1 3  ? 0.750   -8.619  17.569  1.00 0.00 ? 3  TYR A HE2  10 
ATOM 7953  H HH   . TYR A 1 3  ? -1.794  -9.030  15.394  1.00 0.00 ? 3  TYR A HH   10 
ATOM 7954  N N    . VAL A 1 4  ? 4.678   -9.135  11.478  1.00 0.00 ? 4  VAL A N    10 
ATOM 7955  C CA   . VAL A 1 4  ? 4.278   -9.306  10.091  1.00 0.00 ? 4  VAL A CA   10 
ATOM 7956  C C    . VAL A 1 4  ? 2.862   -8.760  9.902   1.00 0.00 ? 4  VAL A C    10 
ATOM 7957  O O    . VAL A 1 4  ? 1.956   -9.495  9.514   1.00 0.00 ? 4  VAL A O    10 
ATOM 7958  C CB   . VAL A 1 4  ? 4.412   -10.775 9.685   1.00 0.00 ? 4  VAL A CB   10 
ATOM 7959  C CG1  . VAL A 1 4  ? 4.287   -10.938 8.169   1.00 0.00 ? 4  VAL A CG1  10 
ATOM 7960  C CG2  . VAL A 1 4  ? 5.728   -11.367 10.194  1.00 0.00 ? 4  VAL A CG2  10 
ATOM 7961  H H    . VAL A 1 4  ? 5.346   -8.408  11.639  1.00 0.00 ? 4  VAL A H    10 
ATOM 7962  H HA   . VAL A 1 4  ? 4.964   -8.722  9.477   1.00 0.00 ? 4  VAL A HA   10 
ATOM 7963  H HB   . VAL A 1 4  ? 3.595   -11.327 10.150  1.00 0.00 ? 4  VAL A HB   10 
ATOM 7964  H HG11 . VAL A 1 4  ? 4.041   -9.977  7.719   1.00 0.00 ? 4  VAL A HG11 10 
ATOM 7965  H HG12 . VAL A 1 4  ? 5.232   -11.299 7.763   1.00 0.00 ? 4  VAL A HG12 10 
ATOM 7966  H HG13 . VAL A 1 4  ? 3.498   -11.656 7.945   1.00 0.00 ? 4  VAL A HG13 10 
ATOM 7967  H HG21 . VAL A 1 4  ? 5.858   -11.112 11.246  1.00 0.00 ? 4  VAL A HG21 10 
ATOM 7968  H HG22 . VAL A 1 4  ? 5.706   -12.451 10.082  1.00 0.00 ? 4  VAL A HG22 10 
ATOM 7969  H HG23 . VAL A 1 4  ? 6.557   -10.959 9.616   1.00 0.00 ? 4  VAL A HG23 10 
ATOM 7970  N N    . GLY A 1 5  ? 2.715   -7.474  10.186  1.00 0.00 ? 5  GLY A N    10 
ATOM 7971  C CA   . GLY A 1 5  ? 1.424   -6.821  10.052  1.00 0.00 ? 5  GLY A CA   10 
ATOM 7972  C C    . GLY A 1 5  ? 1.350   -5.568  10.928  1.00 0.00 ? 5  GLY A C    10 
ATOM 7973  O O    . GLY A 1 5  ? 0.560   -4.664  10.659  1.00 0.00 ? 5  GLY A O    10 
ATOM 7974  H H    . GLY A 1 5  ? 3.457   -6.883  10.502  1.00 0.00 ? 5  GLY A H    10 
ATOM 7975  H HA2  . GLY A 1 5  ? 1.255   -6.551  9.010   1.00 0.00 ? 5  GLY A HA2  10 
ATOM 7976  H HA3  . GLY A 1 5  ? 0.631   -7.513  10.335  1.00 0.00 ? 5  GLY A HA3  10 
ATOM 7977  N N    . LEU A 1 6  ? 2.183   -5.555  11.958  1.00 0.00 ? 6  LEU A N    10 
ATOM 7978  C CA   . LEU A 1 6  ? 2.222   -4.428  12.874  1.00 0.00 ? 6  LEU A CA   10 
ATOM 7979  C C    . LEU A 1 6  ? 2.942   -3.256  12.204  1.00 0.00 ? 6  LEU A C    10 
ATOM 7980  O O    . LEU A 1 6  ? 3.843   -3.459  11.392  1.00 0.00 ? 6  LEU A O    10 
ATOM 7981  C CB   . LEU A 1 6  ? 2.838   -4.845  14.211  1.00 0.00 ? 6  LEU A CB   10 
ATOM 7982  C CG   . LEU A 1 6  ? 4.274   -4.379  14.462  1.00 0.00 ? 6  LEU A CG   10 
ATOM 7983  C CD1  . LEU A 1 6  ? 4.295   -2.986  15.094  1.00 0.00 ? 6  LEU A CD1  10 
ATOM 7984  C CD2  . LEU A 1 6  ? 5.043   -5.401  15.302  1.00 0.00 ? 6  LEU A CD2  10 
ATOM 7985  H H    . LEU A 1 6  ? 2.822   -6.294  12.170  1.00 0.00 ? 6  LEU A H    10 
ATOM 7986  H HA   . LEU A 1 6  ? 1.192   -4.132  13.073  1.00 0.00 ? 6  LEU A HA   10 
ATOM 7987  H HB2  . LEU A 1 6  ? 2.207   -4.464  15.014  1.00 0.00 ? 6  LEU A HB2  10 
ATOM 7988  H HB3  . LEU A 1 6  ? 2.814   -5.933  14.276  1.00 0.00 ? 6  LEU A HB3  10 
ATOM 7989  H HG   . LEU A 1 6  ? 4.782   -4.305  13.501  1.00 0.00 ? 6  LEU A HG   10 
ATOM 7990  H HD11 . LEU A 1 6  ? 3.657   -2.978  15.978  1.00 0.00 ? 6  LEU A HD11 10 
ATOM 7991  H HD12 . LEU A 1 6  ? 5.316   -2.732  15.380  1.00 0.00 ? 6  LEU A HD12 10 
ATOM 7992  H HD13 . LEU A 1 6  ? 3.927   -2.255  14.374  1.00 0.00 ? 6  LEU A HD13 10 
ATOM 7993  H HD21 . LEU A 1 6  ? 4.337   -6.024  15.852  1.00 0.00 ? 6  LEU A HD21 10 
ATOM 7994  H HD22 . LEU A 1 6  ? 5.648   -6.028  14.647  1.00 0.00 ? 6  LEU A HD22 10 
ATOM 7995  H HD23 . LEU A 1 6  ? 5.691   -4.879  16.006  1.00 0.00 ? 6  LEU A HD23 10 
ATOM 7996  N N    . SER A 1 7  ? 2.518   -2.055  12.571  1.00 0.00 ? 7  SER A N    10 
ATOM 7997  C CA   . SER A 1 7  ? 3.112   -0.851  12.016  1.00 0.00 ? 7  SER A CA   10 
ATOM 7998  C C    . SER A 1 7  ? 3.060   -0.898  10.487  1.00 0.00 ? 7  SER A C    10 
ATOM 7999  O O    . SER A 1 7  ? 2.480   -1.817  9.911   1.00 0.00 ? 7  SER A O    10 
ATOM 8000  C CB   . SER A 1 7  ? 4.555   -0.677  12.492  1.00 0.00 ? 7  SER A CB   10 
ATOM 8001  O OG   . SER A 1 7  ? 5.239   -1.924  12.588  1.00 0.00 ? 7  SER A OG   10 
ATOM 8002  H H    . SER A 1 7  ? 1.785   -1.899  13.233  1.00 0.00 ? 7  SER A H    10 
ATOM 8003  H HA   . SER A 1 7  ? 2.503   -0.029  12.393  1.00 0.00 ? 7  SER A HA   10 
ATOM 8004  H HB2  . SER A 1 7  ? 5.088   -0.023  11.803  1.00 0.00 ? 7  SER A HB2  10 
ATOM 8005  H HB3  . SER A 1 7  ? 4.559   -0.186  13.465  1.00 0.00 ? 7  SER A HB3  10 
ATOM 8006  H HG   . SER A 1 7  ? 5.833   -2.049  11.794  1.00 0.00 ? 7  SER A HG   10 
ATOM 8007  N N    . ALA A 1 8  ? 3.673   0.104   9.874   1.00 0.00 ? 8  ALA A N    10 
ATOM 8008  C CA   . ALA A 1 8  ? 3.704   0.187   8.424   1.00 0.00 ? 8  ALA A CA   10 
ATOM 8009  C C    . ALA A 1 8  ? 4.963   -0.511  7.904   1.00 0.00 ? 8  ALA A C    10 
ATOM 8010  O O    . ALA A 1 8  ? 5.460   -0.181  6.829   1.00 0.00 ? 8  ALA A O    10 
ATOM 8011  C CB   . ALA A 1 8  ? 3.632   1.654   7.996   1.00 0.00 ? 8  ALA A CB   10 
ATOM 8012  H H    . ALA A 1 8  ? 4.142   0.847   10.351  1.00 0.00 ? 8  ALA A H    10 
ATOM 8013  H HA   . ALA A 1 8  ? 2.826   -0.333  8.043   1.00 0.00 ? 8  ALA A HA   10 
ATOM 8014  H HB1  . ALA A 1 8  ? 4.376   1.844   7.221   1.00 0.00 ? 8  ALA A HB1  10 
ATOM 8015  H HB2  . ALA A 1 8  ? 3.832   2.294   8.855   1.00 0.00 ? 8  ALA A HB2  10 
ATOM 8016  H HB3  . ALA A 1 8  ? 2.638   1.870   7.605   1.00 0.00 ? 8  ALA A HB3  10 
ATOM 8017  N N    . ASN A 1 9  ? 5.441   -1.463  8.692   1.00 0.00 ? 9  ASN A N    10 
ATOM 8018  C CA   . ASN A 1 9  ? 6.631   -2.211  8.324   1.00 0.00 ? 9  ASN A CA   10 
ATOM 8019  C C    . ASN A 1 9  ? 6.526   -2.642  6.860   1.00 0.00 ? 9  ASN A C    10 
ATOM 8020  O O    . ASN A 1 9  ? 7.494   -2.541  6.108   1.00 0.00 ? 9  ASN A O    10 
ATOM 8021  C CB   . ASN A 1 9  ? 6.776   -3.471  9.179   1.00 0.00 ? 9  ASN A CB   10 
ATOM 8022  C CG   . ASN A 1 9  ? 8.249   -3.823  9.392   1.00 0.00 ? 9  ASN A CG   10 
ATOM 8023  O OD1  . ASN A 1 9  ? 8.791   -4.733  8.786   1.00 0.00 ? 9  ASN A OD1  10 
ATOM 8024  N ND2  . ASN A 1 9  ? 8.865   -3.054  10.285  1.00 0.00 ? 9  ASN A ND2  10 
ATOM 8025  H H    . ASN A 1 9  ? 5.029   -1.726  9.565   1.00 0.00 ? 9  ASN A H    10 
ATOM 8026  H HA   . ASN A 1 9  ? 7.463   -1.529  8.499   1.00 0.00 ? 9  ASN A HA   10 
ATOM 8027  H HB2  . ASN A 1 9  ? 6.291   -3.319  10.143  1.00 0.00 ? 9  ASN A HB2  10 
ATOM 8028  H HB3  . ASN A 1 9  ? 6.266   -4.304  8.694   1.00 0.00 ? 9  ASN A HB3  10 
ATOM 8029  H HD21 . ASN A 1 9  ? 8.362   -2.323  10.748  1.00 0.00 ? 9  ASN A HD21 10 
ATOM 8030  H HD22 . ASN A 1 9  ? 9.831   -3.205  10.494  1.00 0.00 ? 9  ASN A HD22 10 
ATOM 8031  N N    . GLN A 1 10 ? 5.341   -3.113  6.499   1.00 0.00 ? 10 GLN A N    10 
ATOM 8032  C CA   . GLN A 1 10 ? 5.097   -3.560  5.138   1.00 0.00 ? 10 GLN A CA   10 
ATOM 8033  C C    . GLN A 1 10 ? 4.942   -2.358  4.204   1.00 0.00 ? 10 GLN A C    10 
ATOM 8034  O O    . GLN A 1 10 ? 5.269   -2.440  3.021   1.00 0.00 ? 10 GLN A O    10 
ATOM 8035  C CB   . GLN A 1 10 ? 3.867   -4.467  5.072   1.00 0.00 ? 10 GLN A CB   10 
ATOM 8036  C CG   . GLN A 1 10 ? 3.623   -5.160  6.414   1.00 0.00 ? 10 GLN A CG   10 
ATOM 8037  C CD   . GLN A 1 10 ? 2.566   -4.416  7.232   1.00 0.00 ? 10 GLN A CD   10 
ATOM 8038  O OE1  . GLN A 1 10 ? 1.620   -3.852  6.706   1.00 0.00 ? 10 GLN A OE1  10 
ATOM 8039  N NE2  . GLN A 1 10 ? 2.779   -4.444  8.544   1.00 0.00 ? 10 GLN A NE2  10 
ATOM 8040  H H    . GLN A 1 10 ? 4.559   -3.192  7.117   1.00 0.00 ? 10 GLN A H    10 
ATOM 8041  H HA   . GLN A 1 10 ? 5.980   -4.134  4.859   1.00 0.00 ? 10 GLN A HA   10 
ATOM 8042  H HB2  . GLN A 1 10 ? 2.991   -3.879  4.798   1.00 0.00 ? 10 GLN A HB2  10 
ATOM 8043  H HB3  . GLN A 1 10 ? 4.004   -5.216  4.291   1.00 0.00 ? 10 GLN A HB3  10 
ATOM 8044  H HG2  . GLN A 1 10 ? 3.300   -6.187  6.243   1.00 0.00 ? 10 GLN A HG2  10 
ATOM 8045  H HG3  . GLN A 1 10 ? 4.556   -5.209  6.976   1.00 0.00 ? 10 GLN A HG3  10 
ATOM 8046  H HE21 . GLN A 1 10 ? 3.575   -4.925  8.912   1.00 0.00 ? 10 GLN A HE21 10 
ATOM 8047  H HE22 . GLN A 1 10 ? 2.142   -3.985  9.164   1.00 0.00 ? 10 GLN A HE22 10 
ATOM 8048  N N    . CYS A 1 11 ? 4.444   -1.269  4.771   1.00 0.00 ? 11 CYS A N    10 
ATOM 8049  C CA   . CYS A 1 11 ? 4.242   -0.051  4.004   1.00 0.00 ? 11 CYS A CA   10 
ATOM 8050  C C    . CYS A 1 11 ? 5.243   0.997   4.494   1.00 0.00 ? 11 CYS A C    10 
ATOM 8051  O O    . CYS A 1 11 ? 4.888   2.159   4.685   1.00 0.00 ? 11 CYS A O    10 
ATOM 8052  C CB   . CYS A 1 11 ? 2.799   0.448   4.105   1.00 0.00 ? 11 CYS A CB   10 
ATOM 8053  S SG   . CYS A 1 11 ? 1.561   -0.851  4.465   1.00 0.00 ? 11 CYS A SG   10 
ATOM 8054  H H    . CYS A 1 11 ? 4.180   -1.210  5.734   1.00 0.00 ? 11 CYS A H    10 
ATOM 8055  H HA   . CYS A 1 11 ? 4.426   -0.305  2.960   1.00 0.00 ? 11 CYS A HA   10 
ATOM 8056  H HB2  . CYS A 1 11 ? 2.745   1.208   4.884   1.00 0.00 ? 11 CYS A HB2  10 
ATOM 8057  H HB3  . CYS A 1 11 ? 2.531   0.934   3.166   1.00 0.00 ? 11 CYS A HB3  10 
ATOM 8058  N N    . ALA A 1 12 ? 6.476   0.548   4.683   1.00 0.00 ? 12 ALA A N    10 
ATOM 8059  C CA   . ALA A 1 12 ? 7.531   1.432   5.147   1.00 0.00 ? 12 ALA A CA   10 
ATOM 8060  C C    . ALA A 1 12 ? 8.583   1.585   4.046   1.00 0.00 ? 12 ALA A C    10 
ATOM 8061  O O    . ALA A 1 12 ? 9.768   1.354   4.279   1.00 0.00 ? 12 ALA A O    10 
ATOM 8062  C CB   . ALA A 1 12 ? 8.123   0.884   6.447   1.00 0.00 ? 12 ALA A CB   10 
ATOM 8063  H H    . ALA A 1 12 ? 6.756   -0.399  4.525   1.00 0.00 ? 12 ALA A H    10 
ATOM 8064  H HA   . ALA A 1 12 ? 7.084   2.406   5.348   1.00 0.00 ? 12 ALA A HA   10 
ATOM 8065  H HB1  . ALA A 1 12 ? 9.095   1.343   6.626   1.00 0.00 ? 12 ALA A HB1  10 
ATOM 8066  H HB2  . ALA A 1 12 ? 7.454   1.113   7.276   1.00 0.00 ? 12 ALA A HB2  10 
ATOM 8067  H HB3  . ALA A 1 12 ? 8.242   -0.197  6.364   1.00 0.00 ? 12 ALA A HB3  10 
ATOM 8068  N N    . VAL A 1 13 ? 8.111   1.973   2.870   1.00 0.00 ? 13 VAL A N    10 
ATOM 8069  C CA   . VAL A 1 13 ? 8.996   2.159   1.733   1.00 0.00 ? 13 VAL A CA   10 
ATOM 8070  C C    . VAL A 1 13 ? 9.386   3.635   1.632   1.00 0.00 ? 13 VAL A C    10 
ATOM 8071  O O    . VAL A 1 13 ? 8.614   4.513   2.017   1.00 0.00 ? 13 VAL A O    10 
ATOM 8072  C CB   . VAL A 1 13 ? 8.332   1.628   0.461   1.00 0.00 ? 13 VAL A CB   10 
ATOM 8073  C CG1  . VAL A 1 13 ? 9.347   0.904   -0.426  1.00 0.00 ? 13 VAL A CG1  10 
ATOM 8074  C CG2  . VAL A 1 13 ? 7.150   0.717   0.799   1.00 0.00 ? 13 VAL A CG2  10 
ATOM 8075  H H    . VAL A 1 13 ? 7.145   2.159   2.689   1.00 0.00 ? 13 VAL A H    10 
ATOM 8076  H HA   . VAL A 1 13 ? 9.894   1.570   1.916   1.00 0.00 ? 13 VAL A HA   10 
ATOM 8077  H HB   . VAL A 1 13 ? 7.947   2.482   -0.098  1.00 0.00 ? 13 VAL A HB   10 
ATOM 8078  H HG11 . VAL A 1 13 ? 10.227  0.647   0.164   1.00 0.00 ? 13 VAL A HG11 10 
ATOM 8079  H HG12 . VAL A 1 13 ? 8.898   -0.006  -0.824  1.00 0.00 ? 13 VAL A HG12 10 
ATOM 8080  H HG13 . VAL A 1 13 ? 9.640   1.556   -1.249  1.00 0.00 ? 13 VAL A HG13 10 
ATOM 8081  H HG21 . VAL A 1 13 ? 7.406   0.093   1.655   1.00 0.00 ? 13 VAL A HG21 10 
ATOM 8082  H HG22 . VAL A 1 13 ? 6.279   1.326   1.040   1.00 0.00 ? 13 VAL A HG22 10 
ATOM 8083  H HG23 . VAL A 1 13 ? 6.924   0.083   -0.058  1.00 0.00 ? 13 VAL A HG23 10 
ATOM 8084  N N    . PRO A 1 14 ? 10.615  3.870   1.099   1.00 0.00 ? 14 PRO A N    10 
ATOM 8085  C CA   . PRO A 1 14 ? 11.117  5.224   0.943   1.00 0.00 ? 14 PRO A CA   10 
ATOM 8086  C C    . PRO A 1 14 ? 10.435  5.930   -0.231  1.00 0.00 ? 14 PRO A C    10 
ATOM 8087  O O    . PRO A 1 14 ? 10.768  7.069   -0.554  1.00 0.00 ? 14 PRO A O    10 
ATOM 8088  C CB   . PRO A 1 14 ? 12.617  5.069   0.753   1.00 0.00 ? 14 PRO A CB   10 
ATOM 8089  C CG   . PRO A 1 14 ? 12.837  3.621   0.345   1.00 0.00 ? 14 PRO A CG   10 
ATOM 8090  C CD   . PRO A 1 14 ? 11.556  2.856   0.633   1.00 0.00 ? 14 PRO A CD   10 
ATOM 8091  H HA   . PRO A 1 14 ? 10.900  5.770   1.753   1.00 0.00 ? 14 PRO A HA   10 
ATOM 8092  H HB2  . PRO A 1 14 ? 12.986  5.751   -0.013  1.00 0.00 ? 14 PRO A HB2  10 
ATOM 8093  H HB3  . PRO A 1 14 ? 13.153  5.302   1.672   1.00 0.00 ? 14 PRO A HB3  10 
ATOM 8094  H HG2  . PRO A 1 14 ? 13.091  3.557   -0.713  1.00 0.00 ? 14 PRO A HG2  10 
ATOM 8095  H HG3  . PRO A 1 14 ? 13.671  3.191   0.899   1.00 0.00 ? 14 PRO A HG3  10 
ATOM 8096  H HD2  . PRO A 1 14 ? 11.185  2.353   -0.260  1.00 0.00 ? 14 PRO A HD2  10 
ATOM 8097  H HD3  . PRO A 1 14 ? 11.715  2.086   1.389   1.00 0.00 ? 14 PRO A HD3  10 
ATOM 8098  N N    . ALA A 1 15 ? 9.492   5.223   -0.838  1.00 0.00 ? 15 ALA A N    10 
ATOM 8099  C CA   . ALA A 1 15 ? 8.761   5.768   -1.969  1.00 0.00 ? 15 ALA A CA   10 
ATOM 8100  C C    . ALA A 1 15 ? 9.543   5.495   -3.255  1.00 0.00 ? 15 ALA A C    10 
ATOM 8101  O O    . ALA A 1 15 ? 8.974   5.509   -4.346  1.00 0.00 ? 15 ALA A O    10 
ATOM 8102  C CB   . ALA A 1 15 ? 8.510   7.260   -1.745  1.00 0.00 ? 15 ALA A CB   10 
ATOM 8103  H H    . ALA A 1 15 ? 9.227   4.297   -0.569  1.00 0.00 ? 15 ALA A H    10 
ATOM 8104  H HA   . ALA A 1 15 ? 7.800   5.254   -2.021  1.00 0.00 ? 15 ALA A HA   10 
ATOM 8105  H HB1  . ALA A 1 15 ? 8.667   7.501   -0.693  1.00 0.00 ? 15 ALA A HB1  10 
ATOM 8106  H HB2  . ALA A 1 15 ? 7.484   7.502   -2.023  1.00 0.00 ? 15 ALA A HB2  10 
ATOM 8107  H HB3  . ALA A 1 15 ? 9.199   7.841   -2.358  1.00 0.00 ? 15 ALA A HB3  10 
ATOM 8108  N N    . LYS A 1 16 ? 10.834  5.253   -3.085  1.00 0.00 ? 16 LYS A N    10 
ATOM 8109  C CA   . LYS A 1 16 ? 11.700  4.978   -4.219  1.00 0.00 ? 16 LYS A CA   10 
ATOM 8110  C C    . LYS A 1 16 ? 11.748  3.468   -4.463  1.00 0.00 ? 16 LYS A C    10 
ATOM 8111  O O    . LYS A 1 16 ? 12.498  2.997   -5.317  1.00 0.00 ? 16 LYS A O    10 
ATOM 8112  C CB   . LYS A 1 16 ? 13.077  5.611   -4.008  1.00 0.00 ? 16 LYS A CB   10 
ATOM 8113  C CG   . LYS A 1 16 ? 13.767  5.024   -2.775  1.00 0.00 ? 16 LYS A CG   10 
ATOM 8114  C CD   . LYS A 1 16 ? 14.091  3.543   -2.980  1.00 0.00 ? 16 LYS A CD   10 
ATOM 8115  C CE   . LYS A 1 16 ? 15.344  3.143   -2.200  1.00 0.00 ? 16 LYS A CE   10 
ATOM 8116  N NZ   . LYS A 1 16 ? 15.202  1.773   -1.658  1.00 0.00 ? 16 LYS A NZ   10 
ATOM 8117  H H    . LYS A 1 16 ? 11.289  5.244   -2.194  1.00 0.00 ? 16 LYS A H    10 
ATOM 8118  H HA   . LYS A 1 16 ? 11.256  5.455   -5.092  1.00 0.00 ? 16 LYS A HA   10 
ATOM 8119  H HB2  . LYS A 1 16 ? 13.696  5.445   -4.889  1.00 0.00 ? 16 LYS A HB2  10 
ATOM 8120  H HB3  . LYS A 1 16 ? 12.971  6.689   -3.892  1.00 0.00 ? 16 LYS A HB3  10 
ATOM 8121  H HG2  . LYS A 1 16 ? 14.684  5.576   -2.571  1.00 0.00 ? 16 LYS A HG2  10 
ATOM 8122  H HG3  . LYS A 1 16 ? 13.123  5.142   -1.903  1.00 0.00 ? 16 LYS A HG3  10 
ATOM 8123  H HD2  . LYS A 1 16 ? 13.247  2.934   -2.657  1.00 0.00 ? 16 LYS A HD2  10 
ATOM 8124  H HD3  . LYS A 1 16 ? 14.240  3.343   -4.041  1.00 0.00 ? 16 LYS A HD3  10 
ATOM 8125  H HE2  . LYS A 1 16 ? 16.217  3.194   -2.851  1.00 0.00 ? 16 LYS A HE2  10 
ATOM 8126  H HE3  . LYS A 1 16 ? 15.513  3.847   -1.385  1.00 0.00 ? 16 LYS A HE3  10 
ATOM 8127  H HZ1  . LYS A 1 16 ? 14.331  1.695   -1.173  1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 8128  H HZ2  . LYS A 1 16 ? 15.225  1.113   -2.410  1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 8129  H HZ3  . LYS A 1 16 ? 15.954  1.584   -1.026  1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 8130  N N    . ASP A 1 17 ? 10.937  2.751   -3.699  1.00 0.00 ? 17 ASP A N    10 
ATOM 8131  C CA   . ASP A 1 17 ? 10.878  1.304   -3.822  1.00 0.00 ? 17 ASP A CA   10 
ATOM 8132  C C    . ASP A 1 17 ? 9.416   0.865   -3.929  1.00 0.00 ? 17 ASP A C    10 
ATOM 8133  O O    . ASP A 1 17 ? 9.088   -0.287  -3.649  1.00 0.00 ? 17 ASP A O    10 
ATOM 8134  C CB   . ASP A 1 17 ? 11.488  0.622   -2.596  1.00 0.00 ? 17 ASP A CB   10 
ATOM 8135  C CG   . ASP A 1 17 ? 12.717  -0.243  -2.881  1.00 0.00 ? 17 ASP A CG   10 
ATOM 8136  O OD1  . ASP A 1 17 ? 12.687  -0.948  -3.913  1.00 0.00 ? 17 ASP A OD1  10 
ATOM 8137  O OD2  . ASP A 1 17 ? 13.658  -0.180  -2.061  1.00 0.00 ? 17 ASP A OD2  10 
ATOM 8138  H H    . ASP A 1 17 ? 10.330  3.141   -3.007  1.00 0.00 ? 17 ASP A H    10 
ATOM 8139  H HA   . ASP A 1 17 ? 11.451  1.069   -4.719  1.00 0.00 ? 17 ASP A HA   10 
ATOM 8140  H HB2  . ASP A 1 17 ? 11.762  1.389   -1.871  1.00 0.00 ? 17 ASP A HB2  10 
ATOM 8141  H HB3  . ASP A 1 17 ? 10.725  0.000   -2.128  1.00 0.00 ? 17 ASP A HB3  10 
ATOM 8142  N N    . ARG A 1 18 ? 8.577   1.807   -4.336  1.00 0.00 ? 18 ARG A N    10 
ATOM 8143  C CA   . ARG A 1 18 ? 7.158   1.532   -4.484  1.00 0.00 ? 18 ARG A CA   10 
ATOM 8144  C C    . ARG A 1 18 ? 6.907   0.708   -5.748  1.00 0.00 ? 18 ARG A C    10 
ATOM 8145  O O    . ARG A 1 18 ? 7.487   0.982   -6.798  1.00 0.00 ? 18 ARG A O    10 
ATOM 8146  C CB   . ARG A 1 18 ? 6.351   2.829   -4.559  1.00 0.00 ? 18 ARG A CB   10 
ATOM 8147  C CG   . ARG A 1 18 ? 6.839   3.840   -3.519  1.00 0.00 ? 18 ARG A CG   10 
ATOM 8148  C CD   . ARG A 1 18 ? 6.197   3.577   -2.155  1.00 0.00 ? 18 ARG A CD   10 
ATOM 8149  N NE   . ARG A 1 18 ? 5.793   4.857   -1.531  1.00 0.00 ? 18 ARG A NE   10 
ATOM 8150  C CZ   . ARG A 1 18 ? 5.703   5.052   -0.209  1.00 0.00 ? 18 ARG A CZ   10 
ATOM 8151  N NH1  . ARG A 1 18 ? 5.989   4.053   0.637   1.00 0.00 ? 18 ARG A NH1  10 
ATOM 8152  N NH2  . ARG A 1 18 ? 5.328   6.247   0.268   1.00 0.00 ? 18 ARG A NH2  10 
ATOM 8153  H H    . ARG A 1 18 ? 8.853   2.741   -4.562  1.00 0.00 ? 18 ARG A H    10 
ATOM 8154  H HA   . ARG A 1 18 ? 6.889   0.970   -3.590  1.00 0.00 ? 18 ARG A HA   10 
ATOM 8155  H HB2  . ARG A 1 18 ? 6.437   3.258   -5.557  1.00 0.00 ? 18 ARG A HB2  10 
ATOM 8156  H HB3  . ARG A 1 18 ? 5.295   2.614   -4.394  1.00 0.00 ? 18 ARG A HB3  10 
ATOM 8157  H HG2  . ARG A 1 18 ? 7.924   3.782   -3.432  1.00 0.00 ? 18 ARG A HG2  10 
ATOM 8158  H HG3  . ARG A 1 18 ? 6.600   4.851   -3.849  1.00 0.00 ? 18 ARG A HG3  10 
ATOM 8159  H HD2  . ARG A 1 18 ? 5.329   2.929   -2.272  1.00 0.00 ? 18 ARG A HD2  10 
ATOM 8160  H HD3  . ARG A 1 18 ? 6.901   3.054   -1.508  1.00 0.00 ? 18 ARG A HD3  10 
ATOM 8161  H HE   . ARG A 1 18 ? 5.573   5.624   -2.135  1.00 0.00 ? 18 ARG A HE   10 
ATOM 8162  H HH11 . ARG A 1 18 ? 6.268   3.161   0.281   1.00 0.00 ? 18 ARG A HH11 10 
ATOM 8163  H HH12 . ARG A 1 18 ? 5.921   4.199   1.624   1.00 0.00 ? 18 ARG A HH12 10 
ATOM 8164  H HH21 . ARG A 1 18 ? 5.115   6.993   -0.363  1.00 0.00 ? 18 ARG A HH21 10 
ATOM 8165  H HH22 . ARG A 1 18 ? 5.261   6.393   1.255   1.00 0.00 ? 18 ARG A HH22 10 
ATOM 8166  N N    . VAL A 1 19 ? 6.040   -0.284  -5.607  1.00 0.00 ? 19 VAL A N    10 
ATOM 8167  C CA   . VAL A 1 19 ? 5.704   -1.149  -6.725  1.00 0.00 ? 19 VAL A CA   10 
ATOM 8168  C C    . VAL A 1 19 ? 4.409   -0.657  -7.374  1.00 0.00 ? 19 VAL A C    10 
ATOM 8169  O O    . VAL A 1 19 ? 3.975   -1.198  -8.390  1.00 0.00 ? 19 VAL A O    10 
ATOM 8170  C CB   . VAL A 1 19 ? 5.623   -2.603  -6.256  1.00 0.00 ? 19 VAL A CB   10 
ATOM 8171  C CG1  . VAL A 1 19 ? 5.482   -3.556  -7.444  1.00 0.00 ? 19 VAL A CG1  10 
ATOM 8172  C CG2  . VAL A 1 19 ? 6.835   -2.971  -5.398  1.00 0.00 ? 19 VAL A CG2  10 
ATOM 8173  H H    . VAL A 1 19 ? 5.572   -0.500  -4.750  1.00 0.00 ? 19 VAL A H    10 
ATOM 8174  H HA   . VAL A 1 19 ? 6.512   -1.075  -7.453  1.00 0.00 ? 19 VAL A HA   10 
ATOM 8175  H HB   . VAL A 1 19 ? 4.731   -2.706  -5.637  1.00 0.00 ? 19 VAL A HB   10 
ATOM 8176  H HG11 . VAL A 1 19 ? 5.835   -3.062  -8.350  1.00 0.00 ? 19 VAL A HG11 10 
ATOM 8177  H HG12 . VAL A 1 19 ? 6.077   -4.452  -7.264  1.00 0.00 ? 19 VAL A HG12 10 
ATOM 8178  H HG13 . VAL A 1 19 ? 4.435   -3.833  -7.567  1.00 0.00 ? 19 VAL A HG13 10 
ATOM 8179  H HG21 . VAL A 1 19 ? 7.743   -2.605  -5.876  1.00 0.00 ? 19 VAL A HG21 10 
ATOM 8180  H HG22 . VAL A 1 19 ? 6.734   -2.516  -4.412  1.00 0.00 ? 19 VAL A HG22 10 
ATOM 8181  H HG23 . VAL A 1 19 ? 6.890   -4.055  -5.293  1.00 0.00 ? 19 VAL A HG23 10 
ATOM 8182  N N    . ASP A 1 20 ? 3.829   0.364   -6.761  1.00 0.00 ? 20 ASP A N    10 
ATOM 8183  C CA   . ASP A 1 20 ? 2.592   0.936   -7.267  1.00 0.00 ? 20 ASP A CA   10 
ATOM 8184  C C    . ASP A 1 20 ? 1.586   -0.187  -7.528  1.00 0.00 ? 20 ASP A C    10 
ATOM 8185  O O    . ASP A 1 20 ? 1.648   -0.853  -8.560  1.00 0.00 ? 20 ASP A O    10 
ATOM 8186  C CB   . ASP A 1 20 ? 2.826   1.677   -8.585  1.00 0.00 ? 20 ASP A CB   10 
ATOM 8187  C CG   . ASP A 1 20 ? 1.560   1.986   -9.386  1.00 0.00 ? 20 ASP A CG   10 
ATOM 8188  O OD1  . ASP A 1 20 ? 1.042   1.039   -10.017 1.00 0.00 ? 20 ASP A OD1  10 
ATOM 8189  O OD2  . ASP A 1 20 ? 1.139   3.162   -9.351  1.00 0.00 ? 20 ASP A OD2  10 
ATOM 8190  H H    . ASP A 1 20 ? 4.189   0.799   -5.936  1.00 0.00 ? 20 ASP A H    10 
ATOM 8191  H HA   . ASP A 1 20 ? 2.257   1.624   -6.492  1.00 0.00 ? 20 ASP A HA   10 
ATOM 8192  H HB2  . ASP A 1 20 ? 3.341   2.613   -8.371  1.00 0.00 ? 20 ASP A HB2  10 
ATOM 8193  H HB3  . ASP A 1 20 ? 3.495   1.080   -9.206  1.00 0.00 ? 20 ASP A HB3  10 
ATOM 8194  N N    . CYS A 1 21 ? 0.683   -0.362  -6.575  1.00 0.00 ? 21 CYS A N    10 
ATOM 8195  C CA   . CYS A 1 21 ? -0.335  -1.393  -6.689  1.00 0.00 ? 21 CYS A CA   10 
ATOM 8196  C C    . CYS A 1 21 ? -1.336  -0.963  -7.764  1.00 0.00 ? 21 CYS A C    10 
ATOM 8197  O O    . CYS A 1 21 ? -2.014  -1.801  -8.356  1.00 0.00 ? 21 CYS A O    10 
ATOM 8198  C CB   . CYS A 1 21 ? -1.020  -1.662  -5.347  1.00 0.00 ? 21 CYS A CB   10 
ATOM 8199  S SG   . CYS A 1 21 ? -1.380  -3.425  -5.010  1.00 0.00 ? 21 CYS A SG   10 
ATOM 8200  H H    . CYS A 1 21 ? 0.639   0.184   -5.738  1.00 0.00 ? 21 CYS A H    10 
ATOM 8201  H HA   . CYS A 1 21 ? 0.178   -2.309  -6.982  1.00 0.00 ? 21 CYS A HA   10 
ATOM 8202  H HB2  . CYS A 1 21 ? -0.387  -1.276  -4.548  1.00 0.00 ? 21 CYS A HB2  10 
ATOM 8203  H HB3  . CYS A 1 21 ? -1.954  -1.102  -5.313  1.00 0.00 ? 21 CYS A HB3  10 
ATOM 8204  N N    . GLY A 1 22 ? -1.396  0.343   -7.983  1.00 0.00 ? 22 GLY A N    10 
ATOM 8205  C CA   . GLY A 1 22 ? -2.302  0.894   -8.976  1.00 0.00 ? 22 GLY A CA   10 
ATOM 8206  C C    . GLY A 1 22 ? -3.760  0.717   -8.546  1.00 0.00 ? 22 GLY A C    10 
ATOM 8207  O O    . GLY A 1 22 ? -4.366  -0.321  -8.807  1.00 0.00 ? 22 GLY A O    10 
ATOM 8208  H H    . GLY A 1 22 ? -0.841  1.017   -7.496  1.00 0.00 ? 22 GLY A H    10 
ATOM 8209  H HA2  . GLY A 1 22 ? -2.088  1.953   -9.121  1.00 0.00 ? 22 GLY A HA2  10 
ATOM 8210  H HA3  . GLY A 1 22 ? -2.140  0.401   -9.935  1.00 0.00 ? 22 GLY A HA3  10 
ATOM 8211  N N    . TYR A 1 23 ? -4.281  1.746   -7.894  1.00 0.00 ? 23 TYR A N    10 
ATOM 8212  C CA   . TYR A 1 23 ? -5.656  1.717   -7.426  1.00 0.00 ? 23 TYR A CA   10 
ATOM 8213  C C    . TYR A 1 23 ? -6.342  3.065   -7.657  1.00 0.00 ? 23 TYR A C    10 
ATOM 8214  O O    . TYR A 1 23 ? -5.694  4.110   -7.618  1.00 0.00 ? 23 TYR A O    10 
ATOM 8215  C CB   . TYR A 1 23 ? -5.583  1.447   -5.921  1.00 0.00 ? 23 TYR A CB   10 
ATOM 8216  C CG   . TYR A 1 23 ? -5.630  -0.037  -5.553  1.00 0.00 ? 23 TYR A CG   10 
ATOM 8217  C CD1  . TYR A 1 23 ? -6.790  -0.760  -5.748  1.00 0.00 ? 23 TYR A CD1  10 
ATOM 8218  C CD2  . TYR A 1 23 ? -4.514  -0.653  -5.026  1.00 0.00 ? 23 TYR A CD2  10 
ATOM 8219  C CE1  . TYR A 1 23 ? -6.835  -2.157  -5.401  1.00 0.00 ? 23 TYR A CE1  10 
ATOM 8220  C CE2  . TYR A 1 23 ? -4.559  -2.050  -4.679  1.00 0.00 ? 23 TYR A CE2  10 
ATOM 8221  C CZ   . TYR A 1 23 ? -5.717  -2.733  -4.884  1.00 0.00 ? 23 TYR A CZ   10 
ATOM 8222  O OH   . TYR A 1 23 ? -5.759  -4.053  -4.557  1.00 0.00 ? 23 TYR A OH   10 
ATOM 8223  H H    . TYR A 1 23 ? -3.780  2.587   -7.685  1.00 0.00 ? 23 TYR A H    10 
ATOM 8224  H HA   . TYR A 1 23 ? -6.186  0.947   -7.986  1.00 0.00 ? 23 TYR A HA   10 
ATOM 8225  H HB2  . TYR A 1 23 ? -4.662  1.879   -5.529  1.00 0.00 ? 23 TYR A HB2  10 
ATOM 8226  H HB3  . TYR A 1 23 ? -6.410  1.959   -5.430  1.00 0.00 ? 23 TYR A HB3  10 
ATOM 8227  H HD1  . TYR A 1 23 ? -7.672  -0.273  -6.164  1.00 0.00 ? 23 TYR A HD1  10 
ATOM 8228  H HD2  . TYR A 1 23 ? -3.598  -0.083  -4.872  1.00 0.00 ? 23 TYR A HD2  10 
ATOM 8229  H HE1  . TYR A 1 23 ? -7.744  -2.739  -5.550  1.00 0.00 ? 23 TYR A HE1  10 
ATOM 8230  H HE2  . TYR A 1 23 ? -3.684  -2.550  -4.262  1.00 0.00 ? 23 TYR A HE2  10 
ATOM 8231  H HH   . TYR A 1 23 ? -4.832  -4.426  -4.520  1.00 0.00 ? 23 TYR A HH   10 
ATOM 8232  N N    . PRO A 1 24 ? -7.678  2.995   -7.899  1.00 0.00 ? 24 PRO A N    10 
ATOM 8233  C CA   . PRO A 1 24 ? -8.460  4.197   -8.136  1.00 0.00 ? 24 PRO A CA   10 
ATOM 8234  C C    . PRO A 1 24 ? -8.700  4.962   -6.833  1.00 0.00 ? 24 PRO A C    10 
ATOM 8235  O O    . PRO A 1 24 ? -8.046  5.969   -6.570  1.00 0.00 ? 24 PRO A O    10 
ATOM 8236  C CB   . PRO A 1 24 ? -9.745  3.709   -8.784  1.00 0.00 ? 24 PRO A CB   10 
ATOM 8237  C CG   . PRO A 1 24 ? -9.837  2.226   -8.464  1.00 0.00 ? 24 PRO A CG   10 
ATOM 8238  C CD   . PRO A 1 24 ? -8.478  1.775   -7.952  1.00 0.00 ? 24 PRO A CD   10 
ATOM 8239  H HA   . PRO A 1 24 ? -7.959  4.825   -8.732  1.00 0.00 ? 24 PRO A HA   10 
ATOM 8240  H HB2  . PRO A 1 24 ? -10.608 4.248   -8.394  1.00 0.00 ? 24 PRO A HB2  10 
ATOM 8241  H HB3  . PRO A 1 24 ? -9.727  3.876   -9.862  1.00 0.00 ? 24 PRO A HB3  10 
ATOM 8242  H HG2  . PRO A 1 24 ? -10.607 2.045   -7.714  1.00 0.00 ? 24 PRO A HG2  10 
ATOM 8243  H HG3  . PRO A 1 24 ? -10.117 1.660   -9.352  1.00 0.00 ? 24 PRO A HG3  10 
ATOM 8244  H HD2  . PRO A 1 24 ? -8.559  1.312   -6.969  1.00 0.00 ? 24 PRO A HD2  10 
ATOM 8245  H HD3  . PRO A 1 24 ? -8.030  1.037   -8.617  1.00 0.00 ? 24 PRO A HD3  10 
ATOM 8246  N N    . HIS A 1 25 ? -9.641  4.453   -6.051  1.00 0.00 ? 25 HIS A N    10 
ATOM 8247  C CA   . HIS A 1 25 ? -9.976  5.075   -4.781  1.00 0.00 ? 25 HIS A CA   10 
ATOM 8248  C C    . HIS A 1 25 ? -9.043  4.548   -3.689  1.00 0.00 ? 25 HIS A C    10 
ATOM 8249  O O    . HIS A 1 25 ? -9.403  3.636   -2.946  1.00 0.00 ? 25 HIS A O    10 
ATOM 8250  C CB   . HIS A 1 25 ? -11.455 4.867   -4.448  1.00 0.00 ? 25 HIS A CB   10 
ATOM 8251  C CG   . HIS A 1 25 ? -11.817 3.437   -4.126  1.00 0.00 ? 25 HIS A CG   10 
ATOM 8252  N ND1  . HIS A 1 25 ? -13.061 3.069   -3.643  1.00 0.00 ? 25 HIS A ND1  10 
ATOM 8253  C CD2  . HIS A 1 25 ? -11.087 2.289   -4.224  1.00 0.00 ? 25 HIS A CD2  10 
ATOM 8254  C CE1  . HIS A 1 25 ? -13.068 1.757   -3.461  1.00 0.00 ? 25 HIS A CE1  10 
ATOM 8255  N NE2  . HIS A 1 25 ? -11.843 1.275   -3.821  1.00 0.00 ? 25 HIS A NE2  10 
ATOM 8256  H H    . HIS A 1 25 ? -10.169 3.633   -6.272  1.00 0.00 ? 25 HIS A H    10 
ATOM 8257  H HA   . HIS A 1 25 ? -9.810  6.145   -4.904  1.00 0.00 ? 25 HIS A HA   10 
ATOM 8258  H HB2  . HIS A 1 25 ? -11.717 5.498   -3.598  1.00 0.00 ? 25 HIS A HB2  10 
ATOM 8259  H HB3  . HIS A 1 25 ? -12.058 5.203   -5.292  1.00 0.00 ? 25 HIS A HB3  10 
ATOM 8260  H HD1  . HIS A 1 25 ? -13.825 3.689   -3.462  1.00 0.00 ? 25 HIS A HD1  10 
ATOM 8261  H HD2  . HIS A 1 25 ? -10.057 2.217   -4.573  1.00 0.00 ? 25 HIS A HD2  10 
ATOM 8262  H HE1  . HIS A 1 25 ? -13.904 1.166   -3.089  1.00 0.00 ? 25 HIS A HE1  10 
ATOM 8263  H HE2  . HIS A 1 25 ? -11.581 0.311   -3.840  1.00 0.00 ? 25 HIS A HE2  10 
ATOM 8264  N N    . VAL A 1 26 ? -7.861  5.144   -3.627  1.00 0.00 ? 26 VAL A N    10 
ATOM 8265  C CA   . VAL A 1 26 ? -6.874  4.746   -2.638  1.00 0.00 ? 26 VAL A CA   10 
ATOM 8266  C C    . VAL A 1 26 ? -7.028  5.618   -1.390  1.00 0.00 ? 26 VAL A C    10 
ATOM 8267  O O    . VAL A 1 26 ? -7.191  6.832   -1.493  1.00 0.00 ? 26 VAL A O    10 
ATOM 8268  C CB   . VAL A 1 26 ? -5.470  4.813   -3.244  1.00 0.00 ? 26 VAL A CB   10 
ATOM 8269  C CG1  . VAL A 1 26 ? -5.291  3.751   -4.331  1.00 0.00 ? 26 VAL A CG1  10 
ATOM 8270  C CG2  . VAL A 1 26 ? -5.175  6.212   -3.790  1.00 0.00 ? 26 VAL A CG2  10 
ATOM 8271  H H    . VAL A 1 26 ? -7.576  5.885   -4.235  1.00 0.00 ? 26 VAL A H    10 
ATOM 8272  H HA   . VAL A 1 26 ? -7.076  3.709   -2.370  1.00 0.00 ? 26 VAL A HA   10 
ATOM 8273  H HB   . VAL A 1 26 ? -4.752  4.604   -2.451  1.00 0.00 ? 26 VAL A HB   10 
ATOM 8274  H HG11 . VAL A 1 26 ? -6.045  3.894   -5.106  1.00 0.00 ? 26 VAL A HG11 10 
ATOM 8275  H HG12 . VAL A 1 26 ? -4.298  3.844   -4.770  1.00 0.00 ? 26 VAL A HG12 10 
ATOM 8276  H HG13 . VAL A 1 26 ? -5.405  2.760   -3.893  1.00 0.00 ? 26 VAL A HG13 10 
ATOM 8277  H HG21 . VAL A 1 26 ? -5.525  6.960   -3.079  1.00 0.00 ? 26 VAL A HG21 10 
ATOM 8278  H HG22 . VAL A 1 26 ? -4.101  6.325   -3.938  1.00 0.00 ? 26 VAL A HG22 10 
ATOM 8279  H HG23 . VAL A 1 26 ? -5.689  6.346   -4.742  1.00 0.00 ? 26 VAL A HG23 10 
ATOM 8280  N N    . THR A 1 27 ? -6.971  4.963   -0.240  1.00 0.00 ? 27 THR A N    10 
ATOM 8281  C CA   . THR A 1 27 ? -7.102  5.663   1.027   1.00 0.00 ? 27 THR A CA   10 
ATOM 8282  C C    . THR A 1 27 ? -6.332  4.927   2.125   1.00 0.00 ? 27 THR A C    10 
ATOM 8283  O O    . THR A 1 27 ? -5.868  3.807   1.919   1.00 0.00 ? 27 THR A O    10 
ATOM 8284  C CB   . THR A 1 27 ? -8.594  5.816   1.330   1.00 0.00 ? 27 THR A CB   10 
ATOM 8285  O OG1  . THR A 1 27 ? -8.957  4.574   1.926   1.00 0.00 ? 27 THR A OG1  10 
ATOM 8286  C CG2  . THR A 1 27 ? -9.446  5.883   0.060   1.00 0.00 ? 27 THR A CG2  10 
ATOM 8287  H H    . THR A 1 27 ? -6.838  3.974   -0.165  1.00 0.00 ? 27 THR A H    10 
ATOM 8288  H HA   . THR A 1 27 ? -6.649  6.648   0.923   1.00 0.00 ? 27 THR A HA   10 
ATOM 8289  H HB   . THR A 1 27 ? -8.775  6.682   1.966   1.00 0.00 ? 27 THR A HB   10 
ATOM 8290  H HG1  . THR A 1 27 ? -9.934  4.569   2.139   1.00 0.00 ? 27 THR A HG1  10 
ATOM 8291  H HG21 . THR A 1 27 ? -9.210  5.033   -0.581  1.00 0.00 ? 27 THR A HG21 10 
ATOM 8292  H HG22 . THR A 1 27 ? -10.502 5.852   0.329   1.00 0.00 ? 27 THR A HG22 10 
ATOM 8293  H HG23 . THR A 1 27 ? -9.233  6.810   -0.472  1.00 0.00 ? 27 THR A HG23 10 
ATOM 8294  N N    . PRO A 1 28 ? -6.216  5.605   3.298   1.00 0.00 ? 28 PRO A N    10 
ATOM 8295  C CA   . PRO A 1 28 ? -5.510  5.028   4.429   1.00 0.00 ? 28 PRO A CA   10 
ATOM 8296  C C    . PRO A 1 28 ? -6.348  3.938   5.101   1.00 0.00 ? 28 PRO A C    10 
ATOM 8297  O O    . PRO A 1 28 ? -6.367  3.831   6.327   1.00 0.00 ? 28 PRO A O    10 
ATOM 8298  C CB   . PRO A 1 28 ? -5.214  6.201   5.349   1.00 0.00 ? 28 PRO A CB   10 
ATOM 8299  C CG   . PRO A 1 28 ? -6.165  7.310   4.929   1.00 0.00 ? 28 PRO A CG   10 
ATOM 8300  C CD   . PRO A 1 28 ? -6.753  6.933   3.579   1.00 0.00 ? 28 PRO A CD   10 
ATOM 8301  H HA   . PRO A 1 28 ? -4.672  4.577   4.122   1.00 0.00 ? 28 PRO A HA   10 
ATOM 8302  H HB2  . PRO A 1 28 ? -5.369  5.928   6.393   1.00 0.00 ? 28 PRO A HB2  10 
ATOM 8303  H HB3  . PRO A 1 28 ? -4.176  6.520   5.254   1.00 0.00 ? 28 PRO A HB3  10 
ATOM 8304  H HG2  . PRO A 1 28 ? -6.956  7.435   5.668   1.00 0.00 ? 28 PRO A HG2  10 
ATOM 8305  H HG3  . PRO A 1 28 ? -5.637  8.261   4.864   1.00 0.00 ? 28 PRO A HG3  10 
ATOM 8306  H HD2  . PRO A 1 28 ? -7.842  6.922   3.610   1.00 0.00 ? 28 PRO A HD2  10 
ATOM 8307  H HD3  . PRO A 1 28 ? -6.464  7.648   2.808   1.00 0.00 ? 28 PRO A HD3  10 
ATOM 8308  N N    . LYS A 1 29 ? -7.021  3.156   4.270   1.00 0.00 ? 29 LYS A N    10 
ATOM 8309  C CA   . LYS A 1 29 ? -7.859  2.079   4.768   1.00 0.00 ? 29 LYS A CA   10 
ATOM 8310  C C    . LYS A 1 29 ? -8.462  1.319   3.585   1.00 0.00 ? 29 LYS A C    10 
ATOM 8311  O O    . LYS A 1 29 ? -8.525  0.091   3.599   1.00 0.00 ? 29 LYS A O    10 
ATOM 8312  C CB   . LYS A 1 29 ? -8.902  2.621   5.747   1.00 0.00 ? 29 LYS A CB   10 
ATOM 8313  C CG   . LYS A 1 29 ? -9.294  1.556   6.774   1.00 0.00 ? 29 LYS A CG   10 
ATOM 8314  C CD   . LYS A 1 29 ? -10.537 0.787   6.320   1.00 0.00 ? 29 LYS A CD   10 
ATOM 8315  C CE   . LYS A 1 29 ? -10.534 -0.637  6.878   1.00 0.00 ? 29 LYS A CE   10 
ATOM 8316  N NZ   . LYS A 1 29 ? -11.466 -0.746  8.023   1.00 0.00 ? 29 LYS A NZ   10 
ATOM 8317  H H    . LYS A 1 29 ? -7.000  3.250   3.274   1.00 0.00 ? 29 LYS A H    10 
ATOM 8318  H HA   . LYS A 1 29 ? -7.217  1.397   5.326   1.00 0.00 ? 29 LYS A HA   10 
ATOM 8319  H HB2  . LYS A 1 29 ? -8.505  3.497   6.260   1.00 0.00 ? 29 LYS A HB2  10 
ATOM 8320  H HB3  . LYS A 1 29 ? -9.786  2.946   5.199   1.00 0.00 ? 29 LYS A HB3  10 
ATOM 8321  H HG2  . LYS A 1 29 ? -8.466  0.863   6.920   1.00 0.00 ? 29 LYS A HG2  10 
ATOM 8322  H HG3  . LYS A 1 29 ? -9.487  2.029   7.737   1.00 0.00 ? 29 LYS A HG3  10 
ATOM 8323  H HD2  . LYS A 1 29 ? -11.434 1.310   6.651   1.00 0.00 ? 29 LYS A HD2  10 
ATOM 8324  H HD3  . LYS A 1 29 ? -10.570 0.755   5.231   1.00 0.00 ? 29 LYS A HD3  10 
ATOM 8325  H HE2  . LYS A 1 29 ? -10.824 -1.340  6.098   1.00 0.00 ? 29 LYS A HE2  10 
ATOM 8326  H HE3  . LYS A 1 29 ? -9.527  -0.909  7.194   1.00 0.00 ? 29 LYS A HE3  10 
ATOM 8327  H HZ1  . LYS A 1 29 ? -12.321 -0.278  7.803   1.00 0.00 ? 29 LYS A HZ1  10 
ATOM 8328  H HZ2  . LYS A 1 29 ? -11.653 -1.710  8.210   1.00 0.00 ? 29 LYS A HZ2  10 
ATOM 8329  H HZ3  . LYS A 1 29 ? -11.053 -0.324  8.830   1.00 0.00 ? 29 LYS A HZ3  10 
ATOM 8330  N N    . GLU A 1 30 ? -8.890  2.081   2.589   1.00 0.00 ? 30 GLU A N    10 
ATOM 8331  C CA   . GLU A 1 30 ? -9.486  1.495   1.401   1.00 0.00 ? 30 GLU A CA   10 
ATOM 8332  C C    . GLU A 1 30 ? -8.401  0.892   0.505   1.00 0.00 ? 30 GLU A C    10 
ATOM 8333  O O    . GLU A 1 30 ? -8.589  -0.180  -0.067  1.00 0.00 ? 30 GLU A O    10 
ATOM 8334  C CB   . GLU A 1 30 ? -10.315 2.529   0.637   1.00 0.00 ? 30 GLU A CB   10 
ATOM 8335  C CG   . GLU A 1 30 ? -11.028 1.887   -0.555  1.00 0.00 ? 30 GLU A CG   10 
ATOM 8336  C CD   . GLU A 1 30 ? -12.516 1.682   -0.259  1.00 0.00 ? 30 GLU A CD   10 
ATOM 8337  O OE1  . GLU A 1 30 ? -13.169 2.689   0.089   1.00 0.00 ? 30 GLU A OE1  10 
ATOM 8338  O OE2  . GLU A 1 30 ? -12.966 0.523   -0.388  1.00 0.00 ? 30 GLU A OE2  10 
ATOM 8339  H H    . GLU A 1 30 ? -8.834  3.080   2.586   1.00 0.00 ? 30 GLU A H    10 
ATOM 8340  H HA   . GLU A 1 30 ? -10.144 0.707   1.766   1.00 0.00 ? 30 GLU A HA   10 
ATOM 8341  H HB2  . GLU A 1 30 ? -11.050 2.977   1.306   1.00 0.00 ? 30 GLU A HB2  10 
ATOM 8342  H HB3  . GLU A 1 30 ? -9.669  3.334   0.288   1.00 0.00 ? 30 GLU A HB3  10 
ATOM 8343  H HG2  . GLU A 1 30 ? -10.913 2.518   -1.436  1.00 0.00 ? 30 GLU A HG2  10 
ATOM 8344  H HG3  . GLU A 1 30 ? -10.565 0.928   -0.787  1.00 0.00 ? 30 GLU A HG3  10 
ATOM 8345  N N    . CYS A 1 31 ? -7.290  1.608   0.412   1.00 0.00 ? 31 CYS A N    10 
ATOM 8346  C CA   . CYS A 1 31 ? -6.175  1.157   -0.404  1.00 0.00 ? 31 CYS A CA   10 
ATOM 8347  C C    . CYS A 1 31 ? -5.513  -0.028  0.301   1.00 0.00 ? 31 CYS A C    10 
ATOM 8348  O O    . CYS A 1 31 ? -4.942  -0.902  -0.350  1.00 0.00 ? 31 CYS A O    10 
ATOM 8349  C CB   . CYS A 1 31 ? -5.181  2.287   -0.677  1.00 0.00 ? 31 CYS A CB   10 
ATOM 8350  S SG   . CYS A 1 31 ? -3.468  1.738   -1.014  1.00 0.00 ? 31 CYS A SG   10 
ATOM 8351  H H    . CYS A 1 31 ? -7.145  2.479   0.881   1.00 0.00 ? 31 CYS A H    10 
ATOM 8352  H HA   . CYS A 1 31 ? -6.593  0.853   -1.363  1.00 0.00 ? 31 CYS A HA   10 
ATOM 8353  H HB2  . CYS A 1 31 ? -5.536  2.867   -1.530  1.00 0.00 ? 31 CYS A HB2  10 
ATOM 8354  H HB3  . CYS A 1 31 ? -5.170  2.958   0.182   1.00 0.00 ? 31 CYS A HB3  10 
ATOM 8355  N N    . ASN A 1 32 ? -5.610  -0.019  1.622   1.00 0.00 ? 32 ASN A N    10 
ATOM 8356  C CA   . ASN A 1 32 ? -5.027  -1.083  2.423   1.00 0.00 ? 32 ASN A CA   10 
ATOM 8357  C C    . ASN A 1 32 ? -6.091  -2.145  2.705   1.00 0.00 ? 32 ASN A C    10 
ATOM 8358  O O    . ASN A 1 32 ? -5.829  -3.121  3.406   1.00 0.00 ? 32 ASN A O    10 
ATOM 8359  C CB   . ASN A 1 32 ? -4.523  -0.549  3.765   1.00 0.00 ? 32 ASN A CB   10 
ATOM 8360  C CG   . ASN A 1 32 ? -5.478  -0.929  4.899   1.00 0.00 ? 32 ASN A CG   10 
ATOM 8361  O OD1  . ASN A 1 32 ? -6.679  -0.727  4.828   1.00 0.00 ? 32 ASN A OD1  10 
ATOM 8362  N ND2  . ASN A 1 32 ? -4.878  -1.488  5.946   1.00 0.00 ? 32 ASN A ND2  10 
ATOM 8363  H H    . ASN A 1 32 ? -6.076  0.695   2.144   1.00 0.00 ? 32 ASN A H    10 
ATOM 8364  H HA   . ASN A 1 32 ? -4.200  -1.470  1.827   1.00 0.00 ? 32 ASN A HA   10 
ATOM 8365  H HB2  . ASN A 1 32 ? -3.531  -0.950  3.971   1.00 0.00 ? 32 ASN A HB2  10 
ATOM 8366  H HB3  . ASN A 1 32 ? -4.424  0.535   3.716   1.00 0.00 ? 32 ASN A HB3  10 
ATOM 8367  H HD21 . ASN A 1 32 ? -3.888  -1.626  5.941   1.00 0.00 ? 32 ASN A HD21 10 
ATOM 8368  H HD22 . ASN A 1 32 ? -5.418  -1.772  6.739   1.00 0.00 ? 32 ASN A HD22 10 
ATOM 8369  N N    . ASN A 1 33 ? -7.271  -1.918  2.146   1.00 0.00 ? 33 ASN A N    10 
ATOM 8370  C CA   . ASN A 1 33 ? -8.376  -2.843  2.329   1.00 0.00 ? 33 ASN A CA   10 
ATOM 8371  C C    . ASN A 1 33 ? -8.546  -3.685  1.063   1.00 0.00 ? 33 ASN A C    10 
ATOM 8372  O O    . ASN A 1 33 ? -8.765  -4.893  1.142   1.00 0.00 ? 33 ASN A O    10 
ATOM 8373  C CB   . ASN A 1 33 ? -9.686  -2.093  2.578   1.00 0.00 ? 33 ASN A CB   10 
ATOM 8374  C CG   . ASN A 1 33 ? -10.892 -3.014  2.379   1.00 0.00 ? 33 ASN A CG   10 
ATOM 8375  O OD1  . ASN A 1 33 ? -10.810 -4.224  2.512   1.00 0.00 ? 33 ASN A OD1  10 
ATOM 8376  N ND2  . ASN A 1 33 ? -12.012 -2.376  2.053   1.00 0.00 ? 33 ASN A ND2  10 
ATOM 8377  H H    . ASN A 1 33 ? -7.476  -1.121  1.578   1.00 0.00 ? 33 ASN A H    10 
ATOM 8378  H HA   . ASN A 1 33 ? -8.106  -3.445  3.197   1.00 0.00 ? 33 ASN A HA   10 
ATOM 8379  H HB2  . ASN A 1 33 ? -9.694  -1.693  3.592   1.00 0.00 ? 33 ASN A HB2  10 
ATOM 8380  H HB3  . ASN A 1 33 ? -9.758  -1.243  1.899   1.00 0.00 ? 33 ASN A HB3  10 
ATOM 8381  H HD21 . ASN A 1 33 ? -12.011 -1.381  1.959   1.00 0.00 ? 33 ASN A HD21 10 
ATOM 8382  H HD22 . ASN A 1 33 ? -12.855 -2.892  1.901   1.00 0.00 ? 33 ASN A HD22 10 
ATOM 8383  N N    . ARG A 1 34 ? -8.439  -3.014  -0.074  1.00 0.00 ? 34 ARG A N    10 
ATOM 8384  C CA   . ARG A 1 34 ? -8.578  -3.685  -1.355  1.00 0.00 ? 34 ARG A CA   10 
ATOM 8385  C C    . ARG A 1 34 ? -7.571  -4.831  -1.466  1.00 0.00 ? 34 ARG A C    10 
ATOM 8386  O O    . ARG A 1 34 ? -7.817  -5.814  -2.163  1.00 0.00 ? 34 ARG A O    10 
ATOM 8387  C CB   . ARG A 1 34 ? -8.361  -2.711  -2.514  1.00 0.00 ? 34 ARG A CB   10 
ATOM 8388  C CG   . ARG A 1 34 ? -9.310  -3.019  -3.675  1.00 0.00 ? 34 ARG A CG   10 
ATOM 8389  C CD   . ARG A 1 34 ? -8.962  -4.360  -4.325  1.00 0.00 ? 34 ARG A CD   10 
ATOM 8390  N NE   . ARG A 1 34 ? -9.442  -4.383  -5.725  1.00 0.00 ? 34 ARG A NE   10 
ATOM 8391  C CZ   . ARG A 1 34 ? -9.558  -5.496  -6.461  1.00 0.00 ? 34 ARG A CZ   10 
ATOM 8392  N NH1  . ARG A 1 34 ? -9.231  -6.684  -5.935  1.00 0.00 ? 34 ARG A NH1  10 
ATOM 8393  N NH2  . ARG A 1 34 ? -10.003 -5.422  -7.723  1.00 0.00 ? 34 ARG A NH2  10 
ATOM 8394  H H    . ARG A 1 34 ? -8.261  -2.032  -0.129  1.00 0.00 ? 34 ARG A H    10 
ATOM 8395  H HA   . ARG A 1 34 ? -9.602  -4.061  -1.363  1.00 0.00 ? 34 ARG A HA   10 
ATOM 8396  H HB2  . ARG A 1 34 ? -8.522  -1.689  -2.170  1.00 0.00 ? 34 ARG A HB2  10 
ATOM 8397  H HB3  . ARG A 1 34 ? -7.329  -2.772  -2.858  1.00 0.00 ? 34 ARG A HB3  10 
ATOM 8398  H HG2  . ARG A 1 34 ? -10.337 -3.042  -3.313  1.00 0.00 ? 34 ARG A HG2  10 
ATOM 8399  H HG3  . ARG A 1 34 ? -9.251  -2.224  -4.418  1.00 0.00 ? 34 ARG A HG3  10 
ATOM 8400  H HD2  . ARG A 1 34 ? -7.884  -4.518  -4.299  1.00 0.00 ? 34 ARG A HD2  10 
ATOM 8401  H HD3  . ARG A 1 34 ? -9.417  -5.175  -3.763  1.00 0.00 ? 34 ARG A HD3  10 
ATOM 8402  H HE   . ARG A 1 34 ? -9.695  -3.513  -6.148  1.00 0.00 ? 34 ARG A HE   10 
ATOM 8403  H HH11 . ARG A 1 34 ? -8.899  -6.740  -4.993  1.00 0.00 ? 34 ARG A HH11 10 
ATOM 8404  H HH12 . ARG A 1 34 ? -9.318  -7.515  -6.485  1.00 0.00 ? 34 ARG A HH12 10 
ATOM 8405  H HH21 . ARG A 1 34 ? -10.247 -4.535  -8.116  1.00 0.00 ? 34 ARG A HH21 10 
ATOM 8406  H HH22 . ARG A 1 34 ? -10.090 -6.253  -8.273  1.00 0.00 ? 34 ARG A HH22 10 
ATOM 8407  N N    . GLY A 1 35 ? -6.456  -4.667  -0.768  1.00 0.00 ? 35 GLY A N    10 
ATOM 8408  C CA   . GLY A 1 35 ? -5.410  -5.675  -0.780  1.00 0.00 ? 35 GLY A CA   10 
ATOM 8409  C C    . GLY A 1 35 ? -4.074  -5.074  -1.221  1.00 0.00 ? 35 GLY A C    10 
ATOM 8410  O O    . GLY A 1 35 ? -3.634  -5.291  -2.349  1.00 0.00 ? 35 GLY A O    10 
ATOM 8411  H H    . GLY A 1 35 ? -6.263  -3.864  -0.204  1.00 0.00 ? 35 GLY A H    10 
ATOM 8412  H HA2  . GLY A 1 35 ? -5.307  -6.109  0.215   1.00 0.00 ? 35 GLY A HA2  10 
ATOM 8413  H HA3  . GLY A 1 35 ? -5.689  -6.485  -1.453  1.00 0.00 ? 35 GLY A HA3  10 
ATOM 8414  N N    . CYS A 1 36 ? -3.466  -4.331  -0.308  1.00 0.00 ? 36 CYS A N    10 
ATOM 8415  C CA   . CYS A 1 36 ? -2.189  -3.697  -0.589  1.00 0.00 ? 36 CYS A CA   10 
ATOM 8416  C C    . CYS A 1 36 ? -1.879  -2.718  0.545   1.00 0.00 ? 36 CYS A C    10 
ATOM 8417  O O    . CYS A 1 36 ? -2.427  -2.837  1.639   1.00 0.00 ? 36 CYS A O    10 
ATOM 8418  C CB   . CYS A 1 36 ? -2.188  -3.008  -1.955  1.00 0.00 ? 36 CYS A CB   10 
ATOM 8419  S SG   . CYS A 1 36 ? -0.889  -3.587  -3.107  1.00 0.00 ? 36 CYS A SG   10 
ATOM 8420  H H    . CYS A 1 36 ? -3.830  -4.160  0.607   1.00 0.00 ? 36 CYS A H    10 
ATOM 8421  H HA   . CYS A 1 36 ? -1.446  -4.494  -0.627  1.00 0.00 ? 36 CYS A HA   10 
ATOM 8422  H HB2  . CYS A 1 36 ? -3.161  -3.157  -2.423  1.00 0.00 ? 36 CYS A HB2  10 
ATOM 8423  H HB3  . CYS A 1 36 ? -2.068  -1.935  -1.805  1.00 0.00 ? 36 CYS A HB3  10 
ATOM 8424  N N    . CYS A 1 37 ? -1.000  -1.773  0.244   1.00 0.00 ? 37 CYS A N    10 
ATOM 8425  C CA   . CYS A 1 37 ? -0.611  -0.774  1.224   1.00 0.00 ? 37 CYS A CA   10 
ATOM 8426  C C    . CYS A 1 37 ? -0.948  0.609   0.662   1.00 0.00 ? 37 CYS A C    10 
ATOM 8427  O O    . CYS A 1 37 ? -0.968  0.800   -0.553  1.00 0.00 ? 37 CYS A O    10 
ATOM 8428  C CB   . CYS A 1 37 ? 0.869   -0.893  1.596   1.00 0.00 ? 37 CYS A CB   10 
ATOM 8429  S SG   . CYS A 1 37 ? 1.226   -2.062  2.958   1.00 0.00 ? 37 CYS A SG   10 
ATOM 8430  H H    . CYS A 1 37 ? -0.559  -1.683  -0.649  1.00 0.00 ? 37 CYS A H    10 
ATOM 8431  H HA   . CYS A 1 37 ? -1.190  -0.977  2.125   1.00 0.00 ? 37 CYS A HA   10 
ATOM 8432  H HB2  . CYS A 1 37 ? 1.427   -1.204  0.713   1.00 0.00 ? 37 CYS A HB2  10 
ATOM 8433  H HB3  . CYS A 1 37 ? 1.239   0.093   1.876   1.00 0.00 ? 37 CYS A HB3  10 
ATOM 8434  N N    . PHE A 1 38 ? -1.205  1.536   1.572   1.00 0.00 ? 38 PHE A N    10 
ATOM 8435  C CA   . PHE A 1 38 ? -1.541  2.895   1.182   1.00 0.00 ? 38 PHE A CA   10 
ATOM 8436  C C    . PHE A 1 38 ? -0.496  3.887   1.697   1.00 0.00 ? 38 PHE A C    10 
ATOM 8437  O O    . PHE A 1 38 ? 0.402   3.513   2.450   1.00 0.00 ? 38 PHE A O    10 
ATOM 8438  C CB   . PHE A 1 38 ? -2.894  3.222   1.818   1.00 0.00 ? 38 PHE A CB   10 
ATOM 8439  C CG   . PHE A 1 38 ? -3.316  4.684   1.665   1.00 0.00 ? 38 PHE A CG   10 
ATOM 8440  C CD1  . PHE A 1 38 ? -3.887  5.109   0.506   1.00 0.00 ? 38 PHE A CD1  10 
ATOM 8441  C CD2  . PHE A 1 38 ? -3.122  5.559   2.687   1.00 0.00 ? 38 PHE A CD2  10 
ATOM 8442  C CE1  . PHE A 1 38 ? -4.279  6.466   0.363   1.00 0.00 ? 38 PHE A CE1  10 
ATOM 8443  C CE2  . PHE A 1 38 ? -3.514  6.916   2.545   1.00 0.00 ? 38 PHE A CE2  10 
ATOM 8444  C CZ   . PHE A 1 38 ? -4.084  7.341   1.386   1.00 0.00 ? 38 PHE A CZ   10 
ATOM 8445  H H    . PHE A 1 38 ? -1.187  1.372   2.559   1.00 0.00 ? 38 PHE A H    10 
ATOM 8446  H HA   . PHE A 1 38 ? -1.561  2.923   0.093   1.00 0.00 ? 38 PHE A HA   10 
ATOM 8447  H HB2  . PHE A 1 38 ? -3.657  2.585   1.372   1.00 0.00 ? 38 PHE A HB2  10 
ATOM 8448  H HB3  . PHE A 1 38 ? -2.854  2.975   2.879   1.00 0.00 ? 38 PHE A HB3  10 
ATOM 8449  H HD1  . PHE A 1 38 ? -4.043  4.408   -0.314  1.00 0.00 ? 38 PHE A HD1  10 
ATOM 8450  H HD2  . PHE A 1 38 ? -2.664  5.219   3.617   1.00 0.00 ? 38 PHE A HD2  10 
ATOM 8451  H HE1  . PHE A 1 38 ? -4.736  6.807   -0.566  1.00 0.00 ? 38 PHE A HE1  10 
ATOM 8452  H HE2  . PHE A 1 38 ? -3.358  7.618   3.365   1.00 0.00 ? 38 PHE A HE2  10 
ATOM 8453  H HZ   . PHE A 1 38 ? -4.386  8.383   1.277   1.00 0.00 ? 38 PHE A HZ   10 
ATOM 8454  N N    . ASP A 1 39 ? -0.648  5.132   1.270   1.00 0.00 ? 39 ASP A N    10 
ATOM 8455  C CA   . ASP A 1 39 ? 0.272   6.181   1.678   1.00 0.00 ? 39 ASP A CA   10 
ATOM 8456  C C    . ASP A 1 39 ? -0.144  7.500   1.024   1.00 0.00 ? 39 ASP A C    10 
ATOM 8457  O O    . ASP A 1 39 ? -0.632  7.511   -0.105  1.00 0.00 ? 39 ASP A O    10 
ATOM 8458  C CB   . ASP A 1 39 ? 1.701   5.863   1.235   1.00 0.00 ? 39 ASP A CB   10 
ATOM 8459  C CG   . ASP A 1 39 ? 2.739   6.930   1.586   1.00 0.00 ? 39 ASP A CG   10 
ATOM 8460  O OD1  . ASP A 1 39 ? 3.071   7.026   2.787   1.00 0.00 ? 39 ASP A OD1  10 
ATOM 8461  O OD2  . ASP A 1 39 ? 3.178   7.627   0.645   1.00 0.00 ? 39 ASP A OD2  10 
ATOM 8462  H H    . ASP A 1 39 ? -1.381  5.428   0.657   1.00 0.00 ? 39 ASP A H    10 
ATOM 8463  H HA   . ASP A 1 39 ? 0.203   6.214   2.765   1.00 0.00 ? 39 ASP A HA   10 
ATOM 8464  H HB2  . ASP A 1 39 ? 2.005   4.919   1.689   1.00 0.00 ? 39 ASP A HB2  10 
ATOM 8465  H HB3  . ASP A 1 39 ? 1.706   5.713   0.155   1.00 0.00 ? 39 ASP A HB3  10 
ATOM 8466  N N    . SER A 1 40 ? 0.066   8.581   1.761   1.00 0.00 ? 40 SER A N    10 
ATOM 8467  C CA   . SER A 1 40 ? -0.281  9.902   1.267   1.00 0.00 ? 40 SER A CA   10 
ATOM 8468  C C    . SER A 1 40 ? 0.841   10.892  1.589   1.00 0.00 ? 40 SER A C    10 
ATOM 8469  O O    . SER A 1 40 ? 0.639   12.104  1.535   1.00 0.00 ? 40 SER A O    10 
ATOM 8470  C CB   . SER A 1 40 ? -1.603  10.385  1.866   1.00 0.00 ? 40 SER A CB   10 
ATOM 8471  O OG   . SER A 1 40 ? -1.487  10.666  3.258   1.00 0.00 ? 40 SER A OG   10 
ATOM 8472  H H    . SER A 1 40 ? 0.464   8.563   2.678   1.00 0.00 ? 40 SER A H    10 
ATOM 8473  H HA   . SER A 1 40 ? -0.392  9.788   0.189   1.00 0.00 ? 40 SER A HA   10 
ATOM 8474  H HB2  . SER A 1 40 ? -1.933  11.282  1.342   1.00 0.00 ? 40 SER A HB2  10 
ATOM 8475  H HB3  . SER A 1 40 ? -2.370  9.626   1.712   1.00 0.00 ? 40 SER A HB3  10 
ATOM 8476  H HG   . SER A 1 40 ? -2.393  10.823  3.652   1.00 0.00 ? 40 SER A HG   10 
ATOM 8477  N N    . ARG A 1 41 ? 1.999   10.339  1.917   1.00 0.00 ? 41 ARG A N    10 
ATOM 8478  C CA   . ARG A 1 41 ? 3.153   11.157  2.248   1.00 0.00 ? 41 ARG A CA   10 
ATOM 8479  C C    . ARG A 1 41 ? 3.515   12.064  1.070   1.00 0.00 ? 41 ARG A C    10 
ATOM 8480  O O    . ARG A 1 41 ? 3.747   13.259  1.250   1.00 0.00 ? 41 ARG A O    10 
ATOM 8481  C CB   . ARG A 1 41 ? 4.361   10.289  2.604   1.00 0.00 ? 41 ARG A CB   10 
ATOM 8482  C CG   . ARG A 1 41 ? 5.184   10.927  3.724   1.00 0.00 ? 41 ARG A CG   10 
ATOM 8483  C CD   . ARG A 1 41 ? 6.451   11.582  3.169   1.00 0.00 ? 41 ARG A CD   10 
ATOM 8484  N NE   . ARG A 1 41 ? 7.641   11.065  3.880   1.00 0.00 ? 41 ARG A NE   10 
ATOM 8485  C CZ   . ARG A 1 41 ? 8.180   9.858   3.662   1.00 0.00 ? 41 ARG A CZ   10 
ATOM 8486  N NH1  . ARG A 1 41 ? 7.638   9.036   2.752   1.00 0.00 ? 41 ARG A NH1  10 
ATOM 8487  N NH2  . ARG A 1 41 ? 9.261   9.472   4.353   1.00 0.00 ? 41 ARG A NH2  10 
ATOM 8488  H H    . ARG A 1 41 ? 2.155   9.352   1.959   1.00 0.00 ? 41 ARG A H    10 
ATOM 8489  H HA   . ARG A 1 41 ? 2.840   11.743  3.112   1.00 0.00 ? 41 ARG A HA   10 
ATOM 8490  H HB2  . ARG A 1 41 ? 4.024   9.300   2.914   1.00 0.00 ? 41 ARG A HB2  10 
ATOM 8491  H HB3  . ARG A 1 41 ? 4.986   10.150  1.722   1.00 0.00 ? 41 ARG A HB3  10 
ATOM 8492  H HG2  . ARG A 1 41 ? 4.582   11.673  4.243   1.00 0.00 ? 41 ARG A HG2  10 
ATOM 8493  H HG3  . ARG A 1 41 ? 5.455   10.169  4.459   1.00 0.00 ? 41 ARG A HG3  10 
ATOM 8494  H HD2  . ARG A 1 41 ? 6.537   11.380  2.102   1.00 0.00 ? 41 ARG A HD2  10 
ATOM 8495  H HD3  . ARG A 1 41 ? 6.390   12.665  3.284   1.00 0.00 ? 41 ARG A HD3  10 
ATOM 8496  H HE   . ARG A 1 41 ? 8.070   11.653  4.565   1.00 0.00 ? 41 ARG A HE   10 
ATOM 8497  H HH11 . ARG A 1 41 ? 6.832   9.324   2.236   1.00 0.00 ? 41 ARG A HH11 10 
ATOM 8498  H HH12 . ARG A 1 41 ? 8.041   8.135   2.590   1.00 0.00 ? 41 ARG A HH12 10 
ATOM 8499  H HH21 . ARG A 1 41 ? 9.666   10.085  5.032   1.00 0.00 ? 41 ARG A HH21 10 
ATOM 8500  H HH22 . ARG A 1 41 ? 9.664   8.571   4.191   1.00 0.00 ? 41 ARG A HH22 10 
ATOM 8501  N N    . ILE A 1 42 ? 3.553   11.462  -0.110  1.00 0.00 ? 42 ILE A N    10 
ATOM 8502  C CA   . ILE A 1 42 ? 3.883   12.201  -1.317  1.00 0.00 ? 42 ILE A CA   10 
ATOM 8503  C C    . ILE A 1 42 ? 3.094   11.624  -2.494  1.00 0.00 ? 42 ILE A C    10 
ATOM 8504  O O    . ILE A 1 42 ? 3.040   10.408  -2.673  1.00 0.00 ? 42 ILE A O    10 
ATOM 8505  C CB   . ILE A 1 42 ? 5.397   12.216  -1.539  1.00 0.00 ? 42 ILE A CB   10 
ATOM 8506  C CG1  . ILE A 1 42 ? 6.067   11.039  -0.827  1.00 0.00 ? 42 ILE A CG1  10 
ATOM 8507  C CG2  . ILE A 1 42 ? 5.999   13.558  -1.118  1.00 0.00 ? 42 ILE A CG2  10 
ATOM 8508  C CD1  . ILE A 1 42 ? 5.552   9.704   -1.371  1.00 0.00 ? 42 ILE A CD1  10 
ATOM 8509  H H    . ILE A 1 42 ? 3.363   10.490  -0.248  1.00 0.00 ? 42 ILE A H    10 
ATOM 8510  H HA   . ILE A 1 42 ? 3.569   13.234  -1.164  1.00 0.00 ? 42 ILE A HA   10 
ATOM 8511  H HB   . ILE A 1 42 ? 5.587   12.098  -2.605  1.00 0.00 ? 42 ILE A HB   10 
ATOM 8512  H HG12 . ILE A 1 42 ? 7.147   11.097  -0.959  1.00 0.00 ? 42 ILE A HG12 10 
ATOM 8513  H HG13 . ILE A 1 42 ? 5.872   11.098  0.244   1.00 0.00 ? 42 ILE A HG13 10 
ATOM 8514  H HG21 . ILE A 1 42 ? 5.375   14.012  -0.349  1.00 0.00 ? 42 ILE A HG21 10 
ATOM 8515  H HG22 . ILE A 1 42 ? 7.003   13.398  -0.725  1.00 0.00 ? 42 ILE A HG22 10 
ATOM 8516  H HG23 . ILE A 1 42 ? 6.049   14.221  -1.983  1.00 0.00 ? 42 ILE A HG23 10 
ATOM 8517  H HD11 . ILE A 1 42 ? 5.104   9.861   -2.352  1.00 0.00 ? 42 ILE A HD11 10 
ATOM 8518  H HD12 . ILE A 1 42 ? 6.383   9.004   -1.458  1.00 0.00 ? 42 ILE A HD12 10 
ATOM 8519  H HD13 . ILE A 1 42 ? 4.804   9.299   -0.690  1.00 0.00 ? 42 ILE A HD13 10 
ATOM 8520  N N    . PRO A 1 43 ? 2.487   12.547  -3.287  1.00 0.00 ? 43 PRO A N    10 
ATOM 8521  C CA   . PRO A 1 43 ? 1.704   12.143  -4.442  1.00 0.00 ? 43 PRO A CA   10 
ATOM 8522  C C    . PRO A 1 43 ? 2.612   11.701  -5.592  1.00 0.00 ? 43 PRO A C    10 
ATOM 8523  O O    . PRO A 1 43 ? 2.294   10.754  -6.310  1.00 0.00 ? 43 PRO A O    10 
ATOM 8524  C CB   . PRO A 1 43 ? 0.856   13.356  -4.787  1.00 0.00 ? 43 PRO A CB   10 
ATOM 8525  C CG   . PRO A 1 43 ? 1.527   14.540  -4.109  1.00 0.00 ? 43 PRO A CG   10 
ATOM 8526  C CD   . PRO A 1 43 ? 2.530   13.995  -3.105  1.00 0.00 ? 43 PRO A CD   10 
ATOM 8527  H HA   . PRO A 1 43 ? 1.140   11.348  -4.218  1.00 0.00 ? 43 PRO A HA   10 
ATOM 8528  H HB2  . PRO A 1 43 ? 0.803   13.502  -5.866  1.00 0.00 ? 43 PRO A HB2  10 
ATOM 8529  H HB3  . PRO A 1 43 ? -0.167  13.231  -4.432  1.00 0.00 ? 43 PRO A HB3  10 
ATOM 8530  H HG2  . PRO A 1 43 ? 2.028   15.168  -4.846  1.00 0.00 ? 43 PRO A HG2  10 
ATOM 8531  H HG3  . PRO A 1 43 ? 0.786   15.164  -3.609  1.00 0.00 ? 43 PRO A HG3  10 
ATOM 8532  H HD2  . PRO A 1 43 ? 3.529   14.388  -3.291  1.00 0.00 ? 43 PRO A HD2  10 
ATOM 8533  H HD3  . PRO A 1 43 ? 2.262   14.274  -2.086  1.00 0.00 ? 43 PRO A HD3  10 
ATOM 8534  N N    . GLY A 1 44 ? 3.724   12.408  -5.731  1.00 0.00 ? 44 GLY A N    10 
ATOM 8535  C CA   . GLY A 1 44 ? 4.679   12.101  -6.782  1.00 0.00 ? 44 GLY A CA   10 
ATOM 8536  C C    . GLY A 1 44 ? 4.872   10.590  -6.923  1.00 0.00 ? 44 GLY A C    10 
ATOM 8537  O O    . GLY A 1 44 ? 5.174   10.098  -8.009  1.00 0.00 ? 44 GLY A O    10 
ATOM 8538  H H    . GLY A 1 44 ? 3.975   13.177  -5.143  1.00 0.00 ? 44 GLY A H    10 
ATOM 8539  H HA2  . GLY A 1 44 ? 4.331   12.517  -7.728  1.00 0.00 ? 44 GLY A HA2  10 
ATOM 8540  H HA3  . GLY A 1 44 ? 5.635   12.574  -6.558  1.00 0.00 ? 44 GLY A HA3  10 
ATOM 8541  N N    . VAL A 1 45 ? 4.690   9.896   -5.809  1.00 0.00 ? 45 VAL A N    10 
ATOM 8542  C CA   . VAL A 1 45 ? 4.841   8.451   -5.794  1.00 0.00 ? 45 VAL A CA   10 
ATOM 8543  C C    . VAL A 1 45 ? 3.457   7.799   -5.754  1.00 0.00 ? 45 VAL A C    10 
ATOM 8544  O O    . VAL A 1 45 ? 2.450   8.481   -5.572  1.00 0.00 ? 45 VAL A O    10 
ATOM 8545  C CB   . VAL A 1 45 ? 5.735   8.029   -4.626  1.00 0.00 ? 45 VAL A CB   10 
ATOM 8546  C CG1  . VAL A 1 45 ? 6.693   9.156   -4.235  1.00 0.00 ? 45 VAL A CG1  10 
ATOM 8547  C CG2  . VAL A 1 45 ? 4.896   7.581   -3.428  1.00 0.00 ? 45 VAL A CG2  10 
ATOM 8548  H H    . VAL A 1 45 ? 4.445   10.304  -4.929  1.00 0.00 ? 45 VAL A H    10 
ATOM 8549  H HA   . VAL A 1 45 ? 5.338   8.163   -6.721  1.00 0.00 ? 45 VAL A HA   10 
ATOM 8550  H HB   . VAL A 1 45 ? 6.334   7.179   -4.953  1.00 0.00 ? 45 VAL A HB   10 
ATOM 8551  H HG11 . VAL A 1 45 ? 6.123   10.064  -4.037  1.00 0.00 ? 45 VAL A HG11 10 
ATOM 8552  H HG12 . VAL A 1 45 ? 7.243   8.870   -3.339  1.00 0.00 ? 45 VAL A HG12 10 
ATOM 8553  H HG13 . VAL A 1 45 ? 7.394   9.337   -5.050  1.00 0.00 ? 45 VAL A HG13 10 
ATOM 8554  H HG21 . VAL A 1 45 ? 4.090   8.296   -3.260  1.00 0.00 ? 45 VAL A HG21 10 
ATOM 8555  H HG22 . VAL A 1 45 ? 4.473   6.597   -3.629  1.00 0.00 ? 45 VAL A HG22 10 
ATOM 8556  H HG23 . VAL A 1 45 ? 5.528   7.531   -2.541  1.00 0.00 ? 45 VAL A HG23 10 
ATOM 8557  N N    . PRO A 1 46 ? 3.452   6.450   -5.930  1.00 0.00 ? 46 PRO A N    10 
ATOM 8558  C CA   . PRO A 1 46 ? 2.209   5.698   -5.916  1.00 0.00 ? 46 PRO A CA   10 
ATOM 8559  C C    . PRO A 1 46 ? 1.675   5.548   -4.490  1.00 0.00 ? 46 PRO A C    10 
ATOM 8560  O O    . PRO A 1 46 ? 2.027   4.602   -3.788  1.00 0.00 ? 46 PRO A O    10 
ATOM 8561  C CB   . PRO A 1 46 ? 2.547   4.367   -6.567  1.00 0.00 ? 46 PRO A CB   10 
ATOM 8562  C CG   . PRO A 1 46 ? 4.060   4.242   -6.500  1.00 0.00 ? 46 PRO A CG   10 
ATOM 8563  C CD   . PRO A 1 46 ? 4.625   5.609   -6.148  1.00 0.00 ? 46 PRO A CD   10 
ATOM 8564  H HA   . PRO A 1 46 ? 1.500   6.189   -6.423  1.00 0.00 ? 46 PRO A HA   10 
ATOM 8565  H HB2  . PRO A 1 46 ? 2.063   3.542   -6.043  1.00 0.00 ? 46 PRO A HB2  10 
ATOM 8566  H HB3  . PRO A 1 46 ? 2.198   4.337   -7.599  1.00 0.00 ? 46 PRO A HB3  10 
ATOM 8567  H HG2  . PRO A 1 46 ? 4.350   3.505   -5.751  1.00 0.00 ? 46 PRO A HG2  10 
ATOM 8568  H HG3  . PRO A 1 46 ? 4.458   3.899   -7.455  1.00 0.00 ? 46 PRO A HG3  10 
ATOM 8569  H HD2  . PRO A 1 46 ? 5.249   5.561   -5.255  1.00 0.00 ? 46 PRO A HD2  10 
ATOM 8570  H HD3  . PRO A 1 46 ? 5.249   5.998   -6.952  1.00 0.00 ? 46 PRO A HD3  10 
ATOM 8571  N N    . TRP A 1 47 ? 0.835   6.497   -4.104  1.00 0.00 ? 47 TRP A N    10 
ATOM 8572  C CA   . TRP A 1 47 ? 0.249   6.482   -2.774  1.00 0.00 ? 47 TRP A CA   10 
ATOM 8573  C C    . TRP A 1 47 ? 0.039   5.023   -2.366  1.00 0.00 ? 47 TRP A C    10 
ATOM 8574  O O    . TRP A 1 47 ? 0.493   4.600   -1.304  1.00 0.00 ? 47 TRP A O    10 
ATOM 8575  C CB   . TRP A 1 47 ? -1.039  7.306   -2.733  1.00 0.00 ? 47 TRP A CB   10 
ATOM 8576  C CG   . TRP A 1 47 ? -0.822  8.786   -2.413  1.00 0.00 ? 47 TRP A CG   10 
ATOM 8577  C CD1  . TRP A 1 47 ? 0.263   9.533   -2.660  1.00 0.00 ? 47 TRP A CD1  10 
ATOM 8578  C CD2  . TRP A 1 47 ? -1.762  9.674   -1.772  1.00 0.00 ? 47 TRP A CD2  10 
ATOM 8579  N NE1  . TRP A 1 47 ? 0.092   10.833  -2.227  1.00 0.00 ? 47 TRP A NE1  10 
ATOM 8580  C CE2  . TRP A 1 47 ? -1.179  10.921  -1.670  1.00 0.00 ? 47 TRP A CE2  10 
ATOM 8581  C CE3  . TRP A 1 47 ? -3.062  9.432   -1.294  1.00 0.00 ? 47 TRP A CE3  10 
ATOM 8582  C CZ2  . TRP A 1 47 ? -1.822  12.023  -1.094  1.00 0.00 ? 47 TRP A CZ2  10 
ATOM 8583  C CZ3  . TRP A 1 47 ? -3.691  10.544  -0.721  1.00 0.00 ? 47 TRP A CZ3  10 
ATOM 8584  C CH2  . TRP A 1 47 ? -3.118  11.806  -0.611  1.00 0.00 ? 47 TRP A CH2  10 
ATOM 8585  H H    . TRP A 1 47 ? 0.554   7.264   -4.681  1.00 0.00 ? 47 TRP A H    10 
ATOM 8586  H HA   . TRP A 1 47 ? 0.954   6.962   -2.094  1.00 0.00 ? 47 TRP A HA   10 
ATOM 8587  H HB2  . TRP A 1 47 ? -1.542  7.224   -3.697  1.00 0.00 ? 47 TRP A HB2  10 
ATOM 8588  H HB3  . TRP A 1 47 ? -1.709  6.878   -1.987  1.00 0.00 ? 47 TRP A HB3  10 
ATOM 8589  H HD1  . TRP A 1 47 ? 1.167   9.162   -3.142  1.00 0.00 ? 47 TRP A HD1  10 
ATOM 8590  H HE1  . TRP A 1 47 ? 0.819   11.641  -2.307  1.00 0.00 ? 47 TRP A HE1  10 
ATOM 8591  H HE3  . TRP A 1 47 ? -3.544  8.457   -1.363  1.00 0.00 ? 47 TRP A HE3  10 
ATOM 8592  H HZ2  . TRP A 1 47 ? -1.339  12.998  -1.025  1.00 0.00 ? 47 TRP A HZ2  10 
ATOM 8593  H HZ3  . TRP A 1 47 ? -4.701  10.411  -0.335  1.00 0.00 ? 47 TRP A HZ3  10 
ATOM 8594  H HH2  . TRP A 1 47 ? -3.674  12.622  -0.151  1.00 0.00 ? 47 TRP A HH2  10 
ATOM 8595  N N    . CYS A 1 48 ? -0.649  4.293   -3.232  1.00 0.00 ? 48 CYS A N    10 
ATOM 8596  C CA   . CYS A 1 48 ? -0.925  2.890   -2.974  1.00 0.00 ? 48 CYS A CA   10 
ATOM 8597  C C    . CYS A 1 48 ? 0.178   2.056   -3.629  1.00 0.00 ? 48 CYS A C    10 
ATOM 8598  O O    . CYS A 1 48 ? 0.289   2.018   -4.853  1.00 0.00 ? 48 CYS A O    10 
ATOM 8599  C CB   . CYS A 1 48 ? -2.315  2.487   -3.470  1.00 0.00 ? 48 CYS A CB   10 
ATOM 8600  S SG   . CYS A 1 48 ? -3.031  1.022   -2.639  1.00 0.00 ? 48 CYS A SG   10 
ATOM 8601  H H    . CYS A 1 48 ? -1.014  4.645   -4.093  1.00 0.00 ? 48 CYS A H    10 
ATOM 8602  H HA   . CYS A 1 48 ? -0.916  2.762   -1.892  1.00 0.00 ? 48 CYS A HA   10 
ATOM 8603  H HB2  . CYS A 1 48 ? -2.992  3.330   -3.336  1.00 0.00 ? 48 CYS A HB2  10 
ATOM 8604  H HB3  . CYS A 1 48 ? -2.261  2.289   -4.541  1.00 0.00 ? 48 CYS A HB3  10 
ATOM 8605  N N    . PHE A 1 49 ? 0.966   1.407   -2.783  1.00 0.00 ? 49 PHE A N    10 
ATOM 8606  C CA   . PHE A 1 49 ? 2.057   0.576   -3.264  1.00 0.00 ? 49 PHE A CA   10 
ATOM 8607  C C    . PHE A 1 49 ? 2.078   -0.772  -2.541  1.00 0.00 ? 49 PHE A C    10 
ATOM 8608  O O    . PHE A 1 49 ? 1.473   -0.922  -1.481  1.00 0.00 ? 49 PHE A O    10 
ATOM 8609  C CB   . PHE A 1 49 ? 3.356   1.325   -2.961  1.00 0.00 ? 49 PHE A CB   10 
ATOM 8610  C CG   . PHE A 1 49 ? 3.429   1.897   -1.544  1.00 0.00 ? 49 PHE A CG   10 
ATOM 8611  C CD1  . PHE A 1 49 ? 3.564   1.062   -0.480  1.00 0.00 ? 49 PHE A CD1  10 
ATOM 8612  C CD2  . PHE A 1 49 ? 3.360   3.241   -1.350  1.00 0.00 ? 49 PHE A CD2  10 
ATOM 8613  C CE1  . PHE A 1 49 ? 3.632   1.593   0.836   1.00 0.00 ? 49 PHE A CE1  10 
ATOM 8614  C CE2  . PHE A 1 49 ? 3.427   3.773   -0.035  1.00 0.00 ? 49 PHE A CE2  10 
ATOM 8615  C CZ   . PHE A 1 49 ? 3.562   2.937   1.030   1.00 0.00 ? 49 PHE A CZ   10 
ATOM 8616  H H    . PHE A 1 49 ? 0.869   1.444   -1.789  1.00 0.00 ? 49 PHE A H    10 
ATOM 8617  H HA   . PHE A 1 49 ? 1.894   0.413   -4.329  1.00 0.00 ? 49 PHE A HA   10 
ATOM 8618  H HB2  . PHE A 1 49 ? 4.197   0.647   -3.112  1.00 0.00 ? 49 PHE A HB2  10 
ATOM 8619  H HB3  . PHE A 1 49 ? 3.470   2.139   -3.677  1.00 0.00 ? 49 PHE A HB3  10 
ATOM 8620  H HD1  . PHE A 1 49 ? 3.620   -0.015  -0.636  1.00 0.00 ? 49 PHE A HD1  10 
ATOM 8621  H HD2  . PHE A 1 49 ? 3.252   3.911   -2.203  1.00 0.00 ? 49 PHE A HD2  10 
ATOM 8622  H HE1  . PHE A 1 49 ? 3.740   0.924   1.689   1.00 0.00 ? 49 PHE A HE1  10 
ATOM 8623  H HE2  . PHE A 1 49 ? 3.371   4.850   0.122   1.00 0.00 ? 49 PHE A HE2  10 
ATOM 8624  H HZ   . PHE A 1 49 ? 3.614   3.345   2.040   1.00 0.00 ? 49 PHE A HZ   10 
ATOM 8625  N N    . LYS A 1 50 ? 2.782   -1.719  -3.144  1.00 0.00 ? 50 LYS A N    10 
ATOM 8626  C CA   . LYS A 1 50 ? 2.890   -3.050  -2.570  1.00 0.00 ? 50 LYS A CA   10 
ATOM 8627  C C    . LYS A 1 50 ? 3.666   -2.972  -1.254  1.00 0.00 ? 50 LYS A C    10 
ATOM 8628  O O    . LYS A 1 50 ? 4.340   -1.979  -0.984  1.00 0.00 ? 50 LYS A O    10 
ATOM 8629  C CB   . LYS A 1 50 ? 3.497   -4.022  -3.584  1.00 0.00 ? 50 LYS A CB   10 
ATOM 8630  C CG   . LYS A 1 50 ? 2.578   -4.194  -4.796  1.00 0.00 ? 50 LYS A CG   10 
ATOM 8631  C CD   . LYS A 1 50 ? 2.641   -5.626  -5.333  1.00 0.00 ? 50 LYS A CD   10 
ATOM 8632  C CE   . LYS A 1 50 ? 2.820   -5.634  -6.852  1.00 0.00 ? 50 LYS A CE   10 
ATOM 8633  N NZ   . LYS A 1 50 ? 1.918   -6.629  -7.475  1.00 0.00 ? 50 LYS A NZ   10 
ATOM 8634  H H    . LYS A 1 50 ? 3.272   -1.589  -4.006  1.00 0.00 ? 50 LYS A H    10 
ATOM 8635  H HA   . LYS A 1 50 ? 1.879   -3.397  -2.356  1.00 0.00 ? 50 LYS A HA   10 
ATOM 8636  H HB2  . LYS A 1 50 ? 4.470   -3.654  -3.910  1.00 0.00 ? 50 LYS A HB2  10 
ATOM 8637  H HB3  . LYS A 1 50 ? 3.665   -4.989  -3.111  1.00 0.00 ? 50 LYS A HB3  10 
ATOM 8638  H HG2  . LYS A 1 50 ? 1.553   -3.951  -4.517  1.00 0.00 ? 50 LYS A HG2  10 
ATOM 8639  H HG3  . LYS A 1 50 ? 2.870   -3.495  -5.580  1.00 0.00 ? 50 LYS A HG3  10 
ATOM 8640  H HD2  . LYS A 1 50 ? 3.468   -6.158  -4.863  1.00 0.00 ? 50 LYS A HD2  10 
ATOM 8641  H HD3  . LYS A 1 50 ? 1.727   -6.158  -5.068  1.00 0.00 ? 50 LYS A HD3  10 
ATOM 8642  H HE2  . LYS A 1 50 ? 2.611   -4.643  -7.255  1.00 0.00 ? 50 LYS A HE2  10 
ATOM 8643  H HE3  . LYS A 1 50 ? 3.855   -5.867  -7.101  1.00 0.00 ? 50 LYS A HE3  10 
ATOM 8644  H HZ1  . LYS A 1 50 ? 1.553   -7.236  -6.769  1.00 0.00 ? 50 LYS A HZ1  10 
ATOM 8645  H HZ2  . LYS A 1 50 ? 1.164   -6.156  -7.930  1.00 0.00 ? 50 LYS A HZ2  10 
ATOM 8646  H HZ3  . LYS A 1 50 ? 2.428   -7.167  -8.146  1.00 0.00 ? 50 LYS A HZ3  10 
ATOM 8647  N N    . PRO A 1 51 ? 3.541   -4.061  -0.448  1.00 0.00 ? 51 PRO A N    10 
ATOM 8648  C CA   . PRO A 1 51 ? 4.222   -4.125  0.834   1.00 0.00 ? 51 PRO A CA   10 
ATOM 8649  C C    . PRO A 1 51 ? 5.717   -4.391  0.648   1.00 0.00 ? 51 PRO A C    10 
ATOM 8650  O O    . PRO A 1 51 ? 6.104   -5.426  0.109   1.00 0.00 ? 51 PRO A O    10 
ATOM 8651  C CB   . PRO A 1 51 ? 3.513   -5.229  1.601   1.00 0.00 ? 51 PRO A CB   10 
ATOM 8652  C CG   . PRO A 1 51 ? 2.773   -6.052  0.559   1.00 0.00 ? 51 PRO A CG   10 
ATOM 8653  C CD   . PRO A 1 51 ? 2.751   -5.255  -0.735  1.00 0.00 ? 51 PRO A CD   10 
ATOM 8654  H HA   . PRO A 1 51 ? 4.157   -3.245  1.306   1.00 0.00 ? 51 PRO A HA   10 
ATOM 8655  H HB2  . PRO A 1 51 ? 4.227   -5.843  2.150   1.00 0.00 ? 51 PRO A HB2  10 
ATOM 8656  H HB3  . PRO A 1 51 ? 2.821   -4.813  2.334   1.00 0.00 ? 51 PRO A HB3  10 
ATOM 8657  H HG2  . PRO A 1 51 ? 3.269   -7.011  0.408   1.00 0.00 ? 51 PRO A HG2  10 
ATOM 8658  H HG3  . PRO A 1 51 ? 1.758   -6.267  0.892   1.00 0.00 ? 51 PRO A HG3  10 
ATOM 8659  H HD2  . PRO A 1 51 ? 3.180   -5.825  -1.559  1.00 0.00 ? 51 PRO A HD2  10 
ATOM 8660  H HD3  . PRO A 1 51 ? 1.732   -4.996  -1.023  1.00 0.00 ? 51 PRO A HD3  10 
ATOM 8661  N N    . LEU A 1 52 ? 6.516   -3.438  1.105   1.00 0.00 ? 52 LEU A N    10 
ATOM 8662  C CA   . LEU A 1 52 ? 7.960   -3.557  0.996   1.00 0.00 ? 52 LEU A CA   10 
ATOM 8663  C C    . LEU A 1 52 ? 8.358   -5.029  1.120   1.00 0.00 ? 52 LEU A C    10 
ATOM 8664  O O    . LEU A 1 52 ? 7.834   -5.748  1.969   1.00 0.00 ? 52 LEU A O    10 
ATOM 8665  C CB   . LEU A 1 52 ? 8.651   -2.646  2.013   1.00 0.00 ? 52 LEU A CB   10 
ATOM 8666  C CG   . LEU A 1 52 ? 10.162  -2.836  2.166   1.00 0.00 ? 52 LEU A CG   10 
ATOM 8667  C CD1  . LEU A 1 52 ? 10.800  -1.625  2.850   1.00 0.00 ? 52 LEU A CD1  10 
ATOM 8668  C CD2  . LEU A 1 52 ? 10.478  -4.141  2.900   1.00 0.00 ? 52 LEU A CD2  10 
ATOM 8669  H H    . LEU A 1 52 ? 6.193   -2.599  1.543   1.00 0.00 ? 52 LEU A H    10 
ATOM 8670  H HA   . LEU A 1 52 ? 8.243   -3.205  0.004   1.00 0.00 ? 52 LEU A HA   10 
ATOM 8671  H HB2  . LEU A 1 52 ? 8.462   -1.610  1.730   1.00 0.00 ? 52 LEU A HB2  10 
ATOM 8672  H HB3  . LEU A 1 52 ? 8.185   -2.801  2.985   1.00 0.00 ? 52 LEU A HB3  10 
ATOM 8673  H HG   . LEU A 1 52 ? 10.599  -2.912  1.171   1.00 0.00 ? 52 LEU A HG   10 
ATOM 8674  H HD11 . LEU A 1 52 ? 10.458  -0.712  2.364   1.00 0.00 ? 52 LEU A HD11 10 
ATOM 8675  H HD12 . LEU A 1 52 ? 10.511  -1.608  3.901   1.00 0.00 ? 52 LEU A HD12 10 
ATOM 8676  H HD13 . LEU A 1 52 ? 11.885  -1.695  2.772   1.00 0.00 ? 52 LEU A HD13 10 
ATOM 8677  H HD21 . LEU A 1 52 ? 9.601   -4.465  3.460   1.00 0.00 ? 52 LEU A HD21 10 
ATOM 8678  H HD22 . LEU A 1 52 ? 10.750  -4.908  2.175   1.00 0.00 ? 52 LEU A HD22 10 
ATOM 8679  H HD23 . LEU A 1 52 ? 11.309  -3.980  3.587   1.00 0.00 ? 52 LEU A HD23 10 
ATOM 8680  N N    . GLN A 1 53 ? 9.280   -5.434  0.259   1.00 0.00 ? 53 GLN A N    10 
ATOM 8681  C CA   . GLN A 1 53 ? 9.754   -6.808  0.262   1.00 0.00 ? 53 GLN A CA   10 
ATOM 8682  C C    . GLN A 1 53 ? 10.286  -7.184  1.646   1.00 0.00 ? 53 GLN A C    10 
ATOM 8683  O O    . GLN A 1 53 ? 11.480  -7.057  1.912   1.00 0.00 ? 53 GLN A O    10 
ATOM 8684  C CB   . GLN A 1 53 ? 10.822  -7.021  -0.813  1.00 0.00 ? 53 GLN A CB   10 
ATOM 8685  C CG   . GLN A 1 53 ? 10.194  -7.496  -2.124  1.00 0.00 ? 53 GLN A CG   10 
ATOM 8686  C CD   . GLN A 1 53 ? 10.116  -6.355  -3.140  1.00 0.00 ? 53 GLN A CD   10 
ATOM 8687  O OE1  . GLN A 1 53 ? 10.785  -6.351  -4.161  1.00 0.00 ? 53 GLN A OE1  10 
ATOM 8688  N NE2  . GLN A 1 53 ? 9.265   -5.390  -2.805  1.00 0.00 ? 53 GLN A NE2  10 
ATOM 8689  H H    . GLN A 1 53 ? 9.701   -4.843  -0.429  1.00 0.00 ? 53 GLN A H    10 
ATOM 8690  H HA   . GLN A 1 53 ? 8.881   -7.416  0.023   1.00 0.00 ? 53 GLN A HA   10 
ATOM 8691  H HB2  . GLN A 1 53 ? 11.365  -6.091  -0.981  1.00 0.00 ? 53 GLN A HB2  10 
ATOM 8692  H HB3  . GLN A 1 53 ? 11.549  -7.756  -0.467  1.00 0.00 ? 53 GLN A HB3  10 
ATOM 8693  H HG2  . GLN A 1 53 ? 10.782  -8.316  -2.537  1.00 0.00 ? 53 GLN A HG2  10 
ATOM 8694  H HG3  . GLN A 1 53 ? 9.194   -7.886  -1.933  1.00 0.00 ? 53 GLN A HG3  10 
ATOM 8695  H HE21 . GLN A 1 53 ? 8.746   -5.454  -1.953  1.00 0.00 ? 53 GLN A HE21 10 
ATOM 8696  H HE22 . GLN A 1 53 ? 9.144   -4.599  -3.406  1.00 0.00 ? 53 GLN A HE22 10 
ATOM 8697  N N    . GLU A 1 54 ? 9.373   -7.638  2.492   1.00 0.00 ? 54 GLU A N    10 
ATOM 8698  C CA   . GLU A 1 54 ? 9.735   -8.033  3.843   1.00 0.00 ? 54 GLU A CA   10 
ATOM 8699  C C    . GLU A 1 54 ? 10.653  -9.257  3.810   1.00 0.00 ? 54 GLU A C    10 
ATOM 8700  O O    . GLU A 1 54 ? 10.183  -10.392 3.877   1.00 0.00 ? 54 GLU A O    10 
ATOM 8701  C CB   . GLU A 1 54 ? 8.489   -8.305  4.687   1.00 0.00 ? 54 GLU A CB   10 
ATOM 8702  C CG   . GLU A 1 54 ? 7.628   -9.403  4.057   1.00 0.00 ? 54 GLU A CG   10 
ATOM 8703  C CD   . GLU A 1 54 ? 6.244   -8.868  3.684   1.00 0.00 ? 54 GLU A CD   10 
ATOM 8704  O OE1  . GLU A 1 54 ? 5.722   -8.049  4.470   1.00 0.00 ? 54 GLU A OE1  10 
ATOM 8705  O OE2  . GLU A 1 54 ? 5.741   -9.290  2.621   1.00 0.00 ? 54 GLU A OE2  10 
ATOM 8706  H H    . GLU A 1 54 ? 8.403   -7.738  2.268   1.00 0.00 ? 54 GLU A H    10 
ATOM 8707  H HA   . GLU A 1 54 ? 10.270  -7.180  4.260   1.00 0.00 ? 54 GLU A HA   10 
ATOM 8708  H HB2  . GLU A 1 54 ? 8.785   -8.603  5.693   1.00 0.00 ? 54 GLU A HB2  10 
ATOM 8709  H HB3  . GLU A 1 54 ? 7.904   -7.391  4.785   1.00 0.00 ? 54 GLU A HB3  10 
ATOM 8710  H HG2  . GLU A 1 54 ? 8.124   -9.792  3.168   1.00 0.00 ? 54 GLU A HG2  10 
ATOM 8711  H HG3  . GLU A 1 54 ? 7.525   -10.234 4.754   1.00 0.00 ? 54 GLU A HG3  10 
ATOM 8712  N N    . ALA A 1 55 ? 11.946  -8.985  3.706   1.00 0.00 ? 55 ALA A N    10 
ATOM 8713  C CA   . ALA A 1 55 ? 12.934  -10.049 3.663   1.00 0.00 ? 55 ALA A CA   10 
ATOM 8714  C C    . ALA A 1 55 ? 13.998  -9.795  4.732   1.00 0.00 ? 55 ALA A C    10 
ATOM 8715  O O    . ALA A 1 55 ? 14.479  -8.672  4.879   1.00 0.00 ? 55 ALA A O    10 
ATOM 8716  C CB   . ALA A 1 55 ? 13.529  -10.137 2.257   1.00 0.00 ? 55 ALA A CB   10 
ATOM 8717  H H    . ALA A 1 55 ? 12.320  -8.059  3.652   1.00 0.00 ? 55 ALA A H    10 
ATOM 8718  H HA   . ALA A 1 55 ? 12.422  -10.986 3.888   1.00 0.00 ? 55 ALA A HA   10 
ATOM 8719  H HB1  . ALA A 1 55 ? 14.147  -11.032 2.179   1.00 0.00 ? 55 ALA A HB1  10 
ATOM 8720  H HB2  . ALA A 1 55 ? 12.724  -10.187 1.524   1.00 0.00 ? 55 ALA A HB2  10 
ATOM 8721  H HB3  . ALA A 1 55 ? 14.140  -9.256  2.065   1.00 0.00 ? 55 ALA A HB3  10 
ATOM 8722  N N    . GLU A 1 56 ? 14.335  -10.855 5.451   1.00 0.00 ? 56 GLU A N    10 
ATOM 8723  C CA   . GLU A 1 56 ? 15.334  -10.760 6.502   1.00 0.00 ? 56 GLU A CA   10 
ATOM 8724  C C    . GLU A 1 56 ? 16.038  -12.106 6.688   1.00 0.00 ? 56 GLU A C    10 
ATOM 8725  O O    . GLU A 1 56 ? 15.412  -13.089 7.080   1.00 0.00 ? 56 GLU A O    10 
ATOM 8726  C CB   . GLU A 1 56 ? 14.706  -10.284 7.814   1.00 0.00 ? 56 GLU A CB   10 
ATOM 8727  C CG   . GLU A 1 56 ? 15.776  -10.066 8.886   1.00 0.00 ? 56 GLU A CG   10 
ATOM 8728  C CD   . GLU A 1 56 ? 15.655  -11.107 10.001  1.00 0.00 ? 56 GLU A CD   10 
ATOM 8729  O OE1  . GLU A 1 56 ? 14.500  -11.411 10.371  1.00 0.00 ? 56 GLU A OE1  10 
ATOM 8730  O OE2  . GLU A 1 56 ? 16.720  -11.574 10.459  1.00 0.00 ? 56 GLU A OE2  10 
ATOM 8731  H H    . GLU A 1 56 ? 13.939  -11.765 5.326   1.00 0.00 ? 56 GLU A H    10 
ATOM 8732  H HA   . GLU A 1 56 ? 16.048  -10.013 6.157   1.00 0.00 ? 56 GLU A HA   10 
ATOM 8733  H HB2  . GLU A 1 56 ? 14.161  -9.356  7.645   1.00 0.00 ? 56 GLU A HB2  10 
ATOM 8734  H HB3  . GLU A 1 56 ? 13.982  -11.020 8.163   1.00 0.00 ? 56 GLU A HB3  10 
ATOM 8735  H HG2  . GLU A 1 56 ? 16.766  -10.125 8.434   1.00 0.00 ? 56 GLU A HG2  10 
ATOM 8736  H HG3  . GLU A 1 56 ? 15.676  -9.065  9.306   1.00 0.00 ? 56 GLU A HG3  10 
ATOM 8737  N N    . CYS A 1 57 ? 17.331  -12.106 6.397   1.00 0.00 ? 57 CYS A N    10 
ATOM 8738  C CA   . CYS A 1 57 ? 18.127  -13.314 6.527   1.00 0.00 ? 57 CYS A CA   10 
ATOM 8739  C C    . CYS A 1 57 ? 17.481  -14.410 5.677   1.00 0.00 ? 57 CYS A C    10 
ATOM 8740  O O    . CYS A 1 57 ? 16.530  -15.059 6.112   1.00 0.00 ? 57 CYS A O    10 
ATOM 8741  C CB   . CYS A 1 57 ? 18.275  -13.740 7.990   1.00 0.00 ? 57 CYS A CB   10 
ATOM 8742  S SG   . CYS A 1 57 ? 18.819  -15.470 8.234   1.00 0.00 ? 57 CYS A SG   10 
ATOM 8743  H H    . CYS A 1 57 ? 17.833  -11.302 6.079   1.00 0.00 ? 57 CYS A H    10 
ATOM 8744  H HA   . CYS A 1 57 ? 19.124  -13.074 6.157   1.00 0.00 ? 57 CYS A HA   10 
ATOM 8745  H HB2  . CYS A 1 57 ? 18.990  -13.077 8.476   1.00 0.00 ? 57 CYS A HB2  10 
ATOM 8746  H HB3  . CYS A 1 57 ? 17.318  -13.600 8.493   1.00 0.00 ? 57 CYS A HB3  10 
ATOM 8747  N N    . THR A 1 58 ? 18.021  -14.581 4.480   1.00 0.00 ? 58 THR A N    10 
ATOM 8748  C CA   . THR A 1 58 ? 17.509  -15.587 3.564   1.00 0.00 ? 58 THR A CA   10 
ATOM 8749  C C    . THR A 1 58 ? 18.656  -16.225 2.778   1.00 0.00 ? 58 THR A C    10 
ATOM 8750  O O    . THR A 1 58 ? 18.734  -17.448 2.670   1.00 0.00 ? 58 THR A O    10 
ATOM 8751  C CB   . THR A 1 58 ? 16.457  -14.923 2.674   1.00 0.00 ? 58 THR A CB   10 
ATOM 8752  O OG1  . THR A 1 58 ? 16.147  -15.918 1.702   1.00 0.00 ? 58 THR A OG1  10 
ATOM 8753  C CG2  . THR A 1 58 ? 17.030  -13.766 1.853   1.00 0.00 ? 58 THR A CG2  10 
ATOM 8754  H H    . THR A 1 58 ? 18.794  -14.049 4.134   1.00 0.00 ? 58 THR A H    10 
ATOM 8755  H HA   . THR A 1 58 ? 17.043  -16.379 4.150   1.00 0.00 ? 58 THR A HA   10 
ATOM 8756  H HB   . THR A 1 58 ? 15.599  -14.596 3.262   1.00 0.00 ? 58 THR A HB   10 
ATOM 8757  H HG1  . THR A 1 58 ? 16.912  -16.025 1.067   1.00 0.00 ? 58 THR A HG1  10 
ATOM 8758  H HG21 . THR A 1 58 ? 17.456  -13.020 2.524   1.00 0.00 ? 58 THR A HG21 10 
ATOM 8759  H HG22 . THR A 1 58 ? 17.807  -14.142 1.188   1.00 0.00 ? 58 THR A HG22 10 
ATOM 8760  H HG23 . THR A 1 58 ? 16.235  -13.310 1.262   1.00 0.00 ? 58 THR A HG23 10 
ATOM 8761  N N    . PHE A 1 59 ? 19.516  -15.369 2.248   1.00 0.00 ? 59 PHE A N    10 
ATOM 8762  C CA   . PHE A 1 59 ? 20.655  -15.834 1.474   1.00 0.00 ? 59 PHE A CA   10 
ATOM 8763  C C    . PHE A 1 59 ? 21.616  -16.644 2.347   1.00 0.00 ? 59 PHE A C    10 
ATOM 8764  O O    . PHE A 1 59 ? 21.217  -17.193 3.373   1.00 0.00 ? 59 PHE A O    10 
ATOM 8765  C CB   . PHE A 1 59 ? 21.381  -14.592 0.954   1.00 0.00 ? 59 PHE A CB   10 
ATOM 8766  C CG   . PHE A 1 59 ? 22.612  -14.902 0.100   1.00 0.00 ? 59 PHE A CG   10 
ATOM 8767  C CD1  . PHE A 1 59 ? 22.490  -15.671 -1.014  1.00 0.00 ? 59 PHE A CD1  10 
ATOM 8768  C CD2  . PHE A 1 59 ? 23.828  -14.408 0.456   1.00 0.00 ? 59 PHE A CD2  10 
ATOM 8769  C CE1  . PHE A 1 59 ? 23.632  -15.959 -1.807  1.00 0.00 ? 59 PHE A CE1  10 
ATOM 8770  C CE2  . PHE A 1 59 ? 24.970  -14.695 -0.337  1.00 0.00 ? 59 PHE A CE2  10 
ATOM 8771  C CZ   . PHE A 1 59 ? 24.849  -15.465 -1.451  1.00 0.00 ? 59 PHE A CZ   10 
ATOM 8772  H H    . PHE A 1 59 ? 19.446  -14.376 2.340   1.00 0.00 ? 59 PHE A H    10 
ATOM 8773  H HA   . PHE A 1 59 ? 20.267  -16.470 0.678   1.00 0.00 ? 59 PHE A HA   10 
ATOM 8774  H HB2  . PHE A 1 59 ? 20.683  -13.996 0.366   1.00 0.00 ? 59 PHE A HB2  10 
ATOM 8775  H HB3  . PHE A 1 59 ? 21.685  -13.979 1.803   1.00 0.00 ? 59 PHE A HB3  10 
ATOM 8776  H HD1  . PHE A 1 59 ? 21.515  -16.067 -1.299  1.00 0.00 ? 59 PHE A HD1  10 
ATOM 8777  H HD2  . PHE A 1 59 ? 23.926  -13.791 1.349   1.00 0.00 ? 59 PHE A HD2  10 
ATOM 8778  H HE1  . PHE A 1 59 ? 23.535  -16.576 -2.700  1.00 0.00 ? 59 PHE A HE1  10 
ATOM 8779  H HE2  . PHE A 1 59 ? 25.945  -14.299 -0.052  1.00 0.00 ? 59 PHE A HE2  10 
ATOM 8780  H HZ   . PHE A 1 59 ? 25.726  -15.686 -2.060  1.00 0.00 ? 59 PHE A HZ   10 
ATOM 8781  N N    . GLU A 1 1  ? 4.689   -18.174 14.836  1.00 0.00 ? 1  GLU A N    11 
ATOM 8782  C CA   . GLU A 1 1  ? 5.781   -17.942 15.767  1.00 0.00 ? 1  GLU A CA   11 
ATOM 8783  C C    . GLU A 1 1  ? 7.045   -17.528 15.010  1.00 0.00 ? 1  GLU A C    11 
ATOM 8784  O O    . GLU A 1 1  ? 8.064   -18.213 15.076  1.00 0.00 ? 1  GLU A O    11 
ATOM 8785  C CB   . GLU A 1 1  ? 6.039   -19.180 16.628  1.00 0.00 ? 1  GLU A CB   11 
ATOM 8786  C CG   . GLU A 1 1  ? 6.500   -20.360 15.770  1.00 0.00 ? 1  GLU A CG   11 
ATOM 8787  C CD   . GLU A 1 1  ? 7.828   -20.923 16.279  1.00 0.00 ? 1  GLU A CD   11 
ATOM 8788  O OE1  . GLU A 1 1  ? 7.841   -21.383 17.441  1.00 0.00 ? 1  GLU A OE1  11 
ATOM 8789  O OE2  . GLU A 1 1  ? 8.801   -20.879 15.494  1.00 0.00 ? 1  GLU A OE2  11 
ATOM 8790  H H    . GLU A 1 1  ? 4.594   -19.119 14.523  1.00 0.00 ? 1  GLU A H    11 
ATOM 8791  H HA   . GLU A 1 1  ? 5.448   -17.125 16.406  1.00 0.00 ? 1  GLU A HA   11 
ATOM 8792  H HB2  . GLU A 1 1  ? 6.797   -18.954 17.378  1.00 0.00 ? 1  GLU A HB2  11 
ATOM 8793  H HB3  . GLU A 1 1  ? 5.130   -19.450 17.165  1.00 0.00 ? 1  GLU A HB3  11 
ATOM 8794  H HG2  . GLU A 1 1  ? 5.741   -21.142 15.782  1.00 0.00 ? 1  GLU A HG2  11 
ATOM 8795  H HG3  . GLU A 1 1  ? 6.610   -20.039 14.734  1.00 0.00 ? 1  GLU A HG3  11 
ATOM 8796  N N    . GLU A 1 2  ? 6.936   -16.410 14.308  1.00 0.00 ? 2  GLU A N    11 
ATOM 8797  C CA   . GLU A 1 2  ? 8.057   -15.896 13.539  1.00 0.00 ? 2  GLU A CA   11 
ATOM 8798  C C    . GLU A 1 2  ? 8.077   -14.367 13.587  1.00 0.00 ? 2  GLU A C    11 
ATOM 8799  O O    . GLU A 1 2  ? 8.985   -13.773 14.168  1.00 0.00 ? 2  GLU A O    11 
ATOM 8800  C CB   . GLU A 1 2  ? 8.007   -16.399 12.095  1.00 0.00 ? 2  GLU A CB   11 
ATOM 8801  C CG   . GLU A 1 2  ? 9.414   -16.680 11.564  1.00 0.00 ? 2  GLU A CG   11 
ATOM 8802  C CD   . GLU A 1 2  ? 9.358   -17.340 10.184  1.00 0.00 ? 2  GLU A CD   11 
ATOM 8803  O OE1  . GLU A 1 2  ? 8.633   -18.351 10.069  1.00 0.00 ? 2  GLU A OE1  11 
ATOM 8804  O OE2  . GLU A 1 2  ? 10.041  -16.817 9.277   1.00 0.00 ? 2  GLU A OE2  11 
ATOM 8805  H H    . GLU A 1 2  ? 6.103   -15.859 14.260  1.00 0.00 ? 2  GLU A H    11 
ATOM 8806  H HA   . GLU A 1 2  ? 8.948   -16.294 14.025  1.00 0.00 ? 2  GLU A HA   11 
ATOM 8807  H HB2  . GLU A 1 2  ? 7.407   -17.307 12.043  1.00 0.00 ? 2  GLU A HB2  11 
ATOM 8808  H HB3  . GLU A 1 2  ? 7.518   -15.657 11.464  1.00 0.00 ? 2  GLU A HB3  11 
ATOM 8809  H HG2  . GLU A 1 2  ? 9.976   -15.748 11.502  1.00 0.00 ? 2  GLU A HG2  11 
ATOM 8810  H HG3  . GLU A 1 2  ? 9.947   -17.328 12.259  1.00 0.00 ? 2  GLU A HG3  11 
ATOM 8811  N N    . TYR A 1 3  ? 7.067   -13.774 12.970  1.00 0.00 ? 3  TYR A N    11 
ATOM 8812  C CA   . TYR A 1 3  ? 6.957   -12.326 12.935  1.00 0.00 ? 3  TYR A CA   11 
ATOM 8813  C C    . TYR A 1 3  ? 5.585   -11.892 12.417  1.00 0.00 ? 3  TYR A C    11 
ATOM 8814  O O    . TYR A 1 3  ? 4.792   -12.723 11.976  1.00 0.00 ? 3  TYR A O    11 
ATOM 8815  C CB   . TYR A 1 3  ? 8.033   -11.845 11.958  1.00 0.00 ? 3  TYR A CB   11 
ATOM 8816  C CG   . TYR A 1 3  ? 7.717   -12.140 10.490  1.00 0.00 ? 3  TYR A CG   11 
ATOM 8817  C CD1  . TYR A 1 3  ? 8.102   -13.341 9.930   1.00 0.00 ? 3  TYR A CD1  11 
ATOM 8818  C CD2  . TYR A 1 3  ? 7.048   -11.205 9.727   1.00 0.00 ? 3  TYR A CD2  11 
ATOM 8819  C CE1  . TYR A 1 3  ? 7.805   -13.618 8.548   1.00 0.00 ? 3  TYR A CE1  11 
ATOM 8820  C CE2  . TYR A 1 3  ? 6.751   -11.482 8.346   1.00 0.00 ? 3  TYR A CE2  11 
ATOM 8821  C CZ   . TYR A 1 3  ? 7.145   -12.675 7.824   1.00 0.00 ? 3  TYR A CZ   11 
ATOM 8822  O OH   . TYR A 1 3  ? 6.864   -12.937 6.520   1.00 0.00 ? 3  TYR A OH   11 
ATOM 8823  H H    . TYR A 1 3  ? 6.333   -14.265 12.500  1.00 0.00 ? 3  TYR A H    11 
ATOM 8824  H HA   . TYR A 1 3  ? 7.088   -11.954 13.951  1.00 0.00 ? 3  TYR A HA   11 
ATOM 8825  H HB2  . TYR A 1 3  ? 8.167   -10.770 12.082  1.00 0.00 ? 3  TYR A HB2  11 
ATOM 8826  H HB3  . TYR A 1 3  ? 8.981   -12.316 12.217  1.00 0.00 ? 3  TYR A HB3  11 
ATOM 8827  H HD1  . TYR A 1 3  ? 8.631   -14.079 10.532  1.00 0.00 ? 3  TYR A HD1  11 
ATOM 8828  H HD2  . TYR A 1 3  ? 6.744   -10.256 10.170  1.00 0.00 ? 3  TYR A HD2  11 
ATOM 8829  H HE1  . TYR A 1 3  ? 8.104   -14.562 8.093   1.00 0.00 ? 3  TYR A HE1  11 
ATOM 8830  H HE2  . TYR A 1 3  ? 6.223   -10.753 7.732   1.00 0.00 ? 3  TYR A HE2  11 
ATOM 8831  H HH   . TYR A 1 3  ? 7.534   -12.487 5.929   1.00 0.00 ? 3  TYR A HH   11 
ATOM 8832  N N    . VAL A 1 4  ? 5.345   -10.590 12.487  1.00 0.00 ? 4  VAL A N    11 
ATOM 8833  C CA   . VAL A 1 4  ? 4.082   -10.036 12.030  1.00 0.00 ? 4  VAL A CA   11 
ATOM 8834  C C    . VAL A 1 4  ? 4.136   -8.510  12.126  1.00 0.00 ? 4  VAL A C    11 
ATOM 8835  O O    . VAL A 1 4  ? 4.020   -7.948  13.214  1.00 0.00 ? 4  VAL A O    11 
ATOM 8836  C CB   . VAL A 1 4  ? 2.926   -10.644 12.826  1.00 0.00 ? 4  VAL A CB   11 
ATOM 8837  C CG1  . VAL A 1 4  ? 3.139   -10.461 14.330  1.00 0.00 ? 4  VAL A CG1  11 
ATOM 8838  C CG2  . VAL A 1 4  ? 1.586   -10.052 12.385  1.00 0.00 ? 4  VAL A CG2  11 
ATOM 8839  H H    . VAL A 1 4  ? 5.995   -9.921  12.846  1.00 0.00 ? 4  VAL A H    11 
ATOM 8840  H HA   . VAL A 1 4  ? 3.958   -10.318 10.985  1.00 0.00 ? 4  VAL A HA   11 
ATOM 8841  H HB   . VAL A 1 4  ? 2.903   -11.714 12.619  1.00 0.00 ? 4  VAL A HB   11 
ATOM 8842  H HG11 . VAL A 1 4  ? 4.181   -10.204 14.521  1.00 0.00 ? 4  VAL A HG11 11 
ATOM 8843  H HG12 . VAL A 1 4  ? 2.495   -9.659  14.693  1.00 0.00 ? 4  VAL A HG12 11 
ATOM 8844  H HG13 . VAL A 1 4  ? 2.892   -11.388 14.848  1.00 0.00 ? 4  VAL A HG13 11 
ATOM 8845  H HG21 . VAL A 1 4  ? 1.732   -9.020  12.067  1.00 0.00 ? 4  VAL A HG21 11 
ATOM 8846  H HG22 . VAL A 1 4  ? 1.186   -10.635 11.556  1.00 0.00 ? 4  VAL A HG22 11 
ATOM 8847  H HG23 . VAL A 1 4  ? 0.885   -10.079 13.219  1.00 0.00 ? 4  VAL A HG23 11 
ATOM 8848  N N    . GLY A 1 5  ? 4.312   -7.882  10.972  1.00 0.00 ? 5  GLY A N    11 
ATOM 8849  C CA   . GLY A 1 5  ? 4.383   -6.432  10.912  1.00 0.00 ? 5  GLY A CA   11 
ATOM 8850  C C    . GLY A 1 5  ? 2.986   -5.812  10.985  1.00 0.00 ? 5  GLY A C    11 
ATOM 8851  O O    . GLY A 1 5  ? 2.240   -5.836  10.007  1.00 0.00 ? 5  GLY A O    11 
ATOM 8852  H H    . GLY A 1 5  ? 4.406   -8.347  10.091  1.00 0.00 ? 5  GLY A H    11 
ATOM 8853  H HA2  . GLY A 1 5  ? 4.993   -6.060  11.734  1.00 0.00 ? 5  GLY A HA2  11 
ATOM 8854  H HA3  . GLY A 1 5  ? 4.872   -6.127  9.987   1.00 0.00 ? 5  GLY A HA3  11 
ATOM 8855  N N    . LEU A 1 6  ? 2.674   -5.271  12.154  1.00 0.00 ? 6  LEU A N    11 
ATOM 8856  C CA   . LEU A 1 6  ? 1.380   -4.645  12.367  1.00 0.00 ? 6  LEU A CA   11 
ATOM 8857  C C    . LEU A 1 6  ? 1.579   -3.153  12.639  1.00 0.00 ? 6  LEU A C    11 
ATOM 8858  O O    . LEU A 1 6  ? 1.478   -2.707  13.781  1.00 0.00 ? 6  LEU A O    11 
ATOM 8859  C CB   . LEU A 1 6  ? 0.609   -5.374  13.470  1.00 0.00 ? 6  LEU A CB   11 
ATOM 8860  C CG   . LEU A 1 6  ? 1.357   -5.581  14.788  1.00 0.00 ? 6  LEU A CG   11 
ATOM 8861  C CD1  . LEU A 1 6  ? 0.694   -4.801  15.924  1.00 0.00 ? 6  LEU A CD1  11 
ATOM 8862  C CD2  . LEU A 1 6  ? 1.489   -7.070  15.115  1.00 0.00 ? 6  LEU A CD2  11 
ATOM 8863  H H    . LEU A 1 6  ? 3.287   -5.256  12.944  1.00 0.00 ? 6  LEU A H    11 
ATOM 8864  H HA   . LEU A 1 6  ? 0.808   -4.756  11.446  1.00 0.00 ? 6  LEU A HA   11 
ATOM 8865  H HB2  . LEU A 1 6  ? -0.304  -4.814  13.677  1.00 0.00 ? 6  LEU A HB2  11 
ATOM 8866  H HB3  . LEU A 1 6  ? 0.305   -6.349  13.090  1.00 0.00 ? 6  LEU A HB3  11 
ATOM 8867  H HG   . LEU A 1 6  ? 2.367   -5.186  14.673  1.00 0.00 ? 6  LEU A HG   11 
ATOM 8868  H HD11 . LEU A 1 6  ? -0.384  -4.962  15.894  1.00 0.00 ? 6  LEU A HD11 11 
ATOM 8869  H HD12 . LEU A 1 6  ? 1.087   -5.147  16.880  1.00 0.00 ? 6  LEU A HD12 11 
ATOM 8870  H HD13 . LEU A 1 6  ? 0.906   -3.738  15.807  1.00 0.00 ? 6  LEU A HD13 11 
ATOM 8871  H HD21 . LEU A 1 6  ? 1.951   -7.587  14.274  1.00 0.00 ? 6  LEU A HD21 11 
ATOM 8872  H HD22 . LEU A 1 6  ? 2.109   -7.193  16.003  1.00 0.00 ? 6  LEU A HD22 11 
ATOM 8873  H HD23 . LEU A 1 6  ? 0.500   -7.490  15.301  1.00 0.00 ? 6  LEU A HD23 11 
ATOM 8874  N N    . SER A 1 7  ? 1.857   -2.422  11.570  1.00 0.00 ? 7  SER A N    11 
ATOM 8875  C CA   . SER A 1 7  ? 2.071   -0.988  11.678  1.00 0.00 ? 7  SER A CA   11 
ATOM 8876  C C    . SER A 1 7  ? 2.315   -0.389  10.292  1.00 0.00 ? 7  SER A C    11 
ATOM 8877  O O    . SER A 1 7  ? 1.369   -0.045  9.585   1.00 0.00 ? 7  SER A O    11 
ATOM 8878  C CB   . SER A 1 7  ? 3.247   -0.675  12.606  1.00 0.00 ? 7  SER A CB   11 
ATOM 8879  O OG   . SER A 1 7  ? 4.345   -1.559  12.393  1.00 0.00 ? 7  SER A OG   11 
ATOM 8880  H H    . SER A 1 7  ? 1.938   -2.792  10.644  1.00 0.00 ? 7  SER A H    11 
ATOM 8881  H HA   . SER A 1 7  ? 1.152   -0.592  12.110  1.00 0.00 ? 7  SER A HA   11 
ATOM 8882  H HB2  . SER A 1 7  ? 3.572   0.352   12.445  1.00 0.00 ? 7  SER A HB2  11 
ATOM 8883  H HB3  . SER A 1 7  ? 2.919   -0.747  13.643  1.00 0.00 ? 7  SER A HB3  11 
ATOM 8884  H HG   . SER A 1 7  ? 4.076   -2.295  11.773  1.00 0.00 ? 7  SER A HG   11 
ATOM 8885  N N    . ALA A 1 8  ? 3.589   -0.282  9.944   1.00 0.00 ? 8  ALA A N    11 
ATOM 8886  C CA   . ALA A 1 8  ? 3.969   0.269   8.655   1.00 0.00 ? 8  ALA A CA   11 
ATOM 8887  C C    . ALA A 1 8  ? 5.104   -0.568  8.061   1.00 0.00 ? 8  ALA A C    11 
ATOM 8888  O O    . ALA A 1 8  ? 5.743   -0.157  7.094   1.00 0.00 ? 8  ALA A O    11 
ATOM 8889  C CB   . ALA A 1 8  ? 4.356   1.740   8.823   1.00 0.00 ? 8  ALA A CB   11 
ATOM 8890  H H    . ALA A 1 8  ? 4.353   -0.564  10.525  1.00 0.00 ? 8  ALA A H    11 
ATOM 8891  H HA   . ALA A 1 8  ? 3.101   0.208   7.998   1.00 0.00 ? 8  ALA A HA   11 
ATOM 8892  H HB1  . ALA A 1 8  ? 4.677   1.916   9.850   1.00 0.00 ? 8  ALA A HB1  11 
ATOM 8893  H HB2  . ALA A 1 8  ? 5.172   1.981   8.141   1.00 0.00 ? 8  ALA A HB2  11 
ATOM 8894  H HB3  . ALA A 1 8  ? 3.496   2.370   8.598   1.00 0.00 ? 8  ALA A HB3  11 
ATOM 8895  N N    . ASN A 1 9  ? 5.319   -1.728  8.665   1.00 0.00 ? 9  ASN A N    11 
ATOM 8896  C CA   . ASN A 1 9  ? 6.365   -2.627  8.208   1.00 0.00 ? 9  ASN A CA   11 
ATOM 8897  C C    . ASN A 1 9  ? 6.135   -2.962  6.733   1.00 0.00 ? 9  ASN A C    11 
ATOM 8898  O O    . ASN A 1 9  ? 7.058   -2.884  5.923   1.00 0.00 ? 9  ASN A O    11 
ATOM 8899  C CB   . ASN A 1 9  ? 6.349   -3.937  8.998   1.00 0.00 ? 9  ASN A CB   11 
ATOM 8900  C CG   . ASN A 1 9  ? 7.446   -4.885  8.509   1.00 0.00 ? 9  ASN A CG   11 
ATOM 8901  O OD1  . ASN A 1 9  ? 7.387   -5.436  7.422   1.00 0.00 ? 9  ASN A OD1  11 
ATOM 8902  N ND2  . ASN A 1 9  ? 8.447   -5.044  9.370   1.00 0.00 ? 9  ASN A ND2  11 
ATOM 8903  H H    . ASN A 1 9  ? 4.794   -2.055  9.450   1.00 0.00 ? 9  ASN A H    11 
ATOM 8904  H HA   . ASN A 1 9  ? 7.298   -2.088  8.372   1.00 0.00 ? 9  ASN A HA   11 
ATOM 8905  H HB2  . ASN A 1 9  ? 6.490   -3.728  10.058  1.00 0.00 ? 9  ASN A HB2  11 
ATOM 8906  H HB3  . ASN A 1 9  ? 5.376   -4.417  8.895   1.00 0.00 ? 9  ASN A HB3  11 
ATOM 8907  H HD21 . ASN A 1 9  ? 8.434   -4.562  10.246  1.00 0.00 ? 9  ASN A HD21 11 
ATOM 8908  H HD22 . ASN A 1 9  ? 9.213   -5.645  9.141   1.00 0.00 ? 9  ASN A HD22 11 
ATOM 8909  N N    . GLN A 1 10 ? 4.899   -3.327  6.427   1.00 0.00 ? 10 GLN A N    11 
ATOM 8910  C CA   . GLN A 1 10 ? 4.536   -3.675  5.064   1.00 0.00 ? 10 GLN A CA   11 
ATOM 8911  C C    . GLN A 1 10 ? 4.602   -2.438  4.166   1.00 0.00 ? 10 GLN A C    11 
ATOM 8912  O O    . GLN A 1 10 ? 5.008   -2.528  3.008   1.00 0.00 ? 10 GLN A O    11 
ATOM 8913  C CB   . GLN A 1 10 ? 3.148   -4.316  5.012   1.00 0.00 ? 10 GLN A CB   11 
ATOM 8914  C CG   . GLN A 1 10 ? 2.174   -3.592  5.944   1.00 0.00 ? 10 GLN A CG   11 
ATOM 8915  C CD   . GLN A 1 10 ? 1.888   -4.426  7.194   1.00 0.00 ? 10 GLN A CD   11 
ATOM 8916  O OE1  . GLN A 1 10 ? 1.381   -5.534  7.130   1.00 0.00 ? 10 GLN A OE1  11 
ATOM 8917  N NE2  . GLN A 1 10 ? 2.241   -3.835  8.332   1.00 0.00 ? 10 GLN A NE2  11 
ATOM 8918  H H    . GLN A 1 10 ? 4.153   -3.388  7.092   1.00 0.00 ? 10 GLN A H    11 
ATOM 8919  H HA   . GLN A 1 10 ? 5.279   -4.405  4.743   1.00 0.00 ? 10 GLN A HA   11 
ATOM 8920  H HB2  . GLN A 1 10 ? 2.768   -4.288  3.991   1.00 0.00 ? 10 GLN A HB2  11 
ATOM 8921  H HB3  . GLN A 1 10 ? 3.217   -5.366  5.298   1.00 0.00 ? 10 GLN A HB3  11 
ATOM 8922  H HG2  . GLN A 1 10 ? 2.591   -2.628  6.234   1.00 0.00 ? 10 GLN A HG2  11 
ATOM 8923  H HG3  . GLN A 1 10 ? 1.242   -3.390  5.416   1.00 0.00 ? 10 GLN A HG3  11 
ATOM 8924  H HE21 . GLN A 1 10 ? 2.653   -2.924  8.315   1.00 0.00 ? 10 GLN A HE21 11 
ATOM 8925  H HE22 . GLN A 1 10 ? 2.094   -4.301  9.204   1.00 0.00 ? 10 GLN A HE22 11 
ATOM 8926  N N    . CYS A 1 11 ? 4.196   -1.311  4.733   1.00 0.00 ? 11 CYS A N    11 
ATOM 8927  C CA   . CYS A 1 11 ? 4.204   -0.058  3.998   1.00 0.00 ? 11 CYS A CA   11 
ATOM 8928  C C    . CYS A 1 11 ? 5.309   0.830   4.575   1.00 0.00 ? 11 CYS A C    11 
ATOM 8929  O O    . CYS A 1 11 ? 5.095   2.017   4.815   1.00 0.00 ? 11 CYS A O    11 
ATOM 8930  C CB   . CYS A 1 11 ? 2.839   0.631   4.040   1.00 0.00 ? 11 CYS A CB   11 
ATOM 8931  S SG   . CYS A 1 11 ? 1.449   -0.448  4.544   1.00 0.00 ? 11 CYS A SG   11 
ATOM 8932  H H    . CYS A 1 11 ? 3.867   -1.247  5.675   1.00 0.00 ? 11 CYS A H    11 
ATOM 8933  H HA   . CYS A 1 11 ? 4.411   -0.307  2.957   1.00 0.00 ? 11 CYS A HA   11 
ATOM 8934  H HB2  . CYS A 1 11 ? 2.894   1.474   4.729   1.00 0.00 ? 11 CYS A HB2  11 
ATOM 8935  H HB3  . CYS A 1 11 ? 2.623   1.039   3.053   1.00 0.00 ? 11 CYS A HB3  11 
ATOM 8936  N N    . ALA A 1 12 ? 6.467   0.220   4.780   1.00 0.00 ? 12 ALA A N    11 
ATOM 8937  C CA   . ALA A 1 12 ? 7.606   0.940   5.323   1.00 0.00 ? 12 ALA A CA   11 
ATOM 8938  C C    . ALA A 1 12 ? 8.598   1.242   4.197   1.00 0.00 ? 12 ALA A C    11 
ATOM 8939  O O    . ALA A 1 12 ? 9.803   1.058   4.361   1.00 0.00 ? 12 ALA A O    11 
ATOM 8940  C CB   . ALA A 1 12 ? 8.237   0.122   6.452   1.00 0.00 ? 12 ALA A CB   11 
ATOM 8941  H H    . ALA A 1 12 ? 6.634   -0.746  4.581   1.00 0.00 ? 12 ALA A H    11 
ATOM 8942  H HA   . ALA A 1 12 ? 7.239   1.880   5.734   1.00 0.00 ? 12 ALA A HA   11 
ATOM 8943  H HB1  . ALA A 1 12 ? 9.295   -0.033  6.241   1.00 0.00 ? 12 ALA A HB1  11 
ATOM 8944  H HB2  . ALA A 1 12 ? 8.128   0.659   7.394   1.00 0.00 ? 12 ALA A HB2  11 
ATOM 8945  H HB3  . ALA A 1 12 ? 7.736   -0.844  6.524   1.00 0.00 ? 12 ALA A HB3  11 
ATOM 8946  N N    . VAL A 1 13 ? 8.053   1.699   3.079   1.00 0.00 ? 13 VAL A N    11 
ATOM 8947  C CA   . VAL A 1 13 ? 8.875   2.028   1.927   1.00 0.00 ? 13 VAL A CA   11 
ATOM 8948  C C    . VAL A 1 13 ? 9.104   3.540   1.884   1.00 0.00 ? 13 VAL A C    11 
ATOM 8949  O O    . VAL A 1 13 ? 8.311   4.307   2.427   1.00 0.00 ? 13 VAL A O    11 
ATOM 8950  C CB   . VAL A 1 13 ? 8.229   1.485   0.651   1.00 0.00 ? 13 VAL A CB   11 
ATOM 8951  C CG1  . VAL A 1 13 ? 9.259   0.766   -0.222  1.00 0.00 ? 13 VAL A CG1  11 
ATOM 8952  C CG2  . VAL A 1 13 ? 7.052   0.564   0.982   1.00 0.00 ? 13 VAL A CG2  11 
ATOM 8953  H H    . VAL A 1 13 ? 7.072   1.846   2.954   1.00 0.00 ? 13 VAL A H    11 
ATOM 8954  H HA   . VAL A 1 13 ? 9.837   1.531   2.056   1.00 0.00 ? 13 VAL A HA   11 
ATOM 8955  H HB   . VAL A 1 13 ? 7.842   2.332   0.085   1.00 0.00 ? 13 VAL A HB   11 
ATOM 8956  H HG11 . VAL A 1 13 ? 10.212  0.719   0.304   1.00 0.00 ? 13 VAL A HG11 11 
ATOM 8957  H HG12 . VAL A 1 13 ? 8.912   -0.245  -0.437  1.00 0.00 ? 13 VAL A HG12 11 
ATOM 8958  H HG13 . VAL A 1 13 ? 9.387   1.312   -1.157  1.00 0.00 ? 13 VAL A HG13 11 
ATOM 8959  H HG21 . VAL A 1 13 ? 7.347   -0.135  1.764   1.00 0.00 ? 13 VAL A HG21 11 
ATOM 8960  H HG22 . VAL A 1 13 ? 6.209   1.162   1.327   1.00 0.00 ? 13 VAL A HG22 11 
ATOM 8961  H HG23 . VAL A 1 13 ? 6.763   0.009   0.089   1.00 0.00 ? 13 VAL A HG23 11 
ATOM 8962  N N    . PRO A 1 14 ? 10.222  3.934   1.216   1.00 0.00 ? 14 PRO A N    11 
ATOM 8963  C CA   . PRO A 1 14 ? 10.565  5.340   1.095   1.00 0.00 ? 14 PRO A CA   11 
ATOM 8964  C C    . PRO A 1 14 ? 9.666   6.038   0.073   1.00 0.00 ? 14 PRO A C    11 
ATOM 8965  O O    . PRO A 1 14 ? 8.970   6.996   0.404   1.00 0.00 ? 14 PRO A O    11 
ATOM 8966  C CB   . PRO A 1 14 ? 12.033  5.354   0.703   1.00 0.00 ? 14 PRO A CB   11 
ATOM 8967  C CG   . PRO A 1 14 ? 12.335  3.964   0.167   1.00 0.00 ? 14 PRO A CG   11 
ATOM 8968  C CD   . PRO A 1 14 ? 11.184  3.053   0.561   1.00 0.00 ? 14 PRO A CD   11 
ATOM 8969  H HA   . PRO A 1 14 ? 10.409  5.812   1.963   1.00 0.00 ? 14 PRO A HA   11 
ATOM 8970  H HB2  . PRO A 1 14 ? 12.228  6.115   -0.053  1.00 0.00 ? 14 PRO A HB2  11 
ATOM 8971  H HB3  . PRO A 1 14 ? 12.664  5.588   1.561   1.00 0.00 ? 14 PRO A HB3  11 
ATOM 8972  H HG2  . PRO A 1 14 ? 12.448  3.990   -0.917  1.00 0.00 ? 14 PRO A HG2  11 
ATOM 8973  H HG3  . PRO A 1 14 ? 13.274  3.593   0.577   1.00 0.00 ? 14 PRO A HG3  11 
ATOM 8974  H HD2  . PRO A 1 14 ? 10.747  2.568   -0.312  1.00 0.00 ? 14 PRO A HD2  11 
ATOM 8975  H HD3  . PRO A 1 14 ? 11.518  2.262   1.232   1.00 0.00 ? 14 PRO A HD3  11 
ATOM 8976  N N    . ALA A 1 15 ? 9.710   5.531   -1.150  1.00 0.00 ? 15 ALA A N    11 
ATOM 8977  C CA   . ALA A 1 15 ? 8.909   6.093   -2.224  1.00 0.00 ? 15 ALA A CA   11 
ATOM 8978  C C    . ALA A 1 15 ? 9.495   5.665   -3.570  1.00 0.00 ? 15 ALA A C    11 
ATOM 8979  O O    . ALA A 1 15 ? 8.782   5.608   -4.572  1.00 0.00 ? 15 ALA A O    11 
ATOM 8980  C CB   . ALA A 1 15 ? 8.847   7.614   -2.072  1.00 0.00 ? 15 ALA A CB   11 
ATOM 8981  H H    . ALA A 1 15 ? 10.279  4.751   -1.412  1.00 0.00 ? 15 ALA A H    11 
ATOM 8982  H HA   . ALA A 1 15 ? 7.900   5.690   -2.131  1.00 0.00 ? 15 ALA A HA   11 
ATOM 8983  H HB1  . ALA A 1 15 ? 9.675   7.951   -1.448  1.00 0.00 ? 15 ALA A HB1  11 
ATOM 8984  H HB2  . ALA A 1 15 ? 7.903   7.895   -1.605  1.00 0.00 ? 15 ALA A HB2  11 
ATOM 8985  H HB3  . ALA A 1 15 ? 8.919   8.081   -3.054  1.00 0.00 ? 15 ALA A HB3  11 
ATOM 8986  N N    . LYS A 1 16 ? 10.787  5.375   -3.552  1.00 0.00 ? 16 LYS A N    11 
ATOM 8987  C CA   . LYS A 1 16 ? 11.477  4.953   -4.759  1.00 0.00 ? 16 LYS A CA   11 
ATOM 8988  C C    . LYS A 1 16 ? 11.405  3.429   -4.877  1.00 0.00 ? 16 LYS A C    11 
ATOM 8989  O O    . LYS A 1 16 ? 11.853  2.858   -5.870  1.00 0.00 ? 16 LYS A O    11 
ATOM 8990  C CB   . LYS A 1 16 ? 12.904  5.505   -4.781  1.00 0.00 ? 16 LYS A CB   11 
ATOM 8991  C CG   . LYS A 1 16 ? 13.754  4.871   -3.679  1.00 0.00 ? 16 LYS A CG   11 
ATOM 8992  C CD   . LYS A 1 16 ? 14.393  3.566   -4.161  1.00 0.00 ? 16 LYS A CD   11 
ATOM 8993  C CE   . LYS A 1 16 ? 15.916  3.691   -4.222  1.00 0.00 ? 16 LYS A CE   11 
ATOM 8994  N NZ   . LYS A 1 16 ? 16.556  2.390   -3.924  1.00 0.00 ? 16 LYS A NZ   11 
ATOM 8995  H H    . LYS A 1 16 ? 11.360  5.423   -2.733  1.00 0.00 ? 16 LYS A H    11 
ATOM 8996  H HA   . LYS A 1 16 ? 10.949  5.391   -5.607  1.00 0.00 ? 16 LYS A HA   11 
ATOM 8997  H HB2  . LYS A 1 16 ? 13.358  5.311   -5.753  1.00 0.00 ? 16 LYS A HB2  11 
ATOM 8998  H HB3  . LYS A 1 16 ? 12.881  6.587   -4.651  1.00 0.00 ? 16 LYS A HB3  11 
ATOM 8999  H HG2  . LYS A 1 16 ? 14.533  5.568   -3.369  1.00 0.00 ? 16 LYS A HG2  11 
ATOM 9000  H HG3  . LYS A 1 16 ? 13.135  4.675   -2.804  1.00 0.00 ? 16 LYS A HG3  11 
ATOM 9001  H HD2  . LYS A 1 16 ? 14.118  2.753   -3.490  1.00 0.00 ? 16 LYS A HD2  11 
ATOM 9002  H HD3  . LYS A 1 16 ? 14.006  3.310   -5.147  1.00 0.00 ? 16 LYS A HD3  11 
ATOM 9003  H HE2  . LYS A 1 16 ? 16.220  4.035   -5.211  1.00 0.00 ? 16 LYS A HE2  11 
ATOM 9004  H HE3  . LYS A 1 16 ? 16.255  4.442   -3.507  1.00 0.00 ? 16 LYS A HE3  11 
ATOM 9005  H HZ1  . LYS A 1 16 ? 15.849  1.697   -3.782  1.00 0.00 ? 16 LYS A HZ1  11 
ATOM 9006  H HZ2  . LYS A 1 16 ? 17.137  2.121   -4.692  1.00 0.00 ? 16 LYS A HZ2  11 
ATOM 9007  H HZ3  . LYS A 1 16 ? 17.112  2.474   -3.098  1.00 0.00 ? 16 LYS A HZ3  11 
ATOM 9008  N N    . ASP A 1 17 ? 10.839  2.814   -3.849  1.00 0.00 ? 17 ASP A N    11 
ATOM 9009  C CA   . ASP A 1 17 ? 10.702  1.368   -3.825  1.00 0.00 ? 17 ASP A CA   11 
ATOM 9010  C C    . ASP A 1 17 ? 9.219   0.999   -3.889  1.00 0.00 ? 17 ASP A C    11 
ATOM 9011  O O    . ASP A 1 17 ? 8.847   -0.141  -3.614  1.00 0.00 ? 17 ASP A O    11 
ATOM 9012  C CB   . ASP A 1 17 ? 11.281  0.782   -2.536  1.00 0.00 ? 17 ASP A CB   11 
ATOM 9013  C CG   . ASP A 1 17 ? 12.611  0.043   -2.701  1.00 0.00 ? 17 ASP A CG   11 
ATOM 9014  O OD1  . ASP A 1 17 ? 12.674  -0.817  -3.606  1.00 0.00 ? 17 ASP A OD1  11 
ATOM 9015  O OD2  . ASP A 1 17 ? 13.534  0.356   -1.919  1.00 0.00 ? 17 ASP A OD2  11 
ATOM 9016  H H    . ASP A 1 17 ? 10.477  3.286   -3.045  1.00 0.00 ? 17 ASP A H    11 
ATOM 9017  H HA   . ASP A 1 17 ? 11.258  1.014   -4.694  1.00 0.00 ? 17 ASP A HA   11 
ATOM 9018  H HB2  . ASP A 1 17 ? 11.418  1.589   -1.817  1.00 0.00 ? 17 ASP A HB2  11 
ATOM 9019  H HB3  . ASP A 1 17 ? 10.551  0.094   -2.108  1.00 0.00 ? 17 ASP A HB3  11 
ATOM 9020  N N    . ARG A 1 18 ? 8.412   1.984   -4.253  1.00 0.00 ? 18 ARG A N    11 
ATOM 9021  C CA   . ARG A 1 18 ? 6.977   1.777   -4.356  1.00 0.00 ? 18 ARG A CA   11 
ATOM 9022  C C    . ARG A 1 18 ? 6.641   1.022   -5.644  1.00 0.00 ? 18 ARG A C    11 
ATOM 9023  O O    . ARG A 1 18 ? 6.642   1.605   -6.727  1.00 0.00 ? 18 ARG A O    11 
ATOM 9024  C CB   . ARG A 1 18 ? 6.226   3.110   -4.343  1.00 0.00 ? 18 ARG A CB   11 
ATOM 9025  C CG   . ARG A 1 18 ? 6.825   4.067   -3.311  1.00 0.00 ? 18 ARG A CG   11 
ATOM 9026  C CD   . ARG A 1 18 ? 6.379   3.695   -1.895  1.00 0.00 ? 18 ARG A CD   11 
ATOM 9027  N NE   . ARG A 1 18 ? 6.084   4.920   -1.119  1.00 0.00 ? 18 ARG A NE   11 
ATOM 9028  C CZ   . ARG A 1 18 ? 5.921   4.946   0.211   1.00 0.00 ? 18 ARG A CZ   11 
ATOM 9029  N NH1  . ARG A 1 18 ? 6.022   3.813   0.920   1.00 0.00 ? 18 ARG A NH1  11 
ATOM 9030  N NH2  . ARG A 1 18 ? 5.655   6.103   0.831   1.00 0.00 ? 18 ARG A NH2  11 
ATOM 9031  H H    . ARG A 1 18 ? 8.722   2.908   -4.475  1.00 0.00 ? 18 ARG A H    11 
ATOM 9032  H HA   . ARG A 1 18 ? 6.717   1.188   -3.477  1.00 0.00 ? 18 ARG A HA   11 
ATOM 9033  H HB2  . ARG A 1 18 ? 6.268   3.565   -5.333  1.00 0.00 ? 18 ARG A HB2  11 
ATOM 9034  H HB3  . ARG A 1 18 ? 5.174   2.936   -4.117  1.00 0.00 ? 18 ARG A HB3  11 
ATOM 9035  H HG2  . ARG A 1 18 ? 7.913   4.040   -3.372  1.00 0.00 ? 18 ARG A HG2  11 
ATOM 9036  H HG3  . ARG A 1 18 ? 6.518   5.088   -3.535  1.00 0.00 ? 18 ARG A HG3  11 
ATOM 9037  H HD2  . ARG A 1 18 ? 5.494   3.060   -1.939  1.00 0.00 ? 18 ARG A HD2  11 
ATOM 9038  H HD3  . ARG A 1 18 ? 7.160   3.119   -1.398  1.00 0.00 ? 18 ARG A HD3  11 
ATOM 9039  H HE   . ARG A 1 18 ? 6.002   5.783   -1.618  1.00 0.00 ? 18 ARG A HE   11 
ATOM 9040  H HH11 . ARG A 1 18 ? 6.220   2.949   0.458   1.00 0.00 ? 18 ARG A HH11 11 
ATOM 9041  H HH12 . ARG A 1 18 ? 5.900   3.833   1.913   1.00 0.00 ? 18 ARG A HH12 11 
ATOM 9042  H HH21 . ARG A 1 18 ? 5.580   6.949   0.302   1.00 0.00 ? 18 ARG A HH21 11 
ATOM 9043  H HH22 . ARG A 1 18 ? 5.533   6.123   1.824   1.00 0.00 ? 18 ARG A HH22 11 
ATOM 9044  N N    . VAL A 1 19 ? 6.361   -0.263  -5.483  1.00 0.00 ? 19 VAL A N    11 
ATOM 9045  C CA   . VAL A 1 19 ? 6.023   -1.103  -6.619  1.00 0.00 ? 19 VAL A CA   11 
ATOM 9046  C C    . VAL A 1 19 ? 4.708   -0.620  -7.233  1.00 0.00 ? 19 VAL A C    11 
ATOM 9047  O O    . VAL A 1 19 ? 4.364   -0.999  -8.351  1.00 0.00 ? 19 VAL A O    11 
ATOM 9048  C CB   . VAL A 1 19 ? 5.979   -2.571  -6.189  1.00 0.00 ? 19 VAL A CB   11 
ATOM 9049  C CG1  . VAL A 1 19 ? 5.742   -3.487  -7.392  1.00 0.00 ? 19 VAL A CG1  11 
ATOM 9050  C CG2  . VAL A 1 19 ? 7.256   -2.963  -5.444  1.00 0.00 ? 19 VAL A CG2  11 
ATOM 9051  H H    . VAL A 1 19 ? 6.362   -0.729  -4.598  1.00 0.00 ? 19 VAL A H    11 
ATOM 9052  H HA   . VAL A 1 19 ? 6.817   -0.992  -7.358  1.00 0.00 ? 19 VAL A HA   11 
ATOM 9053  H HB   . VAL A 1 19 ? 5.140   -2.694  -5.504  1.00 0.00 ? 19 VAL A HB   11 
ATOM 9054  H HG11 . VAL A 1 19 ? 6.005   -2.959  -8.308  1.00 0.00 ? 19 VAL A HG11 11 
ATOM 9055  H HG12 . VAL A 1 19 ? 6.361   -4.379  -7.296  1.00 0.00 ? 19 VAL A HG12 11 
ATOM 9056  H HG13 . VAL A 1 19 ? 4.691   -3.775  -7.427  1.00 0.00 ? 19 VAL A HG13 11 
ATOM 9057  H HG21 . VAL A 1 19 ? 7.879   -2.080  -5.301  1.00 0.00 ? 19 VAL A HG21 11 
ATOM 9058  H HG22 . VAL A 1 19 ? 6.995   -3.384  -4.473  1.00 0.00 ? 19 VAL A HG22 11 
ATOM 9059  H HG23 . VAL A 1 19 ? 7.803   -3.704  -6.026  1.00 0.00 ? 19 VAL A HG23 11 
ATOM 9060  N N    . ASP A 1 20 ? 4.008   0.211   -6.474  1.00 0.00 ? 20 ASP A N    11 
ATOM 9061  C CA   . ASP A 1 20 ? 2.738   0.750   -6.929  1.00 0.00 ? 20 ASP A CA   11 
ATOM 9062  C C    . ASP A 1 20 ? 1.769   -0.401  -7.205  1.00 0.00 ? 20 ASP A C    11 
ATOM 9063  O O    . ASP A 1 20 ? 2.023   -1.237  -8.071  1.00 0.00 ? 20 ASP A O    11 
ATOM 9064  C CB   . ASP A 1 20 ? 2.909   1.545   -8.225  1.00 0.00 ? 20 ASP A CB   11 
ATOM 9065  C CG   . ASP A 1 20 ? 1.614   1.820   -8.992  1.00 0.00 ? 20 ASP A CG   11 
ATOM 9066  O OD1  . ASP A 1 20 ? 1.223   0.934   -9.782  1.00 0.00 ? 20 ASP A OD1  11 
ATOM 9067  O OD2  . ASP A 1 20 ? 1.044   2.909   -8.770  1.00 0.00 ? 20 ASP A OD2  11 
ATOM 9068  H H    . ASP A 1 20 ? 4.295   0.515   -5.565  1.00 0.00 ? 20 ASP A H    11 
ATOM 9069  H HA   . ASP A 1 20 ? 2.396   1.399   -6.122  1.00 0.00 ? 20 ASP A HA   11 
ATOM 9070  H HB2  . ASP A 1 20 ? 3.384   2.497   -7.990  1.00 0.00 ? 20 ASP A HB2  11 
ATOM 9071  H HB3  . ASP A 1 20 ? 3.592   1.001   -8.879  1.00 0.00 ? 20 ASP A HB3  11 
ATOM 9072  N N    . CYS A 1 21 ? 0.678   -0.408  -6.453  1.00 0.00 ? 21 CYS A N    11 
ATOM 9073  C CA   . CYS A 1 21 ? -0.330  -1.443  -6.605  1.00 0.00 ? 21 CYS A CA   11 
ATOM 9074  C C    . CYS A 1 21 ? -1.301  -1.010  -7.705  1.00 0.00 ? 21 CYS A C    11 
ATOM 9075  O O    . CYS A 1 21 ? -1.982  -1.843  -8.300  1.00 0.00 ? 21 CYS A O    11 
ATOM 9076  C CB   . CYS A 1 21 ? -1.051  -1.729  -5.287  1.00 0.00 ? 21 CYS A CB   11 
ATOM 9077  S SG   . CYS A 1 21 ? -1.326  -3.503  -4.930  1.00 0.00 ? 21 CYS A SG   11 
ATOM 9078  H H    . CYS A 1 21 ? 0.479   0.276   -5.751  1.00 0.00 ? 21 CYS A H    11 
ATOM 9079  H HA   . CYS A 1 21 ? 0.197   -2.354  -6.891  1.00 0.00 ? 21 CYS A HA   11 
ATOM 9080  H HB2  . CYS A 1 21 ? -0.474  -1.294  -4.471  1.00 0.00 ? 21 CYS A HB2  11 
ATOM 9081  H HB3  . CYS A 1 21 ? -2.016  -1.222  -5.300  1.00 0.00 ? 21 CYS A HB3  11 
ATOM 9082  N N    . GLY A 1 22 ? -1.333  0.293   -7.942  1.00 0.00 ? 22 GLY A N    11 
ATOM 9083  C CA   . GLY A 1 22 ? -2.209  0.848   -8.960  1.00 0.00 ? 22 GLY A CA   11 
ATOM 9084  C C    . GLY A 1 22 ? -3.679  0.681   -8.568  1.00 0.00 ? 22 GLY A C    11 
ATOM 9085  O O    . GLY A 1 22 ? -4.302  -0.327  -8.897  1.00 0.00 ? 22 GLY A O    11 
ATOM 9086  H H    . GLY A 1 22 ? -0.775  0.965   -7.453  1.00 0.00 ? 22 GLY A H    11 
ATOM 9087  H HA2  . GLY A 1 22 ? -1.985  1.905   -9.102  1.00 0.00 ? 22 GLY A HA2  11 
ATOM 9088  H HA3  . GLY A 1 22 ? -2.025  0.352   -9.913  1.00 0.00 ? 22 GLY A HA3  11 
ATOM 9089  N N    . TYR A 1 23 ? -4.190  1.685   -7.871  1.00 0.00 ? 23 TYR A N    11 
ATOM 9090  C CA   . TYR A 1 23 ? -5.575  1.662   -7.431  1.00 0.00 ? 23 TYR A CA   11 
ATOM 9091  C C    . TYR A 1 23 ? -6.251  3.011   -7.680  1.00 0.00 ? 23 TYR A C    11 
ATOM 9092  O O    . TYR A 1 23 ? -5.600  4.054   -7.638  1.00 0.00 ? 23 TYR A O    11 
ATOM 9093  C CB   . TYR A 1 23 ? -5.534  1.396   -5.925  1.00 0.00 ? 23 TYR A CB   11 
ATOM 9094  C CG   . TYR A 1 23 ? -5.569  -0.088  -5.554  1.00 0.00 ? 23 TYR A CG   11 
ATOM 9095  C CD1  . TYR A 1 23 ? -6.712  -0.829  -5.781  1.00 0.00 ? 23 TYR A CD1  11 
ATOM 9096  C CD2  . TYR A 1 23 ? -4.459  -0.686  -4.994  1.00 0.00 ? 23 TYR A CD2  11 
ATOM 9097  C CE1  . TYR A 1 23 ? -6.745  -2.226  -5.432  1.00 0.00 ? 23 TYR A CE1  11 
ATOM 9098  C CE2  . TYR A 1 23 ? -4.492  -2.083  -4.645  1.00 0.00 ? 23 TYR A CE2  11 
ATOM 9099  C CZ   . TYR A 1 23 ? -5.634  -2.784  -4.881  1.00 0.00 ? 23 TYR A CZ   11 
ATOM 9100  O OH   . TYR A 1 23 ? -5.665  -4.103  -4.552  1.00 0.00 ? 23 TYR A OH   11 
ATOM 9101  H H    . TYR A 1 23 ? -3.676  2.501   -7.607  1.00 0.00 ? 23 TYR A H    11 
ATOM 9102  H HA   . TYR A 1 23 ? -6.096  0.892   -8.000  1.00 0.00 ? 23 TYR A HA   11 
ATOM 9103  H HB2  . TYR A 1 23 ? -4.629  1.841   -5.511  1.00 0.00 ? 23 TYR A HB2  11 
ATOM 9104  H HB3  . TYR A 1 23 ? -6.380  1.897   -5.454  1.00 0.00 ? 23 TYR A HB3  11 
ATOM 9105  H HD1  . TYR A 1 23 ? -7.589  -0.357  -6.223  1.00 0.00 ? 23 TYR A HD1  11 
ATOM 9106  H HD2  . TYR A 1 23 ? -3.557  -0.101  -4.815  1.00 0.00 ? 23 TYR A HD2  11 
ATOM 9107  H HE1  . TYR A 1 23 ? -7.641  -2.823  -5.605  1.00 0.00 ? 23 TYR A HE1  11 
ATOM 9108  H HE2  . TYR A 1 23 ? -3.622  -2.568  -4.202  1.00 0.00 ? 23 TYR A HE2  11 
ATOM 9109  H HH   . TYR A 1 23 ? -5.678  -4.207  -3.558  1.00 0.00 ? 23 TYR A HH   11 
ATOM 9110  N N    . PRO A 1 24 ? -7.585  2.946   -7.940  1.00 0.00 ? 24 PRO A N    11 
ATOM 9111  C CA   . PRO A 1 24 ? -8.357  4.150   -8.196  1.00 0.00 ? 24 PRO A CA   11 
ATOM 9112  C C    . PRO A 1 24 ? -8.612  4.924   -6.900  1.00 0.00 ? 24 PRO A C    11 
ATOM 9113  O O    . PRO A 1 24 ? -8.002  5.965   -6.664  1.00 0.00 ? 24 PRO A O    11 
ATOM 9114  C CB   . PRO A 1 24 ? -9.635  3.664   -8.859  1.00 0.00 ? 24 PRO A CB   11 
ATOM 9115  C CG   . PRO A 1 24 ? -9.738  2.184   -8.530  1.00 0.00 ? 24 PRO A CG   11 
ATOM 9116  C CD   . PRO A 1 24 ? -8.389  1.730   -7.997  1.00 0.00 ? 24 PRO A CD   11 
ATOM 9117  H HA   . PRO A 1 24 ? -7.845  4.772   -8.789  1.00 0.00 ? 24 PRO A HA   11 
ATOM 9118  H HB2  . PRO A 1 24 ? -10.502 4.209   -8.483  1.00 0.00 ? 24 PRO A HB2  11 
ATOM 9119  H HB3  . PRO A 1 24 ? -9.601  3.824   -9.936  1.00 0.00 ? 24 PRO A HB3  11 
ATOM 9120  H HG2  . PRO A 1 24 ? -10.520 2.010   -7.790  1.00 0.00 ? 24 PRO A HG2  11 
ATOM 9121  H HG3  . PRO A 1 24 ? -10.009 1.613   -9.419  1.00 0.00 ? 24 PRO A HG3  11 
ATOM 9122  H HD2  . PRO A 1 24 ? -8.486  1.272   -7.012  1.00 0.00 ? 24 PRO A HD2  11 
ATOM 9123  H HD3  . PRO A 1 24 ? -7.936  0.985   -8.651  1.00 0.00 ? 24 PRO A HD3  11 
ATOM 9124  N N    . HIS A 1 25 ? -9.515  4.384   -6.094  1.00 0.00 ? 25 HIS A N    11 
ATOM 9125  C CA   . HIS A 1 25 ? -9.858  5.010   -4.829  1.00 0.00 ? 25 HIS A CA   11 
ATOM 9126  C C    . HIS A 1 25 ? -8.936  4.482   -3.728  1.00 0.00 ? 25 HIS A C    11 
ATOM 9127  O O    . HIS A 1 25 ? -9.288  3.544   -3.015  1.00 0.00 ? 25 HIS A O    11 
ATOM 9128  C CB   . HIS A 1 25 ? -11.340 4.809   -4.508  1.00 0.00 ? 25 HIS A CB   11 
ATOM 9129  C CG   . HIS A 1 25 ? -11.717 3.376   -4.217  1.00 0.00 ? 25 HIS A CG   11 
ATOM 9130  N ND1  . HIS A 1 25 ? -12.972 3.007   -3.767  1.00 0.00 ? 25 HIS A ND1  11 
ATOM 9131  C CD2  . HIS A 1 25 ? -10.990 2.225   -4.317  1.00 0.00 ? 25 HIS A CD2  11 
ATOM 9132  C CE1  . HIS A 1 25 ? -12.990 1.692   -3.607  1.00 0.00 ? 25 HIS A CE1  11 
ATOM 9133  N NE2  . HIS A 1 25 ? -11.760 1.209   -3.948  1.00 0.00 ? 25 HIS A NE2  11 
ATOM 9134  H H    . HIS A 1 25 ? -10.006 3.536   -6.293  1.00 0.00 ? 25 HIS A H    11 
ATOM 9135  H HA   . HIS A 1 25 ? -9.687  6.079   -4.953  1.00 0.00 ? 25 HIS A HA   11 
ATOM 9136  H HB2  . HIS A 1 25 ? -11.602 5.424   -3.647  1.00 0.00 ? 25 HIS A HB2  11 
ATOM 9137  H HB3  . HIS A 1 25 ? -11.935 5.167   -5.348  1.00 0.00 ? 25 HIS A HB3  11 
ATOM 9138  H HD1  . HIS A 1 25 ? -13.737 3.627   -3.593  1.00 0.00 ? 25 HIS A HD1  11 
ATOM 9139  H HD2  . HIS A 1 25 ? -9.953  2.153   -4.646  1.00 0.00 ? 25 HIS A HD2  11 
ATOM 9140  H HE1  . HIS A 1 25 ? -13.837 1.099   -3.263  1.00 0.00 ? 25 HIS A HE1  11 
ATOM 9141  H HE2  . HIS A 1 25 ? -11.502 0.244   -3.977  1.00 0.00 ? 25 HIS A HE2  11 
ATOM 9142  N N    . VAL A 1 26 ? -7.773  5.108   -3.624  1.00 0.00 ? 26 VAL A N    11 
ATOM 9143  C CA   . VAL A 1 26 ? -6.797  4.714   -2.622  1.00 0.00 ? 26 VAL A CA   11 
ATOM 9144  C C    . VAL A 1 26 ? -6.940  5.615   -1.395  1.00 0.00 ? 26 VAL A C    11 
ATOM 9145  O O    . VAL A 1 26 ? -7.139  6.822   -1.526  1.00 0.00 ? 26 VAL A O    11 
ATOM 9146  C CB   . VAL A 1 26 ? -5.390  4.740   -3.223  1.00 0.00 ? 26 VAL A CB   11 
ATOM 9147  C CG1  . VAL A 1 26 ? -5.231  3.658   -4.293  1.00 0.00 ? 26 VAL A CG1  11 
ATOM 9148  C CG2  . VAL A 1 26 ? -5.061  6.123   -3.788  1.00 0.00 ? 26 VAL A CG2  11 
ATOM 9149  H H    . VAL A 1 26 ? -7.494  5.871   -4.208  1.00 0.00 ? 26 VAL A H    11 
ATOM 9150  H HA   . VAL A 1 26 ? -7.021  3.687   -2.332  1.00 0.00 ? 26 VAL A HA   11 
ATOM 9151  H HB   . VAL A 1 26 ? -4.681  4.527   -2.423  1.00 0.00 ? 26 VAL A HB   11 
ATOM 9152  H HG11 . VAL A 1 26 ? -5.987  3.797   -5.066  1.00 0.00 ? 26 VAL A HG11 11 
ATOM 9153  H HG12 . VAL A 1 26 ? -4.239  3.731   -4.739  1.00 0.00 ? 26 VAL A HG12 11 
ATOM 9154  H HG13 . VAL A 1 26 ? -5.353  2.675   -3.837  1.00 0.00 ? 26 VAL A HG13 11 
ATOM 9155  H HG21 . VAL A 1 26 ? -5.754  6.857   -3.377  1.00 0.00 ? 26 VAL A HG21 11 
ATOM 9156  H HG22 . VAL A 1 26 ? -4.041  6.393   -3.515  1.00 0.00 ? 26 VAL A HG22 11 
ATOM 9157  H HG23 . VAL A 1 26 ? -5.154  6.103   -4.874  1.00 0.00 ? 26 VAL A HG23 11 
ATOM 9158  N N    . THR A 1 27 ? -6.832  4.995   -0.229  1.00 0.00 ? 27 THR A N    11 
ATOM 9159  C CA   . THR A 1 27 ? -6.947  5.727   1.022   1.00 0.00 ? 27 THR A CA   11 
ATOM 9160  C C    . THR A 1 27 ? -6.168  5.015   2.129   1.00 0.00 ? 27 THR A C    11 
ATOM 9161  O O    . THR A 1 27 ? -5.683  3.901   1.935   1.00 0.00 ? 27 THR A O    11 
ATOM 9162  C CB   . THR A 1 27 ? -8.435  5.895   1.336   1.00 0.00 ? 27 THR A CB   11 
ATOM 9163  O OG1  . THR A 1 27 ? -8.775  4.708   2.049   1.00 0.00 ? 27 THR A OG1  11 
ATOM 9164  C CG2  . THR A 1 27 ? -9.309  5.839   0.082   1.00 0.00 ? 27 THR A CG2  11 
ATOM 9165  H H    . THR A 1 27 ? -6.670  4.013   -0.130  1.00 0.00 ? 27 THR A H    11 
ATOM 9166  H HA   . THR A 1 27 ? -6.490  6.707   0.889   1.00 0.00 ? 27 THR A HA   11 
ATOM 9167  H HB   . THR A 1 27 ? -8.613  6.813   1.895   1.00 0.00 ? 27 THR A HB   11 
ATOM 9168  H HG1  . THR A 1 27 ? -9.551  4.884   2.655   1.00 0.00 ? 27 THR A HG1  11 
ATOM 9169  H HG21 . THR A 1 27 ? -9.055  4.952   -0.499  1.00 0.00 ? 27 THR A HG21 11 
ATOM 9170  H HG22 . THR A 1 27 ? -10.359 5.796   0.372   1.00 0.00 ? 27 THR A HG22 11 
ATOM 9171  H HG23 . THR A 1 27 ? -9.135  6.730   -0.522  1.00 0.00 ? 27 THR A HG23 11 
ATOM 9172  N N    . PRO A 1 28 ? -6.070  5.704   3.298   1.00 0.00 ? 28 PRO A N    11 
ATOM 9173  C CA   . PRO A 1 28 ? -5.359  5.150   4.437   1.00 0.00 ? 28 PRO A CA   11 
ATOM 9174  C C    . PRO A 1 28 ? -6.180  4.051   5.114   1.00 0.00 ? 28 PRO A C    11 
ATOM 9175  O O    . PRO A 1 28 ? -6.216  3.965   6.340   1.00 0.00 ? 28 PRO A O    11 
ATOM 9176  C CB   . PRO A 1 28 ? -5.089  6.336   5.347   1.00 0.00 ? 28 PRO A CB   11 
ATOM 9177  C CG   . PRO A 1 28 ? -6.058  7.424   4.914   1.00 0.00 ? 28 PRO A CG   11 
ATOM 9178  C CD   . PRO A 1 28 ? -6.633  7.025   3.564   1.00 0.00 ? 28 PRO A CD   11 
ATOM 9179  H HA   . PRO A 1 28 ? -4.511  4.712   4.137   1.00 0.00 ? 28 PRO A HA   11 
ATOM 9180  H HB2  . PRO A 1 28 ? -5.243  6.069   6.393   1.00 0.00 ? 28 PRO A HB2  11 
ATOM 9181  H HB3  . PRO A 1 28 ? -4.057  6.674   5.254   1.00 0.00 ? 28 PRO A HB3  11 
ATOM 9182  H HG2  . PRO A 1 28 ? -6.855  7.540   5.648   1.00 0.00 ? 28 PRO A HG2  11 
ATOM 9183  H HG3  . PRO A 1 28 ? -5.548  8.384   4.843   1.00 0.00 ? 28 PRO A HG3  11 
ATOM 9184  H HD2  . PRO A 1 28 ? -7.722  6.994   3.591   1.00 0.00 ? 28 PRO A HD2  11 
ATOM 9185  H HD3  . PRO A 1 28 ? -6.353  7.738   2.788   1.00 0.00 ? 28 PRO A HD3  11 
ATOM 9186  N N    . LYS A 1 29 ? -6.818  3.238   4.285   1.00 0.00 ? 29 LYS A N    11 
ATOM 9187  C CA   . LYS A 1 29 ? -7.636  2.148   4.789   1.00 0.00 ? 29 LYS A CA   11 
ATOM 9188  C C    . LYS A 1 29 ? -8.221  1.368   3.610   1.00 0.00 ? 29 LYS A C    11 
ATOM 9189  O O    . LYS A 1 29 ? -8.113  0.143   3.556   1.00 0.00 ? 29 LYS A O    11 
ATOM 9190  C CB   . LYS A 1 29 ? -8.693  2.676   5.761   1.00 0.00 ? 29 LYS A CB   11 
ATOM 9191  C CG   . LYS A 1 29 ? -9.054  1.618   6.806   1.00 0.00 ? 29 LYS A CG   11 
ATOM 9192  C CD   . LYS A 1 29 ? -10.010 0.575   6.224   1.00 0.00 ? 29 LYS A CD   11 
ATOM 9193  C CE   . LYS A 1 29 ? -10.246 -0.567  7.215   1.00 0.00 ? 29 LYS A CE   11 
ATOM 9194  N NZ   . LYS A 1 29 ? -11.331 -0.217  8.159   1.00 0.00 ? 29 LYS A NZ   11 
ATOM 9195  H H    . LYS A 1 29 ? -6.783  3.314   3.289   1.00 0.00 ? 29 LYS A H    11 
ATOM 9196  H HA   . LYS A 1 29 ? -6.983  1.482   5.353   1.00 0.00 ? 29 LYS A HA   11 
ATOM 9197  H HB2  . LYS A 1 29 ? -8.320  3.571   6.259   1.00 0.00 ? 29 LYS A HB2  11 
ATOM 9198  H HB3  . LYS A 1 29 ? -9.587  2.967   5.210   1.00 0.00 ? 29 LYS A HB3  11 
ATOM 9199  H HG2  . LYS A 1 29 ? -8.147  1.128   7.161   1.00 0.00 ? 29 LYS A HG2  11 
ATOM 9200  H HG3  . LYS A 1 29 ? -9.515  2.097   7.670   1.00 0.00 ? 29 LYS A HG3  11 
ATOM 9201  H HD2  . LYS A 1 29 ? -10.960 1.047   5.974   1.00 0.00 ? 29 LYS A HD2  11 
ATOM 9202  H HD3  . LYS A 1 29 ? -9.598  0.177   5.296   1.00 0.00 ? 29 LYS A HD3  11 
ATOM 9203  H HE2  . LYS A 1 29 ? -10.504 -1.477  6.675   1.00 0.00 ? 29 LYS A HE2  11 
ATOM 9204  H HE3  . LYS A 1 29 ? -9.329  -0.773  7.767   1.00 0.00 ? 29 LYS A HE3  11 
ATOM 9205  H HZ1  . LYS A 1 29 ? -12.066 0.246   7.664   1.00 0.00 ? 29 LYS A HZ1  11 
ATOM 9206  H HZ2  . LYS A 1 29 ? -11.687 -1.051  8.580   1.00 0.00 ? 29 LYS A HZ2  11 
ATOM 9207  H HZ3  . LYS A 1 29 ? -10.973 0.389   8.869   1.00 0.00 ? 29 LYS A HZ3  11 
ATOM 9208  N N    . GLU A 1 30 ? -8.828  2.108   2.694   1.00 0.00 ? 30 GLU A N    11 
ATOM 9209  C CA   . GLU A 1 30 ? -9.430  1.501   1.519   1.00 0.00 ? 30 GLU A CA   11 
ATOM 9210  C C    . GLU A 1 30 ? -8.351  0.872   0.635   1.00 0.00 ? 30 GLU A C    11 
ATOM 9211  O O    . GLU A 1 30 ? -8.510  -0.251  0.160   1.00 0.00 ? 30 GLU A O    11 
ATOM 9212  C CB   . GLU A 1 30 ? -10.254 2.524   0.735   1.00 0.00 ? 30 GLU A CB   11 
ATOM 9213  C CG   . GLU A 1 30 ? -10.738 1.937   -0.592  1.00 0.00 ? 30 GLU A CG   11 
ATOM 9214  C CD   . GLU A 1 30 ? -12.192 2.327   -0.866  1.00 0.00 ? 30 GLU A CD   11 
ATOM 9215  O OE1  . GLU A 1 30 ? -12.405 3.502   -1.235  1.00 0.00 ? 30 GLU A OE1  11 
ATOM 9216  O OE2  . GLU A 1 30 ? -13.058 1.441   -0.701  1.00 0.00 ? 30 GLU A OE2  11 
ATOM 9217  H H    . GLU A 1 30 ? -8.912  3.104   2.745   1.00 0.00 ? 30 GLU A H    11 
ATOM 9218  H HA   . GLU A 1 30 ? -10.094 0.726   1.901   1.00 0.00 ? 30 GLU A HA   11 
ATOM 9219  H HB2  . GLU A 1 30 ? -11.110 2.841   1.330   1.00 0.00 ? 30 GLU A HB2  11 
ATOM 9220  H HB3  . GLU A 1 30 ? -9.652  3.413   0.545   1.00 0.00 ? 30 GLU A HB3  11 
ATOM 9221  H HG2  . GLU A 1 30 ? -10.104 2.292   -1.404  1.00 0.00 ? 30 GLU A HG2  11 
ATOM 9222  H HG3  . GLU A 1 30 ? -10.648 0.851   -0.568  1.00 0.00 ? 30 GLU A HG3  11 
ATOM 9223  N N    . CYS A 1 31 ? -7.278  1.624   0.441   1.00 0.00 ? 31 CYS A N    11 
ATOM 9224  C CA   . CYS A 1 31 ? -6.173  1.155   -0.378  1.00 0.00 ? 31 CYS A CA   11 
ATOM 9225  C C    . CYS A 1 31 ? -5.572  -0.084  0.291   1.00 0.00 ? 31 CYS A C    11 
ATOM 9226  O O    . CYS A 1 31 ? -5.135  -1.011  -0.390  1.00 0.00 ? 31 CYS A O    11 
ATOM 9227  C CB   . CYS A 1 31 ? -5.126  2.249   -0.598  1.00 0.00 ? 31 CYS A CB   11 
ATOM 9228  S SG   . CYS A 1 31 ? -3.427  1.637   -0.891  1.00 0.00 ? 31 CYS A SG   11 
ATOM 9229  H H    . CYS A 1 31 ? -7.156  2.537   0.831   1.00 0.00 ? 31 CYS A H    11 
ATOM 9230  H HA   . CYS A 1 31 ? -6.590  0.904   -1.353  1.00 0.00 ? 31 CYS A HA   11 
ATOM 9231  H HB2  . CYS A 1 31 ? -5.430  2.857   -1.449  1.00 0.00 ? 31 CYS A HB2  11 
ATOM 9232  H HB3  . CYS A 1 31 ? -5.117  2.903   0.274   1.00 0.00 ? 31 CYS A HB3  11 
ATOM 9233  N N    . ASN A 1 32 ? -5.570  -0.059  1.615   1.00 0.00 ? 32 ASN A N    11 
ATOM 9234  C CA   . ASN A 1 32 ? -5.030  -1.168  2.383   1.00 0.00 ? 32 ASN A CA   11 
ATOM 9235  C C    . ASN A 1 32 ? -6.138  -2.191  2.642   1.00 0.00 ? 32 ASN A C    11 
ATOM 9236  O O    . ASN A 1 32 ? -5.897  -3.232  3.251   1.00 0.00 ? 32 ASN A O    11 
ATOM 9237  C CB   . ASN A 1 32 ? -4.499  -0.694  3.738   1.00 0.00 ? 32 ASN A CB   11 
ATOM 9238  C CG   . ASN A 1 32 ? -4.265  -1.877  4.680   1.00 0.00 ? 32 ASN A CG   11 
ATOM 9239  O OD1  . ASN A 1 32 ? -3.417  -2.724  4.454   1.00 0.00 ? 32 ASN A OD1  11 
ATOM 9240  N ND2  . ASN A 1 32 ? -5.062  -1.886  5.744   1.00 0.00 ? 32 ASN A ND2  11 
ATOM 9241  H H    . ASN A 1 32 ? -5.927  0.699   2.161   1.00 0.00 ? 32 ASN A H    11 
ATOM 9242  H HA   . ASN A 1 32 ? -4.223  -1.573  1.773   1.00 0.00 ? 32 ASN A HA   11 
ATOM 9243  H HB2  . ASN A 1 32 ? -3.567  -0.147  3.596   1.00 0.00 ? 32 ASN A HB2  11 
ATOM 9244  H HB3  . ASN A 1 32 ? -5.210  -0.001  4.188   1.00 0.00 ? 32 ASN A HB3  11 
ATOM 9245  H HD21 . ASN A 1 32 ? -5.737  -1.160  5.870   1.00 0.00 ? 32 ASN A HD21 11 
ATOM 9246  H HD22 . ASN A 1 32 ? -4.985  -2.620  6.420   1.00 0.00 ? 32 ASN A HD22 11 
ATOM 9247  N N    . ASN A 1 33 ? -7.329  -1.859  2.166   1.00 0.00 ? 33 ASN A N    11 
ATOM 9248  C CA   . ASN A 1 33 ? -8.475  -2.736  2.338   1.00 0.00 ? 33 ASN A CA   11 
ATOM 9249  C C    . ASN A 1 33 ? -8.647  -3.595  1.084   1.00 0.00 ? 33 ASN A C    11 
ATOM 9250  O O    . ASN A 1 33 ? -8.995  -4.771  1.176   1.00 0.00 ? 33 ASN A O    11 
ATOM 9251  C CB   . ASN A 1 33 ? -9.760  -1.930  2.538   1.00 0.00 ? 33 ASN A CB   11 
ATOM 9252  C CG   . ASN A 1 33 ? -10.973 -2.853  2.660   1.00 0.00 ? 33 ASN A CG   11 
ATOM 9253  O OD1  . ASN A 1 33 ? -10.890 -3.970  3.144   1.00 0.00 ? 33 ASN A OD1  11 
ATOM 9254  N ND2  . ASN A 1 33 ? -12.103 -2.327  2.194   1.00 0.00 ? 33 ASN A ND2  11 
ATOM 9255  H H    . ASN A 1 33 ? -7.517  -1.010  1.671   1.00 0.00 ? 33 ASN A H    11 
ATOM 9256  H HA   . ASN A 1 33 ? -8.250  -3.330  3.223   1.00 0.00 ? 33 ASN A HA   11 
ATOM 9257  H HB2  . ASN A 1 33 ? -9.673  -1.317  3.436   1.00 0.00 ? 33 ASN A HB2  11 
ATOM 9258  H HB3  . ASN A 1 33 ? -9.900  -1.247  1.700   1.00 0.00 ? 33 ASN A HB3  11 
ATOM 9259  H HD21 . ASN A 1 33 ? -12.103 -1.405  1.809   1.00 0.00 ? 33 ASN A HD21 11 
ATOM 9260  H HD22 . ASN A 1 33 ? -12.952 -2.855  2.229   1.00 0.00 ? 33 ASN A HD22 11 
ATOM 9261  N N    . ARG A 1 34 ? -8.395  -2.974  -0.060  1.00 0.00 ? 34 ARG A N    11 
ATOM 9262  C CA   . ARG A 1 34 ? -8.518  -3.668  -1.331  1.00 0.00 ? 34 ARG A CA   11 
ATOM 9263  C C    . ARG A 1 34 ? -7.514  -4.820  -1.406  1.00 0.00 ? 34 ARG A C    11 
ATOM 9264  O O    . ARG A 1 34 ? -7.754  -5.814  -2.089  1.00 0.00 ? 34 ARG A O    11 
ATOM 9265  C CB   . ARG A 1 34 ? -8.279  -2.715  -2.503  1.00 0.00 ? 34 ARG A CB   11 
ATOM 9266  C CG   . ARG A 1 34 ? -9.205  -3.045  -3.676  1.00 0.00 ? 34 ARG A CG   11 
ATOM 9267  C CD   . ARG A 1 34 ? -8.876  -4.419  -4.264  1.00 0.00 ? 34 ARG A CD   11 
ATOM 9268  N NE   . ARG A 1 34 ? -9.459  -4.542  -5.619  1.00 0.00 ? 34 ARG A NE   11 
ATOM 9269  C CZ   . ARG A 1 34 ? -9.039  -5.419  -6.540  1.00 0.00 ? 34 ARG A CZ   11 
ATOM 9270  N NH1  . ARG A 1 34 ? -8.030  -6.255  -6.259  1.00 0.00 ? 34 ARG A NH1  11 
ATOM 9271  N NH2  . ARG A 1 34 ? -9.627  -5.460  -7.744  1.00 0.00 ? 34 ARG A NH2  11 
ATOM 9272  H H    . ARG A 1 34 ? -8.113  -2.017  -0.126  1.00 0.00 ? 34 ARG A H    11 
ATOM 9273  H HA   . ARG A 1 34 ? -9.543  -4.039  -1.348  1.00 0.00 ? 34 ARG A HA   11 
ATOM 9274  H HB2  . ARG A 1 34 ? -8.447  -1.687  -2.181  1.00 0.00 ? 34 ARG A HB2  11 
ATOM 9275  H HB3  . ARG A 1 34 ? -7.240  -2.782  -2.826  1.00 0.00 ? 34 ARG A HB3  11 
ATOM 9276  H HG2  . ARG A 1 34 ? -10.242 -3.028  -3.341  1.00 0.00 ? 34 ARG A HG2  11 
ATOM 9277  H HG3  . ARG A 1 34 ? -9.106  -2.282  -4.448  1.00 0.00 ? 34 ARG A HG3  11 
ATOM 9278  H HD2  . ARG A 1 34 ? -7.796  -4.554  -4.310  1.00 0.00 ? 34 ARG A HD2  11 
ATOM 9279  H HD3  . ARG A 1 34 ? -9.268  -5.204  -3.617  1.00 0.00 ? 34 ARG A HD3  11 
ATOM 9280  H HE   . ARG A 1 34 ? -10.214 -3.933  -5.861  1.00 0.00 ? 34 ARG A HE   11 
ATOM 9281  H HH11 . ARG A 1 34 ? -7.590  -6.224  -5.361  1.00 0.00 ? 34 ARG A HH11 11 
ATOM 9282  H HH12 . ARG A 1 34 ? -7.716  -6.909  -6.947  1.00 0.00 ? 34 ARG A HH12 11 
ATOM 9283  H HH21 . ARG A 1 34 ? -10.380 -4.836  -7.954  1.00 0.00 ? 34 ARG A HH21 11 
ATOM 9284  H HH22 . ARG A 1 34 ? -9.313  -6.114  -8.432  1.00 0.00 ? 34 ARG A HH22 11 
ATOM 9285  N N    . GLY A 1 35 ? -6.409  -4.647  -0.694  1.00 0.00 ? 35 GLY A N    11 
ATOM 9286  C CA   . GLY A 1 35 ? -5.368  -5.660  -0.672  1.00 0.00 ? 35 GLY A CA   11 
ATOM 9287  C C    . GLY A 1 35 ? -4.026  -5.076  -1.119  1.00 0.00 ? 35 GLY A C    11 
ATOM 9288  O O    . GLY A 1 35 ? -3.568  -5.343  -2.229  1.00 0.00 ? 35 GLY A O    11 
ATOM 9289  H H    . GLY A 1 35 ? -6.221  -3.835  -0.141  1.00 0.00 ? 35 GLY A H    11 
ATOM 9290  H HA2  . GLY A 1 35 ? -5.274  -6.068  0.335   1.00 0.00 ? 35 GLY A HA2  11 
ATOM 9291  H HA3  . GLY A 1 35 ? -5.645  -6.486  -1.326  1.00 0.00 ? 35 GLY A HA3  11 
ATOM 9292  N N    . CYS A 1 36 ? -3.433  -4.291  -0.231  1.00 0.00 ? 36 CYS A N    11 
ATOM 9293  C CA   . CYS A 1 36 ? -2.153  -3.668  -0.520  1.00 0.00 ? 36 CYS A CA   11 
ATOM 9294  C C    . CYS A 1 36 ? -1.833  -2.683  0.606   1.00 0.00 ? 36 CYS A C    11 
ATOM 9295  O O    . CYS A 1 36 ? -2.387  -2.784  1.700   1.00 0.00 ? 36 CYS A O    11 
ATOM 9296  C CB   . CYS A 1 36 ? -2.152  -2.988  -1.891  1.00 0.00 ? 36 CYS A CB   11 
ATOM 9297  S SG   . CYS A 1 36 ? -0.857  -3.581  -3.040  1.00 0.00 ? 36 CYS A SG   11 
ATOM 9298  H H    . CYS A 1 36 ? -3.813  -4.080  0.670   1.00 0.00 ? 36 CYS A H    11 
ATOM 9299  H HA   . CYS A 1 36 ? -1.415  -4.469  -0.554  1.00 0.00 ? 36 CYS A HA   11 
ATOM 9300  H HB2  . CYS A 1 36 ? -3.126  -3.136  -2.355  1.00 0.00 ? 36 CYS A HB2  11 
ATOM 9301  H HB3  . CYS A 1 36 ? -2.027  -1.914  -1.748  1.00 0.00 ? 36 CYS A HB3  11 
ATOM 9302  N N    . CYS A 1 37 ? -0.941  -1.752  0.300   1.00 0.00 ? 37 CYS A N    11 
ATOM 9303  C CA   . CYS A 1 37 ? -0.541  -0.749  1.273   1.00 0.00 ? 37 CYS A CA   11 
ATOM 9304  C C    . CYS A 1 37 ? -0.870  0.632   0.702   1.00 0.00 ? 37 CYS A C    11 
ATOM 9305  O O    . CYS A 1 37 ? -0.885  0.817   -0.514  1.00 0.00 ? 37 CYS A O    11 
ATOM 9306  C CB   . CYS A 1 37 ? 0.938   -0.877  1.641   1.00 0.00 ? 37 CYS A CB   11 
ATOM 9307  S SG   . CYS A 1 37 ? 1.280   -1.953  3.081   1.00 0.00 ? 37 CYS A SG   11 
ATOM 9308  H H    . CYS A 1 37 ? -0.496  -1.677  -0.592  1.00 0.00 ? 37 CYS A H    11 
ATOM 9309  H HA   . CYS A 1 37 ? -1.119  -0.942  2.177   1.00 0.00 ? 37 CYS A HA   11 
ATOM 9310  H HB2  . CYS A 1 37 ? 1.481   -1.265  0.779   1.00 0.00 ? 37 CYS A HB2  11 
ATOM 9311  H HB3  . CYS A 1 37 ? 1.334   0.117   1.846   1.00 0.00 ? 37 CYS A HB3  11 
ATOM 9312  N N    . PHE A 1 38 ? -1.126  1.565   1.607   1.00 0.00 ? 38 PHE A N    11 
ATOM 9313  C CA   . PHE A 1 38 ? -1.454  2.923   1.209   1.00 0.00 ? 38 PHE A CA   11 
ATOM 9314  C C    . PHE A 1 38 ? -0.388  3.909   1.693   1.00 0.00 ? 38 PHE A C    11 
ATOM 9315  O O    . PHE A 1 38 ? 0.515   3.534   2.440   1.00 0.00 ? 38 PHE A O    11 
ATOM 9316  C CB   . PHE A 1 38 ? -2.790  3.272   1.867   1.00 0.00 ? 38 PHE A CB   11 
ATOM 9317  C CG   . PHE A 1 38 ? -3.200  4.737   1.704   1.00 0.00 ? 38 PHE A CG   11 
ATOM 9318  C CD1  . PHE A 1 38 ? -3.831  5.144   0.570   1.00 0.00 ? 38 PHE A CD1  11 
ATOM 9319  C CD2  . PHE A 1 38 ? -2.935  5.632   2.693   1.00 0.00 ? 38 PHE A CD2  11 
ATOM 9320  C CE1  . PHE A 1 38 ? -4.212  6.504   0.418   1.00 0.00 ? 38 PHE A CE1  11 
ATOM 9321  C CE2  . PHE A 1 38 ? -3.315  6.992   2.541   1.00 0.00 ? 38 PHE A CE2  11 
ATOM 9322  C CZ   . PHE A 1 38 ? -3.946  7.399   1.407   1.00 0.00 ? 38 PHE A CZ   11 
ATOM 9323  H H    . PHE A 1 38 ? -1.112  1.405   2.594   1.00 0.00 ? 38 PHE A H    11 
ATOM 9324  H HA   . PHE A 1 38 ? -1.494  2.941   0.120   1.00 0.00 ? 38 PHE A HA   11 
ATOM 9325  H HB2  . PHE A 1 38 ? -3.569  2.638   1.444   1.00 0.00 ? 38 PHE A HB2  11 
ATOM 9326  H HB3  . PHE A 1 38 ? -2.732  3.038   2.930   1.00 0.00 ? 38 PHE A HB3  11 
ATOM 9327  H HD1  . PHE A 1 38 ? -4.044  4.427   -0.223  1.00 0.00 ? 38 PHE A HD1  11 
ATOM 9328  H HD2  . PHE A 1 38 ? -2.429  5.306   3.602   1.00 0.00 ? 38 PHE A HD2  11 
ATOM 9329  H HE1  . PHE A 1 38 ? -4.717  6.830   -0.491  1.00 0.00 ? 38 PHE A HE1  11 
ATOM 9330  H HE2  . PHE A 1 38 ? -3.102  7.709   3.334   1.00 0.00 ? 38 PHE A HE2  11 
ATOM 9331  H HZ   . PHE A 1 38 ? -4.238  8.442   1.291   1.00 0.00 ? 38 PHE A HZ   11 
ATOM 9332  N N    . ASP A 1 39 ? -0.528  5.149   1.248   1.00 0.00 ? 39 ASP A N    11 
ATOM 9333  C CA   . ASP A 1 39 ? 0.411   6.190   1.626   1.00 0.00 ? 39 ASP A CA   11 
ATOM 9334  C C    . ASP A 1 39 ? -0.008  7.510   0.975   1.00 0.00 ? 39 ASP A C    11 
ATOM 9335  O O    . ASP A 1 39 ? -0.464  7.525   -0.167  1.00 0.00 ? 39 ASP A O    11 
ATOM 9336  C CB   . ASP A 1 39 ? 1.826   5.856   1.149   1.00 0.00 ? 39 ASP A CB   11 
ATOM 9337  C CG   . ASP A 1 39 ? 2.883   6.916   1.466   1.00 0.00 ? 39 ASP A CG   11 
ATOM 9338  O OD1  . ASP A 1 39 ? 3.162   7.097   2.671   1.00 0.00 ? 39 ASP A OD1  11 
ATOM 9339  O OD2  . ASP A 1 39 ? 3.388   7.521   0.496   1.00 0.00 ? 39 ASP A OD2  11 
ATOM 9340  H H    . ASP A 1 39 ? -1.266  5.445   0.641   1.00 0.00 ? 39 ASP A H    11 
ATOM 9341  H HA   . ASP A 1 39 ? 0.371   6.231   2.715   1.00 0.00 ? 39 ASP A HA   11 
ATOM 9342  H HB2  . ASP A 1 39 ? 2.132   4.913   1.601   1.00 0.00 ? 39 ASP A HB2  11 
ATOM 9343  H HB3  . ASP A 1 39 ? 1.802   5.700   0.071   1.00 0.00 ? 39 ASP A HB3  11 
ATOM 9344  N N    . SER A 1 40 ? 0.162   8.586   1.730   1.00 0.00 ? 40 SER A N    11 
ATOM 9345  C CA   . SER A 1 40 ? -0.193  9.907   1.241   1.00 0.00 ? 40 SER A CA   11 
ATOM 9346  C C    . SER A 1 40 ? 0.921   10.903  1.570   1.00 0.00 ? 40 SER A C    11 
ATOM 9347  O O    . SER A 1 40 ? 0.705   12.114  1.535   1.00 0.00 ? 40 SER A O    11 
ATOM 9348  C CB   . SER A 1 40 ? -1.520  10.378  1.839   1.00 0.00 ? 40 SER A CB   11 
ATOM 9349  O OG   . SER A 1 40 ? -1.448  10.518  3.255   1.00 0.00 ? 40 SER A OG   11 
ATOM 9350  H H    . SER A 1 40 ? 0.534   8.564   2.658   1.00 0.00 ? 40 SER A H    11 
ATOM 9351  H HA   . SER A 1 40 ? -0.300  9.796   0.162   1.00 0.00 ? 40 SER A HA   11 
ATOM 9352  H HB2  . SER A 1 40 ? -1.800  11.332  1.393   1.00 0.00 ? 40 SER A HB2  11 
ATOM 9353  H HB3  . SER A 1 40 ? -2.305  9.665   1.585   1.00 0.00 ? 40 SER A HB3  11 
ATOM 9354  H HG   . SER A 1 40 ? -0.806  11.247  3.494   1.00 0.00 ? 40 SER A HG   11 
ATOM 9355  N N    . ARG A 1 41 ? 2.087   10.357  1.882   1.00 0.00 ? 41 ARG A N    11 
ATOM 9356  C CA   . ARG A 1 41 ? 3.234   11.183  2.217   1.00 0.00 ? 41 ARG A CA   11 
ATOM 9357  C C    . ARG A 1 41 ? 3.602   12.085  1.037   1.00 0.00 ? 41 ARG A C    11 
ATOM 9358  O O    . ARG A 1 41 ? 3.911   13.261  1.223   1.00 0.00 ? 41 ARG A O    11 
ATOM 9359  C CB   . ARG A 1 41 ? 4.443   10.322  2.587   1.00 0.00 ? 41 ARG A CB   11 
ATOM 9360  C CG   . ARG A 1 41 ? 5.273   10.985  3.689   1.00 0.00 ? 41 ARG A CG   11 
ATOM 9361  C CD   . ARG A 1 41 ? 6.765   10.712  3.492   1.00 0.00 ? 41 ARG A CD   11 
ATOM 9362  N NE   . ARG A 1 41 ? 7.546   11.938  3.770   1.00 0.00 ? 41 ARG A NE   11 
ATOM 9363  C CZ   . ARG A 1 41 ? 8.884   11.990  3.780   1.00 0.00 ? 41 ARG A CZ   11 
ATOM 9364  N NH1  . ARG A 1 41 ? 9.600   10.886  3.526   1.00 0.00 ? 41 ARG A NH1  11 
ATOM 9365  N NH2  . ARG A 1 41 ? 9.508   13.147  4.042   1.00 0.00 ? 41 ARG A NH2  11 
ATOM 9366  H H    . ARG A 1 41 ? 2.253   9.371   1.908   1.00 0.00 ? 41 ARG A H    11 
ATOM 9367  H HA   . ARG A 1 41 ? 2.912   11.772  3.076   1.00 0.00 ? 41 ARG A HA   11 
ATOM 9368  H HB2  . ARG A 1 41 ? 4.107   9.341   2.922   1.00 0.00 ? 41 ARG A HB2  11 
ATOM 9369  H HB3  . ARG A 1 41 ? 5.064   10.162  1.706   1.00 0.00 ? 41 ARG A HB3  11 
ATOM 9370  H HG2  . ARG A 1 41 ? 5.093   12.060  3.686   1.00 0.00 ? 41 ARG A HG2  11 
ATOM 9371  H HG3  . ARG A 1 41 ? 4.956   10.611  4.662   1.00 0.00 ? 41 ARG A HG3  11 
ATOM 9372  H HD2  . ARG A 1 41 ? 7.086   9.908   4.154   1.00 0.00 ? 41 ARG A HD2  11 
ATOM 9373  H HD3  . ARG A 1 41 ? 6.950   10.377  2.471   1.00 0.00 ? 41 ARG A HD3  11 
ATOM 9374  H HE   . ARG A 1 41 ? 7.042   12.780  3.963   1.00 0.00 ? 41 ARG A HE   11 
ATOM 9375  H HH11 . ARG A 1 41 ? 9.135   10.023  3.330   1.00 0.00 ? 41 ARG A HH11 11 
ATOM 9376  H HH12 . ARG A 1 41 ? 10.599  10.925  3.533   1.00 0.00 ? 41 ARG A HH12 11 
ATOM 9377  H HH21 . ARG A 1 41 ? 8.974   13.971  4.232   1.00 0.00 ? 41 ARG A HH21 11 
ATOM 9378  H HH22 . ARG A 1 41 ? 10.507  13.186  4.050   1.00 0.00 ? 41 ARG A HH22 11 
ATOM 9379  N N    . ILE A 1 42 ? 3.555   11.500  -0.151  1.00 0.00 ? 42 ILE A N    11 
ATOM 9380  C CA   . ILE A 1 42 ? 3.879   12.237  -1.361  1.00 0.00 ? 42 ILE A CA   11 
ATOM 9381  C C    . ILE A 1 42 ? 3.072   11.668  -2.530  1.00 0.00 ? 42 ILE A C    11 
ATOM 9382  O O    . ILE A 1 42 ? 3.013   10.454  -2.716  1.00 0.00 ? 42 ILE A O    11 
ATOM 9383  C CB   . ILE A 1 42 ? 5.390   12.238  -1.599  1.00 0.00 ? 42 ILE A CB   11 
ATOM 9384  C CG1  . ILE A 1 42 ? 6.058   11.060  -0.887  1.00 0.00 ? 42 ILE A CG1  11 
ATOM 9385  C CG2  . ILE A 1 42 ? 6.008   13.578  -1.194  1.00 0.00 ? 42 ILE A CG2  11 
ATOM 9386  C CD1  . ILE A 1 42 ? 5.535   9.727   -1.425  1.00 0.00 ? 42 ILE A CD1  11 
ATOM 9387  H H    . ILE A 1 42 ? 3.302   10.544  -0.294  1.00 0.00 ? 42 ILE A H    11 
ATOM 9388  H HA   . ILE A 1 42 ? 3.576   13.272  -1.204  1.00 0.00 ? 42 ILE A HA   11 
ATOM 9389  H HB   . ILE A 1 42 ? 5.568   12.112  -2.667  1.00 0.00 ? 42 ILE A HB   11 
ATOM 9390  H HG12 . ILE A 1 42 ? 7.138   11.113  -1.024  1.00 0.00 ? 42 ILE A HG12 11 
ATOM 9391  H HG13 . ILE A 1 42 ? 5.869   11.123  0.185   1.00 0.00 ? 42 ILE A HG13 11 
ATOM 9392  H HG21 . ILE A 1 42 ? 5.316   14.115  -0.545  1.00 0.00 ? 42 ILE A HG21 11 
ATOM 9393  H HG22 . ILE A 1 42 ? 6.942   13.401  -0.662  1.00 0.00 ? 42 ILE A HG22 11 
ATOM 9394  H HG23 . ILE A 1 42 ? 6.205   14.172  -2.086  1.00 0.00 ? 42 ILE A HG23 11 
ATOM 9395  H HD11 . ILE A 1 42 ? 5.057   9.887   -2.391  1.00 0.00 ? 42 ILE A HD11 11 
ATOM 9396  H HD12 . ILE A 1 42 ? 6.367   9.031   -1.542  1.00 0.00 ? 42 ILE A HD12 11 
ATOM 9397  H HD13 . ILE A 1 42 ? 4.811   9.311   -0.725  1.00 0.00 ? 42 ILE A HD13 11 
ATOM 9398  N N    . PRO A 1 43 ? 2.455   12.597  -3.309  1.00 0.00 ? 43 PRO A N    11 
ATOM 9399  C CA   . PRO A 1 43 ? 1.655   12.201  -4.455  1.00 0.00 ? 43 PRO A CA   11 
ATOM 9400  C C    . PRO A 1 43 ? 2.545   11.765  -5.620  1.00 0.00 ? 43 PRO A C    11 
ATOM 9401  O O    . PRO A 1 43 ? 2.206   10.834  -6.351  1.00 0.00 ? 43 PRO A O    11 
ATOM 9402  C CB   . PRO A 1 43 ? 0.804   13.417  -4.780  1.00 0.00 ? 43 PRO A CB   11 
ATOM 9403  C CG   . PRO A 1 43 ? 1.487   14.596  -4.105  1.00 0.00 ? 43 PRO A CG   11 
ATOM 9404  C CD   . PRO A 1 43 ? 2.503   14.044  -3.119  1.00 0.00 ? 43 PRO A CD   11 
ATOM 9405  H HA   . PRO A 1 43 ? 1.093   11.405  -4.227  1.00 0.00 ? 43 PRO A HA   11 
ATOM 9406  H HB2  . PRO A 1 43 ? 0.736   13.570  -5.857  1.00 0.00 ? 43 PRO A HB2  11 
ATOM 9407  H HB3  . PRO A 1 43 ? -0.214  13.292  -4.411  1.00 0.00 ? 43 PRO A HB3  11 
ATOM 9408  H HG2  . PRO A 1 43 ? 1.977   15.228  -4.845  1.00 0.00 ? 43 PRO A HG2  11 
ATOM 9409  H HG3  . PRO A 1 43 ? 0.754   15.218  -3.591  1.00 0.00 ? 43 PRO A HG3  11 
ATOM 9410  H HD2  . PRO A 1 43 ? 3.500   14.437  -3.316  1.00 0.00 ? 43 PRO A HD2  11 
ATOM 9411  H HD3  . PRO A 1 43 ? 2.250   14.318  -2.095  1.00 0.00 ? 43 PRO A HD3  11 
ATOM 9412  N N    . GLY A 1 44 ? 3.666   12.458  -5.759  1.00 0.00 ? 44 GLY A N    11 
ATOM 9413  C CA   . GLY A 1 44 ? 4.607   12.153  -6.823  1.00 0.00 ? 44 GLY A CA   11 
ATOM 9414  C C    . GLY A 1 44 ? 4.816   10.644  -6.955  1.00 0.00 ? 44 GLY A C    11 
ATOM 9415  O O    . GLY A 1 44 ? 5.132   10.149  -8.037  1.00 0.00 ? 44 GLY A O    11 
ATOM 9416  H H    . GLY A 1 44 ? 3.934   13.213  -5.161  1.00 0.00 ? 44 GLY A H    11 
ATOM 9417  H HA2  . GLY A 1 44 ? 4.238   12.557  -7.766  1.00 0.00 ? 44 GLY A HA2  11 
ATOM 9418  H HA3  . GLY A 1 44 ? 5.561   12.640  -6.620  1.00 0.00 ? 44 GLY A HA3  11 
ATOM 9419  N N    . VAL A 1 45 ? 4.632   9.953   -5.840  1.00 0.00 ? 45 VAL A N    11 
ATOM 9420  C CA   . VAL A 1 45 ? 4.797   8.509   -5.817  1.00 0.00 ? 45 VAL A CA   11 
ATOM 9421  C C    . VAL A 1 45 ? 3.419   7.844   -5.777  1.00 0.00 ? 45 VAL A C    11 
ATOM 9422  O O    . VAL A 1 45 ? 2.406   8.517   -5.598  1.00 0.00 ? 45 VAL A O    11 
ATOM 9423  C CB   . VAL A 1 45 ? 5.691   8.103   -4.645  1.00 0.00 ? 45 VAL A CB   11 
ATOM 9424  C CG1  . VAL A 1 45 ? 6.639   9.240   -4.258  1.00 0.00 ? 45 VAL A CG1  11 
ATOM 9425  C CG2  . VAL A 1 45 ? 4.854   7.655   -3.446  1.00 0.00 ? 45 VAL A CG2  11 
ATOM 9426  H H    . VAL A 1 45 ? 4.375   10.363  -4.964  1.00 0.00 ? 45 VAL A H    11 
ATOM 9427  H HA   . VAL A 1 45 ? 5.299   8.221   -6.741  1.00 0.00 ? 45 VAL A HA   11 
ATOM 9428  H HB   . VAL A 1 45 ? 6.298   7.256   -4.965  1.00 0.00 ? 45 VAL A HB   11 
ATOM 9429  H HG11 . VAL A 1 45 ? 6.061   10.145  -4.067  1.00 0.00 ? 45 VAL A HG11 11 
ATOM 9430  H HG12 . VAL A 1 45 ? 7.190   8.964   -3.359  1.00 0.00 ? 45 VAL A HG12 11 
ATOM 9431  H HG13 . VAL A 1 45 ? 7.340   9.422   -5.073  1.00 0.00 ? 45 VAL A HG13 11 
ATOM 9432  H HG21 . VAL A 1 45 ? 4.072   8.390   -3.253  1.00 0.00 ? 45 VAL A HG21 11 
ATOM 9433  H HG22 . VAL A 1 45 ? 4.398   6.688   -3.661  1.00 0.00 ? 45 VAL A HG22 11 
ATOM 9434  H HG23 . VAL A 1 45 ? 5.494   7.567   -2.568  1.00 0.00 ? 45 VAL A HG23 11 
ATOM 9435  N N    . PRO A 1 46 ? 3.427   6.495   -5.953  1.00 0.00 ? 46 PRO A N    11 
ATOM 9436  C CA   . PRO A 1 46 ? 2.191   5.732   -5.938  1.00 0.00 ? 46 PRO A CA   11 
ATOM 9437  C C    . PRO A 1 46 ? 1.658   5.578   -4.512  1.00 0.00 ? 46 PRO A C    11 
ATOM 9438  O O    . PRO A 1 46 ? 1.993   4.617   -3.821  1.00 0.00 ? 46 PRO A O    11 
ATOM 9439  C CB   . PRO A 1 46 ? 2.543   4.403   -6.587  1.00 0.00 ? 46 PRO A CB   11 
ATOM 9440  C CG   . PRO A 1 46 ? 4.057   4.293   -6.519  1.00 0.00 ? 46 PRO A CG   11 
ATOM 9441  C CD   . PRO A 1 46 ? 4.609   5.665   -6.168  1.00 0.00 ? 46 PRO A CD   11 
ATOM 9442  H HA   . PRO A 1 46 ? 1.479   6.215   -6.446  1.00 0.00 ? 46 PRO A HA   11 
ATOM 9443  H HB2  . PRO A 1 46 ? 2.067   3.574   -6.063  1.00 0.00 ? 46 PRO A HB2  11 
ATOM 9444  H HB3  . PRO A 1 46 ? 2.195   4.368   -7.620  1.00 0.00 ? 46 PRO A HB3  11 
ATOM 9445  H HG2  . PRO A 1 46 ? 4.353   3.559   -5.769  1.00 0.00 ? 46 PRO A HG2  11 
ATOM 9446  H HG3  . PRO A 1 46 ? 4.459   3.953   -7.474  1.00 0.00 ? 46 PRO A HG3  11 
ATOM 9447  H HD2  . PRO A 1 46 ? 5.233   5.625   -5.275  1.00 0.00 ? 46 PRO A HD2  11 
ATOM 9448  H HD3  . PRO A 1 46 ? 5.229   6.060   -6.973  1.00 0.00 ? 46 PRO A HD3  11 
ATOM 9449  N N    . TRP A 1 47 ? 0.838   6.539   -4.115  1.00 0.00 ? 47 TRP A N    11 
ATOM 9450  C CA   . TRP A 1 47 ? 0.255   6.523   -2.784  1.00 0.00 ? 47 TRP A CA   11 
ATOM 9451  C C    . TRP A 1 47 ? 0.052   5.063   -2.374  1.00 0.00 ? 47 TRP A C    11 
ATOM 9452  O O    . TRP A 1 47 ? 0.517   4.640   -1.317  1.00 0.00 ? 47 TRP A O    11 
ATOM 9453  C CB   . TRP A 1 47 ? -1.036  7.342   -2.740  1.00 0.00 ? 47 TRP A CB   11 
ATOM 9454  C CG   . TRP A 1 47 ? -0.825  8.821   -2.411  1.00 0.00 ? 47 TRP A CG   11 
ATOM 9455  C CD1  . TRP A 1 47 ? 0.249   9.579   -2.671  1.00 0.00 ? 47 TRP A CD1  11 
ATOM 9456  C CD2  . TRP A 1 47 ? -1.761  9.696   -1.746  1.00 0.00 ? 47 TRP A CD2  11 
ATOM 9457  N NE1  . TRP A 1 47 ? 0.075   10.873  -2.224  1.00 0.00 ? 47 TRP A NE1  11 
ATOM 9458  C CE2  . TRP A 1 47 ? -1.186  10.946  -1.643  1.00 0.00 ? 47 TRP A CE2  11 
ATOM 9459  C CE3  . TRP A 1 47 ? -3.050  9.439   -1.247  1.00 0.00 ? 47 TRP A CE3  11 
ATOM 9460  C CZ2  . TRP A 1 47 ? -1.827  12.038  -1.047  1.00 0.00 ? 47 TRP A CZ2  11 
ATOM 9461  C CZ3  . TRP A 1 47 ? -3.677  10.541  -0.654  1.00 0.00 ? 47 TRP A CZ3  11 
ATOM 9462  C CH2  . TRP A 1 47 ? -3.112  11.806  -0.543  1.00 0.00 ? 47 TRP A CH2  11 
ATOM 9463  H H    . TRP A 1 47 ? 0.571   7.317   -4.683  1.00 0.00 ? 47 TRP A H    11 
ATOM 9464  H HA   . TRP A 1 47 ? 0.960   7.005   -2.106  1.00 0.00 ? 47 TRP A HA   11 
ATOM 9465  H HB2  . TRP A 1 47 ? -1.537  7.263   -3.706  1.00 0.00 ? 47 TRP A HB2  11 
ATOM 9466  H HB3  . TRP A 1 47 ? -1.706  6.907   -1.998  1.00 0.00 ? 47 TRP A HB3  11 
ATOM 9467  H HD1  . TRP A 1 47 ? 1.147   9.218   -3.172  1.00 0.00 ? 47 TRP A HD1  11 
ATOM 9468  H HE1  . TRP A 1 47 ? 0.795   11.687  -2.310  1.00 0.00 ? 47 TRP A HE1  11 
ATOM 9469  H HE3  . TRP A 1 47 ? -3.526  8.461   -1.316  1.00 0.00 ? 47 TRP A HE3  11 
ATOM 9470  H HZ2  . TRP A 1 47 ? -1.351  13.016  -0.978  1.00 0.00 ? 47 TRP A HZ2  11 
ATOM 9471  H HZ3  . TRP A 1 47 ? -4.680  10.396  -0.251  1.00 0.00 ? 47 TRP A HZ3  11 
ATOM 9472  H HH2  . TRP A 1 47 ? -3.667  12.613  -0.065  1.00 0.00 ? 47 TRP A HH2  11 
ATOM 9473  N N    . CYS A 1 48 ? -0.644  4.333   -3.233  1.00 0.00 ? 48 CYS A N    11 
ATOM 9474  C CA   . CYS A 1 48 ? -0.915  2.929   -2.974  1.00 0.00 ? 48 CYS A CA   11 
ATOM 9475  C C    . CYS A 1 48 ? 0.160   2.095   -3.673  1.00 0.00 ? 48 CYS A C    11 
ATOM 9476  O O    . CYS A 1 48 ? 0.246   2.088   -4.900  1.00 0.00 ? 48 CYS A O    11 
ATOM 9477  C CB   . CYS A 1 48 ? -2.324  2.533   -3.422  1.00 0.00 ? 48 CYS A CB   11 
ATOM 9478  S SG   . CYS A 1 48 ? -2.999  1.043   -2.601  1.00 0.00 ? 48 CYS A SG   11 
ATOM 9479  H H    . CYS A 1 48 ? -1.020  4.684   -4.091  1.00 0.00 ? 48 CYS A H    11 
ATOM 9480  H HA   . CYS A 1 48 ? -0.868  2.795   -1.894  1.00 0.00 ? 48 CYS A HA   11 
ATOM 9481  H HB2  . CYS A 1 48 ? -2.998  3.369   -3.236  1.00 0.00 ? 48 CYS A HB2  11 
ATOM 9482  H HB3  . CYS A 1 48 ? -2.314  2.364   -4.498  1.00 0.00 ? 48 CYS A HB3  11 
ATOM 9483  N N    . PHE A 1 49 ? 0.955   1.412   -2.861  1.00 0.00 ? 49 PHE A N    11 
ATOM 9484  C CA   . PHE A 1 49 ? 2.022   0.577   -3.386  1.00 0.00 ? 49 PHE A CA   11 
ATOM 9485  C C    . PHE A 1 49 ? 2.048   -0.783  -2.686  1.00 0.00 ? 49 PHE A C    11 
ATOM 9486  O O    . PHE A 1 49 ? 1.433   -0.956  -1.635  1.00 0.00 ? 49 PHE A O    11 
ATOM 9487  C CB   . PHE A 1 49 ? 3.338   1.306   -3.109  1.00 0.00 ? 49 PHE A CB   11 
ATOM 9488  C CG   . PHE A 1 49 ? 3.447   1.876   -1.693  1.00 0.00 ? 49 PHE A CG   11 
ATOM 9489  C CD1  . PHE A 1 49 ? 3.565   1.037   -0.629  1.00 0.00 ? 49 PHE A CD1  11 
ATOM 9490  C CD2  . PHE A 1 49 ? 3.426   3.222   -1.499  1.00 0.00 ? 49 PHE A CD2  11 
ATOM 9491  C CE1  . PHE A 1 49 ? 3.667   1.566   0.684   1.00 0.00 ? 49 PHE A CE1  11 
ATOM 9492  C CE2  . PHE A 1 49 ? 3.528   3.751   -0.185  1.00 0.00 ? 49 PHE A CE2  11 
ATOM 9493  C CZ   . PHE A 1 49 ? 3.646   2.912   0.879   1.00 0.00 ? 49 PHE A CZ   11 
ATOM 9494  H H    . PHE A 1 49 ? 0.878   1.424   -1.864  1.00 0.00 ? 49 PHE A H    11 
ATOM 9495  H HA   . PHE A 1 49 ? 1.827   0.433   -4.449  1.00 0.00 ? 49 PHE A HA   11 
ATOM 9496  H HB2  . PHE A 1 49 ? 4.166   0.617   -3.277  1.00 0.00 ? 49 PHE A HB2  11 
ATOM 9497  H HB3  . PHE A 1 49 ? 3.449   2.119   -3.826  1.00 0.00 ? 49 PHE A HB3  11 
ATOM 9498  H HD1  . PHE A 1 49 ? 3.582   -0.042  -0.785  1.00 0.00 ? 49 PHE A HD1  11 
ATOM 9499  H HD2  . PHE A 1 49 ? 3.332   3.895   -2.351  1.00 0.00 ? 49 PHE A HD2  11 
ATOM 9500  H HE1  . PHE A 1 49 ? 3.762   0.894   1.537   1.00 0.00 ? 49 PHE A HE1  11 
ATOM 9501  H HE2  . PHE A 1 49 ? 3.511   4.830   -0.029  1.00 0.00 ? 49 PHE A HE2  11 
ATOM 9502  H HZ   . PHE A 1 49 ? 3.724   3.318   1.887   1.00 0.00 ? 49 PHE A HZ   11 
ATOM 9503  N N    . LYS A 1 50 ? 2.767   -1.713  -3.297  1.00 0.00 ? 50 LYS A N    11 
ATOM 9504  C CA   . LYS A 1 50 ? 2.882   -3.053  -2.745  1.00 0.00 ? 50 LYS A CA   11 
ATOM 9505  C C    . LYS A 1 50 ? 3.616   -2.986  -1.404  1.00 0.00 ? 50 LYS A C    11 
ATOM 9506  O O    . LYS A 1 50 ? 4.274   -1.992  -1.101  1.00 0.00 ? 50 LYS A O    11 
ATOM 9507  C CB   . LYS A 1 50 ? 3.535   -3.995  -3.758  1.00 0.00 ? 50 LYS A CB   11 
ATOM 9508  C CG   . LYS A 1 50 ? 2.826   -3.922  -5.112  1.00 0.00 ? 50 LYS A CG   11 
ATOM 9509  C CD   . LYS A 1 50 ? 3.121   -5.166  -5.953  1.00 0.00 ? 50 LYS A CD   11 
ATOM 9510  C CE   . LYS A 1 50 ? 2.265   -6.350  -5.499  1.00 0.00 ? 50 LYS A CE   11 
ATOM 9511  N NZ   . LYS A 1 50 ? 2.119   -7.334  -6.595  1.00 0.00 ? 50 LYS A NZ   11 
ATOM 9512  H H    . LYS A 1 50 ? 3.264   -1.564  -4.151  1.00 0.00 ? 50 LYS A H    11 
ATOM 9513  H HA   . LYS A 1 50 ? 1.871   -3.421  -2.568  1.00 0.00 ? 50 LYS A HA   11 
ATOM 9514  H HB2  . LYS A 1 50 ? 4.586   -3.733  -3.879  1.00 0.00 ? 50 LYS A HB2  11 
ATOM 9515  H HB3  . LYS A 1 50 ? 3.504   -5.018  -3.381  1.00 0.00 ? 50 LYS A HB3  11 
ATOM 9516  H HG2  . LYS A 1 50 ? 1.751   -3.829  -4.958  1.00 0.00 ? 50 LYS A HG2  11 
ATOM 9517  H HG3  . LYS A 1 50 ? 3.150   -3.030  -5.648  1.00 0.00 ? 50 LYS A HG3  11 
ATOM 9518  H HD2  . LYS A 1 50 ? 2.926   -4.953  -7.004  1.00 0.00 ? 50 LYS A HD2  11 
ATOM 9519  H HD3  . LYS A 1 50 ? 4.177   -5.423  -5.871  1.00 0.00 ? 50 LYS A HD3  11 
ATOM 9520  H HE2  . LYS A 1 50 ? 2.724   -6.827  -4.633  1.00 0.00 ? 50 LYS A HE2  11 
ATOM 9521  H HE3  . LYS A 1 50 ? 1.283   -5.998  -5.185  1.00 0.00 ? 50 LYS A HE3  11 
ATOM 9522  H HZ1  . LYS A 1 50 ? 2.479   -6.944  -7.443  1.00 0.00 ? 50 LYS A HZ1  11 
ATOM 9523  H HZ2  . LYS A 1 50 ? 2.627   -8.165  -6.368  1.00 0.00 ? 50 LYS A HZ2  11 
ATOM 9524  H HZ3  . LYS A 1 50 ? 1.152   -7.557  -6.716  1.00 0.00 ? 50 LYS A HZ3  11 
ATOM 9525  N N    . PRO A 1 51 ? 3.475   -4.086  -0.617  1.00 0.00 ? 51 PRO A N    11 
ATOM 9526  C CA   . PRO A 1 51 ? 4.117   -4.161  0.685   1.00 0.00 ? 51 PRO A CA   11 
ATOM 9527  C C    . PRO A 1 51 ? 5.619   -4.414  0.541   1.00 0.00 ? 51 PRO A C    11 
ATOM 9528  O O    . PRO A 1 51 ? 6.031   -5.372  -0.112  1.00 0.00 ? 51 PRO A O    11 
ATOM 9529  C CB   . PRO A 1 51 ? 3.393   -5.280  1.416   1.00 0.00 ? 51 PRO A CB   11 
ATOM 9530  C CG   . PRO A 1 51 ? 2.692   -6.095  0.341   1.00 0.00 ? 51 PRO A CG   11 
ATOM 9531  C CD   . PRO A 1 51 ? 2.703   -5.282  -0.943  1.00 0.00 ? 51 PRO A CD   11 
ATOM 9532  H HA   . PRO A 1 51 ? 4.031   -3.288  1.165   1.00 0.00 ? 51 PRO A HA   11 
ATOM 9533  H HB2  . PRO A 1 51 ? 4.095   -5.897  1.978   1.00 0.00 ? 51 PRO A HB2  11 
ATOM 9534  H HB3  . PRO A 1 51 ? 2.676   -4.879  2.132   1.00 0.00 ? 51 PRO A HB3  11 
ATOM 9535  H HG2  . PRO A 1 51 ? 3.199   -7.049  0.193   1.00 0.00 ? 51 PRO A HG2  11 
ATOM 9536  H HG3  . PRO A 1 51 ? 1.669   -6.322  0.641   1.00 0.00 ? 51 PRO A HG3  11 
ATOM 9537  H HD2  . PRO A 1 51 ? 3.162   -5.838  -1.760  1.00 0.00 ? 51 PRO A HD2  11 
ATOM 9538  H HD3  . PRO A 1 51 ? 1.692   -5.026  -1.259  1.00 0.00 ? 51 PRO A HD3  11 
ATOM 9539  N N    . LEU A 1 52 ? 6.396   -3.539  1.162   1.00 0.00 ? 52 LEU A N    11 
ATOM 9540  C CA   . LEU A 1 52 ? 7.843   -3.655  1.112   1.00 0.00 ? 52 LEU A CA   11 
ATOM 9541  C C    . LEU A 1 52 ? 8.234   -5.134  1.162   1.00 0.00 ? 52 LEU A C    11 
ATOM 9542  O O    . LEU A 1 52 ? 7.663   -5.905  1.931   1.00 0.00 ? 52 LEU A O    11 
ATOM 9543  C CB   . LEU A 1 52 ? 8.487   -2.812  2.214   1.00 0.00 ? 52 LEU A CB   11 
ATOM 9544  C CG   . LEU A 1 52 ? 9.908   -3.210  2.620   1.00 0.00 ? 52 LEU A CG   11 
ATOM 9545  C CD1  . LEU A 1 52 ? 10.588  -2.088  3.406   1.00 0.00 ? 52 LEU A CD1  11 
ATOM 9546  C CD2  . LEU A 1 52 ? 9.909   -4.532  3.390   1.00 0.00 ? 52 LEU A CD2  11 
ATOM 9547  H H    . LEU A 1 52 ? 6.053   -2.763  1.691   1.00 0.00 ? 52 LEU A H    11 
ATOM 9548  H HA   . LEU A 1 52 ? 8.171   -3.243  0.158   1.00 0.00 ? 52 LEU A HA   11 
ATOM 9549  H HB2  . LEU A 1 52 ? 8.502   -1.772  1.887   1.00 0.00 ? 52 LEU A HB2  11 
ATOM 9550  H HB3  . LEU A 1 52 ? 7.852   -2.859  3.099   1.00 0.00 ? 52 LEU A HB3  11 
ATOM 9551  H HG   . LEU A 1 52 ? 10.491  -3.366  1.712   1.00 0.00 ? 52 LEU A HG   11 
ATOM 9552  H HD11 . LEU A 1 52 ? 9.974   -1.823  4.267   1.00 0.00 ? 52 LEU A HD11 11 
ATOM 9553  H HD12 . LEU A 1 52 ? 11.567  -2.425  3.749   1.00 0.00 ? 52 LEU A HD12 11 
ATOM 9554  H HD13 . LEU A 1 52 ? 10.709  -1.215  2.764   1.00 0.00 ? 52 LEU A HD13 11 
ATOM 9555  H HD21 . LEU A 1 52 ? 8.891   -4.916  3.453   1.00 0.00 ? 52 LEU A HD21 11 
ATOM 9556  H HD22 . LEU A 1 52 ? 10.538  -5.254  2.871   1.00 0.00 ? 52 LEU A HD22 11 
ATOM 9557  H HD23 . LEU A 1 52 ? 10.298  -4.367  4.395   1.00 0.00 ? 52 LEU A HD23 11 
ATOM 9558  N N    . GLN A 1 53 ? 9.205   -5.485  0.331   1.00 0.00 ? 53 GLN A N    11 
ATOM 9559  C CA   . GLN A 1 53 ? 9.678   -6.857  0.270   1.00 0.00 ? 53 GLN A CA   11 
ATOM 9560  C C    . GLN A 1 53 ? 10.380  -7.235  1.576   1.00 0.00 ? 53 GLN A C    11 
ATOM 9561  O O    . GLN A 1 53 ? 11.605  -7.333  1.621   1.00 0.00 ? 53 GLN A O    11 
ATOM 9562  C CB   . GLN A 1 53 ? 10.604  -7.065  -0.930  1.00 0.00 ? 53 GLN A CB   11 
ATOM 9563  C CG   . GLN A 1 53 ? 9.835   -7.632  -2.125  1.00 0.00 ? 53 GLN A CG   11 
ATOM 9564  C CD   . GLN A 1 53 ? 9.631   -6.564  -3.202  1.00 0.00 ? 53 GLN A CD   11 
ATOM 9565  O OE1  . GLN A 1 53 ? 10.034  -6.713  -4.344  1.00 0.00 ? 53 GLN A OE1  11 
ATOM 9566  N NE2  . GLN A 1 53 ? 8.985   -5.483  -2.776  1.00 0.00 ? 53 GLN A NE2  11 
ATOM 9567  H H    . GLN A 1 53 ? 9.664   -4.851  -0.292  1.00 0.00 ? 53 GLN A H    11 
ATOM 9568  H HA   . GLN A 1 53 ? 8.784   -7.467  0.141   1.00 0.00 ? 53 GLN A HA   11 
ATOM 9569  H HB2  . GLN A 1 53 ? 11.066  -6.117  -1.206  1.00 0.00 ? 53 GLN A HB2  11 
ATOM 9570  H HB3  . GLN A 1 53 ? 11.412  -7.745  -0.657  1.00 0.00 ? 53 GLN A HB3  11 
ATOM 9571  H HG2  . GLN A 1 53 ? 10.379  -8.478  -2.545  1.00 0.00 ? 53 GLN A HG2  11 
ATOM 9572  H HG3  . GLN A 1 53 ? 8.867   -8.008  -1.793  1.00 0.00 ? 53 GLN A HG3  11 
ATOM 9573  H HE21 . GLN A 1 53 ? 8.681   -5.424  -1.825  1.00 0.00 ? 53 GLN A HE21 11 
ATOM 9574  H HE22 . GLN A 1 53 ? 8.803   -4.728  -3.407  1.00 0.00 ? 53 GLN A HE22 11 
ATOM 9575  N N    . GLU A 1 54 ? 9.573   -7.437  2.607   1.00 0.00 ? 54 GLU A N    11 
ATOM 9576  C CA   . GLU A 1 54 ? 10.101  -7.801  3.911   1.00 0.00 ? 54 GLU A CA   11 
ATOM 9577  C C    . GLU A 1 54 ? 11.157  -8.899  3.768   1.00 0.00 ? 54 GLU A C    11 
ATOM 9578  O O    . GLU A 1 54 ? 10.846  -10.014 3.349   1.00 0.00 ? 54 GLU A O    11 
ATOM 9579  C CB   . GLU A 1 54 ? 8.979   -8.240  4.854   1.00 0.00 ? 54 GLU A CB   11 
ATOM 9580  C CG   . GLU A 1 54 ? 8.510   -9.659  4.527   1.00 0.00 ? 54 GLU A CG   11 
ATOM 9581  C CD   . GLU A 1 54 ? 9.268   -10.693 5.363   1.00 0.00 ? 54 GLU A CD   11 
ATOM 9582  O OE1  . GLU A 1 54 ? 10.402  -10.367 5.776   1.00 0.00 ? 54 GLU A OE1  11 
ATOM 9583  O OE2  . GLU A 1 54 ? 8.696   -11.784 5.571   1.00 0.00 ? 54 GLU A OE2  11 
ATOM 9584  H H    . GLU A 1 54 ? 8.577   -7.355  2.563   1.00 0.00 ? 54 GLU A H    11 
ATOM 9585  H HA   . GLU A 1 54 ? 10.561  -6.894  4.301   1.00 0.00 ? 54 GLU A HA   11 
ATOM 9586  H HB2  . GLU A 1 54 ? 9.328   -8.197  5.886   1.00 0.00 ? 54 GLU A HB2  11 
ATOM 9587  H HB3  . GLU A 1 54 ? 8.140   -7.548  4.773   1.00 0.00 ? 54 GLU A HB3  11 
ATOM 9588  H HG2  . GLU A 1 54 ? 7.441   -9.746  4.717   1.00 0.00 ? 54 GLU A HG2  11 
ATOM 9589  H HG3  . GLU A 1 54 ? 8.663   -9.861  3.467   1.00 0.00 ? 54 GLU A HG3  11 
ATOM 9590  N N    . ALA A 1 55 ? 12.383  -8.547  4.123   1.00 0.00 ? 55 ALA A N    11 
ATOM 9591  C CA   . ALA A 1 55 ? 13.487  -9.488  4.039   1.00 0.00 ? 55 ALA A CA   11 
ATOM 9592  C C    . ALA A 1 55 ? 14.663  -8.963  4.865   1.00 0.00 ? 55 ALA A C    11 
ATOM 9593  O O    . ALA A 1 55 ? 14.580  -7.888  5.456   1.00 0.00 ? 55 ALA A O    11 
ATOM 9594  C CB   . ALA A 1 55 ? 13.858  -9.711  2.572   1.00 0.00 ? 55 ALA A CB   11 
ATOM 9595  H H    . ALA A 1 55 ? 12.628  -7.638  4.463   1.00 0.00 ? 55 ALA A H    11 
ATOM 9596  H HA   . ALA A 1 55 ? 13.149  -10.434 4.463   1.00 0.00 ? 55 ALA A HA   11 
ATOM 9597  H HB1  . ALA A 1 55 ? 13.527  -10.701 2.260   1.00 0.00 ? 55 ALA A HB1  11 
ATOM 9598  H HB2  . ALA A 1 55 ? 14.939  -9.635  2.455   1.00 0.00 ? 55 ALA A HB2  11 
ATOM 9599  H HB3  . ALA A 1 55 ? 13.372  -8.954  1.956   1.00 0.00 ? 55 ALA A HB3  11 
ATOM 9600  N N    . GLU A 1 56 ? 15.731  -9.748  4.880   1.00 0.00 ? 56 GLU A N    11 
ATOM 9601  C CA   . GLU A 1 56 ? 16.922  -9.376  5.624   1.00 0.00 ? 56 GLU A CA   11 
ATOM 9602  C C    . GLU A 1 56 ? 17.569  -8.135  5.004   1.00 0.00 ? 56 GLU A C    11 
ATOM 9603  O O    . GLU A 1 56 ? 17.055  -7.583  4.033   1.00 0.00 ? 56 GLU A O    11 
ATOM 9604  C CB   . GLU A 1 56 ? 17.915  -10.538 5.687   1.00 0.00 ? 56 GLU A CB   11 
ATOM 9605  C CG   . GLU A 1 56 ? 18.325  -10.986 4.282   1.00 0.00 ? 56 GLU A CG   11 
ATOM 9606  C CD   . GLU A 1 56 ? 18.360  -12.512 4.181   1.00 0.00 ? 56 GLU A CD   11 
ATOM 9607  O OE1  . GLU A 1 56 ? 17.363  -13.132 4.610   1.00 0.00 ? 56 GLU A OE1  11 
ATOM 9608  O OE2  . GLU A 1 56 ? 19.382  -13.024 3.677   1.00 0.00 ? 56 GLU A OE2  11 
ATOM 9609  H H    . GLU A 1 56 ? 15.790  -10.621 4.397   1.00 0.00 ? 56 GLU A H    11 
ATOM 9610  H HA   . GLU A 1 56 ? 16.575  -9.148  6.632   1.00 0.00 ? 56 GLU A HA   11 
ATOM 9611  H HB2  . GLU A 1 56 ? 18.799  -10.237 6.249   1.00 0.00 ? 56 GLU A HB2  11 
ATOM 9612  H HB3  . GLU A 1 56 ? 17.467  -11.375 6.222   1.00 0.00 ? 56 GLU A HB3  11 
ATOM 9613  H HG2  . GLU A 1 56 ? 17.623  -10.585 3.550   1.00 0.00 ? 56 GLU A HG2  11 
ATOM 9614  H HG3  . GLU A 1 56 ? 19.306  -10.579 4.039   1.00 0.00 ? 56 GLU A HG3  11 
ATOM 9615  N N    . CYS A 1 57 ? 18.686  -7.734  5.592   1.00 0.00 ? 57 CYS A N    11 
ATOM 9616  C CA   . CYS A 1 57 ? 19.409  -6.569  5.110   1.00 0.00 ? 57 CYS A CA   11 
ATOM 9617  C C    . CYS A 1 57 ? 18.639  -5.316  5.536   1.00 0.00 ? 57 CYS A C    11 
ATOM 9618  O O    . CYS A 1 57 ? 17.507  -5.103  5.105   1.00 0.00 ? 57 CYS A O    11 
ATOM 9619  C CB   . CYS A 1 57 ? 19.620  -6.621  3.596   1.00 0.00 ? 57 CYS A CB   11 
ATOM 9620  S SG   . CYS A 1 57 ? 20.076  -8.268  2.941   1.00 0.00 ? 57 CYS A SG   11 
ATOM 9621  H H    . CYS A 1 57 ? 19.097  -8.188  6.382   1.00 0.00 ? 57 CYS A H    11 
ATOM 9622  H HA   . CYS A 1 57 ? 20.393  -6.595  5.577   1.00 0.00 ? 57 CYS A HA   11 
ATOM 9623  H HB2  . CYS A 1 57 ? 18.706  -6.291  3.103   1.00 0.00 ? 57 CYS A HB2  11 
ATOM 9624  H HB3  . CYS A 1 57 ? 20.401  -5.910  3.327   1.00 0.00 ? 57 CYS A HB3  11 
ATOM 9625  N N    . THR A 1 58 ? 19.285  -4.522  6.377   1.00 0.00 ? 58 THR A N    11 
ATOM 9626  C CA   . THR A 1 58 ? 18.676  -3.296  6.865   1.00 0.00 ? 58 THR A CA   11 
ATOM 9627  C C    . THR A 1 58 ? 18.302  -2.383  5.696   1.00 0.00 ? 58 THR A C    11 
ATOM 9628  O O    . THR A 1 58 ? 18.804  -2.553  4.586   1.00 0.00 ? 58 THR A O    11 
ATOM 9629  C CB   . THR A 1 58 ? 19.646  -2.648  7.856   1.00 0.00 ? 58 THR A CB   11 
ATOM 9630  O OG1  . THR A 1 58 ? 18.961  -1.479  8.297   1.00 0.00 ? 58 THR A OG1  11 
ATOM 9631  C CG2  . THR A 1 58 ? 20.904  -2.108  7.174   1.00 0.00 ? 58 THR A CG2  11 
ATOM 9632  H H    . THR A 1 58 ? 20.206  -4.703  6.722   1.00 0.00 ? 58 THR A H    11 
ATOM 9633  H HA   . THR A 1 58 ? 17.750  -3.554  7.379   1.00 0.00 ? 58 THR A HA   11 
ATOM 9634  H HB   . THR A 1 58 ? 19.903  -3.340  8.657   1.00 0.00 ? 58 THR A HB   11 
ATOM 9635  H HG1  . THR A 1 58 ? 18.830  -0.850  7.531   1.00 0.00 ? 58 THR A HG1  11 
ATOM 9636  H HG21 . THR A 1 58 ? 20.691  -1.905  6.124   1.00 0.00 ? 58 THR A HG21 11 
ATOM 9637  H HG22 . THR A 1 58 ? 21.217  -1.187  7.666   1.00 0.00 ? 58 THR A HG22 11 
ATOM 9638  H HG23 . THR A 1 58 ? 21.702  -2.847  7.246   1.00 0.00 ? 58 THR A HG23 11 
ATOM 9639  N N    . PHE A 1 59 ? 17.422  -1.435  5.985   1.00 0.00 ? 59 PHE A N    11 
ATOM 9640  C CA   . PHE A 1 59 ? 16.975  -0.495  4.971   1.00 0.00 ? 59 PHE A CA   11 
ATOM 9641  C C    . PHE A 1 59 ? 18.138  -0.057  4.079   1.00 0.00 ? 59 PHE A C    11 
ATOM 9642  O O    . PHE A 1 59 ? 17.976  0.088   2.868   1.00 0.00 ? 59 PHE A O    11 
ATOM 9643  C CB   . PHE A 1 59 ? 16.423  0.727   5.707   1.00 0.00 ? 59 PHE A CB   11 
ATOM 9644  C CG   . PHE A 1 59 ? 14.933  0.632   6.041   1.00 0.00 ? 59 PHE A CG   11 
ATOM 9645  C CD1  . PHE A 1 59 ? 14.524  -0.071  7.132   1.00 0.00 ? 59 PHE A CD1  11 
ATOM 9646  C CD2  . PHE A 1 59 ? 14.017  1.249   5.248   1.00 0.00 ? 59 PHE A CD2  11 
ATOM 9647  C CE1  . PHE A 1 59 ? 13.141  -0.159  7.442   1.00 0.00 ? 59 PHE A CE1  11 
ATOM 9648  C CE2  . PHE A 1 59 ? 12.634  1.161   5.558   1.00 0.00 ? 59 PHE A CE2  11 
ATOM 9649  C CZ   . PHE A 1 59 ? 12.225  0.459   6.649   1.00 0.00 ? 59 PHE A CZ   11 
ATOM 9650  H H    . PHE A 1 59 ? 17.018  -1.304  6.890   1.00 0.00 ? 59 PHE A H    11 
ATOM 9651  H HA   . PHE A 1 59 ? 16.226  -1.006  4.365   1.00 0.00 ? 59 PHE A HA   11 
ATOM 9652  H HB2  . PHE A 1 59 ? 16.984  0.866   6.631   1.00 0.00 ? 59 PHE A HB2  11 
ATOM 9653  H HB3  . PHE A 1 59 ? 16.591  1.613   5.095   1.00 0.00 ? 59 PHE A HB3  11 
ATOM 9654  H HD1  . PHE A 1 59 ? 15.258  -0.565  7.768   1.00 0.00 ? 59 PHE A HD1  11 
ATOM 9655  H HD2  . PHE A 1 59 ? 14.344  1.812   4.374   1.00 0.00 ? 59 PHE A HD2  11 
ATOM 9656  H HE1  . PHE A 1 59 ? 12.814  -0.722  8.317   1.00 0.00 ? 59 PHE A HE1  11 
ATOM 9657  H HE2  . PHE A 1 59 ? 11.900  1.656   4.923   1.00 0.00 ? 59 PHE A HE2  11 
ATOM 9658  H HZ   . PHE A 1 59 ? 11.164  0.391   6.887   1.00 0.00 ? 59 PHE A HZ   11 
ATOM 9659  N N    . GLU A 1 1  ? 10.468  -16.565 15.547  1.00 0.00 ? 1  GLU A N    12 
ATOM 9660  C CA   . GLU A 1 1  ? 9.030   -16.613 15.755  1.00 0.00 ? 1  GLU A CA   12 
ATOM 9661  C C    . GLU A 1 1  ? 8.306   -15.870 14.630  1.00 0.00 ? 1  GLU A C    12 
ATOM 9662  O O    . GLU A 1 1  ? 8.866   -14.959 14.022  1.00 0.00 ? 1  GLU A O    12 
ATOM 9663  C CB   . GLU A 1 1  ? 8.655   -16.037 17.122  1.00 0.00 ? 1  GLU A CB   12 
ATOM 9664  C CG   . GLU A 1 1  ? 8.545   -17.144 18.172  1.00 0.00 ? 1  GLU A CG   12 
ATOM 9665  C CD   . GLU A 1 1  ? 7.185   -17.102 18.873  1.00 0.00 ? 1  GLU A CD   12 
ATOM 9666  O OE1  . GLU A 1 1  ? 6.924   -16.079 19.542  1.00 0.00 ? 1  GLU A OE1  12 
ATOM 9667  O OE2  . GLU A 1 1  ? 6.439   -18.093 18.723  1.00 0.00 ? 1  GLU A OE2  12 
ATOM 9668  H H    . GLU A 1 1  ? 10.752  -16.395 14.603  1.00 0.00 ? 1  GLU A H    12 
ATOM 9669  H HA   . GLU A 1 1  ? 8.769   -17.670 15.729  1.00 0.00 ? 1  GLU A HA   12 
ATOM 9670  H HB2  . GLU A 1 1  ? 9.406   -15.310 17.433  1.00 0.00 ? 1  GLU A HB2  12 
ATOM 9671  H HB3  . GLU A 1 1  ? 7.707   -15.504 17.049  1.00 0.00 ? 1  GLU A HB3  12 
ATOM 9672  H HG2  . GLU A 1 1  ? 8.683   -18.116 17.697  1.00 0.00 ? 1  GLU A HG2  12 
ATOM 9673  H HG3  . GLU A 1 1  ? 9.341   -17.034 18.908  1.00 0.00 ? 1  GLU A HG3  12 
ATOM 9674  N N    . GLU A 1 2  ? 7.072   -16.288 14.388  1.00 0.00 ? 2  GLU A N    12 
ATOM 9675  C CA   . GLU A 1 2  ? 6.266   -15.674 13.347  1.00 0.00 ? 2  GLU A CA   12 
ATOM 9676  C C    . GLU A 1 2  ? 6.459   -14.156 13.351  1.00 0.00 ? 2  GLU A C    12 
ATOM 9677  O O    . GLU A 1 2  ? 6.902   -13.586 14.347  1.00 0.00 ? 2  GLU A O    12 
ATOM 9678  C CB   . GLU A 1 2  ? 4.789   -16.039 13.510  1.00 0.00 ? 2  GLU A CB   12 
ATOM 9679  C CG   . GLU A 1 2  ? 4.210   -15.425 14.786  1.00 0.00 ? 2  GLU A CG   12 
ATOM 9680  C CD   . GLU A 1 2  ? 3.264   -14.268 14.457  1.00 0.00 ? 2  GLU A CD   12 
ATOM 9681  O OE1  . GLU A 1 2  ? 2.363   -14.492 13.621  1.00 0.00 ? 2  GLU A OE1  12 
ATOM 9682  O OE2  . GLU A 1 2  ? 3.464   -13.186 15.050  1.00 0.00 ? 2  GLU A OE2  12 
ATOM 9683  H H    . GLU A 1 2  ? 6.625   -17.029 14.887  1.00 0.00 ? 2  GLU A H    12 
ATOM 9684  H HA   . GLU A 1 2  ? 6.635   -16.091 12.410  1.00 0.00 ? 2  GLU A HA   12 
ATOM 9685  H HB2  . GLU A 1 2  ? 4.226   -15.688 12.645  1.00 0.00 ? 2  GLU A HB2  12 
ATOM 9686  H HB3  . GLU A 1 2  ? 4.680   -17.123 13.542  1.00 0.00 ? 2  GLU A HB3  12 
ATOM 9687  H HG2  . GLU A 1 2  ? 3.675   -16.188 15.351  1.00 0.00 ? 2  GLU A HG2  12 
ATOM 9688  H HG3  . GLU A 1 2  ? 5.020   -15.067 15.422  1.00 0.00 ? 2  GLU A HG3  12 
ATOM 9689  N N    . TYR A 1 3  ? 6.116   -13.545 12.227  1.00 0.00 ? 3  TYR A N    12 
ATOM 9690  C CA   . TYR A 1 3  ? 6.246   -12.104 12.089  1.00 0.00 ? 3  TYR A CA   12 
ATOM 9691  C C    . TYR A 1 3  ? 5.022   -11.507 11.392  1.00 0.00 ? 3  TYR A C    12 
ATOM 9692  O O    . TYR A 1 3  ? 4.325   -12.200 10.652  1.00 0.00 ? 3  TYR A O    12 
ATOM 9693  C CB   . TYR A 1 3  ? 7.479   -11.874 11.213  1.00 0.00 ? 3  TYR A CB   12 
ATOM 9694  C CG   . TYR A 1 3  ? 7.196   -11.938 9.710   1.00 0.00 ? 3  TYR A CG   12 
ATOM 9695  C CD1  . TYR A 1 3  ? 6.783   -10.806 9.037   1.00 0.00 ? 3  TYR A CD1  12 
ATOM 9696  C CD2  . TYR A 1 3  ? 7.354   -13.127 9.028   1.00 0.00 ? 3  TYR A CD2  12 
ATOM 9697  C CE1  . TYR A 1 3  ? 6.516   -10.866 7.624   1.00 0.00 ? 3  TYR A CE1  12 
ATOM 9698  C CE2  . TYR A 1 3  ? 7.087   -13.187 7.614   1.00 0.00 ? 3  TYR A CE2  12 
ATOM 9699  C CZ   . TYR A 1 3  ? 6.682   -12.054 6.982   1.00 0.00 ? 3  TYR A CZ   12 
ATOM 9700  O OH   . TYR A 1 3  ? 6.430   -12.111 5.647   1.00 0.00 ? 3  TYR A OH   12 
ATOM 9701  H H    . TYR A 1 3  ? 5.756   -14.016 11.421  1.00 0.00 ? 3  TYR A H    12 
ATOM 9702  H HA   . TYR A 1 3  ? 6.331   -11.677 13.088  1.00 0.00 ? 3  TYR A HA   12 
ATOM 9703  H HB2  . TYR A 1 3  ? 7.905   -10.899 11.451  1.00 0.00 ? 3  TYR A HB2  12 
ATOM 9704  H HB3  . TYR A 1 3  ? 8.234   -12.620 11.462  1.00 0.00 ? 3  TYR A HB3  12 
ATOM 9705  H HD1  . TYR A 1 3  ? 6.658   -9.867  9.576   1.00 0.00 ? 3  TYR A HD1  12 
ATOM 9706  H HD2  . TYR A 1 3  ? 7.681   -14.021 9.560   1.00 0.00 ? 3  TYR A HD2  12 
ATOM 9707  H HE1  . TYR A 1 3  ? 6.189   -9.980  7.080   1.00 0.00 ? 3  TYR A HE1  12 
ATOM 9708  H HE2  . TYR A 1 3  ? 7.208   -14.120 7.064   1.00 0.00 ? 3  TYR A HE2  12 
ATOM 9709  H HH   . TYR A 1 3  ? 7.164   -12.605 5.181   1.00 0.00 ? 3  TYR A HH   12 
ATOM 9710  N N    . VAL A 1 4  ? 4.798   -10.228 11.652  1.00 0.00 ? 4  VAL A N    12 
ATOM 9711  C CA   . VAL A 1 4  ? 3.669   -9.530  11.059  1.00 0.00 ? 4  VAL A CA   12 
ATOM 9712  C C    . VAL A 1 4  ? 4.063   -8.078  10.779  1.00 0.00 ? 4  VAL A C    12 
ATOM 9713  O O    . VAL A 1 4  ? 5.234   -7.716  10.891  1.00 0.00 ? 4  VAL A O    12 
ATOM 9714  C CB   . VAL A 1 4  ? 2.443   -9.653  11.966  1.00 0.00 ? 4  VAL A CB   12 
ATOM 9715  C CG1  . VAL A 1 4  ? 1.770   -11.016 11.796  1.00 0.00 ? 4  VAL A CG1  12 
ATOM 9716  C CG2  . VAL A 1 4  ? 2.815   -9.403  13.429  1.00 0.00 ? 4  VAL A CG2  12 
ATOM 9717  H H    . VAL A 1 4  ? 5.370   -9.671  12.255  1.00 0.00 ? 4  VAL A H    12 
ATOM 9718  H HA   . VAL A 1 4  ? 3.440   -10.020 10.113  1.00 0.00 ? 4  VAL A HA   12 
ATOM 9719  H HB   . VAL A 1 4  ? 1.728   -8.886  11.667  1.00 0.00 ? 4  VAL A HB   12 
ATOM 9720  H HG11 . VAL A 1 4  ? 2.074   -11.455 10.846  1.00 0.00 ? 4  VAL A HG11 12 
ATOM 9721  H HG12 . VAL A 1 4  ? 2.070   -11.673 12.612  1.00 0.00 ? 4  VAL A HG12 12 
ATOM 9722  H HG13 . VAL A 1 4  ? 0.687   -10.891 11.809  1.00 0.00 ? 4  VAL A HG13 12 
ATOM 9723  H HG21 . VAL A 1 4  ? 3.841   -9.038  13.485  1.00 0.00 ? 4  VAL A HG21 12 
ATOM 9724  H HG22 . VAL A 1 4  ? 2.141   -8.660  13.853  1.00 0.00 ? 4  VAL A HG22 12 
ATOM 9725  H HG23 . VAL A 1 4  ? 2.729   -10.334 13.989  1.00 0.00 ? 4  VAL A HG23 12 
ATOM 9726  N N    . GLY A 1 5  ? 3.063   -7.286  10.422  1.00 0.00 ? 5  GLY A N    12 
ATOM 9727  C CA   . GLY A 1 5  ? 3.291   -5.881  10.126  1.00 0.00 ? 5  GLY A CA   12 
ATOM 9728  C C    . GLY A 1 5  ? 1.967   -5.120  10.030  1.00 0.00 ? 5  GLY A C    12 
ATOM 9729  O O    . GLY A 1 5  ? 1.430   -4.672  11.042  1.00 0.00 ? 5  GLY A O    12 
ATOM 9730  H H    . GLY A 1 5  ? 2.114   -7.588  10.334  1.00 0.00 ? 5  GLY A H    12 
ATOM 9731  H HA2  . GLY A 1 5  ? 3.914   -5.438  10.902  1.00 0.00 ? 5  GLY A HA2  12 
ATOM 9732  H HA3  . GLY A 1 5  ? 3.837   -5.788  9.187   1.00 0.00 ? 5  GLY A HA3  12 
ATOM 9733  N N    . LEU A 1 6  ? 1.479   -4.996  8.805   1.00 0.00 ? 6  LEU A N    12 
ATOM 9734  C CA   . LEU A 1 6  ? 0.229   -4.297  8.564   1.00 0.00 ? 6  LEU A CA   12 
ATOM 9735  C C    . LEU A 1 6  ? 0.098   -3.139  9.555   1.00 0.00 ? 6  LEU A C    12 
ATOM 9736  O O    . LEU A 1 6  ? -0.485  -3.296  10.626  1.00 0.00 ? 6  LEU A O    12 
ATOM 9737  C CB   . LEU A 1 6  ? -0.948  -5.274  8.602   1.00 0.00 ? 6  LEU A CB   12 
ATOM 9738  C CG   . LEU A 1 6  ? -1.224  -5.939  9.952   1.00 0.00 ? 6  LEU A CG   12 
ATOM 9739  C CD1  . LEU A 1 6  ? -2.667  -5.695  10.398  1.00 0.00 ? 6  LEU A CD1  12 
ATOM 9740  C CD2  . LEU A 1 6  ? -0.882  -7.430  9.909   1.00 0.00 ? 6  LEU A CD2  12 
ATOM 9741  H H    . LEU A 1 6  ? 1.922   -5.363  7.987   1.00 0.00 ? 6  LEU A H    12 
ATOM 9742  H HA   . LEU A 1 6  ? 0.273   -3.885  7.555   1.00 0.00 ? 6  LEU A HA   12 
ATOM 9743  H HB2  . LEU A 1 6  ? -1.847  -4.742  8.291   1.00 0.00 ? 6  LEU A HB2  12 
ATOM 9744  H HB3  . LEU A 1 6  ? -0.769  -6.056  7.864   1.00 0.00 ? 6  LEU A HB3  12 
ATOM 9745  H HG   . LEU A 1 6  ? -0.575  -5.481  10.698  1.00 0.00 ? 6  LEU A HG   12 
ATOM 9746  H HD11 . LEU A 1 6  ? -2.961  -4.678  10.137  1.00 0.00 ? 6  LEU A HD11 12 
ATOM 9747  H HD12 . LEU A 1 6  ? -3.327  -6.404  9.898   1.00 0.00 ? 6  LEU A HD12 12 
ATOM 9748  H HD13 . LEU A 1 6  ? -2.741  -5.829  11.477  1.00 0.00 ? 6  LEU A HD13 12 
ATOM 9749  H HD21 . LEU A 1 6  ? -0.964  -7.792  8.884   1.00 0.00 ? 6  LEU A HD21 12 
ATOM 9750  H HD22 . LEU A 1 6  ? 0.137   -7.579  10.267  1.00 0.00 ? 6  LEU A HD22 12 
ATOM 9751  H HD23 . LEU A 1 6  ? -1.575  -7.980  10.545  1.00 0.00 ? 6  LEU A HD23 12 
ATOM 9752  N N    . SER A 1 7  ? 0.651   -2.000  9.162   1.00 0.00 ? 7  SER A N    12 
ATOM 9753  C CA   . SER A 1 7  ? 0.604   -0.816  10.003  1.00 0.00 ? 7  SER A CA   12 
ATOM 9754  C C    . SER A 1 7  ? 1.667   0.188   9.553   1.00 0.00 ? 7  SER A C    12 
ATOM 9755  O O    . SER A 1 7  ? 1.512   1.392   9.749   1.00 0.00 ? 7  SER A O    12 
ATOM 9756  C CB   . SER A 1 7  ? 0.804   -1.178  11.476  1.00 0.00 ? 7  SER A CB   12 
ATOM 9757  O OG   . SER A 1 7  ? 1.699   -2.275  11.639  1.00 0.00 ? 7  SER A OG   12 
ATOM 9758  H H    . SER A 1 7  ? 1.124   -1.880  8.289   1.00 0.00 ? 7  SER A H    12 
ATOM 9759  H HA   . SER A 1 7  ? -0.395  -0.403  9.863   1.00 0.00 ? 7  SER A HA   12 
ATOM 9760  H HB2  . SER A 1 7  ? 1.191   -0.311  12.012  1.00 0.00 ? 7  SER A HB2  12 
ATOM 9761  H HB3  . SER A 1 7  ? -0.158  -1.426  11.923  1.00 0.00 ? 7  SER A HB3  12 
ATOM 9762  H HG   . SER A 1 7  ? 2.372   -2.280  10.899  1.00 0.00 ? 7  SER A HG   12 
ATOM 9763  N N    . ALA A 1 8  ? 2.725   -0.346  8.959   1.00 0.00 ? 8  ALA A N    12 
ATOM 9764  C CA   . ALA A 1 8  ? 3.814   0.489   8.480   1.00 0.00 ? 8  ALA A CA   12 
ATOM 9765  C C    . ALA A 1 8  ? 4.954   -0.404  7.984   1.00 0.00 ? 8  ALA A C    12 
ATOM 9766  O O    . ALA A 1 8  ? 5.657   -0.051  7.039   1.00 0.00 ? 8  ALA A O    12 
ATOM 9767  C CB   . ALA A 1 8  ? 4.258   1.438   9.594   1.00 0.00 ? 8  ALA A CB   12 
ATOM 9768  H H    . ALA A 1 8  ? 2.844   -1.326  8.803   1.00 0.00 ? 8  ALA A H    12 
ATOM 9769  H HA   . ALA A 1 8  ? 3.437   1.079   7.645   1.00 0.00 ? 8  ALA A HA   12 
ATOM 9770  H HB1  . ALA A 1 8  ? 4.238   2.464   9.227   1.00 0.00 ? 8  ALA A HB1  12 
ATOM 9771  H HB2  . ALA A 1 8  ? 5.271   1.183   9.906   1.00 0.00 ? 8  ALA A HB2  12 
ATOM 9772  H HB3  . ALA A 1 8  ? 3.582   1.343   10.444  1.00 0.00 ? 8  ALA A HB3  12 
ATOM 9773  N N    . ASN A 1 9  ? 5.102   -1.542  8.646   1.00 0.00 ? 9  ASN A N    12 
ATOM 9774  C CA   . ASN A 1 9  ? 6.144   -2.487  8.284   1.00 0.00 ? 9  ASN A CA   12 
ATOM 9775  C C    . ASN A 1 9  ? 5.999   -2.860  6.807   1.00 0.00 ? 9  ASN A C    12 
ATOM 9776  O O    . ASN A 1 9  ? 6.967   -2.798  6.050   1.00 0.00 ? 9  ASN A O    12 
ATOM 9777  C CB   . ASN A 1 9  ? 6.034   -3.771  9.109   1.00 0.00 ? 9  ASN A CB   12 
ATOM 9778  C CG   . ASN A 1 9  ? 7.149   -4.754  8.745   1.00 0.00 ? 9  ASN A CG   12 
ATOM 9779  O OD1  . ASN A 1 9  ? 8.312   -4.402  8.641   1.00 0.00 ? 9  ASN A OD1  12 
ATOM 9780  N ND2  . ASN A 1 9  ? 6.729   -6.003  8.559   1.00 0.00 ? 9  ASN A ND2  12 
ATOM 9781  H H    . ASN A 1 9  ? 4.526   -1.821  9.414   1.00 0.00 ? 9  ASN A H    12 
ATOM 9782  H HA   . ASN A 1 9  ? 7.082   -1.973  8.494   1.00 0.00 ? 9  ASN A HA   12 
ATOM 9783  H HB2  . ASN A 1 9  ? 6.088   -3.531  10.171  1.00 0.00 ? 9  ASN A HB2  12 
ATOM 9784  H HB3  . ASN A 1 9  ? 5.063   -4.236  8.936   1.00 0.00 ? 9  ASN A HB3  12 
ATOM 9785  H HD21 . ASN A 1 9  ? 5.760   -6.225  8.661   1.00 0.00 ? 9  ASN A HD21 12 
ATOM 9786  H HD22 . ASN A 1 9  ? 7.384   -6.719  8.318   1.00 0.00 ? 9  ASN A HD22 12 
ATOM 9787  N N    . GLN A 1 10 ? 4.784   -3.240  6.443   1.00 0.00 ? 10 GLN A N    12 
ATOM 9788  C CA   . GLN A 1 10 ? 4.500   -3.623  5.070   1.00 0.00 ? 10 GLN A CA   12 
ATOM 9789  C C    . GLN A 1 10 ? 4.576   -2.401  4.151   1.00 0.00 ? 10 GLN A C    12 
ATOM 9790  O O    . GLN A 1 10 ? 5.029   -2.504  3.013   1.00 0.00 ? 10 GLN A O    12 
ATOM 9791  C CB   . GLN A 1 10 ? 3.134   -4.305  4.962   1.00 0.00 ? 10 GLN A CB   12 
ATOM 9792  C CG   . GLN A 1 10 ? 2.074   -3.538  5.755   1.00 0.00 ? 10 GLN A CG   12 
ATOM 9793  C CD   . GLN A 1 10 ? 0.673   -3.811  5.204   1.00 0.00 ? 10 GLN A CD   12 
ATOM 9794  O OE1  . GLN A 1 10 ? -0.190  -2.949  5.175   1.00 0.00 ? 10 GLN A OE1  12 
ATOM 9795  N NE2  . GLN A 1 10 ? 0.496   -5.055  4.770   1.00 0.00 ? 10 GLN A NE2  12 
ATOM 9796  H H    . GLN A 1 10 ? 4.002   -3.288  7.065   1.00 0.00 ? 10 GLN A H    12 
ATOM 9797  H HA   . GLN A 1 10 ? 5.278   -4.337  4.802   1.00 0.00 ? 10 GLN A HA   12 
ATOM 9798  H HB2  . GLN A 1 10 ? 2.836   -4.367  3.916   1.00 0.00 ? 10 GLN A HB2  12 
ATOM 9799  H HB3  . GLN A 1 10 ? 3.204   -5.327  5.335   1.00 0.00 ? 10 GLN A HB3  12 
ATOM 9800  H HG2  . GLN A 1 10 ? 2.119   -3.828  6.805   1.00 0.00 ? 10 GLN A HG2  12 
ATOM 9801  H HG3  . GLN A 1 10 ? 2.284   -2.469  5.711   1.00 0.00 ? 10 GLN A HG3  12 
ATOM 9802  H HE21 . GLN A 1 10 ? 1.246   -5.715  4.823   1.00 0.00 ? 10 GLN A HE21 12 
ATOM 9803  H HE22 . GLN A 1 10 ? -0.388  -5.332  4.392   1.00 0.00 ? 10 GLN A HE22 12 
ATOM 9804  N N    . CYS A 1 11 ? 4.127   -1.273  4.681   1.00 0.00 ? 11 CYS A N    12 
ATOM 9805  C CA   . CYS A 1 11 ? 4.139   -0.034  3.923   1.00 0.00 ? 11 CYS A CA   12 
ATOM 9806  C C    . CYS A 1 11 ? 5.219   0.878   4.510   1.00 0.00 ? 11 CYS A C    12 
ATOM 9807  O O    . CYS A 1 11 ? 4.988   2.069   4.712   1.00 0.00 ? 11 CYS A O    12 
ATOM 9808  C CB   . CYS A 1 11 ? 2.765   0.640   3.918   1.00 0.00 ? 11 CYS A CB   12 
ATOM 9809  S SG   . CYS A 1 11 ? 1.367   -0.465  4.334   1.00 0.00 ? 11 CYS A SG   12 
ATOM 9810  H H    . CYS A 1 11 ? 3.760   -1.198  5.609   1.00 0.00 ? 11 CYS A H    12 
ATOM 9811  H HA   . CYS A 1 11 ? 4.374   -0.299  2.893   1.00 0.00 ? 11 CYS A HA   12 
ATOM 9812  H HB2  . CYS A 1 11 ? 2.779   1.467   4.628   1.00 0.00 ? 11 CYS A HB2  12 
ATOM 9813  H HB3  . CYS A 1 11 ? 2.590   1.069   2.932   1.00 0.00 ? 11 CYS A HB3  12 
ATOM 9814  N N    . ALA A 1 12 ? 6.375   0.283   4.767   1.00 0.00 ? 12 ALA A N    12 
ATOM 9815  C CA   . ALA A 1 12 ? 7.491   1.026   5.326   1.00 0.00 ? 12 ALA A CA   12 
ATOM 9816  C C    . ALA A 1 12 ? 8.471   1.384   4.207   1.00 0.00 ? 12 ALA A C    12 
ATOM 9817  O O    . ALA A 1 12 ? 9.685   1.340   4.403   1.00 0.00 ? 12 ALA A O    12 
ATOM 9818  C CB   . ALA A 1 12 ? 8.148   0.203   6.436   1.00 0.00 ? 12 ALA A CB   12 
ATOM 9819  H H    . ALA A 1 12 ? 6.554   -0.687  4.599   1.00 0.00 ? 12 ALA A H    12 
ATOM 9820  H HA   . ALA A 1 12 ? 7.094   1.945   5.759   1.00 0.00 ? 12 ALA A HA   12 
ATOM 9821  H HB1  . ALA A 1 12 ? 9.205   0.066   6.209   1.00 0.00 ? 12 ALA A HB1  12 
ATOM 9822  H HB2  . ALA A 1 12 ? 8.045   0.726   7.386   1.00 0.00 ? 12 ALA A HB2  12 
ATOM 9823  H HB3  . ALA A 1 12 ? 7.662   -0.771  6.502   1.00 0.00 ? 12 ALA A HB3  12 
ATOM 9824  N N    . VAL A 1 13 ? 7.908   1.730   3.059   1.00 0.00 ? 13 VAL A N    12 
ATOM 9825  C CA   . VAL A 1 13 ? 8.717   2.096   1.909   1.00 0.00 ? 13 VAL A CA   12 
ATOM 9826  C C    . VAL A 1 13 ? 8.899   3.615   1.881   1.00 0.00 ? 13 VAL A C    12 
ATOM 9827  O O    . VAL A 1 13 ? 8.045   4.355   2.366   1.00 0.00 ? 13 VAL A O    12 
ATOM 9828  C CB   . VAL A 1 13 ? 8.086   1.546   0.629   1.00 0.00 ? 13 VAL A CB   12 
ATOM 9829  C CG1  . VAL A 1 13 ? 9.143   0.900   -0.270  1.00 0.00 ? 13 VAL A CG1  12 
ATOM 9830  C CG2  . VAL A 1 13 ? 6.963   0.558   0.952   1.00 0.00 ? 13 VAL A CG2  12 
ATOM 9831  H H    . VAL A 1 13 ? 6.920   1.764   2.908   1.00 0.00 ? 13 VAL A H    12 
ATOM 9832  H HA   . VAL A 1 13 ? 9.694   1.628   2.032   1.00 0.00 ? 13 VAL A HA   12 
ATOM 9833  H HB   . VAL A 1 13 ? 7.649   2.383   0.084   1.00 0.00 ? 13 VAL A HB   12 
ATOM 9834  H HG11 . VAL A 1 13 ? 10.061  0.752   0.298   1.00 0.00 ? 13 VAL A HG11 12 
ATOM 9835  H HG12 . VAL A 1 13 ? 8.777   -0.063  -0.627  1.00 0.00 ? 13 VAL A HG12 12 
ATOM 9836  H HG13 . VAL A 1 13 ? 9.342   1.551   -1.121  1.00 0.00 ? 13 VAL A HG13 12 
ATOM 9837  H HG21 . VAL A 1 13 ? 7.259   -0.066  1.795   1.00 0.00 ? 13 VAL A HG21 12 
ATOM 9838  H HG22 . VAL A 1 13 ? 6.058   1.108   1.207   1.00 0.00 ? 13 VAL A HG22 12 
ATOM 9839  H HG23 . VAL A 1 13 ? 6.773   -0.072  0.083   1.00 0.00 ? 13 VAL A HG23 12 
ATOM 9840  N N    . PRO A 1 14 ? 10.048  4.045   1.293   1.00 0.00 ? 14 PRO A N    12 
ATOM 9841  C CA   . PRO A 1 14 ? 10.353  5.463   1.195   1.00 0.00 ? 14 PRO A CA   12 
ATOM 9842  C C    . PRO A 1 14 ? 9.506   6.132   0.111   1.00 0.00 ? 14 PRO A C    12 
ATOM 9843  O O    . PRO A 1 14 ? 8.746   7.057   0.395   1.00 0.00 ? 14 PRO A O    12 
ATOM 9844  C CB   . PRO A 1 14 ? 11.844  5.525   0.907   1.00 0.00 ? 14 PRO A CB   12 
ATOM 9845  C CG   . PRO A 1 14 ? 12.228  4.146   0.395   1.00 0.00 ? 14 PRO A CG   12 
ATOM 9846  C CD   . PRO A 1 14 ? 11.082  3.198   0.708   1.00 0.00 ? 14 PRO A CD   12 
ATOM 9847  H HA   . PRO A 1 14 ? 10.120  5.927   2.050   1.00 0.00 ? 14 PRO A HA   12 
ATOM 9848  H HB2  . PRO A 1 14 ? 12.067  6.293   0.166   1.00 0.00 ? 14 PRO A HB2  12 
ATOM 9849  H HB3  . PRO A 1 14 ? 12.405  5.778   1.807   1.00 0.00 ? 14 PRO A HB3  12 
ATOM 9850  H HG2  . PRO A 1 14 ? 12.416  4.177   -0.678  1.00 0.00 ? 14 PRO A HG2  12 
ATOM 9851  H HG3  . PRO A 1 14 ? 13.147  3.805   0.870   1.00 0.00 ? 14 PRO A HG3  12 
ATOM 9852  H HD2  . PRO A 1 14 ? 10.723  2.699   -0.193  1.00 0.00 ? 14 PRO A HD2  12 
ATOM 9853  H HD3  . PRO A 1 14 ? 11.393  2.416   1.401   1.00 0.00 ? 14 PRO A HD3  12 
ATOM 9854  N N    . ALA A 1 15 ? 9.665   5.639   -1.108  1.00 0.00 ? 15 ALA A N    12 
ATOM 9855  C CA   . ALA A 1 15 ? 8.925   6.178   -2.236  1.00 0.00 ? 15 ALA A CA   12 
ATOM 9856  C C    . ALA A 1 15 ? 9.606   5.753   -3.538  1.00 0.00 ? 15 ALA A C    12 
ATOM 9857  O O    . ALA A 1 15 ? 8.970   5.710   -4.591  1.00 0.00 ? 15 ALA A O    12 
ATOM 9858  C CB   . ALA A 1 15 ? 8.823   7.699   -2.101  1.00 0.00 ? 15 ALA A CB   12 
ATOM 9859  H H    . ALA A 1 15 ? 10.285  4.887   -1.331  1.00 0.00 ? 15 ALA A H    12 
ATOM 9860  H HA   . ALA A 1 15 ? 7.920   5.755   -2.207  1.00 0.00 ? 15 ALA A HA   12 
ATOM 9861  H HB1  . ALA A 1 15 ? 9.533   8.045   -1.350  1.00 0.00 ? 15 ALA A HB1  12 
ATOM 9862  H HB2  . ALA A 1 15 ? 7.812   7.970   -1.797  1.00 0.00 ? 15 ALA A HB2  12 
ATOM 9863  H HB3  . ALA A 1 15 ? 9.052   8.165   -3.059  1.00 0.00 ? 15 ALA A HB3  12 
ATOM 9864  N N    . LYS A 1 16 ? 10.891  5.450   -3.425  1.00 0.00 ? 16 LYS A N    12 
ATOM 9865  C CA   . LYS A 1 16 ? 11.666  5.029   -4.580  1.00 0.00 ? 16 LYS A CA   12 
ATOM 9866  C C    . LYS A 1 16 ? 11.648  3.502   -4.673  1.00 0.00 ? 16 LYS A C    12 
ATOM 9867  O O    . LYS A 1 16 ? 12.295  2.922   -5.542  1.00 0.00 ? 16 LYS A O    12 
ATOM 9868  C CB   . LYS A 1 16 ? 13.074  5.626   -4.527  1.00 0.00 ? 16 LYS A CB   12 
ATOM 9869  C CG   . LYS A 1 16 ? 13.864  5.061   -3.344  1.00 0.00 ? 16 LYS A CG   12 
ATOM 9870  C CD   . LYS A 1 16 ? 14.694  3.848   -3.769  1.00 0.00 ? 16 LYS A CD   12 
ATOM 9871  C CE   . LYS A 1 16 ? 15.815  4.259   -4.726  1.00 0.00 ? 16 LYS A CE   12 
ATOM 9872  N NZ   . LYS A 1 16 ? 15.963  3.262   -5.810  1.00 0.00 ? 16 LYS A NZ   12 
ATOM 9873  H H    . LYS A 1 16 ? 11.401  5.488   -2.565  1.00 0.00 ? 16 LYS A H    12 
ATOM 9874  H HA   . LYS A 1 16 ? 11.177  5.435   -5.466  1.00 0.00 ? 16 LYS A HA   12 
ATOM 9875  H HB2  . LYS A 1 16 ? 13.600  5.410   -5.457  1.00 0.00 ? 16 LYS A HB2  12 
ATOM 9876  H HB3  . LYS A 1 16 ? 13.010  6.710   -4.441  1.00 0.00 ? 16 LYS A HB3  12 
ATOM 9877  H HG2  . LYS A 1 16 ? 14.520  5.832   -2.939  1.00 0.00 ? 16 LYS A HG2  12 
ATOM 9878  H HG3  . LYS A 1 16 ? 13.178  4.775   -2.547  1.00 0.00 ? 16 LYS A HG3  12 
ATOM 9879  H HD2  . LYS A 1 16 ? 15.121  3.369   -2.888  1.00 0.00 ? 16 LYS A HD2  12 
ATOM 9880  H HD3  . LYS A 1 16 ? 14.051  3.113   -4.251  1.00 0.00 ? 16 LYS A HD3  12 
ATOM 9881  H HE2  . LYS A 1 16 ? 15.596  5.239   -5.152  1.00 0.00 ? 16 LYS A HE2  12 
ATOM 9882  H HE3  . LYS A 1 16 ? 16.753  4.352   -4.179  1.00 0.00 ? 16 LYS A HE3  12 
ATOM 9883  H HZ1  . LYS A 1 16 ? 16.029  2.347   -5.414  1.00 0.00 ? 16 LYS A HZ1  12 
ATOM 9884  H HZ2  . LYS A 1 16 ? 15.167  3.307   -6.415  1.00 0.00 ? 16 LYS A HZ2  12 
ATOM 9885  H HZ3  . LYS A 1 16 ? 16.791  3.460   -6.334  1.00 0.00 ? 16 LYS A HZ3  12 
ATOM 9886  N N    . ASP A 1 17 ? 10.899  2.895   -3.764  1.00 0.00 ? 17 ASP A N    12 
ATOM 9887  C CA   . ASP A 1 17 ? 10.788  1.447   -3.732  1.00 0.00 ? 17 ASP A CA   12 
ATOM 9888  C C    . ASP A 1 17 ? 9.321   1.048   -3.908  1.00 0.00 ? 17 ASP A C    12 
ATOM 9889  O O    . ASP A 1 17 ? 8.961   -0.111  -3.708  1.00 0.00 ? 17 ASP A O    12 
ATOM 9890  C CB   . ASP A 1 17 ? 11.273  0.886   -2.394  1.00 0.00 ? 17 ASP A CB   12 
ATOM 9891  C CG   . ASP A 1 17 ? 12.608  0.141   -2.450  1.00 0.00 ? 17 ASP A CG   12 
ATOM 9892  O OD1  . ASP A 1 17 ? 12.788  -0.627  -3.420  1.00 0.00 ? 17 ASP A OD1  12 
ATOM 9893  O OD2  . ASP A 1 17 ? 13.417  0.355   -1.523  1.00 0.00 ? 17 ASP A OD2  12 
ATOM 9894  H H    . ASP A 1 17 ? 10.375  3.375   -3.060  1.00 0.00 ? 17 ASP A H    12 
ATOM 9895  H HA   . ASP A 1 17 ? 11.417  1.093   -4.549  1.00 0.00 ? 17 ASP A HA   12 
ATOM 9896  H HB2  . ASP A 1 17 ? 11.363  1.709   -1.684  1.00 0.00 ? 17 ASP A HB2  12 
ATOM 9897  H HB3  . ASP A 1 17 ? 10.512  0.210   -2.003  1.00 0.00 ? 17 ASP A HB3  12 
ATOM 9898  N N    . ARG A 1 18 ? 8.514   2.031   -4.280  1.00 0.00 ? 18 ARG A N    12 
ATOM 9899  C CA   . ARG A 1 18 ? 7.095   1.797   -4.485  1.00 0.00 ? 18 ARG A CA   12 
ATOM 9900  C C    . ARG A 1 18 ? 6.860   1.099   -5.826  1.00 0.00 ? 18 ARG A C    12 
ATOM 9901  O O    . ARG A 1 18 ? 7.206   1.635   -6.878  1.00 0.00 ? 18 ARG A O    12 
ATOM 9902  C CB   . ARG A 1 18 ? 6.311   3.110   -4.457  1.00 0.00 ? 18 ARG A CB   12 
ATOM 9903  C CG   . ARG A 1 18 ? 6.815   4.027   -3.341  1.00 0.00 ? 18 ARG A CG   12 
ATOM 9904  C CD   . ARG A 1 18 ? 6.598   3.388   -1.968  1.00 0.00 ? 18 ARG A CD   12 
ATOM 9905  N NE   . ARG A 1 18 ? 6.825   4.390   -0.902  1.00 0.00 ? 18 ARG A NE   12 
ATOM 9906  C CZ   . ARG A 1 18 ? 6.067   5.481   -0.723  1.00 0.00 ? 18 ARG A CZ   12 
ATOM 9907  N NH1  . ARG A 1 18 ? 5.029   5.716   -1.537  1.00 0.00 ? 18 ARG A NH1  12 
ATOM 9908  N NH2  . ARG A 1 18 ? 6.346   6.335   0.270   1.00 0.00 ? 18 ARG A NH2  12 
ATOM 9909  H H    . ARG A 1 18 ? 8.815   2.971   -4.441  1.00 0.00 ? 18 ARG A H    12 
ATOM 9910  H HA   . ARG A 1 18 ? 6.795   1.159   -3.653  1.00 0.00 ? 18 ARG A HA   12 
ATOM 9911  H HB2  . ARG A 1 18 ? 6.406   3.615   -5.419  1.00 0.00 ? 18 ARG A HB2  12 
ATOM 9912  H HB3  . ARG A 1 18 ? 5.251   2.902   -4.311  1.00 0.00 ? 18 ARG A HB3  12 
ATOM 9913  H HG2  . ARG A 1 18 ? 7.875   4.233   -3.487  1.00 0.00 ? 18 ARG A HG2  12 
ATOM 9914  H HG3  . ARG A 1 18 ? 6.294   4.983   -3.388  1.00 0.00 ? 18 ARG A HG3  12 
ATOM 9915  H HD2  . ARG A 1 18 ? 5.585   2.993   -1.897  1.00 0.00 ? 18 ARG A HD2  12 
ATOM 9916  H HD3  . ARG A 1 18 ? 7.279   2.547   -1.837  1.00 0.00 ? 18 ARG A HD3  12 
ATOM 9917  H HE   . ARG A 1 18 ? 7.592   4.245   -0.277  1.00 0.00 ? 18 ARG A HE   12 
ATOM 9918  H HH11 . ARG A 1 18 ? 4.820   5.078   -2.278  1.00 0.00 ? 18 ARG A HH11 12 
ATOM 9919  H HH12 . ARG A 1 18 ? 4.463   6.530   -1.403  1.00 0.00 ? 18 ARG A HH12 12 
ATOM 9920  H HH21 . ARG A 1 18 ? 7.121   6.160   0.878   1.00 0.00 ? 18 ARG A HH21 12 
ATOM 9921  H HH22 . ARG A 1 18 ? 5.781   7.149   0.404   1.00 0.00 ? 18 ARG A HH22 12 
ATOM 9922  N N    . VAL A 1 19 ? 6.275   -0.087  -5.745  1.00 0.00 ? 19 VAL A N    12 
ATOM 9923  C CA   . VAL A 1 19 ? 5.990   -0.864  -6.940  1.00 0.00 ? 19 VAL A CA   12 
ATOM 9924  C C    . VAL A 1 19 ? 4.642   -0.429  -7.517  1.00 0.00 ? 19 VAL A C    12 
ATOM 9925  O O    . VAL A 1 19 ? 4.275   -0.831  -8.620  1.00 0.00 ? 19 VAL A O    12 
ATOM 9926  C CB   . VAL A 1 19 ? 6.048   -2.359  -6.618  1.00 0.00 ? 19 VAL A CB   12 
ATOM 9927  C CG1  . VAL A 1 19 ? 6.269   -3.185  -7.887  1.00 0.00 ? 19 VAL A CG1  12 
ATOM 9928  C CG2  . VAL A 1 19 ? 7.129   -2.654  -5.576  1.00 0.00 ? 19 VAL A CG2  12 
ATOM 9929  H H    . VAL A 1 19 ? 5.997   -0.516  -4.886  1.00 0.00 ? 19 VAL A H    12 
ATOM 9930  H HA   . VAL A 1 19 ? 6.771   -0.645  -7.668  1.00 0.00 ? 19 VAL A HA   12 
ATOM 9931  H HB   . VAL A 1 19 ? 5.087   -2.648  -6.193  1.00 0.00 ? 19 VAL A HB   12 
ATOM 9932  H HG11 . VAL A 1 19 ? 7.174   -2.843  -8.390  1.00 0.00 ? 19 VAL A HG11 12 
ATOM 9933  H HG12 . VAL A 1 19 ? 6.376   -4.236  -7.622  1.00 0.00 ? 19 VAL A HG12 12 
ATOM 9934  H HG13 . VAL A 1 19 ? 5.415   -3.063  -8.553  1.00 0.00 ? 19 VAL A HG13 12 
ATOM 9935  H HG21 . VAL A 1 19 ? 7.944   -1.938  -5.685  1.00 0.00 ? 19 VAL A HG21 12 
ATOM 9936  H HG22 . VAL A 1 19 ? 6.703   -2.570  -4.576  1.00 0.00 ? 19 VAL A HG22 12 
ATOM 9937  H HG23 . VAL A 1 19 ? 7.511   -3.664  -5.725  1.00 0.00 ? 19 VAL A HG23 12 
ATOM 9938  N N    . ASP A 1 20 ? 3.940   0.388   -6.745  1.00 0.00 ? 20 ASP A N    12 
ATOM 9939  C CA   . ASP A 1 20 ? 2.640   0.883   -7.165  1.00 0.00 ? 20 ASP A CA   12 
ATOM 9940  C C    . ASP A 1 20 ? 1.698   -0.301  -7.392  1.00 0.00 ? 20 ASP A C    12 
ATOM 9941  O O    . ASP A 1 20 ? 1.939   -1.134  -8.264  1.00 0.00 ? 20 ASP A O    12 
ATOM 9942  C CB   . ASP A 1 20 ? 2.745   1.661   -8.478  1.00 0.00 ? 20 ASP A CB   12 
ATOM 9943  C CG   . ASP A 1 20 ? 1.417   1.889   -9.203  1.00 0.00 ? 20 ASP A CG   12 
ATOM 9944  O OD1  . ASP A 1 20 ? 0.836   0.879   -9.655  1.00 0.00 ? 20 ASP A OD1  12 
ATOM 9945  O OD2  . ASP A 1 20 ? 1.013   3.069   -9.289  1.00 0.00 ? 20 ASP A OD2  12 
ATOM 9946  H H    . ASP A 1 20 ? 4.245   0.711   -5.849  1.00 0.00 ? 20 ASP A H    12 
ATOM 9947  H HA   . ASP A 1 20 ? 2.306   1.533   -6.357  1.00 0.00 ? 20 ASP A HA   12 
ATOM 9948  H HB2  . ASP A 1 20 ? 3.201   2.629   -8.274  1.00 0.00 ? 20 ASP A HB2  12 
ATOM 9949  H HB3  . ASP A 1 20 ? 3.419   1.126   -9.147  1.00 0.00 ? 20 ASP A HB3  12 
ATOM 9950  N N    . CYS A 1 21 ? 0.643   -0.339  -6.590  1.00 0.00 ? 21 CYS A N    12 
ATOM 9951  C CA   . CYS A 1 21 ? -0.337  -1.407  -6.692  1.00 0.00 ? 21 CYS A CA   12 
ATOM 9952  C C    . CYS A 1 21 ? -1.356  -1.024  -7.767  1.00 0.00 ? 21 CYS A C    12 
ATOM 9953  O O    . CYS A 1 21 ? -2.021  -1.889  -8.334  1.00 0.00 ? 21 CYS A O    12 
ATOM 9954  C CB   . CYS A 1 21 ? -1.006  -1.691  -5.346  1.00 0.00 ? 21 CYS A CB   12 
ATOM 9955  S SG   . CYS A 1 21 ? -1.307  -3.462  -4.996  1.00 0.00 ? 21 CYS A SG   12 
ATOM 9956  H H    . CYS A 1 21 ? 0.454   0.342   -5.883  1.00 0.00 ? 21 CYS A H    12 
ATOM 9957  H HA   . CYS A 1 21 ? 0.209   -2.306  -6.979  1.00 0.00 ? 21 CYS A HA   12 
ATOM 9958  H HB2  . CYS A 1 21 ? -0.384  -1.279  -4.552  1.00 0.00 ? 21 CYS A HB2  12 
ATOM 9959  H HB3  . CYS A 1 21 ? -1.959  -1.162  -5.311  1.00 0.00 ? 21 CYS A HB3  12 
ATOM 9960  N N    . GLY A 1 22 ? -1.446  0.275   -8.015  1.00 0.00 ? 22 GLY A N    12 
ATOM 9961  C CA   . GLY A 1 22 ? -2.372  0.784   -9.012  1.00 0.00 ? 22 GLY A CA   12 
ATOM 9962  C C    . GLY A 1 22 ? -3.821  0.615   -8.551  1.00 0.00 ? 22 GLY A C    12 
ATOM 9963  O O    . GLY A 1 22 ? -4.432  -0.427  -8.780  1.00 0.00 ? 22 GLY A O    12 
ATOM 9964  H H    . GLY A 1 22 ? -0.901  0.972   -7.550  1.00 0.00 ? 22 GLY A H    12 
ATOM 9965  H HA2  . GLY A 1 22 ? -2.167  1.837   -9.200  1.00 0.00 ? 22 GLY A HA2  12 
ATOM 9966  H HA3  . GLY A 1 22 ? -2.224  0.257   -9.955  1.00 0.00 ? 22 GLY A HA3  12 
ATOM 9967  N N    . TYR A 1 23 ? -4.329  1.657   -7.908  1.00 0.00 ? 23 TYR A N    12 
ATOM 9968  C CA   . TYR A 1 23 ? -5.695  1.638   -7.413  1.00 0.00 ? 23 TYR A CA   12 
ATOM 9969  C C    . TYR A 1 23 ? -6.378  2.989   -7.634  1.00 0.00 ? 23 TYR A C    12 
ATOM 9970  O O    . TYR A 1 23 ? -5.722  4.029   -7.619  1.00 0.00 ? 23 TYR A O    12 
ATOM 9971  C CB   . TYR A 1 23 ? -5.594  1.371   -5.909  1.00 0.00 ? 23 TYR A CB   12 
ATOM 9972  C CG   . TYR A 1 23 ? -5.624  -0.113  -5.537  1.00 0.00 ? 23 TYR A CG   12 
ATOM 9973  C CD1  . TYR A 1 23 ? -6.777  -0.848  -5.723  1.00 0.00 ? 23 TYR A CD1  12 
ATOM 9974  C CD2  . TYR A 1 23 ? -4.497  -0.717  -5.017  1.00 0.00 ? 23 TYR A CD2  12 
ATOM 9975  C CE1  . TYR A 1 23 ? -6.805  -2.244  -5.373  1.00 0.00 ? 23 TYR A CE1  12 
ATOM 9976  C CE2  . TYR A 1 23 ? -4.526  -2.113  -4.667  1.00 0.00 ? 23 TYR A CE2  12 
ATOM 9977  C CZ   . TYR A 1 23 ? -5.678  -2.808  -4.862  1.00 0.00 ? 23 TYR A CZ   12 
ATOM 9978  O OH   . TYR A 1 23 ? -5.705  -4.127  -4.531  1.00 0.00 ? 23 TYR A OH   12 
ATOM 9979  H H    . TYR A 1 23 ? -3.825  2.501   -7.726  1.00 0.00 ? 23 TYR A H    12 
ATOM 9980  H HA   . TYR A 1 23 ? -6.240  0.869   -7.960  1.00 0.00 ? 23 TYR A HA   12 
ATOM 9981  H HB2  . TYR A 1 23 ? -4.670  1.810   -5.534  1.00 0.00 ? 23 TYR A HB2  12 
ATOM 9982  H HB3  . TYR A 1 23 ? -6.416  1.878   -5.405  1.00 0.00 ? 23 TYR A HB3  12 
ATOM 9983  H HD1  . TYR A 1 23 ? -7.667  -0.371  -6.134  1.00 0.00 ? 23 TYR A HD1  12 
ATOM 9984  H HD2  . TYR A 1 23 ? -3.586  -0.136  -4.870  1.00 0.00 ? 23 TYR A HD2  12 
ATOM 9985  H HE1  . TYR A 1 23 ? -7.710  -2.836  -5.514  1.00 0.00 ? 23 TYR A HE1  12 
ATOM 9986  H HE2  . TYR A 1 23 ? -3.643  -2.602  -4.254  1.00 0.00 ? 23 TYR A HE2  12 
ATOM 9987  H HH   . TYR A 1 23 ? -5.729  -4.687  -5.359  1.00 0.00 ? 23 TYR A HH   12 
ATOM 9988  N N    . PRO A 1 24 ? -7.720  2.927   -7.840  1.00 0.00 ? 24 PRO A N    12 
ATOM 9989  C CA   . PRO A 1 24 ? -8.500  4.133   -8.064  1.00 0.00 ? 24 PRO A CA   12 
ATOM 9990  C C    . PRO A 1 24 ? -8.700  4.906   -6.759  1.00 0.00 ? 24 PRO A C    12 
ATOM 9991  O O    . PRO A 1 24 ? -8.046  5.922   -6.529  1.00 0.00 ? 24 PRO A O    12 
ATOM 9992  C CB   . PRO A 1 24 ? -9.805  3.650   -8.675  1.00 0.00 ? 24 PRO A CB   12 
ATOM 9993  C CG   . PRO A 1 24 ? -9.898  2.169   -8.343  1.00 0.00 ? 24 PRO A CG   12 
ATOM 9994  C CD   . PRO A 1 24 ? -8.530  1.712   -7.865  1.00 0.00 ? 24 PRO A CD   12 
ATOM 9995  H HA   . PRO A 1 24 ? -8.010  4.753   -8.677  1.00 0.00 ? 24 PRO A HA   12 
ATOM 9996  H HB2  . PRO A 1 24 ? -10.654 4.197   -8.265  1.00 0.00 ? 24 PRO A HB2  12 
ATOM 9997  H HB3  . PRO A 1 24 ? -9.814  3.810   -9.754  1.00 0.00 ? 24 PRO A HB3  12 
ATOM 9998  H HG2  . PRO A 1 24 ? -10.649 1.998   -7.572  1.00 0.00 ? 24 PRO A HG2  12 
ATOM 9999  H HG3  . PRO A 1 24 ? -10.206 1.600   -9.220  1.00 0.00 ? 24 PRO A HG3  12 
ATOM 10000 H HD2  . PRO A 1 24 ? -8.588  1.255   -6.877  1.00 0.00 ? 24 PRO A HD2  12 
ATOM 10001 H HD3  . PRO A 1 24 ? -8.104  0.966   -8.537  1.00 0.00 ? 24 PRO A HD3  12 
ATOM 10002 N N    . HIS A 1 25 ? -9.608  4.396   -5.940  1.00 0.00 ? 25 HIS A N    12 
ATOM 10003 C CA   . HIS A 1 25 ? -9.904  5.027   -4.665  1.00 0.00 ? 25 HIS A CA   12 
ATOM 10004 C C    . HIS A 1 25 ? -8.952  4.490   -3.594  1.00 0.00 ? 25 HIS A C    12 
ATOM 10005 O O    . HIS A 1 25 ? -9.296  3.566   -2.859  1.00 0.00 ? 25 HIS A O    12 
ATOM 10006 C CB   . HIS A 1 25 ? -11.377 4.841   -4.295  1.00 0.00 ? 25 HIS A CB   12 
ATOM 10007 C CG   . HIS A 1 25 ? -11.751 3.417   -3.961  1.00 0.00 ? 25 HIS A CG   12 
ATOM 10008 N ND1  . HIS A 1 25 ? -12.981 3.070   -3.429  1.00 0.00 ? 25 HIS A ND1  12 
ATOM 10009 C CD2  . HIS A 1 25 ? -11.046 2.256   -4.090  1.00 0.00 ? 25 HIS A CD2  12 
ATOM 10010 C CE1  . HIS A 1 25 ? -13.003 1.757   -3.249  1.00 0.00 ? 25 HIS A CE1  12 
ATOM 10011 N NE2  . HIS A 1 25 ? -11.804 1.255   -3.659  1.00 0.00 ? 25 HIS A NE2  12 
ATOM 10012 H H    . HIS A 1 25 ? -10.136 3.570   -6.136  1.00 0.00 ? 25 HIS A H    12 
ATOM 10013 H HA   . HIS A 1 25 ? -9.726  6.094   -4.795  1.00 0.00 ? 25 HIS A HA   12 
ATOM 10014 H HB2  . HIS A 1 25 ? -11.609 5.477   -3.441  1.00 0.00 ? 25 HIS A HB2  12 
ATOM 10015 H HB3  . HIS A 1 25 ? -11.995 5.183   -5.125  1.00 0.00 ? 25 HIS A HB3  12 
ATOM 10016 H HD1  . HIS A 1 25 ? -13.725 3.702   -3.216  1.00 0.00 ? 25 HIS A HD1  12 
ATOM 10017 H HD2  . HIS A 1 25 ? -10.033 2.166   -4.482  1.00 0.00 ? 25 HIS A HD2  12 
ATOM 10018 H HE1  . HIS A 1 25 ? -13.835 1.180   -2.844  1.00 0.00 ? 25 HIS A HE1  12 
ATOM 10019 H HE2  . HIS A 1 25 ? -11.559 0.286   -3.691  1.00 0.00 ? 25 HIS A HE2  12 
ATOM 10020 N N    . VAL A 1 26 ? -7.772  5.091   -3.542  1.00 0.00 ? 26 VAL A N    12 
ATOM 10021 C CA   . VAL A 1 26 ? -6.768  4.685   -2.574  1.00 0.00 ? 26 VAL A CA   12 
ATOM 10022 C C    . VAL A 1 26 ? -6.870  5.577   -1.334  1.00 0.00 ? 26 VAL A C    12 
ATOM 10023 O O    . VAL A 1 26 ? -7.020  6.792   -1.450  1.00 0.00 ? 26 VAL A O    12 
ATOM 10024 C CB   . VAL A 1 26 ? -5.380  4.712   -3.217  1.00 0.00 ? 26 VAL A CB   12 
ATOM 10025 C CG1  . VAL A 1 26 ? -5.262  3.650   -4.312  1.00 0.00 ? 26 VAL A CG1  12 
ATOM 10026 C CG2  . VAL A 1 26 ? -5.057  6.104   -3.765  1.00 0.00 ? 26 VAL A CG2  12 
ATOM 10027 H H    . VAL A 1 26 ? -7.500  5.841   -4.144  1.00 0.00 ? 26 VAL A H    12 
ATOM 10028 H HA   . VAL A 1 26 ? -6.986  3.657   -2.285  1.00 0.00 ? 26 VAL A HA   12 
ATOM 10029 H HB   . VAL A 1 26 ? -4.647  4.479   -2.444  1.00 0.00 ? 26 VAL A HB   12 
ATOM 10030 H HG11 . VAL A 1 26 ? -6.040  3.810   -5.059  1.00 0.00 ? 26 VAL A HG11 12 
ATOM 10031 H HG12 . VAL A 1 26 ? -4.283  3.724   -4.786  1.00 0.00 ? 26 VAL A HG12 12 
ATOM 10032 H HG13 . VAL A 1 26 ? -5.379  2.660   -3.872  1.00 0.00 ? 26 VAL A HG13 12 
ATOM 10033 H HG21 . VAL A 1 26 ? -5.485  6.861   -3.109  1.00 0.00 ? 26 VAL A HG21 12 
ATOM 10034 H HG22 . VAL A 1 26 ? -3.976  6.234   -3.813  1.00 0.00 ? 26 VAL A HG22 12 
ATOM 10035 H HG23 . VAL A 1 26 ? -5.480  6.208   -4.764  1.00 0.00 ? 26 VAL A HG23 12 
ATOM 10036 N N    . THR A 1 27 ? -6.784  4.938   -0.177  1.00 0.00 ? 27 THR A N    12 
ATOM 10037 C CA   . THR A 1 27 ? -6.866  5.658   1.083   1.00 0.00 ? 27 THR A CA   12 
ATOM 10038 C C    . THR A 1 27 ? -6.079  4.922   2.169   1.00 0.00 ? 27 THR A C    12 
ATOM 10039 O O    . THR A 1 27 ? -5.623  3.800   1.958   1.00 0.00 ? 27 THR A O    12 
ATOM 10040 C CB   . THR A 1 27 ? -8.345  5.846   1.426   1.00 0.00 ? 27 THR A CB   12 
ATOM 10041 O OG1  . THR A 1 27 ? -8.700  4.642   2.101   1.00 0.00 ? 27 THR A OG1  12 
ATOM 10042 C CG2  . THR A 1 27 ? -9.237  5.854   0.183   1.00 0.00 ? 27 THR A CG2  12 
ATOM 10043 H H    . THR A 1 27 ? -6.662  3.949   -0.091  1.00 0.00 ? 27 THR A H    12 
ATOM 10044 H HA   . THR A 1 27 ? -6.396  6.633   0.952   1.00 0.00 ? 27 THR A HA   12 
ATOM 10045 H HB   . THR A 1 27 ? -8.495  6.748   2.019   1.00 0.00 ? 27 THR A HB   12 
ATOM 10046 H HG1  . THR A 1 27 ? -9.590  4.750   2.545   1.00 0.00 ? 27 THR A HG1  12 
ATOM 10047 H HG21 . THR A 1 27 ? -9.012  4.982   -0.432  1.00 0.00 ? 27 THR A HG21 12 
ATOM 10048 H HG22 . THR A 1 27 ? -10.284 5.824   0.487   1.00 0.00 ? 27 THR A HG22 12 
ATOM 10049 H HG23 . THR A 1 27 ? -9.052  6.762   -0.392  1.00 0.00 ? 27 THR A HG23 12 
ATOM 10050 N N    . PRO A 1 28 ? -5.940  5.603   3.339   1.00 0.00 ? 28 PRO A N    12 
ATOM 10051 C CA   . PRO A 1 28 ? -5.217  5.026   4.459   1.00 0.00 ? 28 PRO A CA   12 
ATOM 10052 C C    . PRO A 1 28 ? -6.047  3.941   5.148   1.00 0.00 ? 28 PRO A C    12 
ATOM 10053 O O    . PRO A 1 28 ? -6.049  3.841   6.374   1.00 0.00 ? 28 PRO A O    12 
ATOM 10054 C CB   . PRO A 1 28 ? -4.901  6.200   5.370   1.00 0.00 ? 28 PRO A CB   12 
ATOM 10055 C CG   . PRO A 1 28 ? -5.855  7.312   4.964   1.00 0.00 ? 28 PRO A CG   12 
ATOM 10056 C CD   . PRO A 1 28 ? -6.467  6.934   3.625   1.00 0.00 ? 28 PRO A CD   12 
ATOM 10057 H HA   . PRO A 1 28 ? -4.386  4.571   4.138   1.00 0.00 ? 28 PRO A HA   12 
ATOM 10058 H HB2  . PRO A 1 28 ? -5.039  5.931   6.417   1.00 0.00 ? 28 PRO A HB2  12 
ATOM 10059 H HB3  . PRO A 1 28 ? -3.864  6.515   5.256   1.00 0.00 ? 28 PRO A HB3  12 
ATOM 10060 H HG2  . PRO A 1 28 ? -6.633  7.441   5.717   1.00 0.00 ? 28 PRO A HG2  12 
ATOM 10061 H HG3  . PRO A 1 28 ? -5.325  8.261   4.887   1.00 0.00 ? 28 PRO A HG3  12 
ATOM 10062 H HD2  . PRO A 1 28 ? -7.556  6.926   3.675   1.00 0.00 ? 28 PRO A HD2  12 
ATOM 10063 H HD3  . PRO A 1 28 ? -6.189  7.645   2.848   1.00 0.00 ? 28 PRO A HD3  12 
ATOM 10064 N N    . LYS A 1 29 ? -6.732  3.156   4.330   1.00 0.00 ? 29 LYS A N    12 
ATOM 10065 C CA   . LYS A 1 29 ? -7.564  2.082   4.845   1.00 0.00 ? 29 LYS A CA   12 
ATOM 10066 C C    . LYS A 1 29 ? -8.186  1.318   3.674   1.00 0.00 ? 29 LYS A C    12 
ATOM 10067 O O    . LYS A 1 29 ? -8.172  0.088   3.654   1.00 0.00 ? 29 LYS A O    12 
ATOM 10068 C CB   . LYS A 1 29 ? -8.592  2.630   5.837   1.00 0.00 ? 29 LYS A CB   12 
ATOM 10069 C CG   . LYS A 1 29 ? -8.987  1.565   6.862   1.00 0.00 ? 29 LYS A CG   12 
ATOM 10070 C CD   . LYS A 1 29 ? -10.088 0.656   6.312   1.00 0.00 ? 29 LYS A CD   12 
ATOM 10071 C CE   . LYS A 1 29 ? -10.311 -0.550  7.227   1.00 0.00 ? 29 LYS A CE   12 
ATOM 10072 N NZ   . LYS A 1 29 ? -10.352 -1.800  6.436   1.00 0.00 ? 29 LYS A NZ   12 
ATOM 10073 H H    . LYS A 1 29 ? -6.725  3.244   3.334   1.00 0.00 ? 29 LYS A H    12 
ATOM 10074 H HA   . LYS A 1 29 ? -6.916  1.401   5.396   1.00 0.00 ? 29 LYS A HA   12 
ATOM 10075 H HB2  . LYS A 1 29 ? -8.181  3.499   6.350   1.00 0.00 ? 29 LYS A HB2  12 
ATOM 10076 H HB3  . LYS A 1 29 ? -9.478  2.968   5.299   1.00 0.00 ? 29 LYS A HB3  12 
ATOM 10077 H HG2  . LYS A 1 29 ? -8.114  0.967   7.125   1.00 0.00 ? 29 LYS A HG2  12 
ATOM 10078 H HG3  . LYS A 1 29 ? -9.331  2.046   7.778   1.00 0.00 ? 29 LYS A HG3  12 
ATOM 10079 H HD2  . LYS A 1 29 ? -11.016 1.220   6.216   1.00 0.00 ? 29 LYS A HD2  12 
ATOM 10080 H HD3  . LYS A 1 29 ? -9.817  0.314   5.314   1.00 0.00 ? 29 LYS A HD3  12 
ATOM 10081 H HE2  . LYS A 1 29 ? -9.511  -0.606  7.966   1.00 0.00 ? 29 LYS A HE2  12 
ATOM 10082 H HE3  . LYS A 1 29 ? -11.245 -0.430  7.777   1.00 0.00 ? 29 LYS A HE3  12 
ATOM 10083 H HZ1  . LYS A 1 29 ? -9.714  -1.731  5.669   1.00 0.00 ? 29 LYS A HZ1  12 
ATOM 10084 H HZ2  . LYS A 1 29 ? -10.092 -2.571  7.018   1.00 0.00 ? 29 LYS A HZ2  12 
ATOM 10085 H HZ3  . LYS A 1 29 ? -11.278 -1.944  6.087   1.00 0.00 ? 29 LYS A HZ3  12 
ATOM 10086 N N    . GLU A 1 30 ? -8.717  2.078   2.728   1.00 0.00 ? 30 GLU A N    12 
ATOM 10087 C CA   . GLU A 1 30 ? -9.343  1.488   1.557   1.00 0.00 ? 30 GLU A CA   12 
ATOM 10088 C C    . GLU A 1 30 ? -8.283  0.865   0.646   1.00 0.00 ? 30 GLU A C    12 
ATOM 10089 O O    . GLU A 1 30 ? -8.485  -0.221  0.105   1.00 0.00 ? 30 GLU A O    12 
ATOM 10090 C CB   . GLU A 1 30 ? -10.175 2.524   0.799   1.00 0.00 ? 30 GLU A CB   12 
ATOM 10091 C CG   . GLU A 1 30 ? -10.763 1.926   -0.480  1.00 0.00 ? 30 GLU A CG   12 
ATOM 10092 C CD   . GLU A 1 30 ? -12.217 2.362   -0.671  1.00 0.00 ? 30 GLU A CD   12 
ATOM 10093 O OE1  . GLU A 1 30 ? -12.417 3.562   -0.958  1.00 0.00 ? 30 GLU A OE1  12 
ATOM 10094 O OE2  . GLU A 1 30 ? -13.096 1.485   -0.526  1.00 0.00 ? 30 GLU A OE2  12 
ATOM 10095 H H    . GLU A 1 30 ? -8.724  3.078   2.752   1.00 0.00 ? 30 GLU A H    12 
ATOM 10096 H HA   . GLU A 1 30 ? -10.003 0.711   1.942   1.00 0.00 ? 30 GLU A HA   12 
ATOM 10097 H HB2  . GLU A 1 30 ? -10.980 2.887   1.439   1.00 0.00 ? 30 GLU A HB2  12 
ATOM 10098 H HB3  . GLU A 1 30 ? -9.554  3.384   0.551   1.00 0.00 ? 30 GLU A HB3  12 
ATOM 10099 H HG2  . GLU A 1 30 ? -10.170 2.240   -1.339  1.00 0.00 ? 30 GLU A HG2  12 
ATOM 10100 H HG3  . GLU A 1 30 ? -10.709 0.838   -0.436  1.00 0.00 ? 30 GLU A HG3  12 
ATOM 10101 N N    . CYS A 1 31 ? -7.175  1.578   0.506   1.00 0.00 ? 31 CYS A N    12 
ATOM 10102 C CA   . CYS A 1 31 ? -6.083  1.109   -0.330  1.00 0.00 ? 31 CYS A CA   12 
ATOM 10103 C C    . CYS A 1 31 ? -5.439  -0.098  0.355   1.00 0.00 ? 31 CYS A C    12 
ATOM 10104 O O    . CYS A 1 31 ? -4.956  -1.011  -0.313  1.00 0.00 ? 31 CYS A O    12 
ATOM 10105 C CB   . CYS A 1 31 ? -5.067  2.218   -0.609  1.00 0.00 ? 31 CYS A CB   12 
ATOM 10106 S SG   . CYS A 1 31 ? -3.375  1.631   -0.984  1.00 0.00 ? 31 CYS A SG   12 
ATOM 10107 H H    . CYS A 1 31 ? -7.018  2.461   0.950   1.00 0.00 ? 31 CYS A H    12 
ATOM 10108 H HA   . CYS A 1 31 ? -6.522  0.822   -1.286  1.00 0.00 ? 31 CYS A HA   12 
ATOM 10109 H HB2  . CYS A 1 31 ? -5.423  2.816   -1.447  1.00 0.00 ? 31 CYS A HB2  12 
ATOM 10110 H HB3  . CYS A 1 31 ? -5.023  2.877   0.258   1.00 0.00 ? 31 CYS A HB3  12 
ATOM 10111 N N    . ASN A 1 32 ? -5.452  -0.062  1.680   1.00 0.00 ? 32 ASN A N    12 
ATOM 10112 C CA   . ASN A 1 32 ? -4.874  -1.141  2.463   1.00 0.00 ? 32 ASN A CA   12 
ATOM 10113 C C    . ASN A 1 32 ? -5.949  -2.193  2.745   1.00 0.00 ? 32 ASN A C    12 
ATOM 10114 O O    . ASN A 1 32 ? -5.672  -3.218  3.366   1.00 0.00 ? 32 ASN A O    12 
ATOM 10115 C CB   . ASN A 1 32 ? -4.351  -0.628  3.806   1.00 0.00 ? 32 ASN A CB   12 
ATOM 10116 C CG   . ASN A 1 32 ? -5.060  -1.320  4.971   1.00 0.00 ? 32 ASN A CG   12 
ATOM 10117 O OD1  . ASN A 1 32 ? -4.486  -2.115  5.698   1.00 0.00 ? 32 ASN A OD1  12 
ATOM 10118 N ND2  . ASN A 1 32 ? -6.337  -0.975  5.109   1.00 0.00 ? 32 ASN A ND2  12 
ATOM 10119 H H    . ASN A 1 32 ? -5.846  0.684   2.215   1.00 0.00 ? 32 ASN A H    12 
ATOM 10120 H HA   . ASN A 1 32 ? -4.058  -1.532  1.855   1.00 0.00 ? 32 ASN A HA   12 
ATOM 10121 H HB2  . ASN A 1 32 ? -3.277  -0.804  3.873   1.00 0.00 ? 32 ASN A HB2  12 
ATOM 10122 H HB3  . ASN A 1 32 ? -4.502  0.449   3.872   1.00 0.00 ? 32 ASN A HB3  12 
ATOM 10123 H HD21 . ASN A 1 32 ? -6.748  -0.317  4.478   1.00 0.00 ? 32 ASN A HD21 12 
ATOM 10124 H HD22 . ASN A 1 32 ? -6.887  -1.374  5.843   1.00 0.00 ? 32 ASN A HD22 12 
ATOM 10125 N N    . ASN A 1 33 ? -7.154  -1.902  2.276   1.00 0.00 ? 33 ASN A N    12 
ATOM 10126 C CA   . ASN A 1 33 ? -8.271  -2.810  2.469   1.00 0.00 ? 33 ASN A CA   12 
ATOM 10127 C C    . ASN A 1 33 ? -8.464  -3.652  1.207   1.00 0.00 ? 33 ASN A C    12 
ATOM 10128 O O    . ASN A 1 33 ? -8.717  -4.853  1.290   1.00 0.00 ? 33 ASN A O    12 
ATOM 10129 C CB   . ASN A 1 33 ? -9.568  -2.040  2.727   1.00 0.00 ? 33 ASN A CB   12 
ATOM 10130 C CG   . ASN A 1 33 ? -10.782 -2.968  2.649   1.00 0.00 ? 33 ASN A CG   12 
ATOM 10131 O OD1  . ASN A 1 33 ? -10.665 -4.179  2.553   1.00 0.00 ? 33 ASN A OD1  12 
ATOM 10132 N ND2  . ASN A 1 33 ? -11.951 -2.336  2.696   1.00 0.00 ? 33 ASN A ND2  12 
ATOM 10133 H H    . ASN A 1 33 ? -7.371  -1.066  1.772   1.00 0.00 ? 33 ASN A H    12 
ATOM 10134 H HA   . ASN A 1 33 ? -8.003  -3.414  3.336   1.00 0.00 ? 33 ASN A HA   12 
ATOM 10135 H HB2  . ASN A 1 33 ? -9.527  -1.570  3.709   1.00 0.00 ? 33 ASN A HB2  12 
ATOM 10136 H HB3  . ASN A 1 33 ? -9.671  -1.239  1.994   1.00 0.00 ? 33 ASN A HB3  12 
ATOM 10137 H HD21 . ASN A 1 33 ? -11.977 -1.339  2.776   1.00 0.00 ? 33 ASN A HD21 12 
ATOM 10138 H HD22 . ASN A 1 33 ? -12.803 -2.856  2.652   1.00 0.00 ? 33 ASN A HD22 12 
ATOM 10139 N N    . ARG A 1 34 ? -8.337  -2.989  0.067   1.00 0.00 ? 34 ARG A N    12 
ATOM 10140 C CA   . ARG A 1 34 ? -8.494  -3.662  -1.212  1.00 0.00 ? 34 ARG A CA   12 
ATOM 10141 C C    . ARG A 1 34 ? -7.503  -4.822  -1.326  1.00 0.00 ? 34 ARG A C    12 
ATOM 10142 O O    . ARG A 1 34 ? -7.778  -5.814  -2.000  1.00 0.00 ? 34 ARG A O    12 
ATOM 10143 C CB   . ARG A 1 34 ? -8.270  -2.693  -2.375  1.00 0.00 ? 34 ARG A CB   12 
ATOM 10144 C CG   . ARG A 1 34 ? -9.218  -3.001  -3.535  1.00 0.00 ? 34 ARG A CG   12 
ATOM 10145 C CD   . ARG A 1 34 ? -8.914  -4.373  -4.142  1.00 0.00 ? 34 ARG A CD   12 
ATOM 10146 N NE   . ARG A 1 34 ? -9.535  -4.483  -5.481  1.00 0.00 ? 34 ARG A NE   12 
ATOM 10147 C CZ   . ARG A 1 34 ? -9.392  -5.540  -6.291  1.00 0.00 ? 34 ARG A CZ   12 
ATOM 10148 N NH1  . ARG A 1 34 ? -8.647  -6.585  -5.904  1.00 0.00 ? 34 ARG A NH1  12 
ATOM 10149 N NH2  . ARG A 1 34 ? -9.993  -5.554  -7.489  1.00 0.00 ? 34 ARG A NH2  12 
ATOM 10150 H H    . ARG A 1 34 ? -8.131  -2.012  0.008   1.00 0.00 ? 34 ARG A H    12 
ATOM 10151 H HA   . ARG A 1 34 ? -9.522  -4.022  -1.212  1.00 0.00 ? 34 ARG A HA   12 
ATOM 10152 H HB2  . ARG A 1 34 ? -8.427  -1.669  -2.035  1.00 0.00 ? 34 ARG A HB2  12 
ATOM 10153 H HB3  . ARG A 1 34 ? -7.237  -2.761  -2.716  1.00 0.00 ? 34 ARG A HB3  12 
ATOM 10154 H HG2  . ARG A 1 34 ? -10.250 -2.977  -3.184  1.00 0.00 ? 34 ARG A HG2  12 
ATOM 10155 H HG3  . ARG A 1 34 ? -9.124  -2.232  -4.301  1.00 0.00 ? 34 ARG A HG3  12 
ATOM 10156 H HD2  . ARG A 1 34 ? -7.836  -4.514  -4.220  1.00 0.00 ? 34 ARG A HD2  12 
ATOM 10157 H HD3  . ARG A 1 34 ? -9.292  -5.160  -3.491  1.00 0.00 ? 34 ARG A HD3  12 
ATOM 10158 H HE   . ARG A 1 34 ? -10.098 -3.721  -5.801  1.00 0.00 ? 34 ARG A HE   12 
ATOM 10159 H HH11 . ARG A 1 34 ? -8.198  -6.575  -5.010  1.00 0.00 ? 34 ARG A HH11 12 
ATOM 10160 H HH12 . ARG A 1 34 ? -8.539  -7.374  -6.508  1.00 0.00 ? 34 ARG A HH12 12 
ATOM 10161 H HH21 . ARG A 1 34 ? -10.549 -4.774  -7.778  1.00 0.00 ? 34 ARG A HH21 12 
ATOM 10162 H HH22 . ARG A 1 34 ? -9.885  -6.343  -8.093  1.00 0.00 ? 34 ARG A HH22 12 
ATOM 10163 N N    . GLY A 1 35 ? -6.371  -4.660  -0.658  1.00 0.00 ? 35 GLY A N    12 
ATOM 10164 C CA   . GLY A 1 35 ? -5.338  -5.681  -0.676  1.00 0.00 ? 35 GLY A CA   12 
ATOM 10165 C C    . GLY A 1 35 ? -4.005  -5.105  -1.159  1.00 0.00 ? 35 GLY A C    12 
ATOM 10166 O O    . GLY A 1 35 ? -3.593  -5.350  -2.292  1.00 0.00 ? 35 GLY A O    12 
ATOM 10167 H H    . GLY A 1 35 ? -6.154  -3.850  -0.112  1.00 0.00 ? 35 GLY A H    12 
ATOM 10168 H HA2  . GLY A 1 35 ? -5.217  -6.099  0.323   1.00 0.00 ? 35 GLY A HA2  12 
ATOM 10169 H HA3  . GLY A 1 35 ? -5.642  -6.499  -1.329  1.00 0.00 ? 35 GLY A HA3  12 
ATOM 10170 N N    . CYS A 1 36 ? -3.368  -4.351  -0.275  1.00 0.00 ? 36 CYS A N    12 
ATOM 10171 C CA   . CYS A 1 36 ? -2.091  -3.738  -0.596  1.00 0.00 ? 36 CYS A CA   12 
ATOM 10172 C C    . CYS A 1 36 ? -1.736  -2.753  0.520   1.00 0.00 ? 36 CYS A C    12 
ATOM 10173 O O    . CYS A 1 36 ? -2.253  -2.857  1.631   1.00 0.00 ? 36 CYS A O    12 
ATOM 10174 C CB   . CYS A 1 36 ? -2.118  -3.060  -1.968  1.00 0.00 ? 36 CYS A CB   12 
ATOM 10175 S SG   . CYS A 1 36 ? -0.838  -3.645  -3.138  1.00 0.00 ? 36 CYS A SG   12 
ATOM 10176 H H    . CYS A 1 36 ? -3.711  -4.157  0.644   1.00 0.00 ? 36 CYS A H    12 
ATOM 10177 H HA   . CYS A 1 36 ? -1.360  -4.545  -0.647  1.00 0.00 ? 36 CYS A HA   12 
ATOM 10178 H HB2  . CYS A 1 36 ? -3.099  -3.217  -2.416  1.00 0.00 ? 36 CYS A HB2  12 
ATOM 10179 H HB3  . CYS A 1 36 ? -1.999  -1.986  -1.829  1.00 0.00 ? 36 CYS A HB3  12 
ATOM 10180 N N    . CYS A 1 37 ? -0.856  -1.821  0.185   1.00 0.00 ? 37 CYS A N    12 
ATOM 10181 C CA   . CYS A 1 37 ? -0.426  -0.819  1.145   1.00 0.00 ? 37 CYS A CA   12 
ATOM 10182 C C    . CYS A 1 37 ? -0.784  0.562   0.591   1.00 0.00 ? 37 CYS A C    12 
ATOM 10183 O O    . CYS A 1 37 ? -0.854  0.749   -0.622  1.00 0.00 ? 37 CYS A O    12 
ATOM 10184 C CB   . CYS A 1 37 ? 1.067   -0.939  1.458   1.00 0.00 ? 37 CYS A CB   12 
ATOM 10185 S SG   . CYS A 1 37 ? 1.468   -2.008  2.888   1.00 0.00 ? 37 CYS A SG   12 
ATOM 10186 H H    . CYS A 1 37 ? -0.441  -1.744  -0.721  1.00 0.00 ? 37 CYS A H    12 
ATOM 10187 H HA   . CYS A 1 37 ? -0.969  -1.017  2.069   1.00 0.00 ? 37 CYS A HA   12 
ATOM 10188 H HB2  . CYS A 1 37 ? 1.578   -1.327  0.577   1.00 0.00 ? 37 CYS A HB2  12 
ATOM 10189 H HB3  . CYS A 1 37 ? 1.466   0.058   1.644   1.00 0.00 ? 37 CYS A HB3  12 
ATOM 10190 N N    . PHE A 1 38 ? -1.001  1.494   1.508   1.00 0.00 ? 38 PHE A N    12 
ATOM 10191 C CA   . PHE A 1 38 ? -1.350  2.852   1.126   1.00 0.00 ? 38 PHE A CA   12 
ATOM 10192 C C    . PHE A 1 38 ? -0.288  3.845   1.604   1.00 0.00 ? 38 PHE A C    12 
ATOM 10193 O O    . PHE A 1 38 ? 0.635   3.473   2.326   1.00 0.00 ? 38 PHE A O    12 
ATOM 10194 C CB   . PHE A 1 38 ? -2.681  3.180   1.806   1.00 0.00 ? 38 PHE A CB   12 
ATOM 10195 C CG   . PHE A 1 38 ? -3.110  4.641   1.662   1.00 0.00 ? 38 PHE A CG   12 
ATOM 10196 C CD1  . PHE A 1 38 ? -3.737  5.057   0.529   1.00 0.00 ? 38 PHE A CD1  12 
ATOM 10197 C CD2  . PHE A 1 38 ? -2.864  5.524   2.667   1.00 0.00 ? 38 PHE A CD2  12 
ATOM 10198 C CE1  . PHE A 1 38 ? -4.135  6.413   0.395   1.00 0.00 ? 38 PHE A CE1  12 
ATOM 10199 C CE2  . PHE A 1 38 ? -3.262  6.881   2.533   1.00 0.00 ? 38 PHE A CE2  12 
ATOM 10200 C CZ   . PHE A 1 38 ? -3.889  7.297   1.400   1.00 0.00 ? 38 PHE A CZ   12 
ATOM 10201 H H    . PHE A 1 38 ? -0.942  1.334   2.493   1.00 0.00 ? 38 PHE A H    12 
ATOM 10202 H HA   . PHE A 1 38 ? -1.406  2.878   0.038   1.00 0.00 ? 38 PHE A HA   12 
ATOM 10203 H HB2  . PHE A 1 38 ? -3.458  2.540   1.388   1.00 0.00 ? 38 PHE A HB2  12 
ATOM 10204 H HB3  . PHE A 1 38 ? -2.605  2.937   2.866   1.00 0.00 ? 38 PHE A HB3  12 
ATOM 10205 H HD1  . PHE A 1 38 ? -3.933  4.349   -0.276  1.00 0.00 ? 38 PHE A HD1  12 
ATOM 10206 H HD2  . PHE A 1 38 ? -2.362  5.191   3.575   1.00 0.00 ? 38 PHE A HD2  12 
ATOM 10207 H HE1  . PHE A 1 38 ? -4.637  6.747   -0.513  1.00 0.00 ? 38 PHE A HE1  12 
ATOM 10208 H HE2  . PHE A 1 38 ? -3.066  7.589   3.338   1.00 0.00 ? 38 PHE A HE2  12 
ATOM 10209 H HZ   . PHE A 1 38 ? -4.195  8.338   1.297   1.00 0.00 ? 38 PHE A HZ   12 
ATOM 10210 N N    . ASP A 1 39 ? -0.456  5.090   1.180   1.00 0.00 ? 39 ASP A N    12 
ATOM 10211 C CA   . ASP A 1 39 ? 0.476   6.139   1.556   1.00 0.00 ? 39 ASP A CA   12 
ATOM 10212 C C    . ASP A 1 39 ? 0.029   7.461   0.927   1.00 0.00 ? 39 ASP A C    12 
ATOM 10213 O O    . ASP A 1 39 ? -0.486  7.478   -0.190  1.00 0.00 ? 39 ASP A O    12 
ATOM 10214 C CB   . ASP A 1 39 ? 1.887   5.829   1.051   1.00 0.00 ? 39 ASP A CB   12 
ATOM 10215 C CG   . ASP A 1 39 ? 2.942   6.884   1.392   1.00 0.00 ? 39 ASP A CG   12 
ATOM 10216 O OD1  . ASP A 1 39 ? 3.342   6.926   2.575   1.00 0.00 ? 39 ASP A OD1  12 
ATOM 10217 O OD2  . ASP A 1 39 ? 3.324   7.625   0.460   1.00 0.00 ? 39 ASP A OD2  12 
ATOM 10218 H H    . ASP A 1 39 ? -1.210  5.384   0.593   1.00 0.00 ? 39 ASP A H    12 
ATOM 10219 H HA   . ASP A 1 39 ? 0.453   6.167   2.645   1.00 0.00 ? 39 ASP A HA   12 
ATOM 10220 H HB2  . ASP A 1 39 ? 2.204   4.873   1.468   1.00 0.00 ? 39 ASP A HB2  12 
ATOM 10221 H HB3  . ASP A 1 39 ? 1.851   5.709   -0.031  1.00 0.00 ? 39 ASP A HB3  12 
ATOM 10222 N N    . SER A 1 40 ? 0.244   8.536   1.672   1.00 0.00 ? 40 SER A N    12 
ATOM 10223 C CA   . SER A 1 40 ? -0.131  9.858   1.201   1.00 0.00 ? 40 SER A CA   12 
ATOM 10224 C C    . SER A 1 40 ? 0.964   10.868  1.553   1.00 0.00 ? 40 SER A C    12 
ATOM 10225 O O    . SER A 1 40 ? 0.742   12.076  1.490   1.00 0.00 ? 40 SER A O    12 
ATOM 10226 C CB   . SER A 1 40 ? -1.469  10.297  1.799   1.00 0.00 ? 40 SER A CB   12 
ATOM 10227 O OG   . SER A 1 40 ? -1.397  10.455  3.213   1.00 0.00 ? 40 SER A OG   12 
ATOM 10228 H H    . SER A 1 40 ? 0.663   8.513   2.579   1.00 0.00 ? 40 SER A H    12 
ATOM 10229 H HA   . SER A 1 40 ? -0.230  9.763   0.120   1.00 0.00 ? 40 SER A HA   12 
ATOM 10230 H HB2  . SER A 1 40 ? -1.778  11.239  1.344   1.00 0.00 ? 40 SER A HB2  12 
ATOM 10231 H HB3  . SER A 1 40 ? -2.234  9.560   1.555   1.00 0.00 ? 40 SER A HB3  12 
ATOM 10232 H HG   . SER A 1 40 ? -1.399  9.559   3.658   1.00 0.00 ? 40 SER A HG   12 
ATOM 10233 N N    . ARG A 1 41 ? 2.121   10.335  1.916   1.00 0.00 ? 41 ARG A N    12 
ATOM 10234 C CA   . ARG A 1 41 ? 3.251   11.175  2.278   1.00 0.00 ? 41 ARG A CA   12 
ATOM 10235 C C    . ARG A 1 41 ? 3.657   12.057  1.096   1.00 0.00 ? 41 ARG A C    12 
ATOM 10236 O O    . ARG A 1 41 ? 4.074   13.199  1.283   1.00 0.00 ? 41 ARG A O    12 
ATOM 10237 C CB   . ARG A 1 41 ? 4.450   10.328  2.710   1.00 0.00 ? 41 ARG A CB   12 
ATOM 10238 C CG   . ARG A 1 41 ? 5.214   11.002  3.852   1.00 0.00 ? 41 ARG A CG   12 
ATOM 10239 C CD   . ARG A 1 41 ? 5.805   9.962   4.805   1.00 0.00 ? 41 ARG A CD   12 
ATOM 10240 N NE   . ARG A 1 41 ? 6.664   10.626  5.810   1.00 0.00 ? 41 ARG A NE   12 
ATOM 10241 C CZ   . ARG A 1 41 ? 7.552   9.985   6.582   1.00 0.00 ? 41 ARG A CZ   12 
ATOM 10242 N NH1  . ARG A 1 41 ? 7.704   8.658   6.468   1.00 0.00 ? 41 ARG A NH1  12 
ATOM 10243 N NH2  . ARG A 1 41 ? 8.288   10.670  7.467   1.00 0.00 ? 41 ARG A NH2  12 
ATOM 10244 H H    . ARG A 1 41 ? 2.293   9.351   1.965   1.00 0.00 ? 41 ARG A H    12 
ATOM 10245 H HA   . ARG A 1 41 ? 2.893   11.778  3.113   1.00 0.00 ? 41 ARG A HA   12 
ATOM 10246 H HB2  . ARG A 1 41 ? 4.109   9.343   3.028   1.00 0.00 ? 41 ARG A HB2  12 
ATOM 10247 H HB3  . ARG A 1 41 ? 5.117   10.176  1.861   1.00 0.00 ? 41 ARG A HB3  12 
ATOM 10248 H HG2  . ARG A 1 41 ? 6.012   11.622  3.444   1.00 0.00 ? 41 ARG A HG2  12 
ATOM 10249 H HG3  . ARG A 1 41 ? 4.544   11.665  4.401   1.00 0.00 ? 41 ARG A HG3  12 
ATOM 10250 H HD2  . ARG A 1 41 ? 5.004   9.415   5.303   1.00 0.00 ? 41 ARG A HD2  12 
ATOM 10251 H HD3  . ARG A 1 41 ? 6.387   9.231   4.243   1.00 0.00 ? 41 ARG A HD3  12 
ATOM 10252 H HE   . ARG A 1 41 ? 6.576   11.616  5.921   1.00 0.00 ? 41 ARG A HE   12 
ATOM 10253 H HH11 . ARG A 1 41 ? 7.154   8.147   5.807   1.00 0.00 ? 41 ARG A HH11 12 
ATOM 10254 H HH12 . ARG A 1 41 ? 8.366   8.180   7.044   1.00 0.00 ? 41 ARG A HH12 12 
ATOM 10255 H HH21 . ARG A 1 41 ? 8.175   11.660  7.553   1.00 0.00 ? 41 ARG A HH21 12 
ATOM 10256 H HH22 . ARG A 1 41 ? 8.951   10.191  8.043   1.00 0.00 ? 41 ARG A HH22 12 
ATOM 10257 N N    . ILE A 1 42 ? 3.521   11.493  -0.096  1.00 0.00 ? 42 ILE A N    12 
ATOM 10258 C CA   . ILE A 1 42 ? 3.868   12.214  -1.308  1.00 0.00 ? 42 ILE A CA   12 
ATOM 10259 C C    . ILE A 1 42 ? 3.081   11.634  -2.485  1.00 0.00 ? 42 ILE A C    12 
ATOM 10260 O O    . ILE A 1 42 ? 3.026   10.418  -2.660  1.00 0.00 ? 42 ILE A O    12 
ATOM 10261 C CB   . ILE A 1 42 ? 5.384   12.208  -1.519  1.00 0.00 ? 42 ILE A CB   12 
ATOM 10262 C CG1  . ILE A 1 42 ? 6.031   11.015  -0.813  1.00 0.00 ? 42 ILE A CG1  12 
ATOM 10263 C CG2  . ILE A 1 42 ? 6.004   13.538  -1.084  1.00 0.00 ? 42 ILE A CG2  12 
ATOM 10264 C CD1  . ILE A 1 42 ? 5.493   9.694   -1.364  1.00 0.00 ? 42 ILE A CD1  12 
ATOM 10265 H H    . ILE A 1 42 ? 3.181   10.564  -0.239  1.00 0.00 ? 42 ILE A H    12 
ATOM 10266 H HA   . ILE A 1 42 ? 3.567   13.253  -1.169  1.00 0.00 ? 42 ILE A HA   12 
ATOM 10267 H HB   . ILE A 1 42 ? 5.579   12.096  -2.586  1.00 0.00 ? 42 ILE A HB   12 
ATOM 10268 H HG12 . ILE A 1 42 ? 7.113   11.054  -0.943  1.00 0.00 ? 42 ILE A HG12 12 
ATOM 10269 H HG13 . ILE A 1 42 ? 5.836   11.073  0.258   1.00 0.00 ? 42 ILE A HG13 12 
ATOM 10270 H HG21 . ILE A 1 42 ? 5.353   14.020  -0.355  1.00 0.00 ? 42 ILE A HG21 12 
ATOM 10271 H HG22 . ILE A 1 42 ? 6.980   13.354  -0.635  1.00 0.00 ? 42 ILE A HG22 12 
ATOM 10272 H HG23 . ILE A 1 42 ? 6.120   14.186  -1.953  1.00 0.00 ? 42 ILE A HG23 12 
ATOM 10273 H HD11 . ILE A 1 42 ? 5.267   9.807   -2.425  1.00 0.00 ? 42 ILE A HD11 12 
ATOM 10274 H HD12 . ILE A 1 42 ? 6.243   8.913   -1.234  1.00 0.00 ? 42 ILE A HD12 12 
ATOM 10275 H HD13 . ILE A 1 42 ? 4.585   9.419   -0.827  1.00 0.00 ? 42 ILE A HD13 12 
ATOM 10276 N N    . PRO A 1 43 ? 2.475   12.556  -3.281  1.00 0.00 ? 43 PRO A N    12 
ATOM 10277 C CA   . PRO A 1 43 ? 1.694   12.148  -4.436  1.00 0.00 ? 43 PRO A CA   12 
ATOM 10278 C C    . PRO A 1 43 ? 2.602   11.702  -5.584  1.00 0.00 ? 43 PRO A C    12 
ATOM 10279 O O    . PRO A 1 43 ? 2.269   10.775  -6.320  1.00 0.00 ? 43 PRO A O    12 
ATOM 10280 C CB   . PRO A 1 43 ? 0.847   13.361  -4.786  1.00 0.00 ? 43 PRO A CB   12 
ATOM 10281 C CG   . PRO A 1 43 ? 1.518   14.546  -4.111  1.00 0.00 ? 43 PRO A CG   12 
ATOM 10282 C CD   . PRO A 1 43 ? 2.519   14.004  -3.104  1.00 0.00 ? 43 PRO A CD   12 
ATOM 10283 H HA   . PRO A 1 43 ? 1.129   11.354  -4.210  1.00 0.00 ? 43 PRO A HA   12 
ATOM 10284 H HB2  . PRO A 1 43 ? 0.795   13.503  -5.865  1.00 0.00 ? 43 PRO A HB2  12 
ATOM 10285 H HB3  . PRO A 1 43 ? -0.177  13.238  -4.432  1.00 0.00 ? 43 PRO A HB3  12 
ATOM 10286 H HG2  . PRO A 1 43 ? 2.019   15.172  -4.849  1.00 0.00 ? 43 PRO A HG2  12 
ATOM 10287 H HG3  . PRO A 1 43 ? 0.777   15.172  -3.614  1.00 0.00 ? 43 PRO A HG3  12 
ATOM 10288 H HD2  . PRO A 1 43 ? 3.519   14.396  -3.289  1.00 0.00 ? 43 PRO A HD2  12 
ATOM 10289 H HD3  . PRO A 1 43 ? 2.249   14.287  -2.086  1.00 0.00 ? 43 PRO A HD3  12 
ATOM 10290 N N    . GLY A 1 44 ? 3.732   12.384  -5.700  1.00 0.00 ? 44 GLY A N    12 
ATOM 10291 C CA   . GLY A 1 44 ? 4.691   12.070  -6.746  1.00 0.00 ? 44 GLY A CA   12 
ATOM 10292 C C    . GLY A 1 44 ? 4.803   10.558  -6.951  1.00 0.00 ? 44 GLY A C    12 
ATOM 10293 O O    . GLY A 1 44 ? 4.855   10.084  -8.085  1.00 0.00 ? 44 GLY A O    12 
ATOM 10294 H H    . GLY A 1 44 ? 3.996   13.137  -5.098  1.00 0.00 ? 44 GLY A H    12 
ATOM 10295 H HA2  . GLY A 1 44 ? 4.387   12.546  -7.678  1.00 0.00 ? 44 GLY A HA2  12 
ATOM 10296 H HA3  . GLY A 1 44 ? 5.667   12.478  -6.484  1.00 0.00 ? 44 GLY A HA3  12 
ATOM 10297 N N    . VAL A 1 45 ? 4.836   9.843   -5.837  1.00 0.00 ? 45 VAL A N    12 
ATOM 10298 C CA   . VAL A 1 45 ? 4.940   8.394   -5.880  1.00 0.00 ? 45 VAL A CA   12 
ATOM 10299 C C    . VAL A 1 45 ? 3.537   7.784   -5.841  1.00 0.00 ? 45 VAL A C    12 
ATOM 10300 O O    . VAL A 1 45 ? 2.554   8.494   -5.639  1.00 0.00 ? 45 VAL A O    12 
ATOM 10301 C CB   . VAL A 1 45 ? 5.839   7.900   -4.745  1.00 0.00 ? 45 VAL A CB   12 
ATOM 10302 C CG1  . VAL A 1 45 ? 6.956   8.904   -4.454  1.00 0.00 ? 45 VAL A CG1  12 
ATOM 10303 C CG2  . VAL A 1 45 ? 5.021   7.608   -3.485  1.00 0.00 ? 45 VAL A CG2  12 
ATOM 10304 H H    . VAL A 1 45 ? 4.792   10.236  -4.918  1.00 0.00 ? 45 VAL A H    12 
ATOM 10305 H HA   . VAL A 1 45 ? 5.412   8.126   -6.826  1.00 0.00 ? 45 VAL A HA   12 
ATOM 10306 H HB   . VAL A 1 45 ? 6.303   6.967   -5.067  1.00 0.00 ? 45 VAL A HB   12 
ATOM 10307 H HG11 . VAL A 1 45 ? 6.858   9.760   -5.121  1.00 0.00 ? 45 VAL A HG11 12 
ATOM 10308 H HG12 . VAL A 1 45 ? 6.883   9.239   -3.419  1.00 0.00 ? 45 VAL A HG12 12 
ATOM 10309 H HG13 . VAL A 1 45 ? 7.924   8.428   -4.614  1.00 0.00 ? 45 VAL A HG13 12 
ATOM 10310 H HG21 . VAL A 1 45 ? 4.254   8.373   -3.365  1.00 0.00 ? 45 VAL A HG21 12 
ATOM 10311 H HG22 . VAL A 1 45 ? 4.548   6.631   -3.577  1.00 0.00 ? 45 VAL A HG22 12 
ATOM 10312 H HG23 . VAL A 1 45 ? 5.679   7.613   -2.616  1.00 0.00 ? 45 VAL A HG23 12 
ATOM 10313 N N    . PRO A 1 46 ? 3.489   6.440   -6.042  1.00 0.00 ? 46 PRO A N    12 
ATOM 10314 C CA   . PRO A 1 46 ? 2.223   5.727   -6.030  1.00 0.00 ? 46 PRO A CA   12 
ATOM 10315 C C    . PRO A 1 46 ? 1.696   5.567   -4.603  1.00 0.00 ? 46 PRO A C    12 
ATOM 10316 O O    . PRO A 1 46 ? 2.044   4.611   -3.912  1.00 0.00 ? 46 PRO A O    12 
ATOM 10317 C CB   . PRO A 1 46 ? 2.514   4.398   -6.708  1.00 0.00 ? 46 PRO A CB   12 
ATOM 10318 C CG   . PRO A 1 46 ? 4.024   4.225   -6.656  1.00 0.00 ? 46 PRO A CG   12 
ATOM 10319 C CD   . PRO A 1 46 ? 4.634   5.567   -6.284  1.00 0.00 ? 46 PRO A CD   12 
ATOM 10320 H HA   . PRO A 1 46 ? 1.526   6.249   -6.522  1.00 0.00 ? 46 PRO A HA   12 
ATOM 10321 H HB2  . PRO A 1 46 ? 2.009   3.579   -6.195  1.00 0.00 ? 46 PRO A HB2  12 
ATOM 10322 H HB3  . PRO A 1 46 ? 2.157   4.398   -7.738  1.00 0.00 ? 46 PRO A HB3  12 
ATOM 10323 H HG2  . PRO A 1 46 ? 4.296   3.466   -5.923  1.00 0.00 ? 46 PRO A HG2  12 
ATOM 10324 H HG3  . PRO A 1 46 ? 4.403   3.888   -7.620  1.00 0.00 ? 46 PRO A HG3  12 
ATOM 10325 H HD2  . PRO A 1 46 ? 5.263   5.484   -5.397  1.00 0.00 ? 46 PRO A HD2  12 
ATOM 10326 H HD3  . PRO A 1 46 ? 5.263   5.952   -7.086  1.00 0.00 ? 46 PRO A HD3  12 
ATOM 10327 N N    . TRP A 1 47 ? 0.865   6.519   -4.203  1.00 0.00 ? 47 TRP A N    12 
ATOM 10328 C CA   . TRP A 1 47 ? 0.286   6.496   -2.871  1.00 0.00 ? 47 TRP A CA   12 
ATOM 10329 C C    . TRP A 1 47 ? 0.089   5.034   -2.466  1.00 0.00 ? 47 TRP A C    12 
ATOM 10330 O O    . TRP A 1 47 ? 0.572   4.605   -1.419  1.00 0.00 ? 47 TRP A O    12 
ATOM 10331 C CB   . TRP A 1 47 ? -1.008  7.310   -2.821  1.00 0.00 ? 47 TRP A CB   12 
ATOM 10332 C CG   . TRP A 1 47 ? -0.803  8.784   -2.464  1.00 0.00 ? 47 TRP A CG   12 
ATOM 10333 C CD1  . TRP A 1 47 ? 0.269   9.550   -2.709  1.00 0.00 ? 47 TRP A CD1  12 
ATOM 10334 C CD2  . TRP A 1 47 ? -1.743  9.643   -1.785  1.00 0.00 ? 47 TRP A CD2  12 
ATOM 10335 N NE1  . TRP A 1 47 ? 0.089   10.835  -2.239  1.00 0.00 ? 47 TRP A NE1  12 
ATOM 10336 C CE2  . TRP A 1 47 ? -1.173  10.893  -1.659  1.00 0.00 ? 47 TRP A CE2  12 
ATOM 10337 C CE3  . TRP A 1 47 ? -3.032  9.372   -1.294  1.00 0.00 ? 47 TRP A CE3  12 
ATOM 10338 C CZ2  . TRP A 1 47 ? -1.820  11.972  -1.044  1.00 0.00 ? 47 TRP A CZ2  12 
ATOM 10339 C CZ3  . TRP A 1 47 ? -3.665  10.461  -0.682  1.00 0.00 ? 47 TRP A CZ3  12 
ATOM 10340 C CH2  . TRP A 1 47 ? -3.105  11.726  -0.547  1.00 0.00 ? 47 TRP A CH2  12 
ATOM 10341 H H    . TRP A 1 47 ? 0.587   7.293   -4.771  1.00 0.00 ? 47 TRP A H    12 
ATOM 10342 H HA   . TRP A 1 47 ? 0.991   6.978   -2.193  1.00 0.00 ? 47 TRP A HA   12 
ATOM 10343 H HB2  . TRP A 1 47 ? -1.503  7.247   -3.790  1.00 0.00 ? 47 TRP A HB2  12 
ATOM 10344 H HB3  . TRP A 1 47 ? -1.680  6.860   -2.090  1.00 0.00 ? 47 TRP A HB3  12 
ATOM 10345 H HD1  . TRP A 1 47 ? 1.169   9.203   -3.215  1.00 0.00 ? 47 TRP A HD1  12 
ATOM 10346 H HE1  . TRP A 1 47 ? 0.805   11.654  -2.309  1.00 0.00 ? 47 TRP A HE1  12 
ATOM 10347 H HE3  . TRP A 1 47 ? -3.504  8.394   -1.381  1.00 0.00 ? 47 TRP A HE3  12 
ATOM 10348 H HZ2  . TRP A 1 47 ? -1.348  12.951  -0.957  1.00 0.00 ? 47 TRP A HZ2  12 
ATOM 10349 H HZ3  . TRP A 1 47 ? -4.668  10.305  -0.283  1.00 0.00 ? 47 TRP A HZ3  12 
ATOM 10350 H HH2  . TRP A 1 47 ? -3.664  12.523  -0.056  1.00 0.00 ? 47 TRP A HH2  12 
ATOM 10351 N N    . CYS A 1 48 ? -0.622  4.308   -3.317  1.00 0.00 ? 48 CYS A N    12 
ATOM 10352 C CA   . CYS A 1 48 ? -0.889  2.903   -3.061  1.00 0.00 ? 48 CYS A CA   12 
ATOM 10353 C C    . CYS A 1 48 ? 0.188   2.074   -3.764  1.00 0.00 ? 48 CYS A C    12 
ATOM 10354 O O    . CYS A 1 48 ? 0.264   2.061   -4.991  1.00 0.00 ? 48 CYS A O    12 
ATOM 10355 C CB   . CYS A 1 48 ? -2.297  2.505   -3.507  1.00 0.00 ? 48 CYS A CB   12 
ATOM 10356 S SG   . CYS A 1 48 ? -2.975  1.022   -2.675  1.00 0.00 ? 48 CYS A SG   12 
ATOM 10357 H H    . CYS A 1 48 ? -1.011  4.665   -4.166  1.00 0.00 ? 48 CYS A H    12 
ATOM 10358 H HA   . CYS A 1 48 ? -0.839  2.767   -1.981  1.00 0.00 ? 48 CYS A HA   12 
ATOM 10359 H HB2  . CYS A 1 48 ? -2.970  3.343   -3.329  1.00 0.00 ? 48 CYS A HB2  12 
ATOM 10360 H HB3  . CYS A 1 48 ? -2.286  2.328   -4.582  1.00 0.00 ? 48 CYS A HB3  12 
ATOM 10361 N N    . PHE A 1 49 ? 0.993   1.401   -2.955  1.00 0.00 ? 49 PHE A N    12 
ATOM 10362 C CA   . PHE A 1 49 ? 2.062   0.571   -3.483  1.00 0.00 ? 49 PHE A CA   12 
ATOM 10363 C C    . PHE A 1 49 ? 2.099   -0.788  -2.782  1.00 0.00 ? 49 PHE A C    12 
ATOM 10364 O O    . PHE A 1 49 ? 1.511   -0.956  -1.714  1.00 0.00 ? 49 PHE A O    12 
ATOM 10365 C CB   . PHE A 1 49 ? 3.376   1.307   -3.212  1.00 0.00 ? 49 PHE A CB   12 
ATOM 10366 C CG   . PHE A 1 49 ? 3.490   1.876   -1.796  1.00 0.00 ? 49 PHE A CG   12 
ATOM 10367 C CD1  . PHE A 1 49 ? 3.621   1.036   -0.734  1.00 0.00 ? 49 PHE A CD1  12 
ATOM 10368 C CD2  . PHE A 1 49 ? 3.461   3.221   -1.599  1.00 0.00 ? 49 PHE A CD2  12 
ATOM 10369 C CE1  . PHE A 1 49 ? 3.726   1.563   0.580   1.00 0.00 ? 49 PHE A CE1  12 
ATOM 10370 C CE2  . PHE A 1 49 ? 3.567   3.749   -0.285  1.00 0.00 ? 49 PHE A CE2  12 
ATOM 10371 C CZ   . PHE A 1 49 ? 3.697   2.909   0.777   1.00 0.00 ? 49 PHE A CZ   12 
ATOM 10372 H H    . PHE A 1 49 ? 0.925   1.417   -1.957  1.00 0.00 ? 49 PHE A H    12 
ATOM 10373 H HA   . PHE A 1 49 ? 1.864   0.425   -4.545  1.00 0.00 ? 49 PHE A HA   12 
ATOM 10374 H HB2  . PHE A 1 49 ? 4.207   0.623   -3.386  1.00 0.00 ? 49 PHE A HB2  12 
ATOM 10375 H HB3  . PHE A 1 49 ? 3.479   2.122   -3.929  1.00 0.00 ? 49 PHE A HB3  12 
ATOM 10376 H HD1  . PHE A 1 49 ? 3.644   -0.043  -0.892  1.00 0.00 ? 49 PHE A HD1  12 
ATOM 10377 H HD2  . PHE A 1 49 ? 3.356   3.894   -2.450  1.00 0.00 ? 49 PHE A HD2  12 
ATOM 10378 H HE1  . PHE A 1 49 ? 3.831   0.890   1.430   1.00 0.00 ? 49 PHE A HE1  12 
ATOM 10379 H HE2  . PHE A 1 49 ? 3.543   4.827   -0.127  1.00 0.00 ? 49 PHE A HE2  12 
ATOM 10380 H HZ   . PHE A 1 49 ? 3.779   3.314   1.785   1.00 0.00 ? 49 PHE A HZ   12 
ATOM 10381 N N    . LYS A 1 50 ? 2.796   -1.724  -3.410  1.00 0.00 ? 50 LYS A N    12 
ATOM 10382 C CA   . LYS A 1 50 ? 2.917   -3.063  -2.859  1.00 0.00 ? 50 LYS A CA   12 
ATOM 10383 C C    . LYS A 1 50 ? 3.620   -2.990  -1.502  1.00 0.00 ? 50 LYS A C    12 
ATOM 10384 O O    . LYS A 1 50 ? 4.269   -1.994  -1.188  1.00 0.00 ? 50 LYS A O    12 
ATOM 10385 C CB   . LYS A 1 50 ? 3.606   -3.993  -3.860  1.00 0.00 ? 50 LYS A CB   12 
ATOM 10386 C CG   . LYS A 1 50 ? 2.660   -4.366  -5.003  1.00 0.00 ? 50 LYS A CG   12 
ATOM 10387 C CD   . LYS A 1 50 ? 2.796   -5.846  -5.366  1.00 0.00 ? 50 LYS A CD   12 
ATOM 10388 C CE   . LYS A 1 50 ? 3.013   -6.024  -6.870  1.00 0.00 ? 50 LYS A CE   12 
ATOM 10389 N NZ   . LYS A 1 50 ? 2.169   -7.123  -7.390  1.00 0.00 ? 50 LYS A NZ   12 
ATOM 10390 H H    . LYS A 1 50 ? 3.271   -1.579  -4.278  1.00 0.00 ? 50 LYS A H    12 
ATOM 10391 H HA   . LYS A 1 50 ? 1.908   -3.445  -2.706  1.00 0.00 ? 50 LYS A HA   12 
ATOM 10392 H HB2  . LYS A 1 50 ? 4.494   -3.507  -4.263  1.00 0.00 ? 50 LYS A HB2  12 
ATOM 10393 H HB3  . LYS A 1 50 ? 3.941   -4.897  -3.350  1.00 0.00 ? 50 LYS A HB3  12 
ATOM 10394 H HG2  . LYS A 1 50 ? 1.631   -4.153  -4.712  1.00 0.00 ? 50 LYS A HG2  12 
ATOM 10395 H HG3  . LYS A 1 50 ? 2.878   -3.752  -5.876  1.00 0.00 ? 50 LYS A HG3  12 
ATOM 10396 H HD2  . LYS A 1 50 ? 3.632   -6.283  -4.821  1.00 0.00 ? 50 LYS A HD2  12 
ATOM 10397 H HD3  . LYS A 1 50 ? 1.899   -6.384  -5.059  1.00 0.00 ? 50 LYS A HD3  12 
ATOM 10398 H HE2  . LYS A 1 50 ? 2.773   -5.096  -7.390  1.00 0.00 ? 50 LYS A HE2  12 
ATOM 10399 H HE3  . LYS A 1 50 ? 4.063   -6.238  -7.070  1.00 0.00 ? 50 LYS A HE3  12 
ATOM 10400 H HZ1  . LYS A 1 50 ? 2.284   -7.932  -6.814  1.00 0.00 ? 50 LYS A HZ1  12 
ATOM 10401 H HZ2  . LYS A 1 50 ? 1.210   -6.840  -7.380  1.00 0.00 ? 50 LYS A HZ2  12 
ATOM 10402 H HZ3  . LYS A 1 50 ? 2.442   -7.339  -8.328  1.00 0.00 ? 50 LYS A HZ3  12 
ATOM 10403 N N    . PRO A 1 51 ? 3.463   -4.087  -0.714  1.00 0.00 ? 51 PRO A N    12 
ATOM 10404 C CA   . PRO A 1 51 ? 4.075   -4.157  0.602   1.00 0.00 ? 51 PRO A CA   12 
ATOM 10405 C C    . PRO A 1 51 ? 5.580   -4.408  0.494   1.00 0.00 ? 51 PRO A C    12 
ATOM 10406 O O    . PRO A 1 51 ? 6.007   -5.416  -0.068  1.00 0.00 ? 51 PRO A O    12 
ATOM 10407 C CB   . PRO A 1 51 ? 3.337   -5.275  1.320   1.00 0.00 ? 51 PRO A CB   12 
ATOM 10408 C CG   . PRO A 1 51 ? 2.662   -6.095  0.233   1.00 0.00 ? 51 PRO A CG   12 
ATOM 10409 C CD   . PRO A 1 51 ? 2.701   -5.286  -1.053  1.00 0.00 ? 51 PRO A CD   12 
ATOM 10410 H HA   . PRO A 1 51 ? 3.977   -3.283  1.077   1.00 0.00 ? 51 PRO A HA   12 
ATOM 10411 H HB2  . PRO A 1 51 ? 4.026   -5.888  1.901   1.00 0.00 ? 51 PRO A HB2  12 
ATOM 10412 H HB3  . PRO A 1 51 ? 2.603   -4.872  2.019   1.00 0.00 ? 51 PRO A HB3  12 
ATOM 10413 H HG2  . PRO A 1 51 ? 3.174   -7.048  0.100   1.00 0.00 ? 51 PRO A HG2  12 
ATOM 10414 H HG3  . PRO A 1 51 ? 1.632   -6.322  0.510   1.00 0.00 ? 51 PRO A HG3  12 
ATOM 10415 H HD2  . PRO A 1 51 ? 3.179   -5.844  -1.858  1.00 0.00 ? 51 PRO A HD2  12 
ATOM 10416 H HD3  . PRO A 1 51 ? 1.697   -5.033  -1.393  1.00 0.00 ? 51 PRO A HD3  12 
ATOM 10417 N N    . LEU A 1 52 ? 6.344   -3.474  1.041   1.00 0.00 ? 52 LEU A N    12 
ATOM 10418 C CA   . LEU A 1 52 ? 7.793   -3.581  1.013   1.00 0.00 ? 52 LEU A CA   12 
ATOM 10419 C C    . LEU A 1 52 ? 8.196   -5.046  1.193   1.00 0.00 ? 52 LEU A C    12 
ATOM 10420 O O    . LEU A 1 52 ? 7.606   -5.761  2.002   1.00 0.00 ? 52 LEU A O    12 
ATOM 10421 C CB   . LEU A 1 52 ? 8.420   -2.640  2.044   1.00 0.00 ? 52 LEU A CB   12 
ATOM 10422 C CG   . LEU A 1 52 ? 9.818   -3.020  2.537   1.00 0.00 ? 52 LEU A CG   12 
ATOM 10423 C CD1  . LEU A 1 52 ? 10.556  -1.799  3.088   1.00 0.00 ? 52 LEU A CD1  12 
ATOM 10424 C CD2  . LEU A 1 52 ? 9.748   -4.157  3.558   1.00 0.00 ? 52 LEU A CD2  12 
ATOM 10425 H H    . LEU A 1 52 ? 5.990   -2.657  1.496   1.00 0.00 ? 52 LEU A H    12 
ATOM 10426 H HA   . LEU A 1 52 ? 8.126   -3.249  0.030   1.00 0.00 ? 52 LEU A HA   12 
ATOM 10427 H HB2  . LEU A 1 52 ? 8.468   -1.640  1.612   1.00 0.00 ? 52 LEU A HB2  12 
ATOM 10428 H HB3  . LEU A 1 52 ? 7.755   -2.583  2.906   1.00 0.00 ? 52 LEU A HB3  12 
ATOM 10429 H HG   . LEU A 1 52 ? 10.392  -3.387  1.686   1.00 0.00 ? 52 LEU A HG   12 
ATOM 10430 H HD11 . LEU A 1 52 ? 10.389  -0.946  2.430   1.00 0.00 ? 52 LEU A HD11 12 
ATOM 10431 H HD12 . LEU A 1 52 ? 10.182  -1.567  4.085   1.00 0.00 ? 52 LEU A HD12 12 
ATOM 10432 H HD13 . LEU A 1 52 ? 11.623  -2.013  3.141   1.00 0.00 ? 52 LEU A HD13 12 
ATOM 10433 H HD21 . LEU A 1 52 ? 8.781   -4.137  4.060   1.00 0.00 ? 52 LEU A HD21 12 
ATOM 10434 H HD22 . LEU A 1 52 ? 9.873   -5.112  3.048   1.00 0.00 ? 52 LEU A HD22 12 
ATOM 10435 H HD23 . LEU A 1 52 ? 10.542  -4.033  4.295   1.00 0.00 ? 52 LEU A HD23 12 
ATOM 10436 N N    . GLN A 1 53 ? 9.197   -5.450  0.425   1.00 0.00 ? 53 GLN A N    12 
ATOM 10437 C CA   . GLN A 1 53 ? 9.685   -6.817  0.489   1.00 0.00 ? 53 GLN A CA   12 
ATOM 10438 C C    . GLN A 1 53 ? 10.125  -7.157  1.915   1.00 0.00 ? 53 GLN A C    12 
ATOM 10439 O O    . GLN A 1 53 ? 11.304  -7.047  2.247   1.00 0.00 ? 53 GLN A O    12 
ATOM 10440 C CB   . GLN A 1 53 ? 10.826  -7.039  -0.505  1.00 0.00 ? 53 GLN A CB   12 
ATOM 10441 C CG   . GLN A 1 53 ? 11.868  -5.923  -0.402  1.00 0.00 ? 53 GLN A CG   12 
ATOM 10442 C CD   . GLN A 1 53 ? 11.716  -4.925  -1.552  1.00 0.00 ? 53 GLN A CD   12 
ATOM 10443 O OE1  . GLN A 1 53 ? 11.782  -5.269  -2.721  1.00 0.00 ? 53 GLN A OE1  12 
ATOM 10444 N NE2  . GLN A 1 53 ? 11.510  -3.672  -1.157  1.00 0.00 ? 53 GLN A NE2  12 
ATOM 10445 H H    . GLN A 1 53 ? 9.671   -4.863  -0.231  1.00 0.00 ? 53 GLN A H    12 
ATOM 10446 H HA   . GLN A 1 53 ? 8.837   -7.441  0.205   1.00 0.00 ? 53 GLN A HA   12 
ATOM 10447 H HB2  . GLN A 1 53 ? 11.300  -8.002  -0.312  1.00 0.00 ? 53 GLN A HB2  12 
ATOM 10448 H HB3  . GLN A 1 53 ? 10.428  -7.078  -1.519  1.00 0.00 ? 53 GLN A HB3  12 
ATOM 10449 H HG2  . GLN A 1 53 ? 11.758  -5.405  0.550   1.00 0.00 ? 53 GLN A HG2  12 
ATOM 10450 H HG3  . GLN A 1 53 ? 12.869  -6.353  -0.419  1.00 0.00 ? 53 GLN A HG3  12 
ATOM 10451 H HE21 . GLN A 1 53 ? 11.467  -3.456  -0.181  1.00 0.00 ? 53 GLN A HE21 12 
ATOM 10452 H HE22 . GLN A 1 53 ? 11.399  -2.945  -1.835  1.00 0.00 ? 53 GLN A HE22 12 
ATOM 10453 N N    . GLU A 1 54 ? 9.154   -7.564  2.719   1.00 0.00 ? 54 GLU A N    12 
ATOM 10454 C CA   . GLU A 1 54 ? 9.426   -7.920  4.101   1.00 0.00 ? 54 GLU A CA   12 
ATOM 10455 C C    . GLU A 1 54 ? 10.434  -9.070  4.163   1.00 0.00 ? 54 GLU A C    12 
ATOM 10456 O O    . GLU A 1 54 ? 10.051  -10.238 4.131   1.00 0.00 ? 54 GLU A O    12 
ATOM 10457 C CB   . GLU A 1 54 ? 8.136   -8.282  4.838   1.00 0.00 ? 54 GLU A CB   12 
ATOM 10458 C CG   . GLU A 1 54 ? 7.480   -9.519  4.222   1.00 0.00 ? 54 GLU A CG   12 
ATOM 10459 C CD   . GLU A 1 54 ? 6.027   -9.234  3.833   1.00 0.00 ? 54 GLU A CD   12 
ATOM 10460 O OE1  . GLU A 1 54 ? 5.836   -8.641  2.750   1.00 0.00 ? 54 GLU A OE1  12 
ATOM 10461 O OE2  . GLU A 1 54 ? 5.142   -9.615  4.629   1.00 0.00 ? 54 GLU A OE2  12 
ATOM 10462 H H    . GLU A 1 54 ? 8.197   -7.651  2.441   1.00 0.00 ? 54 GLU A H    12 
ATOM 10463 H HA   . GLU A 1 54 ? 9.857   -7.026  4.551   1.00 0.00 ? 54 GLU A HA   12 
ATOM 10464 H HB2  . GLU A 1 54 ? 8.353   -8.468  5.890   1.00 0.00 ? 54 GLU A HB2  12 
ATOM 10465 H HB3  . GLU A 1 54 ? 7.443   -7.442  4.800   1.00 0.00 ? 54 GLU A HB3  12 
ATOM 10466 H HG2  . GLU A 1 54 ? 8.041   -9.832  3.341   1.00 0.00 ? 54 GLU A HG2  12 
ATOM 10467 H HG3  . GLU A 1 54 ? 7.515   -10.346 4.932   1.00 0.00 ? 54 GLU A HG3  12 
ATOM 10468 N N    . ALA A 1 55 ? 11.703  -8.698  4.251   1.00 0.00 ? 55 ALA A N    12 
ATOM 10469 C CA   . ALA A 1 55 ? 12.768  -9.683  4.319   1.00 0.00 ? 55 ALA A CA   12 
ATOM 10470 C C    . ALA A 1 55 ? 13.445  -9.604  5.689   1.00 0.00 ? 55 ALA A C    12 
ATOM 10471 O O    . ALA A 1 55 ? 14.416  -8.869  5.864   1.00 0.00 ? 55 ALA A O    12 
ATOM 10472 C CB   . ALA A 1 55 ? 13.751  -9.452  3.169   1.00 0.00 ? 55 ALA A CB   12 
ATOM 10473 H H    . ALA A 1 55 ? 12.006  -7.745  4.277   1.00 0.00 ? 55 ALA A H    12 
ATOM 10474 H HA   . ALA A 1 55 ? 12.317  -10.669 4.202   1.00 0.00 ? 55 ALA A HA   12 
ATOM 10475 H HB1  . ALA A 1 55 ? 14.169  -10.407 2.851   1.00 0.00 ? 55 ALA A HB1  12 
ATOM 10476 H HB2  . ALA A 1 55 ? 14.556  -8.798  3.505   1.00 0.00 ? 55 ALA A HB2  12 
ATOM 10477 H HB3  . ALA A 1 55 ? 13.229  -8.987  2.333   1.00 0.00 ? 55 ALA A HB3  12 
ATOM 10478 N N    . GLU A 1 56 ? 12.905  -10.370 6.625   1.00 0.00 ? 56 GLU A N    12 
ATOM 10479 C CA   . GLU A 1 56 ? 13.444  -10.396 7.974   1.00 0.00 ? 56 GLU A CA   12 
ATOM 10480 C C    . GLU A 1 56 ? 14.675  -11.303 8.037   1.00 0.00 ? 56 GLU A C    12 
ATOM 10481 O O    . GLU A 1 56 ? 15.598  -11.050 8.810   1.00 0.00 ? 56 GLU A O    12 
ATOM 10482 C CB   . GLU A 1 56 ? 12.382  -10.842 8.981   1.00 0.00 ? 56 GLU A CB   12 
ATOM 10483 C CG   . GLU A 1 56 ? 12.283  -9.856  10.147  1.00 0.00 ? 56 GLU A CG   12 
ATOM 10484 C CD   . GLU A 1 56 ? 11.708  -10.535 11.392  1.00 0.00 ? 56 GLU A CD   12 
ATOM 10485 O OE1  . GLU A 1 56 ? 10.499  -10.851 11.359  1.00 0.00 ? 56 GLU A OE1  12 
ATOM 10486 O OE2  . GLU A 1 56 ? 12.491  -10.723 12.348  1.00 0.00 ? 56 GLU A OE2  12 
ATOM 10487 H H    . GLU A 1 56 ? 12.115  -10.965 6.475   1.00 0.00 ? 56 GLU A H    12 
ATOM 10488 H HA   . GLU A 1 56 ? 13.732  -9.367  8.191   1.00 0.00 ? 56 GLU A HA   12 
ATOM 10489 H HB2  . GLU A 1 56 ? 11.415  -10.921 8.484   1.00 0.00 ? 56 GLU A HB2  12 
ATOM 10490 H HB3  . GLU A 1 56 ? 12.628  -11.834 9.359   1.00 0.00 ? 56 GLU A HB3  12 
ATOM 10491 H HG2  . GLU A 1 56 ? 13.270  -9.453  10.372  1.00 0.00 ? 56 GLU A HG2  12 
ATOM 10492 H HG3  . GLU A 1 56 ? 11.652  -9.014  9.863   1.00 0.00 ? 56 GLU A HG3  12 
ATOM 10493 N N    . CYS A 1 57 ? 14.648  -12.340 7.213   1.00 0.00 ? 57 CYS A N    12 
ATOM 10494 C CA   . CYS A 1 57 ? 15.750  -13.286 7.165   1.00 0.00 ? 57 CYS A CA   12 
ATOM 10495 C C    . CYS A 1 57 ? 15.914  -13.903 8.555   1.00 0.00 ? 57 CYS A C    12 
ATOM 10496 O O    . CYS A 1 57 ? 15.184  -13.556 9.483   1.00 0.00 ? 57 CYS A O    12 
ATOM 10497 C CB   . CYS A 1 57 ? 17.042  -12.626 6.678   1.00 0.00 ? 57 CYS A CB   12 
ATOM 10498 S SG   . CYS A 1 57 ? 17.040  -12.146 4.912   1.00 0.00 ? 57 CYS A SG   12 
ATOM 10499 H H    . CYS A 1 57 ? 13.894  -12.538 6.587   1.00 0.00 ? 57 CYS A H    12 
ATOM 10500 H HA   . CYS A 1 57 ? 15.478  -14.047 6.434   1.00 0.00 ? 57 CYS A HA   12 
ATOM 10501 H HB2  . CYS A 1 57 ? 17.229  -11.737 7.281   1.00 0.00 ? 57 CYS A HB2  12 
ATOM 10502 H HB3  . CYS A 1 57 ? 17.872  -13.310 6.853   1.00 0.00 ? 57 CYS A HB3  12 
ATOM 10503 N N    . THR A 1 58 ? 16.877  -14.808 8.656   1.00 0.00 ? 58 THR A N    12 
ATOM 10504 C CA   . THR A 1 58 ? 17.146  -15.477 9.918   1.00 0.00 ? 58 THR A CA   12 
ATOM 10505 C C    . THR A 1 58 ? 17.122  -14.471 11.071  1.00 0.00 ? 58 THR A C    12 
ATOM 10506 O O    . THR A 1 58 ? 16.466  -14.700 12.085  1.00 0.00 ? 58 THR A O    12 
ATOM 10507 C CB   . THR A 1 58 ? 18.478  -16.218 9.785   1.00 0.00 ? 58 THR A CB   12 
ATOM 10508 O OG1  . THR A 1 58 ? 18.767  -16.652 11.112  1.00 0.00 ? 58 THR A OG1  12 
ATOM 10509 C CG2  . THR A 1 58 ? 19.637  -15.282 9.438   1.00 0.00 ? 58 THR A CG2  12 
ATOM 10510 H H    . THR A 1 58 ? 17.466  -15.085 7.897   1.00 0.00 ? 58 THR A H    12 
ATOM 10511 H HA   . THR A 1 58 ? 16.347  -16.195 10.104  1.00 0.00 ? 58 THR A HA   12 
ATOM 10512 H HB   . THR A 1 58 ? 18.401  -17.029 9.061   1.00 0.00 ? 58 THR A HB   12 
ATOM 10513 H HG1  . THR A 1 58 ? 18.580  -17.631 11.200  1.00 0.00 ? 58 THR A HG1  12 
ATOM 10514 H HG21 . THR A 1 58 ? 19.277  -14.484 8.789   1.00 0.00 ? 58 THR A HG21 12 
ATOM 10515 H HG22 . THR A 1 58 ? 20.043  -14.852 10.354  1.00 0.00 ? 58 THR A HG22 12 
ATOM 10516 H HG23 . THR A 1 58 ? 20.417  -15.845 8.925   1.00 0.00 ? 58 THR A HG23 12 
ATOM 10517 N N    . PHE A 1 59 ? 17.847  -13.379 10.876  1.00 0.00 ? 59 PHE A N    12 
ATOM 10518 C CA   . PHE A 1 59 ? 17.917  -12.338 11.886  1.00 0.00 ? 59 PHE A CA   12 
ATOM 10519 C C    . PHE A 1 59 ? 18.598  -11.084 11.334  1.00 0.00 ? 59 PHE A C    12 
ATOM 10520 O O    . PHE A 1 59 ? 18.884  -11.002 10.141  1.00 0.00 ? 59 PHE A O    12 
ATOM 10521 C CB   . PHE A 1 59 ? 18.754  -12.891 13.042  1.00 0.00 ? 59 PHE A CB   12 
ATOM 10522 C CG   . PHE A 1 59 ? 17.924  -13.421 14.213  1.00 0.00 ? 59 PHE A CG   12 
ATOM 10523 C CD1  . PHE A 1 59 ? 16.961  -12.640 14.772  1.00 0.00 ? 59 PHE A CD1  12 
ATOM 10524 C CD2  . PHE A 1 59 ? 18.149  -14.672 14.696  1.00 0.00 ? 59 PHE A CD2  12 
ATOM 10525 C CE1  . PHE A 1 59 ? 16.191  -13.131 15.859  1.00 0.00 ? 59 PHE A CE1  12 
ATOM 10526 C CE2  . PHE A 1 59 ? 17.379  -15.163 15.783  1.00 0.00 ? 59 PHE A CE2  12 
ATOM 10527 C CZ   . PHE A 1 59 ? 16.416  -14.382 16.341  1.00 0.00 ? 59 PHE A CZ   12 
ATOM 10528 H H    . PHE A 1 59 ? 18.378  -13.201 10.047  1.00 0.00 ? 59 PHE A H    12 
ATOM 10529 H HA   . PHE A 1 59 ? 16.894  -12.096 12.174  1.00 0.00 ? 59 PHE A HA   12 
ATOM 10530 H HB2  . PHE A 1 59 ? 19.387  -13.695 12.666  1.00 0.00 ? 59 PHE A HB2  12 
ATOM 10531 H HB3  . PHE A 1 59 ? 19.417  -12.107 13.405  1.00 0.00 ? 59 PHE A HB3  12 
ATOM 10532 H HD1  . PHE A 1 59 ? 16.780  -11.637 14.385  1.00 0.00 ? 59 PHE A HD1  12 
ATOM 10533 H HD2  . PHE A 1 59 ? 18.921  -15.298 14.248  1.00 0.00 ? 59 PHE A HD2  12 
ATOM 10534 H HE1  . PHE A 1 59 ? 15.419  -12.505 16.306  1.00 0.00 ? 59 PHE A HE1  12 
ATOM 10535 H HE2  . PHE A 1 59 ? 17.560  -16.166 16.170  1.00 0.00 ? 59 PHE A HE2  12 
ATOM 10536 H HZ   . PHE A 1 59 ? 15.825  -14.759 17.176  1.00 0.00 ? 59 PHE A HZ   12 
ATOM 10537 N N    . GLU A 1 1  ? 8.716   -9.782  18.416  1.00 0.00 ? 1  GLU A N    13 
ATOM 10538 C CA   . GLU A 1 1  ? 8.283   -11.021 19.039  1.00 0.00 ? 1  GLU A CA   13 
ATOM 10539 C C    . GLU A 1 1  ? 7.203   -11.693 18.189  1.00 0.00 ? 1  GLU A C    13 
ATOM 10540 O O    . GLU A 1 1  ? 7.327   -12.864 17.833  1.00 0.00 ? 1  GLU A O    13 
ATOM 10541 C CB   . GLU A 1 1  ? 7.784   -10.773 20.464  1.00 0.00 ? 1  GLU A CB   13 
ATOM 10542 C CG   . GLU A 1 1  ? 8.775   -11.318 21.494  1.00 0.00 ? 1  GLU A CG   13 
ATOM 10543 C CD   . GLU A 1 1  ? 9.942   -10.350 21.698  1.00 0.00 ? 1  GLU A CD   13 
ATOM 10544 O OE1  . GLU A 1 1  ? 9.659   -9.188  22.063  1.00 0.00 ? 1  GLU A OE1  13 
ATOM 10545 O OE2  . GLU A 1 1  ? 11.091  -10.793 21.485  1.00 0.00 ? 1  GLU A OE2  13 
ATOM 10546 H H    . GLU A 1 1  ? 9.213   -9.893  17.555  1.00 0.00 ? 1  GLU A H    13 
ATOM 10547 H HA   . GLU A 1 1  ? 9.171   -11.652 19.076  1.00 0.00 ? 1  GLU A HA   13 
ATOM 10548 H HB2  . GLU A 1 1  ? 7.641   -9.704  20.622  1.00 0.00 ? 1  GLU A HB2  13 
ATOM 10549 H HB3  . GLU A 1 1  ? 6.813   -11.249 20.601  1.00 0.00 ? 1  GLU A HB3  13 
ATOM 10550 H HG2  . GLU A 1 1  ? 8.265   -11.483 22.443  1.00 0.00 ? 1  GLU A HG2  13 
ATOM 10551 H HG3  . GLU A 1 1  ? 9.154   -12.285 21.163  1.00 0.00 ? 1  GLU A HG3  13 
ATOM 10552 N N    . GLU A 1 2  ? 6.167   -10.923 17.888  1.00 0.00 ? 2  GLU A N    13 
ATOM 10553 C CA   . GLU A 1 2  ? 5.066   -11.429 17.087  1.00 0.00 ? 2  GLU A CA   13 
ATOM 10554 C C    . GLU A 1 2  ? 5.139   -10.864 15.667  1.00 0.00 ? 2  GLU A C    13 
ATOM 10555 O O    . GLU A 1 2  ? 5.599   -9.741  15.465  1.00 0.00 ? 2  GLU A O    13 
ATOM 10556 C CB   . GLU A 1 2  ? 3.720   -11.105 17.738  1.00 0.00 ? 2  GLU A CB   13 
ATOM 10557 C CG   . GLU A 1 2  ? 3.453   -9.598  17.724  1.00 0.00 ? 2  GLU A CG   13 
ATOM 10558 C CD   . GLU A 1 2  ? 3.628   -8.998  19.121  1.00 0.00 ? 2  GLU A CD   13 
ATOM 10559 O OE1  . GLU A 1 2  ? 2.931   -9.483  20.038  1.00 0.00 ? 2  GLU A OE1  13 
ATOM 10560 O OE2  . GLU A 1 2  ? 4.454   -8.067  19.239  1.00 0.00 ? 2  GLU A OE2  13 
ATOM 10561 H H    . GLU A 1 2  ? 6.074   -9.972  18.182  1.00 0.00 ? 2  GLU A H    13 
ATOM 10562 H HA   . GLU A 1 2  ? 5.199   -12.511 17.062  1.00 0.00 ? 2  GLU A HA   13 
ATOM 10563 H HB2  . GLU A 1 2  ? 2.921   -11.624 17.208  1.00 0.00 ? 2  GLU A HB2  13 
ATOM 10564 H HB3  . GLU A 1 2  ? 3.711   -11.470 18.765  1.00 0.00 ? 2  GLU A HB3  13 
ATOM 10565 H HG2  . GLU A 1 2  ? 4.135   -9.111  17.027  1.00 0.00 ? 2  GLU A HG2  13 
ATOM 10566 H HG3  . GLU A 1 2  ? 2.441   -9.407  17.366  1.00 0.00 ? 2  GLU A HG3  13 
ATOM 10567 N N    . TYR A 1 3  ? 4.678   -11.667 14.720  1.00 0.00 ? 3  TYR A N    13 
ATOM 10568 C CA   . TYR A 1 3  ? 4.685   -11.261 13.325  1.00 0.00 ? 3  TYR A CA   13 
ATOM 10569 C C    . TYR A 1 3  ? 3.471   -10.387 13.002  1.00 0.00 ? 3  TYR A C    13 
ATOM 10570 O O    . TYR A 1 3  ? 2.693   -10.046 13.891  1.00 0.00 ? 3  TYR A O    13 
ATOM 10571 C CB   . TYR A 1 3  ? 4.600   -12.553 12.509  1.00 0.00 ? 3  TYR A CB   13 
ATOM 10572 C CG   . TYR A 1 3  ? 5.060   -12.403 11.058  1.00 0.00 ? 3  TYR A CG   13 
ATOM 10573 C CD1  . TYR A 1 3  ? 6.368   -12.061 10.780  1.00 0.00 ? 3  TYR A CD1  13 
ATOM 10574 C CD2  . TYR A 1 3  ? 4.167   -12.611 10.026  1.00 0.00 ? 3  TYR A CD2  13 
ATOM 10575 C CE1  . TYR A 1 3  ? 6.801   -11.920 9.414   1.00 0.00 ? 3  TYR A CE1  13 
ATOM 10576 C CE2  . TYR A 1 3  ? 4.600   -12.471 8.660   1.00 0.00 ? 3  TYR A CE2  13 
ATOM 10577 C CZ   . TYR A 1 3  ? 5.896   -12.132 8.421   1.00 0.00 ? 3  TYR A CZ   13 
ATOM 10578 O OH   . TYR A 1 3  ? 6.305   -12.000 7.131   1.00 0.00 ? 3  TYR A OH   13 
ATOM 10579 H H    . TYR A 1 3  ? 4.305   -12.579 14.893  1.00 0.00 ? 3  TYR A H    13 
ATOM 10580 H HA   . TYR A 1 3  ? 5.594   -10.687 13.146  1.00 0.00 ? 3  TYR A HA   13 
ATOM 10581 H HB2  . TYR A 1 3  ? 5.206   -13.318 12.995  1.00 0.00 ? 3  TYR A HB2  13 
ATOM 10582 H HB3  . TYR A 1 3  ? 3.570   -12.909 12.518  1.00 0.00 ? 3  TYR A HB3  13 
ATOM 10583 H HD1  . TYR A 1 3  ? 7.073   -11.896 11.595  1.00 0.00 ? 3  TYR A HD1  13 
ATOM 10584 H HD2  . TYR A 1 3  ? 3.134   -12.882 10.245  1.00 0.00 ? 3  TYR A HD2  13 
ATOM 10585 H HE1  . TYR A 1 3  ? 7.831   -11.650 9.181   1.00 0.00 ? 3  TYR A HE1  13 
ATOM 10586 H HE2  . TYR A 1 3  ? 3.906   -12.632 7.835   1.00 0.00 ? 3  TYR A HE2  13 
ATOM 10587 H HH   . TYR A 1 3  ? 7.167   -11.493 7.096   1.00 0.00 ? 3  TYR A HH   13 
ATOM 10588 N N    . VAL A 1 4  ? 3.348   -10.049 11.727  1.00 0.00 ? 4  VAL A N    13 
ATOM 10589 C CA   . VAL A 1 4  ? 2.242   -9.221  11.275  1.00 0.00 ? 4  VAL A CA   13 
ATOM 10590 C C    . VAL A 1 4  ? 2.375   -7.825  11.886  1.00 0.00 ? 4  VAL A C    13 
ATOM 10591 O O    . VAL A 1 4  ? 1.898   -7.579  12.993  1.00 0.00 ? 4  VAL A O    13 
ATOM 10592 C CB   . VAL A 1 4  ? 0.912   -9.897  11.612  1.00 0.00 ? 4  VAL A CB   13 
ATOM 10593 C CG1  . VAL A 1 4  ? -0.188  -8.858  11.841  1.00 0.00 ? 4  VAL A CG1  13 
ATOM 10594 C CG2  . VAL A 1 4  ? 0.509   -10.890 10.519  1.00 0.00 ? 4  VAL A CG2  13 
ATOM 10595 H H    . VAL A 1 4  ? 3.985   -10.331 11.010  1.00 0.00 ? 4  VAL A H    13 
ATOM 10596 H HA   . VAL A 1 4  ? 2.315   -9.139  10.191  1.00 0.00 ? 4  VAL A HA   13 
ATOM 10597 H HB   . VAL A 1 4  ? 1.044   -10.455 12.539  1.00 0.00 ? 4  VAL A HB   13 
ATOM 10598 H HG11 . VAL A 1 4  ? -0.067  -8.039  11.132  1.00 0.00 ? 4  VAL A HG11 13 
ATOM 10599 H HG12 . VAL A 1 4  ? -1.163  -9.323  11.696  1.00 0.00 ? 4  VAL A HG12 13 
ATOM 10600 H HG13 . VAL A 1 4  ? -0.117  -8.473  12.858  1.00 0.00 ? 4  VAL A HG13 13 
ATOM 10601 H HG21 . VAL A 1 4  ? 0.963   -10.593 9.573   1.00 0.00 ? 4  VAL A HG21 13 
ATOM 10602 H HG22 . VAL A 1 4  ? 0.854   -11.888 10.790  1.00 0.00 ? 4  VAL A HG22 13 
ATOM 10603 H HG23 . VAL A 1 4  ? -0.576  -10.895 10.415  1.00 0.00 ? 4  VAL A HG23 13 
ATOM 10604 N N    . GLY A 1 5  ? 3.024   -6.945  11.136  1.00 0.00 ? 5  GLY A N    13 
ATOM 10605 C CA   . GLY A 1 5  ? 3.224   -5.580  11.590  1.00 0.00 ? 5  GLY A CA   13 
ATOM 10606 C C    . GLY A 1 5  ? 1.988   -4.722  11.312  1.00 0.00 ? 5  GLY A C    13 
ATOM 10607 O O    . GLY A 1 5  ? 2.001   -3.514  11.543  1.00 0.00 ? 5  GLY A O    13 
ATOM 10608 H H    . GLY A 1 5  ? 3.408   -7.153  10.237  1.00 0.00 ? 5  GLY A H    13 
ATOM 10609 H HA2  . GLY A 1 5  ? 3.442   -5.575  12.658  1.00 0.00 ? 5  GLY A HA2  13 
ATOM 10610 H HA3  . GLY A 1 5  ? 4.090   -5.149  11.086  1.00 0.00 ? 5  GLY A HA3  13 
ATOM 10611 N N    . LEU A 1 6  ? 0.949   -5.381  10.820  1.00 0.00 ? 6  LEU A N    13 
ATOM 10612 C CA   . LEU A 1 6  ? -0.293  -4.694  10.508  1.00 0.00 ? 6  LEU A CA   13 
ATOM 10613 C C    . LEU A 1 6  ? 0.024   -3.318  9.920   1.00 0.00 ? 6  LEU A C    13 
ATOM 10614 O O    . LEU A 1 6  ? 0.152   -2.340  10.655  1.00 0.00 ? 6  LEU A O    13 
ATOM 10615 C CB   . LEU A 1 6  ? -1.201  -4.643  11.739  1.00 0.00 ? 6  LEU A CB   13 
ATOM 10616 C CG   . LEU A 1 6  ? -0.551  -4.144  13.031  1.00 0.00 ? 6  LEU A CG   13 
ATOM 10617 C CD1  . LEU A 1 6  ? -1.599  -3.572  13.987  1.00 0.00 ? 6  LEU A CD1  13 
ATOM 10618 C CD2  . LEU A 1 6  ? 0.282   -5.247  13.688  1.00 0.00 ? 6  LEU A CD2  13 
ATOM 10619 H H    . LEU A 1 6  ? 0.946   -6.364  10.635  1.00 0.00 ? 6  LEU A H    13 
ATOM 10620 H HA   . LEU A 1 6  ? -0.811  -5.283  9.751   1.00 0.00 ? 6  LEU A HA   13 
ATOM 10621 H HB2  . LEU A 1 6  ? -2.052  -4.001  11.512  1.00 0.00 ? 6  LEU A HB2  13 
ATOM 10622 H HB3  . LEU A 1 6  ? -1.595  -5.643  11.917  1.00 0.00 ? 6  LEU A HB3  13 
ATOM 10623 H HG   . LEU A 1 6  ? 0.132   -3.332  12.779  1.00 0.00 ? 6  LEU A HG   13 
ATOM 10624 H HD11 . LEU A 1 6  ? -2.352  -4.332  14.198  1.00 0.00 ? 6  LEU A HD11 13 
ATOM 10625 H HD12 . LEU A 1 6  ? -1.117  -3.270  14.917  1.00 0.00 ? 6  LEU A HD12 13 
ATOM 10626 H HD13 . LEU A 1 6  ? -2.076  -2.706  13.527  1.00 0.00 ? 6  LEU A HD13 13 
ATOM 10627 H HD21 . LEU A 1 6  ? 0.093   -6.194  13.183  1.00 0.00 ? 6  LEU A HD21 13 
ATOM 10628 H HD22 . LEU A 1 6  ? 1.341   -4.998  13.609  1.00 0.00 ? 6  LEU A HD22 13 
ATOM 10629 H HD23 . LEU A 1 6  ? 0.007   -5.333  14.739  1.00 0.00 ? 6  LEU A HD23 13 
ATOM 10630 N N    . SER A 1 7  ? 0.140   -3.286  8.601   1.00 0.00 ? 7  SER A N    13 
ATOM 10631 C CA   . SER A 1 7  ? 0.439   -2.046  7.905   1.00 0.00 ? 7  SER A CA   13 
ATOM 10632 C C    . SER A 1 7  ? 1.685   -1.395  8.510   1.00 0.00 ? 7  SER A C    13 
ATOM 10633 O O    . SER A 1 7  ? 2.329   -1.972  9.384   1.00 0.00 ? 7  SER A O    13 
ATOM 10634 C CB   . SER A 1 7  ? -0.746  -1.081  7.965   1.00 0.00 ? 7  SER A CB   13 
ATOM 10635 O OG   . SER A 1 7  ? -0.798  -0.375  9.201   1.00 0.00 ? 7  SER A OG   13 
ATOM 10636 H H    . SER A 1 7  ? 0.034   -4.087  8.011   1.00 0.00 ? 7  SER A H    13 
ATOM 10637 H HA   . SER A 1 7  ? 0.622   -2.333  6.870   1.00 0.00 ? 7  SER A HA   13 
ATOM 10638 H HB2  . SER A 1 7  ? -0.676  -0.369  7.143   1.00 0.00 ? 7  SER A HB2  13 
ATOM 10639 H HB3  . SER A 1 7  ? -1.673  -1.637  7.826   1.00 0.00 ? 7  SER A HB3  13 
ATOM 10640 H HG   . SER A 1 7  ? -1.435  0.392   9.131   1.00 0.00 ? 7  SER A HG   13 
ATOM 10641 N N    . ALA A 1 8  ? 1.986   -0.201  8.020   1.00 0.00 ? 8  ALA A N    13 
ATOM 10642 C CA   . ALA A 1 8  ? 3.143   0.535   8.501   1.00 0.00 ? 8  ALA A CA   13 
ATOM 10643 C C    . ALA A 1 8  ? 4.418   -0.203  8.091   1.00 0.00 ? 8  ALA A C    13 
ATOM 10644 O O    . ALA A 1 8  ? 5.119   0.223   7.175   1.00 0.00 ? 8  ALA A O    13 
ATOM 10645 C CB   . ALA A 1 8  ? 3.037   0.719   10.017  1.00 0.00 ? 8  ALA A CB   13 
ATOM 10646 H H    . ALA A 1 8  ? 1.456   0.262   7.309   1.00 0.00 ? 8  ALA A H    13 
ATOM 10647 H HA   . ALA A 1 8  ? 3.132   1.516   8.027   1.00 0.00 ? 8  ALA A HA   13 
ATOM 10648 H HB1  . ALA A 1 8  ? 2.353   -0.025  10.426  1.00 0.00 ? 8  ALA A HB1  13 
ATOM 10649 H HB2  . ALA A 1 8  ? 2.661   1.718   10.236  1.00 0.00 ? 8  ALA A HB2  13 
ATOM 10650 H HB3  . ALA A 1 8  ? 4.022   0.594   10.467  1.00 0.00 ? 8  ALA A HB3  13 
ATOM 10651 N N    . ASN A 1 9  ? 4.681   -1.298  8.790   1.00 0.00 ? 9  ASN A N    13 
ATOM 10652 C CA   . ASN A 1 9  ? 5.860   -2.100  8.509   1.00 0.00 ? 9  ASN A CA   13 
ATOM 10653 C C    . ASN A 1 9  ? 5.895   -2.443  7.019   1.00 0.00 ? 9  ASN A C    13 
ATOM 10654 O O    . ASN A 1 9  ? 6.780   -1.990  6.295   1.00 0.00 ? 9  ASN A O    13 
ATOM 10655 C CB   . ASN A 1 9  ? 5.834   -3.412  9.296   1.00 0.00 ? 9  ASN A CB   13 
ATOM 10656 C CG   . ASN A 1 9  ? 7.086   -3.557  10.162  1.00 0.00 ? 9  ASN A CG   13 
ATOM 10657 O OD1  . ASN A 1 9  ? 8.209   -3.543  9.684   1.00 0.00 ? 9  ASN A OD1  13 
ATOM 10658 N ND2  . ASN A 1 9  ? 6.833   -3.696  11.461  1.00 0.00 ? 9  ASN A ND2  13 
ATOM 10659 H H    . ASN A 1 9  ? 4.106   -1.639  9.533   1.00 0.00 ? 9  ASN A H    13 
ATOM 10660 H HA   . ASN A 1 9  ? 6.705   -1.483  8.816   1.00 0.00 ? 9  ASN A HA   13 
ATOM 10661 H HB2  . ASN A 1 9  ? 4.945   -3.444  9.927   1.00 0.00 ? 9  ASN A HB2  13 
ATOM 10662 H HB3  . ASN A 1 9  ? 5.765   -4.253  8.606   1.00 0.00 ? 9  ASN A HB3  13 
ATOM 10663 H HD21 . ASN A 1 9  ? 5.889   -3.699  11.788  1.00 0.00 ? 9  ASN A HD21 13 
ATOM 10664 H HD22 . ASN A 1 9  ? 7.588   -3.798  12.109  1.00 0.00 ? 9  ASN A HD22 13 
ATOM 10665 N N    . GLN A 1 10 ? 4.922   -3.241  6.605   1.00 0.00 ? 10 GLN A N    13 
ATOM 10666 C CA   . GLN A 1 10 ? 4.831   -3.651  5.213   1.00 0.00 ? 10 GLN A CA   13 
ATOM 10667 C C    . GLN A 1 10 ? 4.854   -2.426  4.297   1.00 0.00 ? 10 GLN A C    13 
ATOM 10668 O O    . GLN A 1 10 ? 5.445   -2.464  3.219   1.00 0.00 ? 10 GLN A O    13 
ATOM 10669 C CB   . GLN A 1 10 ? 3.577   -4.493  4.971   1.00 0.00 ? 10 GLN A CB   13 
ATOM 10670 C CG   . GLN A 1 10 ? 2.371   -3.906  5.706   1.00 0.00 ? 10 GLN A CG   13 
ATOM 10671 C CD   . GLN A 1 10 ? 1.788   -4.916  6.697   1.00 0.00 ? 10 GLN A CD   13 
ATOM 10672 O OE1  . GLN A 1 10 ? 0.585   -5.079  6.821   1.00 0.00 ? 10 GLN A OE1  13 
ATOM 10673 N NE2  . GLN A 1 10 ? 2.704   -5.583  7.392   1.00 0.00 ? 10 GLN A NE2  13 
ATOM 10674 H H    . GLN A 1 10 ? 4.206   -3.606  7.200   1.00 0.00 ? 10 GLN A H    13 
ATOM 10675 H HA   . GLN A 1 10 ? 5.714   -4.264  5.033   1.00 0.00 ? 10 GLN A HA   13 
ATOM 10676 H HB2  . GLN A 1 10 ? 3.368   -4.541  3.902   1.00 0.00 ? 10 GLN A HB2  13 
ATOM 10677 H HB3  . GLN A 1 10 ? 3.751   -5.515  5.308   1.00 0.00 ? 10 GLN A HB3  13 
ATOM 10678 H HG2  . GLN A 1 10 ? 2.669   -3.002  6.237   1.00 0.00 ? 10 GLN A HG2  13 
ATOM 10679 H HG3  . GLN A 1 10 ? 1.607   -3.615  4.985   1.00 0.00 ? 10 GLN A HG3  13 
ATOM 10680 H HE21 . GLN A 1 10 ? 3.676   -5.402  7.241   1.00 0.00 ? 10 GLN A HE21 13 
ATOM 10681 H HE22 . GLN A 1 10 ? 2.422   -6.267  8.065   1.00 0.00 ? 10 GLN A HE22 13 
ATOM 10682 N N    . CYS A 1 11 ? 4.204   -1.368  4.760   1.00 0.00 ? 11 CYS A N    13 
ATOM 10683 C CA   . CYS A 1 11 ? 4.142   -0.134  3.995   1.00 0.00 ? 11 CYS A CA   13 
ATOM 10684 C C    . CYS A 1 11 ? 5.192   0.830   4.553   1.00 0.00 ? 11 CYS A C    13 
ATOM 10685 O O    . CYS A 1 11 ? 4.942   2.029   4.665   1.00 0.00 ? 11 CYS A O    13 
ATOM 10686 C CB   . CYS A 1 11 ? 2.739   0.476   4.018   1.00 0.00 ? 11 CYS A CB   13 
ATOM 10687 S SG   . CYS A 1 11 ? 1.392   -0.711  4.369   1.00 0.00 ? 11 CYS A SG   13 
ATOM 10688 H H    . CYS A 1 11 ? 3.726   -1.345  5.638   1.00 0.00 ? 11 CYS A H    13 
ATOM 10689 H HA   . CYS A 1 11 ? 4.367   -0.395  2.961   1.00 0.00 ? 11 CYS A HA   13 
ATOM 10690 H HB2  . CYS A 1 11 ? 2.713   1.266   4.768   1.00 0.00 ? 11 CYS A HB2  13 
ATOM 10691 H HB3  . CYS A 1 11 ? 2.548   0.946   3.053   1.00 0.00 ? 11 CYS A HB3  13 
ATOM 10692 N N    . ALA A 1 12 ? 6.345   0.269   4.888   1.00 0.00 ? 12 ALA A N    13 
ATOM 10693 C CA   . ALA A 1 12 ? 7.434   1.063   5.431   1.00 0.00 ? 12 ALA A CA   13 
ATOM 10694 C C    . ALA A 1 12 ? 8.430   1.385   4.315   1.00 0.00 ? 12 ALA A C    13 
ATOM 10695 O O    . ALA A 1 12 ? 9.641   1.331   4.525   1.00 0.00 ? 12 ALA A O    13 
ATOM 10696 C CB   . ALA A 1 12 ? 8.083   0.312   6.594   1.00 0.00 ? 12 ALA A CB   13 
ATOM 10697 H H    . ALA A 1 12 ? 6.540   -0.707  4.793   1.00 0.00 ? 12 ALA A H    13 
ATOM 10698 H HA   . ALA A 1 12 ? 7.010   1.994   5.807   1.00 0.00 ? 12 ALA A HA   13 
ATOM 10699 H HB1  . ALA A 1 12 ? 8.679   -0.514  6.206   1.00 0.00 ? 12 ALA A HB1  13 
ATOM 10700 H HB2  . ALA A 1 12 ? 7.308   -0.078  7.253   1.00 0.00 ? 12 ALA A HB2  13 
ATOM 10701 H HB3  . ALA A 1 12 ? 8.726   0.992   7.153   1.00 0.00 ? 12 ALA A HB3  13 
ATOM 10702 N N    . VAL A 1 13 ? 7.884   1.713   3.154   1.00 0.00 ? 13 VAL A N    13 
ATOM 10703 C CA   . VAL A 1 13 ? 8.710   2.043   2.005   1.00 0.00 ? 13 VAL A CA   13 
ATOM 10704 C C    . VAL A 1 13 ? 8.936   3.556   1.963   1.00 0.00 ? 13 VAL A C    13 
ATOM 10705 O O    . VAL A 1 13 ? 8.115   4.324   2.461   1.00 0.00 ? 13 VAL A O    13 
ATOM 10706 C CB   . VAL A 1 13 ? 8.070   1.498   0.726   1.00 0.00 ? 13 VAL A CB   13 
ATOM 10707 C CG1  . VAL A 1 13 ? 9.110   0.800   -0.153  1.00 0.00 ? 13 VAL A CG1  13 
ATOM 10708 C CG2  . VAL A 1 13 ? 6.908   0.559   1.052   1.00 0.00 ? 13 VAL A CG2  13 
ATOM 10709 H H    . VAL A 1 13 ? 6.898   1.755   2.991   1.00 0.00 ? 13 VAL A H    13 
ATOM 10710 H HA   . VAL A 1 13 ? 9.672   1.548   2.138   1.00 0.00 ? 13 VAL A HA   13 
ATOM 10711 H HB   . VAL A 1 13 ? 7.671   2.343   0.165   1.00 0.00 ? 13 VAL A HB   13 
ATOM 10712 H HG11 . VAL A 1 13 ? 10.025  0.646   0.419   1.00 0.00 ? 13 VAL A HG11 13 
ATOM 10713 H HG12 . VAL A 1 13 ? 8.720   -0.163  -0.481  1.00 0.00 ? 13 VAL A HG12 13 
ATOM 10714 H HG13 . VAL A 1 13 ? 9.326   1.420   -1.023  1.00 0.00 ? 13 VAL A HG13 13 
ATOM 10715 H HG21 . VAL A 1 13 ? 7.165   -0.050  1.919   1.00 0.00 ? 13 VAL A HG21 13 
ATOM 10716 H HG22 . VAL A 1 13 ? 6.016   1.146   1.272   1.00 0.00 ? 13 VAL A HG22 13 
ATOM 10717 H HG23 . VAL A 1 13 ? 6.714   -0.090  0.197   1.00 0.00 ? 13 VAL A HG23 13 
ATOM 10718 N N    . PRO A 1 14 ? 10.084  3.949   1.348   1.00 0.00 ? 14 PRO A N    13 
ATOM 10719 C CA   . PRO A 1 14 ? 10.428  5.356   1.234   1.00 0.00 ? 14 PRO A CA   13 
ATOM 10720 C C    . PRO A 1 14 ? 9.579   6.043   0.164   1.00 0.00 ? 14 PRO A C    13 
ATOM 10721 O O    . PRO A 1 14 ? 8.859   6.998   0.455   1.00 0.00 ? 14 PRO A O    13 
ATOM 10722 C CB   . PRO A 1 14 ? 11.914  5.372   0.914   1.00 0.00 ? 14 PRO A CB   13 
ATOM 10723 C CG   . PRO A 1 14 ? 12.246  3.980   0.403   1.00 0.00 ? 14 PRO A CG   13 
ATOM 10724 C CD   . PRO A 1 14 ? 11.080  3.067   0.747   1.00 0.00 ? 14 PRO A CD   13 
ATOM 10725 H HA   . PRO A 1 14 ? 10.228  5.832   2.090   1.00 0.00 ? 14 PRO A HA   13 
ATOM 10726 H HB2  . PRO A 1 14 ? 12.144  6.129   0.164   1.00 0.00 ? 14 PRO A HB2  13 
ATOM 10727 H HB3  . PRO A 1 14 ? 12.502  5.614   1.800   1.00 0.00 ? 14 PRO A HB3  13 
ATOM 10728 H HG2  . PRO A 1 14 ? 12.412  3.998   -0.674  1.00 0.00 ? 14 PRO A HG2  13 
ATOM 10729 H HG3  . PRO A 1 14 ? 13.165  3.614   0.861   1.00 0.00 ? 14 PRO A HG3  13 
ATOM 10730 H HD2  . PRO A 1 14 ? 10.688  2.574   -0.143  1.00 0.00 ? 14 PRO A HD2  13 
ATOM 10731 H HD3  . PRO A 1 14 ? 11.383  2.281   1.439   1.00 0.00 ? 14 PRO A HD3  13 
ATOM 10732 N N    . ALA A 1 15 ? 9.690   5.532   -1.053  1.00 0.00 ? 15 ALA A N    13 
ATOM 10733 C CA   . ALA A 1 15 ? 8.940   6.085   -2.169  1.00 0.00 ? 15 ALA A CA   13 
ATOM 10734 C C    . ALA A 1 15 ? 9.592   5.647   -3.482  1.00 0.00 ? 15 ALA A C    13 
ATOM 10735 O O    . ALA A 1 15 ? 8.938   5.617   -4.524  1.00 0.00 ? 15 ALA A O    13 
ATOM 10736 C CB   . ALA A 1 15 ? 8.870   7.607   -2.032  1.00 0.00 ? 15 ALA A CB   13 
ATOM 10737 H H    . ALA A 1 15 ? 10.277  4.756   -1.282  1.00 0.00 ? 15 ALA A H    13 
ATOM 10738 H HA   . ALA A 1 15 ? 7.929   5.681   -2.122  1.00 0.00 ? 15 ALA A HA   13 
ATOM 10739 H HB1  . ALA A 1 15 ? 9.631   7.944   -1.328  1.00 0.00 ? 15 ALA A HB1  13 
ATOM 10740 H HB2  . ALA A 1 15 ? 7.884   7.894   -1.666  1.00 0.00 ? 15 ALA A HB2  13 
ATOM 10741 H HB3  . ALA A 1 15 ? 9.045   8.068   -3.004  1.00 0.00 ? 15 ALA A HB3  13 
ATOM 10742 N N    . LYS A 1 16 ? 10.872  5.319   -3.390  1.00 0.00 ? 16 LYS A N    13 
ATOM 10743 C CA   . LYS A 1 16 ? 11.619  4.884   -4.558  1.00 0.00 ? 16 LYS A CA   13 
ATOM 10744 C C    . LYS A 1 16 ? 11.571  3.358   -4.650  1.00 0.00 ? 16 LYS A C    13 
ATOM 10745 O O    . LYS A 1 16 ? 12.156  2.768   -5.557  1.00 0.00 ? 16 LYS A O    13 
ATOM 10746 C CB   . LYS A 1 16 ? 13.039  5.454   -4.528  1.00 0.00 ? 16 LYS A CB   13 
ATOM 10747 C CG   . LYS A 1 16 ? 13.837  4.875   -3.358  1.00 0.00 ? 16 LYS A CG   13 
ATOM 10748 C CD   . LYS A 1 16 ? 14.605  3.622   -3.785  1.00 0.00 ? 16 LYS A CD   13 
ATOM 10749 C CE   . LYS A 1 16 ? 15.789  3.984   -4.684  1.00 0.00 ? 16 LYS A CE   13 
ATOM 10750 N NZ   . LYS A 1 16 ? 17.060  3.889   -3.930  1.00 0.00 ? 16 LYS A NZ   13 
ATOM 10751 H H    . LYS A 1 16 ? 11.397  5.346   -2.539  1.00 0.00 ? 16 LYS A H    13 
ATOM 10752 H HA   . LYS A 1 16 ? 11.124  5.300   -5.436  1.00 0.00 ? 16 LYS A HA   13 
ATOM 10753 H HB2  . LYS A 1 16 ? 13.546  5.227   -5.466  1.00 0.00 ? 16 LYS A HB2  13 
ATOM 10754 H HB3  . LYS A 1 16 ? 12.998  6.540   -4.444  1.00 0.00 ? 16 LYS A HB3  13 
ATOM 10755 H HG2  . LYS A 1 16 ? 14.535  5.624   -2.984  1.00 0.00 ? 16 LYS A HG2  13 
ATOM 10756 H HG3  . LYS A 1 16 ? 13.162  4.631   -2.538  1.00 0.00 ? 16 LYS A HG3  13 
ATOM 10757 H HD2  . LYS A 1 16 ? 14.963  3.093   -2.902  1.00 0.00 ? 16 LYS A HD2  13 
ATOM 10758 H HD3  . LYS A 1 16 ? 13.936  2.944   -4.314  1.00 0.00 ? 16 LYS A HD3  13 
ATOM 10759 H HE2  . LYS A 1 16 ? 15.818  3.316   -5.544  1.00 0.00 ? 16 LYS A HE2  13 
ATOM 10760 H HE3  . LYS A 1 16 ? 15.664  4.996   -5.070  1.00 0.00 ? 16 LYS A HE3  13 
ATOM 10761 H HZ1  . LYS A 1 16 ? 16.868  3.909   -2.949  1.00 0.00 ? 16 LYS A HZ1  13 
ATOM 10762 H HZ2  . LYS A 1 16 ? 17.522  3.033   -4.163  1.00 0.00 ? 16 LYS A HZ2  13 
ATOM 10763 H HZ3  . LYS A 1 16 ? 17.648  4.662   -4.171  1.00 0.00 ? 16 LYS A HZ3  13 
ATOM 10764 N N    . ASP A 1 17 ? 10.867  2.762   -3.699  1.00 0.00 ? 17 ASP A N    13 
ATOM 10765 C CA   . ASP A 1 17 ? 10.734  1.315   -3.662  1.00 0.00 ? 17 ASP A CA   13 
ATOM 10766 C C    . ASP A 1 17 ? 9.260   0.938   -3.824  1.00 0.00 ? 17 ASP A C    13 
ATOM 10767 O O    . ASP A 1 17 ? 8.884   -0.214  -3.617  1.00 0.00 ? 17 ASP A O    13 
ATOM 10768 C CB   . ASP A 1 17 ? 11.222  0.752   -2.326  1.00 0.00 ? 17 ASP A CB   13 
ATOM 10769 C CG   . ASP A 1 17 ? 12.550  -0.005  -2.389  1.00 0.00 ? 17 ASP A CG   13 
ATOM 10770 O OD1  . ASP A 1 17 ? 13.393  0.397   -3.219  1.00 0.00 ? 17 ASP A OD1  13 
ATOM 10771 O OD2  . ASP A 1 17 ? 12.691  -0.969  -1.606  1.00 0.00 ? 17 ASP A OD2  13 
ATOM 10772 H H    . ASP A 1 17 ? 10.393  3.249   -2.965  1.00 0.00 ? 17 ASP A H    13 
ATOM 10773 H HA   . ASP A 1 17 ? 11.351  0.950   -4.483  1.00 0.00 ? 17 ASP A HA   13 
ATOM 10774 H HB2  . ASP A 1 17 ? 11.323  1.574   -1.617  1.00 0.00 ? 17 ASP A HB2  13 
ATOM 10775 H HB3  . ASP A 1 17 ? 10.458  0.082   -1.930  1.00 0.00 ? 17 ASP A HB3  13 
ATOM 10776 N N    . ARG A 1 18 ? 8.465   1.932   -4.193  1.00 0.00 ? 18 ARG A N    13 
ATOM 10777 C CA   . ARG A 1 18 ? 7.041   1.719   -4.385  1.00 0.00 ? 18 ARG A CA   13 
ATOM 10778 C C    . ARG A 1 18 ? 6.784   1.019   -5.721  1.00 0.00 ? 18 ARG A C    13 
ATOM 10779 O O    . ARG A 1 18 ? 7.091   1.563   -6.780  1.00 0.00 ? 18 ARG A O    13 
ATOM 10780 C CB   . ARG A 1 18 ? 6.277   3.045   -4.358  1.00 0.00 ? 18 ARG A CB   13 
ATOM 10781 C CG   . ARG A 1 18 ? 6.803   3.958   -3.249  1.00 0.00 ? 18 ARG A CG   13 
ATOM 10782 C CD   . ARG A 1 18 ? 6.582   3.331   -1.871  1.00 0.00 ? 18 ARG A CD   13 
ATOM 10783 N NE   . ARG A 1 18 ? 6.801   4.343   -0.813  1.00 0.00 ? 18 ARG A NE   13 
ATOM 10784 C CZ   . ARG A 1 18 ? 6.041   5.434   -0.648  1.00 0.00 ? 18 ARG A CZ   13 
ATOM 10785 N NH1  . ARG A 1 18 ? 5.008   5.661   -1.470  1.00 0.00 ? 18 ARG A NH1  13 
ATOM 10786 N NH2  . ARG A 1 18 ? 6.314   6.298   0.339   1.00 0.00 ? 18 ARG A NH2  13 
ATOM 10787 H H    . ARG A 1 18 ? 8.779   2.867   -4.359  1.00 0.00 ? 18 ARG A H    13 
ATOM 10788 H HA   . ARG A 1 18 ? 6.737   1.091   -3.548  1.00 0.00 ? 18 ARG A HA   13 
ATOM 10789 H HB2  . ARG A 1 18 ? 6.374   3.544   -5.322  1.00 0.00 ? 18 ARG A HB2  13 
ATOM 10790 H HB3  . ARG A 1 18 ? 5.215   2.854   -4.203  1.00 0.00 ? 18 ARG A HB3  13 
ATOM 10791 H HG2  . ARG A 1 18 ? 7.867   4.145   -3.401  1.00 0.00 ? 18 ARG A HG2  13 
ATOM 10792 H HG3  . ARG A 1 18 ? 6.300   4.923   -3.298  1.00 0.00 ? 18 ARG A HG3  13 
ATOM 10793 H HD2  . ARG A 1 18 ? 5.570   2.934   -1.801  1.00 0.00 ? 18 ARG A HD2  13 
ATOM 10794 H HD3  . ARG A 1 18 ? 7.264   2.492   -1.730  1.00 0.00 ? 18 ARG A HD3  13 
ATOM 10795 H HE   . ARG A 1 18 ? 7.565   4.203   -0.182  1.00 0.00 ? 18 ARG A HE   13 
ATOM 10796 H HH11 . ARG A 1 18 ? 4.804   5.016   -2.207  1.00 0.00 ? 18 ARG A HH11 13 
ATOM 10797 H HH12 . ARG A 1 18 ? 4.440   6.475   -1.347  1.00 0.00 ? 18 ARG A HH12 13 
ATOM 10798 H HH21 . ARG A 1 18 ? 7.085   6.128   0.953   1.00 0.00 ? 18 ARG A HH21 13 
ATOM 10799 H HH22 . ARG A 1 18 ? 5.747   7.112   0.462   1.00 0.00 ? 18 ARG A HH22 13 
ATOM 10800 N N    . VAL A 1 19 ? 6.225   -0.179  -5.627  1.00 0.00 ? 19 VAL A N    13 
ATOM 10801 C CA   . VAL A 1 19 ? 5.923   -0.959  -6.815  1.00 0.00 ? 19 VAL A CA   13 
ATOM 10802 C C    . VAL A 1 19 ? 4.576   -0.512  -7.386  1.00 0.00 ? 19 VAL A C    13 
ATOM 10803 O O    . VAL A 1 19 ? 4.202   -0.912  -8.487  1.00 0.00 ? 19 VAL A O    13 
ATOM 10804 C CB   . VAL A 1 19 ? 5.966   -2.453  -6.484  1.00 0.00 ? 19 VAL A CB   13 
ATOM 10805 C CG1  . VAL A 1 19 ? 6.197   -3.287  -7.746  1.00 0.00 ? 19 VAL A CG1  13 
ATOM 10806 C CG2  . VAL A 1 19 ? 7.032   -2.750  -5.427  1.00 0.00 ? 19 VAL A CG2  13 
ATOM 10807 H H    . VAL A 1 19 ? 5.978   -0.614  -4.761  1.00 0.00 ? 19 VAL A H    13 
ATOM 10808 H HA   . VAL A 1 19 ? 6.702   -0.754  -7.549  1.00 0.00 ? 19 VAL A HA   13 
ATOM 10809 H HB   . VAL A 1 19 ? 4.997   -2.732  -6.070  1.00 0.00 ? 19 VAL A HB   13 
ATOM 10810 H HG11 . VAL A 1 19 ? 6.111   -2.648  -8.624  1.00 0.00 ? 19 VAL A HG11 13 
ATOM 10811 H HG12 . VAL A 1 19 ? 7.194   -3.727  -7.713  1.00 0.00 ? 19 VAL A HG12 13 
ATOM 10812 H HG13 . VAL A 1 19 ? 5.451   -4.080  -7.798  1.00 0.00 ? 19 VAL A HG13 13 
ATOM 10813 H HG21 . VAL A 1 19 ? 7.743   -1.925  -5.386  1.00 0.00 ? 19 VAL A HG21 13 
ATOM 10814 H HG22 . VAL A 1 19 ? 6.556   -2.868  -4.454  1.00 0.00 ? 19 VAL A HG22 13 
ATOM 10815 H HG23 . VAL A 1 19 ? 7.557   -3.669  -5.689  1.00 0.00 ? 19 VAL A HG23 13 
ATOM 10816 N N    . ASP A 1 20 ? 3.885   0.311   -6.611  1.00 0.00 ? 20 ASP A N    13 
ATOM 10817 C CA   . ASP A 1 20 ? 2.588   0.817   -7.026  1.00 0.00 ? 20 ASP A CA   13 
ATOM 10818 C C    . ASP A 1 20 ? 1.632   -0.358  -7.241  1.00 0.00 ? 20 ASP A C    13 
ATOM 10819 O O    . ASP A 1 20 ? 1.882   -1.220  -8.082  1.00 0.00 ? 20 ASP A O    13 
ATOM 10820 C CB   . ASP A 1 20 ? 2.694   1.588   -8.344  1.00 0.00 ? 20 ASP A CB   13 
ATOM 10821 C CG   . ASP A 1 20 ? 1.362   1.837   -9.055  1.00 0.00 ? 20 ASP A CG   13 
ATOM 10822 O OD1  . ASP A 1 20 ? 0.757   0.836   -9.495  1.00 0.00 ? 20 ASP A OD1  13 
ATOM 10823 O OD2  . ASP A 1 20 ? 0.979   3.024   -9.144  1.00 0.00 ? 20 ASP A OD2  13 
ATOM 10824 H H    . ASP A 1 20 ? 4.197   0.632   -5.717  1.00 0.00 ? 20 ASP A H    13 
ATOM 10825 H HA   . ASP A 1 20 ? 2.266   1.475   -6.220  1.00 0.00 ? 20 ASP A HA   13 
ATOM 10826 H HB2  . ASP A 1 20 ? 3.169   2.549   -8.148  1.00 0.00 ? 20 ASP A HB2  13 
ATOM 10827 H HB3  . ASP A 1 20 ? 3.351   1.038   -9.018  1.00 0.00 ? 20 ASP A HB3  13 
ATOM 10828 N N    . CYS A 1 21 ? 0.557   -0.354  -6.467  1.00 0.00 ? 21 CYS A N    13 
ATOM 10829 C CA   . CYS A 1 21 ? -0.438  -1.408  -6.562  1.00 0.00 ? 21 CYS A CA   13 
ATOM 10830 C C    . CYS A 1 21 ? -1.412  -1.050  -7.686  1.00 0.00 ? 21 CYS A C    13 
ATOM 10831 O O    . CYS A 1 21 ? -2.023  -1.933  -8.287  1.00 0.00 ? 21 CYS A O    13 
ATOM 10832 C CB   . CYS A 1 21 ? -1.159  -1.628  -5.231  1.00 0.00 ? 21 CYS A CB   13 
ATOM 10833 S SG   . CYS A 1 21 ? -1.651  -3.359  -4.900  1.00 0.00 ? 21 CYS A SG   13 
ATOM 10834 H H    . CYS A 1 21 ? 0.361   0.352   -5.786  1.00 0.00 ? 21 CYS A H    13 
ATOM 10835 H HA   . CYS A 1 21 ? 0.101   -2.327  -6.795  1.00 0.00 ? 21 CYS A HA   13 
ATOM 10836 H HB2  . CYS A 1 21 ? -0.511  -1.288  -4.422  1.00 0.00 ? 21 CYS A HB2  13 
ATOM 10837 H HB3  . CYS A 1 21 ? -2.050  -1.001  -5.209  1.00 0.00 ? 21 CYS A HB3  13 
ATOM 10838 N N    . GLY A 1 22 ? -1.526  0.246   -7.937  1.00 0.00 ? 22 GLY A N    13 
ATOM 10839 C CA   . GLY A 1 22 ? -2.415  0.731   -8.979  1.00 0.00 ? 22 GLY A CA   13 
ATOM 10840 C C    . GLY A 1 22 ? -3.879  0.607   -8.552  1.00 0.00 ? 22 GLY A C    13 
ATOM 10841 O O    . GLY A 1 22 ? -4.522  -0.407  -8.816  1.00 0.00 ? 22 GLY A O    13 
ATOM 10842 H H    . GLY A 1 22 ? -1.024  0.957   -7.444  1.00 0.00 ? 22 GLY A H    13 
ATOM 10843 H HA2  . GLY A 1 22 ? -2.184  1.773   -9.202  1.00 0.00 ? 22 GLY A HA2  13 
ATOM 10844 H HA3  . GLY A 1 22 ? -2.250  0.164   -9.895  1.00 0.00 ? 22 GLY A HA3  13 
ATOM 10845 N N    . TYR A 1 23 ? -4.362  1.654   -7.899  1.00 0.00 ? 23 TYR A N    13 
ATOM 10846 C CA   . TYR A 1 23 ? -5.738  1.675   -7.433  1.00 0.00 ? 23 TYR A CA   13 
ATOM 10847 C C    . TYR A 1 23 ? -6.370  3.051   -7.650  1.00 0.00 ? 23 TYR A C    13 
ATOM 10848 O O    . TYR A 1 23 ? -5.688  4.072   -7.567  1.00 0.00 ? 23 TYR A O    13 
ATOM 10849 C CB   . TYR A 1 23 ? -5.679  1.385   -5.931  1.00 0.00 ? 23 TYR A CB   13 
ATOM 10850 C CG   . TYR A 1 23 ? -5.805  -0.098  -5.578  1.00 0.00 ? 23 TYR A CG   13 
ATOM 10851 C CD1  . TYR A 1 23 ? -6.968  -0.781  -5.871  1.00 0.00 ? 23 TYR A CD1  13 
ATOM 10852 C CD2  . TYR A 1 23 ? -4.755  -0.753  -4.968  1.00 0.00 ? 23 TYR A CD2  13 
ATOM 10853 C CE1  . TYR A 1 23 ? -7.086  -2.177  -5.538  1.00 0.00 ? 23 TYR A CE1  13 
ATOM 10854 C CE2  . TYR A 1 23 ? -4.873  -2.149  -4.635  1.00 0.00 ? 23 TYR A CE2  13 
ATOM 10855 C CZ   . TYR A 1 23 ? -6.033  -2.792  -4.937  1.00 0.00 ? 23 TYR A CZ   13 
ATOM 10856 O OH   . TYR A 1 23 ? -6.145  -4.111  -4.623  1.00 0.00 ? 23 TYR A OH   13 
ATOM 10857 H H    . TYR A 1 23 ? -3.832  2.475   -7.688  1.00 0.00 ? 23 TYR A H    13 
ATOM 10858 H HA   . TYR A 1 23 ? -6.298  0.933   -8.002  1.00 0.00 ? 23 TYR A HA   13 
ATOM 10859 H HB2  . TYR A 1 23 ? -4.737  1.764   -5.535  1.00 0.00 ? 23 TYR A HB2  13 
ATOM 10860 H HB3  . TYR A 1 23 ? -6.478  1.936   -5.434  1.00 0.00 ? 23 TYR A HB3  13 
ATOM 10861 H HD1  . TYR A 1 23 ? -7.797  -0.263  -6.353  1.00 0.00 ? 23 TYR A HD1  13 
ATOM 10862 H HD2  . TYR A 1 23 ? -3.836  -0.214  -4.737  1.00 0.00 ? 23 TYR A HD2  13 
ATOM 10863 H HE1  . TYR A 1 23 ? -7.999  -2.728  -5.764  1.00 0.00 ? 23 TYR A HE1  13 
ATOM 10864 H HE2  . TYR A 1 23 ? -4.052  -2.679  -4.153  1.00 0.00 ? 23 TYR A HE2  13 
ATOM 10865 H HH   . TYR A 1 23 ? -6.707  -4.578  -5.305  1.00 0.00 ? 23 TYR A HH   13 
ATOM 10866 N N    . PRO A 1 24 ? -7.700  3.035   -7.932  1.00 0.00 ? 24 PRO A N    13 
ATOM 10867 C CA   . PRO A 1 24 ? -8.431  4.269   -8.162  1.00 0.00 ? 24 PRO A CA   13 
ATOM 10868 C C    . PRO A 1 24 ? -8.684  5.011   -6.848  1.00 0.00 ? 24 PRO A C    13 
ATOM 10869 O O    . PRO A 1 24 ? -8.098  6.064   -6.603  1.00 0.00 ? 24 PRO A O    13 
ATOM 10870 C CB   . PRO A 1 24 ? -9.713  3.843   -8.859  1.00 0.00 ? 24 PRO A CB   13 
ATOM 10871 C CG   . PRO A 1 24 ? -9.866  2.357   -8.578  1.00 0.00 ? 24 PRO A CG   13 
ATOM 10872 C CD   . PRO A 1 24 ? -8.540  1.846   -8.039  1.00 0.00 ? 24 PRO A CD   13 
ATOM 10873 H HA   . PRO A 1 24 ? -7.891  4.893   -8.728  1.00 0.00 ? 24 PRO A HA   13 
ATOM 10874 H HB2  . PRO A 1 24 ? -10.568 4.403   -8.480  1.00 0.00 ? 24 PRO A HB2  13 
ATOM 10875 H HB3  . PRO A 1 24 ? -9.657  4.034   -9.931  1.00 0.00 ? 24 PRO A HB3  13 
ATOM 10876 H HG2  . PRO A 1 24 ? -10.664 2.186   -7.855  1.00 0.00 ? 24 PRO A HG2  13 
ATOM 10877 H HG3  . PRO A 1 24 ? -10.140 1.823   -9.488  1.00 0.00 ? 24 PRO A HG3  13 
ATOM 10878 H HD2  . PRO A 1 24 ? -8.667  1.362   -7.070  1.00 0.00 ? 24 PRO A HD2  13 
ATOM 10879 H HD3  . PRO A 1 24 ? -8.099  1.108   -8.708  1.00 0.00 ? 24 PRO A HD3  13 
ATOM 10880 N N    . HIS A 1 25 ? -9.556  4.430   -6.036  1.00 0.00 ? 25 HIS A N    13 
ATOM 10881 C CA   . HIS A 1 25 ? -9.892  5.023   -4.753  1.00 0.00 ? 25 HIS A CA   13 
ATOM 10882 C C    . HIS A 1 25 ? -8.950  4.483   -3.675  1.00 0.00 ? 25 HIS A C    13 
ATOM 10883 O O    . HIS A 1 25 ? -9.289  3.536   -2.966  1.00 0.00 ? 25 HIS A O    13 
ATOM 10884 C CB   . HIS A 1 25 ? -11.368 4.794   -4.419  1.00 0.00 ? 25 HIS A CB   13 
ATOM 10885 C CG   . HIS A 1 25 ? -11.704 3.363   -4.074  1.00 0.00 ? 25 HIS A CG   13 
ATOM 10886 N ND1  . HIS A 1 25 ? -12.874 3.002   -3.428  1.00 0.00 ? 25 HIS A ND1  13 
ATOM 10887 C CD2  . HIS A 1 25 ? -11.014 2.207   -4.292  1.00 0.00 ? 25 HIS A CD2  13 
ATOM 10888 C CE1  . HIS A 1 25 ? -12.876 1.687   -3.269  1.00 0.00 ? 25 HIS A CE1  13 
ATOM 10889 N NE2  . HIS A 1 25 ? -11.722 1.196   -3.805  1.00 0.00 ? 25 HIS A NE2  13 
ATOM 10890 H H    . HIS A 1 25 ? -10.027 3.573   -6.243  1.00 0.00 ? 25 HIS A H    13 
ATOM 10891 H HA   . HIS A 1 25 ? -9.737  6.097   -4.854  1.00 0.00 ? 25 HIS A HA   13 
ATOM 10892 H HB2  . HIS A 1 25 ? -11.644 5.433   -3.581  1.00 0.00 ? 25 HIS A HB2  13 
ATOM 10893 H HB3  . HIS A 1 25 ? -11.975 5.104   -5.270  1.00 0.00 ? 25 HIS A HB3  13 
ATOM 10894 H HD1  . HIS A 1 25 ? -13.595 3.629   -3.132  1.00 0.00 ? 25 HIS A HD1  13 
ATOM 10895 H HD2  . HIS A 1 25 ? -10.044 2.128   -4.784  1.00 0.00 ? 25 HIS A HD2  13 
ATOM 10896 H HE1  . HIS A 1 25 ? -13.663 1.100   -2.794  1.00 0.00 ? 25 HIS A HE1  13 
ATOM 10897 H HE2  . HIS A 1 25 ? -11.481 0.228   -3.878  1.00 0.00 ? 25 HIS A HE2  13 
ATOM 10898 N N    . VAL A 1 26 ? -7.785  5.108   -3.586  1.00 0.00 ? 26 VAL A N    13 
ATOM 10899 C CA   . VAL A 1 26 ? -6.791  4.702   -2.607  1.00 0.00 ? 26 VAL A CA   13 
ATOM 10900 C C    . VAL A 1 26 ? -6.897  5.603   -1.375  1.00 0.00 ? 26 VAL A C    13 
ATOM 10901 O O    . VAL A 1 26 ? -7.026  6.820   -1.501  1.00 0.00 ? 26 VAL A O    13 
ATOM 10902 C CB   . VAL A 1 26 ? -5.398  4.714   -3.239  1.00 0.00 ? 26 VAL A CB   13 
ATOM 10903 C CG1  . VAL A 1 26 ? -5.280  3.644   -4.326  1.00 0.00 ? 26 VAL A CG1  13 
ATOM 10904 C CG2  . VAL A 1 26 ? -5.061  6.099   -3.794  1.00 0.00 ? 26 VAL A CG2  13 
ATOM 10905 H H    . VAL A 1 26 ? -7.517  5.876   -4.166  1.00 0.00 ? 26 VAL A H    13 
ATOM 10906 H HA   . VAL A 1 26 ? -7.019  3.677   -2.312  1.00 0.00 ? 26 VAL A HA   13 
ATOM 10907 H HB   . VAL A 1 26 ? -4.674  4.481   -2.458  1.00 0.00 ? 26 VAL A HB   13 
ATOM 10908 H HG11 . VAL A 1 26 ? -5.459  2.661   -3.889  1.00 0.00 ? 26 VAL A HG11 13 
ATOM 10909 H HG12 . VAL A 1 26 ? -6.017  3.835   -5.105  1.00 0.00 ? 26 VAL A HG12 13 
ATOM 10910 H HG13 . VAL A 1 26 ? -4.279  3.673   -4.757  1.00 0.00 ? 26 VAL A HG13 13 
ATOM 10911 H HG21 . VAL A 1 26 ? -5.872  6.790   -3.565  1.00 0.00 ? 26 VAL A HG21 13 
ATOM 10912 H HG22 . VAL A 1 26 ? -4.138  6.459   -3.338  1.00 0.00 ? 26 VAL A HG22 13 
ATOM 10913 H HG23 . VAL A 1 26 ? -4.932  6.036   -4.874  1.00 0.00 ? 26 VAL A HG23 13 
ATOM 10914 N N    . THR A 1 27 ? -6.840  4.971   -0.212  1.00 0.00 ? 27 THR A N    13 
ATOM 10915 C CA   . THR A 1 27 ? -6.928  5.701   1.041   1.00 0.00 ? 27 THR A CA   13 
ATOM 10916 C C    . THR A 1 27 ? -6.138  4.979   2.135   1.00 0.00 ? 27 THR A C    13 
ATOM 10917 O O    . THR A 1 27 ? -5.668  3.861   1.932   1.00 0.00 ? 27 THR A O    13 
ATOM 10918 C CB   . THR A 1 27 ? -8.408  5.883   1.380   1.00 0.00 ? 27 THR A CB   13 
ATOM 10919 O OG1  . THR A 1 27 ? -8.755  4.689   2.076   1.00 0.00 ? 27 THR A OG1  13 
ATOM 10920 C CG2  . THR A 1 27 ? -9.300  5.861   0.137   1.00 0.00 ? 27 THR A CG2  13 
ATOM 10921 H H    . THR A 1 27 ? -6.735  3.981   -0.118  1.00 0.00 ? 27 THR A H    13 
ATOM 10922 H HA   . THR A 1 27 ? -6.463  6.678   0.904   1.00 0.00 ? 27 THR A HA   13 
ATOM 10923 H HB   . THR A 1 27 ? -8.567  6.794   1.957   1.00 0.00 ? 27 THR A HB   13 
ATOM 10924 H HG1  . THR A 1 27 ? -9.582  4.836   2.619   1.00 0.00 ? 27 THR A HG1  13 
ATOM 10925 H HG21 . THR A 1 27 ? -9.079  4.972   -0.454  1.00 0.00 ? 27 THR A HG21 13 
ATOM 10926 H HG22 . THR A 1 27 ? -10.347 5.844   0.441   1.00 0.00 ? 27 THR A HG22 13 
ATOM 10927 H HG23 . THR A 1 27 ? -9.111  6.752   -0.462  1.00 0.00 ? 27 THR A HG23 13 
ATOM 10928 N N    . PRO A 1 28 ? -6.014  5.666   3.303   1.00 0.00 ? 28 PRO A N    13 
ATOM 10929 C CA   . PRO A 1 28 ? -5.290  5.102   4.429   1.00 0.00 ? 28 PRO A CA   13 
ATOM 10930 C C    . PRO A 1 28 ? -6.111  4.011   5.119   1.00 0.00 ? 28 PRO A C    13 
ATOM 10931 O O    . PRO A 1 28 ? -6.125  3.921   6.345   1.00 0.00 ? 28 PRO A O    13 
ATOM 10932 C CB   . PRO A 1 28 ? -4.992  6.285   5.337   1.00 0.00 ? 28 PRO A CB   13 
ATOM 10933 C CG   . PRO A 1 28 ? -5.957  7.383   4.920   1.00 0.00 ? 28 PRO A CG   13 
ATOM 10934 C CD   . PRO A 1 28 ? -6.557  6.992   3.580   1.00 0.00 ? 28 PRO A CD   13 
ATOM 10935 H HA   . PRO A 1 28 ? -4.452  4.656   4.115   1.00 0.00 ? 28 PRO A HA   13 
ATOM 10936 H HB2  . PRO A 1 28 ? -5.132  6.018   6.384   1.00 0.00 ? 28 PRO A HB2  13 
ATOM 10937 H HB3  . PRO A 1 28 ? -3.958  6.611   5.227   1.00 0.00 ? 28 PRO A HB3  13 
ATOM 10938 H HG2  . PRO A 1 28 ? -6.740  7.507   5.668   1.00 0.00 ? 28 PRO A HG2  13 
ATOM 10939 H HG3  . PRO A 1 28 ? -5.437  8.338   4.842   1.00 0.00 ? 28 PRO A HG3  13 
ATOM 10940 H HD2  . PRO A 1 28 ? -7.646  6.973   3.625   1.00 0.00 ? 28 PRO A HD2  13 
ATOM 10941 H HD3  . PRO A 1 28 ? -6.283  7.703   2.801   1.00 0.00 ? 28 PRO A HD3  13 
ATOM 10942 N N    . LYS A 1 29 ? -6.776  3.209   4.300   1.00 0.00 ? 29 LYS A N    13 
ATOM 10943 C CA   . LYS A 1 29 ? -7.598  2.128   4.816   1.00 0.00 ? 29 LYS A CA   13 
ATOM 10944 C C    . LYS A 1 29 ? -8.210  1.356   3.645   1.00 0.00 ? 29 LYS A C    13 
ATOM 10945 O O    . LYS A 1 29 ? -8.138  0.129   3.601   1.00 0.00 ? 29 LYS A O    13 
ATOM 10946 C CB   . LYS A 1 29 ? -8.633  2.667   5.805   1.00 0.00 ? 29 LYS A CB   13 
ATOM 10947 C CG   . LYS A 1 29 ? -8.953  1.629   6.883   1.00 0.00 ? 29 LYS A CG   13 
ATOM 10948 C CD   . LYS A 1 29 ? -10.221 0.848   6.533   1.00 0.00 ? 29 LYS A CD   13 
ATOM 10949 C CE   . LYS A 1 29 ? -11.372 1.222   7.469   1.00 0.00 ? 29 LYS A CE   13 
ATOM 10950 N NZ   . LYS A 1 29 ? -12.130 0.014   7.866   1.00 0.00 ? 29 LYS A NZ   13 
ATOM 10951 H H    . LYS A 1 29 ? -6.760  3.290   3.303   1.00 0.00 ? 29 LYS A H    13 
ATOM 10952 H HA   . LYS A 1 29 ? -6.943  1.455   5.369   1.00 0.00 ? 29 LYS A HA   13 
ATOM 10953 H HB2  . LYS A 1 29 ? -8.256  3.577   6.272   1.00 0.00 ? 29 LYS A HB2  13 
ATOM 10954 H HB3  . LYS A 1 29 ? -9.545  2.936   5.273   1.00 0.00 ? 29 LYS A HB3  13 
ATOM 10955 H HG2  . LYS A 1 29 ? -8.115  0.940   6.990   1.00 0.00 ? 29 LYS A HG2  13 
ATOM 10956 H HG3  . LYS A 1 29 ? -9.082  2.126   7.845   1.00 0.00 ? 29 LYS A HG3  13 
ATOM 10957 H HD2  . LYS A 1 29 ? -10.506 1.054   5.501   1.00 0.00 ? 29 LYS A HD2  13 
ATOM 10958 H HD3  . LYS A 1 29 ? -10.025 -0.222  6.601   1.00 0.00 ? 29 LYS A HD3  13 
ATOM 10959 H HE2  . LYS A 1 29 ? -10.980 1.720   8.356   1.00 0.00 ? 29 LYS A HE2  13 
ATOM 10960 H HE3  . LYS A 1 29 ? -12.037 1.929   6.974   1.00 0.00 ? 29 LYS A HE3  13 
ATOM 10961 H HZ1  . LYS A 1 29 ? -11.817 -0.768  7.328   1.00 0.00 ? 29 LYS A HZ1  13 
ATOM 10962 H HZ2  . LYS A 1 29 ? -11.981 -0.169  8.838   1.00 0.00 ? 29 LYS A HZ2  13 
ATOM 10963 H HZ3  . LYS A 1 29 ? -13.105 0.164   7.701   1.00 0.00 ? 29 LYS A HZ3  13 
ATOM 10964 N N    . GLU A 1 30 ? -8.800  2.107   2.726   1.00 0.00 ? 30 GLU A N    13 
ATOM 10965 C CA   . GLU A 1 30 ? -9.424  1.508   1.559   1.00 0.00 ? 30 GLU A CA   13 
ATOM 10966 C C    . GLU A 1 30 ? -8.364  0.878   0.654   1.00 0.00 ? 30 GLU A C    13 
ATOM 10967 O O    . GLU A 1 30 ? -8.551  -0.228  0.149   1.00 0.00 ? 30 GLU A O    13 
ATOM 10968 C CB   . GLU A 1 30 ? -10.256 2.539   0.793   1.00 0.00 ? 30 GLU A CB   13 
ATOM 10969 C CG   . GLU A 1 30 ? -10.814 1.941   -0.501  1.00 0.00 ? 30 GLU A CG   13 
ATOM 10970 C CD   . GLU A 1 30 ? -12.333 2.106   -0.571  1.00 0.00 ? 30 GLU A CD   13 
ATOM 10971 O OE1  . GLU A 1 30 ? -12.782 3.270   -0.493  1.00 0.00 ? 30 GLU A OE1  13 
ATOM 10972 O OE2  . GLU A 1 30 ? -13.012 1.064   -0.700  1.00 0.00 ? 30 GLU A OE2  13 
ATOM 10973 H H    . GLU A 1 30 ? -8.855  3.104   2.770   1.00 0.00 ? 30 GLU A H    13 
ATOM 10974 H HA   . GLU A 1 30 ? -10.086 0.734   1.949   1.00 0.00 ? 30 GLU A HA   13 
ATOM 10975 H HB2  . GLU A 1 30 ? -11.077 2.888   1.420   1.00 0.00 ? 30 GLU A HB2  13 
ATOM 10976 H HB3  . GLU A 1 30 ? -9.641  3.408   0.561   1.00 0.00 ? 30 GLU A HB3  13 
ATOM 10977 H HG2  . GLU A 1 30 ? -10.352 2.429   -1.359  1.00 0.00 ? 30 GLU A HG2  13 
ATOM 10978 H HG3  . GLU A 1 30 ? -10.556 0.884   -0.558  1.00 0.00 ? 30 GLU A HG3  13 
ATOM 10979 N N    . CYS A 1 31 ? -7.273  1.608   0.477   1.00 0.00 ? 31 CYS A N    13 
ATOM 10980 C CA   . CYS A 1 31 ? -6.182  1.134   -0.358  1.00 0.00 ? 31 CYS A CA   13 
ATOM 10981 C C    . CYS A 1 31 ? -5.585  -0.114  0.294   1.00 0.00 ? 31 CYS A C    13 
ATOM 10982 O O    . CYS A 1 31 ? -5.231  -1.070  -0.394  1.00 0.00 ? 31 CYS A O    13 
ATOM 10983 C CB   . CYS A 1 31 ? -5.128  2.221   -0.582  1.00 0.00 ? 31 CYS A CB   13 
ATOM 10984 S SG   . CYS A 1 31 ? -3.440  1.596   -0.910  1.00 0.00 ? 31 CYS A SG   13 
ATOM 10985 H H    . CYS A 1 31 ? -7.128  2.507   0.891   1.00 0.00 ? 31 CYS A H    13 
ATOM 10986 H HA   . CYS A 1 31 ? -6.613  0.895   -1.330  1.00 0.00 ? 31 CYS A HA   13 
ATOM 10987 H HB2  . CYS A 1 31 ? -5.440  2.842   -1.422  1.00 0.00 ? 31 CYS A HB2  13 
ATOM 10988 H HB3  . CYS A 1 31 ? -5.098  2.865   0.296   1.00 0.00 ? 31 CYS A HB3  13 
ATOM 10989 N N    . ASN A 1 32 ? -5.491  -0.065  1.615   1.00 0.00 ? 32 ASN A N    13 
ATOM 10990 C CA   . ASN A 1 32 ? -4.943  -1.180  2.368   1.00 0.00 ? 32 ASN A CA   13 
ATOM 10991 C C    . ASN A 1 32 ? -6.033  -2.233  2.579   1.00 0.00 ? 32 ASN A C    13 
ATOM 10992 O O    . ASN A 1 32 ? -5.759  -3.324  3.076   1.00 0.00 ? 32 ASN A O    13 
ATOM 10993 C CB   . ASN A 1 32 ? -4.451  -0.727  3.744   1.00 0.00 ? 32 ASN A CB   13 
ATOM 10994 C CG   . ASN A 1 32 ? -4.268  -1.922  4.682   1.00 0.00 ? 32 ASN A CG   13 
ATOM 10995 O OD1  . ASN A 1 32 ? -3.334  -2.698  4.566   1.00 0.00 ? 32 ASN A OD1  13 
ATOM 10996 N ND2  . ASN A 1 32 ? -5.211  -2.026  5.615   1.00 0.00 ? 32 ASN A ND2  13 
ATOM 10997 H H    . ASN A 1 32 ? -5.781  0.716   2.168   1.00 0.00 ? 32 ASN A H    13 
ATOM 10998 H HA   . ASN A 1 32 ? -4.114  -1.553  1.766   1.00 0.00 ? 32 ASN A HA   13 
ATOM 10999 H HB2  . ASN A 1 32 ? -3.505  -0.195  3.639   1.00 0.00 ? 32 ASN A HB2  13 
ATOM 11000 H HB3  . ASN A 1 32 ? -5.165  -0.026  4.177   1.00 0.00 ? 32 ASN A HB3  13 
ATOM 11001 H HD21 . ASN A 1 32 ? -5.951  -1.355  5.655   1.00 0.00 ? 32 ASN A HD21 13 
ATOM 11002 H HD22 . ASN A 1 32 ? -5.179  -2.775  6.277   1.00 0.00 ? 32 ASN A HD22 13 
ATOM 11003 N N    . ASN A 1 33 ? -7.246  -1.868  2.191   1.00 0.00 ? 33 ASN A N    13 
ATOM 11004 C CA   . ASN A 1 33 ? -8.379  -2.767  2.331   1.00 0.00 ? 33 ASN A CA   13 
ATOM 11005 C C    . ASN A 1 33 ? -8.562  -3.556  1.034   1.00 0.00 ? 33 ASN A C    13 
ATOM 11006 O O    . ASN A 1 33 ? -8.888  -4.742  1.065   1.00 0.00 ? 33 ASN A O    13 
ATOM 11007 C CB   . ASN A 1 33 ? -9.670  -1.990  2.598   1.00 0.00 ? 33 ASN A CB   13 
ATOM 11008 C CG   . ASN A 1 33 ? -10.876 -2.930  2.647   1.00 0.00 ? 33 ASN A CG   13 
ATOM 11009 O OD1  . ASN A 1 33 ? -10.768 -4.130  2.460   1.00 0.00 ? 33 ASN A OD1  13 
ATOM 11010 N ND2  . ASN A 1 33 ? -12.028 -2.318  2.908   1.00 0.00 ? 33 ASN A ND2  13 
ATOM 11011 H H    . ASN A 1 33 ? -7.461  -0.978  1.788   1.00 0.00 ? 33 ASN A H    13 
ATOM 11012 H HA   . ASN A 1 33 ? -8.133  -3.408  3.178   1.00 0.00 ? 33 ASN A HA   13 
ATOM 11013 H HB2  . ASN A 1 33 ? -9.586  -1.451  3.541   1.00 0.00 ? 33 ASN A HB2  13 
ATOM 11014 H HB3  . ASN A 1 33 ? -9.817  -1.244  1.817   1.00 0.00 ? 33 ASN A HB3  13 
ATOM 11015 H HD21 . ASN A 1 33 ? -12.047 -1.329  3.052   1.00 0.00 ? 33 ASN A HD21 13 
ATOM 11016 H HD22 . ASN A 1 33 ? -12.874 -2.848  2.961   1.00 0.00 ? 33 ASN A HD22 13 
ATOM 11017 N N    . ARG A 1 34 ? -8.344  -2.867  -0.077  1.00 0.00 ? 34 ARG A N    13 
ATOM 11018 C CA   . ARG A 1 34 ? -8.481  -3.489  -1.383  1.00 0.00 ? 34 ARG A CA   13 
ATOM 11019 C C    . ARG A 1 34 ? -7.501  -4.656  -1.520  1.00 0.00 ? 34 ARG A C    13 
ATOM 11020 O O    . ARG A 1 34 ? -7.713  -5.557  -2.330  1.00 0.00 ? 34 ARG A O    13 
ATOM 11021 C CB   . ARG A 1 34 ? -8.222  -2.479  -2.503  1.00 0.00 ? 34 ARG A CB   13 
ATOM 11022 C CG   . ARG A 1 34 ? -9.173  -2.710  -3.679  1.00 0.00 ? 34 ARG A CG   13 
ATOM 11023 C CD   . ARG A 1 34 ? -10.618 -2.856  -3.196  1.00 0.00 ? 34 ARG A CD   13 
ATOM 11024 N NE   . ARG A 1 34 ? -11.553 -2.408  -4.252  1.00 0.00 ? 34 ARG A NE   13 
ATOM 11025 C CZ   . ARG A 1 34 ? -11.737 -3.051  -5.414  1.00 0.00 ? 34 ARG A CZ   13 
ATOM 11026 N NH1  . ARG A 1 34 ? -11.052 -4.172  -5.675  1.00 0.00 ? 34 ARG A NH1  13 
ATOM 11027 N NH2  . ARG A 1 34 ? -12.606 -2.571  -6.314  1.00 0.00 ? 34 ARG A NH2  13 
ATOM 11028 H H    . ARG A 1 34 ? -8.080  -1.903  -0.093  1.00 0.00 ? 34 ARG A H    13 
ATOM 11029 H HA   . ARG A 1 34 ? -9.513  -3.837  -1.419  1.00 0.00 ? 34 ARG A HA   13 
ATOM 11030 H HB2  . ARG A 1 34 ? -8.349  -1.466  -2.121  1.00 0.00 ? 34 ARG A HB2  13 
ATOM 11031 H HB3  . ARG A 1 34 ? -7.190  -2.565  -2.843  1.00 0.00 ? 34 ARG A HB3  13 
ATOM 11032 H HG2  . ARG A 1 34 ? -9.102  -1.876  -4.378  1.00 0.00 ? 34 ARG A HG2  13 
ATOM 11033 H HG3  . ARG A 1 34 ? -8.875  -3.607  -4.222  1.00 0.00 ? 34 ARG A HG3  13 
ATOM 11034 H HD2  . ARG A 1 34 ? -10.820 -3.895  -2.937  1.00 0.00 ? 34 ARG A HD2  13 
ATOM 11035 H HD3  . ARG A 1 34 ? -10.769 -2.267  -2.292  1.00 0.00 ? 34 ARG A HD3  13 
ATOM 11036 H HE   . ARG A 1 34 ? -12.080 -1.574  -4.089  1.00 0.00 ? 34 ARG A HE   13 
ATOM 11037 H HH11 . ARG A 1 34 ? -10.403 -4.530  -5.004  1.00 0.00 ? 34 ARG A HH11 13 
ATOM 11038 H HH12 . ARG A 1 34 ? -11.190 -4.652  -6.542  1.00 0.00 ? 34 ARG A HH12 13 
ATOM 11039 H HH21 . ARG A 1 34 ? -13.118 -1.734  -6.119  1.00 0.00 ? 34 ARG A HH21 13 
ATOM 11040 H HH22 . ARG A 1 34 ? -12.744 -3.051  -7.181  1.00 0.00 ? 34 ARG A HH22 13 
ATOM 11041 N N    . GLY A 1 35 ? -6.449  -4.601  -0.717  1.00 0.00 ? 35 GLY A N    13 
ATOM 11042 C CA   . GLY A 1 35 ? -5.436  -5.642  -0.739  1.00 0.00 ? 35 GLY A CA   13 
ATOM 11043 C C    . GLY A 1 35 ? -4.086  -5.084  -1.195  1.00 0.00 ? 35 GLY A C    13 
ATOM 11044 O O    . GLY A 1 35 ? -3.646  -5.350  -2.312  1.00 0.00 ? 35 GLY A O    13 
ATOM 11045 H H    . GLY A 1 35 ? -6.284  -3.864  -0.061  1.00 0.00 ? 35 GLY A H    13 
ATOM 11046 H HA2  . GLY A 1 35 ? -5.336  -6.078  0.255   1.00 0.00 ? 35 GLY A HA2  13 
ATOM 11047 H HA3  . GLY A 1 35 ? -5.747  -6.443  -1.409  1.00 0.00 ? 35 GLY A HA3  13 
ATOM 11048 N N    . CYS A 1 36 ? -3.467  -4.321  -0.306  1.00 0.00 ? 36 CYS A N    13 
ATOM 11049 C CA   . CYS A 1 36 ? -2.176  -3.723  -0.603  1.00 0.00 ? 36 CYS A CA   13 
ATOM 11050 C C    . CYS A 1 36 ? -1.821  -2.758  0.530   1.00 0.00 ? 36 CYS A C    13 
ATOM 11051 O O    . CYS A 1 36 ? -2.320  -2.896  1.646   1.00 0.00 ? 36 CYS A O    13 
ATOM 11052 C CB   . CYS A 1 36 ? -2.175  -3.028  -1.966  1.00 0.00 ? 36 CYS A CB   13 
ATOM 11053 S SG   . CYS A 1 36 ? -0.825  -3.542  -3.089  1.00 0.00 ? 36 CYS A SG   13 
ATOM 11054 H H    . CYS A 1 36 ? -3.832  -4.110  0.601   1.00 0.00 ? 36 CYS A H    13 
ATOM 11055 H HA   . CYS A 1 36 ? -1.457  -4.540  -0.655  1.00 0.00 ? 36 CYS A HA   13 
ATOM 11056 H HB2  . CYS A 1 36 ? -3.129  -3.219  -2.457  1.00 0.00 ? 36 CYS A HB2  13 
ATOM 11057 H HB3  . CYS A 1 36 ? -2.108  -1.951  -1.809  1.00 0.00 ? 36 CYS A HB3  13 
ATOM 11058 N N    . CYS A 1 37 ? -0.963  -1.803  0.204   1.00 0.00 ? 37 CYS A N    13 
ATOM 11059 C CA   . CYS A 1 37 ? -0.535  -0.816  1.181   1.00 0.00 ? 37 CYS A CA   13 
ATOM 11060 C C    . CYS A 1 37 ? -0.860  0.575   0.631   1.00 0.00 ? 37 CYS A C    13 
ATOM 11061 O O    . CYS A 1 37 ? -0.876  0.779   -0.582  1.00 0.00 ? 37 CYS A O    13 
ATOM 11062 C CB   . CYS A 1 37 ? 0.949   -0.963  1.522   1.00 0.00 ? 37 CYS A CB   13 
ATOM 11063 S SG   . CYS A 1 37 ? 1.311   -2.125  2.888   1.00 0.00 ? 37 CYS A SG   13 
ATOM 11064 H H    . CYS A 1 37 ? -0.562  -1.698  -0.706  1.00 0.00 ? 37 CYS A H    13 
ATOM 11065 H HA   . CYS A 1 37 ? -1.099  -1.013  2.092   1.00 0.00 ? 37 CYS A HA   13 
ATOM 11066 H HB2  . CYS A 1 37 ? 1.481   -1.295  0.630   1.00 0.00 ? 37 CYS A HB2  13 
ATOM 11067 H HB3  . CYS A 1 37 ? 1.346   0.018   1.783   1.00 0.00 ? 37 CYS A HB3  13 
ATOM 11068 N N    . PHE A 1 38 ? -1.109  1.496   1.551   1.00 0.00 ? 38 PHE A N    13 
ATOM 11069 C CA   . PHE A 1 38 ? -1.432  2.861   1.173   1.00 0.00 ? 38 PHE A CA   13 
ATOM 11070 C C    . PHE A 1 38 ? -0.352  3.833   1.653   1.00 0.00 ? 38 PHE A C    13 
ATOM 11071 O O    . PHE A 1 38 ? 0.568   3.440   2.370   1.00 0.00 ? 38 PHE A O    13 
ATOM 11072 C CB   . PHE A 1 38 ? -2.756  3.213   1.855   1.00 0.00 ? 38 PHE A CB   13 
ATOM 11073 C CG   . PHE A 1 38 ? -3.161  4.681   1.710   1.00 0.00 ? 38 PHE A CG   13 
ATOM 11074 C CD1  . PHE A 1 38 ? -3.816  5.098   0.593   1.00 0.00 ? 38 PHE A CD1  13 
ATOM 11075 C CD2  . PHE A 1 38 ? -2.865  5.569   2.696   1.00 0.00 ? 38 PHE A CD2  13 
ATOM 11076 C CE1  . PHE A 1 38 ? -4.191  6.461   0.458   1.00 0.00 ? 38 PHE A CE1  13 
ATOM 11077 C CE2  . PHE A 1 38 ? -3.240  6.932   2.561   1.00 0.00 ? 38 PHE A CE2  13 
ATOM 11078 C CZ   . PHE A 1 38 ? -3.895  7.349   1.445   1.00 0.00 ? 38 PHE A CZ   13 
ATOM 11079 H H    . PHE A 1 38 ? -1.094  1.322   2.535   1.00 0.00 ? 38 PHE A H    13 
ATOM 11080 H HA   . PHE A 1 38 ? -1.488  2.892   0.085   1.00 0.00 ? 38 PHE A HA   13 
ATOM 11081 H HB2  . PHE A 1 38 ? -3.545  2.586   1.439   1.00 0.00 ? 38 PHE A HB2  13 
ATOM 11082 H HB3  . PHE A 1 38 ? -2.682  2.970   2.915   1.00 0.00 ? 38 PHE A HB3  13 
ATOM 11083 H HD1  . PHE A 1 38 ? -4.053  4.387   -0.198  1.00 0.00 ? 38 PHE A HD1  13 
ATOM 11084 H HD2  . PHE A 1 38 ? -2.340  5.235   3.591   1.00 0.00 ? 38 PHE A HD2  13 
ATOM 11085 H HE1  . PHE A 1 38 ? -4.716  6.796   -0.437  1.00 0.00 ? 38 PHE A HE1  13 
ATOM 11086 H HE2  . PHE A 1 38 ? -3.003  7.643   3.352   1.00 0.00 ? 38 PHE A HE2  13 
ATOM 11087 H HZ   . PHE A 1 38 ? -4.184  8.395   1.341   1.00 0.00 ? 38 PHE A HZ   13 
ATOM 11088 N N    . ASP A 1 39 ? -0.498  5.082   1.238   1.00 0.00 ? 39 ASP A N    13 
ATOM 11089 C CA   . ASP A 1 39 ? 0.454   6.113   1.616   1.00 0.00 ? 39 ASP A CA   13 
ATOM 11090 C C    . ASP A 1 39 ? 0.053   7.437   0.962   1.00 0.00 ? 39 ASP A C    13 
ATOM 11091 O O    . ASP A 1 39 ? -0.402  7.456   -0.181  1.00 0.00 ? 39 ASP A O    13 
ATOM 11092 C CB   . ASP A 1 39 ? 1.865   5.760   1.142   1.00 0.00 ? 39 ASP A CB   13 
ATOM 11093 C CG   . ASP A 1 39 ? 2.942   6.788   1.496   1.00 0.00 ? 39 ASP A CG   13 
ATOM 11094 O OD1  . ASP A 1 39 ? 3.210   6.934   2.708   1.00 0.00 ? 39 ASP A OD1  13 
ATOM 11095 O OD2  . ASP A 1 39 ? 3.473   7.403   0.546   1.00 0.00 ? 39 ASP A OD2  13 
ATOM 11096 H H    . ASP A 1 39 ? -1.249  5.394   0.655   1.00 0.00 ? 39 ASP A H    13 
ATOM 11097 H HA   . ASP A 1 39 ? 0.412   6.156   2.705   1.00 0.00 ? 39 ASP A HA   13 
ATOM 11098 H HB2  . ASP A 1 39 ? 2.146   4.798   1.572   1.00 0.00 ? 39 ASP A HB2  13 
ATOM 11099 H HB3  . ASP A 1 39 ? 1.847   5.632   0.060   1.00 0.00 ? 39 ASP A HB3  13 
ATOM 11100 N N    . SER A 1 40 ? 0.236   8.511   1.715   1.00 0.00 ? 40 SER A N    13 
ATOM 11101 C CA   . SER A 1 40 ? -0.101  9.836   1.222   1.00 0.00 ? 40 SER A CA   13 
ATOM 11102 C C    . SER A 1 40 ? 1.017   10.822  1.565   1.00 0.00 ? 40 SER A C    13 
ATOM 11103 O O    . SER A 1 40 ? 0.810   12.034  1.541   1.00 0.00 ? 40 SER A O    13 
ATOM 11104 C CB   . SER A 1 40 ? -1.431  10.319  1.805   1.00 0.00 ? 40 SER A CB   13 
ATOM 11105 O OG   . SER A 1 40 ? -1.371  10.466  3.221   1.00 0.00 ? 40 SER A OG   13 
ATOM 11106 H H    . SER A 1 40 ? 0.606   8.487   2.643   1.00 0.00 ? 40 SER A H    13 
ATOM 11107 H HA   . SER A 1 40 ? -0.197  9.727   0.142   1.00 0.00 ? 40 SER A HA   13 
ATOM 11108 H HB2  . SER A 1 40 ? -1.700  11.273  1.352   1.00 0.00 ? 40 SER A HB2  13 
ATOM 11109 H HB3  . SER A 1 40 ? -2.218  9.610   1.548   1.00 0.00 ? 40 SER A HB3  13 
ATOM 11110 H HG   . SER A 1 40 ? -1.912  11.257  3.506   1.00 0.00 ? 40 SER A HG   13 
ATOM 11111 N N    . ARG A 1 41 ? 2.179   10.265  1.875   1.00 0.00 ? 41 ARG A N    13 
ATOM 11112 C CA   . ARG A 1 41 ? 3.331   11.080  2.222   1.00 0.00 ? 41 ARG A CA   13 
ATOM 11113 C C    . ARG A 1 41 ? 3.709   11.991  1.052   1.00 0.00 ? 41 ARG A C    13 
ATOM 11114 O O    . ARG A 1 41 ? 4.100   13.139  1.255   1.00 0.00 ? 41 ARG A O    13 
ATOM 11115 C CB   . ARG A 1 41 ? 4.532   10.208  2.590   1.00 0.00 ? 41 ARG A CB   13 
ATOM 11116 C CG   . ARG A 1 41 ? 5.353   10.849  3.711   1.00 0.00 ? 41 ARG A CG   13 
ATOM 11117 C CD   . ARG A 1 41 ? 6.812   11.029  3.287   1.00 0.00 ? 41 ARG A CD   13 
ATOM 11118 N NE   . ARG A 1 41 ? 7.709   10.749  4.430   1.00 0.00 ? 41 ARG A NE   13 
ATOM 11119 C CZ   . ARG A 1 41 ? 9.046   10.713  4.345   1.00 0.00 ? 41 ARG A CZ   13 
ATOM 11120 N NH1  . ARG A 1 41 ? 9.649   10.938  3.170   1.00 0.00 ? 41 ARG A NH1  13 
ATOM 11121 N NH2  . ARG A 1 41 ? 9.780   10.450  5.435   1.00 0.00 ? 41 ARG A NH2  13 
ATOM 11122 H H    . ARG A 1 41 ? 2.339   9.278   1.892   1.00 0.00 ? 41 ARG A H    13 
ATOM 11123 H HA   . ARG A 1 41 ? 3.009   11.664  3.085   1.00 0.00 ? 41 ARG A HA   13 
ATOM 11124 H HB2  . ARG A 1 41 ? 4.188   9.222   2.904   1.00 0.00 ? 41 ARG A HB2  13 
ATOM 11125 H HB3  . ARG A 1 41 ? 5.161   10.061  1.712   1.00 0.00 ? 41 ARG A HB3  13 
ATOM 11126 H HG2  . ARG A 1 41 ? 4.924   11.816  3.973   1.00 0.00 ? 41 ARG A HG2  13 
ATOM 11127 H HG3  . ARG A 1 41 ? 5.304   10.226  4.604   1.00 0.00 ? 41 ARG A HG3  13 
ATOM 11128 H HD2  . ARG A 1 41 ? 7.045   10.360  2.459   1.00 0.00 ? 41 ARG A HD2  13 
ATOM 11129 H HD3  . ARG A 1 41 ? 6.973   12.046  2.930   1.00 0.00 ? 41 ARG A HD3  13 
ATOM 11130 H HE   . ARG A 1 41 ? 7.292   10.576  5.322   1.00 0.00 ? 41 ARG A HE   13 
ATOM 11131 H HH11 . ARG A 1 41 ? 9.101   11.134  2.356   1.00 0.00 ? 41 ARG A HH11 13 
ATOM 11132 H HH12 . ARG A 1 41 ? 10.647  10.911  3.106   1.00 0.00 ? 41 ARG A HH12 13 
ATOM 11133 H HH21 . ARG A 1 41 ? 9.331   10.281  6.312   1.00 0.00 ? 41 ARG A HH21 13 
ATOM 11134 H HH22 . ARG A 1 41 ? 10.778  10.423  5.371   1.00 0.00 ? 41 ARG A HH22 13 
ATOM 11135 N N    . ILE A 1 42 ? 3.579   11.443  -0.148  1.00 0.00 ? 42 ILE A N    13 
ATOM 11136 C CA   . ILE A 1 42 ? 3.902   12.192  -1.351  1.00 0.00 ? 42 ILE A CA   13 
ATOM 11137 C C    . ILE A 1 42 ? 3.131   11.603  -2.534  1.00 0.00 ? 42 ILE A C    13 
ATOM 11138 O O    . ILE A 1 42 ? 3.068   10.386  -2.695  1.00 0.00 ? 42 ILE A O    13 
ATOM 11139 C CB   . ILE A 1 42 ? 5.416   12.236  -1.564  1.00 0.00 ? 42 ILE A CB   13 
ATOM 11140 C CG1  . ILE A 1 42 ? 6.100   11.045  -0.889  1.00 0.00 ? 42 ILE A CG1  13 
ATOM 11141 C CG2  . ILE A 1 42 ? 5.997   13.571  -1.095  1.00 0.00 ? 42 ILE A CG2  13 
ATOM 11142 C CD1  . ILE A 1 42 ? 5.614   9.723   -1.486  1.00 0.00 ? 42 ILE A CD1  13 
ATOM 11143 H H    . ILE A 1 42 ? 3.260   10.509  -0.304  1.00 0.00 ? 42 ILE A H    13 
ATOM 11144 H HA   . ILE A 1 42 ? 3.568   13.218  -1.197  1.00 0.00 ? 42 ILE A HA   13 
ATOM 11145 H HB   . ILE A 1 42 ? 5.613   12.156  -2.633  1.00 0.00 ? 42 ILE A HB   13 
ATOM 11146 H HG12 . ILE A 1 42 ? 7.180   11.126  -1.007  1.00 0.00 ? 42 ILE A HG12 13 
ATOM 11147 H HG13 . ILE A 1 42 ? 5.894   11.062  0.182   1.00 0.00 ? 42 ILE A HG13 13 
ATOM 11148 H HG21 . ILE A 1 42 ? 5.271   14.365  -1.272  1.00 0.00 ? 42 ILE A HG21 13 
ATOM 11149 H HG22 . ILE A 1 42 ? 6.223   13.515  -0.030  1.00 0.00 ? 42 ILE A HG22 13 
ATOM 11150 H HG23 . ILE A 1 42 ? 6.911   13.784  -1.649  1.00 0.00 ? 42 ILE A HG23 13 
ATOM 11151 H HD11 . ILE A 1 42 ? 5.546   9.817   -2.570  1.00 0.00 ? 42 ILE A HD11 13 
ATOM 11152 H HD12 . ILE A 1 42 ? 6.318   8.929   -1.234  1.00 0.00 ? 42 ILE A HD12 13 
ATOM 11153 H HD13 . ILE A 1 42 ? 4.632   9.480   -1.080  1.00 0.00 ? 42 ILE A HD13 13 
ATOM 11154 N N    . PRO A 1 43 ? 2.549   12.520  -3.354  1.00 0.00 ? 43 PRO A N    13 
ATOM 11155 C CA   . PRO A 1 43 ? 1.786   12.104  -4.518  1.00 0.00 ? 43 PRO A CA   13 
ATOM 11156 C C    . PRO A 1 43 ? 2.711   11.635  -5.642  1.00 0.00 ? 43 PRO A C    13 
ATOM 11157 O O    . PRO A 1 43 ? 2.390   10.691  -6.362  1.00 0.00 ? 43 PRO A O    13 
ATOM 11158 C CB   . PRO A 1 43 ? 0.957   13.320  -4.899  1.00 0.00 ? 43 PRO A CB   13 
ATOM 11159 C CG   . PRO A 1 43 ? 1.627   14.508  -4.227  1.00 0.00 ? 43 PRO A CG   13 
ATOM 11160 C CD   . PRO A 1 43 ? 2.603   13.970  -3.195  1.00 0.00 ? 43 PRO A CD   13 
ATOM 11161 H HA   . PRO A 1 43 ? 1.209   11.319  -4.293  1.00 0.00 ? 43 PRO A HA   13 
ATOM 11162 H HB2  . PRO A 1 43 ? 0.927   13.449  -5.981  1.00 0.00 ? 43 PRO A HB2  13 
ATOM 11163 H HB3  . PRO A 1 43 ? -0.074  13.211  -4.563  1.00 0.00 ? 43 PRO A HB3  13 
ATOM 11164 H HG2  . PRO A 1 43 ? 2.148   15.119  -4.964  1.00 0.00 ? 43 PRO A HG2  13 
ATOM 11165 H HG3  . PRO A 1 43 ? 0.882   15.147  -3.752  1.00 0.00 ? 43 PRO A HG3  13 
ATOM 11166 H HD2  . PRO A 1 43 ? 3.610   14.350  -3.366  1.00 0.00 ? 43 PRO A HD2  13 
ATOM 11167 H HD3  . PRO A 1 43 ? 2.318   14.268  -2.186  1.00 0.00 ? 43 PRO A HD3  13 
ATOM 11168 N N    . GLY A 1 44 ? 3.842   12.317  -5.758  1.00 0.00 ? 44 GLY A N    13 
ATOM 11169 C CA   . GLY A 1 44 ? 4.816   11.982  -6.783  1.00 0.00 ? 44 GLY A CA   13 
ATOM 11170 C C    . GLY A 1 44 ? 4.956   10.465  -6.931  1.00 0.00 ? 44 GLY A C    13 
ATOM 11171 O O    . GLY A 1 44 ? 5.182   9.964   -8.032  1.00 0.00 ? 44 GLY A O    13 
ATOM 11172 H H    . GLY A 1 44 ? 4.095   13.084  -5.169  1.00 0.00 ? 44 GLY A H    13 
ATOM 11173 H HA2  . GLY A 1 44 ? 4.513   12.417  -7.734  1.00 0.00 ? 44 GLY A HA2  13 
ATOM 11174 H HA3  . GLY A 1 44 ? 5.782   12.416  -6.527  1.00 0.00 ? 44 GLY A HA3  13 
ATOM 11175 N N    . VAL A 1 45 ? 4.815   9.777   -5.808  1.00 0.00 ? 45 VAL A N    13 
ATOM 11176 C CA   . VAL A 1 45 ? 4.923   8.328   -5.799  1.00 0.00 ? 45 VAL A CA   13 
ATOM 11177 C C    . VAL A 1 45 ? 3.521   7.717   -5.758  1.00 0.00 ? 45 VAL A C    13 
ATOM 11178 O O    . VAL A 1 45 ? 2.536   8.427   -5.563  1.00 0.00 ? 45 VAL A O    13 
ATOM 11179 C CB   . VAL A 1 45 ? 5.807   7.876   -4.635  1.00 0.00 ? 45 VAL A CB   13 
ATOM 11180 C CG1  . VAL A 1 45 ? 6.887   8.916   -4.330  1.00 0.00 ? 45 VAL A CG1  13 
ATOM 11181 C CG2  . VAL A 1 45 ? 4.966   7.578   -3.392  1.00 0.00 ? 45 VAL A CG2  13 
ATOM 11182 H H    . VAL A 1 45 ? 4.632   10.193  -4.917  1.00 0.00 ? 45 VAL A H    13 
ATOM 11183 H HA   . VAL A 1 45 ? 5.409   8.029   -6.728  1.00 0.00 ? 45 VAL A HA   13 
ATOM 11184 H HB   . VAL A 1 45 ? 6.305   6.953   -4.931  1.00 0.00 ? 45 VAL A HB   13 
ATOM 11185 H HG11 . VAL A 1 45 ? 6.465   9.917   -4.428  1.00 0.00 ? 45 VAL A HG11 13 
ATOM 11186 H HG12 . VAL A 1 45 ? 7.251   8.774   -3.313  1.00 0.00 ? 45 VAL A HG12 13 
ATOM 11187 H HG13 . VAL A 1 45 ? 7.712   8.799   -5.032  1.00 0.00 ? 45 VAL A HG13 13 
ATOM 11188 H HG21 . VAL A 1 45 ? 4.201   8.347   -3.278  1.00 0.00 ? 45 VAL A HG21 13 
ATOM 11189 H HG22 . VAL A 1 45 ? 4.489   6.604   -3.501  1.00 0.00 ? 45 VAL A HG22 13 
ATOM 11190 H HG23 . VAL A 1 45 ? 5.608   7.572   -2.511  1.00 0.00 ? 45 VAL A HG23 13 
ATOM 11191 N N    . PRO A 1 46 ? 3.475   6.371   -5.950  1.00 0.00 ? 46 PRO A N    13 
ATOM 11192 C CA   . PRO A 1 46 ? 2.210   5.657   -5.937  1.00 0.00 ? 46 PRO A CA   13 
ATOM 11193 C C    . PRO A 1 46 ? 1.680   5.506   -4.510  1.00 0.00 ? 46 PRO A C    13 
ATOM 11194 O O    . PRO A 1 46 ? 2.011   4.543   -3.819  1.00 0.00 ? 46 PRO A O    13 
ATOM 11195 C CB   . PRO A 1 46 ? 2.504   4.324   -6.605  1.00 0.00 ? 46 PRO A CB   13 
ATOM 11196 C CG   . PRO A 1 46 ? 4.014   4.153   -6.548  1.00 0.00 ? 46 PRO A CG   13 
ATOM 11197 C CD   . PRO A 1 46 ? 4.621   5.498   -6.184  1.00 0.00 ? 46 PRO A CD   13 
ATOM 11198 H HA   . PRO A 1 46 ? 1.513   6.175   -6.434  1.00 0.00 ? 46 PRO A HA   13 
ATOM 11199 H HB2  . PRO A 1 46 ? 1.999   3.508   -6.088  1.00 0.00 ? 46 PRO A HB2  13 
ATOM 11200 H HB3  . PRO A 1 46 ? 2.149   4.316   -7.636  1.00 0.00 ? 46 PRO A HB3  13 
ATOM 11201 H HG2  . PRO A 1 46 ? 4.285   3.399   -5.810  1.00 0.00 ? 46 PRO A HG2  13 
ATOM 11202 H HG3  . PRO A 1 46 ? 4.395   3.810   -7.510  1.00 0.00 ? 46 PRO A HG3  13 
ATOM 11203 H HD2  . PRO A 1 46 ? 5.248   5.422   -5.296  1.00 0.00 ? 46 PRO A HD2  13 
ATOM 11204 H HD3  . PRO A 1 46 ? 5.251   5.879   -6.988  1.00 0.00 ? 46 PRO A HD3  13 
ATOM 11205 N N    . TRP A 1 47 ? 0.867   6.472   -4.109  1.00 0.00 ? 47 TRP A N    13 
ATOM 11206 C CA   . TRP A 1 47 ? 0.288   6.459   -2.777  1.00 0.00 ? 47 TRP A CA   13 
ATOM 11207 C C    . TRP A 1 47 ? 0.065   5.000   -2.372  1.00 0.00 ? 47 TRP A C    13 
ATOM 11208 O O    . TRP A 1 47 ? 0.527   4.567   -1.318  1.00 0.00 ? 47 TRP A O    13 
ATOM 11209 C CB   . TRP A 1 47 ? -0.992  7.295   -2.726  1.00 0.00 ? 47 TRP A CB   13 
ATOM 11210 C CG   . TRP A 1 47 ? -0.757  8.774   -2.412  1.00 0.00 ? 47 TRP A CG   13 
ATOM 11211 C CD1  . TRP A 1 47 ? 0.323   9.516   -2.693  1.00 0.00 ? 47 TRP A CD1  13 
ATOM 11212 C CD2  . TRP A 1 47 ? -1.672  9.667   -1.742  1.00 0.00 ? 47 TRP A CD2  13 
ATOM 11213 N NE1  . TRP A 1 47 ? 0.172   10.816  -2.254  1.00 0.00 ? 47 TRP A NE1  13 
ATOM 11214 C CE2  . TRP A 1 47 ? -1.080  10.910  -1.658  1.00 0.00 ? 47 TRP A CE2  13 
ATOM 11215 C CE3  . TRP A 1 47 ? -2.958  9.431   -1.224  1.00 0.00 ? 47 TRP A CE3  13 
ATOM 11216 C CZ2  . TRP A 1 47 ? -1.699  12.015  -1.062  1.00 0.00 ? 47 TRP A CZ2  13 
ATOM 11217 C CZ3  . TRP A 1 47 ? -3.563  10.546  -0.631  1.00 0.00 ? 47 TRP A CZ3  13 
ATOM 11218 C CH2  . TRP A 1 47 ? -2.981  11.804  -0.539  1.00 0.00 ? 47 TRP A CH2  13 
ATOM 11219 H H    . TRP A 1 47 ? 0.603   7.252   -4.677  1.00 0.00 ? 47 TRP A H    13 
ATOM 11220 H HA   . TRP A 1 47 ? 1.001   6.929   -2.099  1.00 0.00 ? 47 TRP A HA   13 
ATOM 11221 H HB2  . TRP A 1 47 ? -1.504  7.215   -3.685  1.00 0.00 ? 47 TRP A HB2  13 
ATOM 11222 H HB3  . TRP A 1 47 ? -1.659  6.876   -1.973  1.00 0.00 ? 47 TRP A HB3  13 
ATOM 11223 H HD1  . TRP A 1 47 ? 1.209   9.140   -3.203  1.00 0.00 ? 47 TRP A HD1  13 
ATOM 11224 H HE1  . TRP A 1 47 ? 0.900   11.620  -2.357  1.00 0.00 ? 47 TRP A HE1  13 
ATOM 11225 H HE3  . TRP A 1 47 ? -3.447  8.458   -1.278  1.00 0.00 ? 47 TRP A HE3  13 
ATOM 11226 H HZ2  . TRP A 1 47 ? -1.210  12.988  -1.008  1.00 0.00 ? 47 TRP A HZ2  13 
ATOM 11227 H HZ3  . TRP A 1 47 ? -4.562  10.418  -0.213  1.00 0.00 ? 47 TRP A HZ3  13 
ATOM 11228 H HH2  . TRP A 1 47 ? -3.519  12.623  -0.061  1.00 0.00 ? 47 TRP A HH2  13 
ATOM 11229 N N    . CYS A 1 48 ? -0.643  4.283   -3.232  1.00 0.00 ? 48 CYS A N    13 
ATOM 11230 C CA   . CYS A 1 48 ? -0.933  2.882   -2.977  1.00 0.00 ? 48 CYS A CA   13 
ATOM 11231 C C    . CYS A 1 48 ? 0.133   2.036   -3.678  1.00 0.00 ? 48 CYS A C    13 
ATOM 11232 O O    . CYS A 1 48 ? 0.185   1.989   -4.906  1.00 0.00 ? 48 CYS A O    13 
ATOM 11233 C CB   . CYS A 1 48 ? -2.346  2.506   -3.427  1.00 0.00 ? 48 CYS A CB   13 
ATOM 11234 S SG   . CYS A 1 48 ? -3.034  1.011   -2.625  1.00 0.00 ? 48 CYS A SG   13 
ATOM 11235 H H    . CYS A 1 48 ? -1.016  4.643   -4.087  1.00 0.00 ? 48 CYS A H    13 
ATOM 11236 H HA   . CYS A 1 48 ? -0.888  2.744   -1.897  1.00 0.00 ? 48 CYS A HA   13 
ATOM 11237 H HB2  . CYS A 1 48 ? -3.011  3.346   -3.228  1.00 0.00 ? 48 CYS A HB2  13 
ATOM 11238 H HB3  . CYS A 1 48 ? -2.341  2.352   -4.506  1.00 0.00 ? 48 CYS A HB3  13 
ATOM 11239 N N    . PHE A 1 49 ? 0.956   1.389   -2.866  1.00 0.00 ? 49 PHE A N    13 
ATOM 11240 C CA   . PHE A 1 49 ? 2.017   0.547   -3.393  1.00 0.00 ? 49 PHE A CA   13 
ATOM 11241 C C    . PHE A 1 49 ? 2.037   -0.813  -2.693  1.00 0.00 ? 49 PHE A C    13 
ATOM 11242 O O    . PHE A 1 49 ? 1.424   -0.982  -1.640  1.00 0.00 ? 49 PHE A O    13 
ATOM 11243 C CB   . PHE A 1 49 ? 3.338   1.268   -3.117  1.00 0.00 ? 49 PHE A CB   13 
ATOM 11244 C CG   . PHE A 1 49 ? 3.458   1.826   -1.697  1.00 0.00 ? 49 PHE A CG   13 
ATOM 11245 C CD1  . PHE A 1 49 ? 3.580   0.978   -0.642  1.00 0.00 ? 49 PHE A CD1  13 
ATOM 11246 C CD2  . PHE A 1 49 ? 3.443   3.170   -1.492  1.00 0.00 ? 49 PHE A CD2  13 
ATOM 11247 C CE1  . PHE A 1 49 ? 3.692   1.495   0.676   1.00 0.00 ? 49 PHE A CE1  13 
ATOM 11248 C CE2  . PHE A 1 49 ? 3.555   3.688   -0.174  1.00 0.00 ? 49 PHE A CE2  13 
ATOM 11249 C CZ   . PHE A 1 49 ? 3.677   2.840   0.882   1.00 0.00 ? 49 PHE A CZ   13 
ATOM 11250 H H    . PHE A 1 49 ? 0.907   1.432   -1.868  1.00 0.00 ? 49 PHE A H    13 
ATOM 11251 H HA   . PHE A 1 49 ? 1.820   0.404   -4.455  1.00 0.00 ? 49 PHE A HA   13 
ATOM 11252 H HB2  . PHE A 1 49 ? 4.162   0.577   -3.296  1.00 0.00 ? 49 PHE A HB2  13 
ATOM 11253 H HB3  . PHE A 1 49 ? 3.449   2.087   -3.829  1.00 0.00 ? 49 PHE A HB3  13 
ATOM 11254 H HD1  . PHE A 1 49 ? 3.592   -0.100  -0.807  1.00 0.00 ? 49 PHE A HD1  13 
ATOM 11255 H HD2  . PHE A 1 49 ? 3.346   3.850   -2.338  1.00 0.00 ? 49 PHE A HD2  13 
ATOM 11256 H HE1  . PHE A 1 49 ? 3.789   0.816   1.522   1.00 0.00 ? 49 PHE A HE1  13 
ATOM 11257 H HE2  . PHE A 1 49 ? 3.543   4.766   -0.009  1.00 0.00 ? 49 PHE A HE2  13 
ATOM 11258 H HZ   . PHE A 1 49 ? 3.762   3.237   1.893   1.00 0.00 ? 49 PHE A HZ   13 
ATOM 11259 N N    . LYS A 1 50 ? 2.747   -1.748  -3.306  1.00 0.00 ? 50 LYS A N    13 
ATOM 11260 C CA   . LYS A 1 50 ? 2.854   -3.088  -2.754  1.00 0.00 ? 50 LYS A CA   13 
ATOM 11261 C C    . LYS A 1 50 ? 3.583   -3.026  -1.411  1.00 0.00 ? 50 LYS A C    13 
ATOM 11262 O O    . LYS A 1 50 ? 4.238   -2.031  -1.101  1.00 0.00 ? 50 LYS A O    13 
ATOM 11263 C CB   . LYS A 1 50 ? 3.508   -4.033  -3.765  1.00 0.00 ? 50 LYS A CB   13 
ATOM 11264 C CG   . LYS A 1 50 ? 2.509   -4.460  -4.843  1.00 0.00 ? 50 LYS A CG   13 
ATOM 11265 C CD   . LYS A 1 50 ? 2.539   -5.976  -5.048  1.00 0.00 ? 50 LYS A CD   13 
ATOM 11266 C CE   . LYS A 1 50 ? 2.739   -6.325  -6.524  1.00 0.00 ? 50 LYS A CE   13 
ATOM 11267 N NZ   . LYS A 1 50 ? 1.723   -7.307  -6.966  1.00 0.00 ? 50 LYS A NZ   13 
ATOM 11268 H H    . LYS A 1 50 ? 3.243   -1.603  -4.162  1.00 0.00 ? 50 LYS A H    13 
ATOM 11269 H HA   . LYS A 1 50 ? 1.842   -3.453  -2.582  1.00 0.00 ? 50 LYS A HA   13 
ATOM 11270 H HB2  . LYS A 1 50 ? 4.362   -3.540  -4.230  1.00 0.00 ? 50 LYS A HB2  13 
ATOM 11271 H HB3  . LYS A 1 50 ? 3.892   -4.914  -3.250  1.00 0.00 ? 50 LYS A HB3  13 
ATOM 11272 H HG2  . LYS A 1 50 ? 1.505   -4.147  -4.557  1.00 0.00 ? 50 LYS A HG2  13 
ATOM 11273 H HG3  . LYS A 1 50 ? 2.745   -3.958  -5.781  1.00 0.00 ? 50 LYS A HG3  13 
ATOM 11274 H HD2  . LYS A 1 50 ? 3.344   -6.411  -4.455  1.00 0.00 ? 50 LYS A HD2  13 
ATOM 11275 H HD3  . LYS A 1 50 ? 1.607   -6.413  -4.690  1.00 0.00 ? 50 LYS A HD3  13 
ATOM 11276 H HE2  . LYS A 1 50 ? 2.668   -5.422  -7.130  1.00 0.00 ? 50 LYS A HE2  13 
ATOM 11277 H HE3  . LYS A 1 50 ? 3.738   -6.734  -6.675  1.00 0.00 ? 50 LYS A HE3  13 
ATOM 11278 H HZ1  . LYS A 1 50 ? 1.408   -7.838  -6.179  1.00 0.00 ? 50 LYS A HZ1  13 
ATOM 11279 H HZ2  . LYS A 1 50 ? 0.948   -6.825  -7.374  1.00 0.00 ? 50 LYS A HZ2  13 
ATOM 11280 H HZ3  . LYS A 1 50 ? 2.127   -7.922  -7.643  1.00 0.00 ? 50 LYS A HZ3  13 
ATOM 11281 N N    . PRO A 1 51 ? 3.441   -4.128  -0.628  1.00 0.00 ? 51 PRO A N    13 
ATOM 11282 C CA   . PRO A 1 51 ? 4.078   -4.208  0.676   1.00 0.00 ? 51 PRO A CA   13 
ATOM 11283 C C    . PRO A 1 51 ? 5.581   -4.457  0.537   1.00 0.00 ? 51 PRO A C    13 
ATOM 11284 O O    . PRO A 1 51 ? 5.997   -5.462  -0.038  1.00 0.00 ? 51 PRO A O    13 
ATOM 11285 C CB   . PRO A 1 51 ? 3.354   -5.331  1.400   1.00 0.00 ? 51 PRO A CB   13 
ATOM 11286 C CG   . PRO A 1 51 ? 2.659   -6.143  0.319   1.00 0.00 ? 51 PRO A CG   13 
ATOM 11287 C CD   . PRO A 1 51 ? 2.673   -5.325  -0.961  1.00 0.00 ? 51 PRO A CD   13 
ATOM 11288 H HA   . PRO A 1 51 ? 3.989   -3.337  1.159   1.00 0.00 ? 51 PRO A HA   13 
ATOM 11289 H HB2  . PRO A 1 51 ? 4.054   -5.949  1.963   1.00 0.00 ? 51 PRO A HB2  13 
ATOM 11290 H HB3  . PRO A 1 51 ? 2.633   -4.934  2.115   1.00 0.00 ? 51 PRO A HB3  13 
ATOM 11291 H HG2  . PRO A 1 51 ? 3.168   -7.095  0.170   1.00 0.00 ? 51 PRO A HG2  13 
ATOM 11292 H HG3  . PRO A 1 51 ? 1.635   -6.373  0.614   1.00 0.00 ? 51 PRO A HG3  13 
ATOM 11293 H HD2  . PRO A 1 51 ? 3.136   -5.877  -1.779  1.00 0.00 ? 51 PRO A HD2  13 
ATOM 11294 H HD3  . PRO A 1 51 ? 1.663   -5.070  -1.280  1.00 0.00 ? 51 PRO A HD3  13 
ATOM 11295 N N    . LEU A 1 52 ? 6.355   -3.526  1.075   1.00 0.00 ? 52 LEU A N    13 
ATOM 11296 C CA   . LEU A 1 52 ? 7.803   -3.632  1.018   1.00 0.00 ? 52 LEU A CA   13 
ATOM 11297 C C    . LEU A 1 52 ? 8.207   -5.105  1.112   1.00 0.00 ? 52 LEU A C    13 
ATOM 11298 O O    . LEU A 1 52 ? 7.842   -5.793  2.065   1.00 0.00 ? 52 LEU A O    13 
ATOM 11299 C CB   . LEU A 1 52 ? 8.448   -2.749  2.088   1.00 0.00 ? 52 LEU A CB   13 
ATOM 11300 C CG   . LEU A 1 52 ? 9.959   -2.907  2.269   1.00 0.00 ? 52 LEU A CG   13 
ATOM 11301 C CD1  . LEU A 1 52 ? 10.516  -1.827  3.198   1.00 0.00 ? 52 LEU A CD1  13 
ATOM 11302 C CD2  . LEU A 1 52 ? 10.308  -4.316  2.753   1.00 0.00 ? 52 LEU A CD2  13 
ATOM 11303 H H    . LEU A 1 52 ? 6.009   -2.712  1.541   1.00 0.00 ? 52 LEU A H    13 
ATOM 11304 H HA   . LEU A 1 52 ? 8.122   -3.248  0.049   1.00 0.00 ? 52 LEU A HA   13 
ATOM 11305 H HB2  . LEU A 1 52 ? 8.238   -1.707  1.846   1.00 0.00 ? 52 LEU A HB2  13 
ATOM 11306 H HB3  . LEU A 1 52 ? 7.964   -2.957  3.043   1.00 0.00 ? 52 LEU A HB3  13 
ATOM 11307 H HG   . LEU A 1 52 ? 10.435  -2.774  1.297   1.00 0.00 ? 52 LEU A HG   13 
ATOM 11308 H HD11 . LEU A 1 52 ? 9.742   -1.087  3.400   1.00 0.00 ? 52 LEU A HD11 13 
ATOM 11309 H HD12 . LEU A 1 52 ? 10.838  -2.284  4.134   1.00 0.00 ? 52 LEU A HD12 13 
ATOM 11310 H HD13 . LEU A 1 52 ? 11.367  -1.341  2.720   1.00 0.00 ? 52 LEU A HD13 13 
ATOM 11311 H HD21 . LEU A 1 52 ? 9.423   -4.781  3.187   1.00 0.00 ? 52 LEU A HD21 13 
ATOM 11312 H HD22 . LEU A 1 52 ? 10.657  -4.914  1.911   1.00 0.00 ? 52 LEU A HD22 13 
ATOM 11313 H HD23 . LEU A 1 52 ? 11.094  -4.257  3.506   1.00 0.00 ? 52 LEU A HD23 13 
ATOM 11314 N N    . GLN A 1 53 ? 8.954   -5.546  0.111   1.00 0.00 ? 53 GLN A N    13 
ATOM 11315 C CA   . GLN A 1 53 ? 9.410   -6.925  0.068   1.00 0.00 ? 53 GLN A CA   13 
ATOM 11316 C C    . GLN A 1 53 ? 10.421  -7.184  1.188   1.00 0.00 ? 53 GLN A C    13 
ATOM 11317 O O    . GLN A 1 53 ? 11.572  -7.527  0.923   1.00 0.00 ? 53 GLN A O    13 
ATOM 11318 C CB   . GLN A 1 53 ? 10.008  -7.263  -1.299  1.00 0.00 ? 53 GLN A CB   13 
ATOM 11319 C CG   . GLN A 1 53 ? 11.404  -6.657  -1.452  1.00 0.00 ? 53 GLN A CG   13 
ATOM 11320 C CD   . GLN A 1 53 ? 11.525  -5.352  -0.662  1.00 0.00 ? 53 GLN A CD   13 
ATOM 11321 O OE1  . GLN A 1 53 ? 12.161  -5.282  0.377   1.00 0.00 ? 53 GLN A OE1  13 
ATOM 11322 N NE2  . GLN A 1 53 ? 10.882  -4.326  -1.211  1.00 0.00 ? 53 GLN A NE2  13 
ATOM 11323 H H    . GLN A 1 53 ? 9.246   -4.981  -0.660  1.00 0.00 ? 53 GLN A H    13 
ATOM 11324 H HA   . GLN A 1 53 ? 8.518   -7.531  0.228   1.00 0.00 ? 53 GLN A HA   13 
ATOM 11325 H HB2  . GLN A 1 53 ? 10.062  -8.345  -1.418  1.00 0.00 ? 53 GLN A HB2  13 
ATOM 11326 H HB3  . GLN A 1 53 ? 9.356   -6.887  -2.088  1.00 0.00 ? 53 GLN A HB3  13 
ATOM 11327 H HG2  . GLN A 1 53 ? 12.153  -7.368  -1.103  1.00 0.00 ? 53 GLN A HG2  13 
ATOM 11328 H HG3  . GLN A 1 53 ? 11.610  -6.469  -2.505  1.00 0.00 ? 53 GLN A HG3  13 
ATOM 11329 H HE21 . GLN A 1 53 ? 10.379  -4.451  -2.066  1.00 0.00 ? 53 GLN A HE21 13 
ATOM 11330 H HE22 . GLN A 1 53 ? 10.902  -3.429  -0.769  1.00 0.00 ? 53 GLN A HE22 13 
ATOM 11331 N N    . GLU A 1 54 ? 9.953   -7.010  2.415   1.00 0.00 ? 54 GLU A N    13 
ATOM 11332 C CA   . GLU A 1 54 ? 10.801  -7.221  3.576   1.00 0.00 ? 54 GLU A CA   13 
ATOM 11333 C C    . GLU A 1 54 ? 11.733  -8.412  3.343   1.00 0.00 ? 54 GLU A C    13 
ATOM 11334 O O    . GLU A 1 54 ? 11.275  -9.513  3.038   1.00 0.00 ? 54 GLU A O    13 
ATOM 11335 C CB   . GLU A 1 54 ? 9.962   -7.420  4.840   1.00 0.00 ? 54 GLU A CB   13 
ATOM 11336 C CG   . GLU A 1 54 ? 9.339   -8.817  4.870   1.00 0.00 ? 54 GLU A CG   13 
ATOM 11337 C CD   . GLU A 1 54 ? 10.167  -9.768  5.737   1.00 0.00 ? 54 GLU A CD   13 
ATOM 11338 O OE1  . GLU A 1 54 ? 11.354  -9.959  5.395   1.00 0.00 ? 54 GLU A OE1  13 
ATOM 11339 O OE2  . GLU A 1 54 ? 9.595   -10.281 6.723   1.00 0.00 ? 54 GLU A OE2  13 
ATOM 11340 H H    . GLU A 1 54 ? 9.015   -6.731  2.622   1.00 0.00 ? 54 GLU A H    13 
ATOM 11341 H HA   . GLU A 1 54 ? 11.387  -6.307  3.676   1.00 0.00 ? 54 GLU A HA   13 
ATOM 11342 H HB2  . GLU A 1 54 ? 10.587  -7.277  5.722   1.00 0.00 ? 54 GLU A HB2  13 
ATOM 11343 H HB3  . GLU A 1 54 ? 9.176   -6.666  4.881   1.00 0.00 ? 54 GLU A HB3  13 
ATOM 11344 H HG2  . GLU A 1 54 ? 8.323   -8.757  5.259   1.00 0.00 ? 54 GLU A HG2  13 
ATOM 11345 H HG3  . GLU A 1 54 ? 9.270   -9.210  3.856   1.00 0.00 ? 54 GLU A HG3  13 
ATOM 11346 N N    . ALA A 1 55 ? 13.023  -8.153  3.497   1.00 0.00 ? 55 ALA A N    13 
ATOM 11347 C CA   . ALA A 1 55 ? 14.023  -9.190  3.307   1.00 0.00 ? 55 ALA A CA   13 
ATOM 11348 C C    . ALA A 1 55 ? 15.381  -8.678  3.790   1.00 0.00 ? 55 ALA A C    13 
ATOM 11349 O O    . ALA A 1 55 ? 15.928  -9.186  4.768   1.00 0.00 ? 55 ALA A O    13 
ATOM 11350 C CB   . ALA A 1 55 ? 14.049  -9.612  1.837   1.00 0.00 ? 55 ALA A CB   13 
ATOM 11351 H H    . ALA A 1 55 ? 13.387  -7.255  3.745   1.00 0.00 ? 55 ALA A H    13 
ATOM 11352 H HA   . ALA A 1 55 ? 13.730  -10.048 3.913   1.00 0.00 ? 55 ALA A HA   13 
ATOM 11353 H HB1  . ALA A 1 55 ? 14.069  -10.700 1.771   1.00 0.00 ? 55 ALA A HB1  13 
ATOM 11354 H HB2  . ALA A 1 55 ? 13.158  -9.234  1.334   1.00 0.00 ? 55 ALA A HB2  13 
ATOM 11355 H HB3  . ALA A 1 55 ? 14.937  -9.202  1.356   1.00 0.00 ? 55 ALA A HB3  13 
ATOM 11356 N N    . GLU A 1 56 ? 15.886  -7.677  3.084   1.00 0.00 ? 56 GLU A N    13 
ATOM 11357 C CA   . GLU A 1 56 ? 17.170  -7.091  3.428   1.00 0.00 ? 56 GLU A CA   13 
ATOM 11358 C C    . GLU A 1 56 ? 17.428  -5.843  2.582   1.00 0.00 ? 56 GLU A C    13 
ATOM 11359 O O    . GLU A 1 56 ? 17.947  -5.938  1.471   1.00 0.00 ? 56 GLU A O    13 
ATOM 11360 C CB   . GLU A 1 56 ? 18.300  -8.109  3.263   1.00 0.00 ? 56 GLU A CB   13 
ATOM 11361 C CG   . GLU A 1 56 ? 19.522  -7.712  4.094   1.00 0.00 ? 56 GLU A CG   13 
ATOM 11362 C CD   . GLU A 1 56 ? 20.225  -6.496  3.489   1.00 0.00 ? 56 GLU A CD   13 
ATOM 11363 O OE1  . GLU A 1 56 ? 21.103  -6.719  2.627   1.00 0.00 ? 56 GLU A OE1  13 
ATOM 11364 O OE2  . GLU A 1 56 ? 19.870  -5.370  3.902   1.00 0.00 ? 56 GLU A OE2  13 
ATOM 11365 H H    . GLU A 1 56 ? 15.435  -7.270  2.290   1.00 0.00 ? 56 GLU A H    13 
ATOM 11366 H HA   . GLU A 1 56 ? 17.089  -6.815  4.480   1.00 0.00 ? 56 GLU A HA   13 
ATOM 11367 H HB2  . GLU A 1 56 ? 17.953  -9.096  3.568   1.00 0.00 ? 56 GLU A HB2  13 
ATOM 11368 H HB3  . GLU A 1 56 ? 18.579  -8.180  2.212   1.00 0.00 ? 56 GLU A HB3  13 
ATOM 11369 H HG2  . GLU A 1 56 ? 19.213  -7.487  5.116   1.00 0.00 ? 56 GLU A HG2  13 
ATOM 11370 H HG3  . GLU A 1 56 ? 20.217  -8.549  4.148   1.00 0.00 ? 56 GLU A HG3  13 
ATOM 11371 N N    . CYS A 1 57 ? 17.053  -4.701  3.139   1.00 0.00 ? 57 CYS A N    13 
ATOM 11372 C CA   . CYS A 1 57 ? 17.237  -3.435  2.449   1.00 0.00 ? 57 CYS A CA   13 
ATOM 11373 C C    . CYS A 1 57 ? 18.185  -2.568  3.281   1.00 0.00 ? 57 CYS A C    13 
ATOM 11374 O O    . CYS A 1 57 ? 19.279  -2.230  2.830   1.00 0.00 ? 57 CYS A O    13 
ATOM 11375 C CB   . CYS A 1 57 ? 15.903  -2.733  2.189   1.00 0.00 ? 57 CYS A CB   13 
ATOM 11376 S SG   . CYS A 1 57 ? 15.642  -2.199  0.459   1.00 0.00 ? 57 CYS A SG   13 
ATOM 11377 H H    . CYS A 1 57 ? 16.632  -4.631  4.044   1.00 0.00 ? 57 CYS A H    13 
ATOM 11378 H HA   . CYS A 1 57 ? 17.676  -3.668  1.479   1.00 0.00 ? 57 CYS A HA   13 
ATOM 11379 H HB2  . CYS A 1 57 ? 15.093  -3.406  2.473   1.00 0.00 ? 57 CYS A HB2  13 
ATOM 11380 H HB3  . CYS A 1 57 ? 15.835  -1.860  2.838   1.00 0.00 ? 57 CYS A HB3  13 
ATOM 11381 N N    . THR A 1 58 ? 17.732  -2.234  4.480   1.00 0.00 ? 58 THR A N    13 
ATOM 11382 C CA   . THR A 1 58 ? 18.526  -1.413  5.378   1.00 0.00 ? 58 THR A CA   13 
ATOM 11383 C C    . THR A 1 58 ? 19.740  -2.197  5.884   1.00 0.00 ? 58 THR A C    13 
ATOM 11384 O O    . THR A 1 58 ? 19.590  -3.247  6.506   1.00 0.00 ? 58 THR A O    13 
ATOM 11385 C CB   . THR A 1 58 ? 17.612  -0.920  6.501   1.00 0.00 ? 58 THR A CB   13 
ATOM 11386 O OG1  . THR A 1 58 ? 16.837  0.109   5.890   1.00 0.00 ? 58 THR A OG1  13 
ATOM 11387 C CG2  . THR A 1 58 ? 18.381  -0.198  7.609   1.00 0.00 ? 58 THR A CG2  13 
ATOM 11388 H H    . THR A 1 58 ? 16.842  -2.514  4.839   1.00 0.00 ? 58 THR A H    13 
ATOM 11389 H HA   . THR A 1 58 ? 18.908  -0.560  4.817   1.00 0.00 ? 58 THR A HA   13 
ATOM 11390 H HB   . THR A 1 58 ? 17.018  -1.738  6.908   1.00 0.00 ? 58 THR A HB   13 
ATOM 11391 H HG1  . THR A 1 58 ? 15.868  -0.136  5.908   1.00 0.00 ? 58 THR A HG1  13 
ATOM 11392 H HG21 . THR A 1 58 ? 19.419  -0.532  7.607   1.00 0.00 ? 58 THR A HG21 13 
ATOM 11393 H HG22 . THR A 1 58 ? 18.345  0.877   7.436   1.00 0.00 ? 58 THR A HG22 13 
ATOM 11394 H HG23 . THR A 1 58 ? 17.928  -0.427  8.574   1.00 0.00 ? 58 THR A HG23 13 
ATOM 11395 N N    . PHE A 1 59 ? 20.915  -1.655  5.597   1.00 0.00 ? 59 PHE A N    13 
ATOM 11396 C CA   . PHE A 1 59 ? 22.153  -2.290  6.014   1.00 0.00 ? 59 PHE A CA   13 
ATOM 11397 C C    . PHE A 1 59 ? 22.089  -3.805  5.810   1.00 0.00 ? 59 PHE A C    13 
ATOM 11398 O O    . PHE A 1 59 ? 21.656  -4.537  6.699   1.00 0.00 ? 59 PHE A O    13 
ATOM 11399 C CB   . PHE A 1 59 ? 22.326  -1.995  7.506   1.00 0.00 ? 59 PHE A CB   13 
ATOM 11400 C CG   . PHE A 1 59 ? 23.576  -1.177  7.837   1.00 0.00 ? 59 PHE A CG   13 
ATOM 11401 C CD1  . PHE A 1 59 ? 23.796  0.012   7.214   1.00 0.00 ? 59 PHE A CD1  13 
ATOM 11402 C CD2  . PHE A 1 59 ? 24.467  -1.639  8.755   1.00 0.00 ? 59 PHE A CD2  13 
ATOM 11403 C CE1  . PHE A 1 59 ? 24.956  0.771   7.522   1.00 0.00 ? 59 PHE A CE1  13 
ATOM 11404 C CE2  . PHE A 1 59 ? 25.627  -0.880  9.063   1.00 0.00 ? 59 PHE A CE2  13 
ATOM 11405 C CZ   . PHE A 1 59 ? 25.847  0.309   8.440   1.00 0.00 ? 59 PHE A CZ   13 
ATOM 11406 H H    . PHE A 1 59 ? 21.028  -0.800  5.090   1.00 0.00 ? 59 PHE A H    13 
ATOM 11407 H HA   . PHE A 1 59 ? 22.952  -1.876  5.399   1.00 0.00 ? 59 PHE A HA   13 
ATOM 11408 H HB2  . PHE A 1 59 ? 21.448  -1.458  7.864   1.00 0.00 ? 59 PHE A HB2  13 
ATOM 11409 H HB3  . PHE A 1 59 ? 22.367  -2.939  8.050   1.00 0.00 ? 59 PHE A HB3  13 
ATOM 11410 H HD1  . PHE A 1 59 ? 23.082  0.382   6.478   1.00 0.00 ? 59 PHE A HD1  13 
ATOM 11411 H HD2  . PHE A 1 59 ? 24.291  -2.591  9.255   1.00 0.00 ? 59 PHE A HD2  13 
ATOM 11412 H HE1  . PHE A 1 59 ? 25.132  1.723   7.022   1.00 0.00 ? 59 PHE A HE1  13 
ATOM 11413 H HE2  . PHE A 1 59 ? 26.341  -1.250  9.799   1.00 0.00 ? 59 PHE A HE2  13 
ATOM 11414 H HZ   . PHE A 1 59 ? 26.737  0.892   8.676   1.00 0.00 ? 59 PHE A HZ   13 
ATOM 11415 N N    . GLU A 1 1  ? 9.254   -14.605 21.097  1.00 0.00 ? 1  GLU A N    14 
ATOM 11416 C CA   . GLU A 1 1  ? 8.147   -13.857 20.525  1.00 0.00 ? 1  GLU A CA   14 
ATOM 11417 C C    . GLU A 1 1  ? 8.434   -13.520 19.060  1.00 0.00 ? 1  GLU A C    14 
ATOM 11418 O O    . GLU A 1 1  ? 9.550   -13.131 18.717  1.00 0.00 ? 1  GLU A O    14 
ATOM 11419 C CB   . GLU A 1 1  ? 7.865   -12.590 21.334  1.00 0.00 ? 1  GLU A CB   14 
ATOM 11420 C CG   . GLU A 1 1  ? 6.701   -12.807 22.303  1.00 0.00 ? 1  GLU A CG   14 
ATOM 11421 C CD   . GLU A 1 1  ? 5.370   -12.887 21.553  1.00 0.00 ? 1  GLU A CD   14 
ATOM 11422 O OE1  . GLU A 1 1  ? 5.278   -12.238 20.488  1.00 0.00 ? 1  GLU A OE1  14 
ATOM 11423 O OE2  . GLU A 1 1  ? 4.474   -13.596 22.060  1.00 0.00 ? 1  GLU A OE2  14 
ATOM 11424 H H    . GLU A 1 1  ? 9.666   -14.194 21.910  1.00 0.00 ? 1  GLU A H    14 
ATOM 11425 H HA   . GLU A 1 1  ? 7.285   -14.522 20.589  1.00 0.00 ? 1  GLU A HA   14 
ATOM 11426 H HB2  . GLU A 1 1  ? 8.757   -12.303 21.891  1.00 0.00 ? 1  GLU A HB2  14 
ATOM 11427 H HB3  . GLU A 1 1  ? 7.632   -11.767 20.659  1.00 0.00 ? 1  GLU A HB3  14 
ATOM 11428 H HG2  . GLU A 1 1  ? 6.859   -13.725 22.869  1.00 0.00 ? 1  GLU A HG2  14 
ATOM 11429 H HG3  . GLU A 1 1  ? 6.666   -11.990 23.024  1.00 0.00 ? 1  GLU A HG3  14 
ATOM 11430 N N    . GLU A 1 2  ? 7.409   -13.681 18.237  1.00 0.00 ? 2  GLU A N    14 
ATOM 11431 C CA   . GLU A 1 2  ? 7.538   -13.399 16.817  1.00 0.00 ? 2  GLU A CA   14 
ATOM 11432 C C    . GLU A 1 2  ? 6.953   -12.022 16.495  1.00 0.00 ? 2  GLU A C    14 
ATOM 11433 O O    . GLU A 1 2  ? 5.914   -11.643 17.035  1.00 0.00 ? 2  GLU A O    14 
ATOM 11434 C CB   . GLU A 1 2  ? 6.868   -14.489 15.978  1.00 0.00 ? 2  GLU A CB   14 
ATOM 11435 C CG   . GLU A 1 2  ? 7.522   -14.599 14.599  1.00 0.00 ? 2  GLU A CG   14 
ATOM 11436 C CD   . GLU A 1 2  ? 6.722   -13.824 13.550  1.00 0.00 ? 2  GLU A CD   14 
ATOM 11437 O OE1  . GLU A 1 2  ? 5.501   -14.079 13.466  1.00 0.00 ? 2  GLU A OE1  14 
ATOM 11438 O OE2  . GLU A 1 2  ? 7.349   -12.995 12.857  1.00 0.00 ? 2  GLU A OE2  14 
ATOM 11439 H H    . GLU A 1 2  ? 6.505   -13.998 18.525  1.00 0.00 ? 2  GLU A H    14 
ATOM 11440 H HA   . GLU A 1 2  ? 8.609   -13.401 16.617  1.00 0.00 ? 2  GLU A HA   14 
ATOM 11441 H HB2  . GLU A 1 2  ? 6.940   -15.446 16.496  1.00 0.00 ? 2  GLU A HB2  14 
ATOM 11442 H HB3  . GLU A 1 2  ? 5.808   -14.266 15.865  1.00 0.00 ? 2  GLU A HB3  14 
ATOM 11443 H HG2  . GLU A 1 2  ? 8.540   -14.212 14.644  1.00 0.00 ? 2  GLU A HG2  14 
ATOM 11444 H HG3  . GLU A 1 2  ? 7.592   -15.647 14.308  1.00 0.00 ? 2  GLU A HG3  14 
ATOM 11445 N N    . TYR A 1 3  ? 7.644   -11.311 15.617  1.00 0.00 ? 3  TYR A N    14 
ATOM 11446 C CA   . TYR A 1 3  ? 7.206   -9.985  15.216  1.00 0.00 ? 3  TYR A CA   14 
ATOM 11447 C C    . TYR A 1 3  ? 5.860   -10.048 14.492  1.00 0.00 ? 3  TYR A C    14 
ATOM 11448 O O    . TYR A 1 3  ? 5.386   -11.130 14.149  1.00 0.00 ? 3  TYR A O    14 
ATOM 11449 C CB   . TYR A 1 3  ? 8.269   -9.465  14.246  1.00 0.00 ? 3  TYR A CB   14 
ATOM 11450 C CG   . TYR A 1 3  ? 8.352   -7.939  14.174  1.00 0.00 ? 3  TYR A CG   14 
ATOM 11451 C CD1  . TYR A 1 3  ? 8.446   -7.197  15.334  1.00 0.00 ? 3  TYR A CD1  14 
ATOM 11452 C CD2  . TYR A 1 3  ? 8.333   -7.304  12.949  1.00 0.00 ? 3  TYR A CD2  14 
ATOM 11453 C CE1  . TYR A 1 3  ? 8.524   -5.761  15.266  1.00 0.00 ? 3  TYR A CE1  14 
ATOM 11454 C CE2  . TYR A 1 3  ? 8.411   -5.868  12.881  1.00 0.00 ? 3  TYR A CE2  14 
ATOM 11455 C CZ   . TYR A 1 3  ? 8.502   -5.167  14.043  1.00 0.00 ? 3  TYR A CZ   14 
ATOM 11456 O OH   . TYR A 1 3  ? 8.576   -3.811  13.978  1.00 0.00 ? 3  TYR A OH   14 
ATOM 11457 H H    . TYR A 1 3  ? 8.488   -11.627 15.182  1.00 0.00 ? 3  TYR A H    14 
ATOM 11458 H HA   . TYR A 1 3  ? 7.099   -9.380  16.116  1.00 0.00 ? 3  TYR A HA   14 
ATOM 11459 H HB2  . TYR A 1 3  ? 9.242   -9.858  14.544  1.00 0.00 ? 3  TYR A HB2  14 
ATOM 11460 H HB3  . TYR A 1 3  ? 8.060   -9.855  13.250  1.00 0.00 ? 3  TYR A HB3  14 
ATOM 11461 H HD1  . TYR A 1 3  ? 8.461   -7.699  16.302  1.00 0.00 ? 3  TYR A HD1  14 
ATOM 11462 H HD2  . TYR A 1 3  ? 8.259   -7.890  12.033  1.00 0.00 ? 3  TYR A HD2  14 
ATOM 11463 H HE1  . TYR A 1 3  ? 8.598   -5.163  16.174  1.00 0.00 ? 3  TYR A HE1  14 
ATOM 11464 H HE2  . TYR A 1 3  ? 8.397   -5.354  11.920  1.00 0.00 ? 3  TYR A HE2  14 
ATOM 11465 H HH   . TYR A 1 3  ? 8.327   -3.412  14.861  1.00 0.00 ? 3  TYR A HH   14 
ATOM 11466 N N    . VAL A 1 4  ? 5.282   -8.874  14.282  1.00 0.00 ? 4  VAL A N    14 
ATOM 11467 C CA   . VAL A 1 4  ? 3.999   -8.782  13.606  1.00 0.00 ? 4  VAL A CA   14 
ATOM 11468 C C    . VAL A 1 4  ? 3.943   -7.480  12.805  1.00 0.00 ? 4  VAL A C    14 
ATOM 11469 O O    . VAL A 1 4  ? 3.952   -6.392  13.380  1.00 0.00 ? 4  VAL A O    14 
ATOM 11470 C CB   . VAL A 1 4  ? 2.862   -8.910  14.621  1.00 0.00 ? 4  VAL A CB   14 
ATOM 11471 C CG1  . VAL A 1 4  ? 1.571   -8.293  14.078  1.00 0.00 ? 4  VAL A CG1  14 
ATOM 11472 C CG2  . VAL A 1 4  ? 2.646   -10.370 15.021  1.00 0.00 ? 4  VAL A CG2  14 
ATOM 11473 H H    . VAL A 1 4  ? 5.674   -7.999  14.565  1.00 0.00 ? 4  VAL A H    14 
ATOM 11474 H HA   . VAL A 1 4  ? 3.931   -9.622  12.915  1.00 0.00 ? 4  VAL A HA   14 
ATOM 11475 H HB   . VAL A 1 4  ? 3.147   -8.356  15.515  1.00 0.00 ? 4  VAL A HB   14 
ATOM 11476 H HG11 . VAL A 1 4  ? 1.647   -8.186  12.996  1.00 0.00 ? 4  VAL A HG11 14 
ATOM 11477 H HG12 . VAL A 1 4  ? 0.729   -8.942  14.320  1.00 0.00 ? 4  VAL A HG12 14 
ATOM 11478 H HG13 . VAL A 1 4  ? 1.418   -7.314  14.531  1.00 0.00 ? 4  VAL A HG13 14 
ATOM 11479 H HG21 . VAL A 1 4  ? 2.924   -11.020 14.191  1.00 0.00 ? 4  VAL A HG21 14 
ATOM 11480 H HG22 . VAL A 1 4  ? 3.264   -10.604 15.888  1.00 0.00 ? 4  VAL A HG22 14 
ATOM 11481 H HG23 . VAL A 1 4  ? 1.596   -10.527 15.270  1.00 0.00 ? 4  VAL A HG23 14 
ATOM 11482 N N    . GLY A 1 5  ? 3.886   -7.633  11.490  1.00 0.00 ? 5  GLY A N    14 
ATOM 11483 C CA   . GLY A 1 5  ? 3.827   -6.482  10.604  1.00 0.00 ? 5  GLY A CA   14 
ATOM 11484 C C    . GLY A 1 5  ? 2.601   -6.554  9.693   1.00 0.00 ? 5  GLY A C    14 
ATOM 11485 O O    . GLY A 1 5  ? 2.599   -7.287  8.705   1.00 0.00 ? 5  GLY A O    14 
ATOM 11486 H H    . GLY A 1 5  ? 3.879   -8.521  11.030  1.00 0.00 ? 5  GLY A H    14 
ATOM 11487 H HA2  . GLY A 1 5  ? 3.794   -5.566  11.194  1.00 0.00 ? 5  GLY A HA2  14 
ATOM 11488 H HA3  . GLY A 1 5  ? 4.733   -6.439  9.999   1.00 0.00 ? 5  GLY A HA3  14 
ATOM 11489 N N    . LEU A 1 6  ? 1.587   -5.782  10.056  1.00 0.00 ? 6  LEU A N    14 
ATOM 11490 C CA   . LEU A 1 6  ? 0.357   -5.749  9.284   1.00 0.00 ? 6  LEU A CA   14 
ATOM 11491 C C    . LEU A 1 6  ? 0.217   -4.380  8.614   1.00 0.00 ? 6  LEU A C    14 
ATOM 11492 O O    . LEU A 1 6  ? -0.565  -4.219  7.679   1.00 0.00 ? 6  LEU A O    14 
ATOM 11493 C CB   . LEU A 1 6  ? -0.838  -6.129  10.161  1.00 0.00 ? 6  LEU A CB   14 
ATOM 11494 C CG   . LEU A 1 6  ? -0.842  -5.549  11.577  1.00 0.00 ? 6  LEU A CG   14 
ATOM 11495 C CD1  . LEU A 1 6  ? -2.249  -5.110  11.986  1.00 0.00 ? 6  LEU A CD1  14 
ATOM 11496 C CD2  . LEU A 1 6  ? -0.236  -6.537  12.576  1.00 0.00 ? 6  LEU A CD2  14 
ATOM 11497 H H    . LEU A 1 6  ? 1.597   -5.189  10.861  1.00 0.00 ? 6  LEU A H    14 
ATOM 11498 H HA   . LEU A 1 6  ? 0.440   -6.507  8.505   1.00 0.00 ? 6  LEU A HA   14 
ATOM 11499 H HB2  . LEU A 1 6  ? -1.750  -5.810  9.656   1.00 0.00 ? 6  LEU A HB2  14 
ATOM 11500 H HB3  . LEU A 1 6  ? -0.877  -7.216  10.235  1.00 0.00 ? 6  LEU A HB3  14 
ATOM 11501 H HG   . LEU A 1 6  ? -0.212  -4.659  11.583  1.00 0.00 ? 6  LEU A HG   14 
ATOM 11502 H HD11 . LEU A 1 6  ? -2.643  -4.416  11.243  1.00 0.00 ? 6  LEU A HD11 14 
ATOM 11503 H HD12 . LEU A 1 6  ? -2.898  -5.984  12.047  1.00 0.00 ? 6  LEU A HD12 14 
ATOM 11504 H HD13 . LEU A 1 6  ? -2.209  -4.619  12.957  1.00 0.00 ? 6  LEU A HD13 14 
ATOM 11505 H HD21 . LEU A 1 6  ? -0.366  -7.554  12.205  1.00 0.00 ? 6  LEU A HD21 14 
ATOM 11506 H HD22 . LEU A 1 6  ? 0.827   -6.327  12.696  1.00 0.00 ? 6  LEU A HD22 14 
ATOM 11507 H HD23 . LEU A 1 6  ? -0.738  -6.434  13.538  1.00 0.00 ? 6  LEU A HD23 14 
ATOM 11508 N N    . SER A 1 7  ? 0.988   -3.428  9.120   1.00 0.00 ? 7  SER A N    14 
ATOM 11509 C CA   . SER A 1 7  ? 0.960   -2.079  8.582   1.00 0.00 ? 7  SER A CA   14 
ATOM 11510 C C    . SER A 1 7  ? 2.222   -1.322  9.002   1.00 0.00 ? 7  SER A C    14 
ATOM 11511 O O    . SER A 1 7  ? 2.917   -1.733  9.930   1.00 0.00 ? 7  SER A O    14 
ATOM 11512 C CB   . SER A 1 7  ? -0.288  -1.326  9.047   1.00 0.00 ? 7  SER A CB   14 
ATOM 11513 O OG   . SER A 1 7  ? -0.359  -1.236  10.467  1.00 0.00 ? 7  SER A OG   14 
ATOM 11514 H H    . SER A 1 7  ? 1.622   -3.567  9.881   1.00 0.00 ? 7  SER A H    14 
ATOM 11515 H HA   . SER A 1 7  ? 0.929   -2.200  7.500   1.00 0.00 ? 7  SER A HA   14 
ATOM 11516 H HB2  . SER A 1 7  ? -0.288  -0.324  8.619   1.00 0.00 ? 7  SER A HB2  14 
ATOM 11517 H HB3  . SER A 1 7  ? -1.177  -1.833  8.671   1.00 0.00 ? 7  SER A HB3  14 
ATOM 11518 H HG   . SER A 1 7  ? 0.486   -0.842  10.828  1.00 0.00 ? 7  SER A HG   14 
ATOM 11519 N N    . ALA A 1 8  ? 2.480   -0.230  8.298   1.00 0.00 ? 8  ALA A N    14 
ATOM 11520 C CA   . ALA A 1 8  ? 3.647   0.588   8.586   1.00 0.00 ? 8  ALA A CA   14 
ATOM 11521 C C    . ALA A 1 8  ? 4.902   -0.128  8.085   1.00 0.00 ? 8  ALA A C    14 
ATOM 11522 O O    . ALA A 1 8  ? 5.386   0.154   6.989   1.00 0.00 ? 8  ALA A O    14 
ATOM 11523 C CB   . ALA A 1 8  ? 3.705   0.885   10.086  1.00 0.00 ? 8  ALA A CB   14 
ATOM 11524 H H    . ALA A 1 8  ? 1.910   0.098   7.545   1.00 0.00 ? 8  ALA A H    14 
ATOM 11525 H HA   . ALA A 1 8  ? 3.534   1.528   8.047   1.00 0.00 ? 8  ALA A HA   14 
ATOM 11526 H HB1  . ALA A 1 8  ? 2.888   0.368   10.591  1.00 0.00 ? 8  ALA A HB1  14 
ATOM 11527 H HB2  . ALA A 1 8  ? 4.657   0.539   10.488  1.00 0.00 ? 8  ALA A HB2  14 
ATOM 11528 H HB3  . ALA A 1 8  ? 3.610   1.959   10.248  1.00 0.00 ? 8  ALA A HB3  14 
ATOM 11529 N N    . ASN A 1 9  ? 5.394   -1.040  8.910   1.00 0.00 ? 9  ASN A N    14 
ATOM 11530 C CA   . ASN A 1 9  ? 6.584   -1.798  8.564   1.00 0.00 ? 9  ASN A CA   14 
ATOM 11531 C C    . ASN A 1 9  ? 6.430   -2.364  7.150   1.00 0.00 ? 9  ASN A C    14 
ATOM 11532 O O    . ASN A 1 9  ? 7.371   -2.331  6.359   1.00 0.00 ? 9  ASN A O    14 
ATOM 11533 C CB   . ASN A 1 9  ? 6.788   -2.973  9.523   1.00 0.00 ? 9  ASN A CB   14 
ATOM 11534 C CG   . ASN A 1 9  ? 7.400   -2.502  10.844  1.00 0.00 ? 9  ASN A CG   14 
ATOM 11535 O OD1  . ASN A 1 9  ? 8.483   -1.942  10.891  1.00 0.00 ? 9  ASN A OD1  14 
ATOM 11536 N ND2  . ASN A 1 9  ? 6.648   -2.760  11.910  1.00 0.00 ? 9  ASN A ND2  14 
ATOM 11537 H H    . ASN A 1 9  ? 4.995   -1.263  9.799   1.00 0.00 ? 9  ASN A H    14 
ATOM 11538 H HA   . ASN A 1 9  ? 7.409   -1.089  8.642   1.00 0.00 ? 9  ASN A HA   14 
ATOM 11539 H HB2  . ASN A 1 9  ? 5.832   -3.460  9.714   1.00 0.00 ? 9  ASN A HB2  14 
ATOM 11540 H HB3  . ASN A 1 9  ? 7.438   -3.716  9.061   1.00 0.00 ? 9  ASN A HB3  14 
ATOM 11541 H HD21 . ASN A 1 9  ? 5.769   -3.223  11.802  1.00 0.00 ? 9  ASN A HD21 14 
ATOM 11542 H HD22 . ASN A 1 9  ? 6.963   -2.490  12.821  1.00 0.00 ? 9  ASN A HD22 14 
ATOM 11543 N N    . GLN A 1 10 ? 5.237   -2.869  6.876   1.00 0.00 ? 10 GLN A N    14 
ATOM 11544 C CA   . GLN A 1 10 ? 4.947   -3.441  5.572   1.00 0.00 ? 10 GLN A CA   14 
ATOM 11545 C C    . GLN A 1 10 ? 4.806   -2.333  4.526   1.00 0.00 ? 10 GLN A C    14 
ATOM 11546 O O    . GLN A 1 10 ? 5.127   -2.535  3.356   1.00 0.00 ? 10 GLN A O    14 
ATOM 11547 C CB   . GLN A 1 10 ? 3.690   -4.311  5.622   1.00 0.00 ? 10 GLN A CB   14 
ATOM 11548 C CG   . GLN A 1 10 ? 3.830   -5.530  4.707   1.00 0.00 ? 10 GLN A CG   14 
ATOM 11549 C CD   . GLN A 1 10 ? 2.502   -6.280  4.586   1.00 0.00 ? 10 GLN A CD   14 
ATOM 11550 O OE1  . GLN A 1 10 ? 1.612   -5.903  3.842   1.00 0.00 ? 10 GLN A OE1  14 
ATOM 11551 N NE2  . GLN A 1 10 ? 2.420   -7.361  5.358   1.00 0.00 ? 10 GLN A NE2  14 
ATOM 11552 H H    . GLN A 1 10 ? 4.477   -2.892  7.526   1.00 0.00 ? 10 GLN A H    14 
ATOM 11553 H HA   . GLN A 1 10 ? 5.806   -4.068  5.334   1.00 0.00 ? 10 GLN A HA   14 
ATOM 11554 H HB2  . GLN A 1 10 ? 3.511   -4.640  6.646   1.00 0.00 ? 10 GLN A HB2  14 
ATOM 11555 H HB3  . GLN A 1 10 ? 2.824   -3.723  5.320   1.00 0.00 ? 10 GLN A HB3  14 
ATOM 11556 H HG2  . GLN A 1 10 ? 4.162   -5.210  3.719   1.00 0.00 ? 10 GLN A HG2  14 
ATOM 11557 H HG3  . GLN A 1 10 ? 4.596   -6.198  5.100   1.00 0.00 ? 10 GLN A HG3  14 
ATOM 11558 H HE21 . GLN A 1 10 ? 3.187   -7.615  5.946   1.00 0.00 ? 10 GLN A HE21 14 
ATOM 11559 H HE22 . GLN A 1 10 ? 1.590   -7.919  5.349   1.00 0.00 ? 10 GLN A HE22 14 
ATOM 11560 N N    . CYS A 1 11 ? 4.325   -1.187  4.986   1.00 0.00 ? 11 CYS A N    14 
ATOM 11561 C CA   . CYS A 1 11 ? 4.137   -0.047  4.105   1.00 0.00 ? 11 CYS A CA   14 
ATOM 11562 C C    . CYS A 1 11 ? 5.103   1.058   4.537   1.00 0.00 ? 11 CYS A C    14 
ATOM 11563 O O    . CYS A 1 11 ? 4.710   2.217   4.662   1.00 0.00 ? 11 CYS A O    14 
ATOM 11564 C CB   . CYS A 1 11 ? 2.684   0.433   4.102   1.00 0.00 ? 11 CYS A CB   14 
ATOM 11565 S SG   . CYS A 1 11 ? 1.445   -0.870  4.442   1.00 0.00 ? 11 CYS A SG   14 
ATOM 11566 H H    . CYS A 1 11 ? 4.066   -1.032  5.939   1.00 0.00 ? 11 CYS A H    14 
ATOM 11567 H HA   . CYS A 1 11 ? 4.368   -0.390  3.096   1.00 0.00 ? 11 CYS A HA   14 
ATOM 11568 H HB2  . CYS A 1 11 ? 2.576   1.221   4.847   1.00 0.00 ? 11 CYS A HB2  14 
ATOM 11569 H HB3  . CYS A 1 11 ? 2.465   0.878   3.132   1.00 0.00 ? 11 CYS A HB3  14 
ATOM 11570 N N    . ALA A 1 12 ? 6.348   0.661   4.753   1.00 0.00 ? 12 ALA A N    14 
ATOM 11571 C CA   . ALA A 1 12 ? 7.373   1.603   5.168   1.00 0.00 ? 12 ALA A CA   14 
ATOM 11572 C C    . ALA A 1 12 ? 8.449   1.692   4.083   1.00 0.00 ? 12 ALA A C    14 
ATOM 11573 O O    . ALA A 1 12 ? 9.631   1.495   4.359   1.00 0.00 ? 12 ALA A O    14 
ATOM 11574 C CB   . ALA A 1 12 ? 7.944   1.174   6.521   1.00 0.00 ? 12 ALA A CB   14 
ATOM 11575 H H    . ALA A 1 12 ? 6.660   -0.284  4.649   1.00 0.00 ? 12 ALA A H    14 
ATOM 11576 H HA   . ALA A 1 12 ? 6.901   2.579   5.280   1.00 0.00 ? 12 ALA A HA   14 
ATOM 11577 H HB1  . ALA A 1 12 ? 8.941   1.595   6.645   1.00 0.00 ? 12 ALA A HB1  14 
ATOM 11578 H HB2  . ALA A 1 12 ? 7.295   1.534   7.320   1.00 0.00 ? 12 ALA A HB2  14 
ATOM 11579 H HB3  . ALA A 1 12 ? 8.001   0.086   6.563   1.00 0.00 ? 12 ALA A HB3  14 
ATOM 11580 N N    . VAL A 1 13 ? 8.000   1.987   2.873   1.00 0.00 ? 13 VAL A N    14 
ATOM 11581 C CA   . VAL A 1 13 ? 8.909   2.104   1.745   1.00 0.00 ? 13 VAL A CA   14 
ATOM 11582 C C    . VAL A 1 13 ? 9.370   3.557   1.616   1.00 0.00 ? 13 VAL A C    14 
ATOM 11583 O O    . VAL A 1 13 ? 8.649   4.478   1.999   1.00 0.00 ? 13 VAL A O    14 
ATOM 11584 C CB   . VAL A 1 13 ? 8.239   1.575   0.476   1.00 0.00 ? 13 VAL A CB   14 
ATOM 11585 C CG1  . VAL A 1 13 ? 9.229   0.777   -0.375  1.00 0.00 ? 13 VAL A CG1  14 
ATOM 11586 C CG2  . VAL A 1 13 ? 7.007   0.734   0.816   1.00 0.00 ? 13 VAL A CG2  14 
ATOM 11587 H H    . VAL A 1 13 ? 7.036   2.146   2.657   1.00 0.00 ? 13 VAL A H    14 
ATOM 11588 H HA   . VAL A 1 13 ? 9.776   1.478   1.956   1.00 0.00 ? 13 VAL A HA   14 
ATOM 11589 H HB   . VAL A 1 13 ? 7.908   2.431   -0.111  1.00 0.00 ? 13 VAL A HB   14 
ATOM 11590 H HG11 . VAL A 1 13 ? 10.103  0.525   0.226   1.00 0.00 ? 13 VAL A HG11 14 
ATOM 11591 H HG12 . VAL A 1 13 ? 8.753   -0.139  -0.724  1.00 0.00 ? 13 VAL A HG12 14 
ATOM 11592 H HG13 . VAL A 1 13 ? 9.538   1.376   -1.232  1.00 0.00 ? 13 VAL A HG13 14 
ATOM 11593 H HG21 . VAL A 1 13 ? 7.235   0.079   1.657   1.00 0.00 ? 13 VAL A HG21 14 
ATOM 11594 H HG22 . VAL A 1 13 ? 6.180   1.392   1.082   1.00 0.00 ? 13 VAL A HG22 14 
ATOM 11595 H HG23 . VAL A 1 13 ? 6.728   0.131   -0.049  1.00 0.00 ? 13 VAL A HG23 14 
ATOM 11596 N N    . PRO A 1 14 ? 10.600  3.723   1.061   1.00 0.00 ? 14 PRO A N    14 
ATOM 11597 C CA   . PRO A 1 14 ? 11.166  5.048   0.876   1.00 0.00 ? 14 PRO A CA   14 
ATOM 11598 C C    . PRO A 1 14 ? 10.502  5.770   -0.298  1.00 0.00 ? 14 PRO A C    14 
ATOM 11599 O O    . PRO A 1 14 ? 10.875  6.893   -0.633  1.00 0.00 ? 14 PRO A O    14 
ATOM 11600 C CB   . PRO A 1 14 ? 12.653  4.815   0.664   1.00 0.00 ? 14 PRO A CB   14 
ATOM 11601 C CG   . PRO A 1 14 ? 12.795  3.352   0.276   1.00 0.00 ? 14 PRO A CG   14 
ATOM 11602 C CD   . PRO A 1 14 ? 11.482  2.656   0.595   1.00 0.00 ? 14 PRO A CD   14 
ATOM 11603 H HA   . PRO A 1 14 ? 10.991  5.615   1.681   1.00 0.00 ? 14 PRO A HA   14 
ATOM 11604 H HB2  . PRO A 1 14 ? 13.044  5.466   -0.117  1.00 0.00 ? 14 PRO A HB2  14 
ATOM 11605 H HB3  . PRO A 1 14 ? 13.216  5.034   1.572   1.00 0.00 ? 14 PRO A HB3  14 
ATOM 11606 H HG2  . PRO A 1 14 ? 13.028  3.260   -0.785  1.00 0.00 ? 14 PRO A HG2  14 
ATOM 11607 H HG3  . PRO A 1 14 ? 13.616  2.889   0.823   1.00 0.00 ? 14 PRO A HG3  14 
ATOM 11608 H HD2  . PRO A 1 14 ? 11.073  2.159   -0.285  1.00 0.00 ? 14 PRO A HD2  14 
ATOM 11609 H HD3  . PRO A 1 14 ? 11.615  1.891   1.360   1.00 0.00 ? 14 PRO A HD3  14 
ATOM 11610 N N    . ALA A 1 15 ? 9.527   5.095   -0.891  1.00 0.00 ? 15 ALA A N    14 
ATOM 11611 C CA   . ALA A 1 15 ? 8.807   5.658   -2.020  1.00 0.00 ? 15 ALA A CA   14 
ATOM 11612 C C    . ALA A 1 15 ? 9.563   5.339   -3.312  1.00 0.00 ? 15 ALA A C    14 
ATOM 11613 O O    . ALA A 1 15 ? 8.964   5.269   -4.384  1.00 0.00 ? 15 ALA A O    14 
ATOM 11614 C CB   . ALA A 1 15 ? 8.621   7.162   -1.809  1.00 0.00 ? 15 ALA A CB   14 
ATOM 11615 H H    . ALA A 1 15 ? 9.230   4.182   -0.612  1.00 0.00 ? 15 ALA A H    14 
ATOM 11616 H HA   . ALA A 1 15 ? 7.826   5.185   -2.057  1.00 0.00 ? 15 ALA A HA   14 
ATOM 11617 H HB1  . ALA A 1 15 ? 8.755   7.400   -0.754  1.00 0.00 ? 15 ALA A HB1  14 
ATOM 11618 H HB2  . ALA A 1 15 ? 7.618   7.451   -2.123  1.00 0.00 ? 15 ALA A HB2  14 
ATOM 11619 H HB3  . ALA A 1 15 ? 9.358   7.705   -2.401  1.00 0.00 ? 15 ALA A HB3  14 
ATOM 11620 N N    . LYS A 1 16 ? 10.866  5.153   -3.166  1.00 0.00 ? 16 LYS A N    14 
ATOM 11621 C CA   . LYS A 1 16 ? 11.710  4.844   -4.308  1.00 0.00 ? 16 LYS A CA   14 
ATOM 11622 C C    . LYS A 1 16 ? 11.747  3.328   -4.513  1.00 0.00 ? 16 LYS A C    14 
ATOM 11623 O O    . LYS A 1 16 ? 12.499  2.829   -5.349  1.00 0.00 ? 16 LYS A O    14 
ATOM 11624 C CB   . LYS A 1 16 ? 13.093  5.475   -4.139  1.00 0.00 ? 16 LYS A CB   14 
ATOM 11625 C CG   . LYS A 1 16 ? 13.843  4.846   -2.963  1.00 0.00 ? 16 LYS A CG   14 
ATOM 11626 C CD   . LYS A 1 16 ? 14.480  3.515   -3.367  1.00 0.00 ? 16 LYS A CD   14 
ATOM 11627 C CE   . LYS A 1 16 ? 15.943  3.451   -2.924  1.00 0.00 ? 16 LYS A CE   14 
ATOM 11628 N NZ   . LYS A 1 16 ? 16.302  2.073   -2.518  1.00 0.00 ? 16 LYS A NZ   14 
ATOM 11629 H H    . LYS A 1 16 ? 11.345  5.212   -2.290  1.00 0.00 ? 16 LYS A H    14 
ATOM 11630 H HA   . LYS A 1 16 ? 11.253  5.300   -5.186  1.00 0.00 ? 16 LYS A HA   14 
ATOM 11631 H HB2  . LYS A 1 16 ? 13.671  5.345   -5.054  1.00 0.00 ? 16 LYS A HB2  14 
ATOM 11632 H HB3  . LYS A 1 16 ? 12.990  6.548   -3.977  1.00 0.00 ? 16 LYS A HB3  14 
ATOM 11633 H HG2  . LYS A 1 16 ? 14.615  5.531   -2.611  1.00 0.00 ? 16 LYS A HG2  14 
ATOM 11634 H HG3  . LYS A 1 16 ? 13.156  4.687   -2.132  1.00 0.00 ? 16 LYS A HG3  14 
ATOM 11635 H HD2  . LYS A 1 16 ? 13.925  2.691   -2.920  1.00 0.00 ? 16 LYS A HD2  14 
ATOM 11636 H HD3  . LYS A 1 16 ? 14.418  3.392   -4.448  1.00 0.00 ? 16 LYS A HD3  14 
ATOM 11637 H HE2  . LYS A 1 16 ? 16.591  3.777   -3.738  1.00 0.00 ? 16 LYS A HE2  14 
ATOM 11638 H HE3  . LYS A 1 16 ? 16.108  4.136   -2.092  1.00 0.00 ? 16 LYS A HE3  14 
ATOM 11639 H HZ1  . LYS A 1 16 ? 15.977  1.427   -3.209  1.00 0.00 ? 16 LYS A HZ1  14 
ATOM 11640 H HZ2  . LYS A 1 16 ? 17.295  1.999   -2.433  1.00 0.00 ? 16 LYS A HZ2  14 
ATOM 11641 H HZ3  . LYS A 1 16 ? 15.875  1.863   -1.639  1.00 0.00 ? 16 LYS A HZ3  14 
ATOM 11642 N N    . ASP A 1 17 ? 10.926  2.637   -3.736  1.00 0.00 ? 17 ASP A N    14 
ATOM 11643 C CA   . ASP A 1 17 ? 10.855  1.189   -3.821  1.00 0.00 ? 17 ASP A CA   14 
ATOM 11644 C C    . ASP A 1 17 ? 9.391   0.760   -3.936  1.00 0.00 ? 17 ASP A C    14 
ATOM 11645 O O    . ASP A 1 17 ? 9.052   -0.388  -3.651  1.00 0.00 ? 17 ASP A O    14 
ATOM 11646 C CB   . ASP A 1 17 ? 11.443  0.533   -2.570  1.00 0.00 ? 17 ASP A CB   14 
ATOM 11647 C CG   . ASP A 1 17 ? 12.629  -0.399  -2.825  1.00 0.00 ? 17 ASP A CG   14 
ATOM 11648 O OD1  . ASP A 1 17 ? 12.956  -0.588  -4.017  1.00 0.00 ? 17 ASP A OD1  14 
ATOM 11649 O OD2  . ASP A 1 17 ? 13.181  -0.903  -1.823  1.00 0.00 ? 17 ASP A OD2  14 
ATOM 11650 H H    . ASP A 1 17 ? 10.318  3.051   -3.058  1.00 0.00 ? 17 ASP A H    14 
ATOM 11651 H HA   . ASP A 1 17 ? 11.437  0.925   -4.705  1.00 0.00 ? 17 ASP A HA   14 
ATOM 11652 H HB2  . ASP A 1 17 ? 11.759  1.317   -1.882  1.00 0.00 ? 17 ASP A HB2  14 
ATOM 11653 H HB3  . ASP A 1 17 ? 10.657  -0.032  -2.071  1.00 0.00 ? 17 ASP A HB3  14 
ATOM 11654 N N    . ARG A 1 18 ? 8.561   1.705   -4.353  1.00 0.00 ? 18 ARG A N    14 
ATOM 11655 C CA   . ARG A 1 18 ? 7.141   1.439   -4.509  1.00 0.00 ? 18 ARG A CA   14 
ATOM 11656 C C    . ARG A 1 18 ? 6.889   0.635   -5.786  1.00 0.00 ? 18 ARG A C    14 
ATOM 11657 O O    . ARG A 1 18 ? 7.461   0.930   -6.833  1.00 0.00 ? 18 ARG A O    14 
ATOM 11658 C CB   . ARG A 1 18 ? 6.341   2.742   -4.568  1.00 0.00 ? 18 ARG A CB   14 
ATOM 11659 C CG   . ARG A 1 18 ? 6.846   3.744   -3.528  1.00 0.00 ? 18 ARG A CG   14 
ATOM 11660 C CD   . ARG A 1 18 ? 6.170   3.516   -2.174  1.00 0.00 ? 18 ARG A CD   14 
ATOM 11661 N NE   . ARG A 1 18 ? 5.771   4.812   -1.583  1.00 0.00 ? 18 ARG A NE   14 
ATOM 11662 C CZ   . ARG A 1 18 ? 5.683   5.042   -0.266  1.00 0.00 ? 18 ARG A CZ   14 
ATOM 11663 N NH1  . ARG A 1 18 ? 5.965   4.064   0.605   1.00 0.00 ? 18 ARG A NH1  14 
ATOM 11664 N NH2  . ARG A 1 18 ? 5.312   6.251   0.180   1.00 0.00 ? 18 ARG A NH2  14 
ATOM 11665 H H    . ARG A 1 18 ? 8.845   2.636   -4.583  1.00 0.00 ? 18 ARG A H    14 
ATOM 11666 H HA   . ARG A 1 18 ? 6.866   0.866   -3.623  1.00 0.00 ? 18 ARG A HA   14 
ATOM 11667 H HB2  . ARG A 1 18 ? 6.419   3.176   -5.565  1.00 0.00 ? 18 ARG A HB2  14 
ATOM 11668 H HB3  . ARG A 1 18 ? 5.285   2.532   -4.394  1.00 0.00 ? 18 ARG A HB3  14 
ATOM 11669 H HG2  . ARG A 1 18 ? 7.926   3.648   -3.420  1.00 0.00 ? 18 ARG A HG2  14 
ATOM 11670 H HG3  . ARG A 1 18 ? 6.648   4.759   -3.870  1.00 0.00 ? 18 ARG A HG3  14 
ATOM 11671 H HD2  . ARG A 1 18 ? 5.294   2.878   -2.298  1.00 0.00 ? 18 ARG A HD2  14 
ATOM 11672 H HD3  . ARG A 1 18 ? 6.851   2.994   -1.502  1.00 0.00 ? 18 ARG A HD3  14 
ATOM 11673 H HE   . ARG A 1 18 ? 5.553   5.564   -2.206  1.00 0.00 ? 18 ARG A HE   14 
ATOM 11674 H HH11 . ARG A 1 18 ? 6.242   3.163   0.272   1.00 0.00 ? 18 ARG A HH11 14 
ATOM 11675 H HH12 . ARG A 1 18 ? 5.900   4.236   1.588   1.00 0.00 ? 18 ARG A HH12 14 
ATOM 11676 H HH21 . ARG A 1 18 ? 5.101   6.981   -0.470  1.00 0.00 ? 18 ARG A HH21 14 
ATOM 11677 H HH22 . ARG A 1 18 ? 5.247   6.422   1.163   1.00 0.00 ? 18 ARG A HH22 14 
ATOM 11678 N N    . VAL A 1 19 ? 6.030   -0.366  -5.656  1.00 0.00 ? 19 VAL A N    14 
ATOM 11679 C CA   . VAL A 1 19 ? 5.695   -1.215  -6.786  1.00 0.00 ? 19 VAL A CA   14 
ATOM 11680 C C    . VAL A 1 19 ? 4.401   -0.713  -7.430  1.00 0.00 ? 19 VAL A C    14 
ATOM 11681 O O    . VAL A 1 19 ? 3.947   -1.263  -8.432  1.00 0.00 ? 19 VAL A O    14 
ATOM 11682 C CB   . VAL A 1 19 ? 5.611   -2.676  -6.337  1.00 0.00 ? 19 VAL A CB   14 
ATOM 11683 C CG1  . VAL A 1 19 ? 5.123   -3.573  -7.476  1.00 0.00 ? 19 VAL A CG1  14 
ATOM 11684 C CG2  . VAL A 1 19 ? 6.957   -3.160  -5.796  1.00 0.00 ? 19 VAL A CG2  14 
ATOM 11685 H H    . VAL A 1 19 ? 5.569   -0.600  -4.800  1.00 0.00 ? 19 VAL A H    14 
ATOM 11686 H HA   . VAL A 1 19 ? 6.503   -1.131  -7.512  1.00 0.00 ? 19 VAL A HA   14 
ATOM 11687 H HB   . VAL A 1 19 ? 4.883   -2.736  -5.528  1.00 0.00 ? 19 VAL A HB   14 
ATOM 11688 H HG11 . VAL A 1 19 ? 5.708   -3.371  -8.374  1.00 0.00 ? 19 VAL A HG11 14 
ATOM 11689 H HG12 . VAL A 1 19 ? 5.243   -4.618  -7.192  1.00 0.00 ? 19 VAL A HG12 14 
ATOM 11690 H HG13 . VAL A 1 19 ? 4.071   -3.368  -7.675  1.00 0.00 ? 19 VAL A HG13 14 
ATOM 11691 H HG21 . VAL A 1 19 ? 7.612   -2.305  -5.630  1.00 0.00 ? 19 VAL A HG21 14 
ATOM 11692 H HG22 . VAL A 1 19 ? 6.802   -3.687  -4.854  1.00 0.00 ? 19 VAL A HG22 14 
ATOM 11693 H HG23 . VAL A 1 19 ? 7.418   -3.835  -6.517  1.00 0.00 ? 19 VAL A HG23 14 
ATOM 11694 N N    . ASP A 1 20 ? 3.842   0.326   -6.826  1.00 0.00 ? 20 ASP A N    14 
ATOM 11695 C CA   . ASP A 1 20 ? 2.609   0.909   -7.328  1.00 0.00 ? 20 ASP A CA   14 
ATOM 11696 C C    . ASP A 1 20 ? 1.590   -0.204  -7.581  1.00 0.00 ? 20 ASP A C    14 
ATOM 11697 O O    . ASP A 1 20 ? 1.644   -0.878  -8.609  1.00 0.00 ? 20 ASP A O    14 
ATOM 11698 C CB   . ASP A 1 20 ? 2.845   1.644   -8.649  1.00 0.00 ? 20 ASP A CB   14 
ATOM 11699 C CG   . ASP A 1 20 ? 1.579   1.954   -9.451  1.00 0.00 ? 20 ASP A CG   14 
ATOM 11700 O OD1  . ASP A 1 20 ? 0.524   2.123   -8.803  1.00 0.00 ? 20 ASP A OD1  14 
ATOM 11701 O OD2  . ASP A 1 20 ? 1.696   2.014   -10.694 1.00 0.00 ? 20 ASP A OD2  14 
ATOM 11702 H H    . ASP A 1 20 ? 4.217   0.767   -6.011  1.00 0.00 ? 20 ASP A H    14 
ATOM 11703 H HA   . ASP A 1 20 ? 2.285   1.603   -6.553  1.00 0.00 ? 20 ASP A HA   14 
ATOM 11704 H HB2  . ASP A 1 20 ? 3.363   2.579   -8.440  1.00 0.00 ? 20 ASP A HB2  14 
ATOM 11705 H HB3  . ASP A 1 20 ? 3.511   1.042   -9.268  1.00 0.00 ? 20 ASP A HB3  14 
ATOM 11706 N N    . CYS A 1 21 ? 0.685   -0.362  -6.626  1.00 0.00 ? 21 CYS A N    14 
ATOM 11707 C CA   . CYS A 1 21 ? -0.345  -1.382  -6.733  1.00 0.00 ? 21 CYS A CA   14 
ATOM 11708 C C    . CYS A 1 21 ? -1.344  -0.945  -7.805  1.00 0.00 ? 21 CYS A C    14 
ATOM 11709 O O    . CYS A 1 21 ? -2.039  -1.777  -8.388  1.00 0.00 ? 21 CYS A O    14 
ATOM 11710 C CB   . CYS A 1 21 ? -1.027  -1.639  -5.388  1.00 0.00 ? 21 CYS A CB   14 
ATOM 11711 S SG   . CYS A 1 21 ? -1.361  -3.401  -5.022  1.00 0.00 ? 21 CYS A SG   14 
ATOM 11712 H H    . CYS A 1 21 ? 0.648   0.190   -5.794  1.00 0.00 ? 21 CYS A H    14 
ATOM 11713 H HA   . CYS A 1 21 ? 0.157   -2.304  -7.024  1.00 0.00 ? 21 CYS A HA   14 
ATOM 11714 H HB2  . CYS A 1 21 ? -0.401  -1.231  -4.595  1.00 0.00 ? 21 CYS A HB2  14 
ATOM 11715 H HB3  . CYS A 1 21 ? -1.970  -1.093  -5.364  1.00 0.00 ? 21 CYS A HB3  14 
ATOM 11716 N N    . GLY A 1 22 ? -1.386  0.360   -8.034  1.00 0.00 ? 22 GLY A N    14 
ATOM 11717 C CA   . GLY A 1 22 ? -2.289  0.917   -9.026  1.00 0.00 ? 22 GLY A CA   14 
ATOM 11718 C C    . GLY A 1 22 ? -3.747  0.751   -8.595  1.00 0.00 ? 22 GLY A C    14 
ATOM 11719 O O    . GLY A 1 22 ? -4.359  -0.286  -8.849  1.00 0.00 ? 22 GLY A O    14 
ATOM 11720 H H    . GLY A 1 22 ? -0.818  1.029   -7.556  1.00 0.00 ? 22 GLY A H    14 
ATOM 11721 H HA2  . GLY A 1 22 ? -2.067  1.974   -9.172  1.00 0.00 ? 22 GLY A HA2  14 
ATOM 11722 H HA3  . GLY A 1 22 ? -2.131  0.424   -9.985  1.00 0.00 ? 22 GLY A HA3  14 
ATOM 11723 N N    . TYR A 1 23 ? -4.262  1.787   -7.950  1.00 0.00 ? 23 TYR A N    14 
ATOM 11724 C CA   . TYR A 1 23 ? -5.637  1.769   -7.481  1.00 0.00 ? 23 TYR A CA   14 
ATOM 11725 C C    . TYR A 1 23 ? -6.310  3.125   -7.703  1.00 0.00 ? 23 TYR A C    14 
ATOM 11726 O O    . TYR A 1 23 ? -5.652  4.164   -7.659  1.00 0.00 ? 23 TYR A O    14 
ATOM 11727 C CB   . TYR A 1 23 ? -5.567  1.488   -5.979  1.00 0.00 ? 23 TYR A CB   14 
ATOM 11728 C CG   . TYR A 1 23 ? -5.616  0.001   -5.622  1.00 0.00 ? 23 TYR A CG   14 
ATOM 11729 C CD1  . TYR A 1 23 ? -6.769  -0.725  -5.842  1.00 0.00 ? 23 TYR A CD1  14 
ATOM 11730 C CD2  . TYR A 1 23 ? -4.506  -0.615  -5.080  1.00 0.00 ? 23 TYR A CD2  14 
ATOM 11731 C CE1  . TYR A 1 23 ? -6.815  -2.124  -5.506  1.00 0.00 ? 23 TYR A CE1  14 
ATOM 11732 C CE2  . TYR A 1 23 ? -4.552  -2.015  -4.743  1.00 0.00 ? 23 TYR A CE2  14 
ATOM 11733 C CZ   . TYR A 1 23 ? -5.704  -2.700  -4.973  1.00 0.00 ? 23 TYR A CZ   14 
ATOM 11734 O OH   . TYR A 1 23 ? -5.747  -4.022  -4.656  1.00 0.00 ? 23 TYR A OH   14 
ATOM 11735 H H    . TYR A 1 23 ? -3.758  2.627   -7.748  1.00 0.00 ? 23 TYR A H    14 
ATOM 11736 H HA   . TYR A 1 23 ? -6.175  1.008   -8.047  1.00 0.00 ? 23 TYR A HA   14 
ATOM 11737 H HB2  . TYR A 1 23 ? -4.647  1.916   -5.582  1.00 0.00 ? 23 TYR A HB2  14 
ATOM 11738 H HB3  . TYR A 1 23 ? -6.395  1.997   -5.485  1.00 0.00 ? 23 TYR A HB3  14 
ATOM 11739 H HD1  . TYR A 1 23 ? -7.645  -0.238  -6.270  1.00 0.00 ? 23 TYR A HD1  14 
ATOM 11740 H HD2  . TYR A 1 23 ? -3.595  -0.043  -4.906  1.00 0.00 ? 23 TYR A HD2  14 
ATOM 11741 H HE1  . TYR A 1 23 ? -7.719  -2.708  -5.675  1.00 0.00 ? 23 TYR A HE1  14 
ATOM 11742 H HE2  . TYR A 1 23 ? -3.683  -2.514  -4.315  1.00 0.00 ? 23 TYR A HE2  14 
ATOM 11743 H HH   . TYR A 1 23 ? -5.363  -4.167  -3.744  1.00 0.00 ? 23 TYR A HH   14 
ATOM 11744 N N    . PRO A 1 24 ? -7.648  3.071   -7.943  1.00 0.00 ? 24 PRO A N    14 
ATOM 11745 C CA   . PRO A 1 24 ? -8.417  4.282   -8.171  1.00 0.00 ? 24 PRO A CA   14 
ATOM 11746 C C    . PRO A 1 24 ? -8.648  5.040   -6.863  1.00 0.00 ? 24 PRO A C    14 
ATOM 11747 O O    . PRO A 1 24 ? -8.006  6.059   -6.610  1.00 0.00 ? 24 PRO A O    14 
ATOM 11748 C CB   . PRO A 1 24 ? -9.708  3.812   -8.821  1.00 0.00 ? 24 PRO A CB   14 
ATOM 11749 C CG   . PRO A 1 24 ? -9.815  2.328   -8.509  1.00 0.00 ? 24 PRO A CG   14 
ATOM 11750 C CD   . PRO A 1 24 ? -8.460  1.859   -8.003  1.00 0.00 ? 24 PRO A CD   14 
ATOM 11751 H HA   . PRO A 1 24 ? -7.911  4.908   -8.764  1.00 0.00 ? 24 PRO A HA   14 
ATOM 11752 H HB2  . PRO A 1 24 ? -10.565 4.356   -8.425  1.00 0.00 ? 24 PRO A HB2  14 
ATOM 11753 H HB3  . PRO A 1 24 ? -9.690  3.985   -9.897  1.00 0.00 ? 24 PRO A HB3  14 
ATOM 11754 H HG2  . PRO A 1 24 ? -10.585 2.149   -7.759  1.00 0.00 ? 24 PRO A HG2  14 
ATOM 11755 H HG3  . PRO A 1 24 ? -10.103 1.770   -9.400  1.00 0.00 ? 24 PRO A HG3  14 
ATOM 11756 H HD2  . PRO A 1 24 ? -8.544  1.390   -7.022  1.00 0.00 ? 24 PRO A HD2  14 
ATOM 11757 H HD3  . PRO A 1 24 ? -8.021  1.121   -8.673  1.00 0.00 ? 24 PRO A HD3  14 
ATOM 11758 N N    . HIS A 1 25 ? -9.566  4.515   -6.065  1.00 0.00 ? 25 HIS A N    14 
ATOM 11759 C CA   . HIS A 1 25 ? -9.889  5.129   -4.789  1.00 0.00 ? 25 HIS A CA   14 
ATOM 11760 C C    . HIS A 1 25 ? -8.967  4.572   -3.703  1.00 0.00 ? 25 HIS A C    14 
ATOM 11761 O O    . HIS A 1 25 ? -9.330  3.632   -2.997  1.00 0.00 ? 25 HIS A O    14 
ATOM 11762 C CB   . HIS A 1 25 ? -11.372 4.947   -4.458  1.00 0.00 ? 25 HIS A CB   14 
ATOM 11763 C CG   . HIS A 1 25 ? -11.762 3.522   -4.150  1.00 0.00 ? 25 HIS A CG   14 
ATOM 11764 N ND1  . HIS A 1 25 ? -13.003 3.177   -3.644  1.00 0.00 ? 25 HIS A ND1  14 
ATOM 11765 C CD2  . HIS A 1 25 ? -11.063 2.358   -4.282  1.00 0.00 ? 25 HIS A CD2  14 
ATOM 11766 C CE1  . HIS A 1 25 ? -13.038 1.862   -3.481  1.00 0.00 ? 25 HIS A CE1  14 
ATOM 11767 N NE2  . HIS A 1 25 ? -11.835 1.357   -3.877  1.00 0.00 ? 25 HIS A NE2  14 
ATOM 11768 H H    . HIS A 1 25 ? -10.083 3.686   -6.278  1.00 0.00 ? 25 HIS A H    14 
ATOM 11769 H HA   . HIS A 1 25 ? -9.701  6.197   -4.899  1.00 0.00 ? 25 HIS A HA   14 
ATOM 11770 H HB2  . HIS A 1 25 ? -11.622 5.575   -3.603  1.00 0.00 ? 25 HIS A HB2  14 
ATOM 11771 H HB3  . HIS A 1 25 ? -11.967 5.302   -5.299  1.00 0.00 ? 25 HIS A HB3  14 
ATOM 11772 H HD1  . HIS A 1 25 ? -13.747 3.812   -3.436  1.00 0.00 ? 25 HIS A HD1  14 
ATOM 11773 H HD2  . HIS A 1 25 ? -10.043 2.266   -4.656  1.00 0.00 ? 25 HIS A HD2  14 
ATOM 11774 H HE1  . HIS A 1 25 ? -13.881 1.286   -3.099  1.00 0.00 ? 25 HIS A HE1  14 
ATOM 11775 H HE2  . HIS A 1 25 ? -11.597 0.386   -3.917  1.00 0.00 ? 25 HIS A HE2  14 
ATOM 11776 N N    . VAL A 1 26 ? -7.791  5.175   -3.602  1.00 0.00 ? 26 VAL A N    14 
ATOM 11777 C CA   . VAL A 1 26 ? -6.814  4.751   -2.614  1.00 0.00 ? 26 VAL A CA   14 
ATOM 11778 C C    . VAL A 1 26 ? -6.944  5.626   -1.366  1.00 0.00 ? 26 VAL A C    14 
ATOM 11779 O O    . VAL A 1 26 ? -7.053  6.847   -1.469  1.00 0.00 ? 26 VAL A O    14 
ATOM 11780 C CB   . VAL A 1 26 ? -5.410  4.779   -3.221  1.00 0.00 ? 26 VAL A CB   14 
ATOM 11781 C CG1  . VAL A 1 26 ? -5.269  3.730   -4.326  1.00 0.00 ? 26 VAL A CG1  14 
ATOM 11782 C CG2  . VAL A 1 26 ? -5.066  6.175   -3.743  1.00 0.00 ? 26 VAL A CG2  14 
ATOM 11783 H H    . VAL A 1 26 ? -7.504  5.939   -4.180  1.00 0.00 ? 26 VAL A H    14 
ATOM 11784 H HA   . VAL A 1 26 ? -7.045  3.720   -2.345  1.00 0.00 ? 26 VAL A HA   14 
ATOM 11785 H HB   . VAL A 1 26 ? -4.699  4.532   -2.432  1.00 0.00 ? 26 VAL A HB   14 
ATOM 11786 H HG11 . VAL A 1 26 ? -6.014  3.915   -5.100  1.00 0.00 ? 26 VAL A HG11 14 
ATOM 11787 H HG12 . VAL A 1 26 ? -4.271  3.791   -4.760  1.00 0.00 ? 26 VAL A HG12 14 
ATOM 11788 H HG13 . VAL A 1 26 ? -5.422  2.736   -3.905  1.00 0.00 ? 26 VAL A HG13 14 
ATOM 11789 H HG21 . VAL A 1 26 ? -5.786  6.896   -3.355  1.00 0.00 ? 26 VAL A HG21 14 
ATOM 11790 H HG22 . VAL A 1 26 ? -4.064  6.449   -3.415  1.00 0.00 ? 26 VAL A HG22 14 
ATOM 11791 H HG23 . VAL A 1 26 ? -5.104  6.175   -4.833  1.00 0.00 ? 26 VAL A HG23 14 
ATOM 11792 N N    . THR A 1 27 ? -6.927  4.969   -0.216  1.00 0.00 ? 27 THR A N    14 
ATOM 11793 C CA   . THR A 1 27 ? -7.041  5.672   1.050   1.00 0.00 ? 27 THR A CA   14 
ATOM 11794 C C    . THR A 1 27 ? -6.305  4.909   2.153   1.00 0.00 ? 27 THR A C    14 
ATOM 11795 O O    . THR A 1 27 ? -5.862  3.781   1.942   1.00 0.00 ? 27 THR A O    14 
ATOM 11796 C CB   . THR A 1 27 ? -8.528  5.880   1.343   1.00 0.00 ? 27 THR A CB   14 
ATOM 11797 O OG1  . THR A 1 27 ? -8.934  4.661   1.961   1.00 0.00 ? 27 THR A OG1  14 
ATOM 11798 C CG2  . THR A 1 27 ? -9.372  5.950   0.069   1.00 0.00 ? 27 THR A CG2  14 
ATOM 11799 H H    . THR A 1 27 ? -6.837  3.976   -0.141  1.00 0.00 ? 27 THR A H    14 
ATOM 11800 H HA   . THR A 1 27 ? -6.551  6.641   0.950   1.00 0.00 ? 27 THR A HA   14 
ATOM 11801 H HB   . THR A 1 27 ? -8.684  6.763   1.962   1.00 0.00 ? 27 THR A HB   14 
ATOM 11802 H HG1  . THR A 1 27 ? -9.892  4.722   2.241   1.00 0.00 ? 27 THR A HG1  14 
ATOM 11803 H HG21 . THR A 1 27 ? -9.141  5.096   -0.568  1.00 0.00 ? 27 THR A HG21 14 
ATOM 11804 H HG22 . THR A 1 27 ? -10.430 5.931   0.332   1.00 0.00 ? 27 THR A HG22 14 
ATOM 11805 H HG23 . THR A 1 27 ? -9.147  6.873   -0.465  1.00 0.00 ? 27 THR A HG23 14 
ATOM 11806 N N    . PRO A 1 28 ? -6.195  5.571   3.335   1.00 0.00 ? 28 PRO A N    14 
ATOM 11807 C CA   . PRO A 1 28 ? -5.521  4.967   4.472   1.00 0.00 ? 28 PRO A CA   14 
ATOM 11808 C C    . PRO A 1 28 ? -6.393  3.888   5.117   1.00 0.00 ? 28 PRO A C    14 
ATOM 11809 O O    . PRO A 1 28 ? -6.424  3.760   6.340   1.00 0.00 ? 28 PRO A O    14 
ATOM 11810 C CB   . PRO A 1 28 ? -5.216  6.124   5.409   1.00 0.00 ? 28 PRO A CB   14 
ATOM 11811 C CG   . PRO A 1 28 ? -6.136  7.257   4.985   1.00 0.00 ? 28 PRO A CG   14 
ATOM 11812 C CD   . PRO A 1 28 ? -6.708  6.908   3.621   1.00 0.00 ? 28 PRO A CD   14 
ATOM 11813 H HA   . PRO A 1 28 ? -4.687  4.502   4.174   1.00 0.00 ? 28 PRO A HA   14 
ATOM 11814 H HB2  . PRO A 1 28 ? -5.394  5.843   6.447   1.00 0.00 ? 28 PRO A HB2  14 
ATOM 11815 H HB3  . PRO A 1 28 ? -4.170  6.421   5.335   1.00 0.00 ? 28 PRO A HB3  14 
ATOM 11816 H HG2  . PRO A 1 28 ? -6.937  7.391   5.713   1.00 0.00 ? 28 PRO A HG2  14 
ATOM 11817 H HG3  . PRO A 1 28 ? -5.587  8.198   4.940   1.00 0.00 ? 28 PRO A HG3  14 
ATOM 11818 H HD2  . PRO A 1 28 ? -7.798  6.919   3.634   1.00 0.00 ? 28 PRO A HD2  14 
ATOM 11819 H HD3  . PRO A 1 28 ? -6.391  7.624   2.863   1.00 0.00 ? 28 PRO A HD3  14 
ATOM 11820 N N    . LYS A 1 29 ? -7.081  3.141   4.267   1.00 0.00 ? 29 LYS A N    14 
ATOM 11821 C CA   . LYS A 1 29 ? -7.952  2.078   4.739   1.00 0.00 ? 29 LYS A CA   14 
ATOM 11822 C C    . LYS A 1 29 ? -8.550  1.343   3.537   1.00 0.00 ? 29 LYS A C    14 
ATOM 11823 O O    . LYS A 1 29 ? -8.613  0.115   3.525   1.00 0.00 ? 29 LYS A O    14 
ATOM 11824 C CB   . LYS A 1 29 ? -9.000  2.633   5.705   1.00 0.00 ? 29 LYS A CB   14 
ATOM 11825 C CG   . LYS A 1 29 ? -9.476  1.552   6.677   1.00 0.00 ? 29 LYS A CG   14 
ATOM 11826 C CD   . LYS A 1 29 ? -10.997 1.391   6.616   1.00 0.00 ? 29 LYS A CD   14 
ATOM 11827 C CE   . LYS A 1 29 ? -11.667 2.055   7.821   1.00 0.00 ? 29 LYS A CE   14 
ATOM 11828 N NZ   . LYS A 1 29 ? -12.831 2.860   7.388   1.00 0.00 ? 29 LYS A NZ   14 
ATOM 11829 H H    . LYS A 1 29 ? -7.050  3.252   3.273   1.00 0.00 ? 29 LYS A H    14 
ATOM 11830 H HA   . LYS A 1 29 ? -7.335  1.376   5.301   1.00 0.00 ? 29 LYS A HA   14 
ATOM 11831 H HB2  . LYS A 1 29 ? -8.579  3.470   6.263   1.00 0.00 ? 29 LYS A HB2  14 
ATOM 11832 H HB3  . LYS A 1 29 ? -9.849  3.021   5.142   1.00 0.00 ? 29 LYS A HB3  14 
ATOM 11833 H HG2  . LYS A 1 29 ? -8.997  0.604   6.436   1.00 0.00 ? 29 LYS A HG2  14 
ATOM 11834 H HG3  . LYS A 1 29 ? -9.175  1.813   7.692   1.00 0.00 ? 29 LYS A HG3  14 
ATOM 11835 H HD2  . LYS A 1 29 ? -11.376 1.833   5.695   1.00 0.00 ? 29 LYS A HD2  14 
ATOM 11836 H HD3  . LYS A 1 29 ? -11.253 0.332   6.591   1.00 0.00 ? 29 LYS A HD3  14 
ATOM 11837 H HE2  . LYS A 1 29 ? -11.988 1.293   8.531   1.00 0.00 ? 29 LYS A HE2  14 
ATOM 11838 H HE3  . LYS A 1 29 ? -10.950