data_1EA5
# 
_entry.id   1EA5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EA5         
PDBE  EBI-5523     
WWPDB D_1290005523 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO)TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI-ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN-II' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL-PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EA5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2000-11-06 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Weik, M.'      2 
'Silman, I.'    3 
'Sussman, J.L.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;X-Ray Structures of Torpedo Californica Acetylcholinesterase Complexed with (+)-Huperzine a and (-)-Huperzine B: Structural Evidence for an Active Site Rearrangement
;
Biochemistry           41   10810 ? 2002 BICHAW US 0006-2960 0033 ? 12196020 10.1021/BI020151+              
1       
'Residues in Torpedo Californica Acetylcholinesterase Necessary for Processing to a Glycosyl Phosphatidylinositol-Anchored Form' 
Biochim.Biophys.Acta   1292 223   ? 1996 BBACAQ NE 0006-3002 0113 ? 8597567  '10.1016/0167-4838(95)00205-7' 
2       
;Structure and Dynamics of the Active Site Gorge of Acetylcholinesterase: Synergistic Use of Molecular Dynamics Simulation and X-Ray Crystallography
;
'Protein Sci.'         3    188   ? 1994 PRCIEI US 0961-8368 0795 ? 8003956  ?                              
3       'Quaternary Ligand Binding to Aromatic Residues in the Active-Site Gorge of Acetylcholinesterase' Proc.Natl.Acad.Sci.USA 
90   9031  ? 1993 PNASA6 US 0027-8424 0040 ? 8415649  10.1073/PNAS.90.19.9031        
4       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253  872   ? 1991 SCIEAS US 0036-8075 0038 ? 1678899  10.1126/SCIENCE.1678899        
5       
;Purification and Crystallization of a Dimeric Form of Acetylcholinesterase from Torpedo Californica Subsequent to Solubilization with Phosphatidylinositol-Specific Phospholipase C
;
J.Mol.Biol.            203  821   ? 1988 JMOBAK UK 0022-2836 0070 ? 2850366  '10.1016/0022-2836(88)90213-6' 
6       'Primary Structure of Torpedo Californica Acetylcholinesterase Deduced from its Cdna Sequence' Nature                 319  
407   ? 1986 NATUAS UK 0028-0836 0006 ? 3753747  10.1038/319407A0               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dvir, H.'            1  ? 
primary 'Jiang, H.L.'         2  ? 
primary 'Wong, D.M.'          3  ? 
primary 'Harel, M.'           4  ? 
primary 'Chetrit, M.'         5  ? 
primary 'He, X.C.'            6  ? 
primary 'Jin, G.Y.'           7  ? 
primary 'Yu, G.L.'            8  ? 
primary 'Tang, X.C.'          9  ? 
primary 'Silman, I.'          10 ? 
primary 'Bai, D.L.'           11 ? 
primary 'Sussman, J.L.'       12 ? 
1       'Bucht, G.'           13 ? 
1       'Hjalmarsson, K.'     14 ? 
2       'Axelsen, P.H.'       15 ? 
2       'Harel, M.'           16 ? 
2       'Silman, I.'          17 ? 
2       'Sussman, J.L.'       18 ? 
3       'Harel, M.'           19 ? 
3       'Schalk, I.'          20 ? 
3       'Ehret-Sabatier, L.'  21 ? 
3       'Bouet, F.'           22 ? 
3       'Goeldner, M.'        23 ? 
3       'Hirth, C.'           24 ? 
3       'Axelsen, P.H.'       25 ? 
3       'Silman, I.'          26 ? 
3       'Sussman, J.L.'       27 ? 
4       'Sussman, J.L.'       28 ? 
4       'Harel, M.'           29 ? 
4       'Frolow, F.'          30 ? 
4       'Oefner, C.'          31 ? 
4       'Goldman, A.'         32 ? 
4       'Toker, L.'           33 ? 
4       'Silman, I.'          34 ? 
5       'Sussman, J.L.'       35 ? 
5       'Harel, M.'           36 ? 
5       'Frolow, F.'          37 ? 
5       'Varon, L.'           38 ? 
5       'Toker, L.'           39 ? 
5       'Futerman, A.H.'      40 ? 
5       'Silman, I.'          41 ? 
6       'Schumacher, M.'      42 ? 
6       'Camp, S.'            43 ? 
6       'Maulet, Y.'          44 ? 
6       'Newton, M.'          45 ? 
6       'Macphee-Quigley, K.' 46 ? 
6       'Taylor, S.S.'        47 ? 
6       'Friedmann, T.'       48 ? 
6       'Taylor, P.'          49 ? 
# 
_cell.entry_id           1EA5 
_cell.length_a           111.573 
_cell.length_b           111.573 
_cell.length_c           137.587 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EA5 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                     60736.516 1   3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?       ? ? ? 
3 water       nat water                                    18.015    739 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1EA5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EA5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 35% PEG 200, 100 MM MES, PH 5.8, AT 4 DEG.' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           155.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   1999-06-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9312 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9312 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1EA5 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.800 
_reflns.number_obs                   86444 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06700 
_reflns.pdbx_netI_over_sigmaI        16.4000 
_reflns.B_iso_Wilson_estimate        33.9 
_reflns.pdbx_redundancy              1.900 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   68.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.25100 
_reflns_shell.meanI_over_sigI_obs    2.200 
_reflns_shell.pdbx_redundancy        1.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1EA5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     86179 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1738173.08 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.34 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    93.7 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.205 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4317 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               24.5 
_refine.aniso_B[1][1]                            6.58 
_refine.aniso_B[2][2]                            6.58 
_refine.aniso_B[3][3]                            -13.17 
_refine.aniso_B[1][2]                            2.62 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.367212 
_refine.solvent_model_param_bsol                 82.8547 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;SEVERAL RESIDUES ARE NOT SEEN IN THE CRYSTAL STRUCTURE, DUE TO DISORDER. THESE INCLUDE THREE N- TERMINAL RESIDUES (ASP 1, ASP 2, HIS 3), AND THE C-TERMINAL RESIDUES AFTER THR 535. THERE ARE 2 ALTERNATE CONFORMATIONS OBSERVED FOR RESIDUES: 9, 16, 19, 24, 46, 49, 55, 65, 221, 228, 260, 344, 353, 408, 430, 455, 468, 478, 508, 526.
;
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1EA5 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           8.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.22 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4218 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             739 
_refine_hist.number_atoms_total               4985 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        27.34 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.016 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.9  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.80  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.41  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.26  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.12  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.8 
_refine_ls_shell.d_res_low                        1.91 
_refine_ls_shell.number_reflns_R_work             11185 
_refine_ls_shell.R_factor_R_work                  0.289 
_refine_ls_shell.percent_reflns_obs               77.9 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             597 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PARAM WATER.TOP        
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    CARBOHYDRATE.TOP 
# 
_struct.entry_id                  1EA5 
_struct.title                     'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA at 1.8A resolution' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EA5 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SERINE HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, ALPHA/BETA HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
;THE ENZYME IS A GPI-ANCHORED DIMER, THE                      
 TWO MONOMERS IN THE DIMER ARE RELATED BY                             
 CRYSTALLOGRAPHIC TWO-FOLD SYMMETRY.
;
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 10 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? LYS A 413 ? VAL A 400 LYS A 413 1 ? 14 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 599 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 A NAG 598 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
# 
_database_PDB_matrix.entry_id          1EA5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EA5 
_atom_sites.fract_transf_matrix[1][1]   0.008963 
_atom_sites.fract_transf_matrix[1][2]   0.005175 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010349 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007268 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -13.267 87.421 34.691 1.00 50.42 ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.582 87.920 35.918 1.00 49.36 ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.448 86.988 36.332 1.00 47.23 ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.519 85.775 36.131 1.00 46.71 ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.585 88.045 37.069 1.00 50.97 ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.938 88.423 38.273 1.00 54.47 ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -10.406 87.569 36.915 1.00 45.30 ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -9.245  86.814 37.364 1.00 43.39 ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.591  85.857 38.507 1.00 41.41 ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.900  84.859 38.717 1.00 40.84 ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.146  87.788 37.799 1.00 45.88 ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.888  87.147 38.362 1.00 49.02 ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.785  88.165 38.606 1.00 51.59 ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -6.107  89.296 39.026 1.00 53.86 ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.599  87.834 38.390 1.00 51.82 ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.666 86.154 39.232 1.00 37.76 ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -11.086 85.318 40.352 1.00 36.65 ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -12.086 84.229 39.974 1.00 35.56 ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.534 83.470 40.830 1.00 36.32 ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.681 86.184 41.465 1.00 35.66 ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.718 87.168 42.130 1.00 36.86 ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -11.443 87.920 43.238 1.00 36.83 ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -9.520  86.413 42.699 1.00 36.90 ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.442 84.149 38.698 1.00 35.21 ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.385 83.131 38.251 1.00 35.92 ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.672 82.137 37.344 1.00 35.09 ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.040 82.520 36.359 1.00 34.91 ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.554 83.770 37.497 1.00 37.98 ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.659 82.803 37.059 1.00 42.06 ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.378 82.248 38.284 1.00 43.29 ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.643 83.529 36.151 1.00 45.12 ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.773 80.857 37.682 1.00 33.31 ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.129 79.816 36.896 1.00 32.45 ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.102 78.685 36.608 1.00 31.95 ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.779 78.194 37.510 1.00 32.49 ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.897 79.231 37.638 1.00 33.46 ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.288 78.088 36.829 1.00 31.57 ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.857  80.323 37.871 1.00 32.91 ? 8    VAL A CG2 1 
ATOM   39   N N   A ASN A 1 9   ? -13.185 78.275 35.346 0.50 31.56 ? 9    ASN A N   1 
ATOM   40   N N   B ASN A 1 9   ? -13.155 78.276 35.344 0.50 32.32 ? 9    ASN A N   1 
ATOM   41   C CA  A ASN A 1 9   ? -14.076 77.185 34.980 0.50 32.19 ? 9    ASN A CA  1 
ATOM   42   C CA  B ASN A 1 9   ? -14.029 77.194 34.909 0.50 33.49 ? 9    ASN A CA  1 
ATOM   43   C C   A ASN A 1 9   ? -13.223 75.898 34.877 0.50 32.98 ? 9    ASN A C   1 
ATOM   44   C C   B ASN A 1 9   ? -13.261 75.905 34.875 0.50 32.16 ? 9    ASN A C   1 
ATOM   45   O O   A ASN A 1 9   ? -12.324 75.747 34.050 0.50 34.42 ? 9    ASN A O   1 
ATOM   46   O O   B ASN A 1 9   ? -12.394 75.775 34.010 0.50 33.66 ? 9    ASN A O   1 
ATOM   47   C CB  A ASN A 1 9   ? -14.776 77.476 33.650 0.50 32.12 ? 9    ASN A CB  1 
ATOM   48   C CB  B ASN A 1 9   ? -14.569 77.488 33.505 0.50 34.83 ? 9    ASN A CB  1 
ATOM   49   C CG  A ASN A 1 9   ? -15.854 76.458 33.328 0.50 32.99 ? 9    ASN A CG  1 
ATOM   50   C CG  B ASN A 1 9   ? -15.350 78.788 33.437 0.50 37.78 ? 9    ASN A CG  1 
ATOM   51   O OD1 A ASN A 1 9   ? -16.476 75.890 34.227 0.50 34.19 ? 9    ASN A OD1 1 
ATOM   52   O OD1 B ASN A 1 9   ? -14.881 79.837 33.883 0.50 40.60 ? 9    ASN A OD1 1 
ATOM   53   N ND2 A ASN A 1 9   ? -16.094 76.236 32.043 0.50 34.31 ? 9    ASN A ND2 1 
ATOM   54   N ND2 B ASN A 1 9   ? -16.549 78.727 32.869 0.50 39.69 ? 9    ASN A ND2 1 
ATOM   55   N N   . THR A 1 10  ? -13.535 74.966 35.773 1.00 32.11 ? 10   THR A N   1 
ATOM   56   C CA  . THR A 1 10  ? -12.822 73.694 35.797 1.00 30.52 ? 10   THR A CA  1 
ATOM   57   C C   . THR A 1 10  ? -13.719 72.597 35.239 1.00 32.47 ? 10   THR A C   1 
ATOM   58   O O   . THR A 1 10  ? -14.892 72.830 34.948 1.00 31.11 ? 10   THR A O   1 
ATOM   59   C CB  . THR A 1 10  ? -12.411 73.289 37.230 1.00 28.40 ? 10   THR A CB  1 
ATOM   60   O OG1 . THR A 1 10  ? -13.552 72.777 37.926 1.00 27.98 ? 10   THR A OG1 1 
ATOM   61   C CG2 . THR A 1 10  ? -11.852 74.483 37.993 1.00 28.27 ? 10   THR A CG2 1 
ATOM   62   N N   . LYS A 1 11  ? -13.164 71.398 35.096 1.00 31.35 ? 11   LYS A N   1 
ATOM   63   C CA  . LYS A 1 11  ? -13.928 70.269 34.586 1.00 31.68 ? 11   LYS A CA  1 
ATOM   64   C C   . LYS A 1 11  ? -15.017 69.851 35.575 1.00 32.46 ? 11   LYS A C   1 
ATOM   65   O O   . LYS A 1 11  ? -15.967 69.164 35.204 1.00 34.12 ? 11   LYS A O   1 
ATOM   66   C CB  . LYS A 1 11  ? -12.986 69.092 34.302 1.00 31.78 ? 11   LYS A CB  1 
ATOM   67   C CG  . LYS A 1 11  ? -12.004 69.370 33.164 1.00 31.29 ? 11   LYS A CG  1 
ATOM   68   C CD  . LYS A 1 11  ? -10.876 68.348 33.101 1.00 29.65 ? 11   LYS A CD  1 
ATOM   69   C CE  . LYS A 1 11  ? -9.972  68.625 31.906 1.00 29.91 ? 11   LYS A CE  1 
ATOM   70   N NZ  . LYS A 1 11  ? -8.725  67.814 31.923 1.00 28.37 ? 11   LYS A NZ  1 
ATOM   71   N N   . SER A 1 12  ? -14.885 70.267 36.831 1.00 31.99 ? 12   SER A N   1 
ATOM   72   C CA  . SER A 1 12  ? -15.876 69.919 37.848 1.00 33.89 ? 12   SER A CA  1 
ATOM   73   C C   . SER A 1 12  ? -16.908 71.023 38.064 1.00 33.77 ? 12   SER A C   1 
ATOM   74   O O   . SER A 1 12  ? -17.899 70.824 38.767 1.00 34.33 ? 12   SER A O   1 
ATOM   75   C CB  . SER A 1 12  ? -15.190 69.608 39.183 1.00 35.62 ? 12   SER A CB  1 
ATOM   76   O OG  . SER A 1 12  ? -14.356 68.467 39.070 1.00 40.75 ? 12   SER A OG  1 
ATOM   77   N N   . GLY A 1 13  ? -16.668 72.181 37.456 1.00 33.52 ? 13   GLY A N   1 
ATOM   78   C CA  . GLY A 1 13  ? -17.576 73.305 37.601 1.00 33.39 ? 13   GLY A CA  1 
ATOM   79   C C   . GLY A 1 13  ? -16.810 74.595 37.820 1.00 33.75 ? 13   GLY A C   1 
ATOM   80   O O   . GLY A 1 13  ? -15.582 74.587 37.909 1.00 32.36 ? 13   GLY A O   1 
ATOM   81   N N   . LYS A 1 14  ? -17.533 75.708 37.913 1.00 32.90 ? 14   LYS A N   1 
ATOM   82   C CA  . LYS A 1 14  ? -16.910 77.013 38.112 1.00 33.63 ? 14   LYS A CA  1 
ATOM   83   C C   . LYS A 1 14  ? -16.635 77.285 39.580 1.00 33.06 ? 14   LYS A C   1 
ATOM   84   O O   . LYS A 1 14  ? -17.404 76.878 40.449 1.00 33.49 ? 14   LYS A O   1 
ATOM   85   C CB  . LYS A 1 14  ? -17.810 78.129 37.568 1.00 35.69 ? 14   LYS A CB  1 
ATOM   86   C CG  . LYS A 1 14  ? -18.108 78.022 36.085 1.00 39.55 ? 14   LYS A CG  1 
ATOM   87   C CD  . LYS A 1 14  ? -18.981 79.178 35.616 1.00 41.59 ? 14   LYS A CD  1 
ATOM   88   N N   . VAL A 1 15  ? -15.536 77.982 39.844 1.00 33.00 ? 15   VAL A N   1 
ATOM   89   C CA  . VAL A 1 15  ? -15.161 78.338 41.202 1.00 33.54 ? 15   VAL A CA  1 
ATOM   90   C C   . VAL A 1 15  ? -14.769 79.809 41.239 1.00 33.82 ? 15   VAL A C   1 
ATOM   91   O O   . VAL A 1 15  ? -14.150 80.319 40.308 1.00 33.43 ? 15   VAL A O   1 
ATOM   92   C CB  . VAL A 1 15  ? -13.949 77.510 41.712 1.00 34.25 ? 15   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 15  ? -14.264 76.022 41.655 1.00 35.64 ? 15   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 15  ? -12.714 77.829 40.889 1.00 34.51 ? 15   VAL A CG2 1 
ATOM   95   N N   A MET A 1 16  ? -15.139 80.489 42.318 0.50 34.50 ? 16   MET A N   1 
ATOM   96   N N   B MET A 1 16  ? -15.140 80.485 42.320 0.50 34.46 ? 16   MET A N   1 
ATOM   97   C CA  A MET A 1 16  ? -14.798 81.896 42.475 0.50 35.05 ? 16   MET A CA  1 
ATOM   98   C CA  B MET A 1 16  ? -14.822 81.897 42.496 0.50 35.02 ? 16   MET A CA  1 
ATOM   99   C C   A MET A 1 16  ? -13.867 82.048 43.669 0.50 34.05 ? 16   MET A C   1 
ATOM   100  C C   B MET A 1 16  ? -13.870 82.052 43.678 0.50 34.02 ? 16   MET A C   1 
ATOM   101  O O   A MET A 1 16  ? -14.209 81.696 44.807 0.50 33.90 ? 16   MET A O   1 
ATOM   102  O O   B MET A 1 16  ? -14.217 81.688 44.793 0.50 33.90 ? 16   MET A O   1 
ATOM   103  C CB  A MET A 1 16  ? -16.100 82.703 42.754 0.50 36.33 ? 16   MET A CB  1 
ATOM   104  C CB  B MET A 1 16  ? -16.055 82.741 42.687 0.50 36.63 ? 16   MET A CB  1 
ATOM   105  C CG  A MET A 1 16  ? -15.859 84.186 42.996 0.50 38.62 ? 16   MET A CG  1 
ATOM   106  C CG  B MET A 1 16  ? -15.760 84.223 42.863 0.50 38.69 ? 16   MET A CG  1 
ATOM   107  S SD  A MET A 1 16  ? -17.250 85.222 42.950 0.50 43.27 ? 16   MET A SD  1 
ATOM   108  S SD  B MET A 1 16  ? -15.272 85.055 41.535 0.50 41.67 ? 16   MET A SD  1 
ATOM   109  C CE  A MET A 1 16  ? -17.479 85.606 41.217 0.50 40.46 ? 16   MET A CE  1 
ATOM   110  C CE  B MET A 1 16  ? -16.327 86.492 41.537 0.50 41.74 ? 16   MET A CE  1 
ATOM   111  N N   . GLY A 1 17  ? -12.679 82.581 43.413 1.00 34.29 ? 17   GLY A N   1 
ATOM   112  C CA  . GLY A 1 17  ? -11.707 82.762 44.471 1.00 35.21 ? 17   GLY A CA  1 
ATOM   113  C C   . GLY A 1 17  ? -11.807 84.114 45.146 1.00 36.77 ? 17   GLY A C   1 
ATOM   114  O O   . GLY A 1 17  ? -12.837 84.783 45.082 1.00 36.69 ? 17   GLY A O   1 
ATOM   115  N N   . THR A 1 18  ? -10.727 84.518 45.801 1.00 37.83 ? 18   THR A N   1 
ATOM   116  C CA  . THR A 1 18  ? -10.688 85.794 46.505 1.00 39.16 ? 18   THR A CA  1 
ATOM   117  C C   . THR A 1 18  ? -9.303  86.402 46.398 1.00 39.93 ? 18   THR A C   1 
ATOM   118  O O   . THR A 1 18  ? -8.303  85.682 46.364 1.00 38.97 ? 18   THR A O   1 
ATOM   119  C CB  . THR A 1 18  ? -11.036 85.610 48.000 1.00 40.14 ? 18   THR A CB  1 
ATOM   120  O OG1 . THR A 1 18  ? -10.971 86.872 48.677 1.00 41.06 ? 18   THR A OG1 1 
ATOM   121  C CG2 . THR A 1 18  ? -10.045 84.650 48.658 1.00 39.64 ? 18   THR A CG2 1 
ATOM   122  N N   A ARG A 1 19  ? -9.240  87.725 46.325 0.50 40.39 ? 19   ARG A N   1 
ATOM   123  N N   B ARG A 1 19  ? -9.248  87.731 46.323 0.50 40.12 ? 19   ARG A N   1 
ATOM   124  C CA  A ARG A 1 19  ? -7.962  88.420 46.234 0.50 41.97 ? 19   ARG A CA  1 
ATOM   125  C CA  B ARG A 1 19  ? -7.969  88.422 46.243 0.50 41.49 ? 19   ARG A CA  1 
ATOM   126  C C   A ARG A 1 19  ? -7.422  88.581 47.654 0.50 41.52 ? 19   ARG A C   1 
ATOM   127  C C   B ARG A 1 19  ? -7.426  88.569 47.664 0.50 41.22 ? 19   ARG A C   1 
ATOM   128  O O   A ARG A 1 19  ? -8.130  89.060 48.542 0.50 41.75 ? 19   ARG A O   1 
ATOM   129  O O   B ARG A 1 19  ? -8.129  89.044 48.560 0.50 41.44 ? 19   ARG A O   1 
ATOM   130  C CB  A ARG A 1 19  ? -8.137  89.805 45.608 0.50 43.95 ? 19   ARG A CB  1 
ATOM   131  C CB  B ARG A 1 19  ? -8.142  89.801 45.596 0.50 44.98 ? 19   ARG A CB  1 
ATOM   132  C CG  A ARG A 1 19  ? -6.820  90.492 45.299 0.50 47.78 ? 19   ARG A CG  1 
ATOM   133  C CG  B ARG A 1 19  ? -6.896  90.671 45.618 0.50 49.58 ? 19   ARG A CG  1 
ATOM   134  C CD  A ARG A 1 19  ? -5.850  90.242 44.592 0.50 53.91 ? 19   ARG A CD  1 
ATOM   135  C CD  B ARG A 1 19  ? -7.025  91.942 44.869 0.50 50.80 ? 19   ARG A CD  1 
ATOM   136  N NE  A ARG A 1 19  ? -6.064  90.871 43.291 0.50 57.64 ? 19   ARG A NE  1 
ATOM   137  N NE  B ARG A 1 19  ? -5.766  92.605 44.538 0.50 53.95 ? 19   ARG A NE  1 
ATOM   138  C CZ  A ARG A 1 19  ? -5.093  91.392 42.544 0.50 58.91 ? 19   ARG A CZ  1 
ATOM   139  C CZ  B ARG A 1 19  ? -5.265  92.697 43.308 0.50 55.08 ? 19   ARG A CZ  1 
ATOM   140  N NH1 A ARG A 1 19  ? -3.834  91.364 42.965 0.50 59.54 ? 19   ARG A NH1 1 
ATOM   141  N NH1 B ARG A 1 19  ? -5.922  92.176 42.280 0.50 56.57 ? 19   ARG A NH1 1 
ATOM   142  N NH2 A ARG A 1 19  ? -5.378  91.946 41.373 0.50 60.80 ? 19   ARG A NH2 1 
ATOM   143  N NH2 B ARG A 1 19  ? -4.093  93.289 43.106 0.50 55.84 ? 19   ARG A NH2 1 
ATOM   144  N N   . VAL A 1 20  ? -6.180  88.159 47.867 1.00 40.47 ? 20   VAL A N   1 
ATOM   145  C CA  . VAL A 1 20  ? -5.566  88.250 49.181 1.00 38.96 ? 20   VAL A CA  1 
ATOM   146  C C   . VAL A 1 20  ? -4.305  89.088 49.172 1.00 37.06 ? 20   VAL A C   1 
ATOM   147  O O   . VAL A 1 20  ? -3.520  89.026 48.240 1.00 35.15 ? 20   VAL A O   1 
ATOM   148  C CB  . VAL A 1 20  ? -5.234  86.845 49.741 1.00 39.39 ? 20   VAL A CB  1 
ATOM   149  C CG1 . VAL A 1 20  ? -6.481  86.006 49.840 1.00 40.75 ? 20   VAL A CG1 1 
ATOM   150  C CG2 . VAL A 1 20  ? -4.205  86.167 48.840 1.00 39.82 ? 20   VAL A CG2 1 
ATOM   151  N N   . PRO A 1 21  ? -4.104  89.900 50.222 1.00 37.58 ? 21   PRO A N   1 
ATOM   152  C CA  . PRO A 1 21  ? -2.904  90.735 50.282 1.00 37.60 ? 21   PRO A CA  1 
ATOM   153  C C   . PRO A 1 21  ? -1.695  89.887 50.672 1.00 37.01 ? 21   PRO A C   1 
ATOM   154  O O   . PRO A 1 21  ? -1.824  88.897 51.397 1.00 36.46 ? 21   PRO A O   1 
ATOM   155  C CB  . PRO A 1 21  ? -3.259  91.765 51.353 1.00 37.47 ? 21   PRO A CB  1 
ATOM   156  C CG  . PRO A 1 21  ? -4.090  90.962 52.297 1.00 38.54 ? 21   PRO A CG  1 
ATOM   157  C CD  . PRO A 1 21  ? -4.995  90.181 51.363 1.00 38.62 ? 21   PRO A CD  1 
ATOM   158  N N   . VAL A 1 22  ? -0.524  90.270 50.180 1.00 36.94 ? 22   VAL A N   1 
ATOM   159  C CA  . VAL A 1 22  ? 0.701   89.548 50.486 1.00 36.25 ? 22   VAL A CA  1 
ATOM   160  C C   . VAL A 1 22  ? 1.915   90.433 50.230 1.00 36.47 ? 22   VAL A C   1 
ATOM   161  O O   . VAL A 1 22  ? 2.161   90.863 49.104 1.00 36.23 ? 22   VAL A O   1 
ATOM   162  C CB  . VAL A 1 22  ? 0.809   88.237 49.644 1.00 35.65 ? 22   VAL A CB  1 
ATOM   163  C CG1 . VAL A 1 22  ? 0.611   88.539 48.165 1.00 33.58 ? 22   VAL A CG1 1 
ATOM   164  C CG2 . VAL A 1 22  ? 2.160   87.574 49.877 1.00 34.26 ? 22   VAL A CG2 1 
ATOM   165  N N   . LEU A 1 23  ? 2.654   90.715 51.299 1.00 38.48 ? 23   LEU A N   1 
ATOM   166  C CA  . LEU A 1 23  ? 3.852   91.539 51.229 1.00 40.43 ? 23   LEU A CA  1 
ATOM   167  C C   . LEU A 1 23  ? 3.676   92.809 50.382 1.00 41.90 ? 23   LEU A C   1 
ATOM   168  O O   . LEU A 1 23  ? 4.417   93.043 49.429 1.00 42.67 ? 23   LEU A O   1 
ATOM   169  C CB  . LEU A 1 23  ? 5.014   90.699 50.695 1.00 40.20 ? 23   LEU A CB  1 
ATOM   170  C CG  . LEU A 1 23  ? 5.281   89.419 51.498 1.00 40.47 ? 23   LEU A CG  1 
ATOM   171  C CD1 . LEU A 1 23  ? 6.366   88.599 50.816 1.00 39.52 ? 23   LEU A CD1 1 
ATOM   172  C CD2 . LEU A 1 23  ? 5.684   89.777 52.926 1.00 41.36 ? 23   LEU A CD2 1 
ATOM   173  N N   A SER A 1 24  ? 2.682   93.614 50.744 0.50 42.49 ? 24   SER A N   1 
ATOM   174  N N   B SER A 1 24  ? 2.683   93.615 50.746 0.50 42.58 ? 24   SER A N   1 
ATOM   175  C CA  A SER A 1 24  ? 2.375   94.871 50.063 0.50 43.39 ? 24   SER A CA  1 
ATOM   176  C CA  B SER A 1 24  ? 2.397   94.868 50.052 0.50 43.21 ? 24   SER A CA  1 
ATOM   177  C C   A SER A 1 24  ? 1.906   94.699 48.616 0.50 43.53 ? 24   SER A C   1 
ATOM   178  C C   B SER A 1 24  ? 1.879   94.706 48.627 0.50 43.64 ? 24   SER A C   1 
ATOM   179  O O   A SER A 1 24  ? 1.887   95.660 47.847 0.50 43.75 ? 24   SER A O   1 
ATOM   180  O O   B SER A 1 24  ? 1.941   95.644 47.827 0.50 43.66 ? 24   SER A O   1 
ATOM   181  C CB  A SER A 1 24  ? 3.590   95.805 50.074 0.50 43.71 ? 24   SER A CB  1 
ATOM   182  C CB  B SER A 1 24  ? 3.635   95.768 50.066 0.50 43.41 ? 24   SER A CB  1 
ATOM   183  O OG  A SER A 1 24  ? 4.016   96.077 51.395 0.50 43.66 ? 24   SER A OG  1 
ATOM   184  O OG  B SER A 1 24  ? 4.589   95.372 49.168 0.50 44.48 ? 24   SER A OG  1 
ATOM   185  N N   . SER A 1 25  ? 1.449   93.498 48.279 1.00 42.90 ? 25   SER A N   1 
ATOM   186  C CA  . SER A 1 25  ? 0.935   93.228 46.942 1.00 41.47 ? 25   SER A CA  1 
ATOM   187  C C   . SER A 1 25  ? -0.290  92.334 47.107 1.00 40.38 ? 25   SER A C   1 
ATOM   188  O O   . SER A 1 25  ? -0.856  92.260 48.197 1.00 38.40 ? 25   SER A O   1 
ATOM   189  C CB  . SER A 1 25  ? 1.993   92.537 46.077 1.00 41.66 ? 25   SER A CB  1 
ATOM   190  O OG  . SER A 1 25  ? 1.544   92.397 44.736 1.00 43.35 ? 25   SER A OG  1 
ATOM   191  N N   . HIS A 1 26  ? -0.708  91.669 46.036 1.00 40.80 ? 26   HIS A N   1 
ATOM   192  C CA  . HIS A 1 26  ? -1.869  90.786 46.105 1.00 41.69 ? 26   HIS A CA  1 
ATOM   193  C C   . HIS A 1 26  ? -1.764  89.615 45.130 1.00 40.89 ? 26   HIS A C   1 
ATOM   194  O O   . HIS A 1 26  ? -1.044  89.681 44.135 1.00 40.79 ? 26   HIS A O   1 
ATOM   195  C CB  . HIS A 1 26  ? -3.162  91.549 45.783 1.00 45.65 ? 26   HIS A CB  1 
ATOM   196  C CG  . HIS A 1 26  ? -3.415  92.740 46.656 1.00 49.70 ? 26   HIS A CG  1 
ATOM   197  N ND1 . HIS A 1 26  ? -2.690  93.906 46.557 1.00 50.90 ? 26   HIS A ND1 1 
ATOM   198  C CD2 . HIS A 1 26  ? -4.342  92.954 47.622 1.00 51.04 ? 26   HIS A CD2 1 
ATOM   199  C CE1 . HIS A 1 26  ? -3.159  94.790 47.423 1.00 51.77 ? 26   HIS A CE1 1 
ATOM   200  N NE2 . HIS A 1 26  ? -4.161  94.237 48.081 1.00 51.46 ? 26   HIS A NE2 1 
ATOM   201  N N   . ILE A 1 27  ? -2.492  88.544 45.431 1.00 39.61 ? 27   ILE A N   1 
ATOM   202  C CA  . ILE A 1 27  ? -2.540  87.367 44.570 1.00 38.12 ? 27   ILE A CA  1 
ATOM   203  C C   . ILE A 1 27  ? -3.924  86.758 44.726 1.00 36.61 ? 27   ILE A C   1 
ATOM   204  O O   . ILE A 1 27  ? -4.710  87.199 45.568 1.00 35.98 ? 27   ILE A O   1 
ATOM   205  C CB  . ILE A 1 27  ? -1.487  86.295 44.942 1.00 38.77 ? 27   ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 27  ? -1.739  85.772 46.354 1.00 38.60 ? 27   ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 27  ? -0.084  86.870 44.801 1.00 39.62 ? 27   ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 27  ? -0.852  84.603 46.732 1.00 43.66 ? 27   ILE A CD1 1 
ATOM   209  N N   . SER A 1 28  ? -4.222  85.745 43.922 1.00 32.89 ? 28   SER A N   1 
ATOM   210  C CA  . SER A 1 28  ? -5.522  85.102 43.988 1.00 32.04 ? 28   SER A CA  1 
ATOM   211  C C   . SER A 1 28  ? -5.452  83.832 44.819 1.00 32.06 ? 28   SER A C   1 
ATOM   212  O O   . SER A 1 28  ? -4.446  83.121 44.800 1.00 32.34 ? 28   SER A O   1 
ATOM   213  C CB  . SER A 1 28  ? -6.013  84.758 42.581 1.00 32.64 ? 28   SER A CB  1 
ATOM   214  O OG  . SER A 1 28  ? -6.028  85.907 41.751 1.00 33.60 ? 28   SER A OG  1 
ATOM   215  N N   . ALA A 1 29  ? -6.524  83.557 45.550 1.00 30.75 ? 29   ALA A N   1 
ATOM   216  C CA  . ALA A 1 29  ? -6.599  82.358 46.367 1.00 31.86 ? 29   ALA A CA  1 
ATOM   217  C C   . ALA A 1 29  ? -7.943  81.689 46.143 1.00 31.78 ? 29   ALA A C   1 
ATOM   218  O O   . ALA A 1 29  ? -8.983  82.348 46.126 1.00 32.57 ? 29   ALA A O   1 
ATOM   219  C CB  . ALA A 1 29  ? -6.431  82.707 47.841 1.00 30.83 ? 29   ALA A CB  1 
ATOM   220  N N   . PHE A 1 30  ? -7.914  80.377 45.948 1.00 30.58 ? 30   PHE A N   1 
ATOM   221  C CA  . PHE A 1 30  ? -9.134  79.608 45.756 1.00 29.66 ? 30   PHE A CA  1 
ATOM   222  C C   . PHE A 1 30  ? -9.091  78.576 46.865 1.00 30.12 ? 30   PHE A C   1 
ATOM   223  O O   . PHE A 1 30  ? -8.397  77.561 46.767 1.00 29.37 ? 30   PHE A O   1 
ATOM   224  C CB  . PHE A 1 30  ? -9.142  78.948 44.378 1.00 29.43 ? 30   PHE A CB  1 
ATOM   225  C CG  . PHE A 1 30  ? -9.057  79.932 43.238 1.00 31.40 ? 30   PHE A CG  1 
ATOM   226  C CD1 . PHE A 1 30  ? -7.834  80.482 42.863 1.00 31.08 ? 30   PHE A CD1 1 
ATOM   227  C CD2 . PHE A 1 30  ? -10.208 80.323 42.552 1.00 30.76 ? 30   PHE A CD2 1 
ATOM   228  C CE1 . PHE A 1 30  ? -7.756  81.407 41.819 1.00 31.17 ? 30   PHE A CE1 1 
ATOM   229  C CE2 . PHE A 1 30  ? -10.143 81.247 41.509 1.00 27.72 ? 30   PHE A CE2 1 
ATOM   230  C CZ  . PHE A 1 30  ? -8.914  81.791 41.139 1.00 30.37 ? 30   PHE A CZ  1 
ATOM   231  N N   . LEU A 1 31  ? -9.833  78.858 47.929 1.00 30.07 ? 31   LEU A N   1 
ATOM   232  C CA  . LEU A 1 31  ? -9.847  78.006 49.103 1.00 30.16 ? 31   LEU A CA  1 
ATOM   233  C C   . LEU A 1 31  ? -11.067 77.111 49.232 1.00 29.84 ? 31   LEU A C   1 
ATOM   234  O O   . LEU A 1 31  ? -12.185 77.504 48.891 1.00 30.10 ? 31   LEU A O   1 
ATOM   235  C CB  . LEU A 1 31  ? -9.730  78.887 50.350 1.00 29.44 ? 31   LEU A CB  1 
ATOM   236  C CG  . LEU A 1 31  ? -8.725  80.040 50.245 1.00 30.86 ? 31   LEU A CG  1 
ATOM   237  C CD1 . LEU A 1 31  ? -8.775  80.878 51.518 1.00 31.18 ? 31   LEU A CD1 1 
ATOM   238  C CD2 . LEU A 1 31  ? -7.318  79.492 50.013 1.00 30.01 ? 31   LEU A CD2 1 
ATOM   239  N N   . GLY A 1 32  ? -10.839 75.899 49.727 1.00 28.38 ? 32   GLY A N   1 
ATOM   240  C CA  . GLY A 1 32  ? -11.931 74.968 49.940 1.00 27.43 ? 32   GLY A CA  1 
ATOM   241  C C   . GLY A 1 32  ? -12.588 74.363 48.716 1.00 27.88 ? 32   GLY A C   1 
ATOM   242  O O   . GLY A 1 32  ? -13.805 74.194 48.691 1.00 29.14 ? 32   GLY A O   1 
ATOM   243  N N   . ILE A 1 33  ? -11.799 74.037 47.699 1.00 28.64 ? 33   ILE A N   1 
ATOM   244  C CA  . ILE A 1 33  ? -12.340 73.412 46.496 1.00 28.54 ? 33   ILE A CA  1 
ATOM   245  C C   . ILE A 1 33  ? -12.477 71.914 46.769 1.00 29.38 ? 33   ILE A C   1 
ATOM   246  O O   . ILE A 1 33  ? -11.505 71.256 47.131 1.00 28.45 ? 33   ILE A O   1 
ATOM   247  C CB  . ILE A 1 33  ? -11.402 73.599 45.291 1.00 29.42 ? 33   ILE A CB  1 
ATOM   248  C CG1 . ILE A 1 33  ? -11.261 75.088 44.964 1.00 29.33 ? 33   ILE A CG1 1 
ATOM   249  C CG2 . ILE A 1 33  ? -11.949 72.825 44.090 1.00 28.79 ? 33   ILE A CG2 1 
ATOM   250  C CD1 . ILE A 1 33  ? -10.269 75.379 43.857 1.00 29.03 ? 33   ILE A CD1 1 
ATOM   251  N N   . PRO A 1 34  ? -13.684 71.355 46.590 1.00 28.83 ? 34   PRO A N   1 
ATOM   252  C CA  . PRO A 1 34  ? -13.913 69.928 46.829 1.00 29.15 ? 34   PRO A CA  1 
ATOM   253  C C   . PRO A 1 34  ? -13.340 69.056 45.715 1.00 29.99 ? 34   PRO A C   1 
ATOM   254  O O   . PRO A 1 34  ? -13.506 69.366 44.538 1.00 30.16 ? 34   PRO A O   1 
ATOM   255  C CB  . PRO A 1 34  ? -15.431 69.841 46.891 1.00 30.73 ? 34   PRO A CB  1 
ATOM   256  C CG  . PRO A 1 34  ? -15.836 70.839 45.836 1.00 29.11 ? 34   PRO A CG  1 
ATOM   257  C CD  . PRO A 1 34  ? -14.922 72.018 46.137 1.00 29.33 ? 34   PRO A CD  1 
ATOM   258  N N   . PHE A 1 35  ? -12.654 67.975 46.076 1.00 29.10 ? 35   PHE A N   1 
ATOM   259  C CA  . PHE A 1 35  ? -12.099 67.088 45.058 1.00 29.56 ? 35   PHE A CA  1 
ATOM   260  C C   . PHE A 1 35  ? -12.669 65.682 45.185 1.00 29.18 ? 35   PHE A C   1 
ATOM   261  O O   . PHE A 1 35  ? -12.421 64.822 44.343 1.00 32.07 ? 35   PHE A O   1 
ATOM   262  C CB  . PHE A 1 35  ? -10.562 67.072 45.115 1.00 29.58 ? 35   PHE A CB  1 
ATOM   263  C CG  . PHE A 1 35  ? -9.994  66.554 46.407 1.00 27.56 ? 35   PHE A CG  1 
ATOM   264  C CD1 . PHE A 1 35  ? -9.927  65.188 46.652 1.00 28.21 ? 35   PHE A CD1 1 
ATOM   265  C CD2 . PHE A 1 35  ? -9.507  67.435 47.370 1.00 28.00 ? 35   PHE A CD2 1 
ATOM   266  C CE1 . PHE A 1 35  ? -9.381  64.700 47.843 1.00 29.35 ? 35   PHE A CE1 1 
ATOM   267  C CE2 . PHE A 1 35  ? -8.959  66.959 48.564 1.00 27.91 ? 35   PHE A CE2 1 
ATOM   268  C CZ  . PHE A 1 35  ? -8.896  65.586 48.799 1.00 27.50 ? 35   PHE A CZ  1 
ATOM   269  N N   . ALA A 1 36  ? -13.453 65.458 46.233 1.00 29.47 ? 36   ALA A N   1 
ATOM   270  C CA  . ALA A 1 36  ? -14.080 64.161 46.456 1.00 29.66 ? 36   ALA A CA  1 
ATOM   271  C C   . ALA A 1 36  ? -15.436 64.352 47.110 1.00 31.42 ? 36   ALA A C   1 
ATOM   272  O O   . ALA A 1 36  ? -15.735 65.421 47.639 1.00 30.71 ? 36   ALA A O   1 
ATOM   273  C CB  . ALA A 1 36  ? -13.200 63.290 47.356 1.00 29.13 ? 36   ALA A CB  1 
ATOM   274  N N   . GLU A 1 37  ? -16.262 63.314 47.057 1.00 31.74 ? 37   GLU A N   1 
ATOM   275  C CA  . GLU A 1 37  ? -17.564 63.356 47.703 1.00 33.55 ? 37   GLU A CA  1 
ATOM   276  C C   . GLU A 1 37  ? -17.280 63.192 49.197 1.00 34.20 ? 37   GLU A C   1 
ATOM   277  O O   . GLU A 1 37  ? -16.352 62.473 49.575 1.00 33.99 ? 37   GLU A O   1 
ATOM   278  C CB  . GLU A 1 37  ? -18.438 62.195 47.219 1.00 34.08 ? 37   GLU A CB  1 
ATOM   279  C CG  . GLU A 1 37  ? -19.046 62.396 45.838 1.00 37.84 ? 37   GLU A CG  1 
ATOM   280  C CD  . GLU A 1 37  ? -20.046 63.535 45.815 1.00 38.22 ? 37   GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 37  ? -20.975 63.520 46.650 1.00 41.72 ? 37   GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 37  ? -19.909 64.443 44.970 1.00 39.41 ? 37   GLU A OE2 1 
ATOM   283  N N   . PRO A 1 38  ? -18.051 63.870 50.062 1.00 34.12 ? 38   PRO A N   1 
ATOM   284  C CA  . PRO A 1 38  ? -17.837 63.753 51.508 1.00 35.16 ? 38   PRO A CA  1 
ATOM   285  C C   . PRO A 1 38  ? -17.866 62.282 51.924 1.00 35.52 ? 38   PRO A C   1 
ATOM   286  O O   . PRO A 1 38  ? -18.863 61.592 51.717 1.00 34.38 ? 38   PRO A O   1 
ATOM   287  C CB  . PRO A 1 38  ? -19.006 64.540 52.089 1.00 35.06 ? 38   PRO A CB  1 
ATOM   288  C CG  . PRO A 1 38  ? -19.205 65.615 51.073 1.00 34.59 ? 38   PRO A CG  1 
ATOM   289  C CD  . PRO A 1 38  ? -19.110 64.852 49.770 1.00 34.63 ? 38   PRO A CD  1 
ATOM   290  N N   . PRO A 1 39  ? -16.767 61.782 52.514 1.00 35.49 ? 39   PRO A N   1 
ATOM   291  C CA  . PRO A 1 39  ? -16.689 60.383 52.947 1.00 35.36 ? 39   PRO A CA  1 
ATOM   292  C C   . PRO A 1 39  ? -17.415 60.174 54.267 1.00 37.07 ? 39   PRO A C   1 
ATOM   293  O O   . PRO A 1 39  ? -16.811 59.798 55.273 1.00 36.50 ? 39   PRO A O   1 
ATOM   294  C CB  . PRO A 1 39  ? -15.188 60.154 53.062 1.00 36.56 ? 39   PRO A CB  1 
ATOM   295  C CG  . PRO A 1 39  ? -14.716 61.469 53.590 1.00 34.39 ? 39   PRO A CG  1 
ATOM   296  C CD  . PRO A 1 39  ? -15.483 62.472 52.742 1.00 36.12 ? 39   PRO A CD  1 
ATOM   297  N N   . VAL A 1 40  ? -18.719 60.413 54.250 1.00 35.98 ? 40   VAL A N   1 
ATOM   298  C CA  . VAL A 1 40  ? -19.524 60.297 55.450 1.00 37.69 ? 40   VAL A CA  1 
ATOM   299  C C   . VAL A 1 40  ? -20.506 59.128 55.449 1.00 37.98 ? 40   VAL A C   1 
ATOM   300  O O   . VAL A 1 40  ? -20.774 58.514 54.415 1.00 38.78 ? 40   VAL A O   1 
ATOM   301  C CB  . VAL A 1 40  ? -20.293 61.612 55.695 1.00 37.59 ? 40   VAL A CB  1 
ATOM   302  C CG1 . VAL A 1 40  ? -19.307 62.751 55.910 1.00 38.75 ? 40   VAL A CG1 1 
ATOM   303  C CG2 . VAL A 1 40  ? -21.179 61.928 54.491 1.00 38.96 ? 40   VAL A CG2 1 
ATOM   304  N N   . GLY A 1 41  ? -21.024 58.827 56.634 1.00 38.26 ? 41   GLY A N   1 
ATOM   305  C CA  . GLY A 1 41  ? -21.978 57.747 56.790 1.00 37.54 ? 41   GLY A CA  1 
ATOM   306  C C   . GLY A 1 41  ? -21.472 56.396 56.325 1.00 38.08 ? 41   GLY A C   1 
ATOM   307  O O   . GLY A 1 41  ? -20.510 55.851 56.884 1.00 36.81 ? 41   GLY A O   1 
ATOM   308  N N   . ASN A 1 42  ? -22.134 55.856 55.305 1.00 36.79 ? 42   ASN A N   1 
ATOM   309  C CA  . ASN A 1 42  ? -21.798 54.564 54.725 1.00 36.28 ? 42   ASN A CA  1 
ATOM   310  C C   . ASN A 1 42  ? -20.414 54.606 54.052 1.00 36.15 ? 42   ASN A C   1 
ATOM   311  O O   . ASN A 1 42  ? -19.797 53.569 53.832 1.00 36.82 ? 42   ASN A O   1 
ATOM   312  C CB  . ASN A 1 42  ? -22.881 54.184 53.701 1.00 38.58 ? 42   ASN A CB  1 
ATOM   313  N N   . MET A 1 43  ? -19.935 55.808 53.738 1.00 34.81 ? 43   MET A N   1 
ATOM   314  C CA  . MET A 1 43  ? -18.636 55.974 53.103 1.00 34.54 ? 43   MET A CA  1 
ATOM   315  C C   . MET A 1 43  ? -17.438 56.003 54.065 1.00 32.89 ? 43   MET A C   1 
ATOM   316  O O   . MET A 1 43  ? -16.289 55.966 53.622 1.00 34.23 ? 43   MET A O   1 
ATOM   317  C CB  . MET A 1 43  ? -18.638 57.242 52.250 1.00 37.18 ? 43   MET A CB  1 
ATOM   318  C CG  . MET A 1 43  ? -19.558 57.133 51.049 1.00 40.92 ? 43   MET A CG  1 
ATOM   319  S SD  . MET A 1 43  ? -19.543 58.606 50.037 1.00 45.08 ? 43   MET A SD  1 
ATOM   320  C CE  . MET A 1 43  ? -17.967 58.469 49.284 1.00 41.56 ? 43   MET A CE  1 
ATOM   321  N N   . ARG A 1 44  ? -17.683 56.070 55.371 1.00 31.42 ? 44   ARG A N   1 
ATOM   322  C CA  . ARG A 1 44  ? -16.571 56.093 56.324 1.00 30.69 ? 44   ARG A CA  1 
ATOM   323  C C   . ARG A 1 44  ? -15.727 54.829 56.139 1.00 30.17 ? 44   ARG A C   1 
ATOM   324  O O   . ARG A 1 44  ? -16.261 53.716 56.064 1.00 30.63 ? 44   ARG A O   1 
ATOM   325  C CB  . ARG A 1 44  ? -17.084 56.180 57.769 1.00 29.57 ? 44   ARG A CB  1 
ATOM   326  C CG  . ARG A 1 44  ? -15.971 56.285 58.803 1.00 27.76 ? 44   ARG A CG  1 
ATOM   327  C CD  . ARG A 1 44  ? -16.493 56.203 60.238 1.00 28.74 ? 44   ARG A CD  1 
ATOM   328  N NE  . ARG A 1 44  ? -17.185 57.415 60.678 1.00 28.13 ? 44   ARG A NE  1 
ATOM   329  C CZ  . ARG A 1 44  ? -17.821 57.525 61.841 1.00 28.84 ? 44   ARG A CZ  1 
ATOM   330  N NH1 . ARG A 1 44  ? -17.859 56.495 62.677 1.00 29.11 ? 44   ARG A NH1 1 
ATOM   331  N NH2 . ARG A 1 44  ? -18.405 58.666 62.181 1.00 27.44 ? 44   ARG A NH2 1 
ATOM   332  N N   . PHE A 1 45  ? -14.413 55.023 56.045 1.00 28.68 ? 45   PHE A N   1 
ATOM   333  C CA  . PHE A 1 45  ? -13.434 53.951 55.854 1.00 27.81 ? 45   PHE A CA  1 
ATOM   334  C C   . PHE A 1 45  ? -13.304 53.513 54.396 1.00 27.46 ? 45   PHE A C   1 
ATOM   335  O O   . PHE A 1 45  ? -12.353 52.815 54.049 1.00 26.79 ? 45   PHE A O   1 
ATOM   336  C CB  . PHE A 1 45  ? -13.768 52.725 56.714 1.00 28.48 ? 45   PHE A CB  1 
ATOM   337  C CG  . PHE A 1 45  ? -13.936 53.028 58.181 1.00 27.85 ? 45   PHE A CG  1 
ATOM   338  C CD1 . PHE A 1 45  ? -12.965 53.743 58.881 1.00 27.59 ? 45   PHE A CD1 1 
ATOM   339  C CD2 . PHE A 1 45  ? -15.065 52.586 58.865 1.00 27.91 ? 45   PHE A CD2 1 
ATOM   340  C CE1 . PHE A 1 45  ? -13.122 54.011 60.245 1.00 27.95 ? 45   PHE A CE1 1 
ATOM   341  C CE2 . PHE A 1 45  ? -15.232 52.848 60.227 1.00 29.93 ? 45   PHE A CE2 1 
ATOM   342  C CZ  . PHE A 1 45  ? -14.259 53.562 60.916 1.00 30.67 ? 45   PHE A CZ  1 
ATOM   343  N N   . ARG A 1 46  ? -14.247 53.921 53.548 1.00 26.44 ? 46   ARG A N   1 
ATOM   344  C CA  A ARG A 1 46  ? -14.206 53.531 52.129 0.50 31.94 ? 46   ARG A CA  1 
ATOM   345  C CA  B ARG A 1 46  ? -14.228 53.552 52.132 0.50 29.56 ? 46   ARG A CA  1 
ATOM   346  C C   A ARG A 1 46  ? -13.265 54.383 51.289 0.50 31.38 ? 46   ARG A C   1 
ATOM   347  C C   B ARG A 1 46  ? -13.285 54.398 51.279 0.50 29.60 ? 46   ARG A C   1 
ATOM   348  O O   A ARG A 1 46  ? -12.953 55.528 51.637 0.50 28.86 ? 46   ARG A O   1 
ATOM   349  O O   B ARG A 1 46  ? -12.919 55.503 51.664 0.50 30.40 ? 46   ARG A O   1 
ATOM   350  C CB  A ARG A 1 46  ? -15.591 53.550 51.472 0.50 35.60 ? 46   ARG A CB  1 
ATOM   351  C CB  B ARG A 1 46  ? -15.643 53.646 51.544 0.50 32.23 ? 46   ARG A CB  1 
ATOM   352  C CG  A ARG A 1 46  ? -16.549 52.476 51.952 0.50 38.52 ? 46   ARG A CG  1 
ATOM   353  C CG  B ARG A 1 46  ? -16.486 52.391 51.705 0.50 36.18 ? 46   ARG A CG  1 
ATOM   354  C CD  A ARG A 1 46  ? -17.861 52.541 51.176 0.50 41.92 ? 46   ARG A CD  1 
ATOM   355  C CD  B ARG A 1 46  ? -17.945 52.661 51.350 0.50 39.84 ? 46   ARG A CD  1 
ATOM   356  N NE  A ARG A 1 46  ? -18.707 51.425 51.187 0.50 43.17 ? 46   ARG A NE  1 
ATOM   357  N NE  B ARG A 1 46  ? -17.971 51.504 50.151 0.50 45.08 ? 46   ARG A NE  1 
ATOM   358  C CZ  A ARG A 1 46  ? -20.031 51.341 51.275 0.50 44.40 ? 46   ARG A CZ  1 
ATOM   359  C CZ  B ARG A 1 46  ? -17.141 51.358 49.123 0.50 46.58 ? 46   ARG A CZ  1 
ATOM   360  N NH1 A ARG A 1 46  ? -20.753 52.423 51.533 0.50 45.02 ? 46   ARG A NH1 1 
ATOM   361  N NH1 B ARG A 1 46  ? -16.117 52.185 48.961 0.50 47.99 ? 46   ARG A NH1 1 
ATOM   362  N NH2 A ARG A 1 46  ? -20.637 50.175 51.099 0.50 45.94 ? 46   ARG A NH2 1 
ATOM   363  N NH2 B ARG A 1 46  ? -17.336 50.377 48.251 0.50 46.56 ? 46   ARG A NH2 1 
ATOM   364  N N   . ARG A 1 47  ? -12.860 53.844 50.145 1.00 29.74 ? 47   ARG A N   1 
ATOM   365  C CA  . ARG A 1 47  ? -11.984 54.566 49.234 1.00 30.67 ? 47   ARG A CA  1 
ATOM   366  C C   . ARG A 1 47  ? -12.785 55.798 48.809 1.00 29.71 ? 47   ARG A C   1 
ATOM   367  O O   . ARG A 1 47  ? -14.018 55.759 48.750 1.00 28.61 ? 47   ARG A O   1 
ATOM   368  C CB  . ARG A 1 47  ? -11.646 53.712 48.010 1.00 33.69 ? 47   ARG A CB  1 
ATOM   369  C CG  . ARG A 1 47  ? -10.921 52.414 48.331 1.00 38.70 ? 47   ARG A CG  1 
ATOM   370  C CD  . ARG A 1 47  ? -10.353 51.792 47.058 1.00 43.61 ? 47   ARG A CD  1 
ATOM   371  N NE  . ARG A 1 47  ? -9.661  50.525 47.300 1.00 47.11 ? 47   ARG A NE  1 
ATOM   372  C CZ  . ARG A 1 47  ? -10.271 49.376 47.581 1.00 49.27 ? 47   ARG A CZ  1 
ATOM   373  N NH1 . ARG A 1 47  ? -11.596 49.320 47.661 1.00 47.72 ? 47   ARG A NH1 1 
ATOM   374  N NH2 . ARG A 1 47  ? -9.554  48.277 47.776 1.00 50.29 ? 47   ARG A NH2 1 
ATOM   375  N N   . PRO A 1 48  ? -12.102 56.907 48.501 1.00 27.94 ? 48   PRO A N   1 
ATOM   376  C CA  . PRO A 1 48  ? -12.836 58.106 48.099 1.00 28.53 ? 48   PRO A CA  1 
ATOM   377  C C   . PRO A 1 48  ? -13.479 58.023 46.721 1.00 30.33 ? 48   PRO A C   1 
ATOM   378  O O   . PRO A 1 48  ? -13.039 57.261 45.862 1.00 28.24 ? 48   PRO A O   1 
ATOM   379  C CB  . PRO A 1 48  ? -11.765 59.191 48.156 1.00 28.07 ? 48   PRO A CB  1 
ATOM   380  C CG  . PRO A 1 48  ? -10.547 58.456 47.675 1.00 27.32 ? 48   PRO A CG  1 
ATOM   381  C CD  . PRO A 1 48  ? -10.644 57.125 48.420 1.00 27.27 ? 48   PRO A CD  1 
ATOM   382  N N   A GLU A 1 49  ? -14.532 58.809 46.524 0.50 31.47 ? 49   GLU A N   1 
ATOM   383  N N   B GLU A 1 49  ? -14.531 58.811 46.526 0.50 31.38 ? 49   GLU A N   1 
ATOM   384  C CA  A GLU A 1 49  ? -15.224 58.861 45.241 0.50 33.94 ? 49   GLU A CA  1 
ATOM   385  C CA  B GLU A 1 49  ? -15.234 58.870 45.249 0.50 33.80 ? 49   GLU A CA  1 
ATOM   386  C C   A GLU A 1 49  ? -15.078 60.284 44.718 0.50 33.53 ? 49   GLU A C   1 
ATOM   387  C C   B GLU A 1 49  ? -15.086 60.290 44.718 0.50 33.44 ? 49   GLU A C   1 
ATOM   388  O O   A GLU A 1 49  ? -15.193 61.253 45.475 0.50 33.30 ? 49   GLU A O   1 
ATOM   389  O O   B GLU A 1 49  ? -15.181 61.242 45.481 0.50 33.36 ? 49   GLU A O   1 
ATOM   390  C CB  A GLU A 1 49  ? -16.722 58.549 45.427 0.50 35.34 ? 49   GLU A CB  1 
ATOM   391  C CB  B GLU A 1 49  ? -16.712 58.528 45.396 0.50 35.67 ? 49   GLU A CB  1 
ATOM   392  C CG  A GLU A 1 49  ? -16.998 57.180 46.035 0.50 38.85 ? 49   GLU A CG  1 
ATOM   393  C CG  B GLU A 1 49  ? -17.034 57.105 45.794 0.50 38.29 ? 49   GLU A CG  1 
ATOM   394  C CD  A GLU A 1 49  ? -18.420 56.712 45.786 0.50 41.67 ? 49   GLU A CD  1 
ATOM   395  C CD  B GLU A 1 49  ? -16.495 56.111 44.782 0.50 40.79 ? 49   GLU A CD  1 
ATOM   396  O OE1 A GLU A 1 49  ? -19.359 57.513 45.986 0.50 43.00 ? 49   GLU A OE1 1 
ATOM   397  O OE1 B GLU A 1 49  ? -16.510 56.421 43.571 0.50 42.41 ? 49   GLU A OE1 1 
ATOM   398  O OE2 A GLU A 1 49  ? -18.599 55.540 45.392 0.50 43.57 ? 49   GLU A OE2 1 
ATOM   399  O OE2 B GLU A 1 49  ? -16.066 55.013 45.195 0.50 42.73 ? 49   GLU A OE2 1 
ATOM   400  N N   . PRO A 1 50  ? -14.839 60.439 43.409 1.00 33.78 ? 50   PRO A N   1 
ATOM   401  C CA  . PRO A 1 50  ? -14.684 61.773 42.825 1.00 34.05 ? 50   PRO A CA  1 
ATOM   402  C C   . PRO A 1 50  ? -15.895 62.672 43.074 1.00 34.37 ? 50   PRO A C   1 
ATOM   403  O O   . PRO A 1 50  ? -17.035 62.209 43.096 1.00 34.53 ? 50   PRO A O   1 
ATOM   404  C CB  . PRO A 1 50  ? -14.452 61.475 41.343 1.00 34.87 ? 50   PRO A CB  1 
ATOM   405  C CG  . PRO A 1 50  ? -15.180 60.186 41.132 1.00 35.96 ? 50   PRO A CG  1 
ATOM   406  C CD  . PRO A 1 50  ? -14.816 59.399 42.366 1.00 34.74 ? 50   PRO A CD  1 
ATOM   407  N N   . LYS A 1 51  ? -15.638 63.960 43.277 1.00 34.03 ? 51   LYS A N   1 
ATOM   408  C CA  . LYS A 1 51  ? -16.704 64.925 43.519 1.00 35.29 ? 51   LYS A CA  1 
ATOM   409  C C   . LYS A 1 51  ? -17.564 65.057 42.265 1.00 35.78 ? 51   LYS A C   1 
ATOM   410  O O   . LYS A 1 51  ? -17.047 65.246 41.167 1.00 34.15 ? 51   LYS A O   1 
ATOM   411  C CB  . LYS A 1 51  ? -16.106 66.290 43.874 1.00 35.30 ? 51   LYS A CB  1 
ATOM   412  C CG  . LYS A 1 51  ? -17.126 67.412 44.055 1.00 34.95 ? 51   LYS A CG  1 
ATOM   413  C CD  . LYS A 1 51  ? -17.984 67.210 45.295 1.00 35.54 ? 51   LYS A CD  1 
ATOM   414  C CE  . LYS A 1 51  ? -18.926 68.390 45.499 1.00 34.73 ? 51   LYS A CE  1 
ATOM   415  N NZ  . LYS A 1 51  ? -19.743 68.252 46.741 1.00 37.00 ? 51   LYS A NZ  1 
ATOM   416  N N   . LYS A 1 52  ? -18.878 64.944 42.428 1.00 36.50 ? 52   LYS A N   1 
ATOM   417  C CA  . LYS A 1 52  ? -19.786 65.073 41.292 1.00 38.02 ? 52   LYS A CA  1 
ATOM   418  C C   . LYS A 1 52  ? -19.766 66.525 40.828 1.00 37.56 ? 52   LYS A C   1 
ATOM   419  O O   . LYS A 1 52  ? -19.825 67.441 41.649 1.00 36.68 ? 52   LYS A O   1 
ATOM   420  C CB  . LYS A 1 52  ? -21.212 64.690 41.699 1.00 39.62 ? 52   LYS A CB  1 
ATOM   421  C CG  . LYS A 1 52  ? -21.326 63.326 42.346 1.00 44.84 ? 52   LYS A CG  1 
ATOM   422  C CD  . LYS A 1 52  ? -22.779 62.950 42.594 1.00 49.83 ? 52   LYS A CD  1 
ATOM   423  C CE  . LYS A 1 52  ? -22.881 61.624 43.337 1.00 52.24 ? 52   LYS A CE  1 
ATOM   424  N NZ  . LYS A 1 52  ? -22.108 60.553 42.650 1.00 55.26 ? 52   LYS A NZ  1 
ATOM   425  N N   . PRO A 1 53  ? -19.669 66.756 39.507 1.00 37.51 ? 53   PRO A N   1 
ATOM   426  C CA  . PRO A 1 53  ? -19.645 68.124 38.979 1.00 38.45 ? 53   PRO A CA  1 
ATOM   427  C C   . PRO A 1 53  ? -20.860 68.915 39.457 1.00 38.29 ? 53   PRO A C   1 
ATOM   428  O O   . PRO A 1 53  ? -21.946 68.361 39.629 1.00 38.20 ? 53   PRO A O   1 
ATOM   429  C CB  . PRO A 1 53  ? -19.645 67.908 37.466 1.00 39.31 ? 53   PRO A CB  1 
ATOM   430  C CG  . PRO A 1 53  ? -18.893 66.620 37.320 1.00 40.75 ? 53   PRO A CG  1 
ATOM   431  C CD  . PRO A 1 53  ? -19.499 65.774 38.423 1.00 38.36 ? 53   PRO A CD  1 
ATOM   432  N N   . TRP A 1 54  ? -20.674 70.212 39.666 1.00 37.94 ? 54   TRP A N   1 
ATOM   433  C CA  . TRP A 1 54  ? -21.754 71.062 40.146 1.00 39.00 ? 54   TRP A CA  1 
ATOM   434  C C   . TRP A 1 54  ? -22.091 72.184 39.174 1.00 40.41 ? 54   TRP A C   1 
ATOM   435  O O   . TRP A 1 54  ? -21.251 72.610 38.382 1.00 39.58 ? 54   TRP A O   1 
ATOM   436  C CB  . TRP A 1 54  ? -21.362 71.675 41.493 1.00 38.18 ? 54   TRP A CB  1 
ATOM   437  C CG  . TRP A 1 54  ? -20.141 72.538 41.398 1.00 36.68 ? 54   TRP A CG  1 
ATOM   438  C CD1 . TRP A 1 54  ? -20.078 73.830 40.950 1.00 36.78 ? 54   TRP A CD1 1 
ATOM   439  C CD2 . TRP A 1 54  ? -18.789 72.141 41.662 1.00 35.83 ? 54   TRP A CD2 1 
ATOM   440  N NE1 . TRP A 1 54  ? -18.771 74.257 40.915 1.00 35.78 ? 54   TRP A NE1 1 
ATOM   441  C CE2 . TRP A 1 54  ? -17.961 73.241 41.346 1.00 35.99 ? 54   TRP A CE2 1 
ATOM   442  C CE3 . TRP A 1 54  ? -18.199 70.961 42.131 1.00 37.21 ? 54   TRP A CE3 1 
ATOM   443  C CZ2 . TRP A 1 54  ? -16.569 73.194 41.484 1.00 35.85 ? 54   TRP A CZ2 1 
ATOM   444  C CZ3 . TRP A 1 54  ? -16.815 70.913 42.268 1.00 35.41 ? 54   TRP A CZ3 1 
ATOM   445  C CH2 . TRP A 1 54  ? -16.016 72.025 41.945 1.00 36.45 ? 54   TRP A CH2 1 
ATOM   446  N N   A SER A 1 55  ? -23.332 72.654 39.233 0.50 41.41 ? 55   SER A N   1 
ATOM   447  N N   B SER A 1 55  ? -23.333 72.652 39.232 0.50 41.37 ? 55   SER A N   1 
ATOM   448  C CA  A SER A 1 55  ? -23.772 73.747 38.380 0.50 42.07 ? 55   SER A CA  1 
ATOM   449  C CA  B SER A 1 55  ? -23.767 73.749 38.379 0.50 42.14 ? 55   SER A CA  1 
ATOM   450  C C   A SER A 1 55  ? -23.593 75.021 39.196 0.50 41.79 ? 55   SER A C   1 
ATOM   451  C C   B SER A 1 55  ? -23.592 75.022 39.196 0.50 41.83 ? 55   SER A C   1 
ATOM   452  O O   A SER A 1 55  ? -23.486 74.965 40.420 0.50 42.64 ? 55   SER A O   1 
ATOM   453  O O   B SER A 1 55  ? -23.487 74.965 40.421 0.50 42.69 ? 55   SER A O   1 
ATOM   454  C CB  A SER A 1 55  ? -25.237 73.570 37.984 0.50 42.56 ? 55   SER A CB  1 
ATOM   455  C CB  B SER A 1 55  ? -25.243 73.571 37.991 0.50 42.44 ? 55   SER A CB  1 
ATOM   456  O OG  A SER A 1 55  ? -25.433 72.397 37.220 0.50 43.03 ? 55   SER A OG  1 
ATOM   457  O OG  B SER A 1 55  ? -26.075 73.532 39.125 0.50 43.31 ? 55   SER A OG  1 
ATOM   458  N N   . GLY A 1 56  ? -23.554 76.166 38.527 1.00 41.96 ? 56   GLY A N   1 
ATOM   459  C CA  . GLY A 1 56  ? -23.382 77.414 39.247 1.00 40.71 ? 56   GLY A CA  1 
ATOM   460  C C   . GLY A 1 56  ? -21.932 77.637 39.642 1.00 39.98 ? 56   GLY A C   1 
ATOM   461  O O   . GLY A 1 56  ? -21.033 76.973 39.123 1.00 39.04 ? 56   GLY A O   1 
ATOM   462  N N   . VAL A 1 57  ? -21.704 78.556 40.575 1.00 37.96 ? 57   VAL A N   1 
ATOM   463  C CA  . VAL A 1 57  ? -20.351 78.890 41.006 1.00 36.54 ? 57   VAL A CA  1 
ATOM   464  C C   . VAL A 1 57  ? -20.039 78.470 42.440 1.00 36.72 ? 57   VAL A C   1 
ATOM   465  O O   . VAL A 1 57  ? -20.768 78.812 43.373 1.00 35.52 ? 57   VAL A O   1 
ATOM   466  C CB  . VAL A 1 57  ? -20.109 80.408 40.880 1.00 36.67 ? 57   VAL A CB  1 
ATOM   467  C CG1 . VAL A 1 57  ? -18.664 80.743 41.226 1.00 37.93 ? 57   VAL A CG1 1 
ATOM   468  C CG2 . VAL A 1 57  ? -20.449 80.870 39.473 1.00 38.43 ? 57   VAL A CG2 1 
ATOM   469  N N   . TRP A 1 58  ? -18.948 77.730 42.615 1.00 34.68 ? 58   TRP A N   1 
ATOM   470  C CA  . TRP A 1 58  ? -18.555 77.298 43.945 1.00 33.55 ? 58   TRP A CA  1 
ATOM   471  C C   . TRP A 1 58  ? -17.824 78.444 44.630 1.00 33.94 ? 58   TRP A C   1 
ATOM   472  O O   . TRP A 1 58  ? -16.877 79.009 44.081 1.00 32.77 ? 58   TRP A O   1 
ATOM   473  C CB  . TRP A 1 58  ? -17.647 76.066 43.873 1.00 33.93 ? 58   TRP A CB  1 
ATOM   474  C CG  . TRP A 1 58  ? -17.332 75.497 45.227 1.00 34.37 ? 58   TRP A CG  1 
ATOM   475  C CD1 . TRP A 1 58  ? -16.413 75.964 46.125 1.00 34.22 ? 58   TRP A CD1 1 
ATOM   476  C CD2 . TRP A 1 58  ? -17.991 74.397 45.862 1.00 33.59 ? 58   TRP A CD2 1 
ATOM   477  N NE1 . TRP A 1 58  ? -16.463 75.223 47.283 1.00 33.98 ? 58   TRP A NE1 1 
ATOM   478  C CE2 . TRP A 1 58  ? -17.425 74.253 47.149 1.00 34.27 ? 58   TRP A CE2 1 
ATOM   479  C CE3 . TRP A 1 58  ? -19.011 73.516 45.471 1.00 35.10 ? 58   TRP A CE3 1 
ATOM   480  C CZ2 . TRP A 1 58  ? -17.841 73.266 48.048 1.00 34.71 ? 58   TRP A CZ2 1 
ATOM   481  C CZ3 . TRP A 1 58  ? -19.427 72.533 46.366 1.00 36.20 ? 58   TRP A CZ3 1 
ATOM   482  C CH2 . TRP A 1 58  ? -18.841 72.418 47.640 1.00 34.94 ? 58   TRP A CH2 1 
ATOM   483  N N   . ASN A 1 59  ? -18.281 78.785 45.829 1.00 34.48 ? 59   ASN A N   1 
ATOM   484  C CA  . ASN A 1 59  ? -17.681 79.857 46.611 1.00 37.91 ? 59   ASN A CA  1 
ATOM   485  C C   . ASN A 1 59  ? -16.386 79.357 47.264 1.00 35.32 ? 59   ASN A C   1 
ATOM   486  O O   . ASN A 1 59  ? -16.417 78.649 48.270 1.00 36.10 ? 59   ASN A O   1 
ATOM   487  C CB  . ASN A 1 59  ? -18.688 80.333 47.667 1.00 43.25 ? 59   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 59  ? -18.106 81.362 48.614 1.00 50.54 ? 59   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 59  ? -17.134 82.044 48.284 1.00 49.20 ? 59   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 59  ? -18.714 81.487 49.792 1.00 58.90 ? 59   ASN A ND2 1 
ATOM   491  N N   . ALA A 1 60  ? -15.250 79.725 46.677 1.00 33.27 ? 60   ALA A N   1 
ATOM   492  C CA  . ALA A 1 60  ? -13.942 79.307 47.183 1.00 32.79 ? 60   ALA A CA  1 
ATOM   493  C C   . ALA A 1 60  ? -13.184 80.469 47.813 1.00 33.33 ? 60   ALA A C   1 
ATOM   494  O O   . ALA A 1 60  ? -12.000 80.674 47.537 1.00 31.13 ? 60   ALA A O   1 
ATOM   495  C CB  . ALA A 1 60  ? -13.115 78.704 46.047 1.00 33.31 ? 60   ALA A CB  1 
ATOM   496  N N   . SER A 1 61  ? -13.864 81.213 48.678 1.00 32.11 ? 61   SER A N   1 
ATOM   497  C CA  . SER A 1 61  ? -13.260 82.366 49.330 1.00 33.96 ? 61   SER A CA  1 
ATOM   498  C C   . SER A 1 61  ? -12.791 82.094 50.756 1.00 34.70 ? 61   SER A C   1 
ATOM   499  O O   . SER A 1 61  ? -12.080 82.913 51.337 1.00 35.58 ? 61   SER A O   1 
ATOM   500  C CB  . SER A 1 61  ? -14.261 83.520 49.358 1.00 34.21 ? 61   SER A CB  1 
ATOM   501  O OG  . SER A 1 61  ? -15.371 83.174 50.168 1.00 35.47 ? 61   SER A OG  1 
ATOM   502  N N   . THR A 1 62  ? -13.183 80.958 51.324 1.00 34.57 ? 62   THR A N   1 
ATOM   503  C CA  . THR A 1 62  ? -12.802 80.648 52.699 1.00 35.65 ? 62   THR A CA  1 
ATOM   504  C C   . THR A 1 62  ? -12.263 79.233 52.892 1.00 34.83 ? 62   THR A C   1 
ATOM   505  O O   . THR A 1 62  ? -12.616 78.313 52.157 1.00 32.73 ? 62   THR A O   1 
ATOM   506  C CB  . THR A 1 62  ? -14.006 80.830 53.650 1.00 38.56 ? 62   THR A CB  1 
ATOM   507  O OG1 . THR A 1 62  ? -14.962 79.792 53.410 1.00 41.94 ? 62   THR A OG1 1 
ATOM   508  C CG2 . THR A 1 62  ? -14.683 82.170 53.407 1.00 39.75 ? 62   THR A CG2 1 
ATOM   509  N N   . TYR A 1 63  ? -11.408 79.068 53.897 1.00 33.70 ? 63   TYR A N   1 
ATOM   510  C CA  . TYR A 1 63  ? -10.836 77.759 54.200 1.00 33.05 ? 63   TYR A CA  1 
ATOM   511  C C   . TYR A 1 63  ? -11.931 76.749 54.534 1.00 32.60 ? 63   TYR A C   1 
ATOM   512  O O   . TYR A 1 63  ? -12.974 77.100 55.093 1.00 32.68 ? 63   TYR A O   1 
ATOM   513  C CB  . TYR A 1 63  ? -9.872  77.844 55.388 1.00 31.10 ? 63   TYR A CB  1 
ATOM   514  C CG  . TYR A 1 63  ? -8.457  78.255 55.045 1.00 32.42 ? 63   TYR A CG  1 
ATOM   515  C CD1 . TYR A 1 63  ? -7.810  77.745 53.914 1.00 31.78 ? 63   TYR A CD1 1 
ATOM   516  C CD2 . TYR A 1 63  ? -7.724  79.072 55.909 1.00 32.59 ? 63   TYR A CD2 1 
ATOM   517  C CE1 . TYR A 1 63  ? -6.469  78.031 53.662 1.00 33.50 ? 63   TYR A CE1 1 
ATOM   518  C CE2 . TYR A 1 63  ? -6.380  79.361 55.666 1.00 33.16 ? 63   TYR A CE2 1 
ATOM   519  C CZ  . TYR A 1 63  ? -5.760  78.835 54.545 1.00 34.34 ? 63   TYR A CZ  1 
ATOM   520  O OH  . TYR A 1 63  ? -4.424  79.087 54.326 1.00 34.62 ? 63   TYR A OH  1 
ATOM   521  N N   . PRO A 1 64  ? -11.703 75.471 54.202 1.00 31.26 ? 64   PRO A N   1 
ATOM   522  C CA  . PRO A 1 64  ? -12.680 74.417 54.475 1.00 30.42 ? 64   PRO A CA  1 
ATOM   523  C C   . PRO A 1 64  ? -12.511 73.878 55.897 1.00 30.51 ? 64   PRO A C   1 
ATOM   524  O O   . PRO A 1 64  ? -11.660 74.347 56.654 1.00 29.90 ? 64   PRO A O   1 
ATOM   525  C CB  . PRO A 1 64  ? -12.319 73.363 53.442 1.00 31.00 ? 64   PRO A CB  1 
ATOM   526  C CG  . PRO A 1 64  ? -10.810 73.428 53.471 1.00 30.16 ? 64   PRO A CG  1 
ATOM   527  C CD  . PRO A 1 64  ? -10.547 74.935 53.454 1.00 30.54 ? 64   PRO A CD  1 
ATOM   528  N N   A ASN A 1 65  ? -13.332 72.899 56.257 0.50 29.74 ? 65   ASN A N   1 
ATOM   529  N N   B ASN A 1 65  ? -13.327 72.890 56.247 0.50 29.20 ? 65   ASN A N   1 
ATOM   530  C CA  A ASN A 1 65  ? -13.237 72.290 57.575 0.50 30.80 ? 65   ASN A CA  1 
ATOM   531  C CA  B ASN A 1 65  ? -13.253 72.259 57.558 0.50 29.94 ? 65   ASN A CA  1 
ATOM   532  C C   A ASN A 1 65  ? -12.003 71.391 57.587 0.50 29.85 ? 65   ASN A C   1 
ATOM   533  C C   B ASN A 1 65  ? -12.004 71.381 57.583 0.50 29.26 ? 65   ASN A C   1 
ATOM   534  O O   A ASN A 1 65  ? -11.474 71.021 56.533 0.50 30.44 ? 65   ASN A O   1 
ATOM   535  O O   B ASN A 1 65  ? -11.483 71.029 56.533 0.50 30.88 ? 65   ASN A O   1 
ATOM   536  C CB  A ASN A 1 65  ? -14.486 71.380 57.789 0.50 29.77 ? 65   ASN A CB  1 
ATOM   537  C CB  B ASN A 1 65  ? -14.485 71.454 57.872 0.50 32.06 ? 65   ASN A CB  1 
ATOM   538  C CG  A ASN A 1 65  ? -15.758 72.188 57.963 0.50 30.19 ? 65   ASN A CG  1 
ATOM   539  C CG  B ASN A 1 65  ? -15.736 72.302 58.013 0.50 33.28 ? 65   ASN A CG  1 
ATOM   540  O OD1 A ASN A 1 65  ? -16.166 72.962 57.068 0.50 36.56 ? 65   ASN A OD1 1 
ATOM   541  O OD1 B ASN A 1 65  ? -16.856 71.700 57.693 0.50 31.28 ? 65   ASN A OD1 1 
ATOM   542  N ND2 A ASN A 1 65  ? -16.324 72.289 59.202 0.50 32.47 ? 65   ASN A ND2 1 
ATOM   543  N ND2 B ASN A 1 65  ? -15.619 73.422 58.430 0.50 28.10 ? 65   ASN A ND2 1 
ATOM   544  N N   . ASN A 1 66  ? -11.532 71.044 58.779 1.00 29.58 ? 66   ASN A N   1 
ATOM   545  C CA  . ASN A 1 66  ? -10.363 70.181 58.922 1.00 29.21 ? 66   ASN A CA  1 
ATOM   546  C C   . ASN A 1 66  ? -10.921 68.785 59.184 1.00 29.17 ? 66   ASN A C   1 
ATOM   547  O O   . ASN A 1 66  ? -12.036 68.653 59.687 1.00 29.86 ? 66   ASN A O   1 
ATOM   548  C CB  . ASN A 1 66  ? -9.517  70.608 60.125 1.00 29.16 ? 66   ASN A CB  1 
ATOM   549  C CG  . ASN A 1 66  ? -8.920  71.992 59.963 1.00 29.60 ? 66   ASN A CG  1 
ATOM   550  O OD1 . ASN A 1 66  ? -8.782  72.730 60.938 1.00 32.24 ? 66   ASN A OD1 1 
ATOM   551  N ND2 . ASN A 1 66  ? -8.544  72.345 58.736 1.00 29.34 ? 66   ASN A ND2 1 
ATOM   552  N N   . CYS A 1 67  ? -10.157 67.748 58.857 1.00 27.81 ? 67   CYS A N   1 
ATOM   553  C CA  . CYS A 1 67  ? -10.623 66.386 59.093 1.00 28.21 ? 67   CYS A CA  1 
ATOM   554  C C   . CYS A 1 67  ? -10.654 66.076 60.590 1.00 29.04 ? 67   CYS A C   1 
ATOM   555  O O   . CYS A 1 67  ? -9.927  66.690 61.376 1.00 29.10 ? 67   CYS A O   1 
ATOM   556  C CB  . CYS A 1 67  ? -9.723  65.377 58.363 1.00 27.98 ? 67   CYS A CB  1 
ATOM   557  S SG  . CYS A 1 67  ? -9.800  65.481 56.542 0.80 27.28 ? 67   CYS A SG  1 
ATOM   558  N N   . GLN A 1 68  ? -11.510 65.135 60.980 1.00 28.24 ? 68   GLN A N   1 
ATOM   559  C CA  . GLN A 1 68  ? -11.638 64.740 62.382 1.00 28.76 ? 68   GLN A CA  1 
ATOM   560  C C   . GLN A 1 68  ? -10.310 64.169 62.866 1.00 29.46 ? 68   GLN A C   1 
ATOM   561  O O   . GLN A 1 68  ? -9.729  63.295 62.222 1.00 30.43 ? 68   GLN A O   1 
ATOM   562  C CB  . GLN A 1 68  ? -12.740 63.692 62.537 1.00 30.23 ? 68   GLN A CB  1 
ATOM   563  C CG  . GLN A 1 68  ? -14.149 64.228 62.314 1.00 31.05 ? 68   GLN A CG  1 
ATOM   564  C CD  . GLN A 1 68  ? -14.668 65.043 63.488 1.00 35.42 ? 68   GLN A CD  1 
ATOM   565  O OE1 . GLN A 1 68  ? -15.788 65.559 63.454 1.00 38.73 ? 68   GLN A OE1 1 
ATOM   566  N NE2 . GLN A 1 68  ? -13.862 65.158 64.534 1.00 32.80 ? 68   GLN A NE2 1 
ATOM   567  N N   . GLN A 1 69  ? -9.837  64.648 64.012 1.00 28.04 ? 69   GLN A N   1 
ATOM   568  C CA  . GLN A 1 69  ? -8.554  64.185 64.516 1.00 26.97 ? 69   GLN A CA  1 
ATOM   569  C C   . GLN A 1 69  ? -8.352  64.436 65.993 1.00 27.62 ? 69   GLN A C   1 
ATOM   570  O O   . GLN A 1 69  ? -9.037  65.257 66.605 1.00 25.77 ? 69   GLN A O   1 
ATOM   571  C CB  . GLN A 1 69  ? -7.428  64.895 63.766 1.00 27.84 ? 69   GLN A CB  1 
ATOM   572  C CG  . GLN A 1 69  ? -7.476  66.417 63.927 1.00 26.06 ? 69   GLN A CG  1 
ATOM   573  C CD  . GLN A 1 69  ? -6.537  67.147 62.981 1.00 27.76 ? 69   GLN A CD  1 
ATOM   574  O OE1 . GLN A 1 69  ? -5.369  67.401 63.303 1.00 27.10 ? 69   GLN A OE1 1 
ATOM   575  N NE2 . GLN A 1 69  ? -7.041  67.479 61.798 1.00 26.85 ? 69   GLN A NE2 1 
ATOM   576  N N   . TYR A 1 70  ? -7.384  63.717 66.545 1.00 28.08 ? 70   TYR A N   1 
ATOM   577  C CA  . TYR A 1 70  ? -6.996  63.867 67.935 1.00 29.15 ? 70   TYR A CA  1 
ATOM   578  C C   . TYR A 1 70  ? -6.448  65.288 68.037 1.00 30.33 ? 70   TYR A C   1 
ATOM   579  O O   . TYR A 1 70  ? -5.717  65.730 67.153 1.00 30.89 ? 70   TYR A O   1 
ATOM   580  C CB  . TYR A 1 70  ? -5.887  62.866 68.267 1.00 29.72 ? 70   TYR A CB  1 
ATOM   581  C CG  . TYR A 1 70  ? -5.206  63.123 69.590 1.00 33.02 ? 70   TYR A CG  1 
ATOM   582  C CD1 . TYR A 1 70  ? -5.800  62.736 70.791 1.00 32.04 ? 70   TYR A CD1 1 
ATOM   583  C CD2 . TYR A 1 70  ? -3.979  63.786 69.643 1.00 33.38 ? 70   TYR A CD2 1 
ATOM   584  C CE1 . TYR A 1 70  ? -5.184  63.006 72.017 1.00 35.62 ? 70   TYR A CE1 1 
ATOM   585  C CE2 . TYR A 1 70  ? -3.361  64.060 70.857 1.00 34.78 ? 70   TYR A CE2 1 
ATOM   586  C CZ  . TYR A 1 70  ? -3.964  63.671 72.036 1.00 33.98 ? 70   TYR A CZ  1 
ATOM   587  O OH  . TYR A 1 70  ? -3.348  63.958 73.233 1.00 37.47 ? 70   TYR A OH  1 
ATOM   588  N N   . VAL A 1 71  ? -6.803  66.007 69.097 1.00 30.09 ? 71   VAL A N   1 
ATOM   589  C CA  . VAL A 1 71  ? -6.320  67.371 69.279 1.00 29.75 ? 71   VAL A CA  1 
ATOM   590  C C   . VAL A 1 71  ? -5.408  67.444 70.496 1.00 31.13 ? 71   VAL A C   1 
ATOM   591  O O   . VAL A 1 71  ? -5.777  67.022 71.591 1.00 30.23 ? 71   VAL A O   1 
ATOM   592  C CB  . VAL A 1 71  ? -7.493  68.360 69.459 1.00 30.95 ? 71   VAL A CB  1 
ATOM   593  C CG1 . VAL A 1 71  ? -6.963  69.738 69.818 1.00 31.40 ? 71   VAL A CG1 1 
ATOM   594  C CG2 . VAL A 1 71  ? -8.312  68.429 68.176 1.00 30.29 ? 71   VAL A CG2 1 
ATOM   595  N N   . ASP A 1 72  ? -4.214  67.985 70.296 1.00 31.90 ? 72   ASP A N   1 
ATOM   596  C CA  . ASP A 1 72  ? -3.239  68.098 71.371 1.00 33.43 ? 72   ASP A CA  1 
ATOM   597  C C   . ASP A 1 72  ? -3.607  69.152 72.411 1.00 32.23 ? 72   ASP A C   1 
ATOM   598  O O   . ASP A 1 72  ? -3.696  70.335 72.099 1.00 33.94 ? 72   ASP A O   1 
ATOM   599  C CB  . ASP A 1 72  ? -1.862  68.397 70.775 1.00 33.76 ? 72   ASP A CB  1 
ATOM   600  C CG  . ASP A 1 72  ? -0.812  68.663 71.831 1.00 36.55 ? 72   ASP A CG  1 
ATOM   601  O OD1 . ASP A 1 72  ? -0.953  68.158 72.965 1.00 36.39 ? 72   ASP A OD1 1 
ATOM   602  O OD2 . ASP A 1 72  ? 0.167   69.367 71.517 1.00 36.74 ? 72   ASP A OD2 1 
ATOM   603  N N   . GLU A 1 73  ? -3.827  68.714 73.649 1.00 32.84 ? 73   GLU A N   1 
ATOM   604  C CA  . GLU A 1 73  ? -4.175  69.628 74.736 1.00 34.94 ? 73   GLU A CA  1 
ATOM   605  C C   . GLU A 1 73  ? -3.143  69.542 75.857 1.00 36.57 ? 73   GLU A C   1 
ATOM   606  O O   . GLU A 1 73  ? -3.427  69.891 77.002 1.00 35.87 ? 73   GLU A O   1 
ATOM   607  C CB  . GLU A 1 73  ? -5.557  69.292 75.307 1.00 36.65 ? 73   GLU A CB  1 
ATOM   608  C CG  . GLU A 1 73  ? -6.697  69.394 74.309 1.00 40.78 ? 73   GLU A CG  1 
ATOM   609  C CD  . GLU A 1 73  ? -8.054  69.135 74.944 1.00 45.02 ? 73   GLU A CD  1 
ATOM   610  O OE1 . GLU A 1 73  ? -8.129  69.031 76.190 1.00 46.37 ? 73   GLU A OE1 1 
ATOM   611  O OE2 . GLU A 1 73  ? -9.050  69.041 74.195 1.00 46.68 ? 73   GLU A OE2 1 
ATOM   612  N N   . GLN A 1 74  ? -1.945  69.076 75.521 1.00 36.49 ? 74   GLN A N   1 
ATOM   613  C CA  . GLN A 1 74  ? -0.874  68.938 76.501 1.00 38.30 ? 74   GLN A CA  1 
ATOM   614  C C   . GLN A 1 74  ? -0.433  70.282 77.090 1.00 37.43 ? 74   GLN A C   1 
ATOM   615  O O   . GLN A 1 74  ? -0.076  70.362 78.268 1.00 37.35 ? 74   GLN A O   1 
ATOM   616  C CB  . GLN A 1 74  ? 0.318   68.216 75.859 1.00 39.62 ? 74   GLN A CB  1 
ATOM   617  C CG  . GLN A 1 74  ? 1.483   67.953 76.798 1.00 43.44 ? 74   GLN A CG  1 
ATOM   618  C CD  . GLN A 1 74  ? 1.089   67.133 78.011 1.00 45.64 ? 74   GLN A CD  1 
ATOM   619  O OE1 . GLN A 1 74  ? 0.512   66.052 77.889 1.00 47.47 ? 74   GLN A OE1 1 
ATOM   620  N NE2 . GLN A 1 74  ? 1.406   67.644 79.194 1.00 47.57 ? 74   GLN A NE2 1 
ATOM   621  N N   . PHE A 1 75  ? -0.459  71.335 76.275 1.00 35.96 ? 75   PHE A N   1 
ATOM   622  C CA  . PHE A 1 75  ? -0.072  72.674 76.724 1.00 35.75 ? 75   PHE A CA  1 
ATOM   623  C C   . PHE A 1 75  ? -1.108  73.710 76.274 1.00 37.60 ? 75   PHE A C   1 
ATOM   624  O O   . PHE A 1 75  ? -0.853  74.505 75.368 1.00 35.48 ? 75   PHE A O   1 
ATOM   625  C CB  . PHE A 1 75  ? 1.308   73.048 76.164 1.00 34.82 ? 75   PHE A CB  1 
ATOM   626  C CG  . PHE A 1 75  ? 2.403   72.095 76.563 1.00 33.45 ? 75   PHE A CG  1 
ATOM   627  C CD1 . PHE A 1 75  ? 2.802   71.988 77.893 1.00 32.48 ? 75   PHE A CD1 1 
ATOM   628  C CD2 . PHE A 1 75  ? 3.009   71.280 75.617 1.00 32.29 ? 75   PHE A CD2 1 
ATOM   629  C CE1 . PHE A 1 75  ? 3.786   71.077 78.275 1.00 30.50 ? 75   PHE A CE1 1 
ATOM   630  C CE2 . PHE A 1 75  ? 3.997   70.363 75.987 1.00 32.84 ? 75   PHE A CE2 1 
ATOM   631  C CZ  . PHE A 1 75  ? 4.383   70.264 77.320 1.00 30.96 ? 75   PHE A CZ  1 
ATOM   632  N N   . PRO A 1 76  ? -2.293  73.715 76.913 1.00 38.89 ? 76   PRO A N   1 
ATOM   633  C CA  . PRO A 1 76  ? -3.384  74.645 76.592 1.00 40.21 ? 76   PRO A CA  1 
ATOM   634  C C   . PRO A 1 76  ? -2.944  76.106 76.522 1.00 41.02 ? 76   PRO A C   1 
ATOM   635  O O   . PRO A 1 76  ? -2.342  76.626 77.461 1.00 43.11 ? 76   PRO A O   1 
ATOM   636  C CB  . PRO A 1 76  ? -4.382  74.404 77.721 1.00 39.40 ? 76   PRO A CB  1 
ATOM   637  C CG  . PRO A 1 76  ? -4.190  72.956 78.031 1.00 40.36 ? 76   PRO A CG  1 
ATOM   638  C CD  . PRO A 1 76  ? -2.682  72.817 78.017 1.00 39.53 ? 76   PRO A CD  1 
ATOM   639  N N   . GLY A 1 77  ? -3.249  76.763 75.408 1.00 41.88 ? 77   GLY A N   1 
ATOM   640  C CA  . GLY A 1 77  ? -2.888  78.163 75.251 1.00 41.75 ? 77   GLY A CA  1 
ATOM   641  C C   . GLY A 1 77  ? -1.484  78.424 74.733 1.00 41.52 ? 77   GLY A C   1 
ATOM   642  O O   . GLY A 1 77  ? -1.181  79.531 74.287 1.00 45.11 ? 77   GLY A O   1 
ATOM   643  N N   . PHE A 1 78  ? -0.627  77.410 74.786 1.00 38.71 ? 78   PHE A N   1 
ATOM   644  C CA  . PHE A 1 78  ? 0.757   77.533 74.334 1.00 35.90 ? 78   PHE A CA  1 
ATOM   645  C C   . PHE A 1 78  ? 0.814   77.534 72.806 1.00 34.97 ? 78   PHE A C   1 
ATOM   646  O O   . PHE A 1 78  ? 0.367   76.589 72.164 1.00 33.78 ? 78   PHE A O   1 
ATOM   647  C CB  . PHE A 1 78  ? 1.578   76.368 74.900 1.00 35.60 ? 78   PHE A CB  1 
ATOM   648  C CG  . PHE A 1 78  ? 3.047   76.458 74.613 1.00 34.93 ? 78   PHE A CG  1 
ATOM   649  C CD1 . PHE A 1 78  ? 3.791   77.546 75.057 1.00 36.38 ? 78   PHE A CD1 1 
ATOM   650  C CD2 . PHE A 1 78  ? 3.691   75.448 73.905 1.00 34.52 ? 78   PHE A CD2 1 
ATOM   651  C CE1 . PHE A 1 78  ? 5.157   77.625 74.800 1.00 35.97 ? 78   PHE A CE1 1 
ATOM   652  C CE2 . PHE A 1 78  ? 5.053   75.516 73.643 1.00 33.70 ? 78   PHE A CE2 1 
ATOM   653  C CZ  . PHE A 1 78  ? 5.788   76.607 74.090 1.00 35.62 ? 78   PHE A CZ  1 
ATOM   654  N N   . SER A 1 79  ? 1.373   78.591 72.226 1.00 33.84 ? 79   SER A N   1 
ATOM   655  C CA  . SER A 1 79  ? 1.455   78.706 70.769 1.00 34.98 ? 79   SER A CA  1 
ATOM   656  C C   . SER A 1 79  ? 2.302   77.627 70.095 1.00 33.64 ? 79   SER A C   1 
ATOM   657  O O   . SER A 1 79  ? 2.003   77.208 68.973 1.00 34.65 ? 79   SER A O   1 
ATOM   658  C CB  . SER A 1 79  ? 2.005   80.079 70.378 1.00 34.48 ? 79   SER A CB  1 
ATOM   659  O OG  . SER A 1 79  ? 3.371   80.193 70.737 1.00 37.32 ? 79   SER A OG  1 
ATOM   660  N N   . GLY A 1 80  ? 3.359   77.189 70.772 1.00 32.17 ? 80   GLY A N   1 
ATOM   661  C CA  . GLY A 1 80  ? 4.236   76.176 70.209 1.00 31.72 ? 80   GLY A CA  1 
ATOM   662  C C   . GLY A 1 80  ? 3.519   74.901 69.800 1.00 32.15 ? 80   GLY A C   1 
ATOM   663  O O   . GLY A 1 80  ? 3.897   74.252 68.822 1.00 30.78 ? 80   GLY A O   1 
ATOM   664  N N   . SER A 1 81  ? 2.483   74.539 70.547 1.00 31.61 ? 81   SER A N   1 
ATOM   665  C CA  . SER A 1 81  ? 1.729   73.329 70.249 1.00 32.20 ? 81   SER A CA  1 
ATOM   666  C C   . SER A 1 81  ? 0.415   73.623 69.536 1.00 32.66 ? 81   SER A C   1 
ATOM   667  O O   . SER A 1 81  ? 0.019   72.897 68.626 1.00 29.33 ? 81   SER A O   1 
ATOM   668  C CB  . SER A 1 81  ? 1.454   72.551 71.540 1.00 33.87 ? 81   SER A CB  1 
ATOM   669  O OG  . SER A 1 81  ? 0.809   73.367 72.505 1.00 37.26 ? 81   SER A OG  1 
ATOM   670  N N   . GLU A 1 82  ? -0.257  74.698 69.930 1.00 32.92 ? 82   GLU A N   1 
ATOM   671  C CA  . GLU A 1 82  ? -1.535  75.027 69.311 1.00 34.69 ? 82   GLU A CA  1 
ATOM   672  C C   . GLU A 1 82  ? -1.430  75.419 67.841 1.00 33.74 ? 82   GLU A C   1 
ATOM   673  O O   . GLU A 1 82  ? -2.407  75.323 67.102 1.00 32.12 ? 82   GLU A O   1 
ATOM   674  C CB  . GLU A 1 82  ? -2.237  76.125 70.113 1.00 37.63 ? 82   GLU A CB  1 
ATOM   675  C CG  . GLU A 1 82  ? -2.345  75.778 71.589 1.00 44.03 ? 82   GLU A CG  1 
ATOM   676  C CD  . GLU A 1 82  ? -3.531  76.422 72.270 1.00 46.89 ? 82   GLU A CD  1 
ATOM   677  O OE1 . GLU A 1 82  ? -3.687  77.656 72.156 1.00 50.23 ? 82   GLU A OE1 1 
ATOM   678  O OE2 . GLU A 1 82  ? -4.301  75.687 72.927 1.00 47.79 ? 82   GLU A OE2 1 
ATOM   679  N N   . MET A 1 83  ? -0.245  75.839 67.407 1.00 32.73 ? 83   MET A N   1 
ATOM   680  C CA  . MET A 1 83  ? -0.063  76.227 66.011 1.00 32.36 ? 83   MET A CA  1 
ATOM   681  C C   . MET A 1 83  ? -0.187  75.022 65.078 1.00 31.02 ? 83   MET A C   1 
ATOM   682  O O   . MET A 1 83  ? -0.264  75.179 63.859 1.00 30.03 ? 83   MET A O   1 
ATOM   683  C CB  . MET A 1 83  ? 1.302   76.890 65.806 1.00 33.04 ? 83   MET A CB  1 
ATOM   684  C CG  . MET A 1 83  ? 2.484   75.948 65.944 1.00 34.97 ? 83   MET A CG  1 
ATOM   685  S SD  . MET A 1 83  ? 4.003   76.666 65.278 1.00 39.98 ? 83   MET A SD  1 
ATOM   686  C CE  . MET A 1 83  ? 3.831   76.257 63.544 1.00 38.31 ? 83   MET A CE  1 
ATOM   687  N N   . TRP A 1 84  ? -0.205  73.821 65.654 1.00 29.28 ? 84   TRP A N   1 
ATOM   688  C CA  . TRP A 1 84  ? -0.321  72.603 64.862 1.00 29.43 ? 84   TRP A CA  1 
ATOM   689  C C   . TRP A 1 84  ? -1.722  72.011 64.897 1.00 29.76 ? 84   TRP A C   1 
ATOM   690  O O   . TRP A 1 84  ? -2.056  71.153 64.078 1.00 29.14 ? 84   TRP A O   1 
ATOM   691  C CB  . TRP A 1 84  ? 0.692   71.562 65.347 1.00 29.27 ? 84   TRP A CB  1 
ATOM   692  C CG  . TRP A 1 84  ? 2.095   72.062 65.295 1.00 27.66 ? 84   TRP A CG  1 
ATOM   693  C CD1 . TRP A 1 84  ? 2.865   72.459 66.350 1.00 28.59 ? 84   TRP A CD1 1 
ATOM   694  C CD2 . TRP A 1 84  ? 2.885   72.266 64.120 1.00 28.75 ? 84   TRP A CD2 1 
ATOM   695  N NE1 . TRP A 1 84  ? 4.088   72.901 65.904 1.00 29.53 ? 84   TRP A NE1 1 
ATOM   696  C CE2 . TRP A 1 84  ? 4.126   72.793 64.539 1.00 29.83 ? 84   TRP A CE2 1 
ATOM   697  C CE3 . TRP A 1 84  ? 2.662   72.056 62.751 1.00 29.05 ? 84   TRP A CE3 1 
ATOM   698  C CZ2 . TRP A 1 84  ? 5.146   73.113 63.635 1.00 30.87 ? 84   TRP A CZ2 1 
ATOM   699  C CZ3 . TRP A 1 84  ? 3.678   72.374 61.852 1.00 30.27 ? 84   TRP A CZ3 1 
ATOM   700  C CH2 . TRP A 1 84  ? 4.905   72.897 62.299 1.00 29.67 ? 84   TRP A CH2 1 
ATOM   701  N N   . ASN A 1 85  ? -2.537  72.464 65.846 1.00 29.32 ? 85   ASN A N   1 
ATOM   702  C CA  . ASN A 1 85  ? -3.905  71.968 65.976 1.00 29.30 ? 85   ASN A CA  1 
ATOM   703  C C   . ASN A 1 85  ? -4.831  72.538 64.910 1.00 29.76 ? 85   ASN A C   1 
ATOM   704  O O   . ASN A 1 85  ? -4.539  73.565 64.292 1.00 28.71 ? 85   ASN A O   1 
ATOM   705  C CB  . ASN A 1 85  ? -4.486  72.313 67.354 1.00 31.60 ? 85   ASN A CB  1 
ATOM   706  C CG  . ASN A 1 85  ? -3.901  71.465 68.469 1.00 35.22 ? 85   ASN A CG  1 
ATOM   707  O OD1 . ASN A 1 85  ? -3.541  70.304 68.259 1.00 38.94 ? 85   ASN A OD1 1 
ATOM   708  N ND2 . ASN A 1 85  ? -3.827  72.034 69.669 1.00 33.88 ? 85   ASN A ND2 1 
ATOM   709  N N   . PRO A 1 86  ? -5.964  71.864 64.672 1.00 28.92 ? 86   PRO A N   1 
ATOM   710  C CA  . PRO A 1 86  ? -6.939  72.320 63.677 1.00 29.12 ? 86   PRO A CA  1 
ATOM   711  C C   . PRO A 1 86  ? -7.363  73.748 64.025 1.00 29.76 ? 86   PRO A C   1 
ATOM   712  O O   . PRO A 1 86  ? -7.646  74.038 65.189 1.00 29.61 ? 86   PRO A O   1 
ATOM   713  C CB  . PRO A 1 86  ? -8.095  71.343 63.856 1.00 29.24 ? 86   PRO A CB  1 
ATOM   714  C CG  . PRO A 1 86  ? -7.426  70.092 64.303 1.00 30.29 ? 86   PRO A CG  1 
ATOM   715  C CD  . PRO A 1 86  ? -6.375  70.581 65.271 1.00 28.55 ? 86   PRO A CD  1 
ATOM   716  N N   . ASN A 1 87  ? -7.408  74.633 63.033 1.00 29.51 ? 87   ASN A N   1 
ATOM   717  C CA  . ASN A 1 87  ? -7.817  76.011 63.288 1.00 30.43 ? 87   ASN A CA  1 
ATOM   718  C C   . ASN A 1 87  ? -9.177  76.319 62.666 1.00 32.44 ? 87   ASN A C   1 
ATOM   719  O O   . ASN A 1 87  ? -9.617  77.464 62.626 1.00 32.86 ? 87   ASN A O   1 
ATOM   720  C CB  . ASN A 1 87  ? -6.750  76.992 62.790 1.00 31.66 ? 87   ASN A CB  1 
ATOM   721  C CG  . ASN A 1 87  ? -6.530  76.916 61.294 1.00 32.78 ? 87   ASN A CG  1 
ATOM   722  O OD1 . ASN A 1 87  ? -6.934  75.955 60.637 1.00 30.80 ? 87   ASN A OD1 1 
ATOM   723  N ND2 . ASN A 1 87  ? -5.867  77.928 60.749 1.00 33.93 ? 87   ASN A ND2 1 
ATOM   724  N N   . ARG A 1 88  ? -9.834  75.273 62.181 1.00 31.36 ? 88   ARG A N   1 
ATOM   725  C CA  . ARG A 1 88  ? -11.169 75.377 61.603 1.00 33.15 ? 88   ARG A CA  1 
ATOM   726  C C   . ARG A 1 88  ? -11.969 74.258 62.258 1.00 33.81 ? 88   ARG A C   1 
ATOM   727  O O   . ARG A 1 88  ? -11.395 73.375 62.897 1.00 34.35 ? 88   ARG A O   1 
ATOM   728  C CB  . ARG A 1 88  ? -11.122 75.194 60.078 1.00 34.64 ? 88   ARG A CB  1 
ATOM   729  C CG  . ARG A 1 88  ? -10.562 76.409 59.330 1.00 37.56 ? 88   ARG A CG  1 
ATOM   730  C CD  . ARG A 1 88  ? -11.506 77.600 59.465 1.00 42.81 ? 88   ARG A CD  1 
ATOM   731  N NE  . ARG A 1 88  ? -11.014 78.808 58.807 1.00 45.09 ? 88   ARG A NE  1 
ATOM   732  C CZ  . ARG A 1 88  ? -9.951  79.506 59.202 1.00 47.39 ? 88   ARG A CZ  1 
ATOM   733  N NH1 . ARG A 1 88  ? -9.248  79.128 60.264 1.00 48.15 ? 88   ARG A NH1 1 
ATOM   734  N NH2 . ARG A 1 88  ? -9.587  80.591 58.530 1.00 46.92 ? 88   ARG A NH2 1 
ATOM   735  N N   . GLU A 1 89  ? -13.288 74.294 62.125 1.00 33.97 ? 89   GLU A N   1 
ATOM   736  C CA  . GLU A 1 89  ? -14.112 73.259 62.730 1.00 34.57 ? 89   GLU A CA  1 
ATOM   737  C C   . GLU A 1 89  ? -13.764 71.913 62.096 1.00 32.80 ? 89   GLU A C   1 
ATOM   738  O O   . GLU A 1 89  ? -13.409 71.851 60.920 1.00 33.29 ? 89   GLU A O   1 
ATOM   739  C CB  . GLU A 1 89  ? -15.592 73.576 62.509 1.00 36.55 ? 89   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 89  ? -16.513 72.925 63.525 1.00 43.08 ? 89   GLU A CG  1 
ATOM   741  N N   . MET A 1 90  ? -13.849 70.839 62.875 1.00 31.66 ? 90   MET A N   1 
ATOM   742  C CA  . MET A 1 90  ? -13.546 69.509 62.353 1.00 32.08 ? 90   MET A CA  1 
ATOM   743  C C   . MET A 1 90  ? -14.814 68.861 61.823 1.00 32.95 ? 90   MET A C   1 
ATOM   744  O O   . MET A 1 90  ? -15.905 69.089 62.351 1.00 31.33 ? 90   MET A O   1 
ATOM   745  C CB  . MET A 1 90  ? -12.936 68.617 63.439 1.00 31.17 ? 90   MET A CB  1 
ATOM   746  C CG  . MET A 1 90  ? -11.552 69.055 63.903 1.00 32.79 ? 90   MET A CG  1 
ATOM   747  S SD  . MET A 1 90  ? -10.795 67.864 65.026 1.00 33.16 ? 90   MET A SD  1 
ATOM   748  C CE  . MET A 1 90  ? -11.828 68.072 66.486 1.00 32.40 ? 90   MET A CE  1 
ATOM   749  N N   . SER A 1 91  ? -14.660 68.048 60.783 1.00 31.42 ? 91   SER A N   1 
ATOM   750  C CA  . SER A 1 91  ? -15.789 67.362 60.167 1.00 31.79 ? 91   SER A CA  1 
ATOM   751  C C   . SER A 1 91  ? -15.288 66.226 59.285 1.00 31.17 ? 91   SER A C   1 
ATOM   752  O O   . SER A 1 91  ? -14.169 66.280 58.777 1.00 29.11 ? 91   SER A O   1 
ATOM   753  C CB  . SER A 1 91  ? -16.584 68.351 59.309 1.00 32.00 ? 91   SER A CB  1 
ATOM   754  O OG  . SER A 1 91  ? -17.607 67.704 58.581 1.00 32.70 ? 91   SER A OG  1 
ATOM   755  N N   . GLU A 1 92  ? -16.099 65.184 59.114 1.00 30.36 ? 92   GLU A N   1 
ATOM   756  C CA  . GLU A 1 92  ? -15.691 64.097 58.237 1.00 30.42 ? 92   GLU A CA  1 
ATOM   757  C C   . GLU A 1 92  ? -15.794 64.614 56.807 1.00 30.02 ? 92   GLU A C   1 
ATOM   758  O O   . GLU A 1 92  ? -15.224 64.037 55.882 1.00 30.60 ? 92   GLU A O   1 
ATOM   759  C CB  . GLU A 1 92  ? -16.575 62.862 58.425 1.00 30.19 ? 92   GLU A CB  1 
ATOM   760  C CG  . GLU A 1 92  ? -16.324 62.131 59.734 1.00 29.47 ? 92   GLU A CG  1 
ATOM   761  C CD  . GLU A 1 92  ? -17.111 60.839 59.839 1.00 32.18 ? 92   GLU A CD  1 
ATOM   762  O OE1 . GLU A 1 92  ? -16.651 59.810 59.300 1.00 32.97 ? 92   GLU A OE1 1 
ATOM   763  O OE2 . GLU A 1 92  ? -18.196 60.860 60.456 1.00 35.12 ? 92   GLU A OE2 1 
ATOM   764  N N   . ASP A 1 93  ? -16.533 65.709 56.633 1.00 29.34 ? 93   ASP A N   1 
ATOM   765  C CA  . ASP A 1 93  ? -16.682 66.338 55.320 1.00 29.53 ? 93   ASP A CA  1 
ATOM   766  C C   . ASP A 1 93  ? -15.480 67.268 55.259 1.00 29.57 ? 93   ASP A C   1 
ATOM   767  O O   . ASP A 1 93  ? -15.589 68.463 55.557 1.00 29.44 ? 93   ASP A O   1 
ATOM   768  C CB  . ASP A 1 93  ? -17.977 67.151 55.265 1.00 32.76 ? 93   ASP A CB  1 
ATOM   769  C CG  . ASP A 1 93  ? -18.216 67.778 53.906 1.00 33.40 ? 93   ASP A CG  1 
ATOM   770  O OD1 . ASP A 1 93  ? -17.267 67.834 53.094 1.00 33.75 ? 93   ASP A OD1 1 
ATOM   771  O OD2 . ASP A 1 93  ? -19.355 68.224 53.653 1.00 37.60 ? 93   ASP A OD2 1 
ATOM   772  N N   . CYS A 1 94  ? -14.335 66.721 54.857 1.00 29.13 ? 94   CYS A N   1 
ATOM   773  C CA  . CYS A 1 94  ? -13.096 67.494 54.858 1.00 28.53 ? 94   CYS A CA  1 
ATOM   774  C C   . CYS A 1 94  ? -12.173 67.349 53.652 1.00 29.08 ? 94   CYS A C   1 
ATOM   775  O O   . CYS A 1 94  ? -11.039 67.830 53.690 1.00 29.22 ? 94   CYS A O   1 
ATOM   776  C CB  . CYS A 1 94  ? -12.312 67.114 56.117 1.00 27.82 ? 94   CYS A CB  1 
ATOM   777  S SG  . CYS A 1 94  ? -11.795 65.361 56.132 0.80 24.81 ? 94   CYS A SG  1 
ATOM   778  N N   . LEU A 1 95  ? -12.629 66.698 52.586 1.00 27.81 ? 95   LEU A N   1 
ATOM   779  C CA  . LEU A 1 95  ? -11.762 66.524 51.427 1.00 28.64 ? 95   LEU A CA  1 
ATOM   780  C C   . LEU A 1 95  ? -11.821 67.694 50.453 1.00 29.19 ? 95   LEU A C   1 
ATOM   781  O O   . LEU A 1 95  ? -12.595 67.690 49.495 1.00 29.20 ? 95   LEU A O   1 
ATOM   782  C CB  . LEU A 1 95  ? -12.085 65.205 50.718 1.00 27.71 ? 95   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 95  ? -11.844 63.972 51.602 1.00 30.14 ? 95   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 95  ? -12.072 62.708 50.786 1.00 29.46 ? 95   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 95  ? -10.410 63.996 52.159 1.00 28.29 ? 95   LEU A CD2 1 
ATOM   786  N N   . TYR A 1 96  ? -10.978 68.689 50.714 1.00 27.93 ? 96   TYR A N   1 
ATOM   787  C CA  . TYR A 1 96  ? -10.898 69.896 49.901 1.00 27.21 ? 96   TYR A CA  1 
ATOM   788  C C   . TYR A 1 96  ? -9.449  70.291 49.672 1.00 26.61 ? 96   TYR A C   1 
ATOM   789  O O   . TYR A 1 96  ? -8.553  69.848 50.393 1.00 27.75 ? 96   TYR A O   1 
ATOM   790  C CB  . TYR A 1 96  ? -11.606 71.065 50.600 1.00 27.63 ? 96   TYR A CB  1 
ATOM   791  C CG  . TYR A 1 96  ? -13.059 70.817 50.899 1.00 28.50 ? 96   TYR A CG  1 
ATOM   792  C CD1 . TYR A 1 96  ? -13.445 70.090 52.025 1.00 28.92 ? 96   TYR A CD1 1 
ATOM   793  C CD2 . TYR A 1 96  ? -14.050 71.264 50.027 1.00 29.28 ? 96   TYR A CD2 1 
ATOM   794  C CE1 . TYR A 1 96  ? -14.788 69.812 52.275 1.00 29.68 ? 96   TYR A CE1 1 
ATOM   795  C CE2 . TYR A 1 96  ? -15.393 70.988 50.263 1.00 29.08 ? 96   TYR A CE2 1 
ATOM   796  C CZ  . TYR A 1 96  ? -15.755 70.263 51.386 1.00 30.50 ? 96   TYR A CZ  1 
ATOM   797  O OH  . TYR A 1 96  ? -17.081 69.974 51.614 1.00 29.68 ? 96   TYR A OH  1 
ATOM   798  N N   . LEU A 1 97  ? -9.217  71.125 48.665 1.00 25.03 ? 97   LEU A N   1 
ATOM   799  C CA  . LEU A 1 97  ? -7.873  71.599 48.394 1.00 25.79 ? 97   LEU A CA  1 
ATOM   800  C C   . LEU A 1 97  ? -7.878  73.121 48.246 1.00 26.68 ? 97   LEU A C   1 
ATOM   801  O O   . LEU A 1 97  ? -8.933  73.738 48.042 1.00 27.47 ? 97   LEU A O   1 
ATOM   802  C CB  . LEU A 1 97  ? -7.288  70.901 47.158 1.00 26.82 ? 97   LEU A CB  1 
ATOM   803  C CG  . LEU A 1 97  ? -8.004  70.922 45.807 1.00 26.19 ? 97   LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 97  ? -7.718  72.237 45.087 1.00 25.23 ? 97   LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 97  ? -7.502  69.759 44.959 1.00 27.71 ? 97   LEU A CD2 1 
ATOM   806  N N   . ASN A 1 98  ? -6.700  73.720 48.381 1.00 26.43 ? 98   ASN A N   1 
ATOM   807  C CA  . ASN A 1 98  ? -6.538  75.166 48.301 1.00 26.26 ? 98   ASN A CA  1 
ATOM   808  C C   . ASN A 1 98  ? -5.493  75.515 47.250 1.00 27.24 ? 98   ASN A C   1 
ATOM   809  O O   . ASN A 1 98  ? -4.479  74.834 47.132 1.00 27.11 ? 98   ASN A O   1 
ATOM   810  C CB  . ASN A 1 98  ? -6.076  75.714 49.659 1.00 26.94 ? 98   ASN A CB  1 
ATOM   811  C CG  . ASN A 1 98  ? -6.919  75.207 50.813 1.00 28.53 ? 98   ASN A CG  1 
ATOM   812  O OD1 . ASN A 1 98  ? -8.108  75.504 50.902 1.00 27.88 ? 98   ASN A OD1 1 
ATOM   813  N ND2 . ASN A 1 98  ? -6.302  74.434 51.709 1.00 28.36 ? 98   ASN A ND2 1 
ATOM   814  N N   . ILE A 1 99  ? -5.731  76.590 46.504 1.00 26.75 ? 99   ILE A N   1 
ATOM   815  C CA  . ILE A 1 99  ? -4.793  77.012 45.473 1.00 26.51 ? 99   ILE A CA  1 
ATOM   816  C C   . ILE A 1 99  ? -4.455  78.500 45.549 1.00 27.49 ? 99   ILE A C   1 
ATOM   817  O O   . ILE A 1 99  ? -5.352  79.340 45.646 1.00 29.77 ? 99   ILE A O   1 
ATOM   818  C CB  . ILE A 1 99  ? -5.355  76.754 44.053 1.00 26.75 ? 99   ILE A CB  1 
ATOM   819  C CG1 . ILE A 1 99  ? -5.894  75.325 43.936 1.00 27.22 ? 99   ILE A CG1 1 
ATOM   820  C CG2 . ILE A 1 99  ? -4.259  76.994 43.021 1.00 25.19 ? 99   ILE A CG2 1 
ATOM   821  C CD1 . ILE A 1 99  ? -6.496  75.011 42.565 1.00 27.77 ? 99   ILE A CD1 1 
ATOM   822  N N   . TRP A 1 100 ? -3.164  78.814 45.504 1.00 27.21 ? 100  TRP A N   1 
ATOM   823  C CA  . TRP A 1 100 ? -2.698  80.198 45.503 1.00 28.21 ? 100  TRP A CA  1 
ATOM   824  C C   . TRP A 1 100 ? -2.131  80.439 44.110 1.00 30.23 ? 100  TRP A C   1 
ATOM   825  O O   . TRP A 1 100 ? -1.232  79.723 43.650 1.00 29.22 ? 100  TRP A O   1 
ATOM   826  C CB  . TRP A 1 100 ? -1.629  80.426 46.573 1.00 28.59 ? 100  TRP A CB  1 
ATOM   827  C CG  . TRP A 1 100 ? -2.213  80.563 47.950 1.00 28.64 ? 100  TRP A CG  1 
ATOM   828  C CD1 . TRP A 1 100 ? -2.670  81.709 48.537 1.00 28.51 ? 100  TRP A CD1 1 
ATOM   829  C CD2 . TRP A 1 100 ? -2.444  79.511 48.890 1.00 28.86 ? 100  TRP A CD2 1 
ATOM   830  N NE1 . TRP A 1 100 ? -3.170  81.437 49.788 1.00 29.58 ? 100  TRP A NE1 1 
ATOM   831  C CE2 . TRP A 1 100 ? -3.043  80.094 50.031 1.00 29.87 ? 100  TRP A CE2 1 
ATOM   832  C CE3 . TRP A 1 100 ? -2.203  78.129 48.882 1.00 29.68 ? 100  TRP A CE3 1 
ATOM   833  C CZ2 . TRP A 1 100 ? -3.406  79.342 51.156 1.00 30.34 ? 100  TRP A CZ2 1 
ATOM   834  C CZ3 . TRP A 1 100 ? -2.564  77.380 50.001 1.00 30.13 ? 100  TRP A CZ3 1 
ATOM   835  C CH2 . TRP A 1 100 ? -3.159  77.991 51.123 1.00 31.49 ? 100  TRP A CH2 1 
ATOM   836  N N   . VAL A 1 101 ? -2.668  81.451 43.442 1.00 28.94 ? 101  VAL A N   1 
ATOM   837  C CA  . VAL A 1 101 ? -2.272  81.766 42.079 1.00 29.77 ? 101  VAL A CA  1 
ATOM   838  C C   . VAL A 1 101 ? -1.718  83.177 41.935 1.00 30.72 ? 101  VAL A C   1 
ATOM   839  O O   . VAL A 1 101 ? -2.338  84.140 42.377 1.00 30.54 ? 101  VAL A O   1 
ATOM   840  C CB  . VAL A 1 101 ? -3.488  81.620 41.135 1.00 29.36 ? 101  VAL A CB  1 
ATOM   841  C CG1 . VAL A 1 101 ? -3.075  81.870 39.692 1.00 29.01 ? 101  VAL A CG1 1 
ATOM   842  C CG2 . VAL A 1 101 ? -4.107  80.237 41.296 1.00 29.74 ? 101  VAL A CG2 1 
ATOM   843  N N   . PRO A 1 102 ? -0.536  83.312 41.314 1.00 32.26 ? 102  PRO A N   1 
ATOM   844  C CA  . PRO A 1 102 ? 0.076   84.630 41.117 1.00 33.40 ? 102  PRO A CA  1 
ATOM   845  C C   . PRO A 1 102 ? -0.869  85.518 40.307 1.00 36.05 ? 102  PRO A C   1 
ATOM   846  O O   . PRO A 1 102 ? -1.726  85.020 39.571 1.00 34.61 ? 102  PRO A O   1 
ATOM   847  C CB  . PRO A 1 102 ? 1.346   84.310 40.337 1.00 33.50 ? 102  PRO A CB  1 
ATOM   848  C CG  . PRO A 1 102 ? 1.699   82.931 40.821 1.00 34.05 ? 102  PRO A CG  1 
ATOM   849  C CD  . PRO A 1 102 ? 0.362   82.240 40.847 1.00 32.69 ? 102  PRO A CD  1 
ATOM   850  N N   . SER A 1 103 ? -0.705  86.830 40.445 1.00 36.97 ? 103  SER A N   1 
ATOM   851  C CA  . SER A 1 103 ? -1.527  87.787 39.722 1.00 38.14 ? 103  SER A CA  1 
ATOM   852  C C   . SER A 1 103 ? -0.609  88.749 38.981 1.00 37.99 ? 103  SER A C   1 
ATOM   853  O O   . SER A 1 103 ? 0.301   89.321 39.574 1.00 39.08 ? 103  SER A O   1 
ATOM   854  C CB  . SER A 1 103 ? -2.410  88.575 40.703 1.00 39.12 ? 103  SER A CB  1 
ATOM   855  O OG  . SER A 1 103 ? -3.181  89.553 40.026 1.00 40.53 ? 103  SER A OG  1 
ATOM   856  N N   . PRO A 1 104 ? -0.809  88.910 37.662 1.00 37.67 ? 104  PRO A N   1 
ATOM   857  C CA  . PRO A 1 104 ? -1.855  88.286 36.840 1.00 37.06 ? 104  PRO A CA  1 
ATOM   858  C C   . PRO A 1 104 ? -1.710  86.763 36.734 1.00 36.02 ? 104  PRO A C   1 
ATOM   859  O O   . PRO A 1 104 ? -0.619  86.217 36.892 1.00 34.38 ? 104  PRO A O   1 
ATOM   860  C CB  . PRO A 1 104 ? -1.682  88.973 35.490 1.00 37.65 ? 104  PRO A CB  1 
ATOM   861  C CG  . PRO A 1 104 ? -0.209  89.244 35.445 1.00 39.68 ? 104  PRO A CG  1 
ATOM   862  C CD  . PRO A 1 104 ? 0.062   89.765 36.836 1.00 38.98 ? 104  PRO A CD  1 
ATOM   863  N N   . ARG A 1 105 ? -2.824  86.090 36.470 1.00 35.27 ? 105  ARG A N   1 
ATOM   864  C CA  . ARG A 1 105 ? -2.829  84.635 36.351 1.00 35.25 ? 105  ARG A CA  1 
ATOM   865  C C   . ARG A 1 105 ? -1.818  84.161 35.311 1.00 35.31 ? 105  ARG A C   1 
ATOM   866  O O   . ARG A 1 105 ? -1.800  84.648 34.181 1.00 34.49 ? 105  ARG A O   1 
ATOM   867  C CB  . ARG A 1 105 ? -4.227  84.142 35.964 1.00 35.02 ? 105  ARG A CB  1 
ATOM   868  C CG  . ARG A 1 105 ? -4.360  82.622 35.904 1.00 34.25 ? 105  ARG A CG  1 
ATOM   869  C CD  . ARG A 1 105 ? -5.675  82.219 35.267 1.00 32.42 ? 105  ARG A CD  1 
ATOM   870  N NE  . ARG A 1 105 ? -6.820  82.743 36.006 1.00 33.74 ? 105  ARG A NE  1 
ATOM   871  C CZ  . ARG A 1 105 ? -8.079  82.649 35.594 1.00 33.87 ? 105  ARG A CZ  1 
ATOM   872  N NH1 . ARG A 1 105 ? -8.357  82.048 34.444 1.00 34.59 ? 105  ARG A NH1 1 
ATOM   873  N NH2 . ARG A 1 105 ? -9.060  83.159 36.326 1.00 34.33 ? 105  ARG A NH2 1 
ATOM   874  N N   . PRO A 1 106 ? -0.946  83.211 35.685 1.00 34.36 ? 106  PRO A N   1 
ATOM   875  C CA  . PRO A 1 106 ? 0.040   82.722 34.716 1.00 34.57 ? 106  PRO A CA  1 
ATOM   876  C C   . PRO A 1 106 ? -0.627  81.858 33.649 1.00 33.55 ? 106  PRO A C   1 
ATOM   877  O O   . PRO A 1 106 ? -1.808  81.519 33.764 1.00 32.33 ? 106  PRO A O   1 
ATOM   878  C CB  . PRO A 1 106 ? 1.022   81.936 35.586 1.00 35.30 ? 106  PRO A CB  1 
ATOM   879  C CG  . PRO A 1 106 ? 0.157   81.430 36.697 1.00 37.16 ? 106  PRO A CG  1 
ATOM   880  C CD  . PRO A 1 106 ? -0.718  82.625 37.019 1.00 35.70 ? 106  PRO A CD  1 
ATOM   881  N N   . LYS A 1 107 ? 0.124   81.511 32.611 1.00 33.25 ? 107  LYS A N   1 
ATOM   882  C CA  . LYS A 1 107 ? -0.417  80.689 31.538 1.00 33.57 ? 107  LYS A CA  1 
ATOM   883  C C   . LYS A 1 107 ? -0.119  79.212 31.754 1.00 33.81 ? 107  LYS A C   1 
ATOM   884  O O   . LYS A 1 107 ? -1.009  78.372 31.645 1.00 33.50 ? 107  LYS A O   1 
ATOM   885  C CB  . LYS A 1 107 ? 0.150   81.134 30.187 1.00 34.43 ? 107  LYS A CB  1 
ATOM   886  C CG  . LYS A 1 107 ? -0.072  82.611 29.889 1.00 35.64 ? 107  LYS A CG  1 
ATOM   887  C CD  . LYS A 1 107 ? -1.545  82.977 30.009 1.00 38.97 ? 107  LYS A CD  1 
ATOM   888  C CE  . LYS A 1 107 ? -1.757  84.479 29.873 1.00 41.07 ? 107  LYS A CE  1 
ATOM   889  N NZ  . LYS A 1 107 ? -3.189  84.836 30.044 1.00 42.05 ? 107  LYS A NZ  1 
ATOM   890  N N   . SER A 1 108 ? 1.134   78.898 32.057 1.00 34.11 ? 108  SER A N   1 
ATOM   891  C CA  . SER A 1 108 ? 1.534   77.512 32.281 1.00 36.42 ? 108  SER A CA  1 
ATOM   892  C C   . SER A 1 108 ? 2.807   77.503 33.113 1.00 35.82 ? 108  SER A C   1 
ATOM   893  O O   . SER A 1 108 ? 3.901   77.293 32.589 1.00 37.66 ? 108  SER A O   1 
ATOM   894  C CB  . SER A 1 108 ? 1.783   76.819 30.940 1.00 37.14 ? 108  SER A CB  1 
ATOM   895  O OG  . SER A 1 108 ? 2.012   75.432 31.115 1.00 40.63 ? 108  SER A OG  1 
ATOM   896  N N   . THR A 1 109 ? 2.665   77.717 34.414 1.00 34.41 ? 109  THR A N   1 
ATOM   897  C CA  . THR A 1 109 ? 3.830   77.763 35.276 1.00 33.86 ? 109  THR A CA  1 
ATOM   898  C C   . THR A 1 109 ? 3.961   76.575 36.228 1.00 32.00 ? 109  THR A C   1 
ATOM   899  O O   . THR A 1 109 ? 3.061   75.743 36.354 1.00 29.82 ? 109  THR A O   1 
ATOM   900  C CB  . THR A 1 109 ? 3.860   79.078 36.095 1.00 35.19 ? 109  THR A CB  1 
ATOM   901  O OG1 . THR A 1 109 ? 5.169   79.262 36.648 1.00 39.12 ? 109  THR A OG1 1 
ATOM   902  C CG2 . THR A 1 109 ? 2.847   79.035 37.227 1.00 34.74 ? 109  THR A CG2 1 
ATOM   903  N N   . THR A 1 110 ? 5.114   76.511 36.878 1.00 30.51 ? 110  THR A N   1 
ATOM   904  C CA  . THR A 1 110 ? 5.434   75.461 37.832 1.00 29.97 ? 110  THR A CA  1 
ATOM   905  C C   . THR A 1 110 ? 4.394   75.347 38.942 1.00 28.49 ? 110  THR A C   1 
ATOM   906  O O   . THR A 1 110 ? 3.942   76.352 39.495 1.00 27.34 ? 110  THR A O   1 
ATOM   907  C CB  . THR A 1 110 ? 6.811   75.733 38.453 1.00 31.72 ? 110  THR A CB  1 
ATOM   908  O OG1 . THR A 1 110 ? 7.788   75.767 37.408 1.00 33.65 ? 110  THR A OG1 1 
ATOM   909  C CG2 . THR A 1 110 ? 7.181   74.655 39.475 1.00 32.95 ? 110  THR A CG2 1 
ATOM   910  N N   . VAL A 1 111 ? 4.027   74.107 39.260 1.00 26.88 ? 111  VAL A N   1 
ATOM   911  C CA  . VAL A 1 111 ? 3.044   73.806 40.298 1.00 24.99 ? 111  VAL A CA  1 
ATOM   912  C C   . VAL A 1 111 ? 3.683   73.010 41.445 1.00 26.03 ? 111  VAL A C   1 
ATOM   913  O O   . VAL A 1 111 ? 4.469   72.095 41.210 1.00 25.79 ? 111  VAL A O   1 
ATOM   914  C CB  . VAL A 1 111 ? 1.884   72.957 39.724 1.00 25.34 ? 111  VAL A CB  1 
ATOM   915  C CG1 . VAL A 1 111 ? 0.909   72.569 40.834 1.00 23.32 ? 111  VAL A CG1 1 
ATOM   916  C CG2 . VAL A 1 111 ? 1.173   73.726 38.614 1.00 26.13 ? 111  VAL A CG2 1 
ATOM   917  N N   . MET A 1 112 ? 3.349   73.375 42.678 1.00 25.39 ? 112  MET A N   1 
ATOM   918  C CA  . MET A 1 112 ? 3.852   72.679 43.862 1.00 25.48 ? 112  MET A CA  1 
ATOM   919  C C   . MET A 1 112 ? 2.632   72.306 44.692 1.00 25.44 ? 112  MET A C   1 
ATOM   920  O O   . MET A 1 112 ? 1.774   73.154 44.947 1.00 26.74 ? 112  MET A O   1 
ATOM   921  C CB  . MET A 1 112 ? 4.798   73.586 44.670 1.00 25.02 ? 112  MET A CB  1 
ATOM   922  C CG  . MET A 1 112 ? 6.111   73.893 43.946 1.00 26.69 ? 112  MET A CG  1 
ATOM   923  S SD  . MET A 1 112 ? 7.280   74.917 44.892 1.00 29.66 ? 112  MET A SD  1 
ATOM   924  C CE  . MET A 1 112 ? 8.068   73.652 45.956 1.00 30.20 ? 112  MET A CE  1 
ATOM   925  N N   . VAL A 1 113 ? 2.547   71.037 45.094 1.00 23.05 ? 113  VAL A N   1 
ATOM   926  C CA  . VAL A 1 113 ? 1.421   70.542 45.885 1.00 22.20 ? 113  VAL A CA  1 
ATOM   927  C C   . VAL A 1 113 ? 1.909   70.084 47.257 1.00 22.96 ? 113  VAL A C   1 
ATOM   928  O O   . VAL A 1 113 ? 2.679   69.132 47.357 1.00 23.03 ? 113  VAL A O   1 
ATOM   929  C CB  . VAL A 1 113 ? 0.729   69.336 45.196 1.00 22.10 ? 113  VAL A CB  1 
ATOM   930  C CG1 . VAL A 1 113 ? -0.448  68.867 46.042 1.00 22.15 ? 113  VAL A CG1 1 
ATOM   931  C CG2 . VAL A 1 113 ? 0.269   69.718 43.800 1.00 21.71 ? 113  VAL A CG2 1 
ATOM   932  N N   . TRP A 1 114 ? 1.435   70.753 48.303 1.00 22.02 ? 114  TRP A N   1 
ATOM   933  C CA  . TRP A 1 114 ? 1.829   70.444 49.673 1.00 23.32 ? 114  TRP A CA  1 
ATOM   934  C C   . TRP A 1 114 ? 0.965   69.371 50.329 1.00 23.60 ? 114  TRP A C   1 
ATOM   935  O O   . TRP A 1 114 ? -0.267  69.401 50.244 1.00 24.10 ? 114  TRP A O   1 
ATOM   936  C CB  . TRP A 1 114 ? 1.793   71.733 50.513 1.00 23.85 ? 114  TRP A CB  1 
ATOM   937  C CG  . TRP A 1 114 ? 2.046   71.546 51.993 1.00 23.33 ? 114  TRP A CG  1 
ATOM   938  C CD1 . TRP A 1 114 ? 1.128   71.637 53.000 1.00 22.63 ? 114  TRP A CD1 1 
ATOM   939  C CD2 . TRP A 1 114 ? 3.302   71.259 52.620 1.00 23.71 ? 114  TRP A CD2 1 
ATOM   940  N NE1 . TRP A 1 114 ? 1.736   71.429 54.221 1.00 23.10 ? 114  TRP A NE1 1 
ATOM   941  C CE2 . TRP A 1 114 ? 3.070   71.194 54.014 1.00 25.41 ? 114  TRP A CE2 1 
ATOM   942  C CE3 . TRP A 1 114 ? 4.602   71.053 52.140 1.00 24.20 ? 114  TRP A CE3 1 
ATOM   943  C CZ2 . TRP A 1 114 ? 4.092   70.930 54.935 1.00 26.39 ? 114  TRP A CZ2 1 
ATOM   944  C CZ3 . TRP A 1 114 ? 5.621   70.791 53.057 1.00 24.76 ? 114  TRP A CZ3 1 
ATOM   945  C CH2 . TRP A 1 114 ? 5.357   70.732 54.439 1.00 24.90 ? 114  TRP A CH2 1 
ATOM   946  N N   . ILE A 1 115 ? 1.625   68.422 50.986 1.00 22.76 ? 115  ILE A N   1 
ATOM   947  C CA  . ILE A 1 115 ? 0.940   67.349 51.694 1.00 21.82 ? 115  ILE A CA  1 
ATOM   948  C C   . ILE A 1 115 ? 1.359   67.468 53.160 1.00 21.76 ? 115  ILE A C   1 
ATOM   949  O O   . ILE A 1 115 ? 2.516   67.213 53.503 1.00 21.59 ? 115  ILE A O   1 
ATOM   950  C CB  . ILE A 1 115 ? 1.350   65.960 51.160 1.00 23.17 ? 115  ILE A CB  1 
ATOM   951  C CG1 . ILE A 1 115 ? 1.054   65.867 49.657 1.00 23.82 ? 115  ILE A CG1 1 
ATOM   952  C CG2 . ILE A 1 115 ? 0.595   64.866 51.937 1.00 22.40 ? 115  ILE A CG2 1 
ATOM   953  C CD1 . ILE A 1 115 ? 1.433   64.524 49.022 1.00 24.53 ? 115  ILE A CD1 1 
ATOM   954  N N   . TYR A 1 116 ? 0.428   67.868 54.020 1.00 21.42 ? 116  TYR A N   1 
ATOM   955  C CA  . TYR A 1 116 ? 0.748   68.037 55.434 1.00 22.35 ? 116  TYR A CA  1 
ATOM   956  C C   . TYR A 1 116 ? 1.081   66.747 56.159 1.00 23.71 ? 116  TYR A C   1 
ATOM   957  O O   . TYR A 1 116 ? 0.662   65.657 55.758 1.00 22.68 ? 116  TYR A O   1 
ATOM   958  C CB  . TYR A 1 116 ? -0.390  68.768 56.172 1.00 22.78 ? 116  TYR A CB  1 
ATOM   959  C CG  . TYR A 1 116 ? -1.749  68.090 56.160 1.00 22.34 ? 116  TYR A CG  1 
ATOM   960  C CD1 . TYR A 1 116 ? -1.983  66.918 56.888 1.00 23.85 ? 116  TYR A CD1 1 
ATOM   961  C CD2 . TYR A 1 116 ? -2.813  68.642 55.445 1.00 22.38 ? 116  TYR A CD2 1 
ATOM   962  C CE1 . TYR A 1 116 ? -3.249  66.316 56.903 1.00 23.71 ? 116  TYR A CE1 1 
ATOM   963  C CE2 . TYR A 1 116 ? -4.082  68.046 55.452 1.00 23.25 ? 116  TYR A CE2 1 
ATOM   964  C CZ  . TYR A 1 116 ? -4.291  66.886 56.182 1.00 24.33 ? 116  TYR A CZ  1 
ATOM   965  O OH  . TYR A 1 116 ? -5.537  66.293 56.181 1.00 24.68 ? 116  TYR A OH  1 
ATOM   966  N N   . GLY A 1 117 ? 1.859   66.889 57.228 1.00 24.26 ? 117  GLY A N   1 
ATOM   967  C CA  . GLY A 1 117 ? 2.240   65.751 58.041 1.00 23.90 ? 117  GLY A CA  1 
ATOM   968  C C   . GLY A 1 117 ? 1.382   65.732 59.292 1.00 24.65 ? 117  GLY A C   1 
ATOM   969  O O   . GLY A 1 117 ? 0.367   66.436 59.368 1.00 25.64 ? 117  GLY A O   1 
ATOM   970  N N   . GLY A 1 118 ? 1.792   64.936 60.275 1.00 23.24 ? 118  GLY A N   1 
ATOM   971  C CA  . GLY A 1 118 ? 1.039   64.819 61.510 1.00 23.37 ? 118  GLY A CA  1 
ATOM   972  C C   . GLY A 1 118 ? 0.908   63.363 61.937 1.00 22.97 ? 118  GLY A C   1 
ATOM   973  O O   . GLY A 1 118 ? -0.086  62.976 62.546 1.00 24.04 ? 118  GLY A O   1 
ATOM   974  N N   . GLY A 1 119 ? 1.914   62.556 61.599 1.00 23.35 ? 119  GLY A N   1 
ATOM   975  C CA  . GLY A 1 119 ? 1.921   61.147 61.969 1.00 23.82 ? 119  GLY A CA  1 
ATOM   976  C C   . GLY A 1 119 ? 0.748   60.306 61.493 1.00 24.83 ? 119  GLY A C   1 
ATOM   977  O O   . GLY A 1 119 ? 0.486   59.236 62.053 1.00 23.88 ? 119  GLY A O   1 
ATOM   978  N N   . PHE A 1 120 ? 0.059   60.779 60.457 1.00 23.47 ? 120  PHE A N   1 
ATOM   979  C CA  . PHE A 1 120 ? -1.109  60.094 59.889 1.00 24.33 ? 120  PHE A CA  1 
ATOM   980  C C   . PHE A 1 120 ? -2.313  60.090 60.826 1.00 24.17 ? 120  PHE A C   1 
ATOM   981  O O   . PHE A 1 120 ? -3.357  59.505 60.511 1.00 24.66 ? 120  PHE A O   1 
ATOM   982  C CB  . PHE A 1 120 ? -0.762  58.652 59.479 1.00 23.79 ? 120  PHE A CB  1 
ATOM   983  C CG  . PHE A 1 120 ? 0.162   58.562 58.285 1.00 23.59 ? 120  PHE A CG  1 
ATOM   984  C CD1 . PHE A 1 120 ? -0.244  59.028 57.037 1.00 23.13 ? 120  PHE A CD1 1 
ATOM   985  C CD2 . PHE A 1 120 ? 1.438   58.013 58.410 1.00 23.15 ? 120  PHE A CD2 1 
ATOM   986  C CE1 . PHE A 1 120 ? 0.600   58.952 55.933 1.00 23.57 ? 120  PHE A CE1 1 
ATOM   987  C CE2 . PHE A 1 120 ? 2.293   57.931 57.307 1.00 22.72 ? 120  PHE A CE2 1 
ATOM   988  C CZ  . PHE A 1 120 ? 1.873   58.401 56.066 1.00 24.10 ? 120  PHE A CZ  1 
ATOM   989  N N   . TYR A 1 121 ? -2.181  60.741 61.979 1.00 23.70 ? 121  TYR A N   1 
ATOM   990  C CA  . TYR A 1 121 ? -3.286  60.813 62.928 1.00 24.44 ? 121  TYR A CA  1 
ATOM   991  C C   . TYR A 1 121 ? -3.791  62.246 63.087 1.00 25.78 ? 121  TYR A C   1 
ATOM   992  O O   . TYR A 1 121 ? -4.781  62.487 63.773 1.00 25.47 ? 121  TYR A O   1 
ATOM   993  C CB  . TYR A 1 121 ? -2.866  60.253 64.298 1.00 26.22 ? 121  TYR A CB  1 
ATOM   994  C CG  . TYR A 1 121 ? -1.882  61.113 65.070 1.00 26.15 ? 121  TYR A CG  1 
ATOM   995  C CD1 . TYR A 1 121 ? -2.326  62.165 65.872 1.00 27.09 ? 121  TYR A CD1 1 
ATOM   996  C CD2 . TYR A 1 121 ? -0.507  60.885 64.985 1.00 24.46 ? 121  TYR A CD2 1 
ATOM   997  C CE1 . TYR A 1 121 ? -1.423  62.975 66.575 1.00 26.90 ? 121  TYR A CE1 1 
ATOM   998  C CE2 . TYR A 1 121 ? 0.403   61.686 65.679 1.00 26.35 ? 121  TYR A CE2 1 
ATOM   999  C CZ  . TYR A 1 121 ? -0.064  62.730 66.472 1.00 29.40 ? 121  TYR A CZ  1 
ATOM   1000 O OH  . TYR A 1 121 ? 0.829   63.528 67.156 1.00 30.27 ? 121  TYR A OH  1 
ATOM   1001 N N   . SER A 1 122 ? -3.111  63.195 62.450 1.00 24.85 ? 122  SER A N   1 
ATOM   1002 C CA  . SER A 1 122 ? -3.501  64.597 62.555 1.00 25.12 ? 122  SER A CA  1 
ATOM   1003 C C   . SER A 1 122 ? -2.989  65.387 61.365 1.00 25.82 ? 122  SER A C   1 
ATOM   1004 O O   . SER A 1 122 ? -2.317  64.838 60.488 1.00 24.81 ? 122  SER A O   1 
ATOM   1005 C CB  . SER A 1 122 ? -2.939  65.209 63.843 1.00 27.28 ? 122  SER A CB  1 
ATOM   1006 O OG  . SER A 1 122 ? -1.516  65.203 63.829 1.00 24.14 ? 122  SER A OG  1 
ATOM   1007 N N   . GLY A 1 123 ? -3.321  66.676 61.341 1.00 24.17 ? 123  GLY A N   1 
ATOM   1008 C CA  . GLY A 1 123 ? -2.883  67.537 60.258 1.00 24.73 ? 123  GLY A CA  1 
ATOM   1009 C C   . GLY A 1 123 ? -4.007  68.346 59.632 1.00 25.09 ? 123  GLY A C   1 
ATOM   1010 O O   . GLY A 1 123 ? -5.154  67.907 59.608 1.00 25.27 ? 123  GLY A O   1 
ATOM   1011 N N   . SER A 1 124 ? -3.672  69.529 59.126 1.00 25.17 ? 124  SER A N   1 
ATOM   1012 C CA  . SER A 1 124 ? -4.649  70.415 58.493 1.00 27.00 ? 124  SER A CA  1 
ATOM   1013 C C   . SER A 1 124 ? -3.950  71.188 57.386 1.00 25.12 ? 124  SER A C   1 
ATOM   1014 O O   . SER A 1 124 ? -2.777  71.520 57.500 1.00 26.95 ? 124  SER A O   1 
ATOM   1015 C CB  . SER A 1 124 ? -5.220  71.413 59.512 1.00 28.56 ? 124  SER A CB  1 
ATOM   1016 O OG  . SER A 1 124 ? -5.880  70.752 60.576 1.00 29.42 ? 124  SER A OG  1 
ATOM   1017 N N   . SER A 1 125 ? -4.671  71.475 56.313 1.00 26.68 ? 125  SER A N   1 
ATOM   1018 C CA  . SER A 1 125 ? -4.091  72.221 55.206 1.00 26.86 ? 125  SER A CA  1 
ATOM   1019 C C   . SER A 1 125 ? -4.211  73.722 55.466 1.00 29.12 ? 125  SER A C   1 
ATOM   1020 O O   . SER A 1 125 ? -3.602  74.532 54.772 1.00 31.51 ? 125  SER A O   1 
ATOM   1021 C CB  . SER A 1 125 ? -4.835  71.893 53.913 1.00 27.15 ? 125  SER A CB  1 
ATOM   1022 O OG  . SER A 1 125 ? -6.167  72.378 53.977 1.00 27.09 ? 125  SER A OG  1 
ATOM   1023 N N   . THR A 1 126 ? -4.978  74.072 56.493 1.00 28.90 ? 126  THR A N   1 
ATOM   1024 C CA  . THR A 1 126 ? -5.267  75.465 56.820 1.00 29.84 ? 126  THR A CA  1 
ATOM   1025 C C   . THR A 1 126 ? -4.416  76.167 57.878 1.00 30.43 ? 126  THR A C   1 
ATOM   1026 O O   . THR A 1 126 ? -4.701  77.313 58.227 1.00 29.50 ? 126  THR A O   1 
ATOM   1027 C CB  . THR A 1 126 ? -6.734  75.585 57.246 1.00 29.83 ? 126  THR A CB  1 
ATOM   1028 O OG1 . THR A 1 126 ? -6.942  74.812 58.437 1.00 28.86 ? 126  THR A OG1 1 
ATOM   1029 C CG2 . THR A 1 126 ? -7.643  75.041 56.157 1.00 29.91 ? 126  THR A CG2 1 
ATOM   1030 N N   . LEU A 1 127 ? -3.385  75.501 58.388 1.00 28.93 ? 127  LEU A N   1 
ATOM   1031 C CA  . LEU A 1 127 ? -2.530  76.108 59.410 1.00 30.55 ? 127  LEU A CA  1 
ATOM   1032 C C   . LEU A 1 127 ? -1.867  77.387 58.902 1.00 30.77 ? 127  LEU A C   1 
ATOM   1033 O O   . LEU A 1 127 ? -1.521  77.485 57.726 1.00 28.97 ? 127  LEU A O   1 
ATOM   1034 C CB  . LEU A 1 127 ? -1.444  75.120 59.851 1.00 29.10 ? 127  LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 127 ? -1.915  73.748 60.346 1.00 30.31 ? 127  LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 127 ? -0.711  72.972 60.881 1.00 28.70 ? 127  LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 127 ? -2.963  73.911 61.435 1.00 28.51 ? 127  LEU A CD2 1 
ATOM   1038 N N   . ASP A 1 128 ? -1.686  78.363 59.788 1.00 32.25 ? 128  ASP A N   1 
ATOM   1039 C CA  . ASP A 1 128 ? -1.047  79.621 59.402 1.00 33.56 ? 128  ASP A CA  1 
ATOM   1040 C C   . ASP A 1 128 ? 0.326   79.342 58.811 1.00 32.59 ? 128  ASP A C   1 
ATOM   1041 O O   . ASP A 1 128 ? 0.779   80.037 57.901 1.00 32.27 ? 128  ASP A O   1 
ATOM   1042 C CB  . ASP A 1 128 ? -0.876  80.554 60.608 1.00 36.18 ? 128  ASP A CB  1 
ATOM   1043 C CG  . ASP A 1 128 ? -2.198  80.964 61.228 1.00 40.20 ? 128  ASP A CG  1 
ATOM   1044 O OD1 . ASP A 1 128 ? -3.177  81.150 60.481 1.00 42.79 ? 128  ASP A OD1 1 
ATOM   1045 O OD2 . ASP A 1 128 ? -2.254  81.119 62.467 1.00 46.16 ? 128  ASP A OD2 1 
ATOM   1046 N N   . VAL A 1 129 ? 0.988   78.318 59.335 1.00 31.47 ? 129  VAL A N   1 
ATOM   1047 C CA  . VAL A 1 129 ? 2.317   77.972 58.864 1.00 29.50 ? 129  VAL A CA  1 
ATOM   1048 C C   . VAL A 1 129 ? 2.315   77.368 57.451 1.00 29.00 ? 129  VAL A C   1 
ATOM   1049 O O   . VAL A 1 129 ? 3.369   77.259 56.820 1.00 29.21 ? 129  VAL A O   1 
ATOM   1050 C CB  . VAL A 1 129 ? 3.021   77.022 59.875 1.00 31.70 ? 129  VAL A CB  1 
ATOM   1051 C CG1 . VAL A 1 129 ? 2.382   75.645 59.844 1.00 30.77 ? 129  VAL A CG1 1 
ATOM   1052 C CG2 . VAL A 1 129 ? 4.501   76.954 59.581 1.00 31.56 ? 129  VAL A CG2 1 
ATOM   1053 N N   . TYR A 1 130 ? 1.138   76.990 56.946 1.00 27.01 ? 130  TYR A N   1 
ATOM   1054 C CA  . TYR A 1 130 ? 1.046   76.433 55.593 1.00 26.50 ? 130  TYR A CA  1 
ATOM   1055 C C   . TYR A 1 130 ? 0.429   77.425 54.597 1.00 28.26 ? 130  TYR A C   1 
ATOM   1056 O O   . TYR A 1 130 ? 0.032   77.034 53.498 1.00 27.44 ? 130  TYR A O   1 
ATOM   1057 C CB  . TYR A 1 130 ? 0.203   75.147 55.560 1.00 25.95 ? 130  TYR A CB  1 
ATOM   1058 C CG  . TYR A 1 130 ? 0.689   74.011 56.438 1.00 24.92 ? 130  TYR A CG  1 
ATOM   1059 C CD1 . TYR A 1 130 ? 2.041   73.873 56.765 1.00 24.37 ? 130  TYR A CD1 1 
ATOM   1060 C CD2 . TYR A 1 130 ? -0.210  73.066 56.932 1.00 25.62 ? 130  TYR A CD2 1 
ATOM   1061 C CE1 . TYR A 1 130 ? 2.482   72.815 57.573 1.00 24.88 ? 130  TYR A CE1 1 
ATOM   1062 C CE2 . TYR A 1 130 ? 0.217   72.011 57.736 1.00 24.76 ? 130  TYR A CE2 1 
ATOM   1063 C CZ  . TYR A 1 130 ? 1.563   71.892 58.053 1.00 24.91 ? 130  TYR A CZ  1 
ATOM   1064 O OH  . TYR A 1 130 ? 1.970   70.853 58.858 1.00 25.11 ? 130  TYR A OH  1 
ATOM   1065 N N   . ASN A 1 131 ? 0.336   78.698 54.976 1.00 28.72 ? 131  ASN A N   1 
ATOM   1066 C CA  . ASN A 1 131 ? -0.236  79.703 54.077 1.00 30.43 ? 131  ASN A CA  1 
ATOM   1067 C C   . ASN A 1 131 ? 0.655   79.802 52.839 1.00 28.86 ? 131  ASN A C   1 
ATOM   1068 O O   . ASN A 1 131 ? 1.783   80.291 52.910 1.00 29.81 ? 131  ASN A O   1 
ATOM   1069 C CB  . ASN A 1 131 ? -0.308  81.064 54.773 1.00 31.23 ? 131  ASN A CB  1 
ATOM   1070 C CG  . ASN A 1 131 ? -1.210  82.047 54.044 1.00 33.67 ? 131  ASN A CG  1 
ATOM   1071 O OD1 . ASN A 1 131 ? -1.294  82.038 52.816 1.00 33.50 ? 131  ASN A OD1 1 
ATOM   1072 N ND2 . ASN A 1 131 ? -1.881  82.911 54.803 1.00 37.43 ? 131  ASN A ND2 1 
ATOM   1073 N N   . GLY A 1 132 ? 0.144   79.354 51.699 1.00 29.31 ? 132  GLY A N   1 
ATOM   1074 C CA  . GLY A 1 132 ? 0.945   79.371 50.488 1.00 29.46 ? 132  GLY A CA  1 
ATOM   1075 C C   . GLY A 1 132 ? 1.101   80.680 49.737 1.00 30.07 ? 132  GLY A C   1 
ATOM   1076 O O   . GLY A 1 132 ? 1.773   80.715 48.710 1.00 28.28 ? 132  GLY A O   1 
ATOM   1077 N N   . LYS A 1 133 ? 0.518   81.763 50.240 1.00 31.05 ? 133  LYS A N   1 
ATOM   1078 C CA  . LYS A 1 133 ? 0.604   83.033 49.526 1.00 31.27 ? 133  LYS A CA  1 
ATOM   1079 C C   . LYS A 1 133 ? 2.010   83.608 49.377 1.00 31.96 ? 133  LYS A C   1 
ATOM   1080 O O   . LYS A 1 133 ? 2.330   84.197 48.346 1.00 32.26 ? 133  LYS A O   1 
ATOM   1081 C CB  . LYS A 1 133 ? -0.325  84.069 50.175 1.00 31.02 ? 133  LYS A CB  1 
ATOM   1082 C CG  . LYS A 1 133 ? 0.111   84.603 51.532 1.00 32.39 ? 133  LYS A CG  1 
ATOM   1083 C CD  . LYS A 1 133 ? -0.947  85.566 52.060 1.00 34.35 ? 133  LYS A CD  1 
ATOM   1084 C CE  . LYS A 1 133 ? -0.468  86.325 53.285 1.00 34.17 ? 133  LYS A CE  1 
ATOM   1085 N NZ  . LYS A 1 133 ? -1.503  87.286 53.765 1.00 35.04 ? 133  LYS A NZ  1 
ATOM   1086 N N   . TYR A 1 134 ? 2.853   83.428 50.391 1.00 32.11 ? 134  TYR A N   1 
ATOM   1087 C CA  . TYR A 1 134 ? 4.213   83.961 50.341 1.00 32.66 ? 134  TYR A CA  1 
ATOM   1088 C C   . TYR A 1 134 ? 5.060   83.262 49.289 1.00 33.64 ? 134  TYR A C   1 
ATOM   1089 O O   . TYR A 1 134 ? 5.769   83.908 48.515 1.00 32.59 ? 134  TYR A O   1 
ATOM   1090 C CB  . TYR A 1 134 ? 4.872   83.826 51.717 1.00 33.09 ? 134  TYR A CB  1 
ATOM   1091 C CG  . TYR A 1 134 ? 4.055   84.441 52.824 1.00 34.17 ? 134  TYR A CG  1 
ATOM   1092 C CD1 . TYR A 1 134 ? 3.872   85.824 52.895 1.00 35.11 ? 134  TYR A CD1 1 
ATOM   1093 C CD2 . TYR A 1 134 ? 3.427   83.643 53.780 1.00 34.16 ? 134  TYR A CD2 1 
ATOM   1094 C CE1 . TYR A 1 134 ? 3.082   86.397 53.891 1.00 34.80 ? 134  TYR A CE1 1 
ATOM   1095 C CE2 . TYR A 1 134 ? 2.636   84.205 54.779 1.00 35.98 ? 134  TYR A CE2 1 
ATOM   1096 C CZ  . TYR A 1 134 ? 2.467   85.580 54.827 1.00 36.03 ? 134  TYR A CZ  1 
ATOM   1097 O OH  . TYR A 1 134 ? 1.679   86.133 55.807 1.00 38.47 ? 134  TYR A OH  1 
ATOM   1098 N N   . LEU A 1 135 ? 4.981   81.937 49.260 1.00 32.62 ? 135  LEU A N   1 
ATOM   1099 C CA  . LEU A 1 135 ? 5.745   81.146 48.307 1.00 32.77 ? 135  LEU A CA  1 
ATOM   1100 C C   . LEU A 1 135 ? 5.244   81.366 46.881 1.00 32.82 ? 135  LEU A C   1 
ATOM   1101 O O   . LEU A 1 135 ? 6.038   81.543 45.957 1.00 33.38 ? 135  LEU A O   1 
ATOM   1102 C CB  . LEU A 1 135 ? 5.651   79.662 48.688 1.00 35.78 ? 135  LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 135 ? 6.499   78.637 47.939 1.00 37.14 ? 135  LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 135 ? 7.971   79.029 47.989 1.00 35.99 ? 135  LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 135 ? 6.286   77.265 48.579 1.00 37.29 ? 135  LEU A CD2 1 
ATOM   1106 N N   . ALA A 1 136 ? 3.926   81.363 46.706 1.00 32.18 ? 136  ALA A N   1 
ATOM   1107 C CA  . ALA A 1 136 ? 3.335   81.560 45.387 1.00 32.61 ? 136  ALA A CA  1 
ATOM   1108 C C   . ALA A 1 136 ? 3.699   82.931 44.828 1.00 33.49 ? 136  ALA A C   1 
ATOM   1109 O O   . ALA A 1 136 ? 4.079   83.062 43.664 1.00 33.91 ? 136  ALA A O   1 
ATOM   1110 C CB  . ALA A 1 136 ? 1.819   81.414 45.464 1.00 30.78 ? 136  ALA A CB  1 
ATOM   1111 N N   . TYR A 1 137 ? 3.589   83.949 45.671 1.00 34.30 ? 137  TYR A N   1 
ATOM   1112 C CA  . TYR A 1 137 ? 3.897   85.315 45.269 1.00 33.98 ? 137  TYR A CA  1 
ATOM   1113 C C   . TYR A 1 137 ? 5.382   85.520 44.993 1.00 33.73 ? 137  TYR A C   1 
ATOM   1114 O O   . TYR A 1 137 ? 5.769   86.021 43.939 1.00 33.05 ? 137  TYR A O   1 
ATOM   1115 C CB  . TYR A 1 137 ? 3.447   86.287 46.359 1.00 35.81 ? 137  TYR A CB  1 
ATOM   1116 C CG  . TYR A 1 137 ? 3.918   87.707 46.144 1.00 37.83 ? 137  TYR A CG  1 
ATOM   1117 C CD1 . TYR A 1 137 ? 3.436   88.470 45.082 1.00 39.87 ? 137  TYR A CD1 1 
ATOM   1118 C CD2 . TYR A 1 137 ? 4.868   88.278 46.989 1.00 39.09 ? 137  TYR A CD2 1 
ATOM   1119 C CE1 . TYR A 1 137 ? 3.892   89.772 44.864 1.00 41.50 ? 137  TYR A CE1 1 
ATOM   1120 C CE2 . TYR A 1 137 ? 5.331   89.577 46.780 1.00 40.49 ? 137  TYR A CE2 1 
ATOM   1121 C CZ  . TYR A 1 137 ? 4.840   90.314 45.719 1.00 40.67 ? 137  TYR A CZ  1 
ATOM   1122 O OH  . TYR A 1 137 ? 5.298   91.593 45.515 1.00 43.82 ? 137  TYR A OH  1 
ATOM   1123 N N   . THR A 1 138 ? 6.215   85.115 45.942 1.00 33.47 ? 138  THR A N   1 
ATOM   1124 C CA  . THR A 1 138 ? 7.656   85.293 45.817 1.00 34.20 ? 138  THR A CA  1 
ATOM   1125 C C   . THR A 1 138 ? 8.313   84.519 44.678 1.00 35.08 ? 138  THR A C   1 
ATOM   1126 O O   . THR A 1 138 ? 9.119   85.076 43.929 1.00 35.86 ? 138  THR A O   1 
ATOM   1127 C CB  . THR A 1 138 ? 8.365   84.916 47.129 1.00 33.72 ? 138  THR A CB  1 
ATOM   1128 O OG1 . THR A 1 138 ? 7.797   85.664 48.208 1.00 32.98 ? 138  THR A OG1 1 
ATOM   1129 C CG2 . THR A 1 138 ? 9.850   85.220 47.040 1.00 33.49 ? 138  THR A CG2 1 
ATOM   1130 N N   . GLU A 1 139 ? 7.971   83.243 44.536 1.00 33.07 ? 139  GLU A N   1 
ATOM   1131 C CA  . GLU A 1 139 ? 8.583   82.427 43.495 1.00 34.10 ? 139  GLU A CA  1 
ATOM   1132 C C   . GLU A 1 139 ? 7.759   82.278 42.220 1.00 33.63 ? 139  GLU A C   1 
ATOM   1133 O O   . GLU A 1 139 ? 8.191   81.627 41.270 1.00 33.39 ? 139  GLU A O   1 
ATOM   1134 C CB  . GLU A 1 139 ? 8.930   81.049 44.064 1.00 34.69 ? 139  GLU A CB  1 
ATOM   1135 C CG  . GLU A 1 139 ? 10.031  81.083 45.122 1.00 34.87 ? 139  GLU A CG  1 
ATOM   1136 C CD  . GLU A 1 139 ? 11.350  81.606 44.577 1.00 35.65 ? 139  GLU A CD  1 
ATOM   1137 O OE1 . GLU A 1 139 ? 11.752  81.176 43.477 1.00 37.85 ? 139  GLU A OE1 1 
ATOM   1138 O OE2 . GLU A 1 139 ? 11.993  82.439 45.248 1.00 37.31 ? 139  GLU A OE2 1 
ATOM   1139 N N   . GLU A 1 140 ? 6.580   82.892 42.201 1.00 33.75 ? 140  GLU A N   1 
ATOM   1140 C CA  . GLU A 1 140 ? 5.697   82.847 41.039 1.00 36.61 ? 140  GLU A CA  1 
ATOM   1141 C C   . GLU A 1 140 ? 5.302   81.433 40.620 1.00 35.53 ? 140  GLU A C   1 
ATOM   1142 O O   . GLU A 1 140 ? 5.398   81.066 39.450 1.00 36.08 ? 140  GLU A O   1 
ATOM   1143 C CB  . GLU A 1 140 ? 6.348   83.570 39.856 1.00 41.12 ? 140  GLU A CB  1 
ATOM   1144 C CG  . GLU A 1 140 ? 6.802   84.986 40.173 1.00 47.89 ? 140  GLU A CG  1 
ATOM   1145 C CD  . GLU A 1 140 ? 7.279   85.736 38.942 1.00 51.64 ? 140  GLU A CD  1 
ATOM   1146 O OE1 . GLU A 1 140 ? 6.426   86.127 38.118 1.00 54.24 ? 140  GLU A OE1 1 
ATOM   1147 O OE2 . GLU A 1 140 ? 8.505   85.929 38.795 1.00 54.69 ? 140  GLU A OE2 1 
ATOM   1148 N N   . VAL A 1 141 ? 4.865   80.636 41.585 1.00 33.24 ? 141  VAL A N   1 
ATOM   1149 C CA  . VAL A 1 141 ? 4.430   79.283 41.290 1.00 31.16 ? 141  VAL A CA  1 
ATOM   1150 C C   . VAL A 1 141 ? 2.986   79.150 41.732 1.00 29.79 ? 141  VAL A C   1 
ATOM   1151 O O   . VAL A 1 141 ? 2.499   79.948 42.533 1.00 30.50 ? 141  VAL A O   1 
ATOM   1152 C CB  . VAL A 1 141 ? 5.260   78.215 42.057 1.00 31.81 ? 141  VAL A CB  1 
ATOM   1153 C CG1 . VAL A 1 141 ? 6.728   78.311 41.681 1.00 32.35 ? 141  VAL A CG1 1 
ATOM   1154 C CG2 . VAL A 1 141 ? 5.085   78.391 43.559 1.00 31.08 ? 141  VAL A CG2 1 
ATOM   1155 N N   . VAL A 1 142 ? 2.295   78.158 41.184 1.00 27.82 ? 142  VAL A N   1 
ATOM   1156 C CA  . VAL A 1 142 ? 0.928   77.892 41.592 1.00 27.99 ? 142  VAL A CA  1 
ATOM   1157 C C   . VAL A 1 142 ? 1.103   76.918 42.753 1.00 29.01 ? 142  VAL A C   1 
ATOM   1158 O O   . VAL A 1 142 ? 1.653   75.827 42.579 1.00 28.49 ? 142  VAL A O   1 
ATOM   1159 C CB  . VAL A 1 142 ? 0.116   77.239 40.459 1.00 28.43 ? 142  VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 142 ? -1.208  76.722 40.993 1.00 28.32 ? 142  VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 142 ? -0.139  78.266 39.362 1.00 28.84 ? 142  VAL A CG2 1 
ATOM   1162 N N   . LEU A 1 143 ? 0.663   77.326 43.939 1.00 29.07 ? 143  LEU A N   1 
ATOM   1163 C CA  . LEU A 1 143 ? 0.807   76.499 45.131 1.00 28.21 ? 143  LEU A CA  1 
ATOM   1164 C C   . LEU A 1 143 ? -0.518  75.879 45.555 1.00 28.24 ? 143  LEU A C   1 
ATOM   1165 O O   . LEU A 1 143 ? -1.518  76.579 45.747 1.00 27.31 ? 143  LEU A O   1 
ATOM   1166 C CB  . LEU A 1 143 ? 1.392   77.342 46.275 1.00 29.63 ? 143  LEU A CB  1 
ATOM   1167 C CG  . LEU A 1 143 ? 1.905   76.663 47.555 1.00 32.40 ? 143  LEU A CG  1 
ATOM   1168 C CD1 . LEU A 1 143 ? 0.753   76.081 48.351 1.00 33.68 ? 143  LEU A CD1 1 
ATOM   1169 C CD2 . LEU A 1 143 ? 2.909   75.583 47.195 1.00 33.74 ? 143  LEU A CD2 1 
ATOM   1170 N N   . VAL A 1 144 ? -0.514  74.557 45.698 1.00 25.54 ? 144  VAL A N   1 
ATOM   1171 C CA  . VAL A 1 144 ? -1.705  73.820 46.097 1.00 24.56 ? 144  VAL A CA  1 
ATOM   1172 C C   . VAL A 1 144 ? -1.476  73.056 47.399 1.00 24.57 ? 144  VAL A C   1 
ATOM   1173 O O   . VAL A 1 144 ? -0.405  72.488 47.615 1.00 25.61 ? 144  VAL A O   1 
ATOM   1174 C CB  . VAL A 1 144 ? -2.104  72.758 45.030 1.00 23.56 ? 144  VAL A CB  1 
ATOM   1175 C CG1 . VAL A 1 144 ? -3.364  72.003 45.480 1.00 24.65 ? 144  VAL A CG1 1 
ATOM   1176 C CG2 . VAL A 1 144 ? -2.331  73.419 43.675 1.00 23.83 ? 144  VAL A CG2 1 
ATOM   1177 N N   . SER A 1 145 ? -2.468  73.064 48.279 1.00 24.07 ? 145  SER A N   1 
ATOM   1178 C CA  . SER A 1 145 ? -2.365  72.271 49.497 1.00 24.80 ? 145  SER A CA  1 
ATOM   1179 C C   . SER A 1 145 ? -3.602  71.383 49.494 1.00 25.77 ? 145  SER A C   1 
ATOM   1180 O O   . SER A 1 145 ? -4.720  71.853 49.296 1.00 25.37 ? 145  SER A O   1 
ATOM   1181 C CB  . SER A 1 145 ? -2.296  73.142 50.768 1.00 25.61 ? 145  SER A CB  1 
ATOM   1182 O OG  . SER A 1 145 ? -3.444  73.953 50.962 1.00 27.21 ? 145  SER A OG  1 
ATOM   1183 N N   . LEU A 1 146 ? -3.398  70.085 49.662 1.00 26.30 ? 146  LEU A N   1 
ATOM   1184 C CA  . LEU A 1 146 ? -4.520  69.156 49.675 1.00 25.79 ? 146  LEU A CA  1 
ATOM   1185 C C   . LEU A 1 146 ? -4.812  68.713 51.102 1.00 26.26 ? 146  LEU A C   1 
ATOM   1186 O O   . LEU A 1 146 ? -4.172  69.168 52.046 1.00 25.29 ? 146  LEU A O   1 
ATOM   1187 C CB  . LEU A 1 146 ? -4.195  67.936 48.797 1.00 25.91 ? 146  LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 146 ? -2.879  67.178 49.055 1.00 23.79 ? 146  LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 146 ? -2.998  66.324 50.323 1.00 25.44 ? 146  LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 146 ? -2.568  66.284 47.858 1.00 23.62 ? 146  LEU A CD2 1 
ATOM   1191 N N   . SER A 1 147 ? -5.793  67.835 51.260 1.00 26.87 ? 147  SER A N   1 
ATOM   1192 C CA  . SER A 1 147 ? -6.124  67.308 52.575 1.00 26.50 ? 147  SER A CA  1 
ATOM   1193 C C   . SER A 1 147 ? -6.410  65.831 52.374 1.00 24.57 ? 147  SER A C   1 
ATOM   1194 O O   . SER A 1 147 ? -6.599  65.379 51.246 1.00 25.48 ? 147  SER A O   1 
ATOM   1195 C CB  . SER A 1 147 ? -7.352  68.009 53.171 1.00 27.10 ? 147  SER A CB  1 
ATOM   1196 O OG  . SER A 1 147 ? -8.508  67.761 52.393 1.00 31.49 ? 147  SER A OG  1 
ATOM   1197 N N   . TYR A 1 148 ? -6.418  65.082 53.465 1.00 23.93 ? 148  TYR A N   1 
ATOM   1198 C CA  . TYR A 1 148 ? -6.679  63.657 53.412 1.00 22.58 ? 148  TYR A CA  1 
ATOM   1199 C C   . TYR A 1 148 ? -7.097  63.195 54.792 1.00 24.56 ? 148  TYR A C   1 
ATOM   1200 O O   . TYR A 1 148 ? -6.695  63.781 55.798 1.00 24.71 ? 148  TYR A O   1 
ATOM   1201 C CB  . TYR A 1 148 ? -5.432  62.883 52.949 1.00 22.11 ? 148  TYR A CB  1 
ATOM   1202 C CG  . TYR A 1 148 ? -4.201  63.069 53.816 1.00 23.94 ? 148  TYR A CG  1 
ATOM   1203 C CD1 . TYR A 1 148 ? -3.375  64.184 53.664 1.00 25.01 ? 148  TYR A CD1 1 
ATOM   1204 C CD2 . TYR A 1 148 ? -3.856  62.120 54.779 1.00 24.79 ? 148  TYR A CD2 1 
ATOM   1205 C CE1 . TYR A 1 148 ? -2.227  64.348 54.451 1.00 24.83 ? 148  TYR A CE1 1 
ATOM   1206 C CE2 . TYR A 1 148 ? -2.714  62.274 55.574 1.00 24.95 ? 148  TYR A CE2 1 
ATOM   1207 C CZ  . TYR A 1 148 ? -1.907  63.389 55.402 1.00 26.71 ? 148  TYR A CZ  1 
ATOM   1208 O OH  . TYR A 1 148 ? -0.783  63.538 56.184 1.00 25.05 ? 148  TYR A OH  1 
ATOM   1209 N N   . ARG A 1 149 ? -7.918  62.152 54.840 1.00 23.90 ? 149  ARG A N   1 
ATOM   1210 C CA  . ARG A 1 149 ? -8.388  61.617 56.112 1.00 24.33 ? 149  ARG A CA  1 
ATOM   1211 C C   . ARG A 1 149 ? -7.236  61.039 56.922 1.00 23.98 ? 149  ARG A C   1 
ATOM   1212 O O   . ARG A 1 149 ? -6.354  60.381 56.378 1.00 23.33 ? 149  ARG A O   1 
ATOM   1213 C CB  . ARG A 1 149 ? -9.434  60.529 55.867 1.00 23.21 ? 149  ARG A CB  1 
ATOM   1214 C CG  . ARG A 1 149 ? -10.776 61.058 55.382 1.00 23.48 ? 149  ARG A CG  1 
ATOM   1215 C CD  . ARG A 1 149 ? -11.666 59.913 54.915 1.00 23.66 ? 149  ARG A CD  1 
ATOM   1216 N NE  . ARG A 1 149 ? -11.305 59.463 53.573 1.00 25.38 ? 149  ARG A NE  1 
ATOM   1217 C CZ  . ARG A 1 149 ? -11.851 58.413 52.968 1.00 27.41 ? 149  ARG A CZ  1 
ATOM   1218 N NH1 . ARG A 1 149 ? -12.779 57.698 53.591 1.00 27.41 ? 149  ARG A NH1 1 
ATOM   1219 N NH2 . ARG A 1 149 ? -11.482 58.085 51.735 1.00 26.73 ? 149  ARG A NH2 1 
ATOM   1220 N N   . VAL A 1 150 ? -7.255  61.286 58.225 1.00 24.51 ? 150  VAL A N   1 
ATOM   1221 C CA  . VAL A 1 150 ? -6.216  60.773 59.109 1.00 25.03 ? 150  VAL A CA  1 
ATOM   1222 C C   . VAL A 1 150 ? -6.825  59.866 60.187 1.00 26.31 ? 150  VAL A C   1 
ATOM   1223 O O   . VAL A 1 150 ? -8.053  59.750 60.300 1.00 24.87 ? 150  VAL A O   1 
ATOM   1224 C CB  . VAL A 1 150 ? -5.438  61.932 59.783 1.00 25.24 ? 150  VAL A CB  1 
ATOM   1225 C CG1 . VAL A 1 150 ? -4.661  62.704 58.735 1.00 25.36 ? 150  VAL A CG1 1 
ATOM   1226 C CG2 . VAL A 1 150 ? -6.400  62.860 60.526 1.00 24.79 ? 150  VAL A CG2 1 
ATOM   1227 N N   . GLY A 1 151 ? -5.966  59.215 60.965 1.00 25.12 ? 151  GLY A N   1 
ATOM   1228 C CA  . GLY A 1 151 ? -6.445  58.336 62.014 1.00 24.27 ? 151  GLY A CA  1 
ATOM   1229 C C   . GLY A 1 151 ? -7.238  57.162 61.463 1.00 24.35 ? 151  GLY A C   1 
ATOM   1230 O O   . GLY A 1 151 ? -7.040  56.742 60.325 1.00 24.76 ? 151  GLY A O   1 
ATOM   1231 N N   . ALA A 1 152 ? -8.140  56.626 62.274 1.00 25.26 ? 152  ALA A N   1 
ATOM   1232 C CA  . ALA A 1 152 ? -8.955  55.490 61.848 1.00 26.84 ? 152  ALA A CA  1 
ATOM   1233 C C   . ALA A 1 152 ? -9.745  55.828 60.581 1.00 26.57 ? 152  ALA A C   1 
ATOM   1234 O O   . ALA A 1 152 ? -9.911  54.990 59.693 1.00 27.42 ? 152  ALA A O   1 
ATOM   1235 C CB  . ALA A 1 152 ? -9.909  55.084 62.972 1.00 27.55 ? 152  ALA A CB  1 
ATOM   1236 N N   . PHE A 1 153 ? -10.215 57.066 60.496 1.00 26.15 ? 153  PHE A N   1 
ATOM   1237 C CA  . PHE A 1 153 ? -10.997 57.516 59.347 1.00 27.25 ? 153  PHE A CA  1 
ATOM   1238 C C   . PHE A 1 153 ? -10.272 57.336 58.022 1.00 27.07 ? 153  PHE A C   1 
ATOM   1239 O O   . PHE A 1 153 ? -10.898 57.067 56.993 1.00 25.73 ? 153  PHE A O   1 
ATOM   1240 C CB  . PHE A 1 153 ? -11.374 58.984 59.533 1.00 27.76 ? 153  PHE A CB  1 
ATOM   1241 C CG  . PHE A 1 153 ? -12.110 59.252 60.811 1.00 29.58 ? 153  PHE A CG  1 
ATOM   1242 C CD1 . PHE A 1 153 ? -13.470 58.983 60.917 1.00 30.41 ? 153  PHE A CD1 1 
ATOM   1243 C CD2 . PHE A 1 153 ? -11.433 59.737 61.926 1.00 28.36 ? 153  PHE A CD2 1 
ATOM   1244 C CE1 . PHE A 1 153 ? -14.146 59.191 62.121 1.00 30.52 ? 153  PHE A CE1 1 
ATOM   1245 C CE2 . PHE A 1 153 ? -12.097 59.947 63.131 1.00 29.27 ? 153  PHE A CE2 1 
ATOM   1246 C CZ  . PHE A 1 153 ? -13.454 59.675 63.230 1.00 31.66 ? 153  PHE A CZ  1 
ATOM   1247 N N   . GLY A 1 154 ? -8.951  57.471 58.039 1.00 24.74 ? 154  GLY A N   1 
ATOM   1248 C CA  . GLY A 1 154 ? -8.218  57.321 56.801 1.00 24.93 ? 154  GLY A CA  1 
ATOM   1249 C C   . GLY A 1 154 ? -7.343  56.092 56.699 1.00 23.06 ? 154  GLY A C   1 
ATOM   1250 O O   . GLY A 1 154 ? -6.878  55.758 55.609 1.00 24.32 ? 154  GLY A O   1 
ATOM   1251 N N   . PHE A 1 155 ? -7.127  55.398 57.812 1.00 23.29 ? 155  PHE A N   1 
ATOM   1252 C CA  . PHE A 1 155 ? -6.241  54.245 57.768 1.00 24.34 ? 155  PHE A CA  1 
ATOM   1253 C C   . PHE A 1 155 ? -6.660  52.961 58.488 1.00 24.83 ? 155  PHE A C   1 
ATOM   1254 O O   . PHE A 1 155 ? -5.872  52.027 58.582 1.00 25.07 ? 155  PHE A O   1 
ATOM   1255 C CB  . PHE A 1 155 ? -4.846  54.705 58.217 1.00 23.08 ? 155  PHE A CB  1 
ATOM   1256 C CG  . PHE A 1 155 ? -4.253  55.751 57.309 1.00 24.21 ? 155  PHE A CG  1 
ATOM   1257 C CD1 . PHE A 1 155 ? -3.685  55.387 56.090 1.00 23.32 ? 155  PHE A CD1 1 
ATOM   1258 C CD2 . PHE A 1 155 ? -4.351  57.101 57.626 1.00 24.82 ? 155  PHE A CD2 1 
ATOM   1259 C CE1 . PHE A 1 155 ? -3.226  56.353 55.186 1.00 25.97 ? 155  PHE A CE1 1 
ATOM   1260 C CE2 . PHE A 1 155 ? -3.898  58.084 56.733 1.00 24.88 ? 155  PHE A CE2 1 
ATOM   1261 C CZ  . PHE A 1 155 ? -3.335  57.708 55.511 1.00 24.83 ? 155  PHE A CZ  1 
ATOM   1262 N N   . LEU A 1 156 ? -7.889  52.901 58.992 1.00 25.68 ? 156  LEU A N   1 
ATOM   1263 C CA  . LEU A 1 156 ? -8.346  51.665 59.625 1.00 28.38 ? 156  LEU A CA  1 
ATOM   1264 C C   . LEU A 1 156 ? -8.240  50.638 58.497 1.00 28.93 ? 156  LEU A C   1 
ATOM   1265 O O   . LEU A 1 156 ? -8.719  50.889 57.390 1.00 29.98 ? 156  LEU A O   1 
ATOM   1266 C CB  . LEU A 1 156 ? -9.804  51.777 60.072 1.00 29.42 ? 156  LEU A CB  1 
ATOM   1267 C CG  . LEU A 1 156 ? -10.328 50.514 60.765 1.00 31.31 ? 156  LEU A CG  1 
ATOM   1268 C CD1 . LEU A 1 156 ? -10.377 50.736 62.263 1.00 30.86 ? 156  LEU A CD1 1 
ATOM   1269 C CD2 . LEU A 1 156 ? -11.715 50.175 60.245 1.00 31.90 ? 156  LEU A CD2 1 
ATOM   1270 N N   . ALA A 1 157 ? -7.614  49.494 58.760 1.00 29.49 ? 157  ALA A N   1 
ATOM   1271 C CA  . ALA A 1 157 ? -7.432  48.491 57.714 1.00 29.84 ? 157  ALA A CA  1 
ATOM   1272 C C   . ALA A 1 157 ? -7.845  47.068 58.076 1.00 31.36 ? 157  ALA A C   1 
ATOM   1273 O O   . ALA A 1 157 ? -7.305  46.469 59.005 1.00 30.05 ? 157  ALA A O   1 
ATOM   1274 C CB  . ALA A 1 157 ? -5.972  48.489 57.260 1.00 27.59 ? 157  ALA A CB  1 
ATOM   1275 N N   . LEU A 1 158 ? -8.806  46.539 57.323 1.00 33.20 ? 158  LEU A N   1 
ATOM   1276 C CA  . LEU A 1 158 ? -9.291  45.175 57.498 1.00 34.16 ? 158  LEU A CA  1 
ATOM   1277 C C   . LEU A 1 158 ? -9.128  44.539 56.121 1.00 34.96 ? 158  LEU A C   1 
ATOM   1278 O O   . LEU A 1 158 ? -10.091 44.382 55.370 1.00 35.26 ? 158  LEU A O   1 
ATOM   1279 C CB  . LEU A 1 158 ? -10.763 45.177 57.938 1.00 32.61 ? 158  LEU A CB  1 
ATOM   1280 C CG  . LEU A 1 158 ? -10.994 45.586 59.398 1.00 34.79 ? 158  LEU A CG  1 
ATOM   1281 C CD1 . LEU A 1 158 ? -12.474 45.803 59.661 1.00 33.61 ? 158  LEU A CD1 1 
ATOM   1282 C CD2 . LEU A 1 158 ? -10.431 44.511 60.323 1.00 33.58 ? 158  LEU A CD2 1 
ATOM   1283 N N   . HIS A 1 159 ? -7.885  44.202 55.791 1.00 36.09 ? 159  HIS A N   1 
ATOM   1284 C CA  . HIS A 1 159 ? -7.550  43.616 54.500 1.00 37.61 ? 159  HIS A CA  1 
ATOM   1285 C C   . HIS A 1 159 ? -8.468  42.458 54.146 1.00 38.97 ? 159  HIS A C   1 
ATOM   1286 O O   . HIS A 1 159 ? -8.708  41.569 54.965 1.00 38.46 ? 159  HIS A O   1 
ATOM   1287 C CB  . HIS A 1 159 ? -6.100  43.144 54.501 1.00 38.24 ? 159  HIS A CB  1 
ATOM   1288 C CG  . HIS A 1 159 ? -5.597  42.720 53.156 1.00 40.39 ? 159  HIS A CG  1 
ATOM   1289 N ND1 . HIS A 1 159 ? -5.556  43.574 52.075 1.00 41.26 ? 159  HIS A ND1 1 
ATOM   1290 C CD2 . HIS A 1 159 ? -5.094  41.539 52.725 1.00 41.18 ? 159  HIS A CD2 1 
ATOM   1291 C CE1 . HIS A 1 159 ? -5.046  42.937 51.035 1.00 41.65 ? 159  HIS A CE1 1 
ATOM   1292 N NE2 . HIS A 1 159 ? -4.758  41.702 51.401 1.00 41.54 ? 159  HIS A NE2 1 
ATOM   1293 N N   . GLY A 1 160 ? -8.969  42.478 52.916 1.00 39.71 ? 160  GLY A N   1 
ATOM   1294 C CA  . GLY A 1 160 ? -9.873  41.440 52.464 1.00 41.83 ? 160  GLY A CA  1 
ATOM   1295 C C   . GLY A 1 160 ? -11.251 42.046 52.307 1.00 42.72 ? 160  GLY A C   1 
ATOM   1296 O O   . GLY A 1 160 ? -12.075 41.568 51.529 1.00 43.60 ? 160  GLY A O   1 
ATOM   1297 N N   . SER A 1 161 ? -11.489 43.115 53.058 1.00 42.48 ? 161  SER A N   1 
ATOM   1298 C CA  . SER A 1 161 ? -12.755 43.829 53.031 1.00 42.41 ? 161  SER A CA  1 
ATOM   1299 C C   . SER A 1 161 ? -12.670 45.012 52.079 1.00 42.72 ? 161  SER A C   1 
ATOM   1300 O O   . SER A 1 161 ? -11.625 45.653 51.966 1.00 43.35 ? 161  SER A O   1 
ATOM   1301 C CB  . SER A 1 161 ? -13.101 44.333 54.433 1.00 43.14 ? 161  SER A CB  1 
ATOM   1302 O OG  . SER A 1 161 ? -14.167 45.265 54.387 1.00 45.40 ? 161  SER A OG  1 
ATOM   1303 N N   . GLN A 1 162 ? -13.770 45.298 51.394 1.00 41.67 ? 162  GLN A N   1 
ATOM   1304 C CA  . GLN A 1 162 ? -13.810 46.420 50.469 1.00 42.13 ? 162  GLN A CA  1 
ATOM   1305 C C   . GLN A 1 162 ? -14.456 47.619 51.148 1.00 40.46 ? 162  GLN A C   1 
ATOM   1306 O O   . GLN A 1 162 ? -14.497 48.713 50.589 1.00 40.08 ? 162  GLN A O   1 
ATOM   1307 C CB  . GLN A 1 162 ? -14.587 46.052 49.202 1.00 45.24 ? 162  GLN A CB  1 
ATOM   1308 C CG  . GLN A 1 162 ? -13.862 45.066 48.289 1.00 50.22 ? 162  GLN A CG  1 
ATOM   1309 C CD  . GLN A 1 162 ? -12.457 45.529 47.922 1.00 53.12 ? 162  GLN A CD  1 
ATOM   1310 O OE1 . GLN A 1 162 ? -12.240 46.695 47.585 1.00 54.72 ? 162  GLN A OE1 1 
ATOM   1311 N NE2 . GLN A 1 162 ? -11.499 44.609 47.975 1.00 54.94 ? 162  GLN A NE2 1 
ATOM   1312 N N   . GLU A 1 163 ? -14.962 47.404 52.359 1.00 38.83 ? 163  GLU A N   1 
ATOM   1313 C CA  . GLU A 1 163 ? -15.596 48.471 53.126 1.00 38.65 ? 163  GLU A CA  1 
ATOM   1314 C C   . GLU A 1 163 ? -14.559 49.273 53.916 1.00 36.79 ? 163  GLU A C   1 
ATOM   1315 O O   . GLU A 1 163 ? -14.732 50.471 54.141 1.00 36.49 ? 163  GLU A O   1 
ATOM   1316 C CB  . GLU A 1 163 ? -16.645 47.887 54.074 1.00 41.27 ? 163  GLU A CB  1 
ATOM   1317 C CG  . GLU A 1 163 ? -17.874 47.342 53.359 1.00 44.23 ? 163  GLU A CG  1 
ATOM   1318 C CD  . GLU A 1 163 ? -18.477 48.354 52.400 1.00 46.06 ? 163  GLU A CD  1 
ATOM   1319 O OE1 . GLU A 1 163 ? -18.716 49.502 52.827 1.00 44.82 ? 163  GLU A OE1 1 
ATOM   1320 O OE2 . GLU A 1 163 ? -18.711 48.001 51.224 1.00 47.63 ? 163  GLU A OE2 1 
ATOM   1321 N N   . ALA A 1 164 ? -13.488 48.604 54.336 1.00 34.74 ? 164  ALA A N   1 
ATOM   1322 C CA  . ALA A 1 164 ? -12.399 49.245 55.081 1.00 33.85 ? 164  ALA A CA  1 
ATOM   1323 C C   . ALA A 1 164 ? -11.110 48.539 54.661 1.00 31.40 ? 164  ALA A C   1 
ATOM   1324 O O   . ALA A 1 164 ? -10.514 47.792 55.434 1.00 33.14 ? 164  ALA A O   1 
ATOM   1325 C CB  . ALA A 1 164 ? -12.623 49.103 56.588 1.00 31.40 ? 164  ALA A CB  1 
ATOM   1326 N N   . PRO A 1 165 ? -10.664 48.775 53.419 1.00 31.55 ? 165  PRO A N   1 
ATOM   1327 C CA  . PRO A 1 165 ? -9.455  48.173 52.854 1.00 31.36 ? 165  PRO A CA  1 
ATOM   1328 C C   . PRO A 1 165 ? -8.133  48.725 53.378 1.00 31.87 ? 165  PRO A C   1 
ATOM   1329 O O   . PRO A 1 165 ? -7.099  48.067 53.269 1.00 33.38 ? 165  PRO A O   1 
ATOM   1330 C CB  . PRO A 1 165 ? -9.618  48.439 51.367 1.00 30.75 ? 165  PRO A CB  1 
ATOM   1331 C CG  . PRO A 1 165 ? -10.211 49.812 51.373 1.00 30.27 ? 165  PRO A CG  1 
ATOM   1332 C CD  . PRO A 1 165 ? -11.276 49.707 52.454 1.00 31.08 ? 165  PRO A CD  1 
ATOM   1333 N N   . GLY A 1 166 ? -8.169  49.928 53.940 1.00 30.17 ? 166  GLY A N   1 
ATOM   1334 C CA  . GLY A 1 166 ? -6.947  50.543 54.429 1.00 29.20 ? 166  GLY A CA  1 
ATOM   1335 C C   . GLY A 1 166 ? -6.388  51.479 53.366 1.00 28.09 ? 166  GLY A C   1 
ATOM   1336 O O   . GLY A 1 166 ? -6.810  51.436 52.209 1.00 28.65 ? 166  GLY A O   1 
ATOM   1337 N N   . ASN A 1 167 ? -5.450  52.333 53.761 1.00 27.10 ? 167  ASN A N   1 
ATOM   1338 C CA  . ASN A 1 167 ? -4.806  53.281 52.853 1.00 26.00 ? 167  ASN A CA  1 
ATOM   1339 C C   . ASN A 1 167 ? -5.728  54.294 52.181 1.00 24.66 ? 167  ASN A C   1 
ATOM   1340 O O   . ASN A 1 167 ? -5.302  54.986 51.259 1.00 25.43 ? 167  ASN A O   1 
ATOM   1341 C CB  . ASN A 1 167 ? -4.030  52.536 51.754 1.00 26.24 ? 167  ASN A CB  1 
ATOM   1342 C CG  . ASN A 1 167 ? -2.865  51.736 52.301 1.00 27.13 ? 167  ASN A CG  1 
ATOM   1343 O OD1 . ASN A 1 167 ? -2.272  52.102 53.317 1.00 27.61 ? 167  ASN A OD1 1 
ATOM   1344 N ND2 . ASN A 1 167 ? -2.522  50.642 51.624 1.00 25.77 ? 167  ASN A ND2 1 
ATOM   1345 N N   . VAL A 1 168 ? -6.973  54.416 52.633 1.00 26.04 ? 168  VAL A N   1 
ATOM   1346 C CA  . VAL A 1 168 ? -7.870  55.357 51.969 1.00 27.30 ? 168  VAL A CA  1 
ATOM   1347 C C   . VAL A 1 168 ? -7.396  56.803 52.076 1.00 26.55 ? 168  VAL A C   1 
ATOM   1348 O O   . VAL A 1 168 ? -7.680  57.617 51.198 1.00 26.73 ? 168  VAL A O   1 
ATOM   1349 C CB  . VAL A 1 168 ? -9.338  55.207 52.459 1.00 27.77 ? 168  VAL A CB  1 
ATOM   1350 C CG1 . VAL A 1 168 ? -9.811  53.783 52.186 1.00 28.54 ? 168  VAL A CG1 1 
ATOM   1351 C CG2 . VAL A 1 168 ? -9.462  55.546 53.930 1.00 27.47 ? 168  VAL A CG2 1 
ATOM   1352 N N   . GLY A 1 169 ? -6.655  57.118 53.134 1.00 26.41 ? 169  GLY A N   1 
ATOM   1353 C CA  . GLY A 1 169 ? -6.125  58.464 53.276 1.00 24.68 ? 169  GLY A CA  1 
ATOM   1354 C C   . GLY A 1 169 ? -5.126  58.740 52.160 1.00 24.81 ? 169  GLY A C   1 
ATOM   1355 O O   . GLY A 1 169 ? -5.026  59.864 51.654 1.00 24.07 ? 169  GLY A O   1 
ATOM   1356 N N   . LEU A 1 170 ? -4.366  57.718 51.775 1.00 23.60 ? 170  LEU A N   1 
ATOM   1357 C CA  . LEU A 1 170 ? -3.396  57.875 50.694 1.00 23.42 ? 170  LEU A CA  1 
ATOM   1358 C C   . LEU A 1 170 ? -4.148  58.022 49.375 1.00 23.53 ? 170  LEU A C   1 
ATOM   1359 O O   . LEU A 1 170 ? -3.703  58.726 48.468 1.00 23.41 ? 170  LEU A O   1 
ATOM   1360 C CB  . LEU A 1 170 ? -2.456  56.666 50.619 1.00 22.29 ? 170  LEU A CB  1 
ATOM   1361 C CG  . LEU A 1 170 ? -1.358  56.583 51.688 1.00 24.78 ? 170  LEU A CG  1 
ATOM   1362 C CD1 . LEU A 1 170 ? -0.661  55.230 51.603 1.00 21.08 ? 170  LEU A CD1 1 
ATOM   1363 C CD2 . LEU A 1 170 ? -0.354  57.711 51.478 1.00 22.12 ? 170  LEU A CD2 1 
ATOM   1364 N N   . LEU A 1 171 ? -5.288  57.346 49.261 1.00 23.72 ? 171  LEU A N   1 
ATOM   1365 C CA  . LEU A 1 171 ? -6.079  57.453 48.043 1.00 24.02 ? 171  LEU A CA  1 
ATOM   1366 C C   . LEU A 1 171 ? -6.730  58.836 47.978 1.00 24.13 ? 171  LEU A C   1 
ATOM   1367 O O   . LEU A 1 171 ? -6.997  59.346 46.891 1.00 24.68 ? 171  LEU A O   1 
ATOM   1368 C CB  . LEU A 1 171 ? -7.136  56.342 47.990 1.00 24.59 ? 171  LEU A CB  1 
ATOM   1369 C CG  . LEU A 1 171 ? -6.536  54.940 47.830 1.00 26.42 ? 171  LEU A CG  1 
ATOM   1370 C CD1 . LEU A 1 171 ? -7.644  53.896 47.882 1.00 28.32 ? 171  LEU A CD1 1 
ATOM   1371 C CD2 . LEU A 1 171 ? -5.763  54.848 46.512 1.00 26.08 ? 171  LEU A CD2 1 
ATOM   1372 N N   . ASP A 1 172 ? -6.989  59.442 49.137 1.00 25.44 ? 172  ASP A N   1 
ATOM   1373 C CA  . ASP A 1 172 ? -7.557  60.793 49.164 1.00 24.39 ? 172  ASP A CA  1 
ATOM   1374 C C   . ASP A 1 172 ? -6.515  61.704 48.520 1.00 25.04 ? 172  ASP A C   1 
ATOM   1375 O O   . ASP A 1 172 ? -6.835  62.553 47.686 1.00 24.51 ? 172  ASP A O   1 
ATOM   1376 C CB  . ASP A 1 172 ? -7.795  61.289 50.600 1.00 24.83 ? 172  ASP A CB  1 
ATOM   1377 C CG  . ASP A 1 172 ? -8.951  60.596 51.286 1.00 27.23 ? 172  ASP A CG  1 
ATOM   1378 O OD1 . ASP A 1 172 ? -9.785  59.974 50.589 1.00 27.86 ? 172  ASP A OD1 1 
ATOM   1379 O OD2 . ASP A 1 172 ? -9.032  60.689 52.535 1.00 26.17 ? 172  ASP A OD2 1 
ATOM   1380 N N   . GLN A 1 173 ? -5.259  61.521 48.924 1.00 23.36 ? 173  GLN A N   1 
ATOM   1381 C CA  . GLN A 1 173 ? -4.164  62.321 48.391 1.00 22.75 ? 173  GLN A CA  1 
ATOM   1382 C C   . GLN A 1 173 ? -4.064  62.134 46.889 1.00 21.64 ? 173  GLN A C   1 
ATOM   1383 O O   . GLN A 1 173 ? -3.901  63.097 46.145 1.00 22.21 ? 173  GLN A O   1 
ATOM   1384 C CB  . GLN A 1 173 ? -2.832  61.912 49.031 1.00 22.33 ? 173  GLN A CB  1 
ATOM   1385 C CG  . GLN A 1 173 ? -2.728  62.200 50.522 1.00 21.86 ? 173  GLN A CG  1 
ATOM   1386 C CD  . GLN A 1 173 ? -1.422  61.687 51.108 1.00 22.20 ? 173  GLN A CD  1 
ATOM   1387 O OE1 . GLN A 1 173 ? -0.487  61.381 50.371 1.00 22.07 ? 173  GLN A OE1 1 
ATOM   1388 N NE2 . GLN A 1 173 ? -1.349  61.602 52.439 1.00 21.00 ? 173  GLN A NE2 1 
ATOM   1389 N N   . ARG A 1 174 ? -4.149  60.885 46.445 1.00 22.88 ? 174  ARG A N   1 
ATOM   1390 C CA  . ARG A 1 174 ? -4.064  60.587 45.024 1.00 22.47 ? 174  ARG A CA  1 
ATOM   1391 C C   . ARG A 1 174 ? -5.190  61.255 44.242 1.00 23.85 ? 174  ARG A C   1 
ATOM   1392 O O   . ARG A 1 174 ? -4.960  61.778 43.153 1.00 24.39 ? 174  ARG A O   1 
ATOM   1393 C CB  . ARG A 1 174 ? -4.113  59.073 44.790 1.00 24.47 ? 174  ARG A CB  1 
ATOM   1394 C CG  . ARG A 1 174 ? -4.083  58.680 43.315 1.00 24.44 ? 174  ARG A CG  1 
ATOM   1395 C CD  . ARG A 1 174 ? -4.222  57.174 43.147 1.00 25.91 ? 174  ARG A CD  1 
ATOM   1396 N NE  . ARG A 1 174 ? -3.029  56.463 43.600 1.00 26.10 ? 174  ARG A NE  1 
ATOM   1397 C CZ  . ARG A 1 174 ? -2.943  55.142 43.706 1.00 29.39 ? 174  ARG A CZ  1 
ATOM   1398 N NH1 . ARG A 1 174 ? -3.983  54.380 43.400 1.00 28.98 ? 174  ARG A NH1 1 
ATOM   1399 N NH2 . ARG A 1 174 ? -1.808  54.578 44.091 1.00 30.45 ? 174  ARG A NH2 1 
ATOM   1400 N N   . MET A 1 175 ? -6.404  61.233 44.786 1.00 24.86 ? 175  MET A N   1 
ATOM   1401 C CA  . MET A 1 175 ? -7.537  61.845 44.092 1.00 26.44 ? 175  MET A CA  1 
ATOM   1402 C C   . MET A 1 175 ? -7.317  63.342 43.921 1.00 26.48 ? 175  MET A C   1 
ATOM   1403 O O   . MET A 1 175 ? -7.680  63.919 42.898 1.00 25.87 ? 175  MET A O   1 
ATOM   1404 C CB  . MET A 1 175 ? -8.847  61.594 44.845 1.00 27.01 ? 175  MET A CB  1 
ATOM   1405 C CG  . MET A 1 175 ? -10.081 61.985 44.036 1.00 28.90 ? 175  MET A CG  1 
ATOM   1406 S SD  . MET A 1 175 ? -11.595 61.282 44.700 1.00 33.95 ? 175  MET A SD  1 
ATOM   1407 C CE  . MET A 1 175 ? -11.464 59.593 44.090 1.00 29.15 ? 175  MET A CE  1 
ATOM   1408 N N   . ALA A 1 176 ? -6.715  63.972 44.924 1.00 26.51 ? 176  ALA A N   1 
ATOM   1409 C CA  . ALA A 1 176 ? -6.434  65.398 44.840 1.00 25.69 ? 176  ALA A CA  1 
ATOM   1410 C C   . ALA A 1 176 ? -5.362  65.633 43.776 1.00 25.68 ? 176  ALA A C   1 
ATOM   1411 O O   . ALA A 1 176 ? -5.435  66.596 43.006 1.00 24.47 ? 176  ALA A O   1 
ATOM   1412 C CB  . ALA A 1 176 ? -5.969  65.930 46.196 1.00 26.63 ? 176  ALA A CB  1 
ATOM   1413 N N   . LEU A 1 177 ? -4.364  64.754 43.722 1.00 24.44 ? 177  LEU A N   1 
ATOM   1414 C CA  . LEU A 1 177 ? -3.311  64.896 42.718 1.00 25.30 ? 177  LEU A CA  1 
ATOM   1415 C C   . LEU A 1 177 ? -3.904  64.710 41.324 1.00 24.44 ? 177  LEU A C   1 
ATOM   1416 O O   . LEU A 1 177 ? -3.467  65.344 40.366 1.00 24.61 ? 177  LEU A O   1 
ATOM   1417 C CB  . LEU A 1 177 ? -2.189  63.871 42.944 1.00 24.43 ? 177  LEU A CB  1 
ATOM   1418 C CG  . LEU A 1 177 ? -1.368  64.028 44.228 1.00 25.71 ? 177  LEU A CG  1 
ATOM   1419 C CD1 . LEU A 1 177 ? -0.309  62.926 44.289 1.00 27.41 ? 177  LEU A CD1 1 
ATOM   1420 C CD2 . LEU A 1 177 ? -0.703  65.400 44.265 1.00 27.32 ? 177  LEU A CD2 1 
ATOM   1421 N N   . GLN A 1 178 ? -4.894  63.828 41.219 1.00 24.35 ? 178  GLN A N   1 
ATOM   1422 C CA  . GLN A 1 178 ? -5.560  63.571 39.941 1.00 25.95 ? 178  GLN A CA  1 
ATOM   1423 C C   . GLN A 1 178 ? -6.318  64.832 39.525 1.00 25.44 ? 178  GLN A C   1 
ATOM   1424 O O   . GLN A 1 178 ? -6.292  65.229 38.362 1.00 26.07 ? 178  GLN A O   1 
ATOM   1425 C CB  . GLN A 1 178 ? -6.546  62.398 40.078 1.00 27.34 ? 178  GLN A CB  1 
ATOM   1426 C CG  . GLN A 1 178 ? -7.269  62.026 38.781 1.00 28.26 ? 178  GLN A CG  1 
ATOM   1427 C CD  . GLN A 1 178 ? -6.354  61.361 37.768 1.00 31.30 ? 178  GLN A CD  1 
ATOM   1428 O OE1 . GLN A 1 178 ? -5.866  60.255 37.995 1.00 32.24 ? 178  GLN A OE1 1 
ATOM   1429 N NE2 . GLN A 1 178 ? -6.119  62.031 36.642 1.00 31.12 ? 178  GLN A NE2 1 
ATOM   1430 N N   . TRP A 1 179 ? -6.991  65.458 40.486 1.00 25.66 ? 179  TRP A N   1 
ATOM   1431 C CA  . TRP A 1 179 ? -7.752  66.675 40.213 1.00 25.91 ? 179  TRP A CA  1 
ATOM   1432 C C   . TRP A 1 179 ? -6.810  67.763 39.702 1.00 26.34 ? 179  TRP A C   1 
ATOM   1433 O O   . TRP A 1 179 ? -7.122  68.463 38.739 1.00 27.31 ? 179  TRP A O   1 
ATOM   1434 C CB  . TRP A 1 179 ? -8.456  67.161 41.481 1.00 26.04 ? 179  TRP A CB  1 
ATOM   1435 C CG  . TRP A 1 179 ? -9.532  68.169 41.205 1.00 27.32 ? 179  TRP A CG  1 
ATOM   1436 C CD1 . TRP A 1 179 ? -10.850 67.912 40.948 1.00 28.38 ? 179  TRP A CD1 1 
ATOM   1437 C CD2 . TRP A 1 179 ? -9.378  69.595 41.125 1.00 28.09 ? 179  TRP A CD2 1 
ATOM   1438 N NE1 . TRP A 1 179 ? -11.526 69.090 40.715 1.00 28.74 ? 179  TRP A NE1 1 
ATOM   1439 C CE2 . TRP A 1 179 ? -10.648 70.135 40.816 1.00 27.95 ? 179  TRP A CE2 1 
ATOM   1440 C CE3 . TRP A 1 179 ? -8.293  70.466 41.283 1.00 27.41 ? 179  TRP A CE3 1 
ATOM   1441 C CZ2 . TRP A 1 179 ? -10.860 71.511 40.663 1.00 27.81 ? 179  TRP A CZ2 1 
ATOM   1442 C CZ3 . TRP A 1 179 ? -8.506  71.835 41.131 1.00 29.26 ? 179  TRP A CZ3 1 
ATOM   1443 C CH2 . TRP A 1 179 ? -9.781  72.341 40.825 1.00 28.09 ? 179  TRP A CH2 1 
ATOM   1444 N N   . VAL A 1 180 ? -5.658  67.900 40.354 1.00 25.82 ? 180  VAL A N   1 
ATOM   1445 C CA  . VAL A 1 180 ? -4.659  68.887 39.956 1.00 25.09 ? 180  VAL A CA  1 
ATOM   1446 C C   . VAL A 1 180 ? -4.168  68.582 38.538 1.00 26.74 ? 180  VAL A C   1 
ATOM   1447 O O   . VAL A 1 180 ? -4.033  69.478 37.700 1.00 24.98 ? 180  VAL A O   1 
ATOM   1448 C CB  . VAL A 1 180 ? -3.463  68.875 40.939 1.00 24.79 ? 180  VAL A CB  1 
ATOM   1449 C CG1 . VAL A 1 180 ? -2.319  69.723 40.404 1.00 23.81 ? 180  VAL A CG1 1 
ATOM   1450 C CG2 . VAL A 1 180 ? -3.919  69.400 42.297 1.00 24.62 ? 180  VAL A CG2 1 
ATOM   1451 N N   . HIS A 1 181 ? -3.908  67.308 38.269 1.00 26.23 ? 181  HIS A N   1 
ATOM   1452 C CA  . HIS A 1 181 ? -3.454  66.891 36.946 1.00 27.85 ? 181  HIS A CA  1 
ATOM   1453 C C   . HIS A 1 181 ? -4.487  67.271 35.882 1.00 27.21 ? 181  HIS A C   1 
ATOM   1454 O O   . HIS A 1 181 ? -4.139  67.727 34.795 1.00 27.32 ? 181  HIS A O   1 
ATOM   1455 C CB  . HIS A 1 181 ? -3.245  65.378 36.924 1.00 30.03 ? 181  HIS A CB  1 
ATOM   1456 C CG  . HIS A 1 181 ? -2.851  64.840 35.585 1.00 34.86 ? 181  HIS A CG  1 
ATOM   1457 N ND1 . HIS A 1 181 ? -1.544  64.812 35.148 1.00 35.20 ? 181  HIS A ND1 1 
ATOM   1458 C CD2 . HIS A 1 181 ? -3.595  64.324 34.576 1.00 35.39 ? 181  HIS A CD2 1 
ATOM   1459 C CE1 . HIS A 1 181 ? -1.498  64.301 33.932 1.00 36.38 ? 181  HIS A CE1 1 
ATOM   1460 N NE2 . HIS A 1 181 ? -2.731  63.996 33.561 1.00 36.64 ? 181  HIS A NE2 1 
ATOM   1461 N N   . ASP A 1 182 ? -5.759  67.088 36.207 1.00 26.65 ? 182  ASP A N   1 
ATOM   1462 C CA  . ASP A 1 182 ? -6.835  67.379 35.270 1.00 28.04 ? 182  ASP A CA  1 
ATOM   1463 C C   . ASP A 1 182 ? -7.292  68.832 35.165 1.00 26.89 ? 182  ASP A C   1 
ATOM   1464 O O   . ASP A 1 182 ? -7.790  69.241 34.117 1.00 27.83 ? 182  ASP A O   1 
ATOM   1465 C CB  . ASP A 1 182 ? -8.073  66.541 35.606 1.00 26.98 ? 182  ASP A CB  1 
ATOM   1466 C CG  . ASP A 1 182 ? -7.815  65.050 35.544 1.00 29.52 ? 182  ASP A CG  1 
ATOM   1467 O OD1 . ASP A 1 182 ? -6.898  64.625 34.812 1.00 34.36 ? 182  ASP A OD1 1 
ATOM   1468 O OD2 . ASP A 1 182 ? -8.548  64.303 36.218 1.00 31.59 ? 182  ASP A OD2 1 
ATOM   1469 N N   . ASN A 1 183 ? -7.111  69.614 36.225 1.00 26.08 ? 183  ASN A N   1 
ATOM   1470 C CA  . ASN A 1 183 ? -7.621  70.988 36.234 1.00 26.82 ? 183  ASN A CA  1 
ATOM   1471 C C   . ASN A 1 183 ? -6.686  72.161 36.488 1.00 27.72 ? 183  ASN A C   1 
ATOM   1472 O O   . ASN A 1 183 ? -7.072  73.310 36.254 1.00 28.98 ? 183  ASN A O   1 
ATOM   1473 C CB  . ASN A 1 183 ? -8.747  71.072 37.267 1.00 25.55 ? 183  ASN A CB  1 
ATOM   1474 C CG  . ASN A 1 183 ? -9.913  70.178 36.925 1.00 27.22 ? 183  ASN A CG  1 
ATOM   1475 O OD1 . ASN A 1 183 ? -10.703 70.492 36.036 1.00 28.72 ? 183  ASN A OD1 1 
ATOM   1476 N ND2 . ASN A 1 183 ? -10.018 69.046 37.616 1.00 27.61 ? 183  ASN A ND2 1 
ATOM   1477 N N   . ILE A 1 184 ? -5.473  71.903 36.963 1.00 27.46 ? 184  ILE A N   1 
ATOM   1478 C CA  . ILE A 1 184 ? -4.581  73.010 37.277 1.00 28.36 ? 184  ILE A CA  1 
ATOM   1479 C C   . ILE A 1 184 ? -4.285  73.928 36.086 1.00 27.21 ? 184  ILE A C   1 
ATOM   1480 O O   . ILE A 1 184 ? -3.986  75.109 36.264 1.00 28.02 ? 184  ILE A O   1 
ATOM   1481 C CB  . ILE A 1 184 ? -3.259  72.496 37.918 1.00 26.86 ? 184  ILE A CB  1 
ATOM   1482 C CG1 . ILE A 1 184 ? -2.683  73.580 38.831 1.00 25.98 ? 184  ILE A CG1 1 
ATOM   1483 C CG2 . ILE A 1 184 ? -2.260  72.091 36.846 1.00 26.74 ? 184  ILE A CG2 1 
ATOM   1484 C CD1 . ILE A 1 184 ? -3.583  73.916 40.014 1.00 23.23 ? 184  ILE A CD1 1 
ATOM   1485 N N   . GLN A 1 185 ? -4.394  73.395 34.875 1.00 27.40 ? 185  GLN A N   1 
ATOM   1486 C CA  . GLN A 1 185 ? -4.132  74.182 33.676 1.00 26.57 ? 185  GLN A CA  1 
ATOM   1487 C C   . GLN A 1 185 ? -5.042  75.411 33.605 1.00 28.02 ? 185  GLN A C   1 
ATOM   1488 O O   . GLN A 1 185 ? -4.658  76.448 33.068 1.00 28.04 ? 185  GLN A O   1 
ATOM   1489 C CB  . GLN A 1 185 ? -4.331  73.319 32.424 1.00 28.85 ? 185  GLN A CB  1 
ATOM   1490 C CG  . GLN A 1 185 ? -5.781  72.949 32.126 1.00 28.09 ? 185  GLN A CG  1 
ATOM   1491 C CD  . GLN A 1 185 ? -5.907  71.827 31.101 1.00 31.47 ? 185  GLN A CD  1 
ATOM   1492 O OE1 . GLN A 1 185 ? -5.712  70.653 31.420 1.00 30.58 ? 185  GLN A OE1 1 
ATOM   1493 N NE2 . GLN A 1 185 ? -6.226  72.187 29.864 1.00 28.53 ? 185  GLN A NE2 1 
ATOM   1494 N N   . PHE A 1 186 ? -6.243  75.302 34.160 1.00 28.86 ? 186  PHE A N   1 
ATOM   1495 C CA  . PHE A 1 186 ? -7.184  76.417 34.122 1.00 30.65 ? 186  PHE A CA  1 
ATOM   1496 C C   . PHE A 1 186 ? -6.828  77.526 35.098 1.00 31.38 ? 186  PHE A C   1 
ATOM   1497 O O   . PHE A 1 186 ? -7.334  78.650 34.986 1.00 29.51 ? 186  PHE A O   1 
ATOM   1498 C CB  . PHE A 1 186 ? -8.602  75.902 34.366 1.00 28.99 ? 186  PHE A CB  1 
ATOM   1499 C CG  . PHE A 1 186 ? -9.014  74.832 33.397 1.00 29.95 ? 186  PHE A CG  1 
ATOM   1500 C CD1 . PHE A 1 186 ? -9.073  75.101 32.031 1.00 28.58 ? 186  PHE A CD1 1 
ATOM   1501 C CD2 . PHE A 1 186 ? -9.287  73.540 33.839 1.00 29.20 ? 186  PHE A CD2 1 
ATOM   1502 C CE1 . PHE A 1 186 ? -9.393  74.097 31.118 1.00 30.35 ? 186  PHE A CE1 1 
ATOM   1503 C CE2 . PHE A 1 186 ? -9.607  72.531 32.932 1.00 29.74 ? 186  PHE A CE2 1 
ATOM   1504 C CZ  . PHE A 1 186 ? -9.659  72.810 31.571 1.00 28.81 ? 186  PHE A CZ  1 
ATOM   1505 N N   . PHE A 1 187 ? -5.948  77.213 36.048 1.00 29.74 ? 187  PHE A N   1 
ATOM   1506 C CA  . PHE A 1 187 ? -5.502  78.193 37.027 1.00 29.02 ? 187  PHE A CA  1 
ATOM   1507 C C   . PHE A 1 187 ? -4.140  78.732 36.620 1.00 29.73 ? 187  PHE A C   1 
ATOM   1508 O O   . PHE A 1 187 ? -3.513  79.479 37.364 1.00 31.12 ? 187  PHE A O   1 
ATOM   1509 C CB  . PHE A 1 187 ? -5.399  77.572 38.419 1.00 29.18 ? 187  PHE A CB  1 
ATOM   1510 C CG  . PHE A 1 187 ? -6.706  77.081 38.962 1.00 29.75 ? 187  PHE A CG  1 
ATOM   1511 C CD1 . PHE A 1 187 ? -7.203  75.835 38.598 1.00 28.17 ? 187  PHE A CD1 1 
ATOM   1512 C CD2 . PHE A 1 187 ? -7.445  77.869 39.840 1.00 28.89 ? 187  PHE A CD2 1 
ATOM   1513 C CE1 . PHE A 1 187 ? -8.416  75.377 39.102 1.00 27.60 ? 187  PHE A CE1 1 
ATOM   1514 C CE2 . PHE A 1 187 ? -8.657  77.424 40.350 1.00 29.29 ? 187  PHE A CE2 1 
ATOM   1515 C CZ  . PHE A 1 187 ? -9.146  76.172 39.980 1.00 28.49 ? 187  PHE A CZ  1 
ATOM   1516 N N   . GLY A 1 188 ? -3.679  78.337 35.437 1.00 30.17 ? 188  GLY A N   1 
ATOM   1517 C CA  . GLY A 1 188 ? -2.389  78.800 34.955 1.00 29.04 ? 188  GLY A CA  1 
ATOM   1518 C C   . GLY A 1 188 ? -1.217  77.885 35.263 1.00 30.07 ? 188  GLY A C   1 
ATOM   1519 O O   . GLY A 1 188 ? -0.070  78.233 34.988 1.00 29.77 ? 188  GLY A O   1 
ATOM   1520 N N   . GLY A 1 189 ? -1.491  76.712 35.829 1.00 31.05 ? 189  GLY A N   1 
ATOM   1521 C CA  . GLY A 1 189 ? -0.414  75.790 36.145 1.00 29.84 ? 189  GLY A CA  1 
ATOM   1522 C C   . GLY A 1 189 ? -0.130  74.781 35.045 1.00 30.56 ? 189  GLY A C   1 
ATOM   1523 O O   . GLY A 1 189 ? -1.000  74.468 34.230 1.00 31.05 ? 189  GLY A O   1 
ATOM   1524 N N   . ASP A 1 190 ? 1.097   74.275 35.011 1.00 29.54 ? 190  ASP A N   1 
ATOM   1525 C CA  . ASP A 1 190 ? 1.488   73.272 34.024 1.00 30.66 ? 190  ASP A CA  1 
ATOM   1526 C C   . ASP A 1 190 ? 1.368   71.901 34.687 1.00 30.50 ? 190  ASP A C   1 
ATOM   1527 O O   . ASP A 1 190 ? 2.166   71.560 35.560 1.00 29.82 ? 190  ASP A O   1 
ATOM   1528 C CB  . ASP A 1 190 ? 2.932   73.513 33.575 1.00 31.14 ? 190  ASP A CB  1 
ATOM   1529 C CG  . ASP A 1 190 ? 3.447   72.428 32.647 1.00 32.10 ? 190  ASP A CG  1 
ATOM   1530 O OD1 . ASP A 1 190 ? 2.639   71.604 32.173 1.00 33.54 ? 190  ASP A OD1 1 
ATOM   1531 O OD2 . ASP A 1 190 ? 4.666   72.407 32.386 1.00 33.22 ? 190  ASP A OD2 1 
ATOM   1532 N N   . PRO A 1 191 ? 0.367   71.098 34.284 1.00 29.87 ? 191  PRO A N   1 
ATOM   1533 C CA  . PRO A 1 191 ? 0.179   69.768 34.873 1.00 30.06 ? 191  PRO A CA  1 
ATOM   1534 C C   . PRO A 1 191 ? 1.333   68.798 34.639 1.00 30.85 ? 191  PRO A C   1 
ATOM   1535 O O   . PRO A 1 191 ? 1.401   67.750 35.272 1.00 31.35 ? 191  PRO A O   1 
ATOM   1536 C CB  . PRO A 1 191 ? -1.133  69.291 34.245 1.00 30.36 ? 191  PRO A CB  1 
ATOM   1537 C CG  . PRO A 1 191 ? -1.132  69.970 32.900 1.00 29.25 ? 191  PRO A CG  1 
ATOM   1538 C CD  . PRO A 1 191 ? -0.638  71.361 33.237 1.00 30.64 ? 191  PRO A CD  1 
ATOM   1539 N N   . LYS A 1 192 ? 2.236   69.144 33.731 1.00 32.58 ? 192  LYS A N   1 
ATOM   1540 C CA  . LYS A 1 192 ? 3.375   68.282 33.445 1.00 33.89 ? 192  LYS A CA  1 
ATOM   1541 C C   . LYS A 1 192 ? 4.594   68.678 34.270 1.00 31.61 ? 192  LYS A C   1 
ATOM   1542 O O   . LYS A 1 192 ? 5.648   68.047 34.187 1.00 29.78 ? 192  LYS A O   1 
ATOM   1543 C CB  . LYS A 1 192 ? 3.709   68.325 31.952 1.00 37.43 ? 192  LYS A CB  1 
ATOM   1544 C CG  . LYS A 1 192 ? 2.563   67.842 31.078 1.00 44.99 ? 192  LYS A CG  1 
ATOM   1545 C CD  . LYS A 1 192 ? 2.170   66.410 31.429 1.00 47.80 ? 192  LYS A CD  1 
ATOM   1546 C CE  . LYS A 1 192 ? 0.900   65.986 30.704 1.00 50.93 ? 192  LYS A CE  1 
ATOM   1547 N NZ  . LYS A 1 192 ? -0.285  66.791 31.125 1.00 51.05 ? 192  LYS A NZ  1 
ATOM   1548 N N   . THR A 1 193 ? 4.449   69.724 35.073 1.00 30.41 ? 193  THR A N   1 
ATOM   1549 C CA  . THR A 1 193 ? 5.548   70.172 35.918 1.00 29.02 ? 193  THR A CA  1 
ATOM   1550 C C   . THR A 1 193 ? 5.037   70.376 37.340 1.00 27.78 ? 193  THR A C   1 
ATOM   1551 O O   . THR A 1 193 ? 5.082   71.481 37.887 1.00 28.93 ? 193  THR A O   1 
ATOM   1552 C CB  . THR A 1 193 ? 6.161   71.482 35.389 1.00 31.00 ? 193  THR A CB  1 
ATOM   1553 O OG1 . THR A 1 193 ? 6.495   71.322 34.003 1.00 32.52 ? 193  THR A OG1 1 
ATOM   1554 C CG2 . THR A 1 193 ? 7.428   71.824 36.157 1.00 29.93 ? 193  THR A CG2 1 
ATOM   1555 N N   . VAL A 1 194 ? 4.535   69.295 37.925 1.00 25.31 ? 194  VAL A N   1 
ATOM   1556 C CA  . VAL A 1 194 ? 4.015   69.332 39.284 1.00 23.74 ? 194  VAL A CA  1 
ATOM   1557 C C   . VAL A 1 194 ? 4.992   68.677 40.245 1.00 25.31 ? 194  VAL A C   1 
ATOM   1558 O O   . VAL A 1 194 ? 5.457   67.562 40.009 1.00 25.51 ? 194  VAL A O   1 
ATOM   1559 C CB  . VAL A 1 194 ? 2.665   68.579 39.396 1.00 25.77 ? 194  VAL A CB  1 
ATOM   1560 C CG1 . VAL A 1 194 ? 2.249   68.446 40.858 1.00 26.87 ? 194  VAL A CG1 1 
ATOM   1561 C CG2 . VAL A 1 194 ? 1.587   69.320 38.614 1.00 25.01 ? 194  VAL A CG2 1 
ATOM   1562 N N   . THR A 1 195 ? 5.306   69.379 41.327 1.00 25.68 ? 195  THR A N   1 
ATOM   1563 C CA  . THR A 1 195 ? 6.185   68.837 42.349 1.00 24.99 ? 195  THR A CA  1 
ATOM   1564 C C   . THR A 1 195 ? 5.365   68.642 43.612 1.00 25.94 ? 195  THR A C   1 
ATOM   1565 O O   . THR A 1 195 ? 4.682   69.566 44.066 1.00 25.71 ? 195  THR A O   1 
ATOM   1566 C CB  . THR A 1 195 ? 7.354   69.791 42.683 1.00 25.28 ? 195  THR A CB  1 
ATOM   1567 O OG1 . THR A 1 195 ? 8.238   69.870 41.562 1.00 25.28 ? 195  THR A OG1 1 
ATOM   1568 C CG2 . THR A 1 195 ? 8.143   69.271 43.894 1.00 26.99 ? 195  THR A CG2 1 
ATOM   1569 N N   . ILE A 1 196 ? 5.393   67.435 44.163 1.00 23.87 ? 196  ILE A N   1 
ATOM   1570 C CA  . ILE A 1 196 ? 4.687   67.209 45.407 1.00 23.07 ? 196  ILE A CA  1 
ATOM   1571 C C   . ILE A 1 196 ? 5.735   67.288 46.508 1.00 23.28 ? 196  ILE A C   1 
ATOM   1572 O O   . ILE A 1 196 ? 6.858   66.797 46.350 1.00 24.49 ? 196  ILE A O   1 
ATOM   1573 C CB  . ILE A 1 196 ? 3.990   65.829 45.455 1.00 23.62 ? 196  ILE A CB  1 
ATOM   1574 C CG1 . ILE A 1 196 ? 4.995   64.709 45.189 1.00 23.08 ? 196  ILE A CG1 1 
ATOM   1575 C CG2 . ILE A 1 196 ? 2.838   65.801 44.458 1.00 24.06 ? 196  ILE A CG2 1 
ATOM   1576 C CD1 . ILE A 1 196 ? 4.412   63.316 45.398 1.00 22.17 ? 196  ILE A CD1 1 
ATOM   1577 N N   . PHE A 1 197 ? 5.387   67.944 47.605 1.00 24.54 ? 197  PHE A N   1 
ATOM   1578 C CA  . PHE A 1 197 ? 6.301   68.051 48.727 1.00 23.96 ? 197  PHE A CA  1 
ATOM   1579 C C   . PHE A 1 197 ? 5.518   67.982 50.023 1.00 23.96 ? 197  PHE A C   1 
ATOM   1580 O O   . PHE A 1 197 ? 4.331   68.311 50.061 1.00 23.84 ? 197  PHE A O   1 
ATOM   1581 C CB  . PHE A 1 197 ? 7.182   69.326 48.622 1.00 23.64 ? 197  PHE A CB  1 
ATOM   1582 C CG  . PHE A 1 197 ? 6.456   70.648 48.834 1.00 24.52 ? 197  PHE A CG  1 
ATOM   1583 C CD1 . PHE A 1 197 ? 5.334   70.990 48.088 1.00 24.50 ? 197  PHE A CD1 1 
ATOM   1584 C CD2 . PHE A 1 197 ? 6.982   71.596 49.720 1.00 24.47 ? 197  PHE A CD2 1 
ATOM   1585 C CE1 . PHE A 1 197 ? 4.747   72.262 48.214 1.00 24.66 ? 197  PHE A CE1 1 
ATOM   1586 C CE2 . PHE A 1 197 ? 6.409   72.866 49.857 1.00 26.20 ? 197  PHE A CE2 1 
ATOM   1587 C CZ  . PHE A 1 197 ? 5.288   73.203 49.100 1.00 25.69 ? 197  PHE A CZ  1 
ATOM   1588 N N   . GLY A 1 198 ? 6.169   67.490 51.071 1.00 23.70 ? 198  GLY A N   1 
ATOM   1589 C CA  . GLY A 1 198 ? 5.503   67.363 52.352 1.00 23.36 ? 198  GLY A CA  1 
ATOM   1590 C C   . GLY A 1 198 ? 6.502   67.080 53.454 1.00 23.18 ? 198  GLY A C   1 
ATOM   1591 O O   . GLY A 1 198 ? 7.645   66.715 53.184 1.00 23.27 ? 198  GLY A O   1 
ATOM   1592 N N   . GLU A 1 199 ? 6.064   67.244 54.696 1.00 23.97 ? 199  GLU A N   1 
ATOM   1593 C CA  . GLU A 1 199 ? 6.934   67.031 55.841 1.00 24.75 ? 199  GLU A CA  1 
ATOM   1594 C C   . GLU A 1 199 ? 6.427   65.898 56.735 1.00 24.11 ? 199  GLU A C   1 
ATOM   1595 O O   . GLU A 1 199 ? 5.217   65.712 56.879 1.00 24.78 ? 199  GLU A O   1 
ATOM   1596 C CB  . GLU A 1 199 ? 7.048   68.345 56.625 1.00 24.89 ? 199  GLU A CB  1 
ATOM   1597 C CG  . GLU A 1 199 ? 8.013   68.331 57.815 1.00 24.32 ? 199  GLU A CG  1 
ATOM   1598 C CD  . GLU A 1 199 ? 7.347   67.925 59.117 1.00 29.38 ? 199  GLU A CD  1 
ATOM   1599 O OE1 . GLU A 1 199 ? 6.097   67.849 59.161 1.00 28.91 ? 199  GLU A OE1 1 
ATOM   1600 O OE2 . GLU A 1 199 ? 8.075   67.698 60.110 1.00 28.70 ? 199  GLU A OE2 1 
ATOM   1601 N N   . SER A 1 200 ? 7.364   65.138 57.307 1.00 23.53 ? 200  SER A N   1 
ATOM   1602 C CA  . SER A 1 200 ? 7.069   64.010 58.202 1.00 25.91 ? 200  SER A CA  1 
ATOM   1603 C C   . SER A 1 200 ? 6.117   62.995 57.545 1.00 25.55 ? 200  SER A C   1 
ATOM   1604 O O   . SER A 1 200 ? 6.487   62.367 56.562 1.00 25.53 ? 200  SER A O   1 
ATOM   1605 C CB  . SER A 1 200 ? 6.494   64.527 59.527 1.00 25.98 ? 200  SER A CB  1 
ATOM   1606 O OG  . SER A 1 200 ? 6.577   63.526 60.530 1.00 29.08 ? 200  SER A OG  1 
ATOM   1607 N N   . ALA A 1 201 ? 4.912   62.813 58.080 1.00 24.46 ? 201  ALA A N   1 
ATOM   1608 C CA  . ALA A 1 201 ? 3.978   61.872 57.448 1.00 23.87 ? 201  ALA A CA  1 
ATOM   1609 C C   . ALA A 1 201 ? 3.705   62.322 56.005 1.00 23.32 ? 201  ALA A C   1 
ATOM   1610 O O   . ALA A 1 201 ? 3.392   61.503 55.133 1.00 22.06 ? 201  ALA A O   1 
ATOM   1611 C CB  . ALA A 1 201 ? 2.672   61.797 58.234 1.00 23.34 ? 201  ALA A CB  1 
ATOM   1612 N N   . GLY A 1 202 ? 3.819   63.626 55.760 1.00 23.37 ? 202  GLY A N   1 
ATOM   1613 C CA  . GLY A 1 202 ? 3.621   64.150 54.419 1.00 21.84 ? 202  GLY A CA  1 
ATOM   1614 C C   . GLY A 1 202 ? 4.804   63.777 53.540 1.00 22.82 ? 202  GLY A C   1 
ATOM   1615 O O   . GLY A 1 202 ? 4.651   63.545 52.338 1.00 22.82 ? 202  GLY A O   1 
ATOM   1616 N N   . GLY A 1 203 ? 5.996   63.734 54.137 1.00 22.46 ? 203  GLY A N   1 
ATOM   1617 C CA  . GLY A 1 203 ? 7.186   63.351 53.394 1.00 22.60 ? 203  GLY A CA  1 
ATOM   1618 C C   . GLY A 1 203 ? 7.127   61.859 53.101 1.00 23.83 ? 203  GLY A C   1 
ATOM   1619 O O   . GLY A 1 203 ? 7.491   61.408 52.012 1.00 22.56 ? 203  GLY A O   1 
ATOM   1620 N N   . ALA A 1 204 ? 6.676   61.083 54.082 1.00 22.61 ? 204  ALA A N   1 
ATOM   1621 C CA  . ALA A 1 204 ? 6.539   59.640 53.890 1.00 22.66 ? 204  ALA A CA  1 
ATOM   1622 C C   . ALA A 1 204 ? 5.504   59.413 52.784 1.00 22.25 ? 204  ALA A C   1 
ATOM   1623 O O   . ALA A 1 204 ? 5.677   58.549 51.924 1.00 24.14 ? 204  ALA A O   1 
ATOM   1624 C CB  . ALA A 1 204 ? 6.080   58.977 55.190 1.00 22.33 ? 204  ALA A CB  1 
ATOM   1625 N N   . SER A 1 205 ? 4.434   60.204 52.807 1.00 21.84 ? 205  SER A N   1 
ATOM   1626 C CA  . SER A 1 205 ? 3.381   60.091 51.798 1.00 22.03 ? 205  SER A CA  1 
ATOM   1627 C C   . SER A 1 205 ? 3.941   60.350 50.400 1.00 23.20 ? 205  SER A C   1 
ATOM   1628 O O   . SER A 1 205 ? 3.609   59.642 49.448 1.00 22.00 ? 205  SER A O   1 
ATOM   1629 C CB  . SER A 1 205 ? 2.242   61.080 52.096 1.00 21.33 ? 205  SER A CB  1 
ATOM   1630 O OG  . SER A 1 205 ? 1.503   60.665 53.232 1.00 22.60 ? 205  SER A OG  1 
ATOM   1631 N N   . VAL A 1 206 ? 4.781   61.376 50.277 1.00 21.95 ? 206  VAL A N   1 
ATOM   1632 C CA  . VAL A 1 206 ? 5.395   61.700 48.993 1.00 22.24 ? 206  VAL A CA  1 
ATOM   1633 C C   . VAL A 1 206 ? 6.181   60.482 48.487 1.00 23.27 ? 206  VAL A C   1 
ATOM   1634 O O   . VAL A 1 206 ? 6.089   60.113 47.316 1.00 23.62 ? 206  VAL A O   1 
ATOM   1635 C CB  . VAL A 1 206 ? 6.342   62.927 49.124 1.00 22.21 ? 206  VAL A CB  1 
ATOM   1636 C CG1 . VAL A 1 206 ? 7.231   63.046 47.897 1.00 22.00 ? 206  VAL A CG1 1 
ATOM   1637 C CG2 . VAL A 1 206 ? 5.514   64.204 49.276 1.00 21.95 ? 206  VAL A CG2 1 
ATOM   1638 N N   . GLY A 1 207 ? 6.945   59.857 49.377 1.00 23.18 ? 207  GLY A N   1 
ATOM   1639 C CA  . GLY A 1 207 ? 7.716   58.683 49.002 1.00 22.38 ? 207  GLY A CA  1 
ATOM   1640 C C   . GLY A 1 207 ? 6.823   57.511 48.626 1.00 23.34 ? 207  GLY A C   1 
ATOM   1641 O O   . GLY A 1 207 ? 7.179   56.690 47.775 1.00 24.47 ? 207  GLY A O   1 
ATOM   1642 N N   . MET A 1 208 ? 5.656   57.433 49.256 1.00 22.90 ? 208  MET A N   1 
ATOM   1643 C CA  . MET A 1 208 ? 4.719   56.359 48.966 1.00 22.41 ? 208  MET A CA  1 
ATOM   1644 C C   . MET A 1 208 ? 4.111   56.537 47.574 1.00 22.76 ? 208  MET A C   1 
ATOM   1645 O O   . MET A 1 208 ? 3.818   55.555 46.895 1.00 24.08 ? 208  MET A O   1 
ATOM   1646 C CB  . MET A 1 208 ? 3.636   56.302 50.046 1.00 22.06 ? 208  MET A CB  1 
ATOM   1647 C CG  . MET A 1 208 ? 4.165   55.727 51.368 1.00 21.43 ? 208  MET A CG  1 
ATOM   1648 S SD  . MET A 1 208 ? 3.075   55.880 52.782 1.00 24.35 ? 208  MET A SD  1 
ATOM   1649 C CE  . MET A 1 208 ? 4.021   54.991 54.025 1.00 23.14 ? 208  MET A CE  1 
ATOM   1650 N N   . HIS A 1 209 ? 3.944   57.784 47.140 1.00 21.80 ? 209  HIS A N   1 
ATOM   1651 C CA  . HIS A 1 209 ? 3.402   58.033 45.807 1.00 24.24 ? 209  HIS A CA  1 
ATOM   1652 C C   . HIS A 1 209 ? 4.473   57.758 44.764 1.00 24.08 ? 209  HIS A C   1 
ATOM   1653 O O   . HIS A 1 209 ? 4.169   57.426 43.619 1.00 25.01 ? 209  HIS A O   1 
ATOM   1654 C CB  . HIS A 1 209 ? 2.882   59.469 45.697 1.00 24.17 ? 209  HIS A CB  1 
ATOM   1655 C CG  . HIS A 1 209 ? 1.643   59.716 46.506 1.00 25.15 ? 209  HIS A CG  1 
ATOM   1656 N ND1 . HIS A 1 209 ? 0.473   59.017 46.291 1.00 27.30 ? 209  HIS A ND1 1 
ATOM   1657 C CD2 . HIS A 1 209 ? 1.403   60.559 47.532 1.00 24.37 ? 209  HIS A CD2 1 
ATOM   1658 C CE1 . HIS A 1 209 ? -0.439  59.426 47.158 1.00 25.85 ? 209  HIS A CE1 1 
ATOM   1659 N NE2 . HIS A 1 209 ? 0.094   60.358 47.923 1.00 26.90 ? 209  HIS A NE2 1 
ATOM   1660 N N   . ILE A 1 210 ? 5.733   57.896 45.164 1.00 24.09 ? 210  ILE A N   1 
ATOM   1661 C CA  . ILE A 1 210 ? 6.842   57.605 44.265 1.00 24.44 ? 210  ILE A CA  1 
ATOM   1662 C C   . ILE A 1 210 ? 6.858   56.088 44.047 1.00 25.58 ? 210  ILE A C   1 
ATOM   1663 O O   . ILE A 1 210 ? 7.123   55.602 42.942 1.00 25.62 ? 210  ILE A O   1 
ATOM   1664 C CB  . ILE A 1 210 ? 8.187   58.051 44.884 1.00 25.13 ? 210  ILE A CB  1 
ATOM   1665 C CG1 . ILE A 1 210 ? 8.297   59.579 44.823 1.00 24.85 ? 210  ILE A CG1 1 
ATOM   1666 C CG2 . ILE A 1 210 ? 9.358   57.376 44.164 1.00 24.63 ? 210  ILE A CG2 1 
ATOM   1667 C CD1 . ILE A 1 210 ? 9.542   60.133 45.495 1.00 24.82 ? 210  ILE A CD1 1 
ATOM   1668 N N   . LEU A 1 211 ? 6.549   55.348 45.110 1.00 24.93 ? 211  LEU A N   1 
ATOM   1669 C CA  . LEU A 1 211 ? 6.529   53.887 45.060 1.00 25.78 ? 211  LEU A CA  1 
ATOM   1670 C C   . LEU A 1 211 ? 5.298   53.266 44.398 1.00 25.29 ? 211  LEU A C   1 
ATOM   1671 O O   . LEU A 1 211 ? 5.425   52.366 43.577 1.00 26.70 ? 211  LEU A O   1 
ATOM   1672 C CB  . LEU A 1 211 ? 6.649   53.317 46.475 1.00 26.26 ? 211  LEU A CB  1 
ATOM   1673 C CG  . LEU A 1 211 ? 7.993   53.488 47.182 1.00 30.31 ? 211  LEU A CG  1 
ATOM   1674 C CD1 . LEU A 1 211 ? 7.825   53.218 48.673 1.00 30.30 ? 211  LEU A CD1 1 
ATOM   1675 C CD2 . LEU A 1 211 ? 9.012   52.545 46.564 1.00 32.69 ? 211  LEU A CD2 1 
ATOM   1676 N N   . SER A 1 212 ? 4.114   53.743 44.762 1.00 24.68 ? 212  SER A N   1 
ATOM   1677 C CA  . SER A 1 212 ? 2.867   53.190 44.234 1.00 26.31 ? 212  SER A CA  1 
ATOM   1678 C C   . SER A 1 212 ? 2.650   53.428 42.739 1.00 26.39 ? 212  SER A C   1 
ATOM   1679 O O   . SER A 1 212 ? 2.554   54.573 42.290 1.00 25.23 ? 212  SER A O   1 
ATOM   1680 C CB  . SER A 1 212 ? 1.677   53.756 45.008 1.00 27.47 ? 212  SER A CB  1 
ATOM   1681 O OG  . SER A 1 212 ? 0.477   53.111 44.622 1.00 27.75 ? 212  SER A OG  1 
ATOM   1682 N N   . PRO A 1 213 ? 2.547   52.340 41.954 1.00 27.19 ? 213  PRO A N   1 
ATOM   1683 C CA  . PRO A 1 213 ? 2.336   52.430 40.502 1.00 28.61 ? 213  PRO A CA  1 
ATOM   1684 C C   . PRO A 1 213 ? 1.155   53.328 40.135 1.00 28.35 ? 213  PRO A C   1 
ATOM   1685 O O   . PRO A 1 213 ? 1.201   54.053 39.141 1.00 29.06 ? 213  PRO A O   1 
ATOM   1686 C CB  . PRO A 1 213 ? 2.088   50.977 40.097 1.00 29.32 ? 213  PRO A CB  1 
ATOM   1687 C CG  . PRO A 1 213 ? 2.926   50.208 41.074 1.00 27.93 ? 213  PRO A CG  1 
ATOM   1688 C CD  . PRO A 1 213 ? 2.671   50.932 42.383 1.00 28.02 ? 213  PRO A CD  1 
ATOM   1689 N N   . GLY A 1 214 ? 0.104   53.274 40.949 1.00 29.93 ? 214  GLY A N   1 
ATOM   1690 C CA  . GLY A 1 214 ? -1.089  54.065 40.694 1.00 28.39 ? 214  GLY A CA  1 
ATOM   1691 C C   . GLY A 1 214 ? -0.980  55.561 40.933 1.00 29.34 ? 214  GLY A C   1 
ATOM   1692 O O   . GLY A 1 214 ? -1.900  56.307 40.593 1.00 31.03 ? 214  GLY A O   1 
ATOM   1693 N N   . SER A 1 215 ? 0.129   56.011 41.514 1.00 26.85 ? 215  SER A N   1 
ATOM   1694 C CA  . SER A 1 215 ? 0.315   57.437 41.791 1.00 26.14 ? 215  SER A CA  1 
ATOM   1695 C C   . SER A 1 215 ? 1.426   58.084 40.964 1.00 27.31 ? 215  SER A C   1 
ATOM   1696 O O   . SER A 1 215 ? 1.398   59.289 40.728 1.00 25.58 ? 215  SER A O   1 
ATOM   1697 C CB  . SER A 1 215 ? 0.656   57.661 43.273 1.00 24.91 ? 215  SER A CB  1 
ATOM   1698 O OG  . SER A 1 215 ? -0.387  57.245 44.134 1.00 27.65 ? 215  SER A OG  1 
ATOM   1699 N N   . ARG A 1 216 ? 2.401   57.283 40.539 1.00 26.94 ? 216  ARG A N   1 
ATOM   1700 C CA  . ARG A 1 216 ? 3.563   57.769 39.789 1.00 27.23 ? 216  ARG A CA  1 
ATOM   1701 C C   . ARG A 1 216 ? 3.335   58.741 38.634 1.00 28.05 ? 216  ARG A C   1 
ATOM   1702 O O   . ARG A 1 216 ? 4.048   59.730 38.506 1.00 27.69 ? 216  ARG A O   1 
ATOM   1703 C CB  . ARG A 1 216 ? 4.370   56.589 39.243 1.00 28.31 ? 216  ARG A CB  1 
ATOM   1704 C CG  . ARG A 1 216 ? 4.846   55.612 40.289 1.00 28.55 ? 216  ARG A CG  1 
ATOM   1705 C CD  . ARG A 1 216 ? 5.605   54.470 39.642 1.00 27.94 ? 216  ARG A CD  1 
ATOM   1706 N NE  . ARG A 1 216 ? 5.880   53.400 40.594 1.00 27.51 ? 216  ARG A NE  1 
ATOM   1707 C CZ  . ARG A 1 216 ? 6.397   52.224 40.261 1.00 27.84 ? 216  ARG A CZ  1 
ATOM   1708 N NH1 . ARG A 1 216 ? 6.699   51.967 38.993 1.00 27.90 ? 216  ARG A NH1 1 
ATOM   1709 N NH2 . ARG A 1 216 ? 6.598   51.302 41.193 1.00 28.28 ? 216  ARG A NH2 1 
ATOM   1710 N N   . ASP A 1 217 ? 2.353   58.451 37.790 1.00 27.87 ? 217  ASP A N   1 
ATOM   1711 C CA  . ASP A 1 217 ? 2.082   59.285 36.622 1.00 28.27 ? 217  ASP A CA  1 
ATOM   1712 C C   . ASP A 1 217 ? 1.464   60.649 36.931 1.00 28.17 ? 217  ASP A C   1 
ATOM   1713 O O   . ASP A 1 217 ? 1.354   61.484 36.041 1.00 29.81 ? 217  ASP A O   1 
ATOM   1714 C CB  . ASP A 1 217 ? 1.142   58.550 35.655 1.00 29.26 ? 217  ASP A CB  1 
ATOM   1715 C CG  . ASP A 1 217 ? 1.652   57.172 35.248 1.00 32.95 ? 217  ASP A CG  1 
ATOM   1716 O OD1 . ASP A 1 217 ? 2.755   56.764 35.673 1.00 30.04 ? 217  ASP A OD1 1 
ATOM   1717 O OD2 . ASP A 1 217 ? 0.933   56.489 34.487 1.00 32.96 ? 217  ASP A OD2 1 
ATOM   1718 N N   . LEU A 1 218 ? 1.072   60.880 38.180 1.00 27.37 ? 218  LEU A N   1 
ATOM   1719 C CA  . LEU A 1 218 ? 0.415   62.135 38.540 1.00 27.13 ? 218  LEU A CA  1 
ATOM   1720 C C   . LEU A 1 218 ? 1.284   63.330 38.931 1.00 28.06 ? 218  LEU A C   1 
ATOM   1721 O O   . LEU A 1 218 ? 0.758   64.409 39.212 1.00 31.04 ? 218  LEU A O   1 
ATOM   1722 C CB  . LEU A 1 218 ? -0.608  61.873 39.647 1.00 26.44 ? 218  LEU A CB  1 
ATOM   1723 C CG  . LEU A 1 218 ? -1.681  60.842 39.276 1.00 28.36 ? 218  LEU A CG  1 
ATOM   1724 C CD1 . LEU A 1 218 ? -2.605  60.606 40.467 1.00 27.64 ? 218  LEU A CD1 1 
ATOM   1725 C CD2 . LEU A 1 218 ? -2.466  61.333 38.060 1.00 30.50 ? 218  LEU A CD2 1 
ATOM   1726 N N   . PHE A 1 219 ? 2.597   63.157 38.958 1.00 26.23 ? 219  PHE A N   1 
ATOM   1727 C CA  . PHE A 1 219 ? 3.476   64.264 39.310 1.00 25.14 ? 219  PHE A CA  1 
ATOM   1728 C C   . PHE A 1 219 ? 4.828   64.102 38.627 1.00 25.89 ? 219  PHE A C   1 
ATOM   1729 O O   . PHE A 1 219 ? 5.160   63.021 38.138 1.00 26.33 ? 219  PHE A O   1 
ATOM   1730 C CB  . PHE A 1 219 ? 3.641   64.363 40.832 1.00 26.28 ? 219  PHE A CB  1 
ATOM   1731 C CG  . PHE A 1 219 ? 4.246   63.145 41.455 1.00 25.92 ? 219  PHE A CG  1 
ATOM   1732 C CD1 . PHE A 1 219 ? 3.473   62.012 41.699 1.00 25.97 ? 219  PHE A CD1 1 
ATOM   1733 C CD2 . PHE A 1 219 ? 5.602   63.115 41.765 1.00 25.10 ? 219  PHE A CD2 1 
ATOM   1734 C CE1 . PHE A 1 219 ? 4.048   60.859 42.244 1.00 25.09 ? 219  PHE A CE1 1 
ATOM   1735 C CE2 . PHE A 1 219 ? 6.184   61.966 42.309 1.00 25.30 ? 219  PHE A CE2 1 
ATOM   1736 C CZ  . PHE A 1 219 ? 5.403   60.838 42.545 1.00 23.92 ? 219  PHE A CZ  1 
ATOM   1737 N N   . ARG A 1 220 ? 5.606   65.180 38.610 1.00 25.48 ? 220  ARG A N   1 
ATOM   1738 C CA  . ARG A 1 220 ? 6.899   65.195 37.944 1.00 26.94 ? 220  ARG A CA  1 
ATOM   1739 C C   . ARG A 1 220 ? 8.108   64.966 38.850 1.00 27.37 ? 220  ARG A C   1 
ATOM   1740 O O   . ARG A 1 220 ? 8.956   64.122 38.557 1.00 27.23 ? 220  ARG A O   1 
ATOM   1741 C CB  . ARG A 1 220 ? 7.051   66.532 37.205 1.00 25.75 ? 220  ARG A CB  1 
ATOM   1742 C CG  . ARG A 1 220 ? 8.368   66.767 36.463 1.00 30.81 ? 220  ARG A CG  1 
ATOM   1743 C CD  . ARG A 1 220 ? 8.521   65.872 35.250 1.00 36.23 ? 220  ARG A CD  1 
ATOM   1744 N NE  . ARG A 1 220 ? 9.580   66.320 34.337 1.00 38.02 ? 220  ARG A NE  1 
ATOM   1745 C CZ  . ARG A 1 220 ? 9.436   67.259 33.399 1.00 38.89 ? 220  ARG A CZ  1 
ATOM   1746 N NH1 . ARG A 1 220 ? 8.274   67.879 33.224 1.00 37.81 ? 220  ARG A NH1 1 
ATOM   1747 N NH2 . ARG A 1 220 ? 10.453  67.561 32.607 1.00 37.66 ? 220  ARG A NH2 1 
ATOM   1748 N N   A ARG A 1 221 ? 8.188   65.734 39.934 0.50 26.97 ? 221  ARG A N   1 
ATOM   1749 N N   B ARG A 1 221 ? 8.179   65.711 39.948 0.50 26.82 ? 221  ARG A N   1 
ATOM   1750 C CA  A ARG A 1 221 ? 9.310   65.648 40.868 0.50 26.71 ? 221  ARG A CA  1 
ATOM   1751 C CA  B ARG A 1 221 ? 9.294   65.581 40.881 0.50 26.52 ? 221  ARG A CA  1 
ATOM   1752 C C   A ARG A 1 221 ? 8.783   65.557 42.312 0.50 25.47 ? 221  ARG A C   1 
ATOM   1753 C C   B ARG A 1 221 ? 8.798   65.615 42.307 0.50 25.47 ? 221  ARG A C   1 
ATOM   1754 O O   A ARG A 1 221 ? 7.612   65.836 42.552 0.50 23.98 ? 221  ARG A O   1 
ATOM   1755 O O   B ARG A 1 221 ? 7.591   65.739 42.558 0.50 24.15 ? 221  ARG A O   1 
ATOM   1756 C CB  A ARG A 1 221 ? 10.278  66.742 40.710 0.50 28.46 ? 221  ARG A CB  1 
ATOM   1757 C CB  B ARG A 1 221 ? 10.240  66.856 40.677 0.50 28.40 ? 221  ARG A CB  1 
ATOM   1758 C CG  A ARG A 1 221 ? 10.533  67.212 39.218 0.50 33.73 ? 221  ARG A CG  1 
ATOM   1759 C CG  B ARG A 1 221 ? 10.725  66.975 39.280 0.50 33.16 ? 221  ARG A CG  1 
ATOM   1760 C CD  A ARG A 1 221 ? 11.938  67.891 39.230 0.50 32.23 ? 221  ARG A CD  1 
ATOM   1761 C CD  B ARG A 1 221 ? 11.428  68.448 39.100 0.50 31.94 ? 221  ARG A CD  1 
ATOM   1762 N NE  A ARG A 1 221 ? 12.088  68.542 37.934 0.50 33.01 ? 221  ARG A NE  1 
ATOM   1763 N NE  B ARG A 1 221 ? 11.386  69.065 37.771 0.50 36.77 ? 221  ARG A NE  1 
ATOM   1764 C CZ  A ARG A 1 221 ? 11.219  69.423 37.448 0.50 33.71 ? 221  ARG A CZ  1 
ATOM   1765 C CZ  B ARG A 1 221 ? 11.892  68.531 36.662 0.50 35.25 ? 221  ARG A CZ  1 
ATOM   1766 N NH1 A ARG A 1 221 ? 10.145  69.743 38.150 0.50 37.03 ? 221  ARG A NH1 1 
ATOM   1767 N NH1 B ARG A 1 221 ? 12.492  67.360 36.692 0.50 39.25 ? 221  ARG A NH1 1 
ATOM   1768 N NH2 A ARG A 1 221 ? 11.427  69.997 36.277 0.50 34.83 ? 221  ARG A NH2 1 
ATOM   1769 N NH2 B ARG A 1 221 ? 11.799  69.173 35.513 0.50 41.41 ? 221  ARG A NH2 1 
ATOM   1770 N N   . ALA A 1 222 ? 9.693   65.353 43.257 1.00 24.49 ? 222  ALA A N   1 
ATOM   1771 C CA  . ALA A 1 222 ? 9.301   65.282 44.658 1.00 24.64 ? 222  ALA A CA  1 
ATOM   1772 C C   . ALA A 1 222 ? 10.301  65.831 45.666 1.00 23.89 ? 222  ALA A C   1 
ATOM   1773 O O   . ALA A 1 222 ? 11.509  65.794 45.452 1.00 25.40 ? 222  ALA A O   1 
ATOM   1774 C CB  . ALA A 1 222 ? 8.968   63.833 45.007 1.00 23.81 ? 222  ALA A CB  1 
ATOM   1775 N N   . ILE A 1 223 ? 9.766   66.332 46.773 1.00 24.57 ? 223  ILE A N   1 
ATOM   1776 C CA  . ILE A 1 223 ? 10.563  66.881 47.860 1.00 22.76 ? 223  ILE A CA  1 
ATOM   1777 C C   . ILE A 1 223 ? 10.065  66.210 49.138 1.00 23.90 ? 223  ILE A C   1 
ATOM   1778 O O   . ILE A 1 223 ? 8.862   66.202 49.407 1.00 22.10 ? 223  ILE A O   1 
ATOM   1779 C CB  . ILE A 1 223 ? 10.366  68.408 47.972 1.00 23.74 ? 223  ILE A CB  1 
ATOM   1780 C CG1 . ILE A 1 223 ? 10.921  69.100 46.726 1.00 24.67 ? 223  ILE A CG1 1 
ATOM   1781 C CG2 . ILE A 1 223 ? 11.040  68.942 49.239 1.00 25.51 ? 223  ILE A CG2 1 
ATOM   1782 C CD1 . ILE A 1 223 ? 10.663  70.609 46.700 1.00 25.73 ? 223  ILE A CD1 1 
ATOM   1783 N N   . LEU A 1 224 ? 10.981  65.627 49.906 1.00 22.38 ? 224  LEU A N   1 
ATOM   1784 C CA  . LEU A 1 224 ? 10.615  64.963 51.154 1.00 22.60 ? 224  LEU A CA  1 
ATOM   1785 C C   . LEU A 1 224 ? 11.336  65.648 52.314 1.00 23.33 ? 224  LEU A C   1 
ATOM   1786 O O   . LEU A 1 224 ? 12.562  65.682 52.352 1.00 24.37 ? 224  LEU A O   1 
ATOM   1787 C CB  . LEU A 1 224 ? 11.000  63.473 51.119 1.00 22.01 ? 224  LEU A CB  1 
ATOM   1788 C CG  . LEU A 1 224 ? 10.352  62.574 50.061 1.00 23.76 ? 224  LEU A CG  1 
ATOM   1789 C CD1 . LEU A 1 224 ? 11.032  62.779 48.711 1.00 22.36 ? 224  LEU A CD1 1 
ATOM   1790 C CD2 . LEU A 1 224 ? 10.475  61.115 50.484 1.00 21.99 ? 224  LEU A CD2 1 
ATOM   1791 N N   . GLN A 1 225 ? 10.568  66.191 53.253 1.00 23.79 ? 225  GLN A N   1 
ATOM   1792 C CA  . GLN A 1 225 ? 11.135  66.877 54.407 1.00 24.37 ? 225  GLN A CA  1 
ATOM   1793 C C   . GLN A 1 225 ? 10.903  66.059 55.681 1.00 24.64 ? 225  GLN A C   1 
ATOM   1794 O O   . GLN A 1 225 ? 9.762   65.805 56.066 1.00 24.84 ? 225  GLN A O   1 
ATOM   1795 C CB  . GLN A 1 225 ? 10.495  68.273 54.548 1.00 23.54 ? 225  GLN A CB  1 
ATOM   1796 C CG  . GLN A 1 225 ? 10.646  69.144 53.295 1.00 23.54 ? 225  GLN A CG  1 
ATOM   1797 C CD  . GLN A 1 225 ? 9.828   70.432 53.333 1.00 25.89 ? 225  GLN A CD  1 
ATOM   1798 O OE1 . GLN A 1 225 ? 9.520   71.004 52.288 1.00 27.46 ? 225  GLN A OE1 1 
ATOM   1799 N NE2 . GLN A 1 225 ? 9.488   70.898 54.531 1.00 25.41 ? 225  GLN A NE2 1 
ATOM   1800 N N   . SER A 1 226 ? 11.992  65.617 56.308 1.00 24.65 ? 226  SER A N   1 
ATOM   1801 C CA  . SER A 1 226 ? 11.918  64.861 57.557 1.00 24.73 ? 226  SER A CA  1 
ATOM   1802 C C   . SER A 1 226 ? 10.963  63.676 57.526 1.00 25.09 ? 226  SER A C   1 
ATOM   1803 O O   . SER A 1 226 ? 10.224  63.441 58.484 1.00 24.57 ? 226  SER A O   1 
ATOM   1804 C CB  . SER A 1 226 ? 11.514  65.796 58.701 1.00 25.09 ? 226  SER A CB  1 
ATOM   1805 O OG  . SER A 1 226 ? 12.446  66.856 58.843 1.00 26.85 ? 226  SER A OG  1 
ATOM   1806 N N   . GLY A 1 227 ? 10.986  62.927 56.433 1.00 25.01 ? 227  GLY A N   1 
ATOM   1807 C CA  . GLY A 1 227 ? 10.111  61.778 56.323 1.00 24.86 ? 227  GLY A CA  1 
ATOM   1808 C C   . GLY A 1 227 ? 10.439  60.943 55.106 1.00 24.88 ? 227  GLY A C   1 
ATOM   1809 O O   . GLY A 1 227 ? 10.850  61.473 54.075 1.00 25.07 ? 227  GLY A O   1 
ATOM   1810 N N   A SER A 1 228 ? 10.256  59.632 55.235 0.50 24.57 ? 228  SER A N   1 
ATOM   1811 N N   B SER A 1 228 ? 10.261  59.632 55.220 0.50 23.85 ? 228  SER A N   1 
ATOM   1812 C CA  A SER A 1 228 ? 10.517  58.723 54.108 0.50 23.95 ? 228  SER A CA  1 
ATOM   1813 C CA  B SER A 1 228 ? 10.541  58.693 54.157 0.50 25.50 ? 228  SER A CA  1 
ATOM   1814 C C   A SER A 1 228 ? 9.516   57.553 54.231 0.50 24.45 ? 228  SER A C   1 
ATOM   1815 C C   B SER A 1 228 ? 9.499   57.588 54.213 0.50 23.73 ? 228  SER A C   1 
ATOM   1816 O O   A SER A 1 228 ? 9.020   57.273 55.301 0.50 23.65 ? 228  SER A O   1 
ATOM   1817 O O   B SER A 1 228 ? 9.047   57.205 55.314 0.50 24.30 ? 228  SER A O   1 
ATOM   1818 C CB  A SER A 1 228 ? 11.953  58.190 54.163 0.50 23.91 ? 228  SER A CB  1 
ATOM   1819 C CB  B SER A 1 228 ? 11.963  58.152 54.325 0.50 26.30 ? 228  SER A CB  1 
ATOM   1820 O OG  A SER A 1 228 ? 12.212  57.524 55.380 0.50 23.59 ? 228  SER A OG  1 
ATOM   1821 O OG  B SER A 1 228 ? 12.406  57.491 53.157 0.50 31.00 ? 228  SER A OG  1 
ATOM   1822 N N   . PRO A 1 229 ? 9.163   56.951 53.084 1.00 24.50 ? 229  PRO A N   1 
ATOM   1823 C CA  . PRO A 1 229 ? 8.179   55.862 53.112 1.00 23.73 ? 229  PRO A CA  1 
ATOM   1824 C C   . PRO A 1 229 ? 8.512   54.638 53.964 1.00 24.57 ? 229  PRO A C   1 
ATOM   1825 O O   . PRO A 1 229 ? 7.611   53.962 54.464 1.00 24.43 ? 229  PRO A O   1 
ATOM   1826 C CB  . PRO A 1 229 ? 7.992   55.531 51.628 1.00 23.37 ? 229  PRO A CB  1 
ATOM   1827 C CG  . PRO A 1 229 ? 9.338   55.834 51.040 1.00 24.70 ? 229  PRO A CG  1 
ATOM   1828 C CD  . PRO A 1 229 ? 9.726   57.129 51.731 1.00 24.33 ? 229  PRO A CD  1 
ATOM   1829 N N   . ASN A 1 230 ? 9.801   54.376 54.149 1.00 24.14 ? 230  ASN A N   1 
ATOM   1830 C CA  . ASN A 1 230 ? 10.263  53.229 54.922 1.00 24.23 ? 230  ASN A CA  1 
ATOM   1831 C C   . ASN A 1 230 ? 10.439  53.493 56.416 1.00 25.72 ? 230  ASN A C   1 
ATOM   1832 O O   . ASN A 1 230 ? 10.983  52.648 57.121 1.00 25.47 ? 230  ASN A O   1 
ATOM   1833 C CB  . ASN A 1 230 ? 11.592  52.728 54.349 1.00 26.36 ? 230  ASN A CB  1 
ATOM   1834 C CG  . ASN A 1 230 ? 12.636  53.829 54.260 1.00 28.57 ? 230  ASN A CG  1 
ATOM   1835 O OD1 . ASN A 1 230 ? 12.375  54.902 53.717 1.00 30.14 ? 230  ASN A OD1 1 
ATOM   1836 N ND2 . ASN A 1 230 ? 13.826  53.568 54.789 1.00 27.24 ? 230  ASN A ND2 1 
ATOM   1837 N N   . CYS A 1 231 ? 10.001  54.651 56.909 1.00 23.84 ? 231  CYS A N   1 
ATOM   1838 C CA  . CYS A 1 231 ? 10.136  54.926 58.343 1.00 24.94 ? 231  CYS A CA  1 
ATOM   1839 C C   . CYS A 1 231 ? 9.423   53.838 59.158 1.00 24.75 ? 231  CYS A C   1 
ATOM   1840 O O   . CYS A 1 231 ? 8.366   53.352 58.763 1.00 26.37 ? 231  CYS A O   1 
ATOM   1841 C CB  . CYS A 1 231 ? 9.570   56.304 58.679 1.00 25.50 ? 231  CYS A CB  1 
ATOM   1842 S SG  . CYS A 1 231 ? 10.607  57.664 58.100 1.00 29.98 ? 231  CYS A SG  1 
ATOM   1843 N N   . PRO A 1 232 ? 9.985   53.461 60.321 1.00 24.39 ? 232  PRO A N   1 
ATOM   1844 C CA  . PRO A 1 232 ? 9.402   52.420 61.178 1.00 24.01 ? 232  PRO A CA  1 
ATOM   1845 C C   . PRO A 1 232 ? 7.972   52.653 61.658 1.00 24.67 ? 232  PRO A C   1 
ATOM   1846 O O   . PRO A 1 232 ? 7.253   51.701 61.955 1.00 26.25 ? 232  PRO A O   1 
ATOM   1847 C CB  . PRO A 1 232 ? 10.405  52.319 62.331 1.00 24.73 ? 232  PRO A CB  1 
ATOM   1848 C CG  . PRO A 1 232 ? 10.937  53.713 62.435 1.00 25.40 ? 232  PRO A CG  1 
ATOM   1849 C CD  . PRO A 1 232 ? 11.146  54.093 60.979 1.00 23.90 ? 232  PRO A CD  1 
ATOM   1850 N N   . TRP A 1 233 ? 7.567   53.918 61.714 1.00 23.28 ? 233  TRP A N   1 
ATOM   1851 C CA  . TRP A 1 233 ? 6.233   54.305 62.169 1.00 23.79 ? 233  TRP A CA  1 
ATOM   1852 C C   . TRP A 1 233 ? 5.253   54.551 61.025 1.00 23.75 ? 233  TRP A C   1 
ATOM   1853 O O   . TRP A 1 233 ? 4.050   54.685 61.255 1.00 25.41 ? 233  TRP A O   1 
ATOM   1854 C CB  . TRP A 1 233 ? 6.332   55.602 62.978 1.00 22.91 ? 233  TRP A CB  1 
ATOM   1855 C CG  . TRP A 1 233 ? 7.111   56.668 62.242 1.00 23.96 ? 233  TRP A CG  1 
ATOM   1856 C CD1 . TRP A 1 233 ? 8.449   56.930 62.355 1.00 24.10 ? 233  TRP A CD1 1 
ATOM   1857 C CD2 . TRP A 1 233 ? 6.616   57.556 61.228 1.00 24.56 ? 233  TRP A CD2 1 
ATOM   1858 N NE1 . TRP A 1 233 ? 8.818   57.923 61.473 1.00 23.07 ? 233  TRP A NE1 1 
ATOM   1859 C CE2 . TRP A 1 233 ? 7.712   58.325 60.770 1.00 25.31 ? 233  TRP A CE2 1 
ATOM   1860 C CE3 . TRP A 1 233 ? 5.352   57.776 60.658 1.00 24.50 ? 233  TRP A CE3 1 
ATOM   1861 C CZ2 . TRP A 1 233 ? 7.585   59.298 59.771 1.00 26.37 ? 233  TRP A CZ2 1 
ATOM   1862 C CZ3 . TRP A 1 233 ? 5.224   58.747 59.662 1.00 26.27 ? 233  TRP A CZ3 1 
ATOM   1863 C CH2 . TRP A 1 233 ? 6.336   59.496 59.230 1.00 27.12 ? 233  TRP A CH2 1 
ATOM   1864 N N   . ALA A 1 234 ? 5.771   54.601 59.803 1.00 23.84 ? 234  ALA A N   1 
ATOM   1865 C CA  . ALA A 1 234 ? 4.966   54.917 58.625 1.00 23.61 ? 234  ALA A CA  1 
ATOM   1866 C C   . ALA A 1 234 ? 4.050   53.845 58.029 1.00 24.56 ? 234  ALA A C   1 
ATOM   1867 O O   . ALA A 1 234 ? 3.194   54.165 57.208 1.00 24.08 ? 234  ALA A O   1 
ATOM   1868 C CB  . ALA A 1 234 ? 5.875   55.469 57.538 1.00 22.70 ? 234  ALA A CB  1 
ATOM   1869 N N   . SER A 1 235 ? 4.233   52.584 58.406 1.00 24.47 ? 235  SER A N   1 
ATOM   1870 C CA  . SER A 1 235 ? 3.371   51.530 57.878 1.00 24.85 ? 235  SER A CA  1 
ATOM   1871 C C   . SER A 1 235 ? 3.328   50.307 58.788 1.00 26.12 ? 235  SER A C   1 
ATOM   1872 O O   . SER A 1 235 ? 4.164   50.151 59.679 1.00 25.16 ? 235  SER A O   1 
ATOM   1873 C CB  . SER A 1 235 ? 3.833   51.108 56.476 1.00 25.58 ? 235  SER A CB  1 
ATOM   1874 O OG  . SER A 1 235 ? 5.148   50.583 56.504 1.00 26.92 ? 235  SER A OG  1 
ATOM   1875 N N   . VAL A 1 236 ? 2.331   49.457 58.573 1.00 24.48 ? 236  VAL A N   1 
ATOM   1876 C CA  . VAL A 1 236 ? 2.185   48.229 59.345 1.00 25.55 ? 236  VAL A CA  1 
ATOM   1877 C C   . VAL A 1 236 ? 1.797   47.116 58.379 1.00 26.08 ? 236  VAL A C   1 
ATOM   1878 O O   . VAL A 1 236 ? 1.433   47.381 57.230 1.00 25.77 ? 236  VAL A O   1 
ATOM   1879 C CB  . VAL A 1 236 ? 1.086   48.342 60.441 1.00 26.20 ? 236  VAL A CB  1 
ATOM   1880 C CG1 . VAL A 1 236 ? 1.501   49.358 61.492 1.00 26.32 ? 236  VAL A CG1 1 
ATOM   1881 C CG2 . VAL A 1 236 ? -0.256  48.734 59.813 1.00 26.36 ? 236  VAL A CG2 1 
ATOM   1882 N N   . SER A 1 237 ? 1.890   45.873 58.837 1.00 25.92 ? 237  SER A N   1 
ATOM   1883 C CA  . SER A 1 237 ? 1.520   44.735 58.007 1.00 27.18 ? 237  SER A CA  1 
ATOM   1884 C C   . SER A 1 237 ? 0.002   44.627 58.012 1.00 28.08 ? 237  SER A C   1 
ATOM   1885 O O   . SER A 1 237 ? -0.674  45.254 58.828 1.00 28.33 ? 237  SER A O   1 
ATOM   1886 C CB  . SER A 1 237 ? 2.107   43.446 58.584 1.00 27.07 ? 237  SER A CB  1 
ATOM   1887 O OG  . SER A 1 237 ? 1.582   43.214 59.881 1.00 27.72 ? 237  SER A OG  1 
ATOM   1888 N N   . VAL A 1 238 ? -0.531  43.824 57.098 1.00 28.61 ? 238  VAL A N   1 
ATOM   1889 C CA  . VAL A 1 238 ? -1.968  43.617 57.019 1.00 30.63 ? 238  VAL A CA  1 
ATOM   1890 C C   . VAL A 1 238 ? -2.472  42.983 58.318 1.00 28.62 ? 238  VAL A C   1 
ATOM   1891 O O   . VAL A 1 238 ? -3.563  43.303 58.797 1.00 30.18 ? 238  VAL A O   1 
ATOM   1892 C CB  . VAL A 1 238 ? -2.311  42.710 55.817 1.00 31.57 ? 238  VAL A CB  1 
ATOM   1893 C CG1 . VAL A 1 238 ? -3.637  42.013 56.045 1.00 36.68 ? 238  VAL A CG1 1 
ATOM   1894 C CG2 . VAL A 1 238 ? -2.362  43.548 54.548 1.00 32.66 ? 238  VAL A CG2 1 
ATOM   1895 N N   . ALA A 1 239 ? -1.666  42.092 58.887 1.00 29.10 ? 239  ALA A N   1 
ATOM   1896 C CA  . ALA A 1 239 ? -2.023  41.417 60.127 1.00 28.71 ? 239  ALA A CA  1 
ATOM   1897 C C   . ALA A 1 239 ? -2.083  42.381 61.310 1.00 29.02 ? 239  ALA A C   1 
ATOM   1898 O O   . ALA A 1 239 ? -3.015  42.323 62.114 1.00 28.84 ? 239  ALA A O   1 
ATOM   1899 C CB  . ALA A 1 239 ? -1.030  40.303 60.416 1.00 30.24 ? 239  ALA A CB  1 
ATOM   1900 N N   . GLU A 1 240 ? -1.093  43.264 61.425 1.00 27.92 ? 240  GLU A N   1 
ATOM   1901 C CA  . GLU A 1 240 ? -1.076  44.216 62.537 1.00 27.67 ? 240  GLU A CA  1 
ATOM   1902 C C   . GLU A 1 240 ? -2.197  45.234 62.364 1.00 26.91 ? 240  GLU A C   1 
ATOM   1903 O O   . GLU A 1 240 ? -2.828  45.638 63.339 1.00 27.56 ? 240  GLU A O   1 
ATOM   1904 C CB  . GLU A 1 240 ? 0.287   44.911 62.625 1.00 27.63 ? 240  GLU A CB  1 
ATOM   1905 C CG  . GLU A 1 240 ? 0.409   45.988 63.718 1.00 28.68 ? 240  GLU A CG  1 
ATOM   1906 C CD  . GLU A 1 240 ? 0.113   45.483 65.129 1.00 30.43 ? 240  GLU A CD  1 
ATOM   1907 O OE1 . GLU A 1 240 ? 0.054   44.251 65.346 1.00 32.17 ? 240  GLU A OE1 1 
ATOM   1908 O OE2 . GLU A 1 240 ? -0.055  46.329 66.033 1.00 27.87 ? 240  GLU A OE2 1 
ATOM   1909 N N   . GLY A 1 241 ? -2.449  45.633 61.119 1.00 27.74 ? 241  GLY A N   1 
ATOM   1910 C CA  . GLY A 1 241 ? -3.519  46.577 60.855 1.00 28.69 ? 241  GLY A CA  1 
ATOM   1911 C C   . GLY A 1 241 ? -4.848  45.982 61.288 1.00 28.15 ? 241  GLY A C   1 
ATOM   1912 O O   . GLY A 1 241 ? -5.676  46.651 61.898 1.00 27.92 ? 241  GLY A O   1 
ATOM   1913 N N   . ARG A 1 242 ? -5.052  44.709 60.970 1.00 29.57 ? 242  ARG A N   1 
ATOM   1914 C CA  . ARG A 1 242 ? -6.284  44.019 61.345 1.00 29.92 ? 242  ARG A CA  1 
ATOM   1915 C C   . ARG A 1 242 ? -6.387  43.924 62.869 1.00 29.39 ? 242  ARG A C   1 
ATOM   1916 O O   . ARG A 1 242 ? -7.437  44.208 63.450 1.00 29.69 ? 242  ARG A O   1 
ATOM   1917 C CB  . ARG A 1 242 ? -6.309  42.617 60.718 1.00 29.94 ? 242  ARG A CB  1 
ATOM   1918 C CG  . ARG A 1 242 ? -7.442  41.719 61.194 1.00 33.33 ? 242  ARG A CG  1 
ATOM   1919 C CD  . ARG A 1 242 ? -7.557  40.483 60.298 1.00 35.47 ? 242  ARG A CD  1 
ATOM   1920 N NE  . ARG A 1 242 ? -8.146  40.811 59.000 1.00 35.81 ? 242  ARG A NE  1 
ATOM   1921 C CZ  . ARG A 1 242 ? -9.447  41.003 58.795 1.00 36.32 ? 242  ARG A CZ  1 
ATOM   1922 N NH1 . ARG A 1 242 ? -10.305 40.891 59.800 1.00 36.75 ? 242  ARG A NH1 1 
ATOM   1923 N NH2 . ARG A 1 242 ? -9.888  41.325 57.587 1.00 36.55 ? 242  ARG A NH2 1 
ATOM   1924 N N   . ARG A 1 243 ? -5.290  43.540 63.516 1.00 28.50 ? 243  ARG A N   1 
ATOM   1925 C CA  . ARG A 1 243 ? -5.283  43.421 64.970 1.00 28.09 ? 243  ARG A CA  1 
ATOM   1926 C C   . ARG A 1 243 ? -5.700  44.726 65.636 1.00 26.68 ? 243  ARG A C   1 
ATOM   1927 O O   . ARG A 1 243 ? -6.468  44.723 66.597 1.00 27.70 ? 243  ARG A O   1 
ATOM   1928 C CB  . ARG A 1 243 ? -3.895  43.031 65.481 1.00 28.85 ? 243  ARG A CB  1 
ATOM   1929 C CG  . ARG A 1 243 ? -3.861  42.730 66.982 1.00 31.41 ? 243  ARG A CG  1 
ATOM   1930 C CD  . ARG A 1 243 ? -2.438  42.699 67.521 1.00 32.74 ? 243  ARG A CD  1 
ATOM   1931 N NE  . ARG A 1 243 ? -1.845  44.032 67.565 1.00 35.05 ? 243  ARG A NE  1 
ATOM   1932 C CZ  . ARG A 1 243 ? -2.204  44.988 68.418 1.00 34.55 ? 243  ARG A CZ  1 
ATOM   1933 N NH1 . ARG A 1 243 ? -3.157  44.766 69.313 1.00 35.59 ? 243  ARG A NH1 1 
ATOM   1934 N NH2 . ARG A 1 243 ? -1.608  46.173 68.377 1.00 35.14 ? 243  ARG A NH2 1 
ATOM   1935 N N   . ARG A 1 244 ? -5.189  45.844 65.130 1.00 28.23 ? 244  ARG A N   1 
ATOM   1936 C CA  . ARG A 1 244 ? -5.520  47.147 65.703 1.00 26.25 ? 244  ARG A CA  1 
ATOM   1937 C C   . ARG A 1 244 ? -6.965  47.542 65.444 1.00 26.87 ? 244  ARG A C   1 
ATOM   1938 O O   . ARG A 1 244 ? -7.607  48.151 66.301 1.00 27.32 ? 244  ARG A O   1 
ATOM   1939 C CB  . ARG A 1 244 ? -4.578  48.231 65.164 1.00 26.75 ? 244  ARG A CB  1 
ATOM   1940 C CG  . ARG A 1 244 ? -3.129  48.020 65.559 1.00 24.12 ? 244  ARG A CG  1 
ATOM   1941 C CD  . ARG A 1 244 ? -2.223  49.109 65.004 1.00 25.94 ? 244  ARG A CD  1 
ATOM   1942 N NE  . ARG A 1 244 ? -0.815  48.830 65.282 1.00 26.25 ? 244  ARG A NE  1 
ATOM   1943 C CZ  . ARG A 1 244 ? 0.174   49.695 65.078 1.00 26.71 ? 244  ARG A CZ  1 
ATOM   1944 N NH1 . ARG A 1 244 ? -0.084  50.905 64.597 1.00 25.92 ? 244  ARG A NH1 1 
ATOM   1945 N NH2 . ARG A 1 244 ? 1.424   49.346 65.349 1.00 25.97 ? 244  ARG A NH2 1 
ATOM   1946 N N   . ALA A 1 245 ? -7.476  47.203 64.265 1.00 27.04 ? 245  ALA A N   1 
ATOM   1947 C CA  . ALA A 1 245 ? -8.860  47.523 63.929 1.00 27.84 ? 245  ALA A CA  1 
ATOM   1948 C C   . ALA A 1 245 ? -9.790  46.773 64.880 1.00 28.98 ? 245  ALA A C   1 
ATOM   1949 O O   . ALA A 1 245 ? -10.783 47.321 65.361 1.00 29.65 ? 245  ALA A O   1 
ATOM   1950 C CB  . ALA A 1 245 ? -9.157  47.127 62.483 1.00 29.32 ? 245  ALA A CB  1 
ATOM   1951 N N   . VAL A 1 246 ? -9.461  45.513 65.147 1.00 29.58 ? 246  VAL A N   1 
ATOM   1952 C CA  . VAL A 1 246 ? -10.269 44.692 66.039 1.00 30.49 ? 246  VAL A CA  1 
ATOM   1953 C C   . VAL A 1 246 ? -10.194 45.213 67.471 1.00 30.73 ? 246  VAL A C   1 
ATOM   1954 O O   . VAL A 1 246 ? -11.194 45.226 68.186 1.00 30.69 ? 246  VAL A O   1 
ATOM   1955 C CB  . VAL A 1 246 ? -9.811  43.217 66.011 1.00 29.97 ? 246  VAL A CB  1 
ATOM   1956 C CG1 . VAL A 1 246 ? -10.538 42.426 67.088 1.00 30.89 ? 246  VAL A CG1 1 
ATOM   1957 C CG2 . VAL A 1 246 ? -10.086 42.615 64.636 1.00 31.39 ? 246  VAL A CG2 1 
ATOM   1958 N N   . GLU A 1 247 ? -9.006  45.644 67.884 1.00 29.92 ? 247  GLU A N   1 
ATOM   1959 C CA  . GLU A 1 247 ? -8.822  46.171 69.229 1.00 30.26 ? 247  GLU A CA  1 
ATOM   1960 C C   . GLU A 1 247 ? -9.618  47.469 69.390 1.00 28.89 ? 247  GLU A C   1 
ATOM   1961 O O   . GLU A 1 247 ? -10.160 47.738 70.462 1.00 30.01 ? 247  GLU A O   1 
ATOM   1962 C CB  . GLU A 1 247 ? -7.330  46.399 69.500 1.00 31.30 ? 247  GLU A CB  1 
ATOM   1963 C CG  . GLU A 1 247 ? -6.976  46.751 70.943 1.00 35.83 ? 247  GLU A CG  1 
ATOM   1964 C CD  . GLU A 1 247 ? -7.410  45.694 71.962 1.00 38.93 ? 247  GLU A CD  1 
ATOM   1965 O OE1 . GLU A 1 247 ? -7.390  44.488 71.633 1.00 40.61 ? 247  GLU A OE1 1 
ATOM   1966 O OE2 . GLU A 1 247 ? -7.753  46.079 73.099 1.00 40.91 ? 247  GLU A OE2 1 
ATOM   1967 N N   . LEU A 1 248 ? -9.704  48.267 68.327 1.00 28.62 ? 248  LEU A N   1 
ATOM   1968 C CA  . LEU A 1 248 ? -10.478 49.510 68.388 1.00 29.29 ? 248  LEU A CA  1 
ATOM   1969 C C   . LEU A 1 248 ? -11.937 49.131 68.647 1.00 29.99 ? 248  LEU A C   1 
ATOM   1970 O O   . LEU A 1 248 ? -12.610 49.732 69.486 1.00 32.10 ? 248  LEU A O   1 
ATOM   1971 C CB  . LEU A 1 248 ? -10.378 50.285 67.070 1.00 29.51 ? 248  LEU A CB  1 
ATOM   1972 C CG  . LEU A 1 248 ? -11.098 51.640 67.023 1.00 30.55 ? 248  LEU A CG  1 
ATOM   1973 C CD1 . LEU A 1 248 ? -10.427 52.611 67.980 1.00 32.41 ? 248  LEU A CD1 1 
ATOM   1974 C CD2 . LEU A 1 248 ? -11.068 52.199 65.609 1.00 30.97 ? 248  LEU A CD2 1 
ATOM   1975 N N   . GLY A 1 249 ? -12.416 48.125 67.922 1.00 30.13 ? 249  GLY A N   1 
ATOM   1976 C CA  . GLY A 1 249 ? -13.785 47.673 68.097 1.00 32.05 ? 249  GLY A CA  1 
ATOM   1977 C C   . GLY A 1 249 ? -14.001 47.164 69.512 1.00 31.62 ? 249  GLY A C   1 
ATOM   1978 O O   . GLY A 1 249 ? -15.041 47.415 70.121 1.00 32.76 ? 249  GLY A O   1 
ATOM   1979 N N   . ARG A 1 250 ? -13.007 46.452 70.034 1.00 31.96 ? 250  ARG A N   1 
ATOM   1980 C CA  . ARG A 1 250 ? -13.068 45.906 71.384 1.00 33.90 ? 250  ARG A CA  1 
ATOM   1981 C C   . ARG A 1 250 ? -13.158 47.041 72.414 1.00 35.13 ? 250  ARG A C   1 
ATOM   1982 O O   . ARG A 1 250 ? -13.802 46.904 73.456 1.00 34.84 ? 250  ARG A O   1 
ATOM   1983 C CB  . ARG A 1 250 ? -11.831 45.041 71.638 1.00 36.31 ? 250  ARG A CB  1 
ATOM   1984 C CG  . ARG A 1 250 ? -11.893 44.215 72.911 1.00 40.77 ? 250  ARG A CG  1 
ATOM   1985 C CD  . ARG A 1 250 ? -10.678 43.302 73.067 1.00 43.69 ? 250  ARG A CD  1 
ATOM   1986 N NE  . ARG A 1 250 ? -10.737 42.110 72.223 1.00 47.27 ? 250  ARG A NE  1 
ATOM   1987 C CZ  . ARG A 1 250 ? -10.025 41.926 71.113 1.00 49.69 ? 250  ARG A CZ  1 
ATOM   1988 N NH1 . ARG A 1 250 ? -9.183  42.861 70.686 1.00 49.85 ? 250  ARG A NH1 1 
ATOM   1989 N NH2 . ARG A 1 250 ? -10.147 40.794 70.433 1.00 49.48 ? 250  ARG A NH2 1 
ATOM   1990 N N   . ASN A 1 251 ? -12.519 48.167 72.109 1.00 33.61 ? 251  ASN A N   1 
ATOM   1991 C CA  . ASN A 1 251 ? -12.529 49.334 72.991 1.00 32.50 ? 251  ASN A CA  1 
ATOM   1992 C C   . ASN A 1 251 ? -13.876 50.050 72.972 1.00 33.33 ? 251  ASN A C   1 
ATOM   1993 O O   . ASN A 1 251 ? -14.202 50.811 73.885 1.00 33.00 ? 251  ASN A O   1 
ATOM   1994 C CB  . ASN A 1 251 ? -11.436 50.320 72.562 1.00 32.97 ? 251  ASN A CB  1 
ATOM   1995 C CG  . ASN A 1 251 ? -10.136 50.122 73.317 1.00 32.21 ? 251  ASN A CG  1 
ATOM   1996 O OD1 . ASN A 1 251 ? -9.888  50.784 74.325 1.00 32.98 ? 251  ASN A OD1 1 
ATOM   1997 N ND2 . ASN A 1 251 ? -9.305  49.199 72.843 1.00 31.84 ? 251  ASN A ND2 1 
ATOM   1998 N N   . LEU A 1 252 ? -14.656 49.805 71.925 1.00 33.47 ? 252  LEU A N   1 
ATOM   1999 C CA  . LEU A 1 252 ? -15.956 50.444 71.786 1.00 34.58 ? 252  LEU A CA  1 
ATOM   2000 C C   . LEU A 1 252 ? -17.118 49.464 71.939 1.00 36.67 ? 252  LEU A C   1 
ATOM   2001 O O   . LEU A 1 252 ? -18.237 49.744 71.511 1.00 36.78 ? 252  LEU A O   1 
ATOM   2002 C CB  . LEU A 1 252 ? -16.033 51.165 70.434 1.00 34.83 ? 252  LEU A CB  1 
ATOM   2003 C CG  . LEU A 1 252 ? -14.977 52.270 70.272 1.00 34.49 ? 252  LEU A CG  1 
ATOM   2004 C CD1 . LEU A 1 252 ? -14.936 52.771 68.835 1.00 34.09 ? 252  LEU A CD1 1 
ATOM   2005 C CD2 . LEU A 1 252 ? -15.292 53.408 71.229 1.00 35.70 ? 252  LEU A CD2 1 
ATOM   2006 N N   . ASN A 1 253 ? -16.840 48.316 72.548 1.00 37.25 ? 253  ASN A N   1 
ATOM   2007 C CA  . ASN A 1 253 ? -17.859 47.298 72.787 1.00 40.94 ? 253  ASN A CA  1 
ATOM   2008 C C   . ASN A 1 253 ? -18.552 46.874 71.498 1.00 40.40 ? 253  ASN A C   1 
ATOM   2009 O O   . ASN A 1 253 ? -19.774 46.745 71.455 1.00 41.17 ? 253  ASN A O   1 
ATOM   2010 C CB  . ASN A 1 253 ? -18.900 47.844 73.767 1.00 44.37 ? 253  ASN A CB  1 
ATOM   2011 C CG  . ASN A 1 253 ? -18.268 48.553 74.948 1.00 48.90 ? 253  ASN A CG  1 
ATOM   2012 O OD1 . ASN A 1 253 ? -18.615 49.695 75.260 1.00 51.00 ? 253  ASN A OD1 1 
ATOM   2013 N ND2 . ASN A 1 253 ? -17.333 47.881 75.613 1.00 50.16 ? 253  ASN A ND2 1 
ATOM   2014 N N   . CYS A 1 254 ? -17.769 46.658 70.449 1.00 38.68 ? 254  CYS A N   1 
ATOM   2015 C CA  . CYS A 1 254 ? -18.313 46.258 69.161 1.00 38.15 ? 254  CYS A CA  1 
ATOM   2016 C C   . CYS A 1 254 ? -18.437 44.747 69.005 1.00 38.52 ? 254  CYS A C   1 
ATOM   2017 O O   . CYS A 1 254 ? -17.733 43.982 69.659 1.00 38.01 ? 254  CYS A O   1 
ATOM   2018 C CB  . CYS A 1 254 ? -17.428 46.791 68.029 1.00 36.83 ? 254  CYS A CB  1 
ATOM   2019 S SG  . CYS A 1 254 ? -17.655 48.550 67.614 0.60 33.05 ? 254  CYS A SG  1 
ATOM   2020 N N   . ASN A 1 255 ? -19.342 44.327 68.128 1.00 40.20 ? 255  ASN A N   1 
ATOM   2021 C CA  . ASN A 1 255 ? -19.523 42.910 67.843 1.00 41.08 ? 255  ASN A CA  1 
ATOM   2022 C C   . ASN A 1 255 ? -18.323 42.567 66.968 1.00 40.31 ? 255  ASN A C   1 
ATOM   2023 O O   . ASN A 1 255 ? -18.108 43.200 65.935 1.00 39.71 ? 255  ASN A O   1 
ATOM   2024 C CB  . ASN A 1 255 ? -20.821 42.685 67.067 1.00 42.25 ? 255  ASN A CB  1 
ATOM   2025 C CG  . ASN A 1 255 ? -21.083 41.221 66.782 1.00 44.42 ? 255  ASN A CG  1 
ATOM   2026 O OD1 . ASN A 1 255 ? -20.237 40.520 66.226 1.00 45.38 ? 255  ASN A OD1 1 
ATOM   2027 N ND2 . ASN A 1 255 ? -22.266 40.751 67.161 1.00 45.41 ? 255  ASN A ND2 1 
ATOM   2028 N N   . LEU A 1 256 ? -17.545 41.571 67.373 1.00 40.30 ? 256  LEU A N   1 
ATOM   2029 C CA  . LEU A 1 256 ? -16.347 41.200 66.624 1.00 42.04 ? 256  LEU A CA  1 
ATOM   2030 C C   . LEU A 1 256 ? -16.435 39.879 65.865 1.00 43.55 ? 256  LEU A C   1 
ATOM   2031 O O   . LEU A 1 256 ? -15.411 39.319 65.478 1.00 44.71 ? 256  LEU A O   1 
ATOM   2032 C CB  . LEU A 1 256 ? -15.152 41.148 67.578 1.00 40.57 ? 256  LEU A CB  1 
ATOM   2033 C CG  . LEU A 1 256 ? -14.975 42.364 68.490 1.00 39.77 ? 256  LEU A CG  1 
ATOM   2034 C CD1 . LEU A 1 256 ? -13.830 42.118 69.458 1.00 40.15 ? 256  LEU A CD1 1 
ATOM   2035 C CD2 . LEU A 1 256 ? -14.723 43.607 67.646 1.00 41.25 ? 256  LEU A CD2 1 
ATOM   2036 N N   . ASN A 1 257 ? -17.645 39.384 65.636 1.00 45.01 ? 257  ASN A N   1 
ATOM   2037 C CA  . ASN A 1 257 ? -17.798 38.113 64.936 1.00 46.79 ? 257  ASN A CA  1 
ATOM   2038 C C   . ASN A 1 257 ? -17.398 38.127 63.463 1.00 45.41 ? 257  ASN A C   1 
ATOM   2039 O O   . ASN A 1 257 ? -17.064 37.083 62.903 1.00 46.17 ? 257  ASN A O   1 
ATOM   2040 C CB  . ASN A 1 257 ? -19.233 37.600 65.078 1.00 50.65 ? 257  ASN A CB  1 
ATOM   2041 C CG  . ASN A 1 257 ? -19.551 37.154 66.492 1.00 54.20 ? 257  ASN A CG  1 
ATOM   2042 O OD1 . ASN A 1 257 ? -20.039 37.935 67.311 1.00 57.87 ? 257  ASN A OD1 1 
ATOM   2043 N ND2 . ASN A 1 257 ? -19.259 35.894 66.791 1.00 57.15 ? 257  ASN A ND2 1 
ATOM   2044 N N   . SER A 1 258 ? -17.423 39.300 62.838 1.00 42.83 ? 258  SER A N   1 
ATOM   2045 C CA  . SER A 1 258 ? -17.056 39.413 61.428 1.00 40.66 ? 258  SER A CA  1 
ATOM   2046 C C   . SER A 1 258 ? -16.673 40.845 61.071 1.00 39.57 ? 258  SER A C   1 
ATOM   2047 O O   . SER A 1 258 ? -16.992 41.778 61.810 1.00 39.29 ? 258  SER A O   1 
ATOM   2048 C CB  . SER A 1 258 ? -18.228 38.986 60.546 1.00 39.71 ? 258  SER A CB  1 
ATOM   2049 O OG  . SER A 1 258 ? -19.307 39.898 60.682 1.00 39.44 ? 258  SER A OG  1 
ATOM   2050 N N   . ASP A 1 259 ? -15.995 41.020 59.938 1.00 39.67 ? 259  ASP A N   1 
ATOM   2051 C CA  . ASP A 1 259 ? -15.609 42.360 59.500 1.00 39.56 ? 259  ASP A CA  1 
ATOM   2052 C C   . ASP A 1 259 ? -16.870 43.187 59.303 1.00 39.44 ? 259  ASP A C   1 
ATOM   2053 O O   . ASP A 1 259 ? -16.920 44.359 59.667 1.00 38.08 ? 259  ASP A O   1 
ATOM   2054 C CB  . ASP A 1 259 ? -14.829 42.308 58.182 1.00 40.69 ? 259  ASP A CB  1 
ATOM   2055 C CG  . ASP A 1 259 ? -13.440 41.732 58.346 1.00 40.87 ? 259  ASP A CG  1 
ATOM   2056 O OD1 . ASP A 1 259 ? -12.974 41.614 59.499 1.00 42.51 ? 259  ASP A OD1 1 
ATOM   2057 O OD2 . ASP A 1 259 ? -12.806 41.409 57.319 1.00 42.62 ? 259  ASP A OD2 1 
ATOM   2058 N N   A GLU A 1 260 ? -17.893 42.571 58.717 0.50 39.43 ? 260  GLU A N   1 
ATOM   2059 N N   B GLU A 1 260 ? -17.888 42.559 58.724 0.50 39.28 ? 260  GLU A N   1 
ATOM   2060 C CA  A GLU A 1 260 ? -19.157 43.256 58.474 0.50 40.21 ? 260  GLU A CA  1 
ATOM   2061 C CA  B GLU A 1 260 ? -19.163 43.216 58.473 0.50 39.96 ? 260  GLU A CA  1 
ATOM   2062 C C   A GLU A 1 260 ? -19.729 43.791 59.768 0.50 39.43 ? 260  GLU A C   1 
ATOM   2063 C C   B GLU A 1 260 ? -19.740 43.799 59.774 0.50 39.61 ? 260  GLU A C   1 
ATOM   2064 O O   A GLU A 1 260 ? -20.195 44.941 59.829 0.50 40.25 ? 260  GLU A O   1 
ATOM   2065 O O   B GLU A 1 260 ? -20.159 44.942 59.811 0.50 40.08 ? 260  GLU A O   1 
ATOM   2066 C CB  A GLU A 1 260 ? -20.154 42.301 57.807 0.50 41.63 ? 260  GLU A CB  1 
ATOM   2067 C CB  B GLU A 1 260 ? -20.162 42.215 57.879 0.50 40.98 ? 260  GLU A CB  1 
ATOM   2068 C CG  A GLU A 1 260 ? -21.557 42.866 57.655 0.50 43.38 ? 260  GLU A CG  1 
ATOM   2069 C CG  B GLU A 1 260 ? -19.765 41.617 56.531 0.50 42.16 ? 260  GLU A CG  1 
ATOM   2070 C CD  A GLU A 1 260 ? -22.444 41.998 56.779 0.50 45.07 ? 260  GLU A CD  1 
ATOM   2071 C CD  B GLU A 1 260 ? -18.460 40.839 56.577 0.50 43.38 ? 260  GLU A CD  1 
ATOM   2072 O OE1 A GLU A 1 260 ? -22.507 40.772 57.017 0.50 45.79 ? 260  GLU A OE1 1 
ATOM   2073 O OE1 B GLU A 1 260 ? -18.294 39.991 57.479 0.50 43.37 ? 260  GLU A OE1 1 
ATOM   2074 O OE2 A GLU A 1 260 ? -23.084 42.544 55.855 0.50 45.68 ? 260  GLU A OE2 1 
ATOM   2075 O OE2 B GLU A 1 260 ? -17.601 41.071 55.702 0.50 45.29 ? 260  GLU A OE2 1 
ATOM   2076 N N   . GLU A 1 261 ? -19.725 42.979 60.820 1.00 38.95 ? 261  GLU A N   1 
ATOM   2077 C CA  . GLU A 1 261 ? -20.243 43.395 62.120 1.00 39.90 ? 261  GLU A CA  1 
ATOM   2078 C C   . GLU A 1 261 ? -19.411 44.543 62.692 1.00 37.92 ? 261  GLU A C   1 
ATOM   2079 O O   . GLU A 1 261 ? -19.947 45.572 63.103 1.00 36.25 ? 261  GLU A O   1 
ATOM   2080 C CB  . GLU A 1 261 ? -20.218 42.213 63.095 1.00 42.95 ? 261  GLU A CB  1 
ATOM   2081 C CG  . GLU A 1 261 ? -21.189 41.095 62.751 1.00 50.17 ? 261  GLU A CG  1 
ATOM   2082 C CD  . GLU A 1 261 ? -22.597 41.370 63.243 1.00 54.20 ? 261  GLU A CD  1 
ATOM   2083 O OE1 . GLU A 1 261 ? -22.888 42.525 63.627 1.00 55.41 ? 261  GLU A OE1 1 
ATOM   2084 O OE2 . GLU A 1 261 ? -23.417 40.426 63.243 1.00 56.63 ? 261  GLU A OE2 1 
ATOM   2085 N N   . LEU A 1 262 ? -18.097 44.351 62.706 1.00 36.38 ? 262  LEU A N   1 
ATOM   2086 C CA  . LEU A 1 262 ? -17.165 45.344 63.231 1.00 35.73 ? 262  LEU A CA  1 
ATOM   2087 C C   . LEU A 1 262 ? -17.293 46.703 62.546 1.00 35.02 ? 262  LEU A C   1 
ATOM   2088 O O   . LEU A 1 262 ? -17.453 47.727 63.208 1.00 35.32 ? 262  LEU A O   1 
ATOM   2089 C CB  . LEU A 1 262 ? -15.731 44.821 63.093 1.00 35.28 ? 262  LEU A CB  1 
ATOM   2090 C CG  . LEU A 1 262 ? -14.578 45.737 63.517 1.00 34.83 ? 262  LEU A CG  1 
ATOM   2091 C CD1 . LEU A 1 262 ? -14.805 46.260 64.927 1.00 33.45 ? 262  LEU A CD1 1 
ATOM   2092 C CD2 . LEU A 1 262 ? -13.271 44.958 63.430 1.00 34.80 ? 262  LEU A CD2 1 
ATOM   2093 N N   . ILE A 1 263 ? -17.232 46.708 61.219 1.00 34.79 ? 263  ILE A N   1 
ATOM   2094 C CA  . ILE A 1 263 ? -17.329 47.949 60.455 1.00 34.73 ? 263  ILE A CA  1 
ATOM   2095 C C   . ILE A 1 263 ? -18.661 48.661 60.666 1.00 36.00 ? 263  ILE A C   1 
ATOM   2096 O O   . ILE A 1 263 ? -18.701 49.883 60.807 1.00 35.34 ? 263  ILE A O   1 
ATOM   2097 C CB  . ILE A 1 263 ? -17.109 47.681 58.949 1.00 34.84 ? 263  ILE A CB  1 
ATOM   2098 C CG1 . ILE A 1 263 ? -15.694 47.137 58.732 1.00 35.02 ? 263  ILE A CG1 1 
ATOM   2099 C CG2 . ILE A 1 263 ? -17.327 48.957 58.150 1.00 32.73 ? 263  ILE A CG2 1 
ATOM   2100 C CD1 . ILE A 1 263 ? -15.395 46.739 57.306 1.00 35.84 ? 263  ILE A CD1 1 
ATOM   2101 N N   . HIS A 1 264 ? -19.752 47.900 60.693 1.00 37.61 ? 264  HIS A N   1 
ATOM   2102 C CA  . HIS A 1 264 ? -21.072 48.488 60.902 1.00 38.29 ? 264  HIS A CA  1 
ATOM   2103 C C   . HIS A 1 264 ? -21.101 49.203 62.246 1.00 36.84 ? 264  HIS A C   1 
ATOM   2104 O O   . HIS A 1 264 ? -21.610 50.319 62.362 1.00 37.07 ? 264  HIS A O   1 
ATOM   2105 C CB  . HIS A 1 264 ? -22.153 47.406 60.887 1.00 41.46 ? 264  HIS A CB  1 
ATOM   2106 C CG  . HIS A 1 264 ? -23.515 47.918 61.240 1.00 45.35 ? 264  HIS A CG  1 
ATOM   2107 N ND1 . HIS A 1 264 ? -24.260 48.700 60.386 1.00 48.94 ? 264  HIS A ND1 1 
ATOM   2108 C CD2 . HIS A 1 264 ? -24.247 47.794 62.374 1.00 47.13 ? 264  HIS A CD2 1 
ATOM   2109 C CE1 . HIS A 1 264 ? -25.394 49.039 60.978 1.00 50.27 ? 264  HIS A CE1 1 
ATOM   2110 N NE2 . HIS A 1 264 ? -25.408 48.502 62.184 1.00 49.75 ? 264  HIS A NE2 1 
ATOM   2111 N N   . CYS A 1 265 ? -20.559 48.543 63.262 1.00 35.77 ? 265  CYS A N   1 
ATOM   2112 C CA  . CYS A 1 265 ? -20.501 49.107 64.606 1.00 35.83 ? 265  CYS A CA  1 
ATOM   2113 C C   . CYS A 1 265 ? -19.697 50.401 64.599 1.00 35.21 ? 265  CYS A C   1 
ATOM   2114 O O   . CYS A 1 265 ? -20.145 51.429 65.106 1.00 35.16 ? 265  CYS A O   1 
ATOM   2115 C CB  . CYS A 1 265 ? -19.844 48.107 65.556 1.00 36.03 ? 265  CYS A CB  1 
ATOM   2116 S SG  . CYS A 1 265 ? -19.657 48.658 67.283 0.60 36.84 ? 265  CYS A SG  1 
ATOM   2117 N N   . LEU A 1 266 ? -18.505 50.342 64.015 1.00 34.93 ? 266  LEU A N   1 
ATOM   2118 C CA  . LEU A 1 266 ? -17.634 51.509 63.949 1.00 35.12 ? 266  LEU A CA  1 
ATOM   2119 C C   . LEU A 1 266 ? -18.258 52.668 63.177 1.00 35.76 ? 266  LEU A C   1 
ATOM   2120 O O   . LEU A 1 266 ? -17.992 53.829 63.475 1.00 35.62 ? 266  LEU A O   1 
ATOM   2121 C CB  . LEU A 1 266 ? -16.289 51.119 63.326 1.00 33.64 ? 266  LEU A CB  1 
ATOM   2122 C CG  . LEU A 1 266 ? -15.444 50.162 64.176 1.00 32.68 ? 266  LEU A CG  1 
ATOM   2123 C CD1 . LEU A 1 266 ? -14.193 49.758 63.419 1.00 32.96 ? 266  LEU A CD1 1 
ATOM   2124 C CD2 . LEU A 1 266 ? -15.077 50.843 65.493 1.00 34.72 ? 266  LEU A CD2 1 
ATOM   2125 N N   . ARG A 1 267 ? -19.090 52.358 62.189 1.00 36.16 ? 267  ARG A N   1 
ATOM   2126 C CA  . ARG A 1 267 ? -19.727 53.407 61.402 1.00 36.63 ? 267  ARG A CA  1 
ATOM   2127 C C   . ARG A 1 267 ? -20.855 54.131 62.131 1.00 37.43 ? 267  ARG A C   1 
ATOM   2128 O O   . ARG A 1 267 ? -21.245 55.229 61.737 1.00 37.85 ? 267  ARG A O   1 
ATOM   2129 C CB  . ARG A 1 267 ? -20.238 52.839 60.074 1.00 35.42 ? 267  ARG A CB  1 
ATOM   2130 C CG  . ARG A 1 267 ? -19.128 52.648 59.056 1.00 35.33 ? 267  ARG A CG  1 
ATOM   2131 C CD  . ARG A 1 267 ? -19.633 52.112 57.734 1.00 36.18 ? 267  ARG A CD  1 
ATOM   2132 N NE  . ARG A 1 267 ? -18.559 52.049 56.745 1.00 35.67 ? 267  ARG A NE  1 
ATOM   2133 C CZ  . ARG A 1 267 ? -18.592 51.285 55.658 1.00 37.14 ? 267  ARG A CZ  1 
ATOM   2134 N NH1 . ARG A 1 267 ? -19.648 50.515 55.422 1.00 35.97 ? 267  ARG A NH1 1 
ATOM   2135 N NH2 . ARG A 1 267 ? -17.570 51.286 54.813 1.00 34.55 ? 267  ARG A NH2 1 
ATOM   2136 N N   . GLU A 1 268 ? -21.369 53.530 63.199 1.00 38.33 ? 268  GLU A N   1 
ATOM   2137 C CA  . GLU A 1 268 ? -22.447 54.149 63.964 1.00 41.05 ? 268  GLU A CA  1 
ATOM   2138 C C   . GLU A 1 268 ? -21.918 55.041 65.081 1.00 40.61 ? 268  GLU A C   1 
ATOM   2139 O O   . GLU A 1 268 ? -22.673 55.795 65.693 1.00 41.58 ? 268  GLU A O   1 
ATOM   2140 C CB  . GLU A 1 268 ? -23.362 53.076 64.564 1.00 44.46 ? 268  GLU A CB  1 
ATOM   2141 C CG  . GLU A 1 268 ? -24.201 52.329 63.540 1.00 50.93 ? 268  GLU A CG  1 
ATOM   2142 C CD  . GLU A 1 268 ? -25.093 53.255 62.733 1.00 54.55 ? 268  GLU A CD  1 
ATOM   2143 O OE1 . GLU A 1 268 ? -25.897 53.993 63.346 1.00 57.41 ? 268  GLU A OE1 1 
ATOM   2144 O OE2 . GLU A 1 268 ? -24.993 53.248 61.486 1.00 57.08 ? 268  GLU A OE2 1 
ATOM   2145 N N   . LYS A 1 269 ? -20.619 54.953 65.346 1.00 39.29 ? 269  LYS A N   1 
ATOM   2146 C CA  . LYS A 1 269 ? -20.009 55.749 66.401 1.00 38.68 ? 269  LYS A CA  1 
ATOM   2147 C C   . LYS A 1 269 ? -19.735 57.177 65.941 1.00 38.08 ? 269  LYS A C   1 
ATOM   2148 O O   . LYS A 1 269 ? -19.423 57.414 64.771 1.00 37.85 ? 269  LYS A O   1 
ATOM   2149 C CB  . LYS A 1 269 ? -18.693 55.106 66.843 1.00 39.65 ? 269  LYS A CB  1 
ATOM   2150 C CG  . LYS A 1 269 ? -18.822 53.670 67.324 1.00 41.22 ? 269  LYS A CG  1 
ATOM   2151 C CD  . LYS A 1 269 ? -19.627 53.592 68.609 1.00 41.97 ? 269  LYS A CD  1 
ATOM   2152 C CE  . LYS A 1 269 ? -19.791 52.153 69.071 1.00 42.01 ? 269  LYS A CE  1 
ATOM   2153 N NZ  . LYS A 1 269 ? -20.574 52.083 70.336 1.00 43.79 ? 269  LYS A NZ  1 
ATOM   2154 N N   . LYS A 1 270 ? -19.866 58.129 66.860 1.00 37.39 ? 270  LYS A N   1 
ATOM   2155 C CA  . LYS A 1 270 ? -19.584 59.522 66.542 1.00 36.89 ? 270  LYS A CA  1 
ATOM   2156 C C   . LYS A 1 270 ? -18.068 59.595 66.360 1.00 35.37 ? 270  LYS A C   1 
ATOM   2157 O O   . LYS A 1 270 ? -17.330 58.809 66.955 1.00 32.67 ? 270  LYS A O   1 
ATOM   2158 C CB  . LYS A 1 270 ? -20.015 60.443 67.687 1.00 38.86 ? 270  LYS A CB  1 
ATOM   2159 C CG  . LYS A 1 270 ? -21.520 60.516 67.912 1.00 41.80 ? 270  LYS A CG  1 
ATOM   2160 C CD  . LYS A 1 270 ? -22.238 61.070 66.690 1.00 44.60 ? 270  LYS A CD  1 
ATOM   2161 N N   . PRO A 1 271 ? -17.585 60.533 65.535 1.00 34.13 ? 271  PRO A N   1 
ATOM   2162 C CA  . PRO A 1 271 ? -16.144 60.665 65.303 1.00 33.69 ? 271  PRO A CA  1 
ATOM   2163 C C   . PRO A 1 271 ? -15.300 60.694 66.578 1.00 33.65 ? 271  PRO A C   1 
ATOM   2164 O O   . PRO A 1 271 ? -14.321 59.960 66.697 1.00 33.32 ? 271  PRO A O   1 
ATOM   2165 C CB  . PRO A 1 271 ? -16.046 61.966 64.511 1.00 34.69 ? 271  PRO A CB  1 
ATOM   2166 C CG  . PRO A 1 271 ? -17.321 61.958 63.724 1.00 34.47 ? 271  PRO A CG  1 
ATOM   2167 C CD  . PRO A 1 271 ? -18.335 61.535 64.758 1.00 33.85 ? 271  PRO A CD  1 
ATOM   2168 N N   . GLN A 1 272 ? -15.689 61.530 67.535 1.00 33.59 ? 272  GLN A N   1 
ATOM   2169 C CA  . GLN A 1 272 ? -14.938 61.651 68.779 1.00 34.45 ? 272  GLN A CA  1 
ATOM   2170 C C   . GLN A 1 272 ? -14.867 60.355 69.590 1.00 34.27 ? 272  GLN A C   1 
ATOM   2171 O O   . GLN A 1 272 ? -13.956 60.175 70.399 1.00 33.75 ? 272  GLN A O   1 
ATOM   2172 C CB  . GLN A 1 272 ? -15.518 62.779 69.637 1.00 36.29 ? 272  GLN A CB  1 
ATOM   2173 C CG  . GLN A 1 272 ? -14.616 63.206 70.793 1.00 38.54 ? 272  GLN A CG  1 
ATOM   2174 C CD  . GLN A 1 272 ? -13.197 63.535 70.340 1.00 40.51 ? 272  GLN A CD  1 
ATOM   2175 O OE1 . GLN A 1 272 ? -12.995 64.256 69.359 1.00 40.05 ? 272  GLN A OE1 1 
ATOM   2176 N NE2 . GLN A 1 272 ? -12.209 63.009 71.060 1.00 38.07 ? 272  GLN A NE2 1 
ATOM   2177 N N   . GLU A 1 273 ? -15.818 59.450 69.378 1.00 33.16 ? 273  GLU A N   1 
ATOM   2178 C CA  . GLU A 1 273 ? -15.807 58.183 70.104 1.00 33.51 ? 273  GLU A CA  1 
ATOM   2179 C C   . GLU A 1 273 ? -14.619 57.330 69.670 1.00 31.36 ? 273  GLU A C   1 
ATOM   2180 O O   . GLU A 1 273 ? -14.018 56.637 70.485 1.00 32.78 ? 273  GLU A O   1 
ATOM   2181 C CB  . GLU A 1 273 ? -17.109 57.406 69.873 1.00 34.69 ? 273  GLU A CB  1 
ATOM   2182 C CG  . GLU A 1 273 ? -18.351 58.103 70.409 1.00 38.68 ? 273  GLU A CG  1 
ATOM   2183 C CD  . GLU A 1 273 ? -19.595 57.231 70.319 1.00 40.25 ? 273  GLU A CD  1 
ATOM   2184 O OE1 . GLU A 1 273 ? -19.698 56.258 71.094 1.00 40.86 ? 273  GLU A OE1 1 
ATOM   2185 O OE2 . GLU A 1 273 ? -20.463 57.518 69.467 1.00 39.93 ? 273  GLU A OE2 1 
ATOM   2186 N N   . LEU A 1 274 ? -14.290 57.378 68.380 1.00 29.52 ? 274  LEU A N   1 
ATOM   2187 C CA  . LEU A 1 274 ? -13.165 56.618 67.851 1.00 30.18 ? 274  LEU A CA  1 
ATOM   2188 C C   . LEU A 1 274 ? -11.861 57.247 68.327 1.00 29.31 ? 274  LEU A C   1 
ATOM   2189 O O   . LEU A 1 274 ? -10.938 56.555 68.757 1.00 30.72 ? 274  LEU A O   1 
ATOM   2190 C CB  . LEU A 1 274 ? -13.197 56.614 66.318 1.00 31.43 ? 274  LEU A CB  1 
ATOM   2191 C CG  . LEU A 1 274 ? -14.017 55.537 65.598 1.00 35.61 ? 274  LEU A CG  1 
ATOM   2192 C CD1 . LEU A 1 274 ? -15.402 55.435 66.191 1.00 36.94 ? 274  LEU A CD1 1 
ATOM   2193 C CD2 . LEU A 1 274 ? -14.092 55.866 64.114 1.00 36.71 ? 274  LEU A CD2 1 
ATOM   2194 N N   . ILE A 1 275 ? -11.803 58.569 68.248 1.00 28.43 ? 275  ILE A N   1 
ATOM   2195 C CA  . ILE A 1 275 ? -10.619 59.321 68.650 1.00 29.94 ? 275  ILE A CA  1 
ATOM   2196 C C   . ILE A 1 275 ? -10.274 59.155 70.131 1.00 29.66 ? 275  ILE A C   1 
ATOM   2197 O O   . ILE A 1 275 ? -9.103  59.098 70.494 1.00 29.30 ? 275  ILE A O   1 
ATOM   2198 C CB  . ILE A 1 275 ? -10.801 60.818 68.325 1.00 29.29 ? 275  ILE A CB  1 
ATOM   2199 C CG1 . ILE A 1 275 ? -10.948 60.993 66.809 1.00 29.43 ? 275  ILE A CG1 1 
ATOM   2200 C CG2 . ILE A 1 275 ? -9.603  61.628 68.836 1.00 30.21 ? 275  ILE A CG2 1 
ATOM   2201 C CD1 . ILE A 1 275 ? -11.290 62.402 66.391 1.00 30.39 ? 275  ILE A CD1 1 
ATOM   2202 N N   . ASP A 1 276 ? -11.289 59.072 70.981 1.00 29.01 ? 276  ASP A N   1 
ATOM   2203 C CA  . ASP A 1 276 ? -11.057 58.912 72.416 1.00 30.83 ? 276  ASP A CA  1 
ATOM   2204 C C   . ASP A 1 276 ? -10.311 57.634 72.805 1.00 30.02 ? 276  ASP A C   1 
ATOM   2205 O O   . ASP A 1 276 ? -9.675  57.584 73.859 1.00 31.46 ? 276  ASP A O   1 
ATOM   2206 C CB  . ASP A 1 276 ? -12.383 58.957 73.189 1.00 32.35 ? 276  ASP A CB  1 
ATOM   2207 C CG  . ASP A 1 276 ? -12.924 60.366 73.349 1.00 36.31 ? 276  ASP A CG  1 
ATOM   2208 O OD1 . ASP A 1 276 ? -12.126 61.326 73.305 1.00 39.87 ? 276  ASP A OD1 1 
ATOM   2209 O OD2 . ASP A 1 276 ? -14.148 60.509 73.539 1.00 39.53 ? 276  ASP A OD2 1 
ATOM   2210 N N   . VAL A 1 277 ? -10.392 56.601 71.972 1.00 28.31 ? 277  VAL A N   1 
ATOM   2211 C CA  . VAL A 1 277 ? -9.729  55.330 72.277 1.00 29.03 ? 277  VAL A CA  1 
ATOM   2212 C C   . VAL A 1 277 ? -8.636  54.951 71.278 1.00 28.49 ? 277  VAL A C   1 
ATOM   2213 O O   . VAL A 1 277 ? -7.977  53.918 71.418 1.00 27.74 ? 277  VAL A O   1 
ATOM   2214 C CB  . VAL A 1 277 ? -10.759 54.171 72.342 1.00 28.97 ? 277  VAL A CB  1 
ATOM   2215 C CG1 . VAL A 1 277 ? -11.721 54.397 73.495 1.00 29.11 ? 277  VAL A CG1 1 
ATOM   2216 C CG2 . VAL A 1 277 ? -11.532 54.074 71.031 1.00 29.74 ? 277  VAL A CG2 1 
ATOM   2217 N N   . GLU A 1 278 ? -8.444  55.802 70.280 1.00 27.75 ? 278  GLU A N   1 
ATOM   2218 C CA  . GLU A 1 278 ? -7.457  55.577 69.228 1.00 28.63 ? 278  GLU A CA  1 
ATOM   2219 C C   . GLU A 1 278 ? -6.077  55.139 69.713 1.00 27.06 ? 278  GLU A C   1 
ATOM   2220 O O   . GLU A 1 278 ? -5.471  54.232 69.145 1.00 27.88 ? 278  GLU A O   1 
ATOM   2221 C CB  . GLU A 1 278 ? -7.298  56.851 68.393 1.00 30.18 ? 278  GLU A CB  1 
ATOM   2222 C CG  . GLU A 1 278 ? -6.301  56.729 67.253 1.00 32.63 ? 278  GLU A CG  1 
ATOM   2223 C CD  . GLU A 1 278 ? -5.995  58.062 66.595 1.00 35.29 ? 278  GLU A CD  1 
ATOM   2224 O OE1 . GLU A 1 278 ? -6.920  58.893 66.471 1.00 31.89 ? 278  GLU A OE1 1 
ATOM   2225 O OE2 . GLU A 1 278 ? -4.829  58.273 66.192 1.00 36.90 ? 278  GLU A OE2 1 
ATOM   2226 N N   . TRP A 1 279 ? -5.578  55.781 70.761 1.00 26.42 ? 279  TRP A N   1 
ATOM   2227 C CA  . TRP A 1 279 ? -4.248  55.456 71.262 1.00 28.18 ? 279  TRP A CA  1 
ATOM   2228 C C   . TRP A 1 279 ? -4.141  54.168 72.068 1.00 29.61 ? 279  TRP A C   1 
ATOM   2229 O O   . TRP A 1 279 ? -3.037  53.719 72.369 1.00 31.98 ? 279  TRP A O   1 
ATOM   2230 C CB  . TRP A 1 279 ? -3.698  56.625 72.086 1.00 27.59 ? 279  TRP A CB  1 
ATOM   2231 C CG  . TRP A 1 279 ? -3.529  57.880 71.287 1.00 29.47 ? 279  TRP A CG  1 
ATOM   2232 C CD1 . TRP A 1 279 ? -4.402  58.926 71.205 1.00 30.02 ? 279  TRP A CD1 1 
ATOM   2233 C CD2 . TRP A 1 279 ? -2.412  58.224 70.456 1.00 30.20 ? 279  TRP A CD2 1 
ATOM   2234 N NE1 . TRP A 1 279 ? -3.898  59.904 70.379 1.00 31.65 ? 279  TRP A NE1 1 
ATOM   2235 C CE2 . TRP A 1 279 ? -2.678  59.497 69.904 1.00 32.44 ? 279  TRP A CE2 1 
ATOM   2236 C CE3 . TRP A 1 279 ? -1.214  57.579 70.124 1.00 31.85 ? 279  TRP A CE3 1 
ATOM   2237 C CZ2 . TRP A 1 279 ? -1.784  60.143 69.038 1.00 33.04 ? 279  TRP A CZ2 1 
ATOM   2238 C CZ3 . TRP A 1 279 ? -0.322  58.221 69.261 1.00 33.67 ? 279  TRP A CZ3 1 
ATOM   2239 C CH2 . TRP A 1 279 ? -0.615  59.489 68.729 1.00 32.57 ? 279  TRP A CH2 1 
ATOM   2240 N N   . ASN A 1 280 ? -5.277  53.555 72.389 1.00 28.18 ? 280  ASN A N   1 
ATOM   2241 C CA  . ASN A 1 280 ? -5.270  52.329 73.179 1.00 29.20 ? 280  ASN A CA  1 
ATOM   2242 C C   . ASN A 1 280 ? -4.925  51.063 72.400 1.00 29.66 ? 280  ASN A C   1 
ATOM   2243 O O   . ASN A 1 280 ? -4.757  50.002 73.001 1.00 30.03 ? 280  ASN A O   1 
ATOM   2244 C CB  . ASN A 1 280 ? -6.631  52.135 73.868 1.00 29.69 ? 280  ASN A CB  1 
ATOM   2245 C CG  . ASN A 1 280 ? -7.007  53.298 74.776 1.00 32.89 ? 280  ASN A CG  1 
ATOM   2246 O OD1 . ASN A 1 280 ? -6.154  54.093 75.181 1.00 32.57 ? 280  ASN A OD1 1 
ATOM   2247 N ND2 . ASN A 1 280 ? -8.292  53.394 75.111 1.00 30.08 ? 280  ASN A ND2 1 
ATOM   2248 N N   . VAL A 1 281 ? -4.797  51.167 71.079 1.00 28.50 ? 281  VAL A N   1 
ATOM   2249 C CA  . VAL A 1 281 ? -4.515  49.985 70.265 1.00 29.06 ? 281  VAL A CA  1 
ATOM   2250 C C   . VAL A 1 281 ? -3.050  49.707 69.920 1.00 28.94 ? 281  VAL A C   1 
ATOM   2251 O O   . VAL A 1 281 ? -2.753  48.709 69.266 1.00 26.75 ? 281  VAL A O   1 
ATOM   2252 C CB  . VAL A 1 281 ? -5.326  50.010 68.939 1.00 30.03 ? 281  VAL A CB  1 
ATOM   2253 C CG1 . VAL A 1 281 ? -6.799  50.268 69.236 1.00 30.77 ? 281  VAL A CG1 1 
ATOM   2254 C CG2 . VAL A 1 281 ? -4.767  51.067 67.993 1.00 30.40 ? 281  VAL A CG2 1 
ATOM   2255 N N   . LEU A 1 282 ? -2.132  50.567 70.351 1.00 27.47 ? 282  LEU A N   1 
ATOM   2256 C CA  . LEU A 1 282 ? -0.717  50.333 70.055 1.00 27.44 ? 282  LEU A CA  1 
ATOM   2257 C C   . LEU A 1 282 ? -0.256  49.050 70.744 1.00 28.15 ? 282  LEU A C   1 
ATOM   2258 O O   . LEU A 1 282 ? -0.630  48.780 71.884 1.00 28.92 ? 282  LEU A O   1 
ATOM   2259 C CB  . LEU A 1 282 ? 0.136   51.508 70.529 1.00 26.68 ? 282  LEU A CB  1 
ATOM   2260 C CG  . LEU A 1 282 ? -0.037  52.789 69.713 1.00 26.86 ? 282  LEU A CG  1 
ATOM   2261 C CD1 . LEU A 1 282 ? 0.782   53.913 70.340 1.00 27.47 ? 282  LEU A CD1 1 
ATOM   2262 C CD2 . LEU A 1 282 ? 0.397   52.535 68.273 1.00 26.02 ? 282  LEU A CD2 1 
ATOM   2263 N N   . PRO A 1 283 ? 0.723   48.339 70.092 1.00 28.82 ? 283  PRO A N   1 
ATOM   2264 C CA  . PRO A 1 283 ? 1.360   47.056 70.590 1.00 29.63 ? 283  PRO A CA  1 
ATOM   2265 C C   . PRO A 1 283 ? 2.054   47.193 71.881 1.00 30.98 ? 283  PRO A C   1 
ATOM   2266 O O   . PRO A 1 283 ? 1.875   46.474 72.860 1.00 31.60 ? 283  PRO A O   1 
ATOM   2267 C CB  . PRO A 1 283 ? 2.368   46.603 69.582 1.00 30.41 ? 283  PRO A CB  1 
ATOM   2268 C CG  . PRO A 1 283 ? 1.609   46.913 68.351 1.00 29.88 ? 283  PRO A CG  1 
ATOM   2269 C CD  . PRO A 1 283 ? 0.580   47.970 68.654 1.00 28.15 ? 283  PRO A CD  1 
ATOM   2270 N N   . PHE A 1 284 ? 2.917   48.186 71.796 1.00 29.78 ? 284  PHE A N   1 
ATOM   2271 C CA  . PHE A 1 284 ? 3.869   48.467 72.827 1.00 29.82 ? 284  PHE A CA  1 
ATOM   2272 C C   . PHE A 1 284 ? 3.767   49.826 73.475 1.00 29.58 ? 284  PHE A C   1 
ATOM   2273 O O   . PHE A 1 284 ? 3.171   50.760 72.945 1.00 28.36 ? 284  PHE A O   1 
ATOM   2274 C CB  . PHE A 1 284 ? 5.243   48.366 72.229 1.00 30.16 ? 284  PHE A CB  1 
ATOM   2275 C CG  . PHE A 1 284 ? 5.463   47.169 71.329 1.00 33.14 ? 284  PHE A CG  1 
ATOM   2276 C CD1 . PHE A 1 284 ? 5.465   45.888 71.868 1.00 35.60 ? 284  PHE A CD1 1 
ATOM   2277 C CD2 . PHE A 1 284 ? 5.704   47.327 69.968 1.00 34.60 ? 284  PHE A CD2 1 
ATOM   2278 C CE1 . PHE A 1 284 ? 5.709   44.776 71.063 1.00 38.38 ? 284  PHE A CE1 1 
ATOM   2279 C CE2 . PHE A 1 284 ? 5.949   46.225 69.152 1.00 37.38 ? 284  PHE A CE2 1 
ATOM   2280 C CZ  . PHE A 1 284 ? 5.952   44.947 69.702 1.00 37.62 ? 284  PHE A CZ  1 
ATOM   2281 N N   . ASP A 1 285 ? 4.371   49.888 74.654 1.00 28.79 ? 285  ASP A N   1 
ATOM   2282 C CA  . ASP A 1 285 ? 4.582   51.143 75.349 1.00 27.74 ? 285  ASP A CA  1 
ATOM   2283 C C   . ASP A 1 285 ? 5.633   51.818 74.482 1.00 28.84 ? 285  ASP A C   1 
ATOM   2284 O O   . ASP A 1 285 ? 6.758   51.319 74.420 1.00 28.50 ? 285  ASP A O   1 
ATOM   2285 C CB  . ASP A 1 285 ? 5.105   50.913 76.761 1.00 29.52 ? 285  ASP A CB  1 
ATOM   2286 C CG  . ASP A 1 285 ? 5.110   52.160 77.609 1.00 30.53 ? 285  ASP A CG  1 
ATOM   2287 O OD1 . ASP A 1 285 ? 4.674   53.229 77.131 1.00 29.83 ? 285  ASP A OD1 1 
ATOM   2288 O OD2 . ASP A 1 285 ? 5.570   52.063 78.765 1.00 33.26 ? 285  ASP A OD2 1 
ATOM   2289 N N   . SER A 1 286 ? 5.311   52.912 73.805 1.00 27.49 ? 286  SER A N   1 
ATOM   2290 C CA  . SER A 1 286 ? 6.280   53.507 72.898 1.00 27.79 ? 286  SER A CA  1 
ATOM   2291 C C   . SER A 1 286 ? 6.077   54.986 72.608 1.00 27.99 ? 286  SER A C   1 
ATOM   2292 O O   . SER A 1 286 ? 5.076   55.579 73.002 1.00 29.08 ? 286  SER A O   1 
ATOM   2293 C CB  . SER A 1 286 ? 6.198   52.761 71.569 1.00 28.66 ? 286  SER A CB  1 
ATOM   2294 O OG  . SER A 1 286 ? 4.854   52.644 71.126 1.00 29.28 ? 286  SER A OG  1 
ATOM   2295 N N   . ILE A 1 287 ? 7.058   55.571 71.926 1.00 25.43 ? 287  ILE A N   1 
ATOM   2296 C CA  . ILE A 1 287 ? 6.973   56.956 71.476 1.00 24.65 ? 287  ILE A CA  1 
ATOM   2297 C C   . ILE A 1 287 ? 7.272   56.884 69.979 1.00 22.84 ? 287  ILE A C   1 
ATOM   2298 O O   . ILE A 1 287 ? 7.939   55.958 69.511 1.00 23.08 ? 287  ILE A O   1 
ATOM   2299 C CB  . ILE A 1 287 ? 7.992   57.913 72.179 1.00 24.66 ? 287  ILE A CB  1 
ATOM   2300 C CG1 . ILE A 1 287 ? 9.424   57.403 71.992 1.00 25.50 ? 287  ILE A CG1 1 
ATOM   2301 C CG2 . ILE A 1 287 ? 7.676   58.049 73.656 1.00 24.86 ? 287  ILE A CG2 1 
ATOM   2302 C CD1 . ILE A 1 287 ? 10.481  58.285 72.632 1.00 28.33 ? 287  ILE A CD1 1 
ATOM   2303 N N   . PHE A 1 288 ? 6.770   57.858 69.234 1.00 22.42 ? 288  PHE A N   1 
ATOM   2304 C CA  . PHE A 1 288 ? 6.930   57.906 67.783 1.00 23.39 ? 288  PHE A CA  1 
ATOM   2305 C C   . PHE A 1 288 ? 6.293   56.691 67.098 1.00 23.86 ? 288  PHE A C   1 
ATOM   2306 O O   . PHE A 1 288 ? 6.840   56.138 66.143 1.00 24.31 ? 288  PHE A O   1 
ATOM   2307 C CB  . PHE A 1 288 ? 8.404   58.013 67.374 1.00 22.11 ? 288  PHE A CB  1 
ATOM   2308 C CG  . PHE A 1 288 ? 8.645   58.985 66.240 1.00 23.39 ? 288  PHE A CG  1 
ATOM   2309 C CD1 . PHE A 1 288 ? 7.856   58.945 65.084 1.00 22.36 ? 288  PHE A CD1 1 
ATOM   2310 C CD2 . PHE A 1 288 ? 9.656   59.938 66.327 1.00 24.18 ? 288  PHE A CD2 1 
ATOM   2311 C CE1 . PHE A 1 288 ? 8.071   59.836 64.036 1.00 23.18 ? 288  PHE A CE1 1 
ATOM   2312 C CE2 . PHE A 1 288 ? 9.884   60.841 65.281 1.00 23.75 ? 288  PHE A CE2 1 
ATOM   2313 C CZ  . PHE A 1 288 ? 9.090   60.790 64.133 1.00 25.63 ? 288  PHE A CZ  1 
ATOM   2314 N N   . ARG A 1 289 ? 5.143   56.269 67.614 1.00 23.90 ? 289  ARG A N   1 
ATOM   2315 C CA  . ARG A 1 289 ? 4.384   55.162 67.031 1.00 24.74 ? 289  ARG A CA  1 
ATOM   2316 C C   . ARG A 1 289 ? 2.931   55.627 67.045 1.00 25.12 ? 289  ARG A C   1 
ATOM   2317 O O   . ARG A 1 289 ? 2.438   56.139 68.059 1.00 24.95 ? 289  ARG A O   1 
ATOM   2318 C CB  . ARG A 1 289 ? 4.556   53.871 67.836 1.00 23.21 ? 289  ARG A CB  1 
ATOM   2319 C CG  . ARG A 1 289 ? 5.952   53.248 67.718 1.00 23.24 ? 289  ARG A CG  1 
ATOM   2320 C CD  . ARG A 1 289 ? 6.277   52.838 66.280 1.00 24.10 ? 289  ARG A CD  1 
ATOM   2321 N NE  . ARG A 1 289 ? 7.555   52.128 66.186 1.00 24.39 ? 289  ARG A NE  1 
ATOM   2322 C CZ  . ARG A 1 289 ? 8.743   52.713 66.052 1.00 27.19 ? 289  ARG A CZ  1 
ATOM   2323 N NH1 . ARG A 1 289 ? 8.841   54.036 65.986 1.00 23.75 ? 289  ARG A NH1 1 
ATOM   2324 N NH2 . ARG A 1 289 ? 9.838   51.970 65.993 1.00 25.91 ? 289  ARG A NH2 1 
ATOM   2325 N N   . PHE A 1 290 ? 2.263   55.464 65.908 1.00 24.37 ? 290  PHE A N   1 
ATOM   2326 C CA  . PHE A 1 290 ? 0.887   55.908 65.736 1.00 24.34 ? 290  PHE A CA  1 
ATOM   2327 C C   . PHE A 1 290 ? -0.018  54.733 65.356 1.00 24.12 ? 290  PHE A C   1 
ATOM   2328 O O   . PHE A 1 290 ? 0.390   53.825 64.637 1.00 23.57 ? 290  PHE A O   1 
ATOM   2329 C CB  . PHE A 1 290 ? 0.891   57.018 64.684 1.00 25.03 ? 290  PHE A CB  1 
ATOM   2330 C CG  . PHE A 1 290 ? 2.041   57.988 64.859 1.00 25.19 ? 290  PHE A CG  1 
ATOM   2331 C CD1 . PHE A 1 290 ? 2.162   58.734 66.029 1.00 27.54 ? 290  PHE A CD1 1 
ATOM   2332 C CD2 . PHE A 1 290 ? 3.037   58.099 63.890 1.00 24.99 ? 290  PHE A CD2 1 
ATOM   2333 C CE1 . PHE A 1 290 ? 3.266   59.577 66.235 1.00 26.70 ? 290  PHE A CE1 1 
ATOM   2334 C CE2 . PHE A 1 290 ? 4.145   58.938 64.082 1.00 26.05 ? 290  PHE A CE2 1 
ATOM   2335 C CZ  . PHE A 1 290 ? 4.257   59.677 65.261 1.00 26.60 ? 290  PHE A CZ  1 
ATOM   2336 N N   . SER A 1 291 ? -1.250  54.766 65.847 1.00 24.69 ? 291  SER A N   1 
ATOM   2337 C CA  . SER A 1 291 ? -2.201  53.674 65.651 1.00 25.86 ? 291  SER A CA  1 
ATOM   2338 C C   . SER A 1 291 ? -2.620  53.281 64.244 1.00 25.65 ? 291  SER A C   1 
ATOM   2339 O O   . SER A 1 291 ? -2.486  52.115 63.858 1.00 24.89 ? 291  SER A O   1 
ATOM   2340 C CB  . SER A 1 291 ? -3.457  53.949 66.480 1.00 26.49 ? 291  SER A CB  1 
ATOM   2341 O OG  . SER A 1 291 ? -3.137  53.947 67.858 1.00 29.78 ? 291  SER A OG  1 
ATOM   2342 N N   . PHE A 1 292 ? -3.138  54.239 63.485 1.00 23.86 ? 292  PHE A N   1 
ATOM   2343 C CA  . PHE A 1 292 ? -3.613  53.945 62.136 1.00 24.07 ? 292  PHE A CA  1 
ATOM   2344 C C   . PHE A 1 292 ? -2.771  54.614 61.065 1.00 23.57 ? 292  PHE A C   1 
ATOM   2345 O O   . PHE A 1 292 ? -2.821  55.830 60.881 1.00 23.96 ? 292  PHE A O   1 
ATOM   2346 C CB  . PHE A 1 292 ? -5.084  54.351 62.043 1.00 23.38 ? 292  PHE A CB  1 
ATOM   2347 C CG  . PHE A 1 292 ? -5.946  53.640 63.044 1.00 25.49 ? 292  PHE A CG  1 
ATOM   2348 C CD1 . PHE A 1 292 ? -6.270  52.296 62.867 1.00 27.16 ? 292  PHE A CD1 1 
ATOM   2349 C CD2 . PHE A 1 292 ? -6.327  54.271 64.225 1.00 25.91 ? 292  PHE A CD2 1 
ATOM   2350 C CE1 . PHE A 1 292 ? -6.954  51.591 63.855 1.00 27.73 ? 292  PHE A CE1 1 
ATOM   2351 C CE2 . PHE A 1 292 ? -7.009  53.579 65.220 1.00 27.84 ? 292  PHE A CE2 1 
ATOM   2352 C CZ  . PHE A 1 292 ? -7.322  52.231 65.037 1.00 26.95 ? 292  PHE A CZ  1 
ATOM   2353 N N   . VAL A 1 293 ? -1.999  53.792 60.362 1.00 22.35 ? 293  VAL A N   1 
ATOM   2354 C CA  . VAL A 1 293 ? -1.096  54.260 59.329 1.00 22.99 ? 293  VAL A CA  1 
ATOM   2355 C C   . VAL A 1 293 ? -1.215  53.385 58.077 1.00 25.25 ? 293  VAL A C   1 
ATOM   2356 O O   . VAL A 1 293 ? -1.948  52.388 58.073 1.00 26.68 ? 293  VAL A O   1 
ATOM   2357 C CB  . VAL A 1 293 ? 0.366   54.208 59.852 1.00 22.93 ? 293  VAL A CB  1 
ATOM   2358 C CG1 . VAL A 1 293 ? 0.519   55.097 61.088 1.00 22.94 ? 293  VAL A CG1 1 
ATOM   2359 C CG2 . VAL A 1 293 ? 0.742   52.767 60.214 1.00 22.13 ? 293  VAL A CG2 1 
ATOM   2360 N N   . PRO A 1 294 ? -0.503  53.750 56.997 1.00 23.78 ? 294  PRO A N   1 
ATOM   2361 C CA  . PRO A 1 294 ? -0.559  52.959 55.765 1.00 23.87 ? 294  PRO A CA  1 
ATOM   2362 C C   . PRO A 1 294 ? -0.271  51.477 56.008 1.00 24.90 ? 294  PRO A C   1 
ATOM   2363 O O   . PRO A 1 294 ? 0.489   51.120 56.907 1.00 23.53 ? 294  PRO A O   1 
ATOM   2364 C CB  . PRO A 1 294 ? 0.501   53.623 54.894 1.00 23.55 ? 294  PRO A CB  1 
ATOM   2365 C CG  . PRO A 1 294 ? 0.300   55.070 55.228 1.00 22.02 ? 294  PRO A CG  1 
ATOM   2366 C CD  . PRO A 1 294 ? 0.177   55.040 56.752 1.00 23.50 ? 294  PRO A CD  1 
ATOM   2367 N N   . VAL A 1 295 ? -0.890  50.617 55.207 1.00 25.51 ? 295  VAL A N   1 
ATOM   2368 C CA  . VAL A 1 295 ? -0.688  49.179 55.340 1.00 26.68 ? 295  VAL A CA  1 
ATOM   2369 C C   . VAL A 1 295 ? -0.095  48.610 54.051 1.00 27.89 ? 295  VAL A C   1 
ATOM   2370 O O   . VAL A 1 295 ? -0.460  49.036 52.955 1.00 26.26 ? 295  VAL A O   1 
ATOM   2371 C CB  . VAL A 1 295 ? -2.028  48.470 55.665 1.00 29.21 ? 295  VAL A CB  1 
ATOM   2372 C CG1 . VAL A 1 295 ? -3.054  48.760 54.572 1.00 28.57 ? 295  VAL A CG1 1 
ATOM   2373 C CG2 . VAL A 1 295 ? -1.806  46.973 55.812 1.00 32.41 ? 295  VAL A CG2 1 
ATOM   2374 N N   . ILE A 1 296 ? 0.842   47.673 54.183 1.00 28.21 ? 296  ILE A N   1 
ATOM   2375 C CA  . ILE A 1 296 ? 1.462   47.043 53.021 1.00 29.68 ? 296  ILE A CA  1 
ATOM   2376 C C   . ILE A 1 296 ? 0.435   46.007 52.570 1.00 32.43 ? 296  ILE A C   1 
ATOM   2377 O O   . ILE A 1 296 ? 0.415   44.872 53.047 1.00 32.45 ? 296  ILE A O   1 
ATOM   2378 C CB  . ILE A 1 296 ? 2.800   46.377 53.410 1.00 29.14 ? 296  ILE A CB  1 
ATOM   2379 C CG1 . ILE A 1 296 ? 3.682   47.400 54.140 1.00 30.02 ? 296  ILE A CG1 1 
ATOM   2380 C CG2 . ILE A 1 296 ? 3.525   45.867 52.167 1.00 29.11 ? 296  ILE A CG2 1 
ATOM   2381 C CD1 . ILE A 1 296 ? 3.896   48.706 53.370 1.00 27.03 ? 296  ILE A CD1 1 
ATOM   2382 N N   . ASP A 1 297 ? -0.415  46.424 51.637 1.00 32.64 ? 297  ASP A N   1 
ATOM   2383 C CA  . ASP A 1 297 ? -1.534  45.618 51.157 1.00 33.27 ? 297  ASP A CA  1 
ATOM   2384 C C   . ASP A 1 297 ? -1.401  44.766 49.903 1.00 34.77 ? 297  ASP A C   1 
ATOM   2385 O O   . ASP A 1 297 ? -2.247  43.908 49.662 1.00 35.46 ? 297  ASP A O   1 
ATOM   2386 C CB  . ASP A 1 297 ? -2.730  46.546 50.966 1.00 32.36 ? 297  ASP A CB  1 
ATOM   2387 C CG  . ASP A 1 297 ? -2.454  47.638 49.946 1.00 33.71 ? 297  ASP A CG  1 
ATOM   2388 O OD1 . ASP A 1 297 ? -1.283  47.793 49.532 1.00 31.41 ? 297  ASP A OD1 1 
ATOM   2389 O OD2 . ASP A 1 297 ? -3.405  48.350 49.559 1.00 37.28 ? 297  ASP A OD2 1 
ATOM   2390 N N   . GLY A 1 298 ? -0.377  45.001 49.096 1.00 34.07 ? 298  GLY A N   1 
ATOM   2391 C CA  . GLY A 1 298 ? -0.244  44.229 47.874 1.00 35.84 ? 298  GLY A CA  1 
ATOM   2392 C C   . GLY A 1 298 ? -1.031  44.873 46.743 1.00 37.33 ? 298  GLY A C   1 
ATOM   2393 O O   . GLY A 1 298 ? -1.137  44.313 45.651 1.00 38.60 ? 298  GLY A O   1 
ATOM   2394 N N   . GLU A 1 299 ? -1.596  46.049 47.012 1.00 36.37 ? 299  GLU A N   1 
ATOM   2395 C CA  . GLU A 1 299 ? -2.370  46.795 46.023 1.00 35.61 ? 299  GLU A CA  1 
ATOM   2396 C C   . GLU A 1 299 ? -1.731  48.173 45.838 1.00 34.12 ? 299  GLU A C   1 
ATOM   2397 O O   . GLU A 1 299 ? -1.081  48.433 44.828 1.00 34.61 ? 299  GLU A O   1 
ATOM   2398 C CB  . GLU A 1 299 ? -3.821  46.952 46.488 1.00 37.65 ? 299  GLU A CB  1 
ATOM   2399 C CG  . GLU A 1 299 ? -4.553  45.633 46.688 1.00 42.44 ? 299  GLU A CG  1 
ATOM   2400 N N   . PHE A 1 300 ? -1.920  49.057 46.814 1.00 30.74 ? 300  PHE A N   1 
ATOM   2401 C CA  . PHE A 1 300 ? -1.316  50.380 46.736 1.00 29.32 ? 300  PHE A CA  1 
ATOM   2402 C C   . PHE A 1 300 ? 0.193   50.137 46.715 1.00 28.51 ? 300  PHE A C   1 
ATOM   2403 O O   . PHE A 1 300 ? 0.934   50.800 45.991 1.00 29.16 ? 300  PHE A O   1 
ATOM   2404 C CB  . PHE A 1 300 ? -1.720  51.229 47.948 1.00 28.25 ? 300  PHE A CB  1 
ATOM   2405 C CG  . PHE A 1 300 ? -1.295  52.669 47.848 1.00 27.70 ? 300  PHE A CG  1 
ATOM   2406 C CD1 . PHE A 1 300 ? 0.018   53.043 48.120 1.00 26.60 ? 300  PHE A CD1 1 
ATOM   2407 C CD2 . PHE A 1 300 ? -2.203  53.649 47.459 1.00 27.88 ? 300  PHE A CD2 1 
ATOM   2408 C CE1 . PHE A 1 300 ? 0.419   54.376 48.009 1.00 27.14 ? 300  PHE A CE1 1 
ATOM   2409 C CE2 . PHE A 1 300 ? -1.810  54.985 47.344 1.00 26.97 ? 300  PHE A CE2 1 
ATOM   2410 C CZ  . PHE A 1 300 ? -0.498  55.346 47.618 1.00 26.26 ? 300  PHE A CZ  1 
ATOM   2411 N N   . PHE A 1 301 ? 0.631   49.165 47.515 1.00 29.28 ? 301  PHE A N   1 
ATOM   2412 C CA  . PHE A 1 301 ? 2.032   48.762 47.597 1.00 28.00 ? 301  PHE A CA  1 
ATOM   2413 C C   . PHE A 1 301 ? 2.078   47.316 47.098 1.00 30.85 ? 301  PHE A C   1 
ATOM   2414 O O   . PHE A 1 301 ? 1.652   46.400 47.806 1.00 30.65 ? 301  PHE A O   1 
ATOM   2415 C CB  . PHE A 1 301 ? 2.524   48.817 49.052 1.00 29.32 ? 301  PHE A CB  1 
ATOM   2416 C CG  . PHE A 1 301 ? 2.473   50.189 49.661 1.00 28.14 ? 301  PHE A CG  1 
ATOM   2417 C CD1 . PHE A 1 301 ? 3.354   51.186 49.244 1.00 28.78 ? 301  PHE A CD1 1 
ATOM   2418 C CD2 . PHE A 1 301 ? 1.530   50.491 50.640 1.00 28.26 ? 301  PHE A CD2 1 
ATOM   2419 C CE1 . PHE A 1 301 ? 3.295   52.470 49.797 1.00 29.03 ? 301  PHE A CE1 1 
ATOM   2420 C CE2 . PHE A 1 301 ? 1.460   51.772 51.202 1.00 29.35 ? 301  PHE A CE2 1 
ATOM   2421 C CZ  . PHE A 1 301 ? 2.346   52.763 50.778 1.00 28.17 ? 301  PHE A CZ  1 
ATOM   2422 N N   . PRO A 1 302 ? 2.586   47.094 45.871 1.00 31.42 ? 302  PRO A N   1 
ATOM   2423 C CA  . PRO A 1 302 ? 2.697   45.769 45.243 1.00 33.46 ? 302  PRO A CA  1 
ATOM   2424 C C   . PRO A 1 302 ? 3.376   44.707 46.105 1.00 33.84 ? 302  PRO A C   1 
ATOM   2425 O O   . PRO A 1 302 ? 2.873   43.590 46.237 1.00 33.79 ? 302  PRO A O   1 
ATOM   2426 C CB  . PRO A 1 302 ? 3.487   46.059 43.971 1.00 34.60 ? 302  PRO A CB  1 
ATOM   2427 C CG  . PRO A 1 302 ? 3.074   47.456 43.636 1.00 35.24 ? 302  PRO A CG  1 
ATOM   2428 C CD  . PRO A 1 302 ? 3.122   48.135 44.975 1.00 32.21 ? 302  PRO A CD  1 
ATOM   2429 N N   . THR A 1 303 ? 4.530   45.057 46.666 1.00 32.51 ? 303  THR A N   1 
ATOM   2430 C CA  . THR A 1 303 ? 5.286   44.150 47.524 1.00 33.69 ? 303  THR A CA  1 
ATOM   2431 C C   . THR A 1 303 ? 5.855   44.966 48.683 1.00 32.60 ? 303  THR A C   1 
ATOM   2432 O O   . THR A 1 303 ? 5.535   46.146 48.826 1.00 32.03 ? 303  THR A O   1 
ATOM   2433 C CB  . THR A 1 303 ? 6.458   43.485 46.760 1.00 34.28 ? 303  THR A CB  1 
ATOM   2434 O OG1 . THR A 1 303 ? 7.411   44.483 46.377 1.00 36.13 ? 303  THR A OG1 1 
ATOM   2435 C CG2 . THR A 1 303 ? 5.952   42.784 45.504 1.00 38.04 ? 303  THR A CG2 1 
ATOM   2436 N N   . SER A 1 304 ? 6.690   44.340 49.506 1.00 31.29 ? 304  SER A N   1 
ATOM   2437 C CA  . SER A 1 304 ? 7.300   45.033 50.641 1.00 30.19 ? 304  SER A CA  1 
ATOM   2438 C C   . SER A 1 304 ? 8.069   46.253 50.149 1.00 30.04 ? 304  SER A C   1 
ATOM   2439 O O   . SER A 1 304 ? 8.620   46.246 49.048 1.00 28.27 ? 304  SER A O   1 
ATOM   2440 C CB  . SER A 1 304 ? 8.268   44.107 51.372 1.00 31.44 ? 304  SER A CB  1 
ATOM   2441 O OG  . SER A 1 304 ? 9.409   43.863 50.571 1.00 30.44 ? 304  SER A OG  1 
ATOM   2442 N N   . LEU A 1 305 ? 8.126   47.294 50.973 1.00 29.57 ? 305  LEU A N   1 
ATOM   2443 C CA  . LEU A 1 305 ? 8.831   48.512 50.590 1.00 29.12 ? 305  LEU A CA  1 
ATOM   2444 C C   . LEU A 1 305 ? 10.307  48.246 50.278 1.00 29.31 ? 305  LEU A C   1 
ATOM   2445 O O   . LEU A 1 305 ? 10.855  48.804 49.327 1.00 28.34 ? 305  LEU A O   1 
ATOM   2446 C CB  . LEU A 1 305 ? 8.714   49.562 51.700 1.00 29.61 ? 305  LEU A CB  1 
ATOM   2447 C CG  . LEU A 1 305 ? 7.285   49.897 52.138 1.00 30.10 ? 305  LEU A CG  1 
ATOM   2448 C CD1 . LEU A 1 305 ? 7.323   51.004 53.189 1.00 32.03 ? 305  LEU A CD1 1 
ATOM   2449 C CD2 . LEU A 1 305 ? 6.455   50.320 50.933 1.00 31.88 ? 305  LEU A CD2 1 
ATOM   2450 N N   . GLU A 1 306 ? 10.943  47.389 51.073 1.00 29.36 ? 306  GLU A N   1 
ATOM   2451 C CA  . GLU A 1 306 ? 12.354  47.072 50.869 1.00 30.81 ? 306  GLU A CA  1 
ATOM   2452 C C   . GLU A 1 306 ? 12.604  46.402 49.518 1.00 30.31 ? 306  GLU A C   1 
ATOM   2453 O O   . GLU A 1 306 ? 13.570  46.731 48.826 1.00 30.22 ? 306  GLU A O   1 
ATOM   2454 C CB  . GLU A 1 306 ? 12.863  46.174 52.002 1.00 32.51 ? 306  GLU A CB  1 
ATOM   2455 C CG  . GLU A 1 306 ? 14.369  45.885 51.971 1.00 38.13 ? 306  GLU A CG  1 
ATOM   2456 C CD  . GLU A 1 306 ? 15.230  47.146 51.986 1.00 42.22 ? 306  GLU A CD  1 
ATOM   2457 O OE1 . GLU A 1 306 ? 14.765  48.194 52.483 1.00 42.84 ? 306  GLU A OE1 1 
ATOM   2458 O OE2 . GLU A 1 306 ? 16.384  47.084 51.510 1.00 44.56 ? 306  GLU A OE2 1 
ATOM   2459 N N   . SER A 1 307 ? 11.745  45.462 49.137 1.00 30.03 ? 307  SER A N   1 
ATOM   2460 C CA  . SER A 1 307 ? 11.927  44.787 47.855 1.00 31.18 ? 307  SER A CA  1 
ATOM   2461 C C   . SER A 1 307 ? 11.688  45.759 46.702 1.00 30.00 ? 307  SER A C   1 
ATOM   2462 O O   . SER A 1 307 ? 12.319  45.650 45.653 1.00 30.56 ? 307  SER A O   1 
ATOM   2463 C CB  . SER A 1 307 ? 10.996  43.571 47.730 1.00 32.18 ? 307  SER A CB  1 
ATOM   2464 O OG  . SER A 1 307 ? 9.635   43.937 47.839 1.00 36.75 ? 307  SER A OG  1 
ATOM   2465 N N   . MET A 1 308 ? 10.783  46.715 46.895 1.00 28.32 ? 308  MET A N   1 
ATOM   2466 C CA  . MET A 1 308 ? 10.513  47.697 45.849 1.00 28.21 ? 308  MET A CA  1 
ATOM   2467 C C   . MET A 1 308 ? 11.724  48.614 45.684 1.00 28.15 ? 308  MET A C   1 
ATOM   2468 O O   . MET A 1 308 ? 12.138  48.916 44.570 1.00 28.99 ? 308  MET A O   1 
ATOM   2469 C CB  . MET A 1 308 ? 9.265   48.530 46.187 1.00 28.24 ? 308  MET A CB  1 
ATOM   2470 C CG  . MET A 1 308 ? 7.957   47.744 46.138 1.00 26.96 ? 308  MET A CG  1 
ATOM   2471 S SD  . MET A 1 308 ? 6.489   48.776 46.391 1.00 31.61 ? 308  MET A SD  1 
ATOM   2472 C CE  . MET A 1 308 ? 6.400   49.627 44.776 1.00 28.42 ? 308  MET A CE  1 
ATOM   2473 N N   . LEU A 1 309 ? 12.293  49.048 46.802 1.00 28.41 ? 309  LEU A N   1 
ATOM   2474 C CA  . LEU A 1 309 ? 13.455  49.926 46.766 1.00 30.89 ? 309  LEU A CA  1 
ATOM   2475 C C   . LEU A 1 309 ? 14.675  49.226 46.175 1.00 32.04 ? 309  LEU A C   1 
ATOM   2476 O O   . LEU A 1 309 ? 15.447  49.825 45.427 1.00 31.17 ? 309  LEU A O   1 
ATOM   2477 C CB  . LEU A 1 309 ? 13.785  50.424 48.178 1.00 30.33 ? 309  LEU A CB  1 
ATOM   2478 C CG  . LEU A 1 309 ? 12.811  51.425 48.806 1.00 32.33 ? 309  LEU A CG  1 
ATOM   2479 C CD1 . LEU A 1 309 ? 13.221  51.700 50.247 1.00 33.04 ? 309  LEU A CD1 1 
ATOM   2480 C CD2 . LEU A 1 309 ? 12.802  52.716 47.999 1.00 31.58 ? 309  LEU A CD2 1 
ATOM   2481 N N   . ASN A 1 310 ? 14.841  47.952 46.505 1.00 33.28 ? 310  ASN A N   1 
ATOM   2482 C CA  . ASN A 1 310 ? 15.983  47.196 46.016 1.00 35.96 ? 310  ASN A CA  1 
ATOM   2483 C C   . ASN A 1 310 ? 15.957  46.881 44.531 1.00 35.53 ? 310  ASN A C   1 
ATOM   2484 O O   . ASN A 1 310 ? 17.001  46.868 43.882 1.00 35.49 ? 310  ASN A O   1 
ATOM   2485 C CB  . ASN A 1 310 ? 16.126  45.890 46.790 1.00 39.96 ? 310  ASN A CB  1 
ATOM   2486 C CG  . ASN A 1 310 ? 17.363  45.870 47.643 1.00 45.99 ? 310  ASN A CG  1 
ATOM   2487 O OD1 . ASN A 1 310 ? 17.437  46.550 48.665 1.00 49.15 ? 310  ASN A OD1 1 
ATOM   2488 N ND2 . ASN A 1 310 ? 18.361  45.104 47.217 1.00 50.33 ? 310  ASN A ND2 1 
ATOM   2489 N N   . SER A 1 311 ? 14.767  46.627 43.997 1.00 34.40 ? 311  SER A N   1 
ATOM   2490 C CA  . SER A 1 311 ? 14.619  46.289 42.588 1.00 34.38 ? 311  SER A CA  1 
ATOM   2491 C C   . SER A 1 311 ? 14.400  47.500 41.683 1.00 34.04 ? 311  SER A C   1 
ATOM   2492 O O   . SER A 1 311 ? 14.344  47.364 40.462 1.00 34.26 ? 311  SER A O   1 
ATOM   2493 C CB  . SER A 1 311 ? 13.455  45.314 42.416 1.00 36.09 ? 311  SER A CB  1 
ATOM   2494 O OG  . SER A 1 311 ? 12.226  45.924 42.777 1.00 38.20 ? 311  SER A OG  1 
ATOM   2495 N N   . GLY A 1 312 ? 14.273  48.681 42.278 1.00 32.34 ? 312  GLY A N   1 
ATOM   2496 C CA  . GLY A 1 312 ? 14.054  49.876 41.485 1.00 31.56 ? 312  GLY A CA  1 
ATOM   2497 C C   . GLY A 1 312 ? 12.608  49.991 41.038 1.00 30.59 ? 312  GLY A C   1 
ATOM   2498 O O   . GLY A 1 312 ? 12.303  50.621 40.023 1.00 31.79 ? 312  GLY A O   1 
ATOM   2499 N N   . ASN A 1 313 ? 11.708  49.372 41.791 1.00 29.17 ? 313  ASN A N   1 
ATOM   2500 C CA  . ASN A 1 313 ? 10.295  49.424 41.460 1.00 28.66 ? 313  ASN A CA  1 
ATOM   2501 C C   . ASN A 1 313 ? 9.696   50.712 42.019 1.00 27.85 ? 313  ASN A C   1 
ATOM   2502 O O   . ASN A 1 313 ? 9.021   50.707 43.051 1.00 28.98 ? 313  ASN A O   1 
ATOM   2503 C CB  . ASN A 1 313 ? 9.571   48.206 42.035 1.00 28.76 ? 313  ASN A CB  1 
ATOM   2504 C CG  . ASN A 1 313 ? 8.147   48.092 41.534 1.00 32.31 ? 313  ASN A CG  1 
ATOM   2505 O OD1 . ASN A 1 313 ? 7.708   48.891 40.705 1.00 32.84 ? 313  ASN A OD1 1 
ATOM   2506 N ND2 . ASN A 1 313 ? 7.416   47.098 42.029 1.00 31.09 ? 313  ASN A ND2 1 
ATOM   2507 N N   . PHE A 1 314 ? 9.967   51.819 41.335 1.00 28.00 ? 314  PHE A N   1 
ATOM   2508 C CA  . PHE A 1 314 ? 9.462   53.123 41.745 1.00 27.07 ? 314  PHE A CA  1 
ATOM   2509 C C   . PHE A 1 314 ? 9.686   54.163 40.651 1.00 27.57 ? 314  PHE A C   1 
ATOM   2510 O O   . PHE A 1 314 ? 10.438  53.935 39.699 1.00 25.87 ? 314  PHE A O   1 
ATOM   2511 C CB  . PHE A 1 314 ? 10.126  53.565 43.064 1.00 27.85 ? 314  PHE A CB  1 
ATOM   2512 C CG  . PHE A 1 314 ? 11.637  53.488 43.060 1.00 26.25 ? 314  PHE A CG  1 
ATOM   2513 C CD1 . PHE A 1 314 ? 12.402  54.458 42.418 1.00 26.87 ? 314  PHE A CD1 1 
ATOM   2514 C CD2 . PHE A 1 314 ? 12.292  52.453 43.725 1.00 26.55 ? 314  PHE A CD2 1 
ATOM   2515 C CE1 . PHE A 1 314 ? 13.800  54.404 42.443 1.00 27.50 ? 314  PHE A CE1 1 
ATOM   2516 C CE2 . PHE A 1 314 ? 13.692  52.388 43.757 1.00 26.52 ? 314  PHE A CE2 1 
ATOM   2517 C CZ  . PHE A 1 314 ? 14.445  53.362 43.116 1.00 27.29 ? 314  PHE A CZ  1 
ATOM   2518 N N   . LYS A 1 315 ? 9.016   55.301 40.782 1.00 27.04 ? 315  LYS A N   1 
ATOM   2519 C CA  . LYS A 1 315 ? 9.146   56.372 39.807 1.00 27.14 ? 315  LYS A CA  1 
ATOM   2520 C C   . LYS A 1 315 ? 10.572  56.905 39.836 1.00 28.33 ? 315  LYS A C   1 
ATOM   2521 O O   . LYS A 1 315 ? 11.101  57.226 40.901 1.00 27.50 ? 315  LYS A O   1 
ATOM   2522 C CB  . LYS A 1 315 ? 8.168   57.504 40.132 1.00 25.60 ? 315  LYS A CB  1 
ATOM   2523 C CG  . LYS A 1 315 ? 8.142   58.641 39.107 1.00 26.38 ? 315  LYS A CG  1 
ATOM   2524 C CD  . LYS A 1 315 ? 7.316   59.819 39.631 1.00 26.77 ? 315  LYS A CD  1 
ATOM   2525 C CE  . LYS A 1 315 ? 7.250   60.957 38.618 1.00 28.50 ? 315  LYS A CE  1 
ATOM   2526 N NZ  . LYS A 1 315 ? 6.537   60.549 37.369 1.00 26.28 ? 315  LYS A NZ  1 
ATOM   2527 N N   . LYS A 1 316 ? 11.194  56.998 38.665 1.00 26.86 ? 316  LYS A N   1 
ATOM   2528 C CA  . LYS A 1 316 ? 12.558  57.501 38.573 1.00 28.17 ? 316  LYS A CA  1 
ATOM   2529 C C   . LYS A 1 316 ? 12.525  58.934 38.068 1.00 28.82 ? 316  LYS A C   1 
ATOM   2530 O O   . LYS A 1 316 ? 12.144  59.200 36.929 1.00 27.98 ? 316  LYS A O   1 
ATOM   2531 C CB  . LYS A 1 316 ? 13.374  56.599 37.648 1.00 32.74 ? 316  LYS A CB  1 
ATOM   2532 C CG  . LYS A 1 316 ? 13.446  55.174 38.178 1.00 33.35 ? 316  LYS A CG  1 
ATOM   2533 C CD  . LYS A 1 316 ? 14.105  54.220 37.212 1.00 38.28 ? 316  LYS A CD  1 
ATOM   2534 C CE  . LYS A 1 316 ? 13.967  52.799 37.720 1.00 39.44 ? 316  LYS A CE  1 
ATOM   2535 N NZ  . LYS A 1 316 ? 12.531  52.420 37.852 1.00 41.06 ? 316  LYS A NZ  1 
ATOM   2536 N N   . THR A 1 317 ? 12.919  59.858 38.935 1.00 27.49 ? 317  THR A N   1 
ATOM   2537 C CA  . THR A 1 317 ? 12.901  61.274 38.607 1.00 28.17 ? 317  THR A CA  1 
ATOM   2538 C C   . THR A 1 317 ? 13.910  61.954 39.534 1.00 28.38 ? 317  THR A C   1 
ATOM   2539 O O   . THR A 1 317 ? 14.810  61.292 40.054 1.00 28.86 ? 317  THR A O   1 
ATOM   2540 C CB  . THR A 1 317 ? 11.465  61.831 38.825 1.00 27.78 ? 317  THR A CB  1 
ATOM   2541 O OG1 . THR A 1 317 ? 11.408  63.212 38.455 1.00 26.56 ? 317  THR A OG1 1 
ATOM   2542 C CG2 . THR A 1 317 ? 11.048  61.673 40.290 1.00 26.22 ? 317  THR A CG2 1 
ATOM   2543 N N   . GLN A 1 318 ? 13.787  63.261 39.734 1.00 26.60 ? 318  GLN A N   1 
ATOM   2544 C CA  . GLN A 1 318 ? 14.705  63.954 40.635 1.00 27.22 ? 318  GLN A CA  1 
ATOM   2545 C C   . GLN A 1 318 ? 14.005  64.163 41.968 1.00 26.32 ? 318  GLN A C   1 
ATOM   2546 O O   . GLN A 1 318 ? 12.792  64.356 42.008 1.00 25.36 ? 318  GLN A O   1 
ATOM   2547 C CB  . GLN A 1 318 ? 15.115  65.326 40.084 1.00 27.23 ? 318  GLN A CB  1 
ATOM   2548 C CG  . GLN A 1 318 ? 15.684  65.324 38.674 1.00 29.58 ? 318  GLN A CG  1 
ATOM   2549 C CD  . GLN A 1 318 ? 14.597  65.230 37.628 1.00 34.59 ? 318  GLN A CD  1 
ATOM   2550 O OE1 . GLN A 1 318 ? 13.528  65.808 37.793 1.00 33.23 ? 318  GLN A OE1 1 
ATOM   2551 N NE2 . GLN A 1 318 ? 14.864  64.511 36.544 1.00 34.22 ? 318  GLN A NE2 1 
ATOM   2552 N N   . ILE A 1 319 ? 14.763  64.110 43.058 1.00 25.01 ? 319  ILE A N   1 
ATOM   2553 C CA  . ILE A 1 319 ? 14.188  64.335 44.376 1.00 26.35 ? 319  ILE A CA  1 
ATOM   2554 C C   . ILE A 1 319 ? 15.102  65.236 45.194 1.00 26.20 ? 319  ILE A C   1 
ATOM   2555 O O   . ILE A 1 319 ? 16.317  65.258 44.995 1.00 26.00 ? 319  ILE A O   1 
ATOM   2556 C CB  . ILE A 1 319 ? 13.978  63.017 45.165 1.00 27.69 ? 319  ILE A CB  1 
ATOM   2557 C CG1 . ILE A 1 319 ? 15.320  62.316 45.401 1.00 27.84 ? 319  ILE A CG1 1 
ATOM   2558 C CG2 . ILE A 1 319 ? 13.001  62.117 44.423 1.00 28.90 ? 319  ILE A CG2 1 
ATOM   2559 C CD1 . ILE A 1 319 ? 15.234  61.132 46.357 1.00 28.71 ? 319  ILE A CD1 1 
ATOM   2560 N N   . LEU A 1 320 ? 14.500  65.986 46.107 1.00 25.92 ? 320  LEU A N   1 
ATOM   2561 C CA  . LEU A 1 320 ? 15.237  66.875 46.990 1.00 24.62 ? 320  LEU A CA  1 
ATOM   2562 C C   . LEU A 1 320 ? 14.672  66.548 48.363 1.00 24.45 ? 320  LEU A C   1 
ATOM   2563 O O   . LEU A 1 320 ? 13.460  66.576 48.563 1.00 24.18 ? 320  LEU A O   1 
ATOM   2564 C CB  . LEU A 1 320 ? 14.987  68.341 46.615 1.00 25.36 ? 320  LEU A CB  1 
ATOM   2565 C CG  . LEU A 1 320 ? 15.764  69.401 47.409 1.00 26.35 ? 320  LEU A CG  1 
ATOM   2566 C CD1 . LEU A 1 320 ? 15.884  70.680 46.583 1.00 26.94 ? 320  LEU A CD1 1 
ATOM   2567 C CD2 . LEU A 1 320 ? 15.065  69.682 48.734 1.00 25.48 ? 320  LEU A CD2 1 
ATOM   2568 N N   . LEU A 1 321 ? 15.542  66.210 49.305 1.00 23.88 ? 321  LEU A N   1 
ATOM   2569 C CA  . LEU A 1 321 ? 15.066  65.831 50.625 1.00 22.90 ? 321  LEU A CA  1 
ATOM   2570 C C   . LEU A 1 321 ? 16.073  66.141 51.714 1.00 23.41 ? 321  LEU A C   1 
ATOM   2571 O O   . LEU A 1 321 ? 17.224  66.471 51.439 1.00 24.11 ? 321  LEU A O   1 
ATOM   2572 C CB  . LEU A 1 321 ? 14.719  64.334 50.636 1.00 22.57 ? 321  LEU A CB  1 
ATOM   2573 C CG  . LEU A 1 321 ? 15.840  63.293 50.503 1.00 25.45 ? 321  LEU A CG  1 
ATOM   2574 C CD1 . LEU A 1 321 ? 15.213  61.905 50.530 1.00 24.24 ? 321  LEU A CD1 1 
ATOM   2575 C CD2 . LEU A 1 321 ? 16.628  63.494 49.209 1.00 25.51 ? 321  LEU A CD2 1 
ATOM   2576 N N   . GLY A 1 322 ? 15.634  66.037 52.961 1.00 23.29 ? 322  GLY A N   1 
ATOM   2577 C CA  . GLY A 1 322 ? 16.534  66.330 54.054 1.00 23.64 ? 322  GLY A CA  1 
ATOM   2578 C C   . GLY A 1 322 ? 15.892  66.155 55.410 1.00 25.28 ? 322  GLY A C   1 
ATOM   2579 O O   . GLY A 1 322 ? 14.727  65.758 55.521 1.00 22.34 ? 322  GLY A O   1 
ATOM   2580 N N   . VAL A 1 323 ? 16.661  66.477 56.443 1.00 23.59 ? 323  VAL A N   1 
ATOM   2581 C CA  . VAL A 1 323 ? 16.209  66.335 57.817 1.00 23.55 ? 323  VAL A CA  1 
ATOM   2582 C C   . VAL A 1 323 ? 16.651  67.515 58.672 1.00 24.83 ? 323  VAL A C   1 
ATOM   2583 O O   . VAL A 1 323 ? 17.460  68.335 58.239 1.00 25.10 ? 323  VAL A O   1 
ATOM   2584 C CB  . VAL A 1 323 ? 16.797  65.061 58.445 1.00 24.14 ? 323  VAL A CB  1 
ATOM   2585 C CG1 . VAL A 1 323 ? 16.389  63.838 57.635 1.00 24.65 ? 323  VAL A CG1 1 
ATOM   2586 C CG2 . VAL A 1 323 ? 18.318  65.171 58.494 1.00 23.60 ? 323  VAL A CG2 1 
ATOM   2587 N N   . ASN A 1 324 ? 16.114  67.579 59.888 1.00 25.35 ? 324  ASN A N   1 
ATOM   2588 C CA  . ASN A 1 324 ? 16.458  68.620 60.852 1.00 25.88 ? 324  ASN A CA  1 
ATOM   2589 C C   . ASN A 1 324 ? 17.408  68.012 61.888 1.00 26.75 ? 324  ASN A C   1 
ATOM   2590 O O   . ASN A 1 324 ? 17.431  66.798 62.093 1.00 25.15 ? 324  ASN A O   1 
ATOM   2591 C CB  . ASN A 1 324 ? 15.205  69.147 61.557 1.00 25.26 ? 324  ASN A CB  1 
ATOM   2592 C CG  . ASN A 1 324 ? 14.297  69.935 60.627 1.00 27.12 ? 324  ASN A CG  1 
ATOM   2593 O OD1 . ASN A 1 324 ? 14.599  70.113 59.445 1.00 25.40 ? 324  ASN A OD1 1 
ATOM   2594 N ND2 . ASN A 1 324 ? 13.174  70.409 61.159 1.00 27.01 ? 324  ASN A ND2 1 
ATOM   2595 N N   . LYS A 1 325 ? 18.178  68.864 62.549 1.00 26.38 ? 325  LYS A N   1 
ATOM   2596 C CA  . LYS A 1 325 ? 19.149  68.404 63.531 1.00 28.18 ? 325  LYS A CA  1 
ATOM   2597 C C   . LYS A 1 325 ? 18.586  67.638 64.728 1.00 27.27 ? 325  LYS A C   1 
ATOM   2598 O O   . LYS A 1 325 ? 19.172  66.639 65.148 1.00 27.37 ? 325  LYS A O   1 
ATOM   2599 C CB  . LYS A 1 325 ? 19.971  69.591 64.037 1.00 29.18 ? 325  LYS A CB  1 
ATOM   2600 C CG  . LYS A 1 325 ? 21.142  69.199 64.926 1.00 33.09 ? 325  LYS A CG  1 
ATOM   2601 C CD  . LYS A 1 325 ? 21.864  70.430 65.449 1.00 35.97 ? 325  LYS A CD  1 
ATOM   2602 C CE  . LYS A 1 325 ? 23.171  70.048 66.125 1.00 40.79 ? 325  LYS A CE  1 
ATOM   2603 N NZ  . LYS A 1 325 ? 22.968  69.046 67.204 1.00 44.81 ? 325  LYS A NZ  1 
ATOM   2604 N N   . ASP A 1 326 ? 17.458  68.086 65.273 1.00 25.95 ? 326  ASP A N   1 
ATOM   2605 C CA  . ASP A 1 326 ? 16.883  67.435 66.453 1.00 26.05 ? 326  ASP A CA  1 
ATOM   2606 C C   . ASP A 1 326 ? 15.450  66.940 66.269 1.00 26.02 ? 326  ASP A C   1 
ATOM   2607 O O   . ASP A 1 326 ? 14.535  67.388 66.956 1.00 26.95 ? 326  ASP A O   1 
ATOM   2608 C CB  . ASP A 1 326 ? 16.956  68.404 67.631 1.00 26.65 ? 326  ASP A CB  1 
ATOM   2609 C CG  . ASP A 1 326 ? 18.357  68.954 67.831 1.00 29.24 ? 326  ASP A CG  1 
ATOM   2610 O OD1 . ASP A 1 326 ? 19.244  68.181 68.255 1.00 29.46 ? 326  ASP A OD1 1 
ATOM   2611 O OD2 . ASP A 1 326 ? 18.577  70.150 67.545 1.00 28.46 ? 326  ASP A OD2 1 
ATOM   2612 N N   . GLU A 1 327 ? 15.270  65.993 65.354 1.00 26.71 ? 327  GLU A N   1 
ATOM   2613 C CA  . GLU A 1 327 ? 13.951  65.437 65.064 1.00 26.66 ? 327  GLU A CA  1 
ATOM   2614 C C   . GLU A 1 327 ? 13.255  64.788 66.265 1.00 26.14 ? 327  GLU A C   1 
ATOM   2615 O O   . GLU A 1 327 ? 12.033  64.844 66.387 1.00 27.50 ? 327  GLU A O   1 
ATOM   2616 C CB  . GLU A 1 327 ? 14.061  64.391 63.949 1.00 26.86 ? 327  GLU A CB  1 
ATOM   2617 C CG  . GLU A 1 327 ? 14.660  64.901 62.649 1.00 26.73 ? 327  GLU A CG  1 
ATOM   2618 C CD  . GLU A 1 327 ? 13.652  65.606 61.773 1.00 28.50 ? 327  GLU A CD  1 
ATOM   2619 O OE1 . GLU A 1 327 ? 12.493  65.780 62.206 1.00 30.59 ? 327  GLU A OE1 1 
ATOM   2620 O OE2 . GLU A 1 327 ? 14.018  65.984 60.641 1.00 27.63 ? 327  GLU A OE2 1 
ATOM   2621 N N   . GLY A 1 328 ? 14.028  64.182 67.158 1.00 26.17 ? 328  GLY A N   1 
ATOM   2622 C CA  . GLY A 1 328 ? 13.420  63.491 68.283 1.00 25.85 ? 328  GLY A CA  1 
ATOM   2623 C C   . GLY A 1 328 ? 12.932  64.226 69.520 1.00 26.99 ? 328  GLY A C   1 
ATOM   2624 O O   . GLY A 1 328 ? 12.135  63.666 70.274 1.00 25.22 ? 328  GLY A O   1 
ATOM   2625 N N   . SER A 1 329 ? 13.368  65.465 69.731 1.00 27.23 ? 329  SER A N   1 
ATOM   2626 C CA  . SER A 1 329 ? 12.992  66.198 70.943 1.00 27.01 ? 329  SER A CA  1 
ATOM   2627 C C   . SER A 1 329 ? 11.497  66.290 71.265 1.00 27.40 ? 329  SER A C   1 
ATOM   2628 O O   . SER A 1 329 ? 11.097  66.113 72.418 1.00 26.01 ? 329  SER A O   1 
ATOM   2629 C CB  . SER A 1 329 ? 13.619  67.600 70.928 1.00 26.14 ? 329  SER A CB  1 
ATOM   2630 O OG  . SER A 1 329 ? 13.279  68.330 69.768 1.00 26.34 ? 329  SER A OG  1 
ATOM   2631 N N   . PHE A 1 330 ? 10.677  66.559 70.256 1.00 28.33 ? 330  PHE A N   1 
ATOM   2632 C CA  . PHE A 1 330 ? 9.229   66.672 70.444 1.00 29.99 ? 330  PHE A CA  1 
ATOM   2633 C C   . PHE A 1 330 ? 8.636   65.430 71.114 1.00 29.15 ? 330  PHE A C   1 
ATOM   2634 O O   . PHE A 1 330 ? 7.846   65.525 72.055 1.00 28.61 ? 330  PHE A O   1 
ATOM   2635 C CB  . PHE A 1 330 ? 8.537   66.852 69.088 1.00 32.74 ? 330  PHE A CB  1 
ATOM   2636 C CG  . PHE A 1 330 ? 7.633   68.048 69.014 1.00 38.14 ? 330  PHE A CG  1 
ATOM   2637 C CD1 . PHE A 1 330 ? 6.689   68.293 70.007 1.00 40.87 ? 330  PHE A CD1 1 
ATOM   2638 C CD2 . PHE A 1 330 ? 7.723   68.932 67.942 1.00 40.76 ? 330  PHE A CD2 1 
ATOM   2639 C CE1 . PHE A 1 330 ? 5.848   69.403 69.935 1.00 41.92 ? 330  PHE A CE1 1 
ATOM   2640 C CE2 . PHE A 1 330 ? 6.888   70.046 67.858 1.00 42.80 ? 330  PHE A CE2 1 
ATOM   2641 C CZ  . PHE A 1 330 ? 5.948   70.283 68.858 1.00 44.31 ? 330  PHE A CZ  1 
ATOM   2642 N N   . PHE A 1 331 ? 9.029   64.265 70.615 1.00 27.44 ? 331  PHE A N   1 
ATOM   2643 C CA  . PHE A 1 331 ? 8.514   62.999 71.107 1.00 27.48 ? 331  PHE A CA  1 
ATOM   2644 C C   . PHE A 1 331 ? 8.970   62.620 72.501 1.00 28.18 ? 331  PHE A C   1 
ATOM   2645 O O   . PHE A 1 331 ? 8.232   61.967 73.238 1.00 29.04 ? 331  PHE A O   1 
ATOM   2646 C CB  . PHE A 1 331 ? 8.851   61.915 70.092 1.00 28.05 ? 331  PHE A CB  1 
ATOM   2647 C CG  . PHE A 1 331 ? 8.412   62.277 68.707 1.00 27.97 ? 331  PHE A CG  1 
ATOM   2648 C CD1 . PHE A 1 331 ? 9.211   63.084 67.902 1.00 27.77 ? 331  PHE A CD1 1 
ATOM   2649 C CD2 . PHE A 1 331 ? 7.139   61.937 68.263 1.00 27.86 ? 331  PHE A CD2 1 
ATOM   2650 C CE1 . PHE A 1 331 ? 8.741   63.558 66.674 1.00 29.96 ? 331  PHE A CE1 1 
ATOM   2651 C CE2 . PHE A 1 331 ? 6.660   62.405 67.039 1.00 28.90 ? 331  PHE A CE2 1 
ATOM   2652 C CZ  . PHE A 1 331 ? 7.459   63.217 66.247 1.00 28.75 ? 331  PHE A CZ  1 
ATOM   2653 N N   . LEU A 1 332 ? 10.180  63.026 72.861 1.00 25.89 ? 332  LEU A N   1 
ATOM   2654 C CA  . LEU A 1 332 ? 10.697  62.746 74.190 1.00 25.68 ? 332  LEU A CA  1 
ATOM   2655 C C   . LEU A 1 332 ? 9.956   63.632 75.185 1.00 26.40 ? 332  LEU A C   1 
ATOM   2656 O O   . LEU A 1 332 ? 9.572   63.185 76.265 1.00 27.12 ? 332  LEU A O   1 
ATOM   2657 C CB  . LEU A 1 332 ? 12.201  63.031 74.237 1.00 25.68 ? 332  LEU A CB  1 
ATOM   2658 C CG  . LEU A 1 332 ? 13.043  62.033 73.437 1.00 25.87 ? 332  LEU A CG  1 
ATOM   2659 C CD1 . LEU A 1 332 ? 14.471  62.550 73.274 1.00 25.39 ? 332  LEU A CD1 1 
ATOM   2660 C CD2 . LEU A 1 332 ? 13.021  60.684 74.149 1.00 27.02 ? 332  LEU A CD2 1 
ATOM   2661 N N   . LEU A 1 333 ? 9.750   64.893 74.815 1.00 26.54 ? 333  LEU A N   1 
ATOM   2662 C CA  . LEU A 1 333 ? 9.046   65.827 75.689 1.00 28.50 ? 333  LEU A CA  1 
ATOM   2663 C C   . LEU A 1 333 ? 7.644   65.336 76.026 1.00 29.15 ? 333  LEU A C   1 
ATOM   2664 O O   . LEU A 1 333 ? 7.203   65.419 77.174 1.00 27.91 ? 333  LEU A O   1 
ATOM   2665 C CB  . LEU A 1 333 ? 8.936   67.204 75.029 1.00 27.62 ? 333  LEU A CB  1 
ATOM   2666 C CG  . LEU A 1 333 ? 7.934   68.152 75.707 1.00 29.80 ? 333  LEU A CG  1 
ATOM   2667 C CD1 . LEU A 1 333 ? 8.387   68.464 77.132 1.00 28.78 ? 333  LEU A CD1 1 
ATOM   2668 C CD2 . LEU A 1 333 ? 7.808   69.427 74.889 1.00 30.05 ? 333  LEU A CD2 1 
ATOM   2669 N N   . TYR A 1 334 ? 6.943   64.824 75.020 1.00 29.81 ? 334  TYR A N   1 
ATOM   2670 C CA  . TYR A 1 334 ? 5.582   64.363 75.229 1.00 32.32 ? 334  TYR A CA  1 
ATOM   2671 C C   . TYR A 1 334 ? 5.409   63.001 75.883 1.00 33.83 ? 334  TYR A C   1 
ATOM   2672 O O   . TYR A 1 334 ? 4.386   62.763 76.521 1.00 36.54 ? 334  TYR A O   1 
ATOM   2673 C CB  . TYR A 1 334 ? 4.807   64.387 73.908 1.00 29.40 ? 334  TYR A CB  1 
ATOM   2674 C CG  . TYR A 1 334 ? 4.234   65.744 73.561 1.00 28.39 ? 334  TYR A CG  1 
ATOM   2675 C CD1 . TYR A 1 334 ? 5.063   66.841 73.341 1.00 26.18 ? 334  TYR A CD1 1 
ATOM   2676 C CD2 . TYR A 1 334 ? 2.857   65.928 73.448 1.00 27.21 ? 334  TYR A CD2 1 
ATOM   2677 C CE1 . TYR A 1 334 ? 4.534   68.090 73.013 1.00 27.56 ? 334  TYR A CE1 1 
ATOM   2678 C CE2 . TYR A 1 334 ? 2.319   67.174 73.123 1.00 28.47 ? 334  TYR A CE2 1 
ATOM   2679 C CZ  . TYR A 1 334 ? 3.161   68.246 72.905 1.00 27.28 ? 334  TYR A CZ  1 
ATOM   2680 O OH  . TYR A 1 334 ? 2.631   69.466 72.556 1.00 28.20 ? 334  TYR A OH  1 
ATOM   2681 N N   . GLY A 1 335 ? 6.382   62.106 75.751 1.00 35.67 ? 335  GLY A N   1 
ATOM   2682 C CA  . GLY A 1 335 ? 6.184   60.794 76.346 1.00 38.07 ? 335  GLY A CA  1 
ATOM   2683 C C   . GLY A 1 335 ? 7.298   60.089 77.097 1.00 38.42 ? 335  GLY A C   1 
ATOM   2684 O O   . GLY A 1 335 ? 7.088   58.978 77.587 1.00 42.05 ? 335  GLY A O   1 
ATOM   2685 N N   . ALA A 1 336 ? 8.472   60.698 77.208 1.00 34.64 ? 336  ALA A N   1 
ATOM   2686 C CA  . ALA A 1 336 ? 9.567   60.046 77.916 1.00 32.45 ? 336  ALA A CA  1 
ATOM   2687 C C   . ALA A 1 336 ? 9.768   60.629 79.313 1.00 32.96 ? 336  ALA A C   1 
ATOM   2688 O O   . ALA A 1 336 ? 9.737   61.844 79.502 1.00 28.98 ? 336  ALA A O   1 
ATOM   2689 C CB  . ALA A 1 336 ? 10.849  60.160 77.113 1.00 31.48 ? 336  ALA A CB  1 
ATOM   2690 N N   . PRO A 1 337 ? 9.971   59.760 80.314 1.00 33.84 ? 337  PRO A N   1 
ATOM   2691 C CA  . PRO A 1 337 ? 10.175  60.221 81.691 1.00 35.00 ? 337  PRO A CA  1 
ATOM   2692 C C   . PRO A 1 337 ? 11.430  61.073 81.834 1.00 33.76 ? 337  PRO A C   1 
ATOM   2693 O O   . PRO A 1 337 ? 12.472  60.761 81.257 1.00 33.69 ? 337  PRO A O   1 
ATOM   2694 C CB  . PRO A 1 337 ? 10.272  58.917 82.474 1.00 36.76 ? 337  PRO A CB  1 
ATOM   2695 C CG  . PRO A 1 337 ? 10.920  57.994 81.485 1.00 36.85 ? 337  PRO A CG  1 
ATOM   2696 C CD  . PRO A 1 337 ? 10.140  58.299 80.225 1.00 34.73 ? 337  PRO A CD  1 
ATOM   2697 N N   . GLY A 1 338 ? 11.322  62.156 82.597 1.00 34.08 ? 338  GLY A N   1 
ATOM   2698 C CA  . GLY A 1 338 ? 12.467  63.023 82.808 1.00 33.23 ? 338  GLY A CA  1 
ATOM   2699 C C   . GLY A 1 338 ? 12.467  64.294 81.982 1.00 31.57 ? 338  GLY A C   1 
ATOM   2700 O O   . GLY A 1 338 ? 13.168  65.252 82.316 1.00 31.90 ? 338  GLY A O   1 
ATOM   2701 N N   . PHE A 1 339 ? 11.697  64.308 80.897 1.00 29.59 ? 339  PHE A N   1 
ATOM   2702 C CA  . PHE A 1 339 ? 11.631  65.480 80.035 1.00 29.14 ? 339  PHE A CA  1 
ATOM   2703 C C   . PHE A 1 339 ? 10.460  66.379 80.397 1.00 29.85 ? 339  PHE A C   1 
ATOM   2704 O O   . PHE A 1 339 ? 9.350   65.901 80.618 1.00 33.16 ? 339  PHE A O   1 
ATOM   2705 C CB  . PHE A 1 339 ? 11.510  65.062 78.565 1.00 26.94 ? 339  PHE A CB  1 
ATOM   2706 C CG  . PHE A 1 339 ? 12.705  64.307 78.047 1.00 25.51 ? 339  PHE A CG  1 
ATOM   2707 C CD1 . PHE A 1 339 ? 12.835  62.940 78.271 1.00 25.22 ? 339  PHE A CD1 1 
ATOM   2708 C CD2 . PHE A 1 339 ? 13.700  64.970 77.337 1.00 25.43 ? 339  PHE A CD2 1 
ATOM   2709 C CE1 . PHE A 1 339 ? 13.943  62.239 77.796 1.00 25.82 ? 339  PHE A CE1 1 
ATOM   2710 C CE2 . PHE A 1 339 ? 14.812  64.283 76.857 1.00 27.61 ? 339  PHE A CE2 1 
ATOM   2711 C CZ  . PHE A 1 339 ? 14.932  62.913 77.087 1.00 25.32 ? 339  PHE A CZ  1 
ATOM   2712 N N   . SER A 1 340 ? 10.712  67.682 80.456 1.00 29.41 ? 340  SER A N   1 
ATOM   2713 C CA  . SER A 1 340 ? 9.670   68.652 80.778 1.00 30.98 ? 340  SER A CA  1 
ATOM   2714 C C   . SER A 1 340 ? 9.876   69.885 79.912 1.00 30.61 ? 340  SER A C   1 
ATOM   2715 O O   . SER A 1 340 ? 11.003  70.205 79.531 1.00 31.00 ? 340  SER A O   1 
ATOM   2716 C CB  . SER A 1 340 ? 9.748   69.050 82.252 1.00 32.69 ? 340  SER A CB  1 
ATOM   2717 O OG  . SER A 1 340 ? 9.739   67.904 83.082 1.00 37.96 ? 340  SER A OG  1 
ATOM   2718 N N   . LYS A 1 341 ? 8.792   70.588 79.611 1.00 29.47 ? 341  LYS A N   1 
ATOM   2719 C CA  . LYS A 1 341 ? 8.888   71.774 78.777 1.00 30.66 ? 341  LYS A CA  1 
ATOM   2720 C C   . LYS A 1 341 ? 9.606   72.931 79.454 1.00 30.11 ? 341  LYS A C   1 
ATOM   2721 O O   . LYS A 1 341 ? 10.314  73.693 78.797 1.00 28.72 ? 341  LYS A O   1 
ATOM   2722 C CB  . LYS A 1 341 ? 7.501   72.250 78.343 1.00 31.07 ? 341  LYS A CB  1 
ATOM   2723 C CG  . LYS A 1 341 ? 7.559   73.410 77.346 1.00 33.51 ? 341  LYS A CG  1 
ATOM   2724 C CD  . LYS A 1 341 ? 6.178   73.847 76.887 1.00 34.02 ? 341  LYS A CD  1 
ATOM   2725 C CE  . LYS A 1 341 ? 5.475   74.674 77.954 1.00 36.72 ? 341  LYS A CE  1 
ATOM   2726 N NZ  . LYS A 1 341 ? 6.193   75.963 78.210 1.00 37.33 ? 341  LYS A NZ  1 
ATOM   2727 N N   . ASP A 1 342 ? 9.435   73.062 80.766 1.00 29.02 ? 342  ASP A N   1 
ATOM   2728 C CA  . ASP A 1 342 ? 10.046  74.179 81.479 1.00 30.75 ? 342  ASP A CA  1 
ATOM   2729 C C   . ASP A 1 342 ? 11.338  73.919 82.249 1.00 31.64 ? 342  ASP A C   1 
ATOM   2730 O O   . ASP A 1 342 ? 11.721  74.722 83.097 1.00 31.31 ? 342  ASP A O   1 
ATOM   2731 C CB  . ASP A 1 342 ? 9.009   74.816 82.411 1.00 29.86 ? 342  ASP A CB  1 
ATOM   2732 C CG  . ASP A 1 342 ? 7.761   75.266 81.671 1.00 31.30 ? 342  ASP A CG  1 
ATOM   2733 O OD1 . ASP A 1 342 ? 7.831   75.453 80.434 1.00 31.39 ? 342  ASP A OD1 1 
ATOM   2734 O OD2 . ASP A 1 342 ? 6.707   75.445 82.323 1.00 29.73 ? 342  ASP A OD2 1 
ATOM   2735 N N   . SER A 1 343 ? 12.010  72.808 81.969 1.00 33.05 ? 343  SER A N   1 
ATOM   2736 C CA  . SER A 1 343 ? 13.277  72.515 82.635 1.00 34.36 ? 343  SER A CA  1 
ATOM   2737 C C   . SER A 1 343 ? 14.295  72.144 81.563 1.00 35.67 ? 343  SER A C   1 
ATOM   2738 O O   . SER A 1 343 ? 13.930  71.931 80.404 1.00 34.58 ? 343  SER A O   1 
ATOM   2739 C CB  . SER A 1 343 ? 13.130  71.348 83.616 1.00 36.29 ? 343  SER A CB  1 
ATOM   2740 O OG  . SER A 1 343 ? 13.180  70.105 82.944 1.00 39.61 ? 343  SER A OG  1 
ATOM   2741 N N   A GLU A 1 344 ? 15.566  72.069 81.952 0.50 34.56 ? 344  GLU A N   1 
ATOM   2742 N N   B GLU A 1 344 ? 15.566  72.065 81.948 0.50 34.88 ? 344  GLU A N   1 
ATOM   2743 C CA  A GLU A 1 344 ? 16.623  71.714 81.008 0.50 35.77 ? 344  GLU A CA  1 
ATOM   2744 C CA  B GLU A 1 344 ? 16.632  71.713 81.020 0.50 35.24 ? 344  GLU A CA  1 
ATOM   2745 C C   A GLU A 1 344 ? 16.577  70.229 80.676 0.50 34.82 ? 344  GLU A C   1 
ATOM   2746 C C   B GLU A 1 344 ? 16.589  70.227 80.688 0.50 34.47 ? 344  GLU A C   1 
ATOM   2747 O O   A GLU A 1 344 ? 17.324  69.751 79.822 0.50 33.35 ? 344  GLU A O   1 
ATOM   2748 O O   B GLU A 1 344 ? 17.301  69.754 79.800 0.50 33.70 ? 344  GLU A O   1 
ATOM   2749 C CB  A GLU A 1 344 ? 17.999  72.067 81.609 0.50 36.88 ? 344  GLU A CB  1 
ATOM   2750 C CB  B GLU A 1 344 ? 17.995  72.067 81.584 0.50 37.99 ? 344  GLU A CB  1 
ATOM   2751 C CG  A GLU A 1 344 ? 18.231  73.554 81.767 0.50 41.79 ? 344  GLU A CG  1 
ATOM   2752 C CG  B GLU A 1 344 ? 18.425  73.507 81.384 0.50 39.62 ? 344  GLU A CG  1 
ATOM   2753 C CD  A GLU A 1 344 ? 19.770  73.818 82.016 0.50 41.55 ? 344  GLU A CD  1 
ATOM   2754 C CD  B GLU A 1 344 ? 19.654  73.864 82.186 0.50 44.28 ? 344  GLU A CD  1 
ATOM   2755 O OE1 A GLU A 1 344 ? 20.720  73.028 81.814 0.50 40.56 ? 344  GLU A OE1 1 
ATOM   2756 O OE1 B GLU A 1 344 ? 20.079  73.379 83.259 0.50 44.72 ? 344  GLU A OE1 1 
ATOM   2757 O OE2 A GLU A 1 344 ? 19.878  74.854 82.707 0.50 42.16 ? 344  GLU A OE2 1 
ATOM   2758 O OE2 B GLU A 1 344 ? 20.348  74.588 81.438 0.50 45.29 ? 344  GLU A OE2 1 
ATOM   2759 N N   . SER A 1 345 ? 15.728  69.500 81.392 1.00 34.21 ? 345  SER A N   1 
ATOM   2760 C CA  . SER A 1 345 ? 15.563  68.071 81.176 1.00 33.09 ? 345  SER A CA  1 
ATOM   2761 C C   . SER A 1 345 ? 16.855  67.259 81.164 1.00 34.08 ? 345  SER A C   1 
ATOM   2762 O O   . SER A 1 345 ? 17.108  66.501 80.230 1.00 32.07 ? 345  SER A O   1 
ATOM   2763 C CB  . SER A 1 345 ? 14.803  67.830 79.868 1.00 32.93 ? 345  SER A CB  1 
ATOM   2764 O OG  . SER A 1 345 ? 13.518  68.425 79.907 1.00 31.36 ? 345  SER A OG  1 
ATOM   2765 N N   . LYS A 1 346 ? 17.683  67.425 82.187 1.00 33.89 ? 346  LYS A N   1 
ATOM   2766 C CA  . LYS A 1 346 ? 18.901  66.635 82.261 1.00 35.20 ? 346  LYS A CA  1 
ATOM   2767 C C   . LYS A 1 346 ? 18.391  65.254 82.642 1.00 35.61 ? 346  LYS A C   1 
ATOM   2768 O O   . LYS A 1 346 ? 17.603  65.112 83.577 1.00 35.82 ? 346  LYS A O   1 
ATOM   2769 C CB  . LYS A 1 346 ? 19.846  67.193 83.325 1.00 38.22 ? 346  LYS A CB  1 
ATOM   2770 C CG  . LYS A 1 346 ? 20.414  68.555 82.959 1.00 40.17 ? 346  LYS A CG  1 
ATOM   2771 C CD  . LYS A 1 346 ? 21.338  69.079 84.045 1.00 45.38 ? 346  LYS A CD  1 
ATOM   2772 C CE  . LYS A 1 346 ? 21.885  70.452 83.683 1.00 48.56 ? 346  LYS A CE  1 
ATOM   2773 N NZ  . LYS A 1 346 ? 22.778  70.993 84.751 1.00 52.66 ? 346  LYS A NZ  1 
ATOM   2774 N N   . ILE A 1 347 ? 18.833  64.237 81.914 1.00 35.25 ? 347  ILE A N   1 
ATOM   2775 C CA  . ILE A 1 347 ? 18.361  62.881 82.146 1.00 36.64 ? 347  ILE A CA  1 
ATOM   2776 C C   . ILE A 1 347 ? 19.299  61.970 82.932 1.00 37.59 ? 347  ILE A C   1 
ATOM   2777 O O   . ILE A 1 347 ? 20.491  61.879 82.639 1.00 37.18 ? 347  ILE A O   1 
ATOM   2778 C CB  . ILE A 1 347 ? 18.032  62.200 80.793 1.00 36.39 ? 347  ILE A CB  1 
ATOM   2779 C CG1 . ILE A 1 347 ? 17.045  63.063 80.007 1.00 36.06 ? 347  ILE A CG1 1 
ATOM   2780 C CG2 . ILE A 1 347 ? 17.449  60.817 81.025 1.00 38.47 ? 347  ILE A CG2 1 
ATOM   2781 C CD1 . ILE A 1 347 ? 15.722  63.270 80.702 1.00 32.82 ? 347  ILE A CD1 1 
ATOM   2782 N N   . SER A 1 348 ? 18.736  61.287 83.922 1.00 39.39 ? 348  SER A N   1 
ATOM   2783 C CA  . SER A 1 348 ? 19.496  60.357 84.746 1.00 42.19 ? 348  SER A CA  1 
ATOM   2784 C C   . SER A 1 348 ? 19.793  59.110 83.922 1.00 43.74 ? 348  SER A C   1 
ATOM   2785 O O   . SER A 1 348 ? 19.174  58.872 82.884 1.00 42.32 ? 348  SER A O   1 
ATOM   2786 C CB  . SER A 1 348 ? 18.691  59.959 85.981 1.00 41.99 ? 348  SER A CB  1 
ATOM   2787 O OG  . SER A 1 348 ? 17.560  59.187 85.618 1.00 43.10 ? 348  SER A OG  1 
ATOM   2788 N N   . ARG A 1 349 ? 20.736  58.308 84.395 1.00 44.70 ? 349  ARG A N   1 
ATOM   2789 C CA  . ARG A 1 349 ? 21.101  57.095 83.690 1.00 46.65 ? 349  ARG A CA  1 
ATOM   2790 C C   . ARG A 1 349 ? 19.890  56.172 83.599 1.00 47.12 ? 349  ARG A C   1 
ATOM   2791 O O   . ARG A 1 349 ? 19.708  55.462 82.608 1.00 46.74 ? 349  ARG A O   1 
ATOM   2792 C CB  . ARG A 1 349 ? 22.243  56.390 84.423 1.00 48.64 ? 349  ARG A CB  1 
ATOM   2793 C CG  . ARG A 1 349 ? 22.890  55.305 83.605 1.00 50.53 ? 349  ARG A CG  1 
ATOM   2794 C CD  . ARG A 1 349 ? 23.397  55.887 82.306 1.00 52.09 ? 349  ARG A CD  1 
ATOM   2795 N NE  . ARG A 1 349 ? 23.583  54.857 81.299 1.00 54.54 ? 349  ARG A NE  1 
ATOM   2796 C CZ  . ARG A 1 349 ? 23.819  55.104 80.018 1.00 52.90 ? 349  ARG A CZ  1 
ATOM   2797 N NH1 . ARG A 1 349 ? 23.899  56.357 79.584 1.00 52.69 ? 349  ARG A NH1 1 
ATOM   2798 N NH2 . ARG A 1 349 ? 23.968  54.095 79.175 1.00 53.20 ? 349  ARG A NH2 1 
ATOM   2799 N N   . GLU A 1 350 ? 19.057  56.207 84.634 1.00 47.25 ? 350  GLU A N   1 
ATOM   2800 C CA  . GLU A 1 350 ? 17.866  55.370 84.697 1.00 48.52 ? 350  GLU A CA  1 
ATOM   2801 C C   . GLU A 1 350 ? 16.794  55.798 83.701 1.00 46.96 ? 350  GLU A C   1 
ATOM   2802 O O   . GLU A 1 350 ? 16.215  54.957 83.009 1.00 46.53 ? 350  GLU A O   1 
ATOM   2803 C CB  . GLU A 1 350 ? 17.295  55.379 86.116 1.00 51.99 ? 350  GLU A CB  1 
ATOM   2804 C CG  . GLU A 1 350 ? 18.213  54.740 87.159 1.00 58.54 ? 350  GLU A CG  1 
ATOM   2805 C CD  . GLU A 1 350 ? 19.591  55.385 87.208 1.00 61.07 ? 350  GLU A CD  1 
ATOM   2806 O OE1 . GLU A 1 350 ? 19.667  56.618 87.400 1.00 62.92 ? 350  GLU A OE1 1 
ATOM   2807 O OE2 . GLU A 1 350 ? 20.600  54.661 87.058 1.00 64.22 ? 350  GLU A OE2 1 
ATOM   2808 N N   . ASP A 1 351 ? 16.518  57.097 83.626 1.00 43.84 ? 351  ASP A N   1 
ATOM   2809 C CA  . ASP A 1 351 ? 15.514  57.568 82.682 1.00 42.20 ? 351  ASP A CA  1 
ATOM   2810 C C   . ASP A 1 351 ? 16.015  57.369 81.261 1.00 40.45 ? 351  ASP A C   1 
ATOM   2811 O O   . ASP A 1 351 ? 15.224  57.253 80.326 1.00 39.89 ? 351  ASP A O   1 
ATOM   2812 C CB  . ASP A 1 351 ? 15.165  59.039 82.928 1.00 42.68 ? 351  ASP A CB  1 
ATOM   2813 C CG  . ASP A 1 351 ? 14.258  59.228 84.131 1.00 44.58 ? 351  ASP A CG  1 
ATOM   2814 O OD1 . ASP A 1 351 ? 13.456  58.315 84.426 1.00 46.52 ? 351  ASP A OD1 1 
ATOM   2815 O OD2 . ASP A 1 351 ? 14.327  60.294 84.772 1.00 45.98 ? 351  ASP A OD2 1 
ATOM   2816 N N   . PHE A 1 352 ? 17.333  57.317 81.102 1.00 38.89 ? 352  PHE A N   1 
ATOM   2817 C CA  . PHE A 1 352 ? 17.917  57.102 79.788 1.00 38.35 ? 352  PHE A CA  1 
ATOM   2818 C C   . PHE A 1 352 ? 17.518  55.703 79.336 1.00 39.05 ? 352  PHE A C   1 
ATOM   2819 O O   . PHE A 1 352 ? 17.124  55.494 78.187 1.00 36.95 ? 352  PHE A O   1 
ATOM   2820 C CB  . PHE A 1 352 ? 19.440  57.188 79.848 1.00 36.66 ? 352  PHE A CB  1 
ATOM   2821 C CG  . PHE A 1 352 ? 20.103  56.987 78.521 1.00 36.76 ? 352  PHE A CG  1 
ATOM   2822 C CD1 . PHE A 1 352 ? 20.175  58.026 77.602 1.00 34.61 ? 352  PHE A CD1 1 
ATOM   2823 C CD2 . PHE A 1 352 ? 20.642  55.751 78.179 1.00 35.72 ? 352  PHE A CD2 1 
ATOM   2824 C CE1 . PHE A 1 352 ? 20.776  57.839 76.359 1.00 35.73 ? 352  PHE A CE1 1 
ATOM   2825 C CE2 . PHE A 1 352 ? 21.244  55.554 76.941 1.00 36.99 ? 352  PHE A CE2 1 
ATOM   2826 C CZ  . PHE A 1 352 ? 21.312  56.601 76.028 1.00 37.26 ? 352  PHE A CZ  1 
ATOM   2827 N N   A MET A 1 353 ? 17.625  54.744 80.251 0.50 39.13 ? 353  MET A N   1 
ATOM   2828 N N   B MET A 1 353 ? 17.622  54.749 80.254 0.50 39.22 ? 353  MET A N   1 
ATOM   2829 C CA  A MET A 1 353 ? 17.276  53.362 79.972 0.50 40.20 ? 353  MET A CA  1 
ATOM   2830 C CA  B MET A 1 353 ? 17.277  53.360 79.949 0.50 40.04 ? 353  MET A CA  1 
ATOM   2831 C C   A MET A 1 353 ? 15.800  53.238 79.612 0.50 38.77 ? 353  MET A C   1 
ATOM   2832 C C   B MET A 1 353 ? 15.795  53.242 79.602 0.50 38.68 ? 353  MET A C   1 
ATOM   2833 O O   A MET A 1 353 ? 15.440  52.530 78.671 0.50 39.30 ? 353  MET A O   1 
ATOM   2834 O O   B MET A 1 353 ? 15.428  52.539 78.661 0.50 39.25 ? 353  MET A O   1 
ATOM   2835 C CB  A MET A 1 353 ? 17.589  52.490 81.190 0.50 41.96 ? 353  MET A CB  1 
ATOM   2836 C CB  B MET A 1 353 ? 17.610  52.455 81.140 0.50 41.59 ? 353  MET A CB  1 
ATOM   2837 C CG  A MET A 1 353 ? 19.044  52.550 81.619 0.50 43.90 ? 353  MET A CG  1 
ATOM   2838 C CG  B MET A 1 353 ? 19.031  52.613 81.658 0.50 43.30 ? 353  MET A CG  1 
ATOM   2839 S SD  A MET A 1 353 ? 20.162  51.985 80.322 0.50 47.73 ? 353  MET A SD  1 
ATOM   2840 S SD  B MET A 1 353 ? 19.514  51.311 82.814 0.50 46.46 ? 353  MET A SD  1 
ATOM   2841 C CE  A MET A 1 353 ? 20.391  50.270 80.804 0.50 44.39 ? 353  MET A CE  1 
ATOM   2842 C CE  B MET A 1 353 ? 18.274  51.514 84.087 0.50 44.17 ? 353  MET A CE  1 
ATOM   2843 N N   . SER A 1 354 ? 14.949  53.928 80.365 1.00 38.00 ? 354  SER A N   1 
ATOM   2844 C CA  . SER A 1 354 ? 13.510  53.900 80.115 1.00 37.55 ? 354  SER A CA  1 
ATOM   2845 C C   . SER A 1 354 ? 13.224  54.498 78.739 1.00 36.24 ? 354  SER A C   1 
ATOM   2846 O O   . SER A 1 354 ? 12.393  53.983 77.987 1.00 33.81 ? 354  SER A O   1 
ATOM   2847 C CB  . SER A 1 354 ? 12.756  54.702 81.179 1.00 39.52 ? 354  SER A CB  1 
ATOM   2848 O OG  . SER A 1 354 ? 12.787  54.054 82.438 1.00 45.19 ? 354  SER A OG  1 
ATOM   2849 N N   . GLY A 1 355 ? 13.920  55.588 78.425 1.00 34.02 ? 355  GLY A N   1 
ATOM   2850 C CA  . GLY A 1 355 ? 13.741  56.245 77.142 1.00 31.83 ? 355  GLY A CA  1 
ATOM   2851 C C   . GLY A 1 355 ? 14.123  55.347 75.986 1.00 30.71 ? 355  GLY A C   1 
ATOM   2852 O O   . GLY A 1 355 ? 13.448  55.323 74.954 1.00 29.90 ? 355  GLY A O   1 
ATOM   2853 N N   . VAL A 1 356 ? 15.209  54.600 76.149 1.00 29.09 ? 356  VAL A N   1 
ATOM   2854 C CA  . VAL A 1 356 ? 15.656  53.700 75.098 1.00 29.13 ? 356  VAL A CA  1 
ATOM   2855 C C   . VAL A 1 356 ? 14.601  52.633 74.808 1.00 29.01 ? 356  VAL A C   1 
ATOM   2856 O O   . VAL A 1 356 ? 14.334  52.321 73.648 1.00 28.66 ? 356  VAL A O   1 
ATOM   2857 C CB  . VAL A 1 356 ? 16.988  53.002 75.476 1.00 29.48 ? 356  VAL A CB  1 
ATOM   2858 C CG1 . VAL A 1 356 ? 17.298  51.889 74.486 1.00 28.96 ? 356  VAL A CG1 1 
ATOM   2859 C CG2 . VAL A 1 356 ? 18.124  54.021 75.477 1.00 30.08 ? 356  VAL A CG2 1 
ATOM   2860 N N   . LYS A 1 357 ? 13.996  52.083 75.857 1.00 30.48 ? 357  LYS A N   1 
ATOM   2861 C CA  . LYS A 1 357 ? 12.982  51.049 75.664 1.00 31.19 ? 357  LYS A CA  1 
ATOM   2862 C C   . LYS A 1 357 ? 11.735  51.600 74.979 1.00 29.30 ? 357  LYS A C   1 
ATOM   2863 O O   . LYS A 1 357 ? 11.088  50.896 74.206 1.00 29.12 ? 357  LYS A O   1 
ATOM   2864 C CB  . LYS A 1 357 ? 12.585  50.408 76.996 1.00 34.43 ? 357  LYS A CB  1 
ATOM   2865 C CG  . LYS A 1 357 ? 11.987  49.022 76.808 1.00 39.27 ? 357  LYS A CG  1 
ATOM   2866 C CD  . LYS A 1 357 ? 11.299  48.507 78.056 1.00 44.81 ? 357  LYS A CD  1 
ATOM   2867 C CE  . LYS A 1 357 ? 11.067  47.007 77.961 1.00 46.78 ? 357  LYS A CE  1 
ATOM   2868 N NZ  . LYS A 1 357 ? 10.531  46.596 76.636 1.00 49.51 ? 357  LYS A NZ  1 
ATOM   2869 N N   . LEU A 1 358 ? 11.393  52.853 75.266 1.00 27.78 ? 358  LEU A N   1 
ATOM   2870 C CA  . LEU A 1 358 ? 10.227  53.481 74.640 1.00 28.19 ? 358  LEU A CA  1 
ATOM   2871 C C   . LEU A 1 358 ? 10.519  53.811 73.180 1.00 28.37 ? 358  LEU A C   1 
ATOM   2872 O O   . LEU A 1 358 ? 9.622   53.793 72.336 1.00 27.82 ? 358  LEU A O   1 
ATOM   2873 C CB  . LEU A 1 358 ? 9.858   54.782 75.358 1.00 27.25 ? 358  LEU A CB  1 
ATOM   2874 C CG  . LEU A 1 358 ? 9.297   54.709 76.780 1.00 28.02 ? 358  LEU A CG  1 
ATOM   2875 C CD1 . LEU A 1 358 ? 9.135   56.121 77.332 1.00 26.55 ? 358  LEU A CD1 1 
ATOM   2876 C CD2 . LEU A 1 358 ? 7.955   53.982 76.760 1.00 29.57 ? 358  LEU A CD2 1 
ATOM   2877 N N   . SER A 1 359 ? 11.783  54.108 72.892 1.00 26.78 ? 359  SER A N   1 
ATOM   2878 C CA  . SER A 1 359 ? 12.203  54.485 71.543 1.00 26.59 ? 359  SER A CA  1 
ATOM   2879 C C   . SER A 1 359 ? 12.336  53.344 70.546 1.00 27.36 ? 359  SER A C   1 
ATOM   2880 O O   . SER A 1 359 ? 12.154  53.544 69.348 1.00 27.98 ? 359  SER A O   1 
ATOM   2881 C CB  . SER A 1 359 ? 13.525  55.248 71.617 1.00 26.58 ? 359  SER A CB  1 
ATOM   2882 O OG  . SER A 1 359 ? 13.399  56.375 72.467 1.00 28.77 ? 359  SER A OG  1 
ATOM   2883 N N   . VAL A 1 360 ? 12.668  52.154 71.033 1.00 28.07 ? 360  VAL A N   1 
ATOM   2884 C CA  . VAL A 1 360 ? 12.818  50.985 70.169 1.00 29.14 ? 360  VAL A CA  1 
ATOM   2885 C C   . VAL A 1 360 ? 11.973  49.890 70.806 1.00 30.56 ? 360  VAL A C   1 
ATOM   2886 O O   . VAL A 1 360 ? 12.497  48.888 71.288 1.00 31.07 ? 360  VAL A O   1 
ATOM   2887 C CB  . VAL A 1 360 ? 14.294  50.518 70.109 1.00 29.55 ? 360  VAL A CB  1 
ATOM   2888 C CG1 . VAL A 1 360 ? 14.488  49.562 68.945 1.00 30.95 ? 360  VAL A CG1 1 
ATOM   2889 C CG2 . VAL A 1 360 ? 15.216  51.721 69.980 1.00 29.67 ? 360  VAL A CG2 1 
ATOM   2890 N N   . PRO A 1 361 ? 10.641  50.068 70.801 1.00 31.65 ? 361  PRO A N   1 
ATOM   2891 C CA  . PRO A 1 361 ? 9.694   49.114 71.389 1.00 32.72 ? 361  PRO A CA  1 
ATOM   2892 C C   . PRO A 1 361 ? 9.743   47.678 70.883 1.00 34.42 ? 361  PRO A C   1 
ATOM   2893 O O   . PRO A 1 361 ? 9.423   46.749 71.627 1.00 35.34 ? 361  PRO A O   1 
ATOM   2894 C CB  . PRO A 1 361 ? 8.339   49.778 71.139 1.00 32.97 ? 361  PRO A CB  1 
ATOM   2895 C CG  . PRO A 1 361 ? 8.565   50.520 69.845 1.00 33.99 ? 361  PRO A CG  1 
ATOM   2896 C CD  . PRO A 1 361 ? 9.926   51.136 70.076 1.00 32.15 ? 361  PRO A CD  1 
ATOM   2897 N N   . HIS A 1 362 ? 10.156  47.494 69.633 1.00 35.80 ? 362  HIS A N   1 
ATOM   2898 C CA  . HIS A 1 362 ? 10.225  46.166 69.028 1.00 39.07 ? 362  HIS A CA  1 
ATOM   2899 C C   . HIS A 1 362 ? 11.485  45.362 69.345 1.00 39.67 ? 362  HIS A C   1 
ATOM   2900 O O   . HIS A 1 362 ? 11.563  44.179 69.015 1.00 40.82 ? 362  HIS A O   1 
ATOM   2901 C CB  . HIS A 1 362 ? 10.101  46.296 67.511 1.00 40.82 ? 362  HIS A CB  1 
ATOM   2902 C CG  . HIS A 1 362 ? 11.113  47.216 66.903 1.00 41.34 ? 362  HIS A CG  1 
ATOM   2903 N ND1 . HIS A 1 362 ? 11.130  48.573 67.156 1.00 41.44 ? 362  HIS A ND1 1 
ATOM   2904 C CD2 . HIS A 1 362 ? 12.153  46.976 66.073 1.00 40.84 ? 362  HIS A CD2 1 
ATOM   2905 C CE1 . HIS A 1 362 ? 12.137  49.126 66.508 1.00 42.21 ? 362  HIS A CE1 1 
ATOM   2906 N NE2 . HIS A 1 362 ? 12.777  48.179 65.841 1.00 42.09 ? 362  HIS A NE2 1 
ATOM   2907 N N   . ALA A 1 363 ? 12.469  45.990 69.979 1.00 39.78 ? 363  ALA A N   1 
ATOM   2908 C CA  . ALA A 1 363 ? 13.726  45.308 70.286 1.00 39.11 ? 363  ALA A CA  1 
ATOM   2909 C C   . ALA A 1 363 ? 13.730  44.459 71.553 1.00 39.08 ? 363  ALA A C   1 
ATOM   2910 O O   . ALA A 1 363 ? 13.084  44.799 72.541 1.00 39.29 ? 363  ALA A O   1 
ATOM   2911 C CB  . ALA A 1 363 ? 14.855  46.331 70.360 1.00 38.75 ? 363  ALA A CB  1 
ATOM   2912 N N   . ASN A 1 364 ? 14.464  43.347 71.510 1.00 38.72 ? 364  ASN A N   1 
ATOM   2913 C CA  . ASN A 1 364 ? 14.592  42.480 72.675 1.00 38.97 ? 364  ASN A CA  1 
ATOM   2914 C C   . ASN A 1 364 ? 15.670  43.106 73.556 1.00 39.34 ? 364  ASN A C   1 
ATOM   2915 O O   . ASN A 1 364 ? 16.241  44.139 73.196 1.00 37.24 ? 364  ASN A O   1 
ATOM   2916 C CB  . ASN A 1 364 ? 14.994  41.053 72.273 1.00 39.17 ? 364  ASN A CB  1 
ATOM   2917 C CG  . ASN A 1 364 ? 16.217  41.013 71.375 1.00 39.68 ? 364  ASN A CG  1 
ATOM   2918 O OD1 . ASN A 1 364 ? 17.016  41.947 71.345 1.00 40.27 ? 364  ASN A OD1 1 
ATOM   2919 N ND2 . ASN A 1 364 ? 16.373  39.915 70.645 1.00 40.30 ? 364  ASN A ND2 1 
ATOM   2920 N N   . ASP A 1 365 ? 15.959  42.492 74.699 1.00 37.53 ? 365  ASP A N   1 
ATOM   2921 C CA  . ASP A 1 365 ? 16.955  43.046 75.606 1.00 38.60 ? 365  ASP A CA  1 
ATOM   2922 C C   . ASP A 1 365 ? 18.340  43.228 75.003 1.00 36.08 ? 365  ASP A C   1 
ATOM   2923 O O   . ASP A 1 365 ? 19.002  44.227 75.276 1.00 36.12 ? 365  ASP A O   1 
ATOM   2924 C CB  . ASP A 1 365 ? 17.048  42.209 76.882 1.00 42.60 ? 365  ASP A CB  1 
ATOM   2925 C CG  . ASP A 1 365 ? 15.807  42.329 77.745 1.00 49.18 ? 365  ASP A CG  1 
ATOM   2926 O OD1 . ASP A 1 365 ? 15.153  43.397 77.705 1.00 51.25 ? 365  ASP A OD1 1 
ATOM   2927 O OD2 . ASP A 1 365 ? 15.492  41.363 78.474 1.00 53.43 ? 365  ASP A OD2 1 
ATOM   2928 N N   . LEU A 1 366 ? 18.784  42.275 74.192 1.00 34.37 ? 366  LEU A N   1 
ATOM   2929 C CA  . LEU A 1 366 ? 20.095  42.390 73.564 1.00 32.67 ? 366  LEU A CA  1 
ATOM   2930 C C   . LEU A 1 366 ? 20.091  43.614 72.652 1.00 32.81 ? 366  LEU A C   1 
ATOM   2931 O O   . LEU A 1 366 ? 21.064  44.368 72.600 1.00 32.00 ? 366  LEU A O   1 
ATOM   2932 C CB  . LEU A 1 366 ? 20.411  41.143 72.745 1.00 33.16 ? 366  LEU A CB  1 
ATOM   2933 C CG  . LEU A 1 366 ? 21.758  41.155 72.015 1.00 34.00 ? 366  LEU A CG  1 
ATOM   2934 C CD1 . LEU A 1 366 ? 22.899  41.223 73.026 1.00 33.41 ? 366  LEU A CD1 1 
ATOM   2935 C CD2 . LEU A 1 366 ? 21.878  39.909 71.151 1.00 35.56 ? 366  LEU A CD2 1 
ATOM   2936 N N   . GLY A 1 367 ? 18.986  43.802 71.936 1.00 30.98 ? 367  GLY A N   1 
ATOM   2937 C CA  . GLY A 1 367 ? 18.866  44.941 71.045 1.00 30.65 ? 367  GLY A CA  1 
ATOM   2938 C C   . GLY A 1 367 ? 18.925  46.240 71.821 1.00 27.97 ? 367  GLY A C   1 
ATOM   2939 O O   . GLY A 1 367 ? 19.570  47.194 71.395 1.00 29.04 ? 367  GLY A O   1 
ATOM   2940 N N   . LEU A 1 368 ? 18.243  46.282 72.962 1.00 29.23 ? 368  LEU A N   1 
ATOM   2941 C CA  . LEU A 1 368 ? 18.243  47.477 73.798 1.00 29.83 ? 368  LEU A CA  1 
ATOM   2942 C C   . LEU A 1 368 ? 19.659  47.763 74.298 1.00 30.60 ? 368  LEU A C   1 
ATOM   2943 O O   . LEU A 1 368 ? 20.076  48.920 74.375 1.00 29.10 ? 368  LEU A O   1 
ATOM   2944 C CB  . LEU A 1 368 ? 17.291  47.299 74.982 1.00 30.19 ? 368  LEU A CB  1 
ATOM   2945 C CG  . LEU A 1 368 ? 15.805  47.197 74.614 1.00 32.97 ? 368  LEU A CG  1 
ATOM   2946 C CD1 . LEU A 1 368 ? 14.994  46.919 75.863 1.00 34.02 ? 368  LEU A CD1 1 
ATOM   2947 C CD2 . LEU A 1 368 ? 15.339  48.494 73.947 1.00 32.93 ? 368  LEU A CD2 1 
ATOM   2948 N N   . ASP A 1 369 ? 20.397  46.706 74.633 1.00 29.36 ? 369  ASP A N   1 
ATOM   2949 C CA  . ASP A 1 369 ? 21.773  46.866 75.098 1.00 30.85 ? 369  ASP A CA  1 
ATOM   2950 C C   . ASP A 1 369 ? 22.652  47.449 73.996 1.00 27.71 ? 369  ASP A C   1 
ATOM   2951 O O   . ASP A 1 369 ? 23.520  48.281 74.261 1.00 28.09 ? 369  ASP A O   1 
ATOM   2952 C CB  . ASP A 1 369 ? 22.367  45.525 75.546 1.00 32.83 ? 369  ASP A CB  1 
ATOM   2953 C CG  . ASP A 1 369 ? 21.815  45.052 76.873 1.00 38.96 ? 369  ASP A CG  1 
ATOM   2954 O OD1 . ASP A 1 369 ? 21.193  45.865 77.595 1.00 40.04 ? 369  ASP A OD1 1 
ATOM   2955 O OD2 . ASP A 1 369 ? 22.018  43.861 77.201 1.00 42.85 ? 369  ASP A OD2 1 
ATOM   2956 N N   . ALA A 1 370 ? 22.430  47.007 72.762 1.00 27.65 ? 370  ALA A N   1 
ATOM   2957 C CA  . ALA A 1 370 ? 23.208  47.495 71.625 1.00 27.69 ? 370  ALA A CA  1 
ATOM   2958 C C   . ALA A 1 370 ? 22.999  48.994 71.421 1.00 27.22 ? 370  ALA A C   1 
ATOM   2959 O O   . ALA A 1 370 ? 23.955  49.734 71.188 1.00 26.34 ? 370  ALA A O   1 
ATOM   2960 C CB  . ALA A 1 370 ? 22.827  46.734 70.356 1.00 27.72 ? 370  ALA A CB  1 
ATOM   2961 N N   . VAL A 1 371 ? 21.748  49.437 71.502 1.00 26.69 ? 371  VAL A N   1 
ATOM   2962 C CA  . VAL A 1 371 ? 21.428  50.854 71.338 1.00 25.74 ? 371  VAL A CA  1 
ATOM   2963 C C   . VAL A 1 371 ? 22.074  51.660 72.465 1.00 26.63 ? 371  VAL A C   1 
ATOM   2964 O O   . VAL A 1 371 ? 22.741  52.665 72.224 1.00 26.91 ? 371  VAL A O   1 
ATOM   2965 C CB  . VAL A 1 371 ? 19.897  51.094 71.376 1.00 25.97 ? 371  VAL A CB  1 
ATOM   2966 C CG1 . VAL A 1 371 ? 19.602  52.586 71.285 1.00 26.26 ? 371  VAL A CG1 1 
ATOM   2967 C CG2 . VAL A 1 371 ? 19.220  50.353 70.225 1.00 23.89 ? 371  VAL A CG2 1 
ATOM   2968 N N   . THR A 1 372 ? 21.872  51.209 73.696 1.00 28.03 ? 372  THR A N   1 
ATOM   2969 C CA  . THR A 1 372 ? 22.428  51.886 74.858 1.00 29.94 ? 372  THR A CA  1 
ATOM   2970 C C   . THR A 1 372 ? 23.941  52.047 74.733 1.00 31.23 ? 372  THR A C   1 
ATOM   2971 O O   . THR A 1 372 ? 24.483  53.117 74.997 1.00 30.70 ? 372  THR A O   1 
ATOM   2972 C CB  . THR A 1 372 ? 22.085  51.115 76.150 1.00 31.28 ? 372  THR A CB  1 
ATOM   2973 O OG1 . THR A 1 372 ? 20.659  51.085 76.314 1.00 32.62 ? 372  THR A OG1 1 
ATOM   2974 C CG2 . THR A 1 372 ? 22.720  51.783 77.366 1.00 32.06 ? 372  THR A CG2 1 
ATOM   2975 N N   . LEU A 1 373 ? 24.617  50.985 74.315 1.00 31.63 ? 373  LEU A N   1 
ATOM   2976 C CA  . LEU A 1 373 ? 26.064  51.029 74.155 1.00 32.93 ? 373  LEU A CA  1 
ATOM   2977 C C   . LEU A 1 373 ? 26.487  52.021 73.077 1.00 32.66 ? 373  LEU A C   1 
ATOM   2978 O O   . LEU A 1 373 ? 27.431  52.797 73.258 1.00 32.98 ? 373  LEU A O   1 
ATOM   2979 C CB  . LEU A 1 373 ? 26.594  49.639 73.795 1.00 34.29 ? 373  LEU A CB  1 
ATOM   2980 C CG  . LEU A 1 373 ? 28.099  49.540 73.528 1.00 37.39 ? 373  LEU A CG  1 
ATOM   2981 C CD1 . LEU A 1 373 ? 28.870  50.016 74.754 1.00 40.17 ? 373  LEU A CD1 1 
ATOM   2982 C CD2 . LEU A 1 373 ? 28.467  48.105 73.194 1.00 39.44 ? 373  LEU A CD2 1 
ATOM   2983 N N   . GLN A 1 374 ? 25.776  51.993 71.955 1.00 30.47 ? 374  GLN A N   1 
ATOM   2984 C CA  . GLN A 1 374 ? 26.070  52.861 70.823 1.00 30.16 ? 374  GLN A CA  1 
ATOM   2985 C C   . GLN A 1 374 ? 25.944  54.349 71.148 1.00 28.13 ? 374  GLN A C   1 
ATOM   2986 O O   . GLN A 1 374 ? 26.686  55.165 70.612 1.00 28.65 ? 374  GLN A O   1 
ATOM   2987 C CB  . GLN A 1 374 ? 25.133  52.517 69.660 1.00 32.21 ? 374  GLN A CB  1 
ATOM   2988 C CG  . GLN A 1 374 ? 25.528  53.114 68.322 1.00 35.98 ? 374  GLN A CG  1 
ATOM   2989 C CD  . GLN A 1 374 ? 26.686  52.371 67.677 1.00 39.27 ? 374  GLN A CD  1 
ATOM   2990 O OE1 . GLN A 1 374 ? 27.151  52.742 66.600 1.00 42.92 ? 374  GLN A OE1 1 
ATOM   2991 N NE2 . GLN A 1 374 ? 27.153  51.314 68.334 1.00 38.12 ? 374  GLN A NE2 1 
ATOM   2992 N N   . TYR A 1 375 ? 25.016  54.707 72.030 1.00 27.68 ? 375  TYR A N   1 
ATOM   2993 C CA  . TYR A 1 375 ? 24.811  56.117 72.354 1.00 28.21 ? 375  TYR A CA  1 
ATOM   2994 C C   . TYR A 1 375 ? 25.274  56.571 73.733 1.00 30.51 ? 375  TYR A C   1 
ATOM   2995 O O   . TYR A 1 375 ? 24.941  57.675 74.164 1.00 32.10 ? 375  TYR A O   1 
ATOM   2996 C CB  . TYR A 1 375 ? 23.334  56.481 72.186 1.00 26.45 ? 375  TYR A CB  1 
ATOM   2997 C CG  . TYR A 1 375 ? 22.902  56.550 70.740 1.00 25.03 ? 375  TYR A CG  1 
ATOM   2998 C CD1 . TYR A 1 375 ? 22.587  55.394 70.024 1.00 26.05 ? 375  TYR A CD1 1 
ATOM   2999 C CD2 . TYR A 1 375 ? 22.847  57.773 70.077 1.00 26.10 ? 375  TYR A CD2 1 
ATOM   3000 C CE1 . TYR A 1 375 ? 22.229  55.459 68.676 1.00 25.33 ? 375  TYR A CE1 1 
ATOM   3001 C CE2 . TYR A 1 375 ? 22.495  57.850 68.731 1.00 24.14 ? 375  TYR A CE2 1 
ATOM   3002 C CZ  . TYR A 1 375 ? 22.189  56.697 68.037 1.00 25.07 ? 375  TYR A CZ  1 
ATOM   3003 O OH  . TYR A 1 375 ? 21.872  56.783 66.701 1.00 25.42 ? 375  TYR A OH  1 
ATOM   3004 N N   . THR A 1 376 ? 26.034  55.735 74.427 1.00 28.62 ? 376  THR A N   1 
ATOM   3005 C CA  . THR A 1 376 ? 26.503  56.110 75.753 1.00 29.66 ? 376  THR A CA  1 
ATOM   3006 C C   . THR A 1 376 ? 27.991  56.422 75.789 1.00 30.82 ? 376  THR A C   1 
ATOM   3007 O O   . THR A 1 376 ? 28.802  55.678 75.238 1.00 30.04 ? 376  THR A O   1 
ATOM   3008 C CB  . THR A 1 376 ? 26.227  54.990 76.783 1.00 29.70 ? 376  THR A CB  1 
ATOM   3009 O OG1 . THR A 1 376 ? 24.815  54.786 76.904 1.00 30.79 ? 376  THR A OG1 1 
ATOM   3010 C CG2 . THR A 1 376 ? 26.787  55.370 78.155 1.00 30.42 ? 376  THR A CG2 1 
ATOM   3011 N N   . ASP A 1 377 ? 28.340  57.535 76.428 1.00 30.45 ? 377  ASP A N   1 
ATOM   3012 C CA  . ASP A 1 377 ? 29.742  57.913 76.592 1.00 32.03 ? 377  ASP A CA  1 
ATOM   3013 C C   . ASP A 1 377 ? 30.103  57.296 77.942 1.00 32.20 ? 377  ASP A C   1 
ATOM   3014 O O   . ASP A 1 377 ? 29.774  57.856 78.991 1.00 31.20 ? 377  ASP A O   1 
ATOM   3015 C CB  . ASP A 1 377 ? 29.892  59.434 76.672 1.00 32.92 ? 377  ASP A CB  1 
ATOM   3016 C CG  . ASP A 1 377 ? 31.336  59.870 76.875 1.00 36.78 ? 377  ASP A CG  1 
ATOM   3017 O OD1 . ASP A 1 377 ? 32.205  58.996 77.100 1.00 34.72 ? 377  ASP A OD1 1 
ATOM   3018 O OD2 . ASP A 1 377 ? 31.598  61.090 76.816 1.00 37.07 ? 377  ASP A OD2 1 
ATOM   3019 N N   . TRP A 1 378 ? 30.762  56.140 77.920 1.00 31.69 ? 378  TRP A N   1 
ATOM   3020 C CA  . TRP A 1 378 ? 31.110  55.462 79.160 1.00 34.24 ? 378  TRP A CA  1 
ATOM   3021 C C   . TRP A 1 378 ? 32.178  56.145 80.004 1.00 34.56 ? 378  TRP A C   1 
ATOM   3022 O O   . TRP A 1 378 ? 32.473  55.699 81.112 1.00 35.11 ? 378  TRP A O   1 
ATOM   3023 C CB  . TRP A 1 378 ? 31.495  54.005 78.880 1.00 35.69 ? 378  TRP A CB  1 
ATOM   3024 C CG  . TRP A 1 378 ? 30.348  53.224 78.311 1.00 39.28 ? 378  TRP A CG  1 
ATOM   3025 C CD1 . TRP A 1 378 ? 30.179  52.851 77.012 1.00 41.02 ? 378  TRP A CD1 1 
ATOM   3026 C CD2 . TRP A 1 378 ? 29.171  52.791 79.007 1.00 40.87 ? 378  TRP A CD2 1 
ATOM   3027 N NE1 . TRP A 1 378 ? 28.973  52.216 76.852 1.00 43.78 ? 378  TRP A NE1 1 
ATOM   3028 C CE2 . TRP A 1 378 ? 28.333  52.165 78.061 1.00 41.44 ? 378  TRP A CE2 1 
ATOM   3029 C CE3 . TRP A 1 378 ? 28.744  52.876 80.338 1.00 42.60 ? 378  TRP A CE3 1 
ATOM   3030 C CZ2 . TRP A 1 378 ? 27.087  51.624 78.400 1.00 44.61 ? 378  TRP A CZ2 1 
ATOM   3031 C CZ3 . TRP A 1 378 ? 27.504  52.338 80.678 1.00 44.32 ? 378  TRP A CZ3 1 
ATOM   3032 C CH2 . TRP A 1 378 ? 26.691  51.720 79.712 1.00 44.70 ? 378  TRP A CH2 1 
ATOM   3033 N N   . MET A 1 379 ? 32.756  57.223 79.492 1.00 36.66 ? 379  MET A N   1 
ATOM   3034 C CA  . MET A 1 379 ? 33.753  57.958 80.265 1.00 40.33 ? 379  MET A CA  1 
ATOM   3035 C C   . MET A 1 379 ? 33.029  58.994 81.117 1.00 40.68 ? 379  MET A C   1 
ATOM   3036 O O   . MET A 1 379 ? 33.607  59.573 82.037 1.00 41.81 ? 379  MET A O   1 
ATOM   3037 C CB  . MET A 1 379 ? 34.736  58.691 79.350 1.00 41.84 ? 379  MET A CB  1 
ATOM   3038 C CG  . MET A 1 379 ? 35.641  57.804 78.525 1.00 45.95 ? 379  MET A CG  1 
ATOM   3039 S SD  . MET A 1 379 ? 36.956  58.778 77.761 1.00 51.73 ? 379  MET A SD  1 
ATOM   3040 C CE  . MET A 1 379 ? 36.079  59.515 76.388 1.00 48.33 ? 379  MET A CE  1 
ATOM   3041 N N   . ASP A 1 380 ? 31.754  59.212 80.809 1.00 40.64 ? 380  ASP A N   1 
ATOM   3042 C CA  . ASP A 1 380 ? 30.947  60.204 81.514 1.00 40.33 ? 380  ASP A CA  1 
ATOM   3043 C C   . ASP A 1 380 ? 29.463  59.836 81.372 1.00 39.87 ? 380  ASP A C   1 
ATOM   3044 O O   . ASP A 1 380 ? 28.651  60.630 80.899 1.00 39.65 ? 380  ASP A O   1 
ATOM   3045 C CB  . ASP A 1 380 ? 31.245  61.576 80.901 1.00 41.28 ? 380  ASP A CB  1 
ATOM   3046 C CG  . ASP A 1 380 ? 30.614  62.717 81.665 1.00 42.57 ? 380  ASP A CG  1 
ATOM   3047 O OD1 . ASP A 1 380 ? 30.390  62.576 82.884 1.00 44.11 ? 380  ASP A OD1 1 
ATOM   3048 O OD2 . ASP A 1 380 ? 30.360  63.769 81.040 1.00 43.81 ? 380  ASP A OD2 1 
ATOM   3049 N N   . ASP A 1 381 ? 29.128  58.626 81.814 1.00 39.80 ? 381  ASP A N   1 
ATOM   3050 C CA  . ASP A 1 381 ? 27.775  58.079 81.713 1.00 40.25 ? 381  ASP A CA  1 
ATOM   3051 C C   . ASP A 1 381 ? 26.670  58.714 82.554 1.00 41.17 ? 381  ASP A C   1 
ATOM   3052 O O   . ASP A 1 381 ? 25.486  58.496 82.285 1.00 40.05 ? 381  ASP A O   1 
ATOM   3053 C CB  . ASP A 1 381 ? 27.814  56.578 82.004 1.00 41.56 ? 381  ASP A CB  1 
ATOM   3054 C CG  . ASP A 1 381 ? 28.398  56.267 83.367 1.00 44.58 ? 381  ASP A CG  1 
ATOM   3055 O OD1 . ASP A 1 381 ? 29.590  56.568 83.590 1.00 46.29 ? 381  ASP A OD1 1 
ATOM   3056 O OD2 . ASP A 1 381 ? 27.662  55.725 84.218 1.00 47.45 ? 381  ASP A OD2 1 
ATOM   3057 N N   . ASN A 1 382 ? 27.033  59.484 83.573 1.00 40.61 ? 382  ASN A N   1 
ATOM   3058 C CA  . ASN A 1 382 ? 26.020  60.118 84.407 1.00 41.81 ? 382  ASN A CA  1 
ATOM   3059 C C   . ASN A 1 382 ? 25.843  61.593 84.080 1.00 41.34 ? 382  ASN A C   1 
ATOM   3060 O O   . ASN A 1 382 ? 25.287  62.354 84.870 1.00 42.30 ? 382  ASN A O   1 
ATOM   3061 C CB  . ASN A 1 382 ? 26.367  59.934 85.884 1.00 45.02 ? 382  ASN A CB  1 
ATOM   3062 C CG  . ASN A 1 382 ? 26.000  58.557 86.392 1.00 46.82 ? 382  ASN A CG  1 
ATOM   3063 O OD1 . ASN A 1 382 ? 26.693  57.989 87.233 1.00 52.53 ? 382  ASN A OD1 1 
ATOM   3064 N ND2 . ASN A 1 382 ? 24.895  58.016 85.890 1.00 48.04 ? 382  ASN A ND2 1 
ATOM   3065 N N   . ASN A 1 383 ? 26.319  61.990 82.906 1.00 38.97 ? 383  ASN A N   1 
ATOM   3066 C CA  . ASN A 1 383 ? 26.201  63.366 82.459 1.00 38.00 ? 383  ASN A CA  1 
ATOM   3067 C C   . ASN A 1 383 ? 24.769  63.548 81.954 1.00 38.23 ? 383  ASN A C   1 
ATOM   3068 O O   . ASN A 1 383 ? 24.382  62.952 80.947 1.00 37.13 ? 383  ASN A O   1 
ATOM   3069 C CB  . ASN A 1 383 ? 27.199  63.628 81.330 1.00 38.59 ? 383  ASN A CB  1 
ATOM   3070 C CG  . ASN A 1 383 ? 27.192  65.067 80.865 1.00 38.32 ? 383  ASN A CG  1 
ATOM   3071 O OD1 . ASN A 1 383 ? 26.135  65.668 80.673 1.00 37.54 ? 383  ASN A OD1 1 
ATOM   3072 N ND2 . ASN A 1 383 ? 28.380  65.627 80.665 1.00 39.19 ? 383  ASN A ND2 1 
ATOM   3073 N N   . GLY A 1 384 ? 23.994  64.366 82.662 1.00 37.45 ? 384  GLY A N   1 
ATOM   3074 C CA  . GLY A 1 384 ? 22.607  64.613 82.299 1.00 35.98 ? 384  GLY A CA  1 
ATOM   3075 C C   . GLY A 1 384 ? 22.386  65.211 80.923 1.00 35.09 ? 384  GLY A C   1 
ATOM   3076 O O   . GLY A 1 384 ? 21.405  64.883 80.256 1.00 35.28 ? 384  GLY A O   1 
ATOM   3077 N N   . ILE A 1 385 ? 23.283  66.097 80.502 1.00 34.89 ? 385  ILE A N   1 
ATOM   3078 C CA  . ILE A 1 385 ? 23.177  66.731 79.191 1.00 35.79 ? 385  ILE A CA  1 
ATOM   3079 C C   . ILE A 1 385 ? 23.442  65.696 78.103 1.00 35.67 ? 385  ILE A C   1 
ATOM   3080 O O   . ILE A 1 385 ? 22.721  65.622 77.107 1.00 33.20 ? 385  ILE A O   1 
ATOM   3081 C CB  . ILE A 1 385 ? 24.204  67.871 79.023 1.00 36.43 ? 385  ILE A CB  1 
ATOM   3082 C CG1 . ILE A 1 385 ? 23.995  68.934 80.103 1.00 39.38 ? 385  ILE A CG1 1 
ATOM   3083 C CG2 . ILE A 1 385 ? 24.077  68.486 77.639 1.00 36.35 ? 385  ILE A CG2 1 
ATOM   3084 C CD1 . ILE A 1 385 ? 22.645  69.603 80.056 1.00 42.00 ? 385  ILE A CD1 1 
ATOM   3085 N N   . LYS A 1 386 ? 24.484  64.897 78.302 1.00 35.42 ? 386  LYS A N   1 
ATOM   3086 C CA  . LYS A 1 386 ? 24.842  63.870 77.337 1.00 34.95 ? 386  LYS A CA  1 
ATOM   3087 C C   . LYS A 1 386 ? 23.761  62.805 77.205 1.00 33.95 ? 386  LYS A C   1 
ATOM   3088 O O   . LYS A 1 386 ? 23.480  62.341 76.098 1.00 33.82 ? 386  LYS A O   1 
ATOM   3089 C CB  . LYS A 1 386 ? 26.179  63.225 77.715 1.00 35.23 ? 386  LYS A CB  1 
ATOM   3090 C CG  . LYS A 1 386 ? 27.372  64.137 77.470 1.00 37.69 ? 386  LYS A CG  1 
ATOM   3091 C CD  . LYS A 1 386 ? 28.693  63.427 77.735 1.00 39.78 ? 386  LYS A CD  1 
ATOM   3092 C CE  . LYS A 1 386 ? 29.875  64.350 77.456 1.00 41.68 ? 386  LYS A CE  1 
ATOM   3093 N NZ  . LYS A 1 386 ? 31.182  63.669 77.671 1.00 42.79 ? 386  LYS A NZ  1 
ATOM   3094 N N   . ASN A 1 387 ? 23.152  62.419 78.323 1.00 32.92 ? 387  ASN A N   1 
ATOM   3095 C CA  . ASN A 1 387 ? 22.094  61.414 78.278 1.00 32.48 ? 387  ASN A CA  1 
ATOM   3096 C C   . ASN A 1 387 ? 20.874  61.977 77.551 1.00 31.65 ? 387  ASN A C   1 
ATOM   3097 O O   . ASN A 1 387 ? 20.251  61.295 76.737 1.00 30.22 ? 387  ASN A O   1 
ATOM   3098 C CB  . ASN A 1 387 ? 21.699  60.966 79.690 1.00 32.31 ? 387  ASN A CB  1 
ATOM   3099 C CG  . ASN A 1 387 ? 22.792  60.161 80.376 1.00 35.01 ? 387  ASN A CG  1 
ATOM   3100 O OD1 . ASN A 1 387 ? 23.640  59.557 79.719 1.00 35.62 ? 387  ASN A OD1 1 
ATOM   3101 N ND2 . ASN A 1 387 ? 22.766  60.139 81.703 1.00 36.36 ? 387  ASN A ND2 1 
ATOM   3102 N N   . ARG A 1 388 ? 20.535  63.227 77.846 1.00 29.48 ? 388  ARG A N   1 
ATOM   3103 C CA  . ARG A 1 388 ? 19.396  63.865 77.202 1.00 30.04 ? 388  ARG A CA  1 
ATOM   3104 C C   . ARG A 1 388 ? 19.615  63.972 75.695 1.00 29.88 ? 388  ARG A C   1 
ATOM   3105 O O   . ARG A 1 388 ? 18.759  63.572 74.905 1.00 28.98 ? 388  ARG A O   1 
ATOM   3106 C CB  . ARG A 1 388 ? 19.156  65.260 77.785 1.00 29.63 ? 388  ARG A CB  1 
ATOM   3107 C CG  . ARG A 1 388 ? 18.142  66.078 77.000 1.00 32.49 ? 388  ARG A CG  1 
ATOM   3108 C CD  . ARG A 1 388 ? 18.810  67.287 76.366 1.00 37.20 ? 388  ARG A CD  1 
ATOM   3109 N NE  . ARG A 1 388 ? 18.907  68.362 77.331 1.00 36.47 ? 388  ARG A NE  1 
ATOM   3110 C CZ  . ARG A 1 388 ? 19.754  69.381 77.260 1.00 35.54 ? 388  ARG A CZ  1 
ATOM   3111 N NH1 . ARG A 1 388 ? 20.613  69.491 76.256 1.00 34.02 ? 388  ARG A NH1 1 
ATOM   3112 N NH2 . ARG A 1 388 ? 19.732  70.300 78.210 1.00 34.31 ? 388  ARG A NH2 1 
ATOM   3113 N N   . ASP A 1 389 ? 20.762  64.507 75.293 1.00 29.78 ? 389  ASP A N   1 
ATOM   3114 C CA  . ASP A 1 389 ? 21.054  64.652 73.871 1.00 30.74 ? 389  ASP A CA  1 
ATOM   3115 C C   . ASP A 1 389 ? 21.216  63.293 73.184 1.00 29.97 ? 389  ASP A C   1 
ATOM   3116 O O   . ASP A 1 389 ? 20.917  63.150 71.995 1.00 28.02 ? 389  ASP A O   1 
ATOM   3117 C CB  . ASP A 1 389 ? 22.310  65.503 73.664 1.00 31.84 ? 389  ASP A CB  1 
ATOM   3118 C CG  . ASP A 1 389 ? 22.126  66.940 74.128 1.00 33.83 ? 389  ASP A CG  1 
ATOM   3119 O OD1 . ASP A 1 389 ? 20.968  67.396 74.236 1.00 33.85 ? 389  ASP A OD1 1 
ATOM   3120 O OD2 . ASP A 1 389 ? 23.144  67.619 74.374 1.00 35.05 ? 389  ASP A OD2 1 
ATOM   3121 N N   . GLY A 1 390 ? 21.692  62.303 73.934 1.00 28.96 ? 390  GLY A N   1 
ATOM   3122 C CA  . GLY A 1 390 ? 21.857  60.968 73.381 1.00 29.17 ? 390  GLY A CA  1 
ATOM   3123 C C   . GLY A 1 390 ? 20.504  60.379 73.008 1.00 28.26 ? 390  GLY A C   1 
ATOM   3124 O O   . GLY A 1 390 ? 20.332  59.811 71.929 1.00 26.80 ? 390  GLY A O   1 
ATOM   3125 N N   . LEU A 1 391 ? 19.538  60.518 73.910 1.00 29.04 ? 391  LEU A N   1 
ATOM   3126 C CA  . LEU A 1 391 ? 18.187  60.021 73.668 1.00 28.70 ? 391  LEU A CA  1 
ATOM   3127 C C   . LEU A 1 391 ? 17.557  60.768 72.501 1.00 28.46 ? 391  LEU A C   1 
ATOM   3128 O O   . LEU A 1 391 ? 16.858  60.173 71.680 1.00 26.67 ? 391  LEU A O   1 
ATOM   3129 C CB  . LEU A 1 391 ? 17.312  60.202 74.911 1.00 30.51 ? 391  LEU A CB  1 
ATOM   3130 C CG  . LEU A 1 391 ? 17.125  58.971 75.794 1.00 34.21 ? 391  LEU A CG  1 
ATOM   3131 C CD1 . LEU A 1 391 ? 16.277  59.338 77.006 1.00 33.81 ? 391  LEU A CD1 1 
ATOM   3132 C CD2 . LEU A 1 391 ? 16.459  57.862 74.989 1.00 36.12 ? 391  LEU A CD2 1 
ATOM   3133 N N   . ASP A 1 392 ? 17.798  62.076 72.444 1.00 27.03 ? 392  ASP A N   1 
ATOM   3134 C CA  . ASP A 1 392 ? 17.272  62.905 71.369 1.00 29.16 ? 392  ASP A CA  1 
ATOM   3135 C C   . ASP A 1 392 ? 17.778  62.327 70.045 1.00 29.10 ? 392  ASP A C   1 
ATOM   3136 O O   . ASP A 1 392 ? 17.004  62.150 69.100 1.00 26.82 ? 392  ASP A O   1 
ATOM   3137 C CB  . ASP A 1 392 ? 17.763  64.347 71.527 1.00 32.39 ? 392  ASP A CB  1 
ATOM   3138 C CG  . ASP A 1 392 ? 16.910  65.352 70.764 1.00 36.58 ? 392  ASP A CG  1 
ATOM   3139 O OD1 . ASP A 1 392 ? 16.158  64.954 69.847 1.00 38.17 ? 392  ASP A OD1 1 
ATOM   3140 O OD2 . ASP A 1 392 ? 17.005  66.559 71.079 1.00 39.03 ? 392  ASP A OD2 1 
ATOM   3141 N N   . ASP A 1 393 ? 19.075  62.025 69.979 1.00 26.26 ? 393  ASP A N   1 
ATOM   3142 C CA  . ASP A 1 393 ? 19.651  61.466 68.759 1.00 25.98 ? 393  ASP A CA  1 
ATOM   3143 C C   . ASP A 1 393 ? 19.090  60.081 68.444 1.00 24.47 ? 393  ASP A C   1 
ATOM   3144 O O   . ASP A 1 393 ? 18.835  59.760 67.288 1.00 24.18 ? 393  ASP A O   1 
ATOM   3145 C CB  . ASP A 1 393 ? 21.178  61.379 68.856 1.00 28.14 ? 393  ASP A CB  1 
ATOM   3146 C CG  . ASP A 1 393 ? 21.851  62.731 68.722 1.00 33.39 ? 393  ASP A CG  1 
ATOM   3147 O OD1 . ASP A 1 393 ? 21.328  63.592 67.982 1.00 35.78 ? 393  ASP A OD1 1 
ATOM   3148 O OD2 . ASP A 1 393 ? 22.914  62.930 69.345 1.00 36.42 ? 393  ASP A OD2 1 
ATOM   3149 N N   . ILE A 1 394 ? 18.896  59.263 69.471 1.00 23.57 ? 394  ILE A N   1 
ATOM   3150 C CA  . ILE A 1 394 ? 18.358  57.926 69.263 1.00 24.09 ? 394  ILE A CA  1 
ATOM   3151 C C   . ILE A 1 394 ? 17.008  58.005 68.558 1.00 24.57 ? 394  ILE A C   1 
ATOM   3152 O O   . ILE A 1 394 ? 16.780  57.338 67.544 1.00 23.60 ? 394  ILE A O   1 
ATOM   3153 C CB  . ILE A 1 394 ? 18.172  57.174 70.605 1.00 24.20 ? 394  ILE A CB  1 
ATOM   3154 C CG1 . ILE A 1 394 ? 19.532  56.715 71.136 1.00 23.62 ? 394  ILE A CG1 1 
ATOM   3155 C CG2 . ILE A 1 394 ? 17.235  55.980 70.413 1.00 23.17 ? 394  ILE A CG2 1 
ATOM   3156 C CD1 . ILE A 1 394 ? 19.477  56.180 72.555 1.00 24.12 ? 394  ILE A CD1 1 
ATOM   3157 N N   . VAL A 1 395 ? 16.123  58.837 69.093 1.00 23.40 ? 395  VAL A N   1 
ATOM   3158 C CA  . VAL A 1 395 ? 14.794  58.988 68.525 1.00 23.82 ? 395  VAL A CA  1 
ATOM   3159 C C   . VAL A 1 395 ? 14.843  59.532 67.097 1.00 23.61 ? 395  VAL A C   1 
ATOM   3160 O O   . VAL A 1 395 ? 14.179  59.002 66.205 1.00 23.65 ? 395  VAL A O   1 
ATOM   3161 C CB  . VAL A 1 395 ? 13.917  59.903 69.417 1.00 24.41 ? 395  VAL A CB  1 
ATOM   3162 C CG1 . VAL A 1 395 ? 12.561  60.119 68.775 1.00 24.15 ? 395  VAL A CG1 1 
ATOM   3163 C CG2 . VAL A 1 395 ? 13.740  59.260 70.793 1.00 23.43 ? 395  VAL A CG2 1 
ATOM   3164 N N   . GLY A 1 396 ? 15.643  60.575 66.880 1.00 23.35 ? 396  GLY A N   1 
ATOM   3165 C CA  . GLY A 1 396 ? 15.756  61.158 65.553 1.00 23.04 ? 396  GLY A CA  1 
ATOM   3166 C C   . GLY A 1 396 ? 16.416  60.255 64.522 1.00 24.17 ? 396  GLY A C   1 
ATOM   3167 O O   . GLY A 1 396 ? 15.968  60.185 63.370 1.00 23.07 ? 396  GLY A O   1 
ATOM   3168 N N   . ASP A 1 397 ? 17.483  59.563 64.922 1.00 22.83 ? 397  ASP A N   1 
ATOM   3169 C CA  . ASP A 1 397 ? 18.194  58.665 64.008 1.00 23.34 ? 397  ASP A CA  1 
ATOM   3170 C C   . ASP A 1 397 ? 17.347  57.457 63.607 1.00 23.19 ? 397  ASP A C   1 
ATOM   3171 O O   . ASP A 1 397 ? 17.245  57.115 62.430 1.00 23.01 ? 397  ASP A O   1 
ATOM   3172 C CB  . ASP A 1 397 ? 19.494  58.162 64.646 1.00 24.85 ? 397  ASP A CB  1 
ATOM   3173 C CG  . ASP A 1 397 ? 20.532  59.252 64.807 1.00 24.94 ? 397  ASP A CG  1 
ATOM   3174 O OD1 . ASP A 1 397 ? 20.391  60.322 64.182 1.00 26.53 ? 397  ASP A OD1 1 
ATOM   3175 O OD2 . ASP A 1 397 ? 21.505  59.025 65.552 1.00 26.26 ? 397  ASP A OD2 1 
ATOM   3176 N N   . HIS A 1 398 ? 16.739  56.818 64.597 1.00 24.06 ? 398  HIS A N   1 
ATOM   3177 C CA  . HIS A 1 398 ? 15.919  55.638 64.352 1.00 23.32 ? 398  HIS A CA  1 
ATOM   3178 C C   . HIS A 1 398 ? 14.653  55.910 63.543 1.00 23.19 ? 398  HIS A C   1 
ATOM   3179 O O   . HIS A 1 398 ? 14.340  55.187 62.598 1.00 22.91 ? 398  HIS A O   1 
ATOM   3180 C CB  . HIS A 1 398 ? 15.538  54.988 65.685 1.00 23.93 ? 398  HIS A CB  1 
ATOM   3181 C CG  . HIS A 1 398 ? 14.503  53.915 65.561 1.00 24.25 ? 398  HIS A CG  1 
ATOM   3182 N ND1 . HIS A 1 398 ? 14.680  52.791 64.782 1.00 25.38 ? 398  HIS A ND1 1 
ATOM   3183 C CD2 . HIS A 1 398 ? 13.270  53.795 66.114 1.00 26.12 ? 398  HIS A CD2 1 
ATOM   3184 C CE1 . HIS A 1 398 ? 13.606  52.026 64.861 1.00 25.19 ? 398  HIS A CE1 1 
ATOM   3185 N NE2 . HIS A 1 398 ? 12.735  52.613 65.663 1.00 26.80 ? 398  HIS A NE2 1 
ATOM   3186 N N   . ASN A 1 399 ? 13.935  56.965 63.903 1.00 22.71 ? 399  ASN A N   1 
ATOM   3187 C CA  . ASN A 1 399 ? 12.673  57.284 63.247 1.00 22.92 ? 399  ASN A CA  1 
ATOM   3188 C C   . ASN A 1 399 ? 12.697  58.161 62.008 1.00 23.79 ? 399  ASN A C   1 
ATOM   3189 O O   . ASN A 1 399 ? 11.792  58.084 61.177 1.00 23.73 ? 399  ASN A O   1 
ATOM   3190 C CB  . ASN A 1 399 ? 11.735  57.912 64.273 1.00 23.38 ? 399  ASN A CB  1 
ATOM   3191 C CG  . ASN A 1 399 ? 11.300  56.927 65.324 1.00 22.40 ? 399  ASN A CG  1 
ATOM   3192 O OD1 . ASN A 1 399 ? 10.586  55.970 65.025 1.00 23.93 ? 399  ASN A OD1 1 
ATOM   3193 N ND2 . ASN A 1 399 ? 11.732  57.143 66.562 1.00 22.82 ? 399  ASN A ND2 1 
ATOM   3194 N N   . VAL A 1 400 ? 13.720  58.992 61.869 1.00 23.08 ? 400  VAL A N   1 
ATOM   3195 C CA  . VAL A 1 400 ? 13.752  59.887 60.724 1.00 22.93 ? 400  VAL A CA  1 
ATOM   3196 C C   . VAL A 1 400 ? 15.008  59.863 59.864 1.00 22.93 ? 400  VAL A C   1 
ATOM   3197 O O   . VAL A 1 400 ? 14.958  59.520 58.679 1.00 21.50 ? 400  VAL A O   1 
ATOM   3198 C CB  . VAL A 1 400 ? 13.522  61.351 61.175 1.00 21.28 ? 400  VAL A CB  1 
ATOM   3199 C CG1 . VAL A 1 400 ? 13.552  62.286 59.963 1.00 23.18 ? 400  VAL A CG1 1 
ATOM   3200 C CG2 . VAL A 1 400 ? 12.189  61.473 61.918 1.00 24.28 ? 400  VAL A CG2 1 
ATOM   3201 N N   . ILE A 1 401 ? 16.133  60.241 60.456 1.00 23.21 ? 401  ILE A N   1 
ATOM   3202 C CA  . ILE A 1 401 ? 17.370  60.331 59.699 1.00 23.71 ? 401  ILE A CA  1 
ATOM   3203 C C   . ILE A 1 401 ? 17.860  59.060 59.032 1.00 23.76 ? 401  ILE A C   1 
ATOM   3204 O O   . ILE A 1 401 ? 18.081  59.049 57.821 1.00 23.30 ? 401  ILE A O   1 
ATOM   3205 C CB  . ILE A 1 401 ? 18.502  60.925 60.563 1.00 23.37 ? 401  ILE A CB  1 
ATOM   3206 C CG1 . ILE A 1 401 ? 18.057  62.289 61.104 1.00 24.68 ? 401  ILE A CG1 1 
ATOM   3207 C CG2 . ILE A 1 401 ? 19.774  61.079 59.720 1.00 23.76 ? 401  ILE A CG2 1 
ATOM   3208 C CD1 . ILE A 1 401 ? 19.101  63.006 61.933 1.00 27.87 ? 401  ILE A CD1 1 
ATOM   3209 N N   . CYS A 1 402 ? 18.019  57.982 59.790 1.00 23.49 ? 402  CYS A N   1 
ATOM   3210 C CA  . CYS A 1 402 ? 18.527  56.772 59.172 1.00 23.57 ? 402  CYS A CA  1 
ATOM   3211 C C   . CYS A 1 402 ? 17.563  56.151 58.163 1.00 23.62 ? 402  CYS A C   1 
ATOM   3212 O O   . CYS A 1 402 ? 17.994  55.629 57.140 1.00 23.55 ? 402  CYS A O   1 
ATOM   3213 C CB  . CYS A 1 402 ? 18.980  55.794 60.251 1.00 25.98 ? 402  CYS A CB  1 
ATOM   3214 S SG  . CYS A 1 402 ? 20.432  56.476 61.131 1.00 29.54 ? 402  CYS A SG  1 
ATOM   3215 N N   . PRO A 1 403 ? 16.247  56.195 58.431 1.00 23.99 ? 403  PRO A N   1 
ATOM   3216 C CA  . PRO A 1 403 ? 15.379  55.601 57.405 1.00 25.78 ? 403  PRO A CA  1 
ATOM   3217 C C   . PRO A 1 403 ? 15.487  56.442 56.122 1.00 23.99 ? 403  PRO A C   1 
ATOM   3218 O O   . PRO A 1 403 ? 15.483  55.909 55.015 1.00 24.27 ? 403  PRO A O   1 
ATOM   3219 C CB  . PRO A 1 403 ? 13.989  55.686 58.030 1.00 26.47 ? 403  PRO A CB  1 
ATOM   3220 C CG  . PRO A 1 403 ? 14.272  55.536 59.497 1.00 27.90 ? 403  PRO A CG  1 
ATOM   3221 C CD  . PRO A 1 403 ? 15.519  56.391 59.699 1.00 25.03 ? 403  PRO A CD  1 
ATOM   3222 N N   . LEU A 1 404 ? 15.585  57.763 56.273 1.00 23.85 ? 404  LEU A N   1 
ATOM   3223 C CA  . LEU A 1 404 ? 15.698  58.624 55.098 1.00 24.14 ? 404  LEU A CA  1 
ATOM   3224 C C   . LEU A 1 404 ? 17.012  58.372 54.363 1.00 24.92 ? 404  LEU A C   1 
ATOM   3225 O O   . LEU A 1 404 ? 17.048  58.368 53.129 1.00 23.80 ? 404  LEU A O   1 
ATOM   3226 C CB  . LEU A 1 404 ? 15.578  60.103 55.487 1.00 25.01 ? 404  LEU A CB  1 
ATOM   3227 C CG  . LEU A 1 404 ? 15.631  61.091 54.309 1.00 26.62 ? 404  LEU A CG  1 
ATOM   3228 C CD1 . LEU A 1 404 ? 14.654  62.232 54.539 1.00 27.17 ? 404  LEU A CD1 1 
ATOM   3229 C CD2 . LEU A 1 404 ? 17.055  61.613 54.145 1.00 26.71 ? 404  LEU A CD2 1 
ATOM   3230 N N   . MET A 1 405 ? 18.092  58.151 55.111 1.00 24.05 ? 405  MET A N   1 
ATOM   3231 C CA  . MET A 1 405 ? 19.375  57.886 54.474 1.00 25.73 ? 405  MET A CA  1 
ATOM   3232 C C   . MET A 1 405 ? 19.340  56.547 53.736 1.00 25.38 ? 405  MET A C   1 
ATOM   3233 O O   . MET A 1 405 ? 19.968  56.390 52.689 1.00 27.54 ? 405  MET A O   1 
ATOM   3234 C CB  . MET A 1 405 ? 20.512  57.912 55.504 1.00 26.92 ? 405  MET A CB  1 
ATOM   3235 C CG  . MET A 1 405 ? 20.807  59.308 56.041 1.00 26.97 ? 405  MET A CG  1 
ATOM   3236 S SD  . MET A 1 405 ? 20.973  60.553 54.724 1.00 28.44 ? 405  MET A SD  1 
ATOM   3237 C CE  . MET A 1 405 ? 22.437  59.950 53.878 1.00 28.44 ? 405  MET A CE  1 
ATOM   3238 N N   . HIS A 1 406 ? 18.599  55.581 54.269 1.00 26.10 ? 406  HIS A N   1 
ATOM   3239 C CA  . HIS A 1 406 ? 18.484  54.288 53.597 1.00 26.41 ? 406  HIS A CA  1 
ATOM   3240 C C   . HIS A 1 406 ? 17.728  54.534 52.284 1.00 26.74 ? 406  HIS A C   1 
ATOM   3241 O O   . HIS A 1 406 ? 18.090  54.018 51.226 1.00 24.75 ? 406  HIS A O   1 
ATOM   3242 C CB  . HIS A 1 406 ? 17.709  53.301 54.473 1.00 27.25 ? 406  HIS A CB  1 
ATOM   3243 C CG  . HIS A 1 406 ? 17.504  51.958 53.839 1.00 31.03 ? 406  HIS A CG  1 
ATOM   3244 N ND1 . HIS A 1 406 ? 18.539  51.075 53.615 1.00 33.16 ? 406  HIS A ND1 1 
ATOM   3245 C CD2 . HIS A 1 406 ? 16.385  51.352 53.378 1.00 30.98 ? 406  HIS A CD2 1 
ATOM   3246 C CE1 . HIS A 1 406 ? 18.065  49.981 53.042 1.00 33.76 ? 406  HIS A CE1 1 
ATOM   3247 N NE2 . HIS A 1 406 ? 16.761  50.125 52.887 1.00 35.10 ? 406  HIS A NE2 1 
ATOM   3248 N N   . PHE A 1 407 ? 16.674  55.339 52.365 1.00 25.34 ? 407  PHE A N   1 
ATOM   3249 C CA  . PHE A 1 407 ? 15.881  55.672 51.191 1.00 26.58 ? 407  PHE A CA  1 
ATOM   3250 C C   . PHE A 1 407 ? 16.704  56.401 50.123 1.00 25.97 ? 407  PHE A C   1 
ATOM   3251 O O   . PHE A 1 407 ? 16.677  56.024 48.951 1.00 26.55 ? 407  PHE A O   1 
ATOM   3252 C CB  . PHE A 1 407 ? 14.689  56.557 51.585 1.00 24.85 ? 407  PHE A CB  1 
ATOM   3253 C CG  . PHE A 1 407 ? 13.841  56.981 50.417 1.00 26.64 ? 407  PHE A CG  1 
ATOM   3254 C CD1 . PHE A 1 407 ? 12.962  56.087 49.819 1.00 27.40 ? 407  PHE A CD1 1 
ATOM   3255 C CD2 . PHE A 1 407 ? 13.953  58.262 49.887 1.00 26.84 ? 407  PHE A CD2 1 
ATOM   3256 C CE1 . PHE A 1 407 ? 12.210  56.460 48.704 1.00 28.27 ? 407  PHE A CE1 1 
ATOM   3257 C CE2 . PHE A 1 407 ? 13.209  58.644 48.773 1.00 27.35 ? 407  PHE A CE2 1 
ATOM   3258 C CZ  . PHE A 1 407 ? 12.336  57.741 48.182 1.00 27.98 ? 407  PHE A CZ  1 
ATOM   3259 N N   A VAL A 1 408 ? 17.435  57.435 50.531 0.50 26.22 ? 408  VAL A N   1 
ATOM   3260 N N   B VAL A 1 408 ? 17.431  57.440 50.525 0.50 26.37 ? 408  VAL A N   1 
ATOM   3261 C CA  A VAL A 1 408 ? 18.218  58.203 49.564 0.50 28.10 ? 408  VAL A CA  1 
ATOM   3262 C CA  B VAL A 1 408 ? 18.235  58.208 49.588 0.50 27.84 ? 408  VAL A CA  1 
ATOM   3263 C C   A VAL A 1 408 ? 19.259  57.353 48.843 0.50 28.75 ? 408  VAL A C   1 
ATOM   3264 C C   B VAL A 1 408 ? 19.256  57.355 48.848 0.50 28.60 ? 408  VAL A C   1 
ATOM   3265 O O   A VAL A 1 408 ? 19.412  57.478 47.635 0.50 27.75 ? 408  VAL A O   1 
ATOM   3266 O O   B VAL A 1 408 ? 19.435  57.481 47.632 0.50 27.91 ? 408  VAL A O   1 
ATOM   3267 C CB  A VAL A 1 408 ? 18.910  59.419 50.228 0.50 29.99 ? 408  VAL A CB  1 
ATOM   3268 C CB  B VAL A 1 408 ? 18.979  59.382 50.283 0.50 29.57 ? 408  VAL A CB  1 
ATOM   3269 C CG1 A VAL A 1 408 ? 17.990  60.284 50.984 0.50 29.50 ? 408  VAL A CG1 1 
ATOM   3270 C CG1 B VAL A 1 408 ? 20.003  58.859 51.265 0.50 30.77 ? 408  VAL A CG1 1 
ATOM   3271 C CG2 A VAL A 1 408 ? 19.937  58.960 51.241 0.50 30.76 ? 408  VAL A CG2 1 
ATOM   3272 C CG2 B VAL A 1 408 ? 19.555  60.292 49.160 0.50 30.81 ? 408  VAL A CG2 1 
ATOM   3273 N N   . ASN A 1 409 ? 19.943  56.480 49.575 1.00 29.27 ? 409  ASN A N   1 
ATOM   3274 C CA  . ASN A 1 409 ? 20.950  55.629 48.959 1.00 30.93 ? 409  ASN A CA  1 
ATOM   3275 C C   . ASN A 1 409 ? 20.341  54.601 48.003 1.00 30.74 ? 409  ASN A C   1 
ATOM   3276 O O   . ASN A 1 409 ? 20.891  54.345 46.935 1.00 31.27 ? 409  ASN A O   1 
ATOM   3277 C CB  . ASN A 1 409 ? 21.805  54.962 50.041 1.00 32.26 ? 409  ASN A CB  1 
ATOM   3278 C CG  . ASN A 1 409 ? 22.885  55.894 50.575 1.00 34.61 ? 409  ASN A CG  1 
ATOM   3279 O OD1 . ASN A 1 409 ? 23.807  56.269 49.847 1.00 37.97 ? 409  ASN A OD1 1 
ATOM   3280 N ND2 . ASN A 1 409 ? 22.769  56.282 51.838 1.00 35.77 ? 409  ASN A ND2 1 
ATOM   3281 N N   . LYS A 1 410 ? 19.195  54.033 48.366 1.00 29.14 ? 410  LYS A N   1 
ATOM   3282 C CA  . LYS A 1 410 ? 18.540  53.060 47.494 1.00 30.22 ? 410  LYS A CA  1 
ATOM   3283 C C   . LYS A 1 410 ? 17.959  53.751 46.259 1.00 28.95 ? 410  LYS A C   1 
ATOM   3284 O O   . LYS A 1 410 ? 18.037  53.233 45.142 1.00 27.70 ? 410  LYS A O   1 
ATOM   3285 C CB  . LYS A 1 410 ? 17.412  52.335 48.237 1.00 31.19 ? 410  LYS A CB  1 
ATOM   3286 C CG  . LYS A 1 410 ? 17.881  51.335 49.287 1.00 34.83 ? 410  LYS A CG  1 
ATOM   3287 C CD  . LYS A 1 410 ? 18.619  50.164 48.648 1.00 37.77 ? 410  LYS A CD  1 
ATOM   3288 C CE  . LYS A 1 410 ? 19.082  49.166 49.697 1.00 41.40 ? 410  LYS A CE  1 
ATOM   3289 N NZ  . LYS A 1 410 ? 19.780  47.999 49.082 1.00 42.29 ? 410  LYS A NZ  1 
ATOM   3290 N N   . TYR A 1 411 ? 17.381  54.929 46.465 1.00 27.43 ? 411  TYR A N   1 
ATOM   3291 C CA  . TYR A 1 411 ? 16.769  55.670 45.370 1.00 27.47 ? 411  TYR A CA  1 
ATOM   3292 C C   . TYR A 1 411 ? 17.782  56.175 44.348 1.00 27.67 ? 411  TYR A C   1 
ATOM   3293 O O   . TYR A 1 411 ? 17.587  56.037 43.136 1.00 28.10 ? 411  TYR A O   1 
ATOM   3294 C CB  . TYR A 1 411 ? 15.976  56.870 45.908 1.00 27.35 ? 411  TYR A CB  1 
ATOM   3295 C CG  . TYR A 1 411 ? 15.130  57.524 44.839 1.00 26.15 ? 411  TYR A CG  1 
ATOM   3296 C CD1 . TYR A 1 411 ? 13.844  57.056 44.567 1.00 26.94 ? 411  TYR A CD1 1 
ATOM   3297 C CD2 . TYR A 1 411 ? 15.649  58.540 44.034 1.00 25.53 ? 411  TYR A CD2 1 
ATOM   3298 C CE1 . TYR A 1 411 ? 13.096  57.572 43.518 1.00 26.41 ? 411  TYR A CE1 1 
ATOM   3299 C CE2 . TYR A 1 411 ? 14.908  59.067 42.976 1.00 26.95 ? 411  TYR A CE2 1 
ATOM   3300 C CZ  . TYR A 1 411 ? 13.633  58.573 42.723 1.00 26.64 ? 411  TYR A CZ  1 
ATOM   3301 O OH  . TYR A 1 411 ? 12.907  59.049 41.657 1.00 28.76 ? 411  TYR A OH  1 
ATOM   3302 N N   . THR A 1 412 ? 18.863  56.761 44.846 1.00 27.54 ? 412  THR A N   1 
ATOM   3303 C CA  . THR A 1 412 ? 19.902  57.331 43.999 1.00 30.58 ? 412  THR A CA  1 
ATOM   3304 C C   . THR A 1 412 ? 20.512  56.361 42.989 1.00 31.68 ? 412  THR A C   1 
ATOM   3305 O O   . THR A 1 412 ? 21.052  56.782 41.969 1.00 32.43 ? 412  THR A O   1 
ATOM   3306 C CB  . THR A 1 412 ? 21.006  57.958 44.878 1.00 30.59 ? 412  THR A CB  1 
ATOM   3307 O OG1 . THR A 1 412 ? 20.421  58.989 45.688 1.00 31.54 ? 412  THR A OG1 1 
ATOM   3308 C CG2 . THR A 1 412 ? 22.106  58.575 44.021 1.00 31.29 ? 412  THR A CG2 1 
ATOM   3309 N N   . LYS A 1 413 ? 20.421  55.067 43.265 1.00 31.94 ? 413  LYS A N   1 
ATOM   3310 C CA  . LYS A 1 413 ? 20.959  54.071 42.350 1.00 34.64 ? 413  LYS A CA  1 
ATOM   3311 C C   . LYS A 1 413 ? 20.166  54.036 41.039 1.00 34.89 ? 413  LYS A C   1 
ATOM   3312 O O   . LYS A 1 413 ? 20.722  53.745 39.979 1.00 34.83 ? 413  LYS A O   1 
ATOM   3313 C CB  . LYS A 1 413 ? 20.924  52.681 42.994 1.00 36.80 ? 413  LYS A CB  1 
ATOM   3314 C CG  . LYS A 1 413 ? 21.351  51.569 42.047 1.00 43.58 ? 413  LYS A CG  1 
ATOM   3315 C CD  . LYS A 1 413 ? 21.285  50.191 42.693 1.00 46.35 ? 413  LYS A CD  1 
ATOM   3316 C CE  . LYS A 1 413 ? 21.670  49.111 41.685 1.00 49.17 ? 413  LYS A CE  1 
ATOM   3317 N NZ  . LYS A 1 413 ? 21.556  47.732 42.240 1.00 50.24 ? 413  LYS A NZ  1 
ATOM   3318 N N   . PHE A 1 414 ? 18.872  54.340 41.116 1.00 31.59 ? 414  PHE A N   1 
ATOM   3319 C CA  . PHE A 1 414 ? 18.000  54.309 39.940 1.00 31.75 ? 414  PHE A CA  1 
ATOM   3320 C C   . PHE A 1 414 ? 17.456  55.671 39.504 1.00 30.96 ? 414  PHE A C   1 
ATOM   3321 O O   . PHE A 1 414 ? 17.040  55.834 38.355 1.00 31.82 ? 414  PHE A O   1 
ATOM   3322 C CB  . PHE A 1 414 ? 16.808  53.388 40.208 1.00 32.11 ? 414  PHE A CB  1 
ATOM   3323 C CG  . PHE A 1 414 ? 17.168  51.933 40.330 1.00 35.24 ? 414  PHE A CG  1 
ATOM   3324 C CD1 . PHE A 1 414 ? 17.273  51.129 39.197 1.00 36.88 ? 414  PHE A CD1 1 
ATOM   3325 C CD2 . PHE A 1 414 ? 17.390  51.361 41.578 1.00 35.29 ? 414  PHE A CD2 1 
ATOM   3326 C CE1 . PHE A 1 414 ? 17.583  49.773 39.309 1.00 37.58 ? 414  PHE A CE1 1 
ATOM   3327 C CE2 . PHE A 1 414 ? 17.702  50.006 41.700 1.00 36.30 ? 414  PHE A CE2 1 
ATOM   3328 C CZ  . PHE A 1 414 ? 17.800  49.212 40.564 1.00 37.11 ? 414  PHE A CZ  1 
ATOM   3329 N N   . GLY A 1 415 ? 17.455  56.636 40.420 1.00 30.74 ? 415  GLY A N   1 
ATOM   3330 C CA  . GLY A 1 415 ? 16.920  57.961 40.137 1.00 29.70 ? 415  GLY A CA  1 
ATOM   3331 C C   . GLY A 1 415 ? 17.674  58.830 39.149 1.00 29.72 ? 415  GLY A C   1 
ATOM   3332 O O   . GLY A 1 415 ? 18.733  58.451 38.657 1.00 27.45 ? 415  GLY A O   1 
ATOM   3333 N N   . ASN A 1 416 ? 17.127  60.014 38.881 1.00 29.82 ? 416  ASN A N   1 
ATOM   3334 C CA  . ASN A 1 416 ? 17.722  60.949 37.928 1.00 30.45 ? 416  ASN A CA  1 
ATOM   3335 C C   . ASN A 1 416 ? 18.321  62.205 38.565 1.00 30.76 ? 416  ASN A C   1 
ATOM   3336 O O   . ASN A 1 416 ? 18.572  63.194 37.878 1.00 31.54 ? 416  ASN A O   1 
ATOM   3337 C CB  . ASN A 1 416 ? 16.671  61.353 36.887 1.00 32.47 ? 416  ASN A CB  1 
ATOM   3338 C CG  . ASN A 1 416 ? 17.267  62.115 35.717 1.00 33.75 ? 416  ASN A CG  1 
ATOM   3339 O OD1 . ASN A 1 416 ? 16.757  63.168 35.329 1.00 32.39 ? 416  ASN A OD1 1 
ATOM   3340 N ND2 . ASN A 1 416 ? 18.344  61.583 35.149 1.00 34.70 ? 416  ASN A ND2 1 
ATOM   3341 N N   . GLY A 1 417 ? 18.558  62.175 39.872 1.00 29.36 ? 417  GLY A N   1 
ATOM   3342 C CA  . GLY A 1 417 ? 19.139  63.339 40.518 1.00 28.90 ? 417  GLY A CA  1 
ATOM   3343 C C   . GLY A 1 417 ? 18.647  63.521 41.938 1.00 28.73 ? 417  GLY A C   1 
ATOM   3344 O O   . GLY A 1 417 ? 17.449  63.674 42.170 1.00 29.38 ? 417  GLY A O   1 
ATOM   3345 N N   . THR A 1 418 ? 19.577  63.516 42.885 1.00 27.74 ? 418  THR A N   1 
ATOM   3346 C CA  . THR A 1 418 ? 19.237  63.656 44.294 1.00 26.62 ? 418  THR A CA  1 
ATOM   3347 C C   . THR A 1 418 ? 19.971  64.822 44.946 1.00 27.21 ? 418  THR A C   1 
ATOM   3348 O O   . THR A 1 418 ? 21.179  64.987 44.753 1.00 28.00 ? 418  THR A O   1 
ATOM   3349 C CB  . THR A 1 418 ? 19.594  62.366 45.071 1.00 25.72 ? 418  THR A CB  1 
ATOM   3350 O OG1 . THR A 1 418 ? 18.904  61.250 44.493 1.00 28.97 ? 418  THR A OG1 1 
ATOM   3351 C CG2 . THR A 1 418 ? 19.201  62.495 46.548 1.00 25.16 ? 418  THR A CG2 1 
ATOM   3352 N N   . TYR A 1 419 ? 19.232  65.623 45.713 1.00 25.41 ? 419  TYR A N   1 
ATOM   3353 C CA  . TYR A 1 419 ? 19.793  66.757 46.447 1.00 25.71 ? 419  TYR A CA  1 
ATOM   3354 C C   . TYR A 1 419 ? 19.396  66.569 47.904 1.00 25.16 ? 419  TYR A C   1 
ATOM   3355 O O   . TYR A 1 419 ? 18.209  66.486 48.219 1.00 25.97 ? 419  TYR A O   1 
ATOM   3356 C CB  . TYR A 1 419 ? 19.240  68.080 45.912 1.00 25.98 ? 419  TYR A CB  1 
ATOM   3357 C CG  . TYR A 1 419 ? 19.710  68.363 44.507 1.00 26.01 ? 419  TYR A CG  1 
ATOM   3358 C CD1 . TYR A 1 419 ? 20.949  68.956 44.275 1.00 28.75 ? 419  TYR A CD1 1 
ATOM   3359 C CD2 . TYR A 1 419 ? 18.949  67.972 43.408 1.00 28.05 ? 419  TYR A CD2 1 
ATOM   3360 C CE1 . TYR A 1 419 ? 21.424  69.151 42.979 1.00 29.05 ? 419  TYR A CE1 1 
ATOM   3361 C CE2 . TYR A 1 419 ? 19.410  68.159 42.113 1.00 27.85 ? 419  TYR A CE2 1 
ATOM   3362 C CZ  . TYR A 1 419 ? 20.651  68.748 41.906 1.00 30.10 ? 419  TYR A CZ  1 
ATOM   3363 O OH  . TYR A 1 419 ? 21.119  68.924 40.624 1.00 29.05 ? 419  TYR A OH  1 
ATOM   3364 N N   . LEU A 1 420 ? 20.396  66.511 48.779 1.00 23.89 ? 420  LEU A N   1 
ATOM   3365 C CA  . LEU A 1 420 ? 20.174  66.281 50.202 1.00 24.72 ? 420  LEU A CA  1 
ATOM   3366 C C   . LEU A 1 420 ? 20.585  67.457 51.085 1.00 25.58 ? 420  LEU A C   1 
ATOM   3367 O O   . LEU A 1 420 ? 21.615  68.095 50.846 1.00 24.85 ? 420  LEU A O   1 
ATOM   3368 C CB  . LEU A 1 420 ? 20.947  65.024 50.616 1.00 24.37 ? 420  LEU A CB  1 
ATOM   3369 C CG  . LEU A 1 420 ? 20.869  64.543 52.065 1.00 26.33 ? 420  LEU A CG  1 
ATOM   3370 C CD1 . LEU A 1 420 ? 19.438  64.117 52.391 1.00 25.04 ? 420  LEU A CD1 1 
ATOM   3371 C CD2 . LEU A 1 420 ? 21.834  63.384 52.255 1.00 24.63 ? 420  LEU A CD2 1 
ATOM   3372 N N   . TYR A 1 421 ? 19.783  67.738 52.109 1.00 25.28 ? 421  TYR A N   1 
ATOM   3373 C CA  . TYR A 1 421 ? 20.082  68.837 53.026 1.00 24.60 ? 421  TYR A CA  1 
ATOM   3374 C C   . TYR A 1 421 ? 19.970  68.439 54.495 1.00 25.69 ? 421  TYR A C   1 
ATOM   3375 O O   . TYR A 1 421 ? 19.288  67.475 54.842 1.00 25.85 ? 421  TYR A O   1 
ATOM   3376 C CB  . TYR A 1 421 ? 19.144  70.025 52.764 1.00 24.97 ? 421  TYR A CB  1 
ATOM   3377 C CG  . TYR A 1 421 ? 17.718  69.815 53.247 1.00 23.47 ? 421  TYR A CG  1 
ATOM   3378 C CD1 . TYR A 1 421 ? 17.393  69.904 54.604 1.00 25.51 ? 421  TYR A CD1 1 
ATOM   3379 C CD2 . TYR A 1 421 ? 16.698  69.509 52.347 1.00 24.61 ? 421  TYR A CD2 1 
ATOM   3380 C CE1 . TYR A 1 421 ? 16.079  69.689 55.050 1.00 24.17 ? 421  TYR A CE1 1 
ATOM   3381 C CE2 . TYR A 1 421 ? 15.385  69.293 52.780 1.00 23.74 ? 421  TYR A CE2 1 
ATOM   3382 C CZ  . TYR A 1 421 ? 15.086  69.383 54.128 1.00 24.58 ? 421  TYR A CZ  1 
ATOM   3383 O OH  . TYR A 1 421 ? 13.792  69.148 54.553 1.00 25.44 ? 421  TYR A OH  1 
ATOM   3384 N N   . PHE A 1 422 ? 20.649  69.208 55.343 1.00 24.87 ? 422  PHE A N   1 
ATOM   3385 C CA  . PHE A 1 422 ? 20.635  69.027 56.792 1.00 26.21 ? 422  PHE A CA  1 
ATOM   3386 C C   . PHE A 1 422 ? 20.321  70.414 57.353 1.00 27.26 ? 422  PHE A C   1 
ATOM   3387 O O   . PHE A 1 422 ? 21.181  71.300 57.345 1.00 27.25 ? 422  PHE A O   1 
ATOM   3388 C CB  . PHE A 1 422 ? 22.006  68.567 57.293 1.00 26.06 ? 422  PHE A CB  1 
ATOM   3389 C CG  . PHE A 1 422 ? 22.051  68.286 58.769 1.00 27.79 ? 422  PHE A CG  1 
ATOM   3390 C CD1 . PHE A 1 422 ? 21.425  67.158 59.294 1.00 27.49 ? 422  PHE A CD1 1 
ATOM   3391 C CD2 . PHE A 1 422 ? 22.729  69.141 59.632 1.00 27.57 ? 422  PHE A CD2 1 
ATOM   3392 C CE1 . PHE A 1 422 ? 21.476  66.881 60.666 1.00 29.84 ? 422  PHE A CE1 1 
ATOM   3393 C CE2 . PHE A 1 422 ? 22.787  68.876 61.003 1.00 30.17 ? 422  PHE A CE2 1 
ATOM   3394 C CZ  . PHE A 1 422 ? 22.159  67.743 61.523 1.00 29.96 ? 422  PHE A CZ  1 
ATOM   3395 N N   . PHE A 1 423 ? 19.085  70.602 57.812 1.00 25.55 ? 423  PHE A N   1 
ATOM   3396 C CA  . PHE A 1 423 ? 18.635  71.882 58.359 1.00 25.27 ? 423  PHE A CA  1 
ATOM   3397 C C   . PHE A 1 423 ? 19.026  71.974 59.827 1.00 27.12 ? 423  PHE A C   1 
ATOM   3398 O O   . PHE A 1 423 ? 18.531  71.198 60.646 1.00 25.48 ? 423  PHE A O   1 
ATOM   3399 C CB  . PHE A 1 423 ? 17.111  71.989 58.225 1.00 25.34 ? 423  PHE A CB  1 
ATOM   3400 C CG  . PHE A 1 423 ? 16.545  73.301 58.682 1.00 26.95 ? 423  PHE A CG  1 
ATOM   3401 C CD1 . PHE A 1 423 ? 16.624  74.430 57.873 1.00 27.39 ? 423  PHE A CD1 1 
ATOM   3402 C CD2 . PHE A 1 423 ? 15.949  73.413 59.936 1.00 26.65 ? 423  PHE A CD2 1 
ATOM   3403 C CE1 . PHE A 1 423 ? 16.105  75.651 58.305 1.00 27.00 ? 423  PHE A CE1 1 
ATOM   3404 C CE2 . PHE A 1 423 ? 15.428  74.628 60.375 1.00 27.73 ? 423  PHE A CE2 1 
ATOM   3405 C CZ  . PHE A 1 423 ? 15.511  75.751 59.559 1.00 27.14 ? 423  PHE A CZ  1 
ATOM   3406 N N   . ASN A 1 424 ? 19.900  72.921 60.170 1.00 26.82 ? 424  ASN A N   1 
ATOM   3407 C CA  . ASN A 1 424 ? 20.334  73.035 61.558 1.00 29.23 ? 424  ASN A CA  1 
ATOM   3408 C C   . ASN A 1 424 ? 20.325  74.438 62.154 1.00 31.43 ? 424  ASN A C   1 
ATOM   3409 O O   . ASN A 1 424 ? 21.183  74.781 62.973 1.00 31.48 ? 424  ASN A O   1 
ATOM   3410 C CB  . ASN A 1 424 ? 21.721  72.388 61.732 1.00 29.78 ? 424  ASN A CB  1 
ATOM   3411 C CG  . ASN A 1 424 ? 22.797  73.038 60.874 1.00 31.99 ? 424  ASN A CG  1 
ATOM   3412 O OD1 . ASN A 1 424 ? 22.510  73.809 59.959 1.00 30.68 ? 424  ASN A OD1 1 
ATOM   3413 N ND2 . ASN A 1 424 ? 24.052  72.709 61.162 1.00 33.97 ? 424  ASN A ND2 1 
ATOM   3414 N N   . HIS A 1 425 ? 19.343  75.242 61.760 1.00 30.74 ? 425  HIS A N   1 
ATOM   3415 C CA  . HIS A 1 425 ? 19.217  76.587 62.299 1.00 32.44 ? 425  HIS A CA  1 
ATOM   3416 C C   . HIS A 1 425 ? 18.048  76.646 63.275 1.00 33.01 ? 425  HIS A C   1 
ATOM   3417 O O   . HIS A 1 425 ? 16.916  76.315 62.918 1.00 32.93 ? 425  HIS A O   1 
ATOM   3418 C CB  . HIS A 1 425 ? 18.969  77.615 61.189 1.00 32.10 ? 425  HIS A CB  1 
ATOM   3419 C CG  . HIS A 1 425 ? 18.695  78.995 61.707 1.00 33.28 ? 425  HIS A CG  1 
ATOM   3420 N ND1 . HIS A 1 425 ? 19.676  79.790 62.262 1.00 34.53 ? 425  HIS A ND1 1 
ATOM   3421 C CD2 . HIS A 1 425 ? 17.542  79.694 61.813 1.00 35.12 ? 425  HIS A CD2 1 
ATOM   3422 C CE1 . HIS A 1 425 ? 19.137  80.917 62.690 1.00 34.23 ? 425  HIS A CE1 1 
ATOM   3423 N NE2 . HIS A 1 425 ? 17.841  80.886 62.431 1.00 33.84 ? 425  HIS A NE2 1 
ATOM   3424 N N   . ARG A 1 426 ? 18.310  77.058 64.509 1.00 33.35 ? 426  ARG A N   1 
ATOM   3425 C CA  . ARG A 1 426 ? 17.219  77.182 65.463 1.00 34.17 ? 426  ARG A CA  1 
ATOM   3426 C C   . ARG A 1 426 ? 16.700  78.612 65.354 1.00 34.20 ? 426  ARG A C   1 
ATOM   3427 O O   . ARG A 1 426 ? 17.463  79.561 65.504 1.00 34.02 ? 426  ARG A O   1 
ATOM   3428 C CB  . ARG A 1 426 ? 17.685  76.909 66.892 1.00 36.65 ? 426  ARG A CB  1 
ATOM   3429 C CG  . ARG A 1 426 ? 16.540  76.996 67.891 1.00 36.70 ? 426  ARG A CG  1 
ATOM   3430 C CD  . ARG A 1 426 ? 17.008  76.819 69.306 1.00 36.34 ? 426  ARG A CD  1 
ATOM   3431 N NE  . ARG A 1 426 ? 16.039  77.354 70.254 1.00 37.46 ? 426  ARG A NE  1 
ATOM   3432 C CZ  . ARG A 1 426 ? 15.104  76.641 70.874 1.00 36.49 ? 426  ARG A CZ  1 
ATOM   3433 N NH1 . ARG A 1 426 ? 14.989  75.332 70.658 1.00 31.04 ? 426  ARG A NH1 1 
ATOM   3434 N NH2 . ARG A 1 426 ? 14.285  77.242 71.725 1.00 36.29 ? 426  ARG A NH2 1 
ATOM   3435 N N   . ALA A 1 427 ? 15.406  78.757 65.084 1.00 34.03 ? 427  ALA A N   1 
ATOM   3436 C CA  . ALA A 1 427 ? 14.791  80.075 64.936 1.00 34.93 ? 427  ALA A CA  1 
ATOM   3437 C C   . ALA A 1 427 ? 14.960  80.936 66.185 1.00 35.82 ? 427  ALA A C   1 
ATOM   3438 O O   . ALA A 1 427 ? 14.791  80.466 67.312 1.00 36.20 ? 427  ALA A O   1 
ATOM   3439 C CB  . ALA A 1 427 ? 13.307  79.925 64.598 1.00 34.88 ? 427  ALA A CB  1 
ATOM   3440 N N   . SER A 1 428 ? 15.280  82.207 65.968 1.00 34.98 ? 428  SER A N   1 
ATOM   3441 C CA  . SER A 1 428 ? 15.491  83.153 67.054 1.00 35.98 ? 428  SER A CA  1 
ATOM   3442 C C   . SER A 1 428 ? 14.245  83.410 67.898 1.00 36.50 ? 428  SER A C   1 
ATOM   3443 O O   . SER A 1 428 ? 14.349  83.817 69.053 1.00 37.21 ? 428  SER A O   1 
ATOM   3444 C CB  . SER A 1 428 ? 15.992  84.483 66.483 1.00 36.70 ? 428  SER A CB  1 
ATOM   3445 O OG  . SER A 1 428 ? 15.019  85.049 65.618 1.00 36.46 ? 428  SER A OG  1 
ATOM   3446 N N   . ASN A 1 429 ? 13.069  83.165 67.328 1.00 36.75 ? 429  ASN A N   1 
ATOM   3447 C CA  . ASN A 1 429 ? 11.814  83.415 68.030 1.00 37.03 ? 429  ASN A CA  1 
ATOM   3448 C C   . ASN A 1 429 ? 11.048  82.175 68.497 1.00 37.15 ? 429  ASN A C   1 
ATOM   3449 O O   . ASN A 1 429 ? 9.842   82.248 68.741 1.00 37.42 ? 429  ASN A O   1 
ATOM   3450 C CB  . ASN A 1 429 ? 10.894  84.248 67.137 1.00 37.62 ? 429  ASN A CB  1 
ATOM   3451 C CG  . ASN A 1 429 ? 10.708  83.627 65.766 1.00 39.18 ? 429  ASN A CG  1 
ATOM   3452 O OD1 . ASN A 1 429 ? 10.978  82.440 65.572 1.00 36.95 ? 429  ASN A OD1 1 
ATOM   3453 N ND2 . ASN A 1 429 ? 10.237  84.422 64.810 1.00 39.39 ? 429  ASN A ND2 1 
ATOM   3454 N N   A LEU A 1 430 ? 11.742  81.050 68.626 0.50 36.41 ? 430  LEU A N   1 
ATOM   3455 N N   B LEU A 1 430 ? 11.737  81.046 68.621 0.50 36.50 ? 430  LEU A N   1 
ATOM   3456 C CA  A LEU A 1 430 ? 11.082  79.818 69.062 0.50 37.05 ? 430  LEU A CA  1 
ATOM   3457 C CA  B LEU A 1 430 ? 11.100  79.809 69.058 0.50 36.91 ? 430  LEU A CA  1 
ATOM   3458 C C   A LEU A 1 430 ? 10.642  79.921 70.515 0.50 36.60 ? 430  LEU A C   1 
ATOM   3459 C C   B LEU A 1 430 ? 10.650  79.907 70.516 0.50 36.52 ? 430  LEU A C   1 
ATOM   3460 O O   A LEU A 1 430 ? 11.389  80.402 71.366 0.50 36.41 ? 430  LEU A O   1 
ATOM   3461 O O   B LEU A 1 430 ? 11.376  80.432 71.362 0.50 36.48 ? 430  LEU A O   1 
ATOM   3462 C CB  A LEU A 1 430 ? 12.019  78.621 68.896 0.50 37.85 ? 430  LEU A CB  1 
ATOM   3463 C CB  B LEU A 1 430 ? 12.073  78.638 68.892 0.50 37.48 ? 430  LEU A CB  1 
ATOM   3464 C CG  A LEU A 1 430 ? 12.319  78.196 67.457 0.50 38.63 ? 430  LEU A CG  1 
ATOM   3465 C CG  B LEU A 1 430 ? 11.481  77.232 68.993 0.50 38.08 ? 430  LEU A CG  1 
ATOM   3466 C CD1 A LEU A 1 430 ? 13.224  76.984 67.469 0.50 38.71 ? 430  LEU A CD1 1 
ATOM   3467 C CD1 B LEU A 1 430 ? 10.505  77.007 67.854 0.50 38.11 ? 430  LEU A CD1 1 
ATOM   3468 C CD2 A LEU A 1 430 ? 11.027  77.878 66.732 0.50 39.32 ? 430  LEU A CD2 1 
ATOM   3469 C CD2 B LEU A 1 430 ? 12.593  76.202 68.939 0.50 38.48 ? 430  LEU A CD2 1 
ATOM   3470 N N   . VAL A 1 431 ? 9.440   79.430 70.801 1.00 35.39 ? 431  VAL A N   1 
ATOM   3471 C CA  . VAL A 1 431 ? 8.902   79.470 72.157 1.00 35.27 ? 431  VAL A CA  1 
ATOM   3472 C C   . VAL A 1 431 ? 9.189   78.188 72.935 1.00 33.31 ? 431  VAL A C   1 
ATOM   3473 O O   . VAL A 1 431 ? 8.985   78.127 74.149 1.00 32.11 ? 431  VAL A O   1 
ATOM   3474 C CB  . VAL A 1 431 ? 7.378   79.728 72.138 1.00 36.34 ? 431  VAL A CB  1 
ATOM   3475 C CG1 . VAL A 1 431 ? 7.095   81.056 71.448 1.00 38.15 ? 431  VAL A CG1 1 
ATOM   3476 C CG2 . VAL A 1 431 ? 6.660   78.597 71.415 1.00 38.07 ? 431  VAL A CG2 1 
ATOM   3477 N N   . TRP A 1 432 ? 9.655   77.163 72.229 1.00 31.71 ? 432  TRP A N   1 
ATOM   3478 C CA  . TRP A 1 432 ? 10.001  75.892 72.862 1.00 30.62 ? 432  TRP A CA  1 
ATOM   3479 C C   . TRP A 1 432 ? 11.360  76.068 73.543 1.00 29.90 ? 432  TRP A C   1 
ATOM   3480 O O   . TRP A 1 432 ? 12.159  76.908 73.127 1.00 30.89 ? 432  TRP A O   1 
ATOM   3481 C CB  . TRP A 1 432 ? 10.092  74.773 71.817 1.00 28.43 ? 432  TRP A CB  1 
ATOM   3482 C CG  . TRP A 1 432 ? 8.763   74.371 71.227 1.00 28.29 ? 432  TRP A CG  1 
ATOM   3483 C CD1 . TRP A 1 432 ? 8.294   74.660 69.975 1.00 28.95 ? 432  TRP A CD1 1 
ATOM   3484 C CD2 . TRP A 1 432 ? 7.740   73.598 71.870 1.00 28.02 ? 432  TRP A CD2 1 
ATOM   3485 N NE1 . TRP A 1 432 ? 7.043   74.112 69.798 1.00 28.40 ? 432  TRP A NE1 1 
ATOM   3486 C CE2 . TRP A 1 432 ? 6.679   73.454 70.945 1.00 30.00 ? 432  TRP A CE2 1 
ATOM   3487 C CE3 . TRP A 1 432 ? 7.616   73.011 73.137 1.00 28.02 ? 432  TRP A CE3 1 
ATOM   3488 C CZ2 . TRP A 1 432 ? 5.509   72.746 71.249 1.00 27.86 ? 432  TRP A CZ2 1 
ATOM   3489 C CZ3 . TRP A 1 432 ? 6.454   72.305 73.439 1.00 29.96 ? 432  TRP A CZ3 1 
ATOM   3490 C CH2 . TRP A 1 432 ? 5.416   72.179 72.495 1.00 31.91 ? 432  TRP A CH2 1 
ATOM   3491 N N   . PRO A 1 433 ? 11.640  75.280 74.596 1.00 29.05 ? 433  PRO A N   1 
ATOM   3492 C CA  . PRO A 1 433 ? 12.915  75.378 75.312 1.00 29.22 ? 433  PRO A CA  1 
ATOM   3493 C C   . PRO A 1 433 ? 14.141  75.093 74.444 1.00 30.25 ? 433  PRO A C   1 
ATOM   3494 O O   . PRO A 1 433 ? 14.052  74.425 73.413 1.00 29.48 ? 433  PRO A O   1 
ATOM   3495 C CB  . PRO A 1 433 ? 12.750  74.367 76.447 1.00 29.27 ? 433  PRO A CB  1 
ATOM   3496 C CG  . PRO A 1 433 ? 11.827  73.336 75.848 1.00 27.86 ? 433  PRO A CG  1 
ATOM   3497 C CD  . PRO A 1 433 ? 10.802  74.209 75.166 1.00 27.89 ? 433  PRO A CD  1 
ATOM   3498 N N   . GLU A 1 434 ? 15.285  75.607 74.885 1.00 29.59 ? 434  GLU A N   1 
ATOM   3499 C CA  . GLU A 1 434 ? 16.548  75.445 74.178 1.00 30.96 ? 434  GLU A CA  1 
ATOM   3500 C C   . GLU A 1 434 ? 17.007  73.998 74.031 1.00 28.93 ? 434  GLU A C   1 
ATOM   3501 O O   . GLU A 1 434 ? 17.598  73.642 73.012 1.00 29.07 ? 434  GLU A O   1 
ATOM   3502 C CB  . GLU A 1 434 ? 17.654  76.248 74.879 1.00 33.35 ? 434  GLU A CB  1 
ATOM   3503 C CG  . GLU A 1 434 ? 17.528  77.753 74.714 1.00 37.45 ? 434  GLU A CG  1 
ATOM   3504 C CD  . GLU A 1 434 ? 17.675  78.196 73.269 1.00 40.50 ? 434  GLU A CD  1 
ATOM   3505 N N   . TRP A 1 435 ? 16.741  73.165 75.036 1.00 28.80 ? 435  TRP A N   1 
ATOM   3506 C CA  . TRP A 1 435 ? 17.181  71.773 74.967 1.00 27.50 ? 435  TRP A CA  1 
ATOM   3507 C C   . TRP A 1 435 ? 16.610  71.009 73.770 1.00 27.64 ? 435  TRP A C   1 
ATOM   3508 O O   . TRP A 1 435 ? 17.213  70.047 73.293 1.00 26.19 ? 435  TRP A O   1 
ATOM   3509 C CB  . TRP A 1 435 ? 16.865  71.017 76.273 1.00 28.63 ? 435  TRP A CB  1 
ATOM   3510 C CG  . TRP A 1 435 ? 15.414  70.678 76.553 1.00 28.08 ? 435  TRP A CG  1 
ATOM   3511 C CD1 . TRP A 1 435 ? 14.562  71.336 77.400 1.00 28.99 ? 435  TRP A CD1 1 
ATOM   3512 C CD2 . TRP A 1 435 ? 14.674  69.557 76.036 1.00 29.03 ? 435  TRP A CD2 1 
ATOM   3513 N NE1 . TRP A 1 435 ? 13.341  70.691 77.447 1.00 29.17 ? 435  TRP A NE1 1 
ATOM   3514 C CE2 . TRP A 1 435 ? 13.385  69.600 76.619 1.00 28.24 ? 435  TRP A CE2 1 
ATOM   3515 C CE3 . TRP A 1 435 ? 14.977  68.523 75.138 1.00 27.79 ? 435  TRP A CE3 1 
ATOM   3516 C CZ2 . TRP A 1 435 ? 12.400  68.647 76.332 1.00 29.81 ? 435  TRP A CZ2 1 
ATOM   3517 C CZ3 . TRP A 1 435 ? 13.997  67.573 74.853 1.00 30.31 ? 435  TRP A CZ3 1 
ATOM   3518 C CH2 . TRP A 1 435 ? 12.722  67.644 75.450 1.00 28.88 ? 435  TRP A CH2 1 
ATOM   3519 N N   . MET A 1 436 ? 15.461  71.446 73.271 1.00 26.80 ? 436  MET A N   1 
ATOM   3520 C CA  . MET A 1 436 ? 14.842  70.774 72.133 1.00 27.05 ? 436  MET A CA  1 
ATOM   3521 C C   . MET A 1 436 ? 15.538  71.048 70.798 1.00 27.10 ? 436  MET A C   1 
ATOM   3522 O O   . MET A 1 436 ? 15.281  70.358 69.810 1.00 26.40 ? 436  MET A O   1 
ATOM   3523 C CB  . MET A 1 436 ? 13.360  71.145 72.056 1.00 25.45 ? 436  MET A CB  1 
ATOM   3524 C CG  . MET A 1 436 ? 12.559  70.601 73.233 1.00 26.12 ? 436  MET A CG  1 
ATOM   3525 S SD  . MET A 1 436 ? 10.839  71.114 73.214 1.00 28.35 ? 436  MET A SD  1 
ATOM   3526 C CE  . MET A 1 436 ? 10.166  70.011 71.926 1.00 28.21 ? 436  MET A CE  1 
ATOM   3527 N N   . GLY A 1 437 ? 16.412  72.052 70.770 1.00 26.91 ? 437  GLY A N   1 
ATOM   3528 C CA  . GLY A 1 437 ? 17.162  72.369 69.560 1.00 27.29 ? 437  GLY A CA  1 
ATOM   3529 C C   . GLY A 1 437 ? 16.396  72.734 68.297 1.00 27.12 ? 437  GLY A C   1 
ATOM   3530 O O   . GLY A 1 437 ? 15.464  73.540 68.330 1.00 28.33 ? 437  GLY A O   1 
ATOM   3531 N N   . VAL A 1 438 ? 16.816  72.154 67.174 1.00 27.25 ? 438  VAL A N   1 
ATOM   3532 C CA  . VAL A 1 438 ? 16.192  72.392 65.872 1.00 26.94 ? 438  VAL A CA  1 
ATOM   3533 C C   . VAL A 1 438 ? 15.119  71.321 65.720 1.00 26.96 ? 438  VAL A C   1 
ATOM   3534 O O   . VAL A 1 438 ? 15.354  70.227 65.200 1.00 25.88 ? 438  VAL A O   1 
ATOM   3535 C CB  . VAL A 1 438 ? 17.229  72.280 64.753 1.00 27.67 ? 438  VAL A CB  1 
ATOM   3536 C CG1 . VAL A 1 438 ? 16.588  72.612 63.405 1.00 27.41 ? 438  VAL A CG1 1 
ATOM   3537 C CG2 . VAL A 1 438 ? 18.390  73.224 65.048 1.00 27.64 ? 438  VAL A CG2 1 
ATOM   3538 N N   . ILE A 1 439 ? 13.936  71.682 66.191 1.00 27.59 ? 439  ILE A N   1 
ATOM   3539 C CA  . ILE A 1 439 ? 12.773  70.816 66.262 1.00 26.03 ? 439  ILE A CA  1 
ATOM   3540 C C   . ILE A 1 439 ? 12.113  70.304 64.991 1.00 26.00 ? 439  ILE A C   1 
ATOM   3541 O O   . ILE A 1 439 ? 12.130  70.943 63.942 1.00 24.78 ? 439  ILE A O   1 
ATOM   3542 C CB  . ILE A 1 439 ? 11.703  71.507 67.139 1.00 26.75 ? 439  ILE A CB  1 
ATOM   3543 C CG1 . ILE A 1 439 ? 12.330  71.876 68.488 1.00 26.64 ? 439  ILE A CG1 1 
ATOM   3544 C CG2 . ILE A 1 439 ? 10.489  70.604 67.335 1.00 25.04 ? 439  ILE A CG2 1 
ATOM   3545 C CD1 . ILE A 1 439 ? 11.465  72.779 69.341 1.00 27.71 ? 439  ILE A CD1 1 
ATOM   3546 N N   . HIS A 1 440 ? 11.536  69.116 65.130 1.00 26.12 ? 440  HIS A N   1 
ATOM   3547 C CA  . HIS A 1 440 ? 10.793  68.441 64.077 1.00 27.62 ? 440  HIS A CA  1 
ATOM   3548 C C   . HIS A 1 440 ? 9.722   69.423 63.593 1.00 27.38 ? 440  HIS A C   1 
ATOM   3549 O O   . HIS A 1 440 ? 8.944   69.944 64.396 1.00 27.87 ? 440  HIS A O   1 
ATOM   3550 C CB  . HIS A 1 440 ? 10.129  67.202 64.686 1.00 28.90 ? 440  HIS A CB  1 
ATOM   3551 C CG  . HIS A 1 440 ? 9.365   66.360 63.716 1.00 31.79 ? 440  HIS A CG  1 
ATOM   3552 N ND1 . HIS A 1 440 ? 9.970   65.680 62.678 1.00 32.08 ? 440  HIS A ND1 1 
ATOM   3553 C CD2 . HIS A 1 440 ? 8.053   66.026 63.665 1.00 32.46 ? 440  HIS A CD2 1 
ATOM   3554 C CE1 . HIS A 1 440 ? 9.066   64.962 62.039 1.00 35.07 ? 440  HIS A CE1 1 
ATOM   3555 N NE2 . HIS A 1 440 ? 7.892   65.154 62.619 1.00 34.09 ? 440  HIS A NE2 1 
ATOM   3556 N N   . GLY A 1 441 ? 9.699   69.688 62.290 1.00 26.22 ? 441  GLY A N   1 
ATOM   3557 C CA  . GLY A 1 441 ? 8.704   70.584 61.727 1.00 27.11 ? 441  GLY A CA  1 
ATOM   3558 C C   . GLY A 1 441 ? 9.012   72.072 61.688 1.00 29.00 ? 441  GLY A C   1 
ATOM   3559 O O   . GLY A 1 441 ? 8.255   72.843 61.088 1.00 27.73 ? 441  GLY A O   1 
ATOM   3560 N N   . TYR A 1 442 ? 10.114  72.501 62.291 1.00 27.59 ? 442  TYR A N   1 
ATOM   3561 C CA  . TYR A 1 442 ? 10.388  73.924 62.284 1.00 27.78 ? 442  TYR A CA  1 
ATOM   3562 C C   . TYR A 1 442 ? 11.189  74.491 61.122 1.00 29.03 ? 442  TYR A C   1 
ATOM   3563 O O   . TYR A 1 442 ? 11.675  75.624 61.177 1.00 29.44 ? 442  TYR A O   1 
ATOM   3564 C CB  . TYR A 1 442 ? 10.946  74.352 63.645 1.00 28.64 ? 442  TYR A CB  1 
ATOM   3565 C CG  . TYR A 1 442 ? 9.820   74.463 64.646 1.00 28.86 ? 442  TYR A CG  1 
ATOM   3566 C CD1 . TYR A 1 442 ? 9.256   73.323 65.224 1.00 27.78 ? 442  TYR A CD1 1 
ATOM   3567 C CD2 . TYR A 1 442 ? 9.234   75.695 64.921 1.00 28.69 ? 442  TYR A CD2 1 
ATOM   3568 C CE1 . TYR A 1 442 ? 8.134   73.412 66.046 1.00 27.91 ? 442  TYR A CE1 1 
ATOM   3569 C CE2 . TYR A 1 442 ? 8.110   75.794 65.737 1.00 29.00 ? 442  TYR A CE2 1 
ATOM   3570 C CZ  . TYR A 1 442 ? 7.566   74.649 66.294 1.00 28.27 ? 442  TYR A CZ  1 
ATOM   3571 O OH  . TYR A 1 442 ? 6.447   74.750 67.089 1.00 30.20 ? 442  TYR A OH  1 
ATOM   3572 N N   . GLU A 1 443 ? 11.315  73.707 60.058 1.00 26.02 ? 443  GLU A N   1 
ATOM   3573 C CA  . GLU A 1 443 ? 11.983  74.189 58.859 1.00 25.92 ? 443  GLU A CA  1 
ATOM   3574 C C   . GLU A 1 443 ? 10.841  74.637 57.940 1.00 26.53 ? 443  GLU A C   1 
ATOM   3575 O O   . GLU A 1 443 ? 11.042  75.407 56.999 1.00 24.14 ? 443  GLU A O   1 
ATOM   3576 C CB  . GLU A 1 443 ? 12.796  73.074 58.187 1.00 25.85 ? 443  GLU A CB  1 
ATOM   3577 C CG  . GLU A 1 443 ? 12.021  72.140 57.250 1.00 27.54 ? 443  GLU A CG  1 
ATOM   3578 C CD  . GLU A 1 443 ? 11.084  71.173 57.962 1.00 27.36 ? 443  GLU A CD  1 
ATOM   3579 O OE1 . GLU A 1 443 ? 11.124  71.076 59.208 1.00 26.17 ? 443  GLU A OE1 1 
ATOM   3580 O OE2 . GLU A 1 443 ? 10.301  70.497 57.259 1.00 28.45 ? 443  GLU A OE2 1 
ATOM   3581 N N   . ILE A 1 444 ? 9.634   74.163 58.244 1.00 26.79 ? 444  ILE A N   1 
ATOM   3582 C CA  . ILE A 1 444 ? 8.460   74.483 57.441 1.00 26.67 ? 444  ILE A CA  1 
ATOM   3583 C C   . ILE A 1 444 ? 8.217   75.985 57.302 1.00 28.27 ? 444  ILE A C   1 
ATOM   3584 O O   . ILE A 1 444 ? 7.942   76.470 56.205 1.00 27.31 ? 444  ILE A O   1 
ATOM   3585 C CB  . ILE A 1 444 ? 7.184   73.830 58.020 1.00 26.72 ? 444  ILE A CB  1 
ATOM   3586 C CG1 . ILE A 1 444 ? 7.327   72.304 58.015 1.00 26.90 ? 444  ILE A CG1 1 
ATOM   3587 C CG2 . ILE A 1 444 ? 5.964   74.241 57.194 1.00 26.21 ? 444  ILE A CG2 1 
ATOM   3588 C CD1 . ILE A 1 444 ? 6.137   71.579 58.606 1.00 24.62 ? 444  ILE A CD1 1 
ATOM   3589 N N   . GLU A 1 445 ? 8.319   76.718 58.407 1.00 27.12 ? 445  GLU A N   1 
ATOM   3590 C CA  . GLU A 1 445 ? 8.097   78.160 58.365 1.00 29.64 ? 445  GLU A CA  1 
ATOM   3591 C C   . GLU A 1 445 ? 9.074   78.859 57.424 1.00 28.42 ? 445  GLU A C   1 
ATOM   3592 O O   . GLU A 1 445 ? 8.757   79.910 56.866 1.00 30.26 ? 445  GLU A O   1 
ATOM   3593 C CB  . GLU A 1 445 ? 8.178   78.761 59.778 1.00 31.07 ? 445  GLU A CB  1 
ATOM   3594 C CG  . GLU A 1 445 ? 9.412   78.378 60.567 1.00 32.41 ? 445  GLU A CG  1 
ATOM   3595 C CD  . GLU A 1 445 ? 9.219   78.583 62.060 1.00 35.70 ? 445  GLU A CD  1 
ATOM   3596 O OE1 . GLU A 1 445 ? 8.253   78.013 62.612 1.00 37.34 ? 445  GLU A OE1 1 
ATOM   3597 O OE2 . GLU A 1 445 ? 10.030  79.304 62.684 1.00 36.11 ? 445  GLU A OE2 1 
ATOM   3598 N N   . PHE A 1 446 ? 10.255  78.277 57.236 1.00 27.72 ? 446  PHE A N   1 
ATOM   3599 C CA  . PHE A 1 446 ? 11.228  78.866 56.329 1.00 27.93 ? 446  PHE A CA  1 
ATOM   3600 C C   . PHE A 1 446 ? 10.872  78.524 54.888 1.00 28.21 ? 446  PHE A C   1 
ATOM   3601 O O   . PHE A 1 446 ? 11.031  79.349 53.986 1.00 29.20 ? 446  PHE A O   1 
ATOM   3602 C CB  . PHE A 1 446 ? 12.645  78.385 56.654 1.00 28.88 ? 446  PHE A CB  1 
ATOM   3603 C CG  . PHE A 1 446 ? 13.221  79.023 57.883 1.00 30.27 ? 446  PHE A CG  1 
ATOM   3604 C CD1 . PHE A 1 446 ? 12.895  78.547 59.148 1.00 29.43 ? 446  PHE A CD1 1 
ATOM   3605 C CD2 . PHE A 1 446 ? 14.043  80.147 57.777 1.00 30.07 ? 446  PHE A CD2 1 
ATOM   3606 C CE1 . PHE A 1 446 ? 13.373  79.182 60.296 1.00 31.22 ? 446  PHE A CE1 1 
ATOM   3607 C CE2 . PHE A 1 446 ? 14.524  80.788 58.917 1.00 30.84 ? 446  PHE A CE2 1 
ATOM   3608 C CZ  . PHE A 1 446 ? 14.187  80.303 60.178 1.00 31.12 ? 446  PHE A CZ  1 
ATOM   3609 N N   . VAL A 1 447 ? 10.386  77.306 54.675 1.00 27.46 ? 447  VAL A N   1 
ATOM   3610 C CA  . VAL A 1 447 ? 9.994   76.871 53.343 1.00 25.50 ? 447  VAL A CA  1 
ATOM   3611 C C   . VAL A 1 447 ? 8.791   77.681 52.854 1.00 25.57 ? 447  VAL A C   1 
ATOM   3612 O O   . VAL A 1 447 ? 8.678   77.972 51.665 1.00 26.85 ? 447  VAL A O   1 
ATOM   3613 C CB  . VAL A 1 447 ? 9.635   75.368 53.335 1.00 24.74 ? 447  VAL A CB  1 
ATOM   3614 C CG1 . VAL A 1 447 ? 8.971   74.989 52.018 1.00 25.31 ? 447  VAL A CG1 1 
ATOM   3615 C CG2 . VAL A 1 447 ? 10.894  74.539 53.535 1.00 25.23 ? 447  VAL A CG2 1 
ATOM   3616 N N   . PHE A 1 448 ? 7.899   78.050 53.770 1.00 27.35 ? 448  PHE A N   1 
ATOM   3617 C CA  . PHE A 1 448 ? 6.722   78.818 53.386 1.00 28.11 ? 448  PHE A CA  1 
ATOM   3618 C C   . PHE A 1 448 ? 6.902   80.335 53.462 1.00 30.13 ? 448  PHE A C   1 
ATOM   3619 O O   . PHE A 1 448 ? 5.952   81.093 53.246 1.00 30.23 ? 448  PHE A O   1 
ATOM   3620 C CB  . PHE A 1 448 ? 5.506   78.375 54.201 1.00 27.69 ? 448  PHE A CB  1 
ATOM   3621 C CG  . PHE A 1 448 ? 4.873   77.111 53.685 1.00 28.88 ? 448  PHE A CG  1 
ATOM   3622 C CD1 . PHE A 1 448 ? 5.465   75.873 53.915 1.00 29.06 ? 448  PHE A CD1 1 
ATOM   3623 C CD2 . PHE A 1 448 ? 3.712   77.164 52.916 1.00 28.05 ? 448  PHE A CD2 1 
ATOM   3624 C CE1 . PHE A 1 448 ? 4.913   74.703 53.383 1.00 29.70 ? 448  PHE A CE1 1 
ATOM   3625 C CE2 . PHE A 1 448 ? 3.150   75.997 52.379 1.00 29.09 ? 448  PHE A CE2 1 
ATOM   3626 C CZ  . PHE A 1 448 ? 3.755   74.768 52.615 1.00 29.94 ? 448  PHE A CZ  1 
ATOM   3627 N N   . GLY A 1 449 ? 8.120   80.766 53.777 1.00 30.74 ? 449  GLY A N   1 
ATOM   3628 C CA  . GLY A 1 449 ? 8.434   82.187 53.819 1.00 31.19 ? 449  GLY A CA  1 
ATOM   3629 C C   . GLY A 1 449 ? 7.905   83.073 54.930 1.00 32.40 ? 449  GLY A C   1 
ATOM   3630 O O   . GLY A 1 449 ? 7.835   84.288 54.756 1.00 34.29 ? 449  GLY A O   1 
ATOM   3631 N N   . LEU A 1 450 ? 7.541   82.495 56.068 1.00 32.07 ? 450  LEU A N   1 
ATOM   3632 C CA  . LEU A 1 450 ? 7.036   83.299 57.177 1.00 33.82 ? 450  LEU A CA  1 
ATOM   3633 C C   . LEU A 1 450 ? 8.043   84.364 57.631 1.00 33.85 ? 450  LEU A C   1 
ATOM   3634 O O   . LEU A 1 450 ? 7.652   85.458 58.027 1.00 34.73 ? 450  LEU A O   1 
ATOM   3635 C CB  . LEU A 1 450 ? 6.653   82.406 58.361 1.00 33.14 ? 450  LEU A CB  1 
ATOM   3636 C CG  . LEU A 1 450 ? 5.310   81.667 58.266 1.00 36.00 ? 450  LEU A CG  1 
ATOM   3637 C CD1 . LEU A 1 450 ? 4.175   82.672 58.300 1.00 38.52 ? 450  LEU A CD1 1 
ATOM   3638 C CD2 . LEU A 1 450 ? 5.253   80.845 56.987 1.00 37.23 ? 450  LEU A CD2 1 
ATOM   3639 N N   . PRO A 1 451 ? 9.350   84.057 57.579 1.00 33.67 ? 451  PRO A N   1 
ATOM   3640 C CA  . PRO A 1 451 ? 10.347  85.047 58.002 1.00 35.27 ? 451  PRO A CA  1 
ATOM   3641 C C   . PRO A 1 451 ? 10.323  86.357 57.212 1.00 36.92 ? 451  PRO A C   1 
ATOM   3642 O O   . PRO A 1 451 ? 10.975  87.326 57.600 1.00 36.46 ? 451  PRO A O   1 
ATOM   3643 C CB  . PRO A 1 451 ? 11.665  84.297 57.835 1.00 35.06 ? 451  PRO A CB  1 
ATOM   3644 C CG  . PRO A 1 451 ? 11.273  82.891 58.167 1.00 34.16 ? 451  PRO A CG  1 
ATOM   3645 C CD  . PRO A 1 451 ? 9.984   82.741 57.386 1.00 34.16 ? 451  PRO A CD  1 
ATOM   3646 N N   . LEU A 1 452 ? 9.587   86.384 56.104 1.00 36.60 ? 452  LEU A N   1 
ATOM   3647 C CA  . LEU A 1 452 ? 9.494   87.596 55.295 1.00 36.96 ? 452  LEU A CA  1 
ATOM   3648 C C   . LEU A 1 452 ? 8.460   88.555 55.880 1.00 37.94 ? 452  LEU A C   1 
ATOM   3649 O O   . LEU A 1 452 ? 8.392   89.718 55.485 1.00 39.74 ? 452  LEU A O   1 
ATOM   3650 C CB  . LEU A 1 452 ? 9.120   87.259 53.845 1.00 33.69 ? 452  LEU A CB  1 
ATOM   3651 C CG  . LEU A 1 452 ? 10.227  86.751 52.919 1.00 32.74 ? 452  LEU A CG  1 
ATOM   3652 C CD1 . LEU A 1 452 ? 10.832  85.454 53.457 1.00 32.60 ? 452  LEU A CD1 1 
ATOM   3653 C CD2 . LEU A 1 452 ? 9.650   86.539 51.525 1.00 33.43 ? 452  LEU A CD2 1 
ATOM   3654 N N   . VAL A 1 453 ? 7.659   88.063 56.820 1.00 38.86 ? 453  VAL A N   1 
ATOM   3655 C CA  . VAL A 1 453 ? 6.635   88.876 57.467 1.00 41.31 ? 453  VAL A CA  1 
ATOM   3656 C C   . VAL A 1 453 ? 7.235   89.541 58.708 1.00 42.99 ? 453  VAL A C   1 
ATOM   3657 O O   . VAL A 1 453 ? 7.390   88.910 59.755 1.00 42.95 ? 453  VAL A O   1 
ATOM   3658 C CB  . VAL A 1 453 ? 5.423   88.014 57.888 1.00 40.45 ? 453  VAL A CB  1 
ATOM   3659 C CG1 . VAL A 1 453 ? 4.352   88.889 58.518 1.00 41.76 ? 453  VAL A CG1 1 
ATOM   3660 C CG2 . VAL A 1 453 ? 4.863   87.282 56.679 1.00 40.67 ? 453  VAL A CG2 1 
ATOM   3661 N N   . LYS A 1 454 ? 7.563   90.822 58.578 1.00 44.90 ? 454  LYS A N   1 
ATOM   3662 C CA  . LYS A 1 454 ? 8.172   91.595 59.659 1.00 47.14 ? 454  LYS A CA  1 
ATOM   3663 C C   . LYS A 1 454 ? 7.548   91.417 61.043 1.00 47.48 ? 454  LYS A C   1 
ATOM   3664 O O   . LYS A 1 454 ? 8.254   91.247 62.034 1.00 48.27 ? 454  LYS A O   1 
ATOM   3665 C CB  . LYS A 1 454 ? 8.162   93.083 59.292 1.00 48.19 ? 454  LYS A CB  1 
ATOM   3666 C CG  . LYS A 1 454 ? 8.764   93.993 60.356 1.00 50.57 ? 454  LYS A CG  1 
ATOM   3667 N N   A GLU A 1 455 ? 6.222   91.450 61.099 0.50 48.10 ? 455  GLU A N   1 
ATOM   3668 N N   B GLU A 1 455 ? 6.221   91.454 61.099 0.50 48.23 ? 455  GLU A N   1 
ATOM   3669 C CA  A GLU A 1 455 ? 5.494   91.319 62.355 0.50 49.15 ? 455  GLU A CA  1 
ATOM   3670 C CA  B GLU A 1 455 ? 5.492   91.316 62.354 0.50 48.92 ? 455  GLU A CA  1 
ATOM   3671 C C   A GLU A 1 455 ? 5.790   90.027 63.116 0.50 48.86 ? 455  GLU A C   1 
ATOM   3672 C C   B GLU A 1 455 ? 5.776   90.023 63.112 0.50 49.00 ? 455  GLU A C   1 
ATOM   3673 O O   A GLU A 1 455 ? 5.509   89.933 64.311 0.50 49.02 ? 455  GLU A O   1 
ATOM   3674 O O   B GLU A 1 455 ? 5.547   89.946 64.321 0.50 48.88 ? 455  GLU A O   1 
ATOM   3675 C CB  A GLU A 1 455 ? 3.984   91.400 62.096 0.50 50.54 ? 455  GLU A CB  1 
ATOM   3676 C CB  B GLU A 1 455 ? 3.988   91.440 62.101 0.50 51.01 ? 455  GLU A CB  1 
ATOM   3677 C CG  A GLU A 1 455 ? 3.568   92.733 61.416 0.50 54.19 ? 455  GLU A CG  1 
ATOM   3678 C CG  B GLU A 1 455 ? 3.520   92.635 61.332 0.50 53.28 ? 455  GLU A CG  1 
ATOM   3679 C CD  A GLU A 1 455 ? 3.921   92.616 59.864 0.50 54.76 ? 455  GLU A CD  1 
ATOM   3680 C CD  B GLU A 1 455 ? 3.951   92.781 59.946 0.50 55.98 ? 455  GLU A CD  1 
ATOM   3681 O OE1 A GLU A 1 455 ? 5.108   92.859 59.558 0.50 55.55 ? 455  GLU A OE1 1 
ATOM   3682 O OE1 B GLU A 1 455 ? 4.395   91.745 59.406 0.50 56.72 ? 455  GLU A OE1 1 
ATOM   3683 O OE2 A GLU A 1 455 ? 3.043   92.353 59.014 0.50 55.41 ? 455  GLU A OE2 1 
ATOM   3684 O OE2 B GLU A 1 455 ? 3.801   93.857 59.326 0.50 56.95 ? 455  GLU A OE2 1 
ATOM   3685 N N   . LEU A 1 456 ? 6.311   89.021 62.422 1.00 48.22 ? 456  LEU A N   1 
ATOM   3686 C CA  . LEU A 1 456 ? 6.604   87.739 63.064 1.00 47.30 ? 456  LEU A CA  1 
ATOM   3687 C C   . LEU A 1 456 ? 7.879   87.686 63.909 1.00 47.27 ? 456  LEU A C   1 
ATOM   3688 O O   . LEU A 1 456 ? 8.164   86.672 64.549 1.00 47.65 ? 456  LEU A O   1 
ATOM   3689 C CB  . LEU A 1 456 ? 6.603   86.626 62.014 1.00 45.02 ? 456  LEU A CB  1 
ATOM   3690 C CG  . LEU A 1 456 ? 5.235   86.453 61.344 1.00 43.99 ? 456  LEU A CG  1 
ATOM   3691 C CD1 . LEU A 1 456 ? 5.287   85.298 60.357 1.00 42.82 ? 456  LEU A CD1 1 
ATOM   3692 C CD2 . LEU A 1 456 ? 4.165   86.203 62.407 1.00 42.04 ? 456  LEU A CD2 1 
ATOM   3693 N N   . ASN A 1 457 ? 8.635   88.778 63.904 1.00 47.31 ? 457  ASN A N   1 
ATOM   3694 C CA  . ASN A 1 457 ? 9.857   88.901 64.699 1.00 46.99 ? 457  ASN A CA  1 
ATOM   3695 C C   . ASN A 1 457 ? 11.066  88.036 64.342 1.00 45.42 ? 457  ASN A C   1 
ATOM   3696 O O   . ASN A 1 457 ? 11.797  87.606 65.235 1.00 44.81 ? 457  ASN A O   1 
ATOM   3697 C CB  . ASN A 1 457 ? 9.539   88.694 66.186 1.00 49.72 ? 457  ASN A CB  1 
ATOM   3698 C CG  . ASN A 1 457 ? 8.524   89.691 66.714 1.00 51.91 ? 457  ASN A CG  1 
ATOM   3699 O OD1 . ASN A 1 457 ? 8.506   90.853 66.306 1.00 52.63 ? 457  ASN A OD1 1 
ATOM   3700 N ND2 . ASN A 1 457 ? 7.682   89.244 67.640 1.00 54.02 ? 457  ASN A ND2 1 
ATOM   3701 N N   . TYR A 1 458 ? 11.280  87.774 63.057 1.00 41.95 ? 458  TYR A N   1 
ATOM   3702 C CA  . TYR A 1 458 ? 12.440  86.990 62.635 1.00 39.98 ? 458  TYR A CA  1 
ATOM   3703 C C   . TYR A 1 458 ? 13.562  87.990 62.363 1.00 40.43 ? 458  TYR A C   1 
ATOM   3704 O O   . TYR A 1 458 ? 13.301  89.179 62.189 1.00 41.00 ? 458  TYR A O   1 
ATOM   3705 C CB  . TYR A 1 458 ? 12.137  86.212 61.350 1.00 38.34 ? 458  TYR A CB  1 
ATOM   3706 C CG  . TYR A 1 458 ? 11.262  84.990 61.532 1.00 35.24 ? 458  TYR A CG  1 
ATOM   3707 C CD1 . TYR A 1 458 ? 11.811  83.762 61.913 1.00 36.70 ? 458  TYR A CD1 1 
ATOM   3708 C CD2 . TYR A 1 458 ? 9.889   85.052 61.296 1.00 36.02 ? 458  TYR A CD2 1 
ATOM   3709 C CE1 . TYR A 1 458 ? 11.011  82.623 62.048 1.00 34.19 ? 458  TYR A CE1 1 
ATOM   3710 C CE2 . TYR A 1 458 ? 9.080   83.920 61.427 1.00 35.32 ? 458  TYR A CE2 1 
ATOM   3711 C CZ  . TYR A 1 458 ? 9.647   82.711 61.801 1.00 35.94 ? 458  TYR A CZ  1 
ATOM   3712 O OH  . TYR A 1 458 ? 8.851   81.591 61.917 1.00 34.21 ? 458  TYR A OH  1 
ATOM   3713 N N   . THR A 1 459 ? 14.802  87.516 62.324 1.00 39.91 ? 459  THR A N   1 
ATOM   3714 C CA  . THR A 1 459 ? 15.934  88.398 62.055 1.00 39.89 ? 459  THR A CA  1 
ATOM   3715 C C   . THR A 1 459 ? 16.132  88.562 60.552 1.00 40.07 ? 459  THR A C   1 
ATOM   3716 O O   . THR A 1 459 ? 15.530  87.840 59.755 1.00 38.67 ? 459  THR A O   1 
ATOM   3717 C CB  . THR A 1 459 ? 17.243  87.846 62.647 1.00 39.87 ? 459  THR A CB  1 
ATOM   3718 O OG1 . THR A 1 459 ? 17.622  86.654 61.946 1.00 39.47 ? 459  THR A OG1 1 
ATOM   3719 C CG2 . THR A 1 459 ? 17.068  87.535 64.128 1.00 39.33 ? 459  THR A CG2 1 
ATOM   3720 N N   . ALA A 1 460 ? 16.978  89.513 60.170 1.00 39.08 ? 460  ALA A N   1 
ATOM   3721 C CA  . ALA A 1 460 ? 17.261  89.766 58.762 1.00 38.65 ? 460  ALA A CA  1 
ATOM   3722 C C   . ALA A 1 460 ? 17.951  88.557 58.141 1.00 38.62 ? 460  ALA A C   1 
ATOM   3723 O O   . ALA A 1 460 ? 17.718  88.227 56.976 1.00 39.03 ? 460  ALA A O   1 
ATOM   3724 C CB  . ALA A 1 460 ? 18.145  91.005 58.622 1.00 39.38 ? 460  ALA A CB  1 
ATOM   3725 N N   . GLU A 1 461 ? 18.806  87.901 58.921 1.00 37.19 ? 461  GLU A N   1 
ATOM   3726 C CA  . GLU A 1 461 ? 19.517  86.723 58.440 1.00 38.36 ? 461  GLU A CA  1 
ATOM   3727 C C   . GLU A 1 461 ? 18.531  85.585 58.186 1.00 36.49 ? 461  GLU A C   1 
ATOM   3728 O O   . GLU A 1 461 ? 18.700  84.801 57.254 1.00 37.00 ? 461  GLU A O   1 
ATOM   3729 C CB  . GLU A 1 461 ? 20.562  86.262 59.460 1.00 41.59 ? 461  GLU A CB  1 
ATOM   3730 C CG  . GLU A 1 461 ? 21.723  87.225 59.695 1.00 46.16 ? 461  GLU A CG  1 
ATOM   3731 C CD  . GLU A 1 461 ? 21.409  88.311 60.712 1.00 49.15 ? 461  GLU A CD  1 
ATOM   3732 O OE1 . GLU A 1 461 ? 20.223  88.509 61.052 1.00 49.96 ? 461  GLU A OE1 1 
ATOM   3733 O OE2 . GLU A 1 461 ? 22.360  88.976 61.172 1.00 54.04 ? 461  GLU A OE2 1 
ATOM   3734 N N   . GLU A 1 462 ? 17.502  85.498 59.019 1.00 34.74 ? 462  GLU A N   1 
ATOM   3735 C CA  . GLU A 1 462 ? 16.505  84.448 58.859 1.00 34.39 ? 462  GLU A CA  1 
ATOM   3736 C C   . GLU A 1 462 ? 15.616  84.719 57.650 1.00 34.70 ? 462  GLU A C   1 
ATOM   3737 O O   . GLU A 1 462 ? 15.127  83.782 57.017 1.00 32.66 ? 462  GLU A O   1 
ATOM   3738 C CB  . GLU A 1 462 ? 15.681  84.311 60.139 1.00 34.68 ? 462  GLU A CB  1 
ATOM   3739 C CG  . GLU A 1 462 ? 16.539  83.867 61.316 1.00 33.49 ? 462  GLU A CG  1 
ATOM   3740 C CD  . GLU A 1 462 ? 15.776  83.777 62.622 1.00 33.87 ? 462  GLU A CD  1 
ATOM   3741 O OE1 . GLU A 1 462 ? 15.000  84.706 62.930 1.00 35.59 ? 462  GLU A OE1 1 
ATOM   3742 O OE2 . GLU A 1 462 ? 15.967  82.783 63.349 1.00 34.76 ? 462  GLU A OE2 1 
ATOM   3743 N N   . GLU A 1 463 ? 15.410  85.992 57.317 1.00 34.33 ? 463  GLU A N   1 
ATOM   3744 C CA  . GLU A 1 463 ? 14.603  86.312 56.147 1.00 34.31 ? 463  GLU A CA  1 
ATOM   3745 C C   . GLU A 1 463 ? 15.401  85.873 54.930 1.00 33.54 ? 463  GLU A C   1 
ATOM   3746 O O   . GLU A 1 463 ? 14.847  85.337 53.969 1.00 33.51 ? 463  GLU A O   1 
ATOM   3747 C CB  . GLU A 1 463 ? 14.318  87.813 56.039 1.00 36.05 ? 463  GLU A CB  1 
ATOM   3748 C CG  . GLU A 1 463 ? 13.344  88.149 54.911 1.00 39.06 ? 463  GLU A CG  1 
ATOM   3749 C CD  . GLU A 1 463 ? 13.282  89.631 54.588 1.00 43.08 ? 463  GLU A CD  1 
ATOM   3750 O OE1 . GLU A 1 463 ? 13.314  90.448 55.530 1.00 44.66 ? 463  GLU A OE1 1 
ATOM   3751 O OE2 . GLU A 1 463 ? 13.186  89.978 53.390 1.00 43.29 ? 463  GLU A OE2 1 
ATOM   3752 N N   . ALA A 1 464 ? 16.711  86.100 54.981 1.00 33.32 ? 464  ALA A N   1 
ATOM   3753 C CA  . ALA A 1 464 ? 17.604  85.731 53.888 1.00 32.84 ? 464  ALA A CA  1 
ATOM   3754 C C   . ALA A 1 464 ? 17.650  84.216 53.723 1.00 32.27 ? 464  ALA A C   1 
ATOM   3755 O O   . ALA A 1 464 ? 17.679  83.706 52.602 1.00 30.81 ? 464  ALA A O   1 
ATOM   3756 C CB  . ALA A 1 464 ? 19.007  86.269 54.150 1.00 33.54 ? 464  ALA A CB  1 
ATOM   3757 N N   . LEU A 1 465 ? 17.670  83.500 54.842 1.00 30.67 ? 465  LEU A N   1 
ATOM   3758 C CA  . LEU A 1 465 ? 17.696  82.042 54.797 1.00 30.44 ? 465  LEU A CA  1 
ATOM   3759 C C   . LEU A 1 465 ? 16.409  81.530 54.154 1.00 29.59 ? 465  LEU A C   1 
ATOM   3760 O O   . LEU A 1 465 ? 16.438  80.633 53.309 1.00 30.37 ? 465  LEU A O   1 
ATOM   3761 C CB  . LEU A 1 465 ? 17.828  81.465 56.209 1.00 30.47 ? 465  LEU A CB  1 
ATOM   3762 C CG  . LEU A 1 465 ? 17.737  79.938 56.314 1.00 27.78 ? 465  LEU A CG  1 
ATOM   3763 C CD1 . LEU A 1 465 ? 18.779  79.286 55.424 1.00 30.56 ? 465  LEU A CD1 1 
ATOM   3764 C CD2 . LEU A 1 465 ? 17.935  79.526 57.756 1.00 29.92 ? 465  LEU A CD2 1 
ATOM   3765 N N   . SER A 1 466 ? 15.281  82.108 54.555 1.00 28.87 ? 466  SER A N   1 
ATOM   3766 C CA  . SER A 1 466 ? 13.986  81.712 54.013 1.00 29.37 ? 466  SER A CA  1 
ATOM   3767 C C   . SER A 1 466 ? 13.922  81.955 52.504 1.00 31.32 ? 466  SER A C   1 
ATOM   3768 O O   . SER A 1 466 ? 13.505  81.079 51.743 1.00 29.76 ? 466  SER A O   1 
ATOM   3769 C CB  . SER A 1 466 ? 12.866  82.483 54.714 1.00 28.66 ? 466  SER A CB  1 
ATOM   3770 O OG  . SER A 1 466 ? 11.588  82.084 54.236 1.00 27.15 ? 466  SER A OG  1 
ATOM   3771 N N   . ARG A 1 467 ? 14.339  83.141 52.065 1.00 30.60 ? 467  ARG A N   1 
ATOM   3772 C CA  . ARG A 1 467 ? 14.315  83.452 50.635 1.00 30.93 ? 467  ARG A CA  1 
ATOM   3773 C C   . ARG A 1 467 ? 15.186  82.480 49.853 1.00 30.74 ? 467  ARG A C   1 
ATOM   3774 O O   . ARG A 1 467 ? 14.834  82.073 48.744 1.00 30.11 ? 467  ARG A O   1 
ATOM   3775 C CB  . ARG A 1 467 ? 14.786  84.891 50.382 1.00 30.99 ? 467  ARG A CB  1 
ATOM   3776 C CG  . ARG A 1 467 ? 13.773  85.943 50.806 1.00 33.24 ? 467  ARG A CG  1 
ATOM   3777 C CD  . ARG A 1 467 ? 14.264  87.362 50.525 1.00 34.07 ? 467  ARG A CD  1 
ATOM   3778 N NE  . ARG A 1 467 ? 13.235  88.340 50.868 1.00 35.59 ? 467  ARG A NE  1 
ATOM   3779 C CZ  . ARG A 1 467 ? 12.153  88.577 50.132 1.00 36.60 ? 467  ARG A CZ  1 
ATOM   3780 N NH1 . ARG A 1 467 ? 11.958  87.913 49.001 1.00 36.22 ? 467  ARG A NH1 1 
ATOM   3781 N NH2 . ARG A 1 467 ? 11.257  89.466 50.537 1.00 36.93 ? 467  ARG A NH2 1 
ATOM   3782 N N   A ARG A 1 468 ? 16.323  82.107 50.435 0.50 30.35 ? 468  ARG A N   1 
ATOM   3783 N N   B ARG A 1 468 ? 16.319  82.109 50.437 0.50 29.96 ? 468  ARG A N   1 
ATOM   3784 C CA  A ARG A 1 468 ? 17.242  81.177 49.800 0.50 30.26 ? 468  ARG A CA  1 
ATOM   3785 C CA  B ARG A 1 468 ? 17.244  81.175 49.790 0.50 30.96 ? 468  ARG A CA  1 
ATOM   3786 C C   A ARG A 1 468 ? 16.604  79.789 49.679 0.50 29.95 ? 468  ARG A C   1 
ATOM   3787 C C   B ARG A 1 468 ? 16.592  79.797 49.676 0.50 29.52 ? 468  ARG A C   1 
ATOM   3788 O O   A ARG A 1 468 ? 16.661  79.155 48.629 0.50 29.56 ? 468  ARG A O   1 
ATOM   3789 O O   B ARG A 1 468 ? 16.690  79.132 48.641 0.50 29.90 ? 468  ARG A O   1 
ATOM   3790 C CB  A ARG A 1 468 ? 18.514  81.072 50.639 0.50 32.07 ? 468  ARG A CB  1 
ATOM   3791 C CB  B ARG A 1 468 ? 18.550  81.080 50.591 0.50 33.56 ? 468  ARG A CB  1 
ATOM   3792 C CG  A ARG A 1 468 ? 19.675  80.350 49.981 0.50 34.66 ? 468  ARG A CG  1 
ATOM   3793 C CG  B ARG A 1 468 ? 19.657  80.290 49.898 0.50 37.56 ? 468  ARG A CG  1 
ATOM   3794 C CD  A ARG A 1 468 ? 20.756  80.099 51.017 0.50 37.38 ? 468  ARG A CD  1 
ATOM   3795 C CD  B ARG A 1 468 ? 20.954  80.282 50.708 0.50 41.36 ? 468  ARG A CD  1 
ATOM   3796 N NE  A ARG A 1 468 ? 20.868  81.232 51.927 0.50 37.27 ? 468  ARG A NE  1 
ATOM   3797 N NE  B ARG A 1 468 ? 21.191  78.996 51.363 0.50 44.40 ? 468  ARG A NE  1 
ATOM   3798 C CZ  A ARG A 1 468 ? 21.497  81.197 53.096 0.50 38.69 ? 468  ARG A CZ  1 
ATOM   3799 C CZ  B ARG A 1 468 ? 22.286  78.696 52.054 0.50 44.83 ? 468  ARG A CZ  1 
ATOM   3800 N NH1 A ARG A 1 468 ? 22.082  80.079 53.506 0.50 38.90 ? 468  ARG A NH1 1 
ATOM   3801 N NH1 B ARG A 1 468 ? 23.252  79.592 52.189 0.50 49.16 ? 468  ARG A NH1 1 
ATOM   3802 N NH2 A ARG A 1 468 ? 21.527  82.280 53.863 0.50 37.46 ? 468  ARG A NH2 1 
ATOM   3803 N NH2 B ARG A 1 468 ? 22.420  77.499 52.603 0.50 46.55 ? 468  ARG A NH2 1 
ATOM   3804 N N   . ILE A 1 469 ? 15.962  79.349 50.757 1.00 29.21 ? 469  ILE A N   1 
ATOM   3805 C CA  . ILE A 1 469 ? 15.301  78.045 50.775 1.00 28.86 ? 469  ILE A CA  1 
ATOM   3806 C C   . ILE A 1 469 ? 14.112  78.010 49.813 1.00 28.62 ? 469  ILE A C   1 
ATOM   3807 O O   . ILE A 1 469 ? 13.950  77.053 49.057 1.00 27.92 ? 469  ILE A O   1 
ATOM   3808 C CB  . ILE A 1 469 ? 14.850  77.683 52.220 1.00 28.79 ? 469  ILE A CB  1 
ATOM   3809 C CG1 . ILE A 1 469 ? 16.092  77.352 53.059 1.00 25.51 ? 469  ILE A CG1 1 
ATOM   3810 C CG2 . ILE A 1 469 ? 13.857  76.516 52.201 1.00 26.57 ? 469  ILE A CG2 1 
ATOM   3811 C CD1 . ILE A 1 469 ? 15.822  77.095 54.526 1.00 27.30 ? 469  ILE A CD1 1 
ATOM   3812 N N   . MET A 1 470 ? 13.287  79.053 49.821 1.00 29.50 ? 470  MET A N   1 
ATOM   3813 C CA  . MET A 1 470 ? 12.145  79.079 48.911 1.00 30.42 ? 470  MET A CA  1 
ATOM   3814 C C   . MET A 1 470 ? 12.612  79.023 47.459 1.00 29.66 ? 470  MET A C   1 
ATOM   3815 O O   . MET A 1 470 ? 11.989  78.365 46.621 1.00 28.89 ? 470  MET A O   1 
ATOM   3816 C CB  . MET A 1 470 ? 11.295  80.338 49.115 1.00 29.93 ? 470  MET A CB  1 
ATOM   3817 C CG  . MET A 1 470 ? 10.487  80.368 50.398 1.00 32.10 ? 470  MET A CG  1 
ATOM   3818 S SD  . MET A 1 470 ? 9.227   81.670 50.355 1.00 37.92 ? 470  MET A SD  1 
ATOM   3819 C CE  . MET A 1 470 ? 10.242  83.091 50.686 1.00 32.90 ? 470  MET A CE  1 
ATOM   3820 N N   . HIS A 1 471 ? 13.711  79.711 47.157 1.00 30.41 ? 471  HIS A N   1 
ATOM   3821 C CA  . HIS A 1 471 ? 14.222  79.725 45.793 1.00 29.87 ? 471  HIS A CA  1 
ATOM   3822 C C   . HIS A 1 471 ? 14.806  78.364 45.416 1.00 29.21 ? 471  HIS A C   1 
ATOM   3823 O O   . HIS A 1 471 ? 14.696  77.937 44.264 1.00 30.00 ? 471  HIS A O   1 
ATOM   3824 C CB  . HIS A 1 471 ? 15.268  80.833 45.614 1.00 31.67 ? 471  HIS A CB  1 
ATOM   3825 C CG  . HIS A 1 471 ? 15.548  81.163 44.179 1.00 34.59 ? 471  HIS A CG  1 
ATOM   3826 N ND1 . HIS A 1 471 ? 14.563  81.572 43.306 1.00 37.42 ? 471  HIS A ND1 1 
ATOM   3827 C CD2 . HIS A 1 471 ? 16.695  81.125 43.459 1.00 35.52 ? 471  HIS A CD2 1 
ATOM   3828 C CE1 . HIS A 1 471 ? 15.089  81.771 42.110 1.00 36.77 ? 471  HIS A CE1 1 
ATOM   3829 N NE2 . HIS A 1 471 ? 16.383  81.506 42.176 1.00 38.41 ? 471  HIS A NE2 1 
ATOM   3830 N N   . TYR A 1 472 ? 15.428  77.683 46.377 1.00 27.00 ? 472  TYR A N   1 
ATOM   3831 C CA  . TYR A 1 472 ? 15.976  76.350 46.111 1.00 27.07 ? 472  TYR A CA  1 
ATOM   3832 C C   . TYR A 1 472 ? 14.815  75.428 45.759 1.00 25.87 ? 472  TYR A C   1 
ATOM   3833 O O   . TYR A 1 472 ? 14.848  74.737 44.744 1.00 25.72 ? 472  TYR A O   1 
ATOM   3834 C CB  . TYR A 1 472 ? 16.661  75.747 47.343 1.00 27.97 ? 472  TYR A CB  1 
ATOM   3835 C CG  . TYR A 1 472 ? 18.053  76.239 47.655 1.00 30.26 ? 472  TYR A CG  1 
ATOM   3836 C CD1 . TYR A 1 472 ? 18.974  76.509 46.641 1.00 33.41 ? 472  TYR A CD1 1 
ATOM   3837 C CD2 . TYR A 1 472 ? 18.474  76.365 48.979 1.00 33.10 ? 472  TYR A CD2 1 
ATOM   3838 C CE1 . TYR A 1 472 ? 20.288  76.893 46.946 1.00 34.47 ? 472  TYR A CE1 1 
ATOM   3839 C CE2 . TYR A 1 472 ? 19.770  76.740 49.293 1.00 33.82 ? 472  TYR A CE2 1 
ATOM   3840 C CZ  . TYR A 1 472 ? 20.673  77.004 48.278 1.00 35.08 ? 472  TYR A CZ  1 
ATOM   3841 O OH  . TYR A 1 472 ? 21.954  77.384 48.611 1.00 36.38 ? 472  TYR A OH  1 
ATOM   3842 N N   . TRP A 1 473 ? 13.804  75.417 46.626 1.00 25.32 ? 473  TRP A N   1 
ATOM   3843 C CA  . TRP A 1 473 ? 12.629  74.569 46.441 1.00 25.37 ? 473  TRP A CA  1 
ATOM   3844 C C   . TRP A 1 473 ? 11.926  74.826 45.104 1.00 26.45 ? 473  TRP A C   1 
ATOM   3845 O O   . TRP A 1 473 ? 11.648  73.892 44.350 1.00 25.74 ? 473  TRP A O   1 
ATOM   3846 C CB  . TRP A 1 473 ? 11.626  74.786 47.586 1.00 24.65 ? 473  TRP A CB  1 
ATOM   3847 C CG  . TRP A 1 473 ? 11.723  73.821 48.768 1.00 26.00 ? 473  TRP A CG  1 
ATOM   3848 C CD1 . TRP A 1 473 ? 10.682  73.161 49.367 1.00 25.65 ? 473  TRP A CD1 1 
ATOM   3849 C CD2 . TRP A 1 473 ? 12.896  73.486 49.533 1.00 26.35 ? 473  TRP A CD2 1 
ATOM   3850 N NE1 . TRP A 1 473 ? 11.130  72.447 50.455 1.00 25.59 ? 473  TRP A NE1 1 
ATOM   3851 C CE2 . TRP A 1 473 ? 12.480  72.628 50.581 1.00 26.15 ? 473  TRP A CE2 1 
ATOM   3852 C CE3 . TRP A 1 473 ? 14.251  73.832 49.438 1.00 26.95 ? 473  TRP A CE3 1 
ATOM   3853 C CZ2 . TRP A 1 473 ? 13.376  72.108 51.528 1.00 26.82 ? 473  TRP A CZ2 1 
ATOM   3854 C CZ3 . TRP A 1 473 ? 15.144  73.314 50.384 1.00 27.73 ? 473  TRP A CZ3 1 
ATOM   3855 C CH2 . TRP A 1 473 ? 14.698  72.463 51.415 1.00 26.03 ? 473  TRP A CH2 1 
ATOM   3856 N N   . ALA A 1 474 ? 11.634  76.091 44.815 1.00 27.96 ? 474  ALA A N   1 
ATOM   3857 C CA  . ALA A 1 474 ? 10.933  76.449 43.583 1.00 27.88 ? 474  ALA A CA  1 
ATOM   3858 C C   . ALA A 1 474 ? 11.760  76.229 42.323 1.00 28.54 ? 474  ALA A C   1 
ATOM   3859 O O   . ALA A 1 474 ? 11.220  75.850 41.286 1.00 28.62 ? 474  ALA A O   1 
ATOM   3860 C CB  . ALA A 1 474 ? 10.459  77.896 43.652 1.00 27.98 ? 474  ALA A CB  1 
ATOM   3861 N N   . THR A 1 475 ? 13.065  76.474 42.399 1.00 28.73 ? 475  THR A N   1 
ATOM   3862 C CA  . THR A 1 475 ? 13.922  76.272 41.236 1.00 27.86 ? 475  THR A CA  1 
ATOM   3863 C C   . THR A 1 475 ? 14.021  74.772 40.965 1.00 28.09 ? 475  THR A C   1 
ATOM   3864 O O   . THR A 1 475 ? 14.052  74.334 39.813 1.00 27.67 ? 475  THR A O   1 
ATOM   3865 C CB  . THR A 1 475 ? 15.328  76.868 41.463 1.00 29.22 ? 475  THR A CB  1 
ATOM   3866 O OG1 . THR A 1 475 ? 15.208  78.280 41.681 1.00 28.32 ? 475  THR A OG1 1 
ATOM   3867 C CG2 . THR A 1 475 ? 16.215  76.626 40.246 1.00 28.38 ? 475  THR A CG2 1 
ATOM   3868 N N   . PHE A 1 476 ? 14.060  73.983 42.033 1.00 26.42 ? 476  PHE A N   1 
ATOM   3869 C CA  . PHE A 1 476 ? 14.117  72.538 41.883 1.00 25.72 ? 476  PHE A CA  1 
ATOM   3870 C C   . PHE A 1 476 ? 12.805  72.084 41.250 1.00 26.64 ? 476  PHE A C   1 
ATOM   3871 O O   . PHE A 1 476 ? 12.789  71.260 40.334 1.00 27.73 ? 476  PHE A O   1 
ATOM   3872 C CB  . PHE A 1 476 ? 14.284  71.850 43.242 1.00 25.99 ? 476  PHE A CB  1 
ATOM   3873 C CG  . PHE A 1 476 ? 14.099  70.359 43.182 1.00 25.54 ? 476  PHE A CG  1 
ATOM   3874 C CD1 . PHE A 1 476 ? 15.103  69.541 42.676 1.00 26.41 ? 476  PHE A CD1 1 
ATOM   3875 C CD2 . PHE A 1 476 ? 12.900  69.777 43.583 1.00 25.77 ? 476  PHE A CD2 1 
ATOM   3876 C CE1 . PHE A 1 476 ? 14.917  68.162 42.567 1.00 25.04 ? 476  PHE A CE1 1 
ATOM   3877 C CE2 . PHE A 1 476 ? 12.704  68.396 43.477 1.00 26.10 ? 476  PHE A CE2 1 
ATOM   3878 C CZ  . PHE A 1 476 ? 13.715  67.591 42.969 1.00 25.23 ? 476  PHE A CZ  1 
ATOM   3879 N N   . ALA A 1 477 ? 11.701  72.639 41.734 1.00 25.51 ? 477  ALA A N   1 
ATOM   3880 C CA  . ALA A 1 477 ? 10.394  72.275 41.208 1.00 26.95 ? 477  ALA A CA  1 
ATOM   3881 C C   . ALA A 1 477 ? 10.288  72.596 39.723 1.00 27.34 ? 477  ALA A C   1 
ATOM   3882 O O   . ALA A 1 477 ? 9.693   71.849 38.957 1.00 27.09 ? 477  ALA A O   1 
ATOM   3883 C CB  . ALA A 1 477 ? 9.299   73.012 41.980 1.00 25.68 ? 477  ALA A CB  1 
ATOM   3884 N N   A LYS A 1 478 ? 10.888  73.710 39.321 0.50 28.02 ? 478  LYS A N   1 
ATOM   3885 N N   B LYS A 1 478 ? 10.885  73.709 39.319 0.50 27.54 ? 478  LYS A N   1 
ATOM   3886 C CA  A LYS A 1 478 ? 10.838  74.144 37.932 0.50 29.57 ? 478  LYS A CA  1 
ATOM   3887 C CA  B LYS A 1 478 ? 10.831  74.136 37.930 0.50 28.72 ? 478  LYS A CA  1 
ATOM   3888 C C   A LYS A 1 478 ? 11.795  73.409 37.000 0.50 30.18 ? 478  LYS A C   1 
ATOM   3889 C C   B LYS A 1 478 ? 11.795  73.407 36.999 0.50 29.68 ? 478  LYS A C   1 
ATOM   3890 O O   A LYS A 1 478 ? 11.436  73.063 35.870 0.50 30.18 ? 478  LYS A O   1 
ATOM   3891 O O   B LYS A 1 478 ? 11.433  73.064 35.874 0.50 30.63 ? 478  LYS A O   1 
ATOM   3892 C CB  A LYS A 1 478 ? 11.122  75.647 37.855 0.50 31.49 ? 478  LYS A CB  1 
ATOM   3893 C CB  B LYS A 1 478 ? 11.094  75.642 37.845 0.50 29.79 ? 478  LYS A CB  1 
ATOM   3894 C CG  A LYS A 1 478 ? 10.159  76.497 38.663 0.50 33.44 ? 478  LYS A CG  1 
ATOM   3895 C CG  B LYS A 1 478 ? 11.032  76.212 36.439 0.50 29.89 ? 478  LYS A CG  1 
ATOM   3896 C CD  A LYS A 1 478 ? 10.495  77.976 38.580 0.50 37.30 ? 478  LYS A CD  1 
ATOM   3897 C CD  B LYS A 1 478 ? 11.326  77.703 36.443 0.50 33.01 ? 478  LYS A CD  1 
ATOM   3898 C CE  A LYS A 1 478 ? 9.467   78.806 39.331 0.50 38.67 ? 478  LYS A CE  1 
ATOM   3899 C CE  B LYS A 1 478 ? 11.289  78.278 35.034 0.50 35.71 ? 478  LYS A CE  1 
ATOM   3900 N NZ  A LYS A 1 478 ? 9.750   80.263 39.225 0.50 40.55 ? 478  LYS A NZ  1 
ATOM   3901 N NZ  B LYS A 1 478 ? 11.578  79.741 35.024 0.50 38.57 ? 478  LYS A NZ  1 
ATOM   3902 N N   . THR A 1 479 ? 13.011  73.159 37.472 1.00 29.48 ? 479  THR A N   1 
ATOM   3903 C CA  . THR A 1 479 ? 14.027  72.520 36.644 1.00 30.11 ? 479  THR A CA  1 
ATOM   3904 C C   . THR A 1 479 ? 14.608  71.177 37.054 1.00 31.31 ? 479  THR A C   1 
ATOM   3905 O O   . THR A 1 479 ? 15.294  70.542 36.248 1.00 30.08 ? 479  THR A O   1 
ATOM   3906 C CB  . THR A 1 479 ? 15.220  73.469 36.488 1.00 32.67 ? 479  THR A CB  1 
ATOM   3907 O OG1 . THR A 1 479 ? 15.908  73.557 37.743 1.00 32.30 ? 479  THR A OG1 1 
ATOM   3908 C CG2 . THR A 1 479 ? 14.745  74.865 36.100 1.00 32.69 ? 479  THR A CG2 1 
ATOM   3909 N N   . GLY A 1 480 ? 14.363  70.751 38.290 1.00 30.05 ? 480  GLY A N   1 
ATOM   3910 C CA  . GLY A 1 480 ? 14.923  69.491 38.746 1.00 30.05 ? 480  GLY A CA  1 
ATOM   3911 C C   . GLY A 1 480 ? 16.302  69.716 39.352 1.00 30.16 ? 480  GLY A C   1 
ATOM   3912 O O   . GLY A 1 480 ? 17.014  68.765 39.682 1.00 28.62 ? 480  GLY A O   1 
ATOM   3913 N N   . ASN A 1 481 ? 16.670  70.987 39.498 1.00 29.46 ? 481  ASN A N   1 
ATOM   3914 C CA  . ASN A 1 481 ? 17.958  71.393 40.063 1.00 30.74 ? 481  ASN A CA  1 
ATOM   3915 C C   . ASN A 1 481 ? 17.698  72.637 40.924 1.00 30.98 ? 481  ASN A C   1 
ATOM   3916 O O   . ASN A 1 481 ? 17.145  73.626 40.444 1.00 31.49 ? 481  ASN A O   1 
ATOM   3917 C CB  . ASN A 1 481 ? 18.927  71.733 38.922 1.00 32.55 ? 481  ASN A CB  1 
ATOM   3918 C CG  . ASN A 1 481 ? 20.346  71.970 39.398 1.00 32.57 ? 481  ASN A CG  1 
ATOM   3919 O OD1 . ASN A 1 481 ? 20.574  72.494 40.485 1.00 34.89 ? 481  ASN A OD1 1 
ATOM   3920 N ND2 . ASN A 1 481 ? 21.315  71.602 38.564 1.00 35.08 ? 481  ASN A ND2 1 
ATOM   3921 N N   . PRO A 1 482 ? 18.093  72.605 42.210 1.00 30.08 ? 482  PRO A N   1 
ATOM   3922 C CA  . PRO A 1 482 ? 17.876  73.753 43.102 1.00 30.90 ? 482  PRO A CA  1 
ATOM   3923 C C   . PRO A 1 482 ? 18.727  74.961 42.733 1.00 31.40 ? 482  PRO A C   1 
ATOM   3924 O O   . PRO A 1 482 ? 18.416  76.089 43.116 1.00 30.23 ? 482  PRO A O   1 
ATOM   3925 C CB  . PRO A 1 482 ? 18.276  73.226 44.484 1.00 30.20 ? 482  PRO A CB  1 
ATOM   3926 C CG  . PRO A 1 482 ? 18.553  71.750 44.290 1.00 33.79 ? 482  PRO A CG  1 
ATOM   3927 C CD  . PRO A 1 482 ? 18.923  71.582 42.862 1.00 30.33 ? 482  PRO A CD  1 
ATOM   3928 N N   . ASN A 1 483 ? 19.806  74.709 42.000 1.00 32.86 ? 483  ASN A N   1 
ATOM   3929 C CA  . ASN A 1 483 ? 20.746  75.755 41.609 1.00 36.21 ? 483  ASN A CA  1 
ATOM   3930 C C   . ASN A 1 483 ? 20.346  76.566 40.389 1.00 38.99 ? 483  ASN A C   1 
ATOM   3931 O O   . ASN A 1 483 ? 19.792  76.039 39.426 1.00 38.20 ? 483  ASN A O   1 
ATOM   3932 C CB  . ASN A 1 483 ? 22.122  75.139 41.356 1.00 34.19 ? 483  ASN A CB  1 
ATOM   3933 C CG  . ASN A 1 483 ? 22.659  74.418 42.569 1.00 34.83 ? 483  ASN A CG  1 
ATOM   3934 O OD1 . ASN A 1 483 ? 22.968  75.041 43.587 1.00 34.53 ? 483  ASN A OD1 1 
ATOM   3935 N ND2 . ASN A 1 483 ? 22.765  73.096 42.474 1.00 33.52 ? 483  ASN A ND2 1 
ATOM   3936 N N   . GLU A 1 484 ? 20.654  77.856 40.448 1.00 43.38 ? 484  GLU A N   1 
ATOM   3937 C CA  . GLU A 1 484 ? 20.375  78.781 39.360 1.00 49.30 ? 484  GLU A CA  1 
ATOM   3938 C C   . GLU A 1 484 ? 21.376  78.546 38.239 1.00 50.97 ? 484  GLU A C   1 
ATOM   3939 O O   . GLU A 1 484 ? 22.587  78.607 38.456 1.00 51.74 ? 484  GLU A O   1 
ATOM   3940 C CB  . GLU A 1 484 ? 20.507  80.222 39.852 1.00 51.98 ? 484  GLU A CB  1 
ATOM   3941 C CG  . GLU A 1 484 ? 19.300  80.747 40.589 1.00 56.31 ? 484  GLU A CG  1 
ATOM   3942 C CD  . GLU A 1 484 ? 18.174  81.103 39.645 1.00 58.17 ? 484  GLU A CD  1 
ATOM   3943 O OE1 . GLU A 1 484 ? 17.752  80.226 38.863 1.00 61.32 ? 484  GLU A OE1 1 
ATOM   3944 O OE2 . GLU A 1 484 ? 17.712  82.261 39.686 1.00 60.09 ? 484  GLU A OE2 1 
ATOM   3945 N N   . PRO A 1 485 ? 20.885  78.261 37.024 0.50 52.62 ? 485  PRO A N   1 
ATOM   3946 C CA  . PRO A 1 485 ? 21.807  78.033 35.912 0.50 53.60 ? 485  PRO A CA  1 
ATOM   3947 C C   . PRO A 1 485 ? 22.674  79.265 35.669 0.50 54.71 ? 485  PRO A C   1 
ATOM   3948 O O   . PRO A 1 485 ? 22.161  80.340 35.358 0.50 54.39 ? 485  PRO A O   1 
ATOM   3949 C CB  . PRO A 1 485 ? 20.868  77.747 34.744 0.50 53.53 ? 485  PRO A CB  1 
ATOM   3950 C CG  . PRO A 1 485 ? 19.703  77.088 35.411 0.50 53.56 ? 485  PRO A CG  1 
ATOM   3951 C CD  . PRO A 1 485 ? 19.499  77.959 36.628 0.50 52.91 ? 485  PRO A CD  1 
ATOM   3952 N N   . HIS A 1 486 ? 23.983  79.105 35.835 0.50 55.74 ? 486  HIS A N   1 
ATOM   3953 C CA  . HIS A 1 486 ? 24.941  80.187 35.617 0.50 57.67 ? 486  HIS A CA  1 
ATOM   3954 C C   . HIS A 1 486 ? 24.922  81.307 36.658 0.50 58.56 ? 486  HIS A C   1 
ATOM   3955 O O   . HIS A 1 486 ? 25.107  82.474 36.311 0.50 58.79 ? 486  HIS A O   1 
ATOM   3956 C CB  . HIS A 1 486 ? 24.729  80.803 34.229 0.50 57.85 ? 486  HIS A CB  1 
ATOM   3957 C CG  . HIS A 1 486 ? 24.697  79.798 33.119 0.50 58.16 ? 486  HIS A CG  1 
ATOM   3958 N ND1 . HIS A 1 486 ? 25.768  78.992 32.812 0.50 58.33 ? 486  HIS A ND1 1 
ATOM   3959 C CD2 . HIS A 1 486 ? 23.713  79.472 32.245 0.50 58.22 ? 486  HIS A CD2 1 
ATOM   3960 C CE1 . HIS A 1 486 ? 25.450  78.209 31.792 0.50 58.57 ? 486  HIS A CE1 1 
ATOM   3961 N NE2 . HIS A 1 486 ? 24.210  78.482 31.432 0.50 58.26 ? 486  HIS A NE2 1 
ATOM   3962 N N   . SER A 1 487 ? 24.703  80.971 37.926 1.00 59.91 ? 487  SER A N   1 
ATOM   3963 C CA  . SER A 1 487 ? 24.691  81.994 38.970 1.00 61.15 ? 487  SER A CA  1 
ATOM   3964 C C   . SER A 1 487 ? 26.066  82.041 39.632 1.00 61.28 ? 487  SER A C   1 
ATOM   3965 O O   . SER A 1 487 ? 26.897  81.159 39.411 1.00 60.95 ? 487  SER A O   1 
ATOM   3966 C CB  . SER A 1 487 ? 23.630  81.685 40.030 1.00 61.26 ? 487  SER A CB  1 
ATOM   3967 O OG  . SER A 1 487 ? 24.090  80.701 40.940 1.00 63.14 ? 487  SER A OG  1 
ATOM   3968 N N   . GLN A 1 488 ? 26.303  83.066 40.445 1.00 61.95 ? 488  GLN A N   1 
ATOM   3969 C CA  . GLN A 1 488 ? 27.584  83.213 41.127 1.00 62.93 ? 488  GLN A CA  1 
ATOM   3970 C C   . GLN A 1 488 ? 27.547  82.722 42.573 1.00 62.25 ? 488  GLN A C   1 
ATOM   3971 O O   . GLN A 1 488 ? 28.556  82.768 43.277 1.00 62.40 ? 488  GLN A O   1 
ATOM   3972 C CB  . GLN A 1 488 ? 28.034  84.678 41.097 1.00 64.88 ? 488  GLN A CB  1 
ATOM   3973 C CG  . GLN A 1 488 ? 28.388  85.211 39.714 1.00 67.64 ? 488  GLN A CG  1 
ATOM   3974 C CD  . GLN A 1 488 ? 29.425  84.355 39.005 1.00 69.25 ? 488  GLN A CD  1 
ATOM   3975 O OE1 . GLN A 1 488 ? 30.377  83.874 39.621 1.00 70.68 ? 488  GLN A OE1 1 
ATOM   3976 N NE2 . GLN A 1 488 ? 29.250  84.172 37.700 1.00 70.10 ? 488  GLN A NE2 1 
ATOM   3977 N N   . GLU A 1 489 ? 26.386  82.247 43.011 1.00 60.47 ? 489  GLU A N   1 
ATOM   3978 C CA  . GLU A 1 489 ? 26.229  81.755 44.377 1.00 58.24 ? 489  GLU A CA  1 
ATOM   3979 C C   . GLU A 1 489 ? 26.783  80.340 44.546 1.00 56.13 ? 489  GLU A C   1 
ATOM   3980 O O   . GLU A 1 489 ? 26.941  79.605 43.570 1.00 56.18 ? 489  GLU A O   1 
ATOM   3981 C CB  . GLU A 1 489 ? 24.751  81.780 44.771 1.00 58.61 ? 489  GLU A CB  1 
ATOM   3982 C CG  . GLU A 1 489 ? 24.119  83.160 44.697 1.00 59.36 ? 489  GLU A CG  1 
ATOM   3983 N N   . SER A 1 490 ? 27.083  79.968 45.789 1.00 53.07 ? 490  SER A N   1 
ATOM   3984 C CA  . SER A 1 490 ? 27.609  78.638 46.087 1.00 50.70 ? 490  SER A CA  1 
ATOM   3985 C C   . SER A 1 490 ? 26.628  77.583 45.581 1.00 47.69 ? 490  SER A C   1 
ATOM   3986 O O   . SER A 1 490 ? 25.415  77.732 45.726 1.00 47.68 ? 490  SER A O   1 
ATOM   3987 C CB  . SER A 1 490 ? 27.820  78.476 47.597 1.00 51.63 ? 490  SER A CB  1 
ATOM   3988 N N   . LYS A 1 491 ? 27.154  76.516 44.991 1.00 45.11 ? 491  LYS A N   1 
ATOM   3989 C CA  . LYS A 1 491 ? 26.306  75.465 44.444 1.00 43.08 ? 491  LYS A CA  1 
ATOM   3990 C C   . LYS A 1 491 ? 26.011  74.299 45.384 1.00 41.13 ? 491  LYS A C   1 
ATOM   3991 O O   . LYS A 1 491 ? 26.886  73.817 46.105 1.00 40.38 ? 491  LYS A O   1 
ATOM   3992 C CB  . LYS A 1 491 ? 26.918  74.919 43.150 1.00 44.22 ? 491  LYS A CB  1 
ATOM   3993 C CG  . LYS A 1 491 ? 27.130  75.966 42.061 1.00 46.87 ? 491  LYS A CG  1 
ATOM   3994 C CD  . LYS A 1 491 ? 25.824  76.637 41.653 1.00 47.25 ? 491  LYS A CD  1 
ATOM   3995 N N   . TRP A 1 492 ? 24.756  73.861 45.360 1.00 37.15 ? 492  TRP A N   1 
ATOM   3996 C CA  . TRP A 1 492 ? 24.291  72.729 46.155 1.00 32.88 ? 492  TRP A CA  1 
ATOM   3997 C C   . TRP A 1 492 ? 24.657  71.537 45.284 1.00 32.59 ? 492  TRP A C   1 
ATOM   3998 O O   . TRP A 1 492 ? 24.048  71.315 44.236 1.00 33.21 ? 492  TRP A O   1 
ATOM   3999 C CB  . TRP A 1 492 ? 22.771  72.813 46.314 1.00 32.00 ? 492  TRP A CB  1 
ATOM   4000 C CG  . TRP A 1 492 ? 22.141  71.757 47.175 1.00 30.91 ? 492  TRP A CG  1 
ATOM   4001 C CD1 . TRP A 1 492 ? 22.632  70.512 47.459 1.00 31.20 ? 492  TRP A CD1 1 
ATOM   4002 C CD2 . TRP A 1 492 ? 20.861  71.835 47.810 1.00 29.06 ? 492  TRP A CD2 1 
ATOM   4003 N NE1 . TRP A 1 492 ? 21.732  69.812 48.231 1.00 29.90 ? 492  TRP A NE1 1 
ATOM   4004 C CE2 . TRP A 1 492 ? 20.637  70.603 48.460 1.00 29.34 ? 492  TRP A CE2 1 
ATOM   4005 C CE3 . TRP A 1 492 ? 19.881  72.833 47.890 1.00 28.37 ? 492  TRP A CE3 1 
ATOM   4006 C CZ2 . TRP A 1 492 ? 19.469  70.337 49.185 1.00 26.49 ? 492  TRP A CZ2 1 
ATOM   4007 C CZ3 . TRP A 1 492 ? 18.713  72.571 48.614 1.00 28.68 ? 492  TRP A CZ3 1 
ATOM   4008 C CH2 . TRP A 1 492 ? 18.520  71.328 49.251 1.00 29.27 ? 492  TRP A CH2 1 
ATOM   4009 N N   . PRO A 1 493 ? 25.666  70.759 45.693 1.00 32.26 ? 493  PRO A N   1 
ATOM   4010 C CA  . PRO A 1 493 ? 26.063  69.606 44.886 1.00 32.29 ? 493  PRO A CA  1 
ATOM   4011 C C   . PRO A 1 493 ? 25.052  68.472 44.859 1.00 32.96 ? 493  PRO A C   1 
ATOM   4012 O O   . PRO A 1 493 ? 24.260  68.289 45.784 1.00 31.07 ? 493  PRO A O   1 
ATOM   4013 C CB  . PRO A 1 493 ? 27.386  69.187 45.519 1.00 32.59 ? 493  PRO A CB  1 
ATOM   4014 C CG  . PRO A 1 493 ? 27.162  69.507 46.957 1.00 33.11 ? 493  PRO A CG  1 
ATOM   4015 C CD  . PRO A 1 493 ? 26.510  70.873 46.895 1.00 31.80 ? 493  PRO A CD  1 
ATOM   4016 N N   . LEU A 1 494 ? 25.098  67.716 43.772 1.00 32.15 ? 494  LEU A N   1 
ATOM   4017 C CA  . LEU A 1 494 ? 24.234  66.572 43.571 1.00 33.93 ? 494  LEU A CA  1 
ATOM   4018 C C   . LEU A 1 494 ? 24.714  65.457 44.512 1.00 33.97 ? 494  LEU A C   1 
ATOM   4019 O O   . LEU A 1 494 ? 25.918  65.271 44.704 1.00 32.03 ? 494  LEU A O   1 
ATOM   4020 C CB  . LEU A 1 494 ? 24.354  66.134 42.110 1.00 36.08 ? 494  LEU A CB  1 
ATOM   4021 C CG  . LEU A 1 494 ? 23.412  65.153 41.422 1.00 39.22 ? 494  LEU A CG  1 
ATOM   4022 C CD1 . LEU A 1 494 ? 21.987  65.691 41.381 1.00 36.60 ? 494  LEU A CD1 1 
ATOM   4023 C CD2 . LEU A 1 494 ? 23.929  64.936 40.001 1.00 40.15 ? 494  LEU A CD2 1 
ATOM   4024 N N   . PHE A 1 495 ? 23.778  64.741 45.130 1.00 33.15 ? 495  PHE A N   1 
ATOM   4025 C CA  . PHE A 1 495 ? 24.144  63.636 46.005 1.00 32.76 ? 495  PHE A CA  1 
ATOM   4026 C C   . PHE A 1 495 ? 24.360  62.434 45.089 1.00 33.28 ? 495  PHE A C   1 
ATOM   4027 O O   . PHE A 1 495 ? 23.471  62.066 44.322 1.00 33.82 ? 495  PHE A O   1 
ATOM   4028 C CB  . PHE A 1 495 ? 23.022  63.351 47.017 1.00 30.68 ? 495  PHE A CB  1 
ATOM   4029 C CG  . PHE A 1 495 ? 23.201  62.065 47.793 1.00 30.61 ? 495  PHE A CG  1 
ATOM   4030 C CD1 . PHE A 1 495 ? 22.969  60.831 47.193 1.00 30.49 ? 495  PHE A CD1 1 
ATOM   4031 C CD2 . PHE A 1 495 ? 23.594  62.092 49.130 1.00 29.33 ? 495  PHE A CD2 1 
ATOM   4032 C CE1 . PHE A 1 495 ? 23.125  59.641 47.911 1.00 30.88 ? 495  PHE A CE1 1 
ATOM   4033 C CE2 . PHE A 1 495 ? 23.752  60.909 49.857 1.00 28.90 ? 495  PHE A CE2 1 
ATOM   4034 C CZ  . PHE A 1 495 ? 23.517  59.680 49.245 1.00 29.24 ? 495  PHE A CZ  1 
ATOM   4035 N N   . THR A 1 496 ? 25.543  61.834 45.151 1.00 33.65 ? 496  THR A N   1 
ATOM   4036 C CA  . THR A 1 496 ? 25.841  60.677 44.315 1.00 34.42 ? 496  THR A CA  1 
ATOM   4037 C C   . THR A 1 496 ? 26.167  59.465 45.175 1.00 36.06 ? 496  THR A C   1 
ATOM   4038 O O   . THR A 1 496 ? 26.584  59.603 46.321 1.00 34.69 ? 496  THR A O   1 
ATOM   4039 C CB  . THR A 1 496 ? 27.033  60.949 43.380 1.00 34.34 ? 496  THR A CB  1 
ATOM   4040 O OG1 . THR A 1 496 ? 28.227  61.108 44.158 1.00 34.09 ? 496  THR A OG1 1 
ATOM   4041 C CG2 . THR A 1 496 ? 26.787  62.213 42.565 1.00 34.39 ? 496  THR A CG2 1 
ATOM   4042 N N   . THR A 1 497 ? 25.968  58.277 44.614 1.00 38.91 ? 497  THR A N   1 
ATOM   4043 C CA  . THR A 1 497 ? 26.228  57.034 45.330 1.00 42.18 ? 497  THR A CA  1 
ATOM   4044 C C   . THR A 1 497 ? 27.650  56.982 45.880 1.00 42.91 ? 497  THR A C   1 
ATOM   4045 O O   . THR A 1 497 ? 27.887  56.470 46.975 1.00 44.83 ? 497  THR A O   1 
ATOM   4046 C CB  . THR A 1 497 ? 26.015  55.809 44.410 1.00 43.48 ? 497  THR A CB  1 
ATOM   4047 O OG1 . THR A 1 497 ? 24.647  55.759 43.981 1.00 45.75 ? 497  THR A OG1 1 
ATOM   4048 C CG2 . THR A 1 497 ? 26.356  54.524 45.145 1.00 43.75 ? 497  THR A CG2 1 
ATOM   4049 N N   . LYS A 1 498 ? 28.590  57.531 45.120 1.00 43.53 ? 498  LYS A N   1 
ATOM   4050 C CA  . LYS A 1 498 ? 29.994  57.525 45.506 1.00 43.25 ? 498  LYS A CA  1 
ATOM   4051 C C   . LYS A 1 498 ? 30.411  58.590 46.523 1.00 42.09 ? 498  LYS A C   1 
ATOM   4052 O O   . LYS A 1 498 ? 31.025  58.268 47.541 1.00 41.36 ? 498  LYS A O   1 
ATOM   4053 C CB  . LYS A 1 498 ? 30.860  57.651 44.251 1.00 45.54 ? 498  LYS A CB  1 
ATOM   4054 C CG  . LYS A 1 498 ? 32.358  57.600 44.506 1.00 49.54 ? 498  LYS A CG  1 
ATOM   4055 C CD  . LYS A 1 498 ? 33.129  57.812 43.211 1.00 52.38 ? 498  LYS A CD  1 
ATOM   4056 C CE  . LYS A 1 498 ? 34.629  57.792 43.440 1.00 55.20 ? 498  LYS A CE  1 
ATOM   4057 N NZ  . LYS A 1 498 ? 35.372  58.045 42.173 1.00 57.39 ? 498  LYS A NZ  1 
ATOM   4058 N N   . GLU A 1 499 ? 30.079  59.851 46.253 1.00 40.11 ? 499  GLU A N   1 
ATOM   4059 C CA  . GLU A 1 499 ? 30.462  60.955 47.134 1.00 39.22 ? 499  GLU A CA  1 
ATOM   4060 C C   . GLU A 1 499 ? 29.487  61.238 48.283 1.00 36.84 ? 499  GLU A C   1 
ATOM   4061 O O   . GLU A 1 499 ? 29.892  61.722 49.341 1.00 34.83 ? 499  GLU A O   1 
ATOM   4062 C CB  . GLU A 1 499 ? 30.650  62.233 46.315 1.00 43.00 ? 499  GLU A CB  1 
ATOM   4063 C CG  . GLU A 1 499 ? 31.583  62.104 45.119 1.00 50.29 ? 499  GLU A CG  1 
ATOM   4064 C CD  . GLU A 1 499 ? 32.994  61.717 45.505 1.00 54.84 ? 499  GLU A CD  1 
ATOM   4065 O OE1 . GLU A 1 499 ? 33.796  62.625 45.810 1.00 58.56 ? 499  GLU A OE1 1 
ATOM   4066 O OE2 . GLU A 1 499 ? 33.300  60.506 45.512 1.00 59.08 ? 499  GLU A OE2 1 
ATOM   4067 N N   . GLN A 1 500 ? 28.204  60.971 48.061 1.00 34.58 ? 500  GLN A N   1 
ATOM   4068 C CA  . GLN A 1 500 ? 27.174  61.172 49.083 1.00 34.09 ? 500  GLN A CA  1 
ATOM   4069 C C   . GLN A 1 500 ? 27.229  62.544 49.758 1.00 31.48 ? 500  GLN A C   1 
ATOM   4070 O O   . GLN A 1 500 ? 27.137  62.658 50.980 1.00 30.48 ? 500  GLN A O   1 
ATOM   4071 C CB  . GLN A 1 500 ? 27.288  60.052 50.121 1.00 35.92 ? 500  GLN A CB  1 
ATOM   4072 C CG  . GLN A 1 500 ? 27.268  58.673 49.463 1.00 38.31 ? 500  GLN A CG  1 
ATOM   4073 C CD  . GLN A 1 500 ? 27.571  57.535 50.417 1.00 40.79 ? 500  GLN A CD  1 
ATOM   4074 O OE1 . GLN A 1 500 ? 28.004  56.461 49.994 1.00 44.11 ? 500  GLN A OE1 1 
ATOM   4075 N NE2 . GLN A 1 500 ? 27.338  57.755 51.701 1.00 39.61 ? 500  GLN A NE2 1 
ATOM   4076 N N   . LYS A 1 501 ? 27.354  63.588 48.947 1.00 29.53 ? 501  LYS A N   1 
ATOM   4077 C CA  . LYS A 1 501 ? 27.432  64.951 49.455 1.00 30.28 ? 501  LYS A CA  1 
ATOM   4078 C C   . LYS A 1 501 ? 26.079  65.559 49.807 1.00 30.59 ? 501  LYS A C   1 
ATOM   4079 O O   . LYS A 1 501 ? 25.045  65.199 49.233 1.00 30.67 ? 501  LYS A O   1 
ATOM   4080 C CB  . LYS A 1 501 ? 28.114  65.856 48.423 1.00 32.09 ? 501  LYS A CB  1 
ATOM   4081 C CG  . LYS A 1 501 ? 29.532  65.439 48.052 1.00 34.23 ? 501  LYS A CG  1 
ATOM   4082 C CD  . LYS A 1 501 ? 30.110  66.380 46.994 1.00 36.70 ? 501  LYS A CD  1 
ATOM   4083 C CE  . LYS A 1 501 ? 31.511  65.965 46.578 1.00 39.10 ? 501  LYS A CE  1 
ATOM   4084 N NZ  . LYS A 1 501 ? 32.055  66.870 45.521 1.00 41.83 ? 501  LYS A NZ  1 
ATOM   4085 N N   . PHE A 1 502 ? 26.100  66.478 50.763 1.00 28.83 ? 502  PHE A N   1 
ATOM   4086 C CA  . PHE A 1 502 ? 24.902  67.196 51.186 1.00 30.48 ? 502  PHE A CA  1 
ATOM   4087 C C   . PHE A 1 502 ? 25.346  68.539 51.737 1.00 29.88 ? 502  PHE A C   1 
ATOM   4088 O O   . PHE A 1 502 ? 26.530  68.749 51.993 1.00 30.74 ? 502  PHE A O   1 
ATOM   4089 C CB  . PHE A 1 502 ? 24.117  66.423 52.261 1.00 28.87 ? 502  PHE A CB  1 
ATOM   4090 C CG  . PHE A 1 502 ? 24.823  66.310 53.591 1.00 27.46 ? 502  PHE A CG  1 
ATOM   4091 C CD1 . PHE A 1 502 ? 25.754  65.303 53.818 1.00 28.26 ? 502  PHE A CD1 1 
ATOM   4092 C CD2 . PHE A 1 502 ? 24.513  67.181 54.633 1.00 28.62 ? 502  PHE A CD2 1 
ATOM   4093 C CE1 . PHE A 1 502 ? 26.364  65.161 55.070 1.00 29.39 ? 502  PHE A CE1 1 
ATOM   4094 C CE2 . PHE A 1 502 ? 25.116  67.049 55.888 1.00 27.95 ? 502  PHE A CE2 1 
ATOM   4095 C CZ  . PHE A 1 502 ? 26.042  66.032 56.104 1.00 27.07 ? 502  PHE A CZ  1 
ATOM   4096 N N   . ILE A 1 503 ? 24.403  69.455 51.906 1.00 29.92 ? 503  ILE A N   1 
ATOM   4097 C CA  . ILE A 1 503 ? 24.735  70.765 52.439 1.00 30.28 ? 503  ILE A CA  1 
ATOM   4098 C C   . ILE A 1 503 ? 23.947  71.041 53.708 1.00 31.51 ? 503  ILE A C   1 
ATOM   4099 O O   . ILE A 1 503 ? 22.919  70.415 53.963 1.00 29.24 ? 503  ILE A O   1 
ATOM   4100 C CB  . ILE A 1 503 ? 24.401  71.898 51.439 1.00 31.72 ? 503  ILE A CB  1 
ATOM   4101 C CG1 . ILE A 1 503 ? 22.893  71.935 51.181 1.00 31.78 ? 503  ILE A CG1 1 
ATOM   4102 C CG2 . ILE A 1 503 ? 25.146  71.686 50.135 1.00 31.99 ? 503  ILE A CG2 1 
ATOM   4103 C CD1 . ILE A 1 503 ? 22.417  73.207 50.515 1.00 34.79 ? 503  ILE A CD1 1 
ATOM   4104 N N   . ASP A 1 504 ? 24.449  71.968 54.515 1.00 31.64 ? 504  ASP A N   1 
ATOM   4105 C CA  . ASP A 1 504 ? 23.744  72.364 55.721 1.00 34.66 ? 504  ASP A CA  1 
ATOM   4106 C C   . ASP A 1 504 ? 22.875  73.528 55.273 1.00 34.21 ? 504  ASP A C   1 
ATOM   4107 O O   . ASP A 1 504 ? 23.190  74.197 54.287 1.00 34.43 ? 504  ASP A O   1 
ATOM   4108 C CB  . ASP A 1 504 ? 24.699  72.874 56.806 1.00 38.21 ? 504  ASP A CB  1 
ATOM   4109 C CG  . ASP A 1 504 ? 25.660  71.813 57.295 1.00 44.51 ? 504  ASP A CG  1 
ATOM   4110 O OD1 . ASP A 1 504 ? 25.228  70.662 57.505 1.00 45.51 ? 504  ASP A OD1 1 
ATOM   4111 O OD2 . ASP A 1 504 ? 26.851  72.138 57.485 1.00 48.09 ? 504  ASP A OD2 1 
ATOM   4112 N N   . LEU A 1 505 ? 21.776  73.753 55.979 1.00 32.07 ? 505  LEU A N   1 
ATOM   4113 C CA  . LEU A 1 505 ? 20.898  74.870 55.681 1.00 32.63 ? 505  LEU A CA  1 
ATOM   4114 C C   . LEU A 1 505 ? 20.798  75.697 56.950 1.00 32.56 ? 505  LEU A C   1 
ATOM   4115 O O   . LEU A 1 505 ? 20.136  75.303 57.909 1.00 31.70 ? 505  LEU A O   1 
ATOM   4116 C CB  . LEU A 1 505 ? 19.502  74.395 55.256 1.00 33.26 ? 505  LEU A CB  1 
ATOM   4117 C CG  . LEU A 1 505 ? 19.335  73.948 53.802 1.00 33.49 ? 505  LEU A CG  1 
ATOM   4118 C CD1 . LEU A 1 505 ? 17.876  73.569 53.550 1.00 31.37 ? 505  LEU A CD1 1 
ATOM   4119 C CD2 . LEU A 1 505 ? 19.760  75.082 52.860 1.00 33.40 ? 505  LEU A CD2 1 
ATOM   4120 N N   . ASN A 1 506 ? 21.491  76.830 56.962 1.00 32.92 ? 506  ASN A N   1 
ATOM   4121 C CA  . ASN A 1 506 ? 21.480  77.723 58.109 1.00 34.37 ? 506  ASN A CA  1 
ATOM   4122 C C   . ASN A 1 506 ? 21.867  79.124 57.641 1.00 35.44 ? 506  ASN A C   1 
ATOM   4123 O O   . ASN A 1 506 ? 22.005  79.359 56.445 1.00 33.66 ? 506  ASN A O   1 
ATOM   4124 C CB  . ASN A 1 506 ? 22.445  77.218 59.193 1.00 35.12 ? 506  ASN A CB  1 
ATOM   4125 C CG  . ASN A 1 506 ? 23.849  76.996 58.671 1.00 35.84 ? 506  ASN A CG  1 
ATOM   4126 O OD1 . ASN A 1 506 ? 24.444  77.887 58.068 1.00 37.71 ? 506  ASN A OD1 1 
ATOM   4127 N ND2 . ASN A 1 506 ? 24.392  75.805 58.911 1.00 34.81 ? 506  ASN A ND2 1 
ATOM   4128 N N   . THR A 1 507 ? 22.040  80.052 58.574 1.00 38.26 ? 507  THR A N   1 
ATOM   4129 C CA  . THR A 1 507 ? 22.379  81.426 58.207 1.00 41.78 ? 507  THR A CA  1 
ATOM   4130 C C   . THR A 1 507 ? 23.863  81.662 57.929 1.00 44.54 ? 507  THR A C   1 
ATOM   4131 O O   . THR A 1 507 ? 24.268  82.775 57.599 1.00 45.54 ? 507  THR A O   1 
ATOM   4132 C CB  . THR A 1 507 ? 21.923  82.418 59.294 1.00 40.84 ? 507  THR A CB  1 
ATOM   4133 O OG1 . THR A 1 507 ? 22.605  82.130 60.520 1.00 40.83 ? 507  THR A OG1 1 
ATOM   4134 C CG2 . THR A 1 507 ? 20.422  82.306 59.516 1.00 38.69 ? 507  THR A CG2 1 
ATOM   4135 N N   A GLU A 1 508 ? 24.665  80.610 58.063 0.50 45.79 ? 508  GLU A N   1 
ATOM   4136 N N   B GLU A 1 508 ? 24.663  80.610 58.057 0.50 45.63 ? 508  GLU A N   1 
ATOM   4137 C CA  A GLU A 1 508 ? 26.102  80.697 57.821 0.50 47.35 ? 508  GLU A CA  1 
ATOM   4138 C CA  B GLU A 1 508 ? 26.099  80.704 57.822 0.50 47.08 ? 508  GLU A CA  1 
ATOM   4139 C C   A GLU A 1 508 ? 26.422  80.314 56.378 0.50 48.01 ? 508  GLU A C   1 
ATOM   4140 C C   B GLU A 1 508 ? 26.421  80.317 56.379 0.50 47.86 ? 508  GLU A C   1 
ATOM   4141 O O   A GLU A 1 508 ? 25.598  79.710 55.692 0.50 47.43 ? 508  GLU A O   1 
ATOM   4142 O O   B GLU A 1 508 ? 25.597  79.714 55.692 0.50 47.28 ? 508  GLU A O   1 
ATOM   4143 C CB  A GLU A 1 508 ? 26.853  79.763 58.775 0.50 48.58 ? 508  GLU A CB  1 
ATOM   4144 C CB  B GLU A 1 508 ? 26.840  79.778 58.791 0.50 47.99 ? 508  GLU A CB  1 
ATOM   4145 C CG  A GLU A 1 508 ? 26.374  79.921 60.231 0.50 49.73 ? 508  GLU A CG  1 
ATOM   4146 C CG  B GLU A 1 508 ? 26.657  80.082 60.247 0.50 50.82 ? 508  GLU A CG  1 
ATOM   4147 C CD  A GLU A 1 508 ? 27.055  78.948 61.169 0.50 50.81 ? 508  GLU A CD  1 
ATOM   4148 C CD  B GLU A 1 508 ? 27.245  81.423 60.634 0.50 52.44 ? 508  GLU A CD  1 
ATOM   4149 O OE1 A GLU A 1 508 ? 27.083  77.739 60.859 0.50 51.09 ? 508  GLU A OE1 1 
ATOM   4150 O OE1 B GLU A 1 508 ? 28.481  81.579 60.542 0.50 53.80 ? 508  GLU A OE1 1 
ATOM   4151 O OE2 A GLU A 1 508 ? 27.557  79.391 62.224 0.50 51.91 ? 508  GLU A OE2 1 
ATOM   4152 O OE2 B GLU A 1 508 ? 26.471  82.321 61.032 0.50 54.22 ? 508  GLU A OE2 1 
ATOM   4153 N N   . PRO A 1 509 ? 27.626  80.669 55.897 1.00 48.20 ? 509  PRO A N   1 
ATOM   4154 C CA  . PRO A 1 509 ? 28.027  80.343 54.525 1.00 49.03 ? 509  PRO A CA  1 
ATOM   4155 C C   . PRO A 1 509 ? 27.878  78.851 54.255 1.00 49.04 ? 509  PRO A C   1 
ATOM   4156 O O   . PRO A 1 509 ? 28.245  78.025 55.088 1.00 48.35 ? 509  PRO A O   1 
ATOM   4157 C CB  . PRO A 1 509 ? 29.481  80.803 54.476 1.00 49.06 ? 509  PRO A CB  1 
ATOM   4158 C CG  . PRO A 1 509 ? 29.473  81.990 55.390 1.00 49.69 ? 509  PRO A CG  1 
ATOM   4159 C CD  . PRO A 1 509 ? 28.661  81.482 56.564 1.00 48.98 ? 509  PRO A CD  1 
ATOM   4160 N N   . MET A 1 510 ? 27.341  78.514 53.088 1.00 49.85 ? 510  MET A N   1 
ATOM   4161 C CA  . MET A 1 510 ? 27.127  77.119 52.717 1.00 50.14 ? 510  MET A CA  1 
ATOM   4162 C C   . MET A 1 510 ? 28.354  76.240 52.896 1.00 48.96 ? 510  MET A C   1 
ATOM   4163 O O   . MET A 1 510 ? 29.463  76.614 52.517 1.00 49.49 ? 510  MET A O   1 
ATOM   4164 C CB  . MET A 1 510 ? 26.657  77.012 51.261 1.00 52.01 ? 510  MET A CB  1 
ATOM   4165 C CG  . MET A 1 510 ? 26.371  75.578 50.820 1.00 53.11 ? 510  MET A CG  1 
ATOM   4166 S SD  . MET A 1 510 ? 26.098  75.393 49.043 1.00 55.06 ? 510  MET A SD  1 
ATOM   4167 C CE  . MET A 1 510 ? 24.392  75.873 48.910 1.00 55.29 ? 510  MET A CE  1 
ATOM   4168 N N   . LYS A 1 511 ? 28.138  75.068 53.479 1.00 46.65 ? 511  LYS A N   1 
ATOM   4169 C CA  . LYS A 1 511 ? 29.196  74.095 53.688 1.00 45.24 ? 511  LYS A CA  1 
ATOM   4170 C C   . LYS A 1 511 ? 28.716  72.761 53.147 1.00 43.26 ? 511  LYS A C   1 
ATOM   4171 O O   . LYS A 1 511 ? 27.576  72.356 53.389 1.00 42.03 ? 511  LYS A O   1 
ATOM   4172 C CB  . LYS A 1 511 ? 29.524  73.934 55.171 1.00 48.41 ? 511  LYS A CB  1 
ATOM   4173 C CG  . LYS A 1 511 ? 30.455  74.982 55.738 1.00 52.15 ? 511  LYS A CG  1 
ATOM   4174 C CD  . LYS A 1 511 ? 30.953  74.546 57.109 1.00 55.92 ? 511  LYS A CD  1 
ATOM   4175 C CE  . LYS A 1 511 ? 31.909  75.558 57.709 1.00 57.81 ? 511  LYS A CE  1 
ATOM   4176 N NZ  . LYS A 1 511 ? 31.241  76.867 57.931 1.00 60.07 ? 511  LYS A NZ  1 
ATOM   4177 N N   . VAL A 1 512 ? 29.587  72.088 52.410 1.00 40.11 ? 512  VAL A N   1 
ATOM   4178 C CA  . VAL A 1 512 ? 29.266  70.792 51.842 1.00 38.12 ? 512  VAL A CA  1 
ATOM   4179 C C   . VAL A 1 512 ? 29.877  69.713 52.728 1.00 37.79 ? 512  VAL A C   1 
ATOM   4180 O O   . VAL A 1 512 ? 31.021  69.834 53.167 1.00 37.18 ? 512  VAL A O   1 
ATOM   4181 C CB  . VAL A 1 512 ? 29.826  70.660 50.409 1.00 38.31 ? 512  VAL A CB  1 
ATOM   4182 C CG1 . VAL A 1 512 ? 29.560  69.265 49.865 1.00 37.54 ? 512  VAL A CG1 1 
ATOM   4183 C CG2 . VAL A 1 512 ? 29.192  71.711 49.508 1.00 38.13 ? 512  VAL A CG2 1 
ATOM   4184 N N   . HIS A 1 513 ? 29.103  68.670 53.002 1.00 35.60 ? 513  HIS A N   1 
ATOM   4185 C CA  . HIS A 1 513 ? 29.566  67.564 53.833 1.00 35.11 ? 513  HIS A CA  1 
ATOM   4186 C C   . HIS A 1 513 ? 29.308  66.259 53.101 1.00 33.82 ? 513  HIS A C   1 
ATOM   4187 O O   . HIS A 1 513 ? 28.750  66.254 52.006 1.00 32.14 ? 513  HIS A O   1 
ATOM   4188 C CB  . HIS A 1 513 ? 28.823  67.556 55.168 1.00 37.18 ? 513  HIS A CB  1 
ATOM   4189 C CG  . HIS A 1 513 ? 28.996  68.812 55.959 1.00 39.40 ? 513  HIS A CG  1 
ATOM   4190 N ND1 . HIS A 1 513 ? 30.203  69.187 56.504 1.00 41.74 ? 513  HIS A ND1 1 
ATOM   4191 C CD2 . HIS A 1 513 ? 28.117  69.792 56.280 1.00 41.21 ? 513  HIS A CD2 1 
ATOM   4192 C CE1 . HIS A 1 513 ? 30.064  70.344 57.127 1.00 42.40 ? 513  HIS A CE1 1 
ATOM   4193 N NE2 . HIS A 1 513 ? 28.806  70.731 57.005 1.00 42.15 ? 513  HIS A NE2 1 
ATOM   4194 N N   . GLN A 1 514 ? 29.710  65.153 53.714 1.00 33.60 ? 514  GLN A N   1 
ATOM   4195 C CA  . GLN A 1 514 ? 29.524  63.839 53.117 1.00 33.58 ? 514  GLN A CA  1 
ATOM   4196 C C   . GLN A 1 514 ? 29.104  62.799 54.145 1.00 32.65 ? 514  GLN A C   1 
ATOM   4197 O O   . GLN A 1 514 ? 29.451  62.896 55.320 1.00 32.91 ? 514  GLN A O   1 
ATOM   4198 C CB  . GLN A 1 514 ? 30.820  63.380 52.448 1.00 36.18 ? 514  GLN A CB  1 
ATOM   4199 C CG  . GLN A 1 514 ? 31.190  64.150 51.201 1.00 39.25 ? 514  GLN A CG  1 
ATOM   4200 C CD  . GLN A 1 514 ? 32.551  63.755 50.671 1.00 43.01 ? 514  GLN A CD  1 
ATOM   4201 O OE1 . GLN A 1 514 ? 33.581  64.144 51.223 1.00 45.19 ? 514  GLN A OE1 1 
ATOM   4202 N NE2 . GLN A 1 514 ? 32.564  62.964 49.608 1.00 41.33 ? 514  GLN A NE2 1 
ATOM   4203 N N   . ARG A 1 515 ? 28.345  61.808 53.686 1.00 32.77 ? 515  ARG A N   1 
ATOM   4204 C CA  . ARG A 1 515 ? 27.882  60.709 54.530 1.00 32.52 ? 515  ARG A CA  1 
ATOM   4205 C C   . ARG A 1 515 ? 27.201  61.129 55.831 1.00 31.63 ? 515  ARG A C   1 
ATOM   4206 O O   . ARG A 1 515 ? 27.697  60.867 56.933 1.00 29.67 ? 515  ARG A O   1 
ATOM   4207 C CB  . ARG A 1 515 ? 29.053  59.771 54.826 1.00 33.89 ? 515  ARG A CB  1 
ATOM   4208 C CG  . ARG A 1 515 ? 29.678  59.203 53.564 1.00 36.32 ? 515  ARG A CG  1 
ATOM   4209 C CD  . ARG A 1 515 ? 30.598  58.027 53.859 1.00 41.02 ? 515  ARG A CD  1 
ATOM   4210 N NE  . ARG A 1 515 ? 31.097  57.422 52.626 1.00 44.04 ? 515  ARG A NE  1 
ATOM   4211 C CZ  . ARG A 1 515 ? 31.764  56.273 52.571 1.00 48.15 ? 515  ARG A CZ  1 
ATOM   4212 N NH1 . ARG A 1 515 ? 32.016  55.593 53.684 1.00 48.44 ? 515  ARG A NH1 1 
ATOM   4213 N NH2 . ARG A 1 515 ? 32.184  55.802 51.403 1.00 48.55 ? 515  ARG A NH2 1 
ATOM   4214 N N   . LEU A 1 516 ? 26.045  61.765 55.682 1.00 30.31 ? 516  LEU A N   1 
ATOM   4215 C CA  . LEU A 1 516 ? 25.249  62.240 56.808 1.00 28.85 ? 516  LEU A CA  1 
ATOM   4216 C C   . LEU A 1 516 ? 25.021  61.136 57.844 1.00 28.74 ? 516  LEU A C   1 
ATOM   4217 O O   . LEU A 1 516 ? 24.421  60.099 57.543 1.00 27.28 ? 516  LEU A O   1 
ATOM   4218 C CB  . LEU A 1 516 ? 23.909  62.771 56.283 1.00 29.99 ? 516  LEU A CB  1 
ATOM   4219 C CG  . LEU A 1 516 ? 22.862  63.321 57.254 1.00 32.37 ? 516  LEU A CG  1 
ATOM   4220 C CD1 . LEU A 1 516 ? 23.479  64.314 58.222 1.00 33.78 ? 516  LEU A CD1 1 
ATOM   4221 C CD2 . LEU A 1 516 ? 21.761  63.983 56.437 1.00 34.23 ? 516  LEU A CD2 1 
ATOM   4222 N N   . ARG A 1 517 ? 25.506  61.379 59.060 1.00 28.65 ? 517  ARG A N   1 
ATOM   4223 C CA  . ARG A 1 517 ? 25.390  60.447 60.188 1.00 31.34 ? 517  ARG A CA  1 
ATOM   4224 C C   . ARG A 1 517 ? 25.540  58.984 59.784 1.00 31.24 ? 517  ARG A C   1 
ATOM   4225 O O   . ARG A 1 517 ? 24.789  58.114 60.230 1.00 30.05 ? 517  ARG A O   1 
ATOM   4226 C CB  . ARG A 1 517 ? 24.059  60.675 60.922 1.00 35.51 ? 517  ARG A CB  1 
ATOM   4227 C CG  . ARG A 1 517 ? 23.989  62.049 61.608 1.00 39.09 ? 517  ARG A CG  1 
ATOM   4228 C CD  . ARG A 1 517 ? 22.770  62.205 62.508 1.00 41.66 ? 517  ARG A CD  1 
ATOM   4229 N NE  . ARG A 1 517 ? 22.839  61.387 63.717 1.00 42.00 ? 517  ARG A NE  1 
ATOM   4230 C CZ  . ARG A 1 517 ? 23.638  61.632 64.754 1.00 44.44 ? 517  ARG A CZ  1 
ATOM   4231 N NH1 . ARG A 1 517 ? 24.451  62.681 64.736 1.00 44.93 ? 517  ARG A NH1 1 
ATOM   4232 N NH2 . ARG A 1 517 ? 23.617  60.832 65.818 1.00 39.51 ? 517  ARG A NH2 1 
ATOM   4233 N N   . VAL A 1 518 ? 26.547  58.713 58.963 1.00 30.17 ? 518  VAL A N   1 
ATOM   4234 C CA  . VAL A 1 518 ? 26.785  57.363 58.474 1.00 30.40 ? 518  VAL A CA  1 
ATOM   4235 C C   . VAL A 1 518 ? 27.085  56.329 59.562 1.00 29.79 ? 518  VAL A C   1 
ATOM   4236 O O   . VAL A 1 518 ? 26.606  55.197 59.492 1.00 29.02 ? 518  VAL A O   1 
ATOM   4237 C CB  . VAL A 1 518 ? 27.926  57.358 57.425 1.00 29.24 ? 518  VAL A CB  1 
ATOM   4238 C CG1 . VAL A 1 518 ? 29.227  57.822 58.059 1.00 28.56 ? 518  VAL A CG1 1 
ATOM   4239 C CG2 . VAL A 1 518 ? 28.069  55.973 56.818 1.00 30.05 ? 518  VAL A CG2 1 
ATOM   4240 N N   . GLN A 1 519 ? 27.861  56.711 60.571 1.00 29.80 ? 519  GLN A N   1 
ATOM   4241 C CA  . GLN A 1 519 ? 28.206  55.775 61.639 1.00 31.12 ? 519  GLN A CA  1 
ATOM   4242 C C   . GLN A 1 519 ? 26.950  55.217 62.312 1.00 30.74 ? 519  GLN A C   1 
ATOM   4243 O O   . GLN A 1 519 ? 26.781  54.003 62.426 1.00 29.95 ? 519  GLN A O   1 
ATOM   4244 C CB  . GLN A 1 519 ? 29.096  56.459 62.687 1.00 33.00 ? 519  GLN A CB  1 
ATOM   4245 C CG  . GLN A 1 519 ? 29.788  55.481 63.635 1.00 35.60 ? 519  GLN A CG  1 
ATOM   4246 C CD  . GLN A 1 519 ? 30.925  54.711 62.969 1.00 38.24 ? 519  GLN A CD  1 
ATOM   4247 O OE1 . GLN A 1 519 ? 31.273  53.606 63.393 1.00 40.92 ? 519  GLN A OE1 1 
ATOM   4248 N NE2 . GLN A 1 519 ? 31.515  55.297 61.934 1.00 34.77 ? 519  GLN A NE2 1 
ATOM   4249 N N   . MET A 1 520 ? 26.063  56.105 62.747 1.00 28.84 ? 520  MET A N   1 
ATOM   4250 C CA  . MET A 1 520 ? 24.839  55.669 63.403 1.00 29.77 ? 520  MET A CA  1 
ATOM   4251 C C   . MET A 1 520 ? 23.882  54.958 62.455 1.00 28.98 ? 520  MET A C   1 
ATOM   4252 O O   . MET A 1 520 ? 23.200  54.013 62.841 1.00 29.69 ? 520  MET A O   1 
ATOM   4253 C CB  . MET A 1 520 ? 24.130  56.858 64.054 1.00 30.90 ? 520  MET A CB  1 
ATOM   4254 C CG  . MET A 1 520 ? 24.882  57.433 65.241 1.00 33.37 ? 520  MET A CG  1 
ATOM   4255 S SD  . MET A 1 520 ? 25.261  56.148 66.463 1.00 40.11 ? 520  MET A SD  1 
ATOM   4256 C CE  . MET A 1 520 ? 25.875  57.150 67.846 1.00 39.55 ? 520  MET A CE  1 
ATOM   4257 N N   . CYS A 1 521 ? 23.835  55.386 61.203 1.00 28.99 ? 521  CYS A N   1 
ATOM   4258 C CA  . CYS A 1 521 ? 22.910  54.743 60.294 1.00 29.91 ? 521  CYS A CA  1 
ATOM   4259 C C   . CYS A 1 521 ? 23.333  53.338 59.874 1.00 29.95 ? 521  CYS A C   1 
ATOM   4260 O O   . CYS A 1 521 ? 22.488  52.523 59.508 1.00 29.88 ? 521  CYS A O   1 
ATOM   4261 C CB  . CYS A 1 521 ? 22.630  55.660 59.109 1.00 32.09 ? 521  CYS A CB  1 
ATOM   4262 S SG  . CYS A 1 521 ? 21.658  57.128 59.627 1.00 35.53 ? 521  CYS A SG  1 
ATOM   4263 N N   . VAL A 1 522 ? 24.628  53.033 59.941 1.00 28.75 ? 522  VAL A N   1 
ATOM   4264 C CA  . VAL A 1 522 ? 25.055  51.674 59.623 1.00 28.71 ? 522  VAL A CA  1 
ATOM   4265 C C   . VAL A 1 522 ? 24.510  50.806 60.759 1.00 27.56 ? 522  VAL A C   1 
ATOM   4266 O O   . VAL A 1 522 ? 24.115  49.659 60.555 1.00 28.90 ? 522  VAL A O   1 
ATOM   4267 C CB  . VAL A 1 522 ? 26.598  51.540 59.567 1.00 28.98 ? 522  VAL A CB  1 
ATOM   4268 C CG1 . VAL A 1 522 ? 26.999  50.063 59.586 1.00 31.08 ? 522  VAL A CG1 1 
ATOM   4269 C CG2 . VAL A 1 522 ? 27.126  52.197 58.304 1.00 29.01 ? 522  VAL A CG2 1 
ATOM   4270 N N   . PHE A 1 523 ? 24.490  51.368 61.963 1.00 27.07 ? 523  PHE A N   1 
ATOM   4271 C CA  . PHE A 1 523 ? 23.967  50.660 63.127 1.00 26.55 ? 523  PHE A CA  1 
ATOM   4272 C C   . PHE A 1 523 ? 22.465  50.379 62.972 1.00 26.07 ? 523  PHE A C   1 
ATOM   4273 O O   . PHE A 1 523 ? 22.014  49.243 63.124 1.00 25.55 ? 523  PHE A O   1 
ATOM   4274 C CB  . PHE A 1 523 ? 24.186  51.490 64.396 1.00 27.10 ? 523  PHE A CB  1 
ATOM   4275 C CG  . PHE A 1 523 ? 23.492  50.934 65.608 1.00 27.07 ? 523  PHE A CG  1 
ATOM   4276 C CD1 . PHE A 1 523 ? 24.047  49.877 66.324 1.00 27.23 ? 523  PHE A CD1 1 
ATOM   4277 C CD2 . PHE A 1 523 ? 22.261  51.444 66.011 1.00 25.30 ? 523  PHE A CD2 1 
ATOM   4278 C CE1 . PHE A 1 523 ? 23.386  49.337 67.427 1.00 28.61 ? 523  PHE A CE1 1 
ATOM   4279 C CE2 . PHE A 1 523 ? 21.591  50.912 67.108 1.00 27.89 ? 523  PHE A CE2 1 
ATOM   4280 C CZ  . PHE A 1 523 ? 22.155  49.853 67.820 1.00 29.73 ? 523  PHE A CZ  1 
ATOM   4281 N N   . TRP A 1 524 ? 21.696  51.422 62.676 1.00 24.54 ? 524  TRP A N   1 
ATOM   4282 C CA  . TRP A 1 524 ? 20.248  51.294 62.531 1.00 25.67 ? 524  TRP A CA  1 
ATOM   4283 C C   . TRP A 1 524 ? 19.771  50.573 61.283 1.00 25.43 ? 524  TRP A C   1 
ATOM   4284 O O   . TRP A 1 524 ? 18.773  49.859 61.324 1.00 27.01 ? 524  TRP A O   1 
ATOM   4285 C CB  . TRP A 1 524 ? 19.581  52.673 62.561 1.00 25.30 ? 524  TRP A CB  1 
ATOM   4286 C CG  . TRP A 1 524 ? 19.677  53.356 63.885 1.00 25.76 ? 524  TRP A CG  1 
ATOM   4287 C CD1 . TRP A 1 524 ? 20.483  54.410 64.212 1.00 23.87 ? 524  TRP A CD1 1 
ATOM   4288 C CD2 . TRP A 1 524 ? 18.961  53.009 65.077 1.00 26.05 ? 524  TRP A CD2 1 
ATOM   4289 N NE1 . TRP A 1 524 ? 20.314  54.741 65.536 1.00 23.95 ? 524  TRP A NE1 1 
ATOM   4290 C CE2 . TRP A 1 524 ? 19.387  53.898 66.090 1.00 24.82 ? 524  TRP A CE2 1 
ATOM   4291 C CE3 . TRP A 1 524 ? 18.002  52.036 65.388 1.00 24.08 ? 524  TRP A CE3 1 
ATOM   4292 C CZ2 . TRP A 1 524 ? 18.883  53.839 67.397 1.00 24.25 ? 524  TRP A CZ2 1 
ATOM   4293 C CZ3 . TRP A 1 524 ? 17.501  51.979 66.685 1.00 24.83 ? 524  TRP A CZ3 1 
ATOM   4294 C CH2 . TRP A 1 524 ? 17.943  52.875 67.674 1.00 24.10 ? 524  TRP A CH2 1 
ATOM   4295 N N   . ASN A 1 525 ? 20.472  50.761 60.175 1.00 26.70 ? 525  ASN A N   1 
ATOM   4296 C CA  . ASN A 1 525 ? 20.050  50.146 58.922 1.00 29.37 ? 525  ASN A CA  1 
ATOM   4297 C C   . ASN A 1 525 ? 20.624  48.778 58.594 1.00 31.99 ? 525  ASN A C   1 
ATOM   4298 O O   . ASN A 1 525 ? 20.028  48.025 57.828 1.00 31.67 ? 525  ASN A O   1 
ATOM   4299 C CB  . ASN A 1 525 ? 20.340  51.097 57.756 1.00 28.91 ? 525  ASN A CB  1 
ATOM   4300 C CG  . ASN A 1 525 ? 19.580  52.402 57.869 1.00 28.26 ? 525  ASN A CG  1 
ATOM   4301 O OD1 . ASN A 1 525 ? 18.526  52.454 58.494 1.00 32.64 ? 525  ASN A OD1 1 
ATOM   4302 N ND2 . ASN A 1 525 ? 20.101  53.456 57.250 1.00 27.63 ? 525  ASN A ND2 1 
ATOM   4303 N N   A GLN A 1 526 ? 21.770  48.444 59.174 0.50 31.55 ? 526  GLN A N   1 
ATOM   4304 N N   B GLN A 1 526 ? 21.770  48.447 59.179 0.50 32.04 ? 526  GLN A N   1 
ATOM   4305 C CA  A GLN A 1 526 ? 22.387  47.161 58.879 0.50 32.72 ? 526  GLN A CA  1 
ATOM   4306 C CA  B GLN A 1 526 ? 22.395  47.169 58.879 0.50 33.61 ? 526  GLN A CA  1 
ATOM   4307 C C   A GLN A 1 526 ? 22.588  46.247 60.081 0.50 32.65 ? 526  GLN A C   1 
ATOM   4308 C C   B GLN A 1 526 ? 22.586  46.250 60.080 0.50 33.18 ? 526  GLN A C   1 
ATOM   4309 O O   A GLN A 1 526 ? 22.125  45.110 60.071 0.50 33.76 ? 526  GLN A O   1 
ATOM   4310 O O   B GLN A 1 526 ? 22.135  45.102 60.073 0.50 33.28 ? 526  GLN A O   1 
ATOM   4311 C CB  A GLN A 1 526 ? 23.720  47.390 58.161 0.50 33.61 ? 526  GLN A CB  1 
ATOM   4312 C CB  B GLN A 1 526 ? 23.739  47.417 58.190 0.50 35.50 ? 526  GLN A CB  1 
ATOM   4313 C CG  A GLN A 1 526 ? 23.671  48.506 57.123 0.50 41.39 ? 526  GLN A CG  1 
ATOM   4314 C CG  B GLN A 1 526 ? 23.576  48.185 56.866 0.50 37.82 ? 526  GLN A CG  1 
ATOM   4315 C CD  A GLN A 1 526 ? 24.903  48.435 56.173 0.50 39.22 ? 526  GLN A CD  1 
ATOM   4316 C CD  B GLN A 1 526 ? 24.968  48.673 56.355 0.50 43.70 ? 526  GLN A CD  1 
ATOM   4317 O OE1 A GLN A 1 526 ? 26.045  48.785 56.944 0.50 46.10 ? 526  GLN A OE1 1 
ATOM   4318 O OE1 B GLN A 1 526 ? 25.603  47.496 55.789 0.50 40.31 ? 526  GLN A OE1 1 
ATOM   4319 N NE2 A GLN A 1 526 ? 24.871  48.700 55.030 0.50 45.84 ? 526  GLN A NE2 1 
ATOM   4320 N NE2 B GLN A 1 526 ? 25.254  49.707 56.006 0.50 39.99 ? 526  GLN A NE2 1 
ATOM   4321 N N   . PHE A 1 527 ? 23.260  46.741 61.114 1.00 32.13 ? 527  PHE A N   1 
ATOM   4322 C CA  . PHE A 1 527 ? 23.513  45.921 62.293 1.00 30.50 ? 527  PHE A CA  1 
ATOM   4323 C C   . PHE A 1 527 ? 22.315  45.537 63.163 1.00 30.10 ? 527  PHE A C   1 
ATOM   4324 O O   . PHE A 1 527 ? 22.076  44.352 63.402 1.00 30.24 ? 527  PHE A O   1 
ATOM   4325 C CB  . PHE A 1 527 ? 24.573  46.566 63.185 1.00 28.35 ? 527  PHE A CB  1 
ATOM   4326 C CG  . PHE A 1 527 ? 24.942  45.720 64.367 1.00 28.34 ? 527  PHE A CG  1 
ATOM   4327 C CD1 . PHE A 1 527 ? 25.615  44.512 64.189 1.00 27.45 ? 527  PHE A CD1 1 
ATOM   4328 C CD2 . PHE A 1 527 ? 24.573  46.098 65.651 1.00 27.88 ? 527  PHE A CD2 1 
ATOM   4329 C CE1 . PHE A 1 527 ? 25.908  43.691 65.273 1.00 27.91 ? 527  PHE A CE1 1 
ATOM   4330 C CE2 . PHE A 1 527 ? 24.862  45.281 66.746 1.00 29.41 ? 527  PHE A CE2 1 
ATOM   4331 C CZ  . PHE A 1 527 ? 25.532  44.075 66.552 1.00 28.67 ? 527  PHE A CZ  1 
ATOM   4332 N N   . LEU A 1 528 ? 21.566  46.521 63.650 1.00 27.33 ? 528  LEU A N   1 
ATOM   4333 C CA  . LEU A 1 528 ? 20.436  46.220 64.527 1.00 29.45 ? 528  LEU A CA  1 
ATOM   4334 C C   . LEU A 1 528 ? 19.398  45.277 63.908 1.00 29.92 ? 528  LEU A C   1 
ATOM   4335 O O   . LEU A 1 528 ? 18.937  44.345 64.566 1.00 28.79 ? 528  LEU A O   1 
ATOM   4336 C CB  . LEU A 1 528 ? 19.757  47.514 65.000 1.00 28.62 ? 528  LEU A CB  1 
ATOM   4337 C CG  . LEU A 1 528 ? 18.693  47.305 66.087 1.00 30.85 ? 528  LEU A CG  1 
ATOM   4338 C CD1 . LEU A 1 528 ? 19.301  46.554 67.270 1.00 30.39 ? 528  LEU A CD1 1 
ATOM   4339 C CD2 . LEU A 1 528 ? 18.139  48.649 66.538 1.00 30.58 ? 528  LEU A CD2 1 
ATOM   4340 N N   . PRO A 1 529 ? 19.012  45.510 62.641 1.00 31.21 ? 529  PRO A N   1 
ATOM   4341 C CA  . PRO A 1 529 ? 18.022  44.619 62.022 1.00 33.27 ? 529  PRO A CA  1 
ATOM   4342 C C   . PRO A 1 529 ? 18.534  43.177 62.013 1.00 34.56 ? 529  PRO A C   1 
ATOM   4343 O O   . PRO A 1 529 ? 17.784  42.230 62.256 1.00 35.41 ? 529  PRO A O   1 
ATOM   4344 C CB  . PRO A 1 529 ? 17.877  45.191 60.613 1.00 33.23 ? 529  PRO A CB  1 
ATOM   4345 C CG  . PRO A 1 529 ? 18.161  46.655 60.813 1.00 33.39 ? 529  PRO A CG  1 
ATOM   4346 C CD  . PRO A 1 529 ? 19.355  46.621 61.738 1.00 31.12 ? 529  PRO A CD  1 
ATOM   4347 N N   . LYS A 1 530 ? 19.823  43.021 61.737 1.00 33.96 ? 530  LYS A N   1 
ATOM   4348 C CA  . LYS A 1 530 ? 20.445  41.704 61.701 1.00 35.63 ? 530  LYS A CA  1 
ATOM   4349 C C   . LYS A 1 530 ? 20.430  41.064 63.093 1.00 35.69 ? 530  LYS A C   1 
ATOM   4350 O O   . LYS A 1 530 ? 20.173  39.864 63.238 1.00 33.93 ? 530  LYS A O   1 
ATOM   4351 C CB  . LYS A 1 530 ? 21.880  41.836 61.194 1.00 36.94 ? 530  LYS A CB  1 
ATOM   4352 C CG  . LYS A 1 530 ? 22.570  40.527 60.901 1.00 40.92 ? 530  LYS A CG  1 
ATOM   4353 C CD  . LYS A 1 530 ? 23.926  40.768 60.256 1.00 43.68 ? 530  LYS A CD  1 
ATOM   4354 N N   . LEU A 1 531 ? 20.698  41.870 64.116 1.00 34.21 ? 531  LEU A N   1 
ATOM   4355 C CA  . LEU A 1 531 ? 20.709  41.379 65.490 1.00 34.65 ? 531  LEU A CA  1 
ATOM   4356 C C   . LEU A 1 531 ? 19.321  40.917 65.927 1.00 36.06 ? 531  LEU A C   1 
ATOM   4357 O O   . LEU A 1 531 ? 19.171  39.852 66.527 1.00 34.52 ? 531  LEU A O   1 
ATOM   4358 C CB  . LEU A 1 531 ? 21.222  42.475 66.437 1.00 32.66 ? 531  LEU A CB  1 
ATOM   4359 C CG  . LEU A 1 531 ? 21.262  42.188 67.945 1.00 32.64 ? 531  LEU A CG  1 
ATOM   4360 C CD1 . LEU A 1 531 ? 22.245  43.129 68.623 1.00 31.93 ? 531  LEU A CD1 1 
ATOM   4361 C CD2 . LEU A 1 531 ? 19.871  42.353 68.550 1.00 33.88 ? 531  LEU A CD2 1 
ATOM   4362 N N   . LEU A 1 532 ? 18.310  41.724 65.625 1.00 37.27 ? 532  LEU A N   1 
ATOM   4363 C CA  . LEU A 1 532 ? 16.940  41.398 65.999 1.00 39.86 ? 532  LEU A CA  1 
ATOM   4364 C C   . LEU A 1 532 ? 16.408  40.168 65.271 1.00 41.96 ? 532  LEU A C   1 
ATOM   4365 O O   . LEU A 1 532 ? 15.620  39.405 65.825 1.00 43.84 ? 532  LEU A O   1 
ATOM   4366 C CB  . LEU A 1 532 ? 16.018  42.596 65.735 1.00 37.53 ? 532  LEU A CB  1 
ATOM   4367 C CG  . LEU A 1 532 ? 16.300  43.848 66.572 1.00 36.84 ? 532  LEU A CG  1 
ATOM   4368 C CD1 . LEU A 1 532 ? 15.346  44.967 66.174 1.00 37.82 ? 532  LEU A CD1 1 
ATOM   4369 C CD2 . LEU A 1 532 ? 16.152  43.518 68.048 1.00 35.38 ? 532  LEU A CD2 1 
ATOM   4370 N N   . ASN A 1 533 ? 16.845  39.971 64.034 1.00 44.56 ? 533  ASN A N   1 
ATOM   4371 C CA  . ASN A 1 533 ? 16.391  38.828 63.253 1.00 48.47 ? 533  ASN A CA  1 
ATOM   4372 C C   . ASN A 1 533 ? 17.114  37.534 63.618 1.00 50.24 ? 533  ASN A C   1 
ATOM   4373 O O   . ASN A 1 533 ? 16.581  36.443 63.420 1.00 49.93 ? 533  ASN A O   1 
ATOM   4374 C CB  . ASN A 1 533 ? 16.561  39.114 61.758 1.00 50.38 ? 533  ASN A CB  1 
ATOM   4375 C CG  . ASN A 1 533 ? 16.136  37.945 60.889 1.00 53.25 ? 533  ASN A CG  1 
ATOM   4376 O OD1 . ASN A 1 533 ? 16.928  37.045 60.608 1.00 55.02 ? 533  ASN A OD1 1 
ATOM   4377 N ND2 . ASN A 1 533 ? 14.877  37.947 60.472 1.00 54.55 ? 533  ASN A ND2 1 
ATOM   4378 N N   . ALA A 1 534 ? 18.321  37.656 64.161 1.00 51.56 ? 534  ALA A N   1 
ATOM   4379 C CA  . ALA A 1 534 ? 19.101  36.483 64.537 1.00 53.24 ? 534  ALA A CA  1 
ATOM   4380 C C   . ALA A 1 534 ? 18.814  36.034 65.961 1.00 55.02 ? 534  ALA A C   1 
ATOM   4381 O O   . ALA A 1 534 ? 18.890  34.845 66.267 1.00 55.86 ? 534  ALA A O   1 
ATOM   4382 C CB  . ALA A 1 534 ? 20.588  36.772 64.373 1.00 52.94 ? 534  ALA A CB  1 
ATOM   4383 N N   . THR A 1 535 ? 18.487  36.986 66.829 1.00 56.93 ? 535  THR A N   1 
ATOM   4384 C CA  . THR A 1 535 ? 18.195  36.677 68.225 1.00 58.42 ? 535  THR A CA  1 
ATOM   4385 C C   . THR A 1 535 ? 16.705  36.802 68.524 1.00 59.45 ? 535  THR A C   1 
ATOM   4386 O O   . THR A 1 535 ? 15.935  37.101 67.585 1.00 59.75 ? 535  THR A O   1 
ATOM   4387 C CB  . THR A 1 535 ? 18.961  37.615 69.179 1.00 58.92 ? 535  THR A CB  1 
ATOM   4388 O OG1 . THR A 1 535 ? 18.505  38.960 68.997 1.00 58.55 ? 535  THR A OG1 1 
ATOM   4389 C CG2 . THR A 1 535 ? 20.456  37.552 68.900 1.00 59.00 ? 535  THR A CG2 1 
HETATM 4390 C C1  . NAG B 2 .   ? 18.931  62.213 33.982 1.00 38.67 ? 598  NAG A C1  1 
HETATM 4391 C C2  . NAG B 2 .   ? 20.460  62.068 34.025 1.00 39.94 ? 598  NAG A C2  1 
HETATM 4392 C C3  . NAG B 2 .   ? 21.092  62.650 32.753 1.00 43.47 ? 598  NAG A C3  1 
HETATM 4393 C C4  . NAG B 2 .   ? 20.424  62.067 31.503 1.00 44.77 ? 598  NAG A C4  1 
HETATM 4394 C C5  . NAG B 2 .   ? 18.915  62.283 31.594 1.00 45.00 ? 598  NAG A C5  1 
HETATM 4395 C C6  . NAG B 2 .   ? 18.155  61.729 30.402 1.00 45.13 ? 598  NAG A C6  1 
HETATM 4396 C C7  . NAG B 2 .   ? 21.359  62.083 36.269 1.00 38.43 ? 598  NAG A C7  1 
HETATM 4397 C C8  . NAG B 2 .   ? 22.020  62.875 37.386 1.00 39.40 ? 598  NAG A C8  1 
HETATM 4398 N N2  . NAG B 2 .   ? 20.982  62.763 35.188 1.00 38.92 ? 598  NAG A N2  1 
HETATM 4399 O O3  . NAG B 2 .   ? 22.480  62.357 32.738 1.00 44.12 ? 598  NAG A O3  1 
HETATM 4400 O O4  . NAG B 2 .   ? 20.931  62.701 30.337 1.00 48.02 ? 598  NAG A O4  1 
HETATM 4401 O O5  . NAG B 2 .   ? 18.404  61.636 32.779 1.00 40.86 ? 598  NAG A O5  1 
HETATM 4402 O O6  . NAG B 2 .   ? 17.992  60.322 30.496 1.00 49.04 ? 598  NAG A O6  1 
HETATM 4403 O O7  . NAG B 2 .   ? 21.195  60.867 36.394 1.00 37.78 ? 598  NAG A O7  1 
HETATM 4404 C C1  . NAG C 2 .   ? -19.348 82.740 50.161 1.00 64.73 ? 599  NAG A C1  1 
HETATM 4405 C C2  . NAG C 2 .   ? -18.775 83.248 51.494 1.00 67.28 ? 599  NAG A C2  1 
HETATM 4406 C C3  . NAG C 2 .   ? -18.378 84.729 51.419 1.00 68.64 ? 599  NAG A C3  1 
HETATM 4407 C C4  . NAG C 2 .   ? -19.439 85.584 50.703 1.00 69.12 ? 599  NAG A C4  1 
HETATM 4408 C C5  . NAG C 2 .   ? -19.920 84.928 49.395 1.00 68.16 ? 599  NAG A C5  1 
HETATM 4409 C C6  . NAG C 2 .   ? -19.738 85.829 48.188 1.00 68.69 ? 599  NAG A C6  1 
HETATM 4410 C C7  . NAG C 2 .   ? -19.316 83.024 53.828 1.00 70.46 ? 599  NAG A C7  1 
HETATM 4411 C C8  . NAG C 2 .   ? -19.471 81.714 54.587 1.00 69.97 ? 599  NAG A C8  1 
HETATM 4412 N N2  . NAG C 2 .   ? -19.734 83.057 52.565 1.00 69.74 ? 599  NAG A N2  1 
HETATM 4413 O O3  . NAG C 2 .   ? -17.135 84.857 50.748 1.00 69.94 ? 599  NAG A O3  1 
HETATM 4414 O O4  . NAG C 2 .   ? -20.548 85.794 51.560 1.00 70.23 ? 599  NAG A O4  1 
HETATM 4415 O O5  . NAG C 2 .   ? -19.177 83.719 49.130 1.00 66.95 ? 599  NAG A O5  1 
HETATM 4416 O O6  . NAG C 2 .   ? -20.462 85.336 47.069 1.00 68.81 ? 599  NAG A O6  1 
HETATM 4417 O O7  . NAG C 2 .   ? -18.808 83.998 54.384 1.00 71.51 ? 599  NAG A O7  1 
HETATM 4418 O O   . HOH D 3 .   ? -12.574 84.352 34.036 1.00 58.60 ? 2001 HOH A O   1 
HETATM 4419 O O   . HOH D 3 .   ? -14.904 86.520 32.685 1.00 74.97 ? 2002 HOH A O   1 
HETATM 4420 O O   . HOH D 3 .   ? -4.468  85.459 39.564 1.00 34.75 ? 2003 HOH A O   1 
HETATM 4421 O O   . HOH D 3 .   ? -6.377  83.586 38.717 1.00 32.88 ? 2004 HOH A O   1 
HETATM 4422 O O   . HOH D 3 .   ? -10.505 90.376 36.426 1.00 68.51 ? 2005 HOH A O   1 
HETATM 4423 O O   . HOH D 3 .   ? -7.652  91.263 36.597 1.00 67.86 ? 2006 HOH A O   1 
HETATM 4424 O O   . HOH D 3 .   ? -13.940 71.601 31.064 1.00 49.67 ? 2007 HOH A O   1 
HETATM 4425 O O   . HOH D 3 .   ? -13.635 73.223 29.684 1.00 54.52 ? 2008 HOH A O   1 
HETATM 4426 O O   . HOH D 3 .   ? -19.338 82.667 34.075 1.00 82.10 ? 2009 HOH A O   1 
HETATM 4427 O O   . HOH D 3 .   ? -15.974 65.331 36.252 1.00 58.77 ? 2010 HOH A O   1 
HETATM 4428 O O   . HOH D 3 .   ? -11.770 79.455 33.244 1.00 53.23 ? 2011 HOH A O   1 
HETATM 4429 O O   . HOH D 3 .   ? -19.111 75.038 34.419 1.00 58.21 ? 2012 HOH A O   1 
HETATM 4430 O O   . HOH D 3 .   ? -12.991 74.537 31.329 1.00 50.72 ? 2013 HOH A O   1 
HETATM 4431 O O   . HOH D 3 .   ? -15.429 63.391 37.983 1.00 70.19 ? 2014 HOH A O   1 
HETATM 4432 O O   . HOH D 3 .   ? -17.849 71.332 32.360 1.00 61.90 ? 2015 HOH A O   1 
HETATM 4433 O O   . HOH D 3 .   ? -24.080 72.757 44.524 1.00 77.70 ? 2016 HOH A O   1 
HETATM 4434 O O   . HOH D 3 .   ? -21.220 82.407 35.827 1.00 64.27 ? 2017 HOH A O   1 
HETATM 4435 O O   . HOH D 3 .   ? -11.536 70.197 69.856 1.00 55.82 ? 2018 HOH A O   1 
HETATM 4436 O O   . HOH D 3 .   ? -16.338 66.630 33.809 1.00 62.80 ? 2019 HOH A O   1 
HETATM 4437 O O   . HOH D 3 .   ? -1.865  96.209 42.806 1.00 75.79 ? 2020 HOH A O   1 
HETATM 4438 O O   . HOH D 3 .   ? 3.167   81.431 61.726 1.00 71.42 ? 2021 HOH A O   1 
HETATM 4439 O O   . HOH D 3 .   ? -10.099 34.821 63.060 1.00 76.46 ? 2022 HOH A O   1 
HETATM 4440 O O   . HOH D 3 .   ? -13.917 76.496 65.584 1.00 74.72 ? 2023 HOH A O   1 
HETATM 4441 O O   . HOH D 3 .   ? -24.437 60.758 57.135 1.00 72.57 ? 2024 HOH A O   1 
HETATM 4442 O O   . HOH D 3 .   ? 3.254   36.311 47.522 1.00 67.88 ? 2025 HOH A O   1 
HETATM 4443 O O   . HOH D 3 .   ? -14.245 86.998 45.888 1.00 55.45 ? 2026 HOH A O   1 
HETATM 4444 O O   . HOH D 3 .   ? -23.498 57.002 51.233 1.00 68.11 ? 2027 HOH A O   1 
HETATM 4445 O O   . HOH D 3 .   ? -6.653  88.525 42.287 1.00 43.88 ? 2028 HOH A O   1 
HETATM 4446 O O   . HOH D 3 .   ? -11.709 89.282 46.664 1.00 46.58 ? 2029 HOH A O   1 
HETATM 4447 O O   . HOH D 3 .   ? -8.362  90.689 41.716 1.00 61.27 ? 2030 HOH A O   1 
HETATM 4448 O O   . HOH D 3 .   ? -5.664  95.341 44.604 1.00 65.88 ? 2031 HOH A O   1 
HETATM 4449 O O   . HOH D 3 .   ? -22.349 73.038 49.269 1.00 70.98 ? 2032 HOH A O   1 
HETATM 4450 O O   . HOH D 3 .   ? -8.522  53.383 43.985 1.00 55.45 ? 2033 HOH A O   1 
HETATM 4451 O O   . HOH D 3 .   ? -18.266 61.682 38.983 1.00 70.58 ? 2034 HOH A O   1 
HETATM 4452 O O   . HOH D 3 .   ? -18.951 71.176 34.536 1.00 57.49 ? 2035 HOH A O   1 
HETATM 4453 O O   . HOH D 3 .   ? -10.468 50.099 43.714 1.00 67.62 ? 2036 HOH A O   1 
HETATM 4454 O O   . HOH D 3 .   ? 4.671   68.142 65.681 1.00 70.31 ? 2037 HOH A O   1 
HETATM 4455 O O   . HOH D 3 .   ? 8.768   88.966 43.278 1.00 74.39 ? 2038 HOH A O   1 
HETATM 4456 O O   . HOH D 3 .   ? -24.801 68.127 46.287 1.00 73.55 ? 2039 HOH A O   1 
HETATM 4457 O O   . HOH D 3 .   ? 22.892  49.944 31.894 1.00 60.10 ? 2040 HOH A O   1 
HETATM 4458 O O   . HOH D 3 .   ? 22.010  48.331 29.880 1.00 66.64 ? 2041 HOH A O   1 
HETATM 4459 O O   . HOH D 3 .   ? -22.685 75.103 44.201 1.00 57.55 ? 2042 HOH A O   1 
HETATM 4460 O O   . HOH D 3 .   ? -22.884 80.503 36.175 1.00 67.16 ? 2043 HOH A O   1 
HETATM 4461 O O   . HOH D 3 .   ? -22.312 79.460 46.933 1.00 65.13 ? 2044 HOH A O   1 
HETATM 4462 O O   . HOH D 3 .   ? 6.442   92.587 48.020 1.00 62.19 ? 2045 HOH A O   1 
HETATM 4463 O O   . HOH D 3 .   ? 1.912   89.845 54.291 1.00 38.52 ? 2046 HOH A O   1 
HETATM 4464 O O   . HOH D 3 .   ? 0.457   93.194 52.384 1.00 54.26 ? 2047 HOH A O   1 
HETATM 4465 O O   . HOH D 3 .   ? 4.843   96.698 45.989 0.50 87.03 ? 2048 HOH A O   1 
HETATM 4466 O O   . HOH D 3 .   ? -11.295 67.596 70.464 1.00 51.74 ? 2049 HOH A O   1 
HETATM 4467 O O   . HOH D 3 .   ? 1.718   94.718 43.359 1.00 51.12 ? 2050 HOH A O   1 
HETATM 4468 O O   . HOH D 3 .   ? 1.263   90.493 42.424 1.00 56.93 ? 2051 HOH A O   1 
HETATM 4469 O O   . HOH D 3 .   ? -1.557  94.843 44.919 1.00 75.52 ? 2052 HOH A O   1 
HETATM 4470 O O   . HOH D 3 .   ? -11.382 65.370 74.481 1.00 74.79 ? 2053 HOH A O   1 
HETATM 4471 O O   . HOH D 3 .   ? -2.473  36.416 61.450 1.00 61.27 ? 2054 HOH A O   1 
HETATM 4472 O O   . HOH D 3 .   ? -6.924  36.711 61.410 1.00 65.75 ? 2055 HOH A O   1 
HETATM 4473 O O   . HOH D 3 .   ? -0.645  36.375 58.902 1.00 67.46 ? 2056 HOH A O   1 
HETATM 4474 O O   . HOH D 3 .   ? -4.416  38.802 67.465 1.00 69.37 ? 2057 HOH A O   1 
HETATM 4475 O O   . HOH D 3 .   ? 6.412   38.862 60.736 1.00 73.44 ? 2058 HOH A O   1 
HETATM 4476 O O   . HOH D 3 .   ? -5.035  36.296 65.301 1.00 67.25 ? 2059 HOH A O   1 
HETATM 4477 O O   . HOH D 3 .   ? 2.055   79.698 63.404 1.00 54.56 ? 2060 HOH A O   1 
HETATM 4478 O O   . HOH D 3 .   ? -7.958  72.452 71.957 1.00 72.96 ? 2061 HOH A O   1 
HETATM 4479 O O   . HOH D 3 .   ? -15.464 74.700 50.789 1.00 51.56 ? 2062 HOH A O   1 
HETATM 4480 O O   . HOH D 3 .   ? -10.312 71.837 67.817 1.00 49.56 ? 2063 HOH A O   1 
HETATM 4481 O O   . HOH D 3 .   ? -11.449 75.771 66.086 1.00 78.29 ? 2064 HOH A O   1 
HETATM 4482 O O   . HOH D 3 .   ? -13.874 78.882 62.603 1.00 80.51 ? 2065 HOH A O   1 
HETATM 4483 O O   . HOH D 3 .   ? -14.680 69.466 67.769 1.00 71.86 ? 2066 HOH A O   1 
HETATM 4484 O O   . HOH D 3 .   ? -17.644 61.996 72.519 1.00 77.97 ? 2067 HOH A O   1 
HETATM 4485 O O   . HOH D 3 .   ? -14.234 68.965 42.057 1.00 53.94 ? 2068 HOH A O   1 
HETATM 4486 O O   . HOH D 3 .   ? -22.947 60.377 59.349 1.00 57.44 ? 2069 HOH A O   1 
HETATM 4487 O O   . HOH D 3 .   ? -21.646 61.166 62.895 1.00 64.75 ? 2070 HOH A O   1 
HETATM 4488 O O   . HOH D 3 .   ? -21.138 65.951 57.598 1.00 72.15 ? 2071 HOH A O   1 
HETATM 4489 O O   . HOH D 3 .   ? -2.782  59.389 75.182 1.00 61.77 ? 2072 HOH A O   1 
HETATM 4490 O O   . HOH D 3 .   ? -12.458 64.561 41.752 1.00 35.05 ? 2073 HOH A O   1 
HETATM 4491 O O   . HOH D 3 .   ? -15.380 67.345 49.392 1.00 29.92 ? 2074 HOH A O   1 
HETATM 4492 O O   . HOH D 3 .   ? 3.628   64.938 69.709 1.00 55.55 ? 2075 HOH A O   1 
HETATM 4493 O O   . HOH D 3 .   ? -15.574 60.068 48.967 1.00 31.38 ? 2076 HOH A O   1 
HETATM 4494 O O   . HOH D 3 .   ? -22.057 61.293 47.958 1.00 56.14 ? 2077 HOH A O   1 
HETATM 4495 O O   . HOH D 3 .   ? -5.902  83.017 53.704 1.00 63.01 ? 2078 HOH A O   1 
HETATM 4496 O O   . HOH D 3 .   ? 5.144   41.191 57.073 1.00 52.51 ? 2079 HOH A O   1 
HETATM 4497 O O   . HOH D 3 .   ? -0.299  40.757 51.510 1.00 64.84 ? 2080 HOH A O   1 
HETATM 4498 O O   . HOH D 3 .   ? -21.234 61.812 50.598 1.00 41.02 ? 2081 HOH A O   1 
HETATM 4499 O O   . HOH D 3 .   ? 8.304   42.171 54.685 1.00 43.82 ? 2082 HOH A O   1 
HETATM 4500 O O   . HOH D 3 .   ? 9.207   43.674 57.385 1.00 67.09 ? 2083 HOH A O   1 
HETATM 4501 O O   . HOH D 3 .   ? 2.450   41.849 50.843 1.00 58.57 ? 2084 HOH A O   1 
HETATM 4502 O O   . HOH D 3 .   ? 1.975   38.334 51.004 1.00 59.76 ? 2085 HOH A O   1 
HETATM 4503 O O   . HOH D 3 .   ? -14.860 59.615 57.138 1.00 29.10 ? 2086 HOH A O   1 
HETATM 4504 O O   . HOH D 3 .   ? -22.199 59.252 52.123 1.00 52.17 ? 2087 HOH A O   1 
HETATM 4505 O O   . HOH D 3 .   ? -5.331  79.889 31.903 1.00 56.63 ? 2088 HOH A O   1 
HETATM 4506 O O   . HOH D 3 .   ? -8.119  85.918 33.050 1.00 62.74 ? 2089 HOH A O   1 
HETATM 4507 O O   . HOH D 3 .   ? -24.618 57.253 54.271 1.00 52.56 ? 2090 HOH A O   1 
HETATM 4508 O O   . HOH D 3 .   ? 20.830  72.046 72.166 1.00 60.76 ? 2091 HOH A O   1 
HETATM 4509 O O   . HOH D 3 .   ? -20.628 53.837 49.554 1.00 68.07 ? 2092 HOH A O   1 
HETATM 4510 O O   . HOH D 3 .   ? 3.048   66.133 65.588 1.00 72.60 ? 2093 HOH A O   1 
HETATM 4511 O O   . HOH D 3 .   ? -2.258  85.310 59.078 1.00 68.59 ? 2094 HOH A O   1 
HETATM 4512 O O   . HOH D 3 .   ? 14.545  49.772 81.730 1.00 75.69 ? 2095 HOH A O   1 
HETATM 4513 O O   . HOH D 3 .   ? -16.723 55.964 49.264 1.00 49.95 ? 2096 HOH A O   1 
HETATM 4514 O O   . HOH D 3 .   ? -7.495  51.316 45.262 1.00 78.68 ? 2097 HOH A O   1 
HETATM 4515 O O   . HOH D 3 .   ? -14.114 50.750 46.460 1.00 70.62 ? 2098 HOH A O   1 
HETATM 4516 O O   . HOH D 3 .   ? -5.475  83.535 56.185 1.00 67.04 ? 2099 HOH A O   1 
HETATM 4517 O O   . HOH D 3 .   ? 1.488   83.350 61.204 1.00 58.06 ? 2100 HOH A O   1 
HETATM 4518 O O   . HOH D 3 .   ? 0.687   87.409 60.190 1.00 71.60 ? 2101 HOH A O   1 
HETATM 4519 O O   . HOH D 3 .   ? -9.875  55.915 45.141 1.00 43.51 ? 2102 HOH A O   1 
HETATM 4520 O O   . HOH D 3 .   ? -18.669 54.625 48.097 1.00 49.04 ? 2103 HOH A O   1 
HETATM 4521 O O   . HOH D 3 .   ? -15.690 54.141 47.430 1.00 59.66 ? 2104 HOH A O   1 
HETATM 4522 O O   . HOH D 3 .   ? 10.192  89.236 46.011 1.00 72.95 ? 2105 HOH A O   1 
HETATM 4523 O O   . HOH D 3 .   ? 14.585  89.093 44.628 1.00 76.03 ? 2106 HOH A O   1 
HETATM 4524 O O   . HOH D 3 .   ? 12.506  90.525 45.864 1.00 80.44 ? 2107 HOH A O   1 
HETATM 4525 O O   . HOH D 3 .   ? 22.344  52.094 33.425 1.00 65.41 ? 2108 HOH A O   1 
HETATM 4526 O O   . HOH D 3 .   ? 12.520  85.194 37.097 1.00 72.09 ? 2109 HOH A O   1 
HETATM 4527 O O   . HOH D 3 .   ? 20.314  50.670 33.518 1.00 52.34 ? 2110 HOH A O   1 
HETATM 4528 O O   . HOH D 3 .   ? -18.689 60.313 42.204 1.00 46.67 ? 2111 HOH A O   1 
HETATM 4529 O O   . HOH D 3 .   ? -21.952 70.081 47.540 1.00 59.91 ? 2112 HOH A O   1 
HETATM 4530 O O   . HOH D 3 .   ? -17.943 68.516 48.944 1.00 32.55 ? 2113 HOH A O   1 
HETATM 4531 O O   . HOH D 3 .   ? -21.797 67.524 49.305 1.00 62.13 ? 2114 HOH A O   1 
HETATM 4532 O O   . HOH D 3 .   ? -21.835 68.362 43.079 1.00 50.36 ? 2115 HOH A O   1 
HETATM 4533 O O   . HOH D 3 .   ? -21.271 70.954 35.428 1.00 56.37 ? 2116 HOH A O   1 
HETATM 4534 O O   . HOH D 3 .   ? -25.021 71.511 41.018 1.00 61.34 ? 2117 HOH A O   1 
HETATM 4535 O O   . HOH D 3 .   ? -18.973 45.053 55.470 1.00 65.38 ? 2118 HOH A O   1 
HETATM 4536 O O   . HOH D 3 .   ? 16.963  88.988 48.530 1.00 61.93 ? 2119 HOH A O   1 
HETATM 4537 O O   . HOH D 3 .   ? 20.959  88.685 51.818 1.00 59.56 ? 2120 HOH A O   1 
HETATM 4538 O O   . HOH D 3 .   ? 20.815  86.355 47.085 1.00 70.14 ? 2121 HOH A O   1 
HETATM 4539 O O   . HOH D 3 .   ? -20.351 75.036 37.442 1.00 35.63 ? 2122 HOH A O   1 
HETATM 4540 O O   . HOH D 3 .   ? -23.275 77.969 35.538 1.00 78.44 ? 2123 HOH A O   1 
HETATM 4541 O O   . HOH D 3 .   ? -24.135 80.036 41.667 1.00 53.22 ? 2124 HOH A O   1 
HETATM 4542 O O   . HOH D 3 .   ? -21.215 81.334 45.025 1.00 62.28 ? 2125 HOH A O   1 
HETATM 4543 O O   . HOH D 3 .   ? -24.154 78.118 44.070 1.00 76.88 ? 2126 HOH A O   1 
HETATM 4544 O O   . HOH D 3 .   ? 15.094  74.785 32.595 1.00 70.85 ? 2127 HOH A O   1 
HETATM 4545 O O   . HOH D 3 .   ? -7.898  59.114 42.151 1.00 31.24 ? 2128 HOH A O   1 
HETATM 4546 O O   . HOH D 3 .   ? -14.736 77.922 50.350 1.00 48.05 ? 2129 HOH A O   1 
HETATM 4547 O O   . HOH D 3 .   ? -20.378 77.387 47.163 1.00 42.55 ? 2130 HOH A O   1 
HETATM 4548 O O   . HOH D 3 .   ? -19.031 77.177 49.898 1.00 62.28 ? 2131 HOH A O   1 
HETATM 4549 O O   . HOH D 3 .   ? -21.547 80.321 49.471 1.00 72.10 ? 2132 HOH A O   1 
HETATM 4550 O O   . HOH D 3 .   ? -5.052  50.804 46.035 1.00 59.47 ? 2133 HOH A O   1 
HETATM 4551 O O   . HOH D 3 .   ? -10.083 60.731 40.463 1.00 40.89 ? 2134 HOH A O   1 
HETATM 4552 O O   . HOH D 3 .   ? 33.637  67.450 49.458 1.00 69.53 ? 2135 HOH A O   1 
HETATM 4553 O O   . HOH D 3 .   ? 30.779  74.272 41.943 1.00 71.45 ? 2136 HOH A O   1 
HETATM 4554 O O   . HOH D 3 .   ? -10.176 84.031 53.756 1.00 64.34 ? 2137 HOH A O   1 
HETATM 4555 O O   . HOH D 3 .   ? -14.722 76.647 52.595 1.00 57.15 ? 2138 HOH A O   1 
HETATM 4556 O O   . HOH D 3 .   ? 30.559  58.793 65.488 1.00 67.81 ? 2139 HOH A O   1 
HETATM 4557 O O   . HOH D 3 .   ? -10.626 81.417 55.604 1.00 39.91 ? 2140 HOH A O   1 
HETATM 4558 O O   . HOH D 3 .   ? -18.671 72.485 61.708 1.00 63.71 ? 2141 HOH A O   1 
HETATM 4559 O O   . HOH D 3 .   ? -15.372 72.677 54.177 1.00 42.67 ? 2142 HOH A O   1 
HETATM 4560 O O   . HOH D 3 .   ? -14.865 75.853 58.576 1.00 70.79 ? 2143 HOH A O   1 
HETATM 4561 O O   . HOH D 3 .   ? -9.753  70.041 54.693 1.00 30.98 ? 2144 HOH A O   1 
HETATM 4562 O O   . HOH D 3 .   ? 8.993   73.795 31.126 1.00 63.92 ? 2145 HOH A O   1 
HETATM 4563 O O   . HOH D 3 .   ? -2.560  65.075 26.229 1.00 70.82 ? 2146 HOH A O   1 
HETATM 4564 O O   . HOH D 3 .   ? 4.069   63.890 64.795 1.00 49.75 ? 2147 HOH A O   1 
HETATM 4565 O O   . HOH D 3 .   ? 4.850   68.953 63.337 1.00 48.94 ? 2148 HOH A O   1 
HETATM 4566 O O   . HOH D 3 .   ? -14.501 65.312 67.069 1.00 46.49 ? 2149 HOH A O   1 
HETATM 4567 O O   . HOH D 3 .   ? -8.837  60.744 63.534 1.00 27.33 ? 2150 HOH A O   1 
HETATM 4568 O O   . HOH D 3 .   ? -9.721  62.076 59.821 1.00 26.27 ? 2151 HOH A O   1 
HETATM 4569 O O   . HOH D 3 .   ? -12.233 62.972 59.181 1.00 30.22 ? 2152 HOH A O   1 
HETATM 4570 O O   . HOH D 3 .   ? -4.569  67.795 65.820 1.00 45.87 ? 2153 HOH A O   1 
HETATM 4571 O O   . HOH D 3 .   ? -10.556 65.579 68.889 1.00 34.27 ? 2154 HOH A O   1 
HETATM 4572 O O   . HOH D 3 .   ? -0.971  65.291 73.045 1.00 46.73 ? 2155 HOH A O   1 
HETATM 4573 O O   . HOH D 3 .   ? -5.567  65.643 74.308 1.00 61.24 ? 2156 HOH A O   1 
HETATM 4574 O O   . HOH D 3 .   ? 25.738  55.030 37.006 1.00 79.79 ? 2157 HOH A O   1 
HETATM 4575 O O   . HOH D 3 .   ? 25.542  62.085 35.164 1.00 57.94 ? 2158 HOH A O   1 
HETATM 4576 O O   . HOH D 3 .   ? -1.111  60.499 73.536 1.00 51.07 ? 2159 HOH A O   1 
HETATM 4577 O O   . HOH D 3 .   ? -8.862  64.849 70.950 1.00 38.43 ? 2160 HOH A O   1 
HETATM 4578 O O   . HOH D 3 .   ? -3.679  51.289 40.353 1.00 60.32 ? 2161 HOH A O   1 
HETATM 4579 O O   . HOH D 3 .   ? -3.533  68.645 79.264 1.00 44.10 ? 2162 HOH A O   1 
HETATM 4580 O O   . HOH D 3 .   ? -8.505  66.897 72.500 1.00 52.60 ? 2163 HOH A O   1 
HETATM 4581 O O   . HOH D 3 .   ? -11.583 68.338 74.666 1.00 59.13 ? 2164 HOH A O   1 
HETATM 4582 O O   . HOH D 3 .   ? 15.000  67.682 33.951 1.00 60.61 ? 2165 HOH A O   1 
HETATM 4583 O O   . HOH D 3 .   ? 1.059   70.835 80.526 1.00 43.64 ? 2166 HOH A O   1 
HETATM 4584 O O   . HOH D 3 .   ? 0.371   75.104 79.073 1.00 63.08 ? 2167 HOH A O   1 
HETATM 4585 O O   . HOH D 3 .   ? 16.520  49.627 56.715 1.00 63.09 ? 2168 HOH A O   1 
HETATM 4586 O O   . HOH D 3 .   ? 9.124   48.603 61.283 1.00 80.72 ? 2169 HOH A O   1 
HETATM 4587 O O   . HOH D 3 .   ? 4.883   47.707 63.165 1.00 36.47 ? 2170 HOH A O   1 
HETATM 4588 O O   . HOH D 3 .   ? 5.324   45.797 57.430 1.00 53.13 ? 2171 HOH A O   1 
HETATM 4589 O O   . HOH D 3 .   ? 8.014   49.280 59.037 1.00 57.29 ? 2172 HOH A O   1 
HETATM 4590 O O   . HOH D 3 .   ? 2.281   81.202 73.723 1.00 52.73 ? 2173 HOH A O   1 
HETATM 4591 O O   . HOH D 3 .   ? 4.971   79.489 68.463 1.00 56.02 ? 2174 HOH A O   1 
HETATM 4592 O O   . HOH D 3 .   ? 3.916   43.955 63.599 1.00 52.37 ? 2175 HOH A O   1 
HETATM 4593 O O   . HOH D 3 .   ? 5.694   42.193 59.805 1.00 66.88 ? 2176 HOH A O   1 
HETATM 4594 O O   . HOH D 3 .   ? -4.287  38.103 60.883 1.00 47.50 ? 2177 HOH A O   1 
HETATM 4595 O O   . HOH D 3 .   ? -1.825  39.639 64.758 1.00 61.91 ? 2178 HOH A O   1 
HETATM 4596 O O   . HOH D 3 .   ? -6.713  40.066 64.321 1.00 56.63 ? 2179 HOH A O   1 
HETATM 4597 O O   . HOH D 3 .   ? -1.582  38.347 57.320 1.00 48.36 ? 2180 HOH A O   1 
HETATM 4598 O O   . HOH D 3 .   ? 2.752   39.652 59.222 1.00 54.39 ? 2181 HOH A O   1 
HETATM 4599 O O   . HOH D 3 .   ? 2.152   40.392 63.302 1.00 62.79 ? 2182 HOH A O   1 
HETATM 4600 O O   . HOH D 3 .   ? 0.652   42.574 70.370 1.00 68.08 ? 2183 HOH A O   1 
HETATM 4601 O O   . HOH D 3 .   ? -1.393  71.947 73.557 1.00 33.34 ? 2184 HOH A O   1 
HETATM 4602 O O   . HOH D 3 .   ? 0.417   70.083 68.689 1.00 36.98 ? 2185 HOH A O   1 
HETATM 4603 O O   . HOH D 3 .   ? -6.961  40.068 66.916 1.00 51.83 ? 2186 HOH A O   1 
HETATM 4604 O O   . HOH D 3 .   ? -3.953  39.099 58.386 1.00 47.94 ? 2187 HOH A O   1 
HETATM 4605 O O   . HOH D 3 .   ? -1.863  80.047 70.959 1.00 56.51 ? 2188 HOH A O   1 
HETATM 4606 O O   . HOH D 3 .   ? -3.735  73.122 73.638 1.00 51.00 ? 2189 HOH A O   1 
HETATM 4607 O O   . HOH D 3 .   ? 4.077   44.784 66.047 1.00 45.12 ? 2190 HOH A O   1 
HETATM 4608 O O   . HOH D 3 .   ? -4.417  46.379 75.521 1.00 49.58 ? 2191 HOH A O   1 
HETATM 4609 O O   . HOH D 3 .   ? -10.205 45.913 76.100 1.00 53.13 ? 2192 HOH A O   1 
HETATM 4610 O O   . HOH D 3 .   ? 0.236   77.427 62.241 1.00 32.51 ? 2193 HOH A O   1 
HETATM 4611 O O   . HOH D 3 .   ? -1.139  79.669 67.353 1.00 70.10 ? 2194 HOH A O   1 
HETATM 4612 O O   . HOH D 3 .   ? -0.361  69.501 62.494 1.00 30.43 ? 2195 HOH A O   1 
HETATM 4613 O O   . HOH D 3 .   ? -13.311 42.385 75.629 1.00 75.20 ? 2196 HOH A O   1 
HETATM 4614 O O   . HOH D 3 .   ? -1.045  68.295 66.984 1.00 51.55 ? 2197 HOH A O   1 
HETATM 4615 O O   . HOH D 3 .   ? -3.576  76.005 64.603 1.00 34.31 ? 2198 HOH A O   1 
HETATM 4616 O O   . HOH D 3 .   ? -5.996  74.356 69.928 1.00 62.50 ? 2199 HOH A O   1 
HETATM 4617 O O   . HOH D 3 .   ? -14.719 41.201 72.802 1.00 73.69 ? 2200 HOH A O   1 
HETATM 4618 O O   . HOH D 3 .   ? -5.664  76.456 66.548 1.00 47.35 ? 2201 HOH A O   1 
HETATM 4619 O O   . HOH D 3 .   ? -7.869  72.763 67.601 1.00 44.64 ? 2202 HOH A O   1 
HETATM 4620 O O   . HOH D 3 .   ? -9.057  79.887 64.481 1.00 69.66 ? 2203 HOH A O   1 
HETATM 4621 O O   . HOH D 3 .   ? -11.576 38.069 55.463 1.00 80.52 ? 2204 HOH A O   1 
HETATM 4622 O O   . HOH D 3 .   ? -6.916  81.162 59.035 1.00 48.26 ? 2205 HOH A O   1 
HETATM 4623 O O   . HOH D 3 .   ? -13.090 79.143 57.292 1.00 50.42 ? 2206 HOH A O   1 
HETATM 4624 O O   . HOH D 3 .   ? -11.707 72.233 65.646 1.00 47.16 ? 2207 HOH A O   1 
HETATM 4625 O O   . HOH D 3 .   ? -23.540 49.018 54.170 1.00 64.51 ? 2208 HOH A O   1 
HETATM 4626 O O   . HOH D 3 .   ? -23.641 52.192 56.250 1.00 60.33 ? 2209 HOH A O   1 
HETATM 4627 O O   . HOH D 3 .   ? -14.536 76.779 61.066 1.00 66.81 ? 2210 HOH A O   1 
HETATM 4628 O O   . HOH D 3 .   ? -23.739 53.819 57.893 1.00 57.84 ? 2211 HOH A O   1 
HETATM 4629 O O   . HOH D 3 .   ? -14.325 71.139 65.698 1.00 41.78 ? 2212 HOH A O   1 
HETATM 4630 O O   . HOH D 3 .   ? -16.660 68.788 65.209 1.00 58.50 ? 2213 HOH A O   1 
HETATM 4631 O O   . HOH D 3 .   ? -19.585 67.497 61.096 1.00 65.10 ? 2214 HOH A O   1 
HETATM 4632 O O   . HOH D 3 .   ? -20.000 69.563 58.028 1.00 66.50 ? 2215 HOH A O   1 
HETATM 4633 O O   . HOH D 3 .   ? -19.329 56.780 75.982 1.00 84.65 ? 2216 HOH A O   1 
HETATM 4634 O O   . HOH D 3 .   ? -22.329 60.394 73.387 1.00 89.50 ? 2217 HOH A O   1 
HETATM 4635 O O   . HOH D 3 .   ? -19.984 60.911 72.413 1.00 80.10 ? 2218 HOH A O   1 
HETATM 4636 O O   . HOH D 3 .   ? -13.576 62.172 56.990 1.00 29.34 ? 2219 HOH A O   1 
HETATM 4637 O O   . HOH D 3 .   ? -19.739 62.911 61.088 1.00 40.87 ? 2220 HOH A O   1 
HETATM 4638 O O   . HOH D 3 .   ? -20.110 59.287 59.222 1.00 35.24 ? 2221 HOH A O   1 
HETATM 4639 O O   . HOH D 3 .   ? -18.119 65.184 61.372 1.00 38.43 ? 2222 HOH A O   1 
HETATM 4640 O O   . HOH D 3 .   ? -5.438  60.375 75.088 1.00 69.27 ? 2223 HOH A O   1 
HETATM 4641 O O   . HOH D 3 .   ? -20.293 69.022 51.242 1.00 43.71 ? 2224 HOH A O   1 
HETATM 4642 O O   . HOH D 3 .   ? -15.367 66.176 51.935 1.00 28.29 ? 2225 HOH A O   1 
HETATM 4643 O O   . HOH D 3 .   ? -22.006 66.263 54.380 1.00 72.75 ? 2226 HOH A O   1 
HETATM 4644 O O   . HOH D 3 .   ? -3.095  43.808 73.243 1.00 60.60 ? 2227 HOH A O   1 
HETATM 4645 O O   . HOH D 3 .   ? 7.839   55.021 81.030 1.00 47.78 ? 2228 HOH A O   1 
HETATM 4646 O O   . HOH D 3 .   ? -18.912 72.207 51.465 1.00 63.45 ? 2229 HOH A O   1 
HETATM 4647 O O   . HOH D 3 .   ? 2.805   62.553 70.184 1.00 60.96 ? 2230 HOH A O   1 
HETATM 4648 O O   . HOH D 3 .   ? 4.199   43.598 55.773 1.00 35.71 ? 2231 HOH A O   1 
HETATM 4649 O O   . HOH D 3 .   ? 1.230   40.558 54.623 1.00 50.93 ? 2232 HOH A O   1 
HETATM 4650 O O   . HOH D 3 .   ? -4.058  83.139 52.004 1.00 36.34 ? 2233 HOH A O   1 
HETATM 4651 O O   . HOH D 3 .   ? 4.576   41.296 52.169 1.00 60.07 ? 2234 HOH A O   1 
HETATM 4652 O O   . HOH D 3 .   ? 13.682  42.120 50.326 1.00 68.71 ? 2235 HOH A O   1 
HETATM 4653 O O   . HOH D 3 .   ? 1.633   87.807 41.636 1.00 52.05 ? 2236 HOH A O   1 
HETATM 4654 O O   . HOH D 3 .   ? -0.672  92.538 40.897 1.00 72.43 ? 2237 HOH A O   1 
HETATM 4655 O O   . HOH D 3 .   ? 6.198   44.116 54.096 1.00 35.90 ? 2238 HOH A O   1 
HETATM 4656 O O   . HOH D 3 .   ? 10.939  43.707 54.437 1.00 59.47 ? 2239 HOH A O   1 
HETATM 4657 O O   . HOH D 3 .   ? 10.817  48.843 54.770 1.00 50.56 ? 2240 HOH A O   1 
HETATM 4658 O O   . HOH D 3 .   ? 14.888  42.468 47.987 1.00 54.50 ? 2241 HOH A O   1 
HETATM 4659 O O   . HOH D 3 .   ? 1.859   86.607 37.049 1.00 49.34 ? 2242 HOH A O   1 
HETATM 4660 O O   . HOH D 3 .   ? -5.135  87.651 35.021 1.00 48.42 ? 2243 HOH A O   1 
HETATM 4661 O O   . HOH D 3 .   ? -7.837  80.169 31.927 1.00 63.53 ? 2244 HOH A O   1 
HETATM 4662 O O   . HOH D 3 .   ? -11.039 82.162 33.420 1.00 48.18 ? 2245 HOH A O   1 
HETATM 4663 O O   . HOH D 3 .   ? -3.536  86.160 32.779 1.00 61.73 ? 2246 HOH A O   1 
HETATM 4664 O O   . HOH D 3 .   ? 0.466   86.106 33.125 1.00 66.50 ? 2247 HOH A O   1 
HETATM 4665 O O   . HOH D 3 .   ? 14.841  49.810 34.312 1.00 71.91 ? 2248 HOH A O   1 
HETATM 4666 O O   . HOH D 3 .   ? -4.053  81.975 32.184 1.00 48.44 ? 2249 HOH A O   1 
HETATM 4667 O O   . HOH D 3 .   ? 3.186   81.803 32.419 1.00 50.17 ? 2250 HOH A O   1 
HETATM 4668 O O   . HOH D 3 .   ? -6.578  84.406 31.296 1.00 75.30 ? 2251 HOH A O   1 
HETATM 4669 O O   . HOH D 3 .   ? -3.171  77.156 31.003 1.00 44.95 ? 2252 HOH A O   1 
HETATM 4670 O O   . HOH D 3 .   ? 7.556   78.074 35.511 1.00 65.81 ? 2253 HOH A O   1 
HETATM 4671 O O   . HOH D 3 .   ? 7.646   75.547 34.624 1.00 67.04 ? 2254 HOH A O   1 
HETATM 4672 O O   . HOH D 3 .   ? 20.828  69.729 71.282 1.00 59.99 ? 2255 HOH A O   1 
HETATM 4673 O O   . HOH D 3 .   ? 19.919  74.355 68.483 1.00 45.11 ? 2256 HOH A O   1 
HETATM 4674 O O   . HOH D 3 .   ? 12.764  77.495 78.697 1.00 68.94 ? 2257 HOH A O   1 
HETATM 4675 O O   . HOH D 3 .   ? 1.972   77.199 78.800 1.00 69.40 ? 2258 HOH A O   1 
HETATM 4676 O O   . HOH D 3 .   ? 7.033   80.004 78.141 1.00 72.19 ? 2259 HOH A O   1 
HETATM 4677 O O   . HOH D 3 .   ? 14.845  73.680 86.239 1.00 65.35 ? 2260 HOH A O   1 
HETATM 4678 O O   . HOH D 3 .   ? -0.618  63.085 59.028 1.00 23.90 ? 2261 HOH A O   1 
HETATM 4679 O O   . HOH D 3 .   ? -0.083  65.888 68.415 1.00 44.71 ? 2262 HOH A O   1 
HETATM 4680 O O   . HOH D 3 .   ? 11.995  63.708 86.357 1.00 65.71 ? 2263 HOH A O   1 
HETATM 4681 O O   . HOH D 3 .   ? 16.856  58.813 90.485 1.00 60.24 ? 2264 HOH A O   1 
HETATM 4682 O O   . HOH D 3 .   ? 0.055   67.466 64.400 1.00 37.66 ? 2265 HOH A O   1 
HETATM 4683 O O   . HOH D 3 .   ? 11.403  50.730 81.339 1.00 62.25 ? 2266 HOH A O   1 
HETATM 4684 O O   . HOH D 3 .   ? -7.330  67.907 57.928 1.00 30.24 ? 2267 HOH A O   1 
HETATM 4685 O O   . HOH D 3 .   ? -4.137  69.916 62.485 1.00 26.58 ? 2268 HOH A O   1 
HETATM 4686 O O   . HOH D 3 .   ? -2.014  75.354 52.854 1.00 31.33 ? 2269 HOH A O   1 
HETATM 4687 O O   . HOH D 3 .   ? -7.424  70.217 56.426 1.00 26.30 ? 2270 HOH A O   1 
HETATM 4688 O O   . HOH D 3 .   ? -8.213  71.342 52.721 1.00 28.62 ? 2271 HOH A O   1 
HETATM 4689 O O   . HOH D 3 .   ? 14.860  46.033 62.622 1.00 52.75 ? 2272 HOH A O   1 
HETATM 4690 O O   . HOH D 3 .   ? 12.310  49.974 60.163 1.00 71.34 ? 2273 HOH A O   1 
HETATM 4691 O O   . HOH D 3 .   ? 26.158  46.053 77.382 1.00 46.45 ? 2274 HOH A O   1 
HETATM 4692 O O   . HOH D 3 .   ? -2.676  77.816 62.671 1.00 38.41 ? 2275 HOH A O   1 
HETATM 4693 O O   . HOH D 3 .   ? -0.148  82.604 57.874 1.00 48.32 ? 2276 HOH A O   1 
HETATM 4694 O O   . HOH D 3 .   ? -4.552  80.189 58.467 1.00 42.37 ? 2277 HOH A O   1 
HETATM 4695 O O   . HOH D 3 .   ? -4.944  80.168 62.810 1.00 46.98 ? 2278 HOH A O   1 
HETATM 4696 O O   . HOH D 3 .   ? -0.042  69.348 59.765 1.00 28.89 ? 2279 HOH A O   1 
HETATM 4697 O O   . HOH D 3 .   ? 3.706   68.913 57.870 1.00 25.69 ? 2280 HOH A O   1 
HETATM 4698 O O   . HOH D 3 .   ? 28.104  59.301 71.518 1.00 63.57 ? 2281 HOH A O   1 
HETATM 4699 O O   . HOH D 3 .   ? 29.816  57.853 69.090 1.00 69.55 ? 2282 HOH A O   1 
HETATM 4700 O O   . HOH D 3 .   ? 31.936  58.406 73.142 1.00 60.20 ? 2283 HOH A O   1 
HETATM 4701 O O   . HOH D 3 .   ? 3.972   80.573 51.467 1.00 28.12 ? 2284 HOH A O   1 
HETATM 4702 O O   . HOH D 3 .   ? 33.498  61.903 85.465 1.00 59.33 ? 2285 HOH A O   1 
HETATM 4703 O O   . HOH D 3 .   ? 20.096  64.182 86.244 1.00 70.35 ? 2286 HOH A O   1 
HETATM 4704 O O   . HOH D 3 .   ? 31.238  67.316 78.767 1.00 59.67 ? 2287 HOH A O   1 
HETATM 4705 O O   . HOH D 3 .   ? -1.865  86.838 57.003 1.00 68.34 ? 2288 HOH A O   1 
HETATM 4706 O O   . HOH D 3 .   ? -4.040  85.444 53.889 1.00 49.93 ? 2289 HOH A O   1 
HETATM 4707 O O   . HOH D 3 .   ? -0.314  90.261 54.198 1.00 56.98 ? 2290 HOH A O   1 
HETATM 4708 O O   . HOH D 3 .   ? 27.067  60.815 74.735 1.00 61.46 ? 2291 HOH A O   1 
HETATM 4709 O O   . HOH D 3 .   ? 26.090  64.536 72.831 1.00 71.26 ? 2292 HOH A O   1 
HETATM 4710 O O   . HOH D 3 .   ? 1.134   84.621 58.926 1.00 73.01 ? 2293 HOH A O   1 
HETATM 4711 O O   . HOH D 3 .   ? 0.704   88.567 55.846 1.00 62.66 ? 2294 HOH A O   1 
HETATM 4712 O O   . HOH D 3 .   ? 27.654  67.948 76.090 1.00 50.00 ? 2295 HOH A O   1 
HETATM 4713 O O   . HOH D 3 .   ? 26.442  70.652 75.590 1.00 54.45 ? 2296 HOH A O   1 
HETATM 4714 O O   . HOH D 3 .   ? 20.731  73.472 75.363 1.00 62.50 ? 2297 HOH A O   1 
HETATM 4715 O O   . HOH D 3 .   ? 22.256  66.772 70.145 1.00 68.71 ? 2298 HOH A O   1 
HETATM 4716 O O   . HOH D 3 .   ? 4.176   86.869 41.812 1.00 50.09 ? 2299 HOH A O   1 
HETATM 4717 O O   . HOH D 3 .   ? 11.925  87.146 44.770 1.00 59.59 ? 2300 HOH A O   1 
HETATM 4718 O O   . HOH D 3 .   ? 8.814   88.408 48.359 1.00 37.32 ? 2301 HOH A O   1 
HETATM 4719 O O   . HOH D 3 .   ? 13.342  84.583 43.950 1.00 51.87 ? 2302 HOH A O   1 
HETATM 4720 O O   . HOH D 3 .   ? 12.406  83.780 41.079 1.00 67.07 ? 2303 HOH A O   1 
HETATM 4721 O O   . HOH D 3 .   ? 22.385  50.964 49.593 1.00 77.64 ? 2304 HOH A O   1 
HETATM 4722 O O   . HOH D 3 .   ? 16.556  52.154 35.730 1.00 57.63 ? 2305 HOH A O   1 
HETATM 4723 O O   . HOH D 3 .   ? 18.809  54.667 33.780 1.00 63.85 ? 2306 HOH A O   1 
HETATM 4724 O O   . HOH D 3 .   ? 21.297  54.346 33.961 1.00 58.62 ? 2307 HOH A O   1 
HETATM 4725 O O   . HOH D 3 .   ? 21.437  56.660 35.340 1.00 48.69 ? 2308 HOH A O   1 
HETATM 4726 O O   . HOH D 3 .   ? 14.929  62.913 32.135 1.00 69.60 ? 2309 HOH A O   1 
HETATM 4727 O O   . HOH D 3 .   ? 23.026  68.418 36.938 1.00 74.43 ? 2310 HOH A O   1 
HETATM 4728 O O   . HOH D 3 .   ? -1.549  69.634 52.708 1.00 22.83 ? 2311 HOH A O   1 
HETATM 4729 O O   . HOH D 3 .   ? 24.922  68.126 64.217 1.00 55.79 ? 2312 HOH A O   1 
HETATM 4730 O O   . HOH D 3 .   ? 25.050  72.547 65.160 1.00 63.35 ? 2313 HOH A O   1 
HETATM 4731 O O   . HOH D 3 .   ? 12.018  79.439 76.599 1.00 74.26 ? 2314 HOH A O   1 
HETATM 4732 O O   . HOH D 3 .   ? 19.276  74.083 77.652 1.00 50.22 ? 2315 HOH A O   1 
HETATM 4733 O O   . HOH D 3 .   ? -13.433 57.524 56.560 1.00 26.77 ? 2316 HOH A O   1 
HETATM 4734 O O   . HOH D 3 .   ? -3.645  50.805 59.698 1.00 30.07 ? 2317 HOH A O   1 
HETATM 4735 O O   . HOH D 3 .   ? -4.247  51.767 56.288 1.00 24.24 ? 2318 HOH A O   1 
HETATM 4736 O O   . HOH D 3 .   ? 6.940   79.612 66.610 1.00 74.65 ? 2319 HOH A O   1 
HETATM 4737 O O   . HOH D 3 .   ? 5.568   81.693 64.026 1.00 85.90 ? 2320 HOH A O   1 
HETATM 4738 O O   . HOH D 3 .   ? -6.525  45.983 51.701 1.00 45.12 ? 2321 HOH A O   1 
HETATM 4739 O O   . HOH D 3 .   ? -7.894  41.106 49.472 1.00 60.07 ? 2322 HOH A O   1 
HETATM 4740 O O   . HOH D 3 .   ? -11.917 38.217 50.890 1.00 78.56 ? 2323 HOH A O   1 
HETATM 4741 O O   . HOH D 3 .   ? -9.060  44.694 51.291 1.00 44.12 ? 2324 HOH A O   1 
HETATM 4742 O O   . HOH D 3 .   ? -16.567 44.063 54.638 1.00 49.48 ? 2325 HOH A O   1 
HETATM 4743 O O   . HOH D 3 .   ? 19.405  83.771 65.431 1.00 52.32 ? 2326 HOH A O   1 
HETATM 4744 O O   . HOH D 3 .   ? 12.301  91.407 66.986 1.00 79.53 ? 2327 HOH A O   1 
HETATM 4745 O O   . HOH D 3 .   ? -13.639 51.073 49.550 1.00 38.72 ? 2328 HOH A O   1 
HETATM 4746 O O   . HOH D 3 .   ? -15.929 43.912 51.627 1.00 63.27 ? 2329 HOH A O   1 
HETATM 4747 O O   . HOH D 3 .   ? 17.813  92.211 51.131 1.00 64.74 ? 2330 HOH A O   1 
HETATM 4748 O O   . HOH D 3 .   ? 16.231  91.925 64.031 1.00 67.48 ? 2331 HOH A O   1 
HETATM 4749 O O   . HOH D 3 .   ? -15.321 47.432 45.415 1.00 69.44 ? 2332 HOH A O   1 
HETATM 4750 O O   . HOH D 3 .   ? 18.295  87.887 50.748 1.00 47.19 ? 2333 HOH A O   1 
HETATM 4751 O O   . HOH D 3 .   ? 15.988  86.370 47.027 1.00 51.33 ? 2334 HOH A O   1 
HETATM 4752 O O   . HOH D 3 .   ? 22.234  83.423 48.061 1.00 72.35 ? 2335 HOH A O   1 
HETATM 4753 O O   . HOH D 3 .   ? 22.739  86.501 52.547 1.00 61.38 ? 2336 HOH A O   1 
HETATM 4754 O O   . HOH D 3 .   ? -9.912  51.808 54.982 1.00 30.88 ? 2337 HOH A O   1 
HETATM 4755 O O   . HOH D 3 .   ? -6.956  50.380 49.691 1.00 44.33 ? 2338 HOH A O   1 
HETATM 4756 O O   . HOH D 3 .   ? 18.970  73.861 35.367 1.00 55.29 ? 2339 HOH A O   1 
HETATM 4757 O O   . HOH D 3 .   ? 12.122  74.426 32.317 1.00 68.61 ? 2340 HOH A O   1 
HETATM 4758 O O   . HOH D 3 .   ? -7.888  57.820 44.610 1.00 29.36 ? 2341 HOH A O   1 
HETATM 4759 O O   . HOH D 3 .   ? -3.285  51.576 44.161 1.00 40.06 ? 2342 HOH A O   1 
HETATM 4760 O O   . HOH D 3 .   ? -6.905  55.153 42.837 1.00 57.81 ? 2343 HOH A O   1 
HETATM 4761 O O   . HOH D 3 .   ? 24.197  60.704 39.988 1.00 42.80 ? 2344 HOH A O   1 
HETATM 4762 O O   . HOH D 3 .   ? 27.982  65.075 40.241 1.00 60.50 ? 2345 HOH A O   1 
HETATM 4763 O O   . HOH D 3 .   ? 27.484  67.678 39.247 1.00 63.82 ? 2346 HOH A O   1 
HETATM 4764 O O   . HOH D 3 .   ? 27.826  71.008 41.749 1.00 69.49 ? 2347 HOH A O   1 
HETATM 4765 O O   . HOH D 3 .   ? 34.211  59.363 48.977 1.00 65.55 ? 2348 HOH A O   1 
HETATM 4766 O O   . HOH D 3 .   ? 28.464  53.989 42.028 1.00 74.73 ? 2349 HOH A O   1 
HETATM 4767 O O   . HOH D 3 .   ? -9.815  63.655 40.833 1.00 37.07 ? 2350 HOH A O   1 
HETATM 4768 O O   . HOH D 3 .   ? 35.411  65.925 47.893 1.00 78.33 ? 2351 HOH A O   1 
HETATM 4769 O O   . HOH D 3 .   ? 26.339  54.464 53.124 1.00 69.31 ? 2352 HOH A O   1 
HETATM 4770 O O   . HOH D 3 .   ? 33.205  69.585 48.003 1.00 62.50 ? 2353 HOH A O   1 
HETATM 4771 O O   . HOH D 3 .   ? -4.464  60.788 34.458 1.00 48.54 ? 2354 HOH A O   1 
HETATM 4772 O O   . HOH D 3 .   ? -6.102  58.560 40.085 1.00 39.93 ? 2355 HOH A O   1 
HETATM 4773 O O   . HOH D 3 .   ? -5.108  57.814 36.878 1.00 43.34 ? 2356 HOH A O   1 
HETATM 4774 O O   . HOH D 3 .   ? 23.147  82.215 64.293 1.00 72.35 ? 2357 HOH A O   1 
HETATM 4775 O O   . HOH D 3 .   ? 33.190  69.548 58.853 1.00 69.79 ? 2358 HOH A O   1 
HETATM 4776 O O   . HOH D 3 .   ? -0.093  66.187 36.827 1.00 35.48 ? 2359 HOH A O   1 
HETATM 4777 O O   . HOH D 3 .   ? 25.237  66.392 60.193 1.00 53.33 ? 2360 HOH A O   1 
HETATM 4778 O O   . HOH D 3 .   ? -9.984  65.003 38.416 1.00 34.36 ? 2361 HOH A O   1 
HETATM 4779 O O   . HOH D 3 .   ? -6.320  65.461 32.063 1.00 49.65 ? 2362 HOH A O   1 
HETATM 4780 O O   . HOH D 3 .   ? -9.217  61.855 35.653 1.00 53.81 ? 2363 HOH A O   1 
HETATM 4781 O O   . HOH D 3 .   ? 31.053  59.660 62.933 1.00 54.05 ? 2364 HOH A O   1 
HETATM 4782 O O   . HOH D 3 .   ? -12.033 66.960 37.192 1.00 37.94 ? 2365 HOH A O   1 
HETATM 4783 O O   . HOH D 3 .   ? 16.462  45.788 56.316 1.00 80.73 ? 2366 HOH A O   1 
HETATM 4784 O O   . HOH D 3 .   ? 14.294  47.358 59.964 1.00 67.59 ? 2367 HOH A O   1 
HETATM 4785 O O   . HOH D 3 .   ? 28.297  52.522 55.015 1.00 69.96 ? 2368 HOH A O   1 
HETATM 4786 O O   . HOH D 3 .   ? 18.297  41.416 58.466 1.00 65.72 ? 2369 HOH A O   1 
HETATM 4787 O O   . HOH D 3 .   ? -4.602  70.643 33.965 1.00 28.72 ? 2370 HOH A O   1 
HETATM 4788 O O   . HOH D 3 .   ? -7.574  69.352 28.869 1.00 76.25 ? 2371 HOH A O   1 
HETATM 4789 O O   . HOH D 3 .   ? -1.039  74.566 31.462 1.00 41.42 ? 2372 HOH A O   1 
HETATM 4790 O O   . HOH D 3 .   ? 6.076   74.795 32.716 1.00 56.11 ? 2373 HOH A O   1 
HETATM 4791 O O   . HOH D 3 .   ? 2.018   70.996 29.544 1.00 56.92 ? 2374 HOH A O   1 
HETATM 4792 O O   . HOH D 3 .   ? 3.636   66.781 36.697 1.00 25.76 ? 2375 HOH A O   1 
HETATM 4793 O O   . HOH D 3 .   ? -1.122  64.439 29.257 1.00 67.14 ? 2376 HOH A O   1 
HETATM 4794 O O   . HOH D 3 .   ? -2.894  67.064 32.279 1.00 53.75 ? 2377 HOH A O   1 
HETATM 4795 O O   . HOH D 3 .   ? 8.925   71.417 32.642 1.00 45.50 ? 2378 HOH A O   1 
HETATM 4796 O O   . HOH D 3 .   ? 10.498  68.521 59.898 1.00 27.73 ? 2379 HOH A O   1 
HETATM 4797 O O   . HOH D 3 .   ? 3.959   67.913 61.247 1.00 44.49 ? 2380 HOH A O   1 
HETATM 4798 O O   . HOH D 3 .   ? 5.680   63.087 62.866 1.00 39.50 ? 2381 HOH A O   1 
HETATM 4799 O O   . HOH D 3 .   ? 4.986   61.577 60.993 1.00 43.96 ? 2382 HOH A O   1 
HETATM 4800 O O   . HOH D 3 .   ? 4.128   63.754 60.899 1.00 31.40 ? 2383 HOH A O   1 
HETATM 4801 O O   . HOH D 3 .   ? 23.440  57.666 36.388 1.00 64.78 ? 2384 HOH A O   1 
HETATM 4802 O O   . HOH D 3 .   ? 24.920  59.585 35.525 1.00 67.87 ? 2385 HOH A O   1 
HETATM 4803 O O   . HOH D 3 .   ? -4.390  56.204 39.398 1.00 48.79 ? 2386 HOH A O   1 
HETATM 4804 O O   . HOH D 3 .   ? -1.001  51.064 42.538 1.00 40.48 ? 2387 HOH A O   1 
HETATM 4805 O O   . HOH D 3 .   ? 8.177   49.977 37.596 1.00 50.15 ? 2388 HOH A O   1 
HETATM 4806 O O   . HOH D 3 .   ? 1.639   64.081 35.579 1.00 40.03 ? 2389 HOH A O   1 
HETATM 4807 O O   . HOH D 3 .   ? 2.746   54.167 36.733 1.00 29.53 ? 2390 HOH A O   1 
HETATM 4808 O O   . HOH D 3 .   ? 0.147   56.728 38.101 1.00 39.29 ? 2391 HOH A O   1 
HETATM 4809 O O   . HOH D 3 .   ? 5.155   55.830 35.514 1.00 59.01 ? 2392 HOH A O   1 
HETATM 4810 O O   . HOH D 3 .   ? -1.459  60.681 34.185 1.00 42.99 ? 2393 HOH A O   1 
HETATM 4811 O O   . HOH D 3 .   ? -0.838  66.432 40.065 1.00 34.96 ? 2394 HOH A O   1 
HETATM 4812 O O   . HOH D 3 .   ? 4.196   64.469 35.415 1.00 36.63 ? 2395 HOH A O   1 
HETATM 4813 O O   . HOH D 3 .   ? 12.950  66.067 33.588 1.00 56.16 ? 2396 HOH A O   1 
HETATM 4814 O O   . HOH D 3 .   ? 12.424  68.908 30.106 1.00 73.72 ? 2397 HOH A O   1 
HETATM 4815 O O   . HOH D 3 .   ? 11.446  64.856 35.457 1.00 47.68 ? 2398 HOH A O   1 
HETATM 4816 O O   . HOH D 3 .   ? 9.204   62.514 35.832 1.00 38.39 ? 2399 HOH A O   1 
HETATM 4817 O O   . HOH D 3 .   ? 11.178  70.851 33.931 1.00 49.84 ? 2400 HOH A O   1 
HETATM 4818 O O   . HOH D 3 .   ? 9.053   62.168 60.629 1.00 46.37 ? 2401 HOH A O   1 
HETATM 4819 O O   . HOH D 3 .   ? 7.307   52.239 56.531 1.00 26.51 ? 2402 HOH A O   1 
HETATM 4820 O O   . HOH D 3 .   ? 9.389   49.646 56.905 1.00 65.88 ? 2403 HOH A O   1 
HETATM 4821 O O   . HOH D 3 .   ? 14.298  51.054 56.150 1.00 36.09 ? 2404 HOH A O   1 
HETATM 4822 O O   . HOH D 3 .   ? 8.990   49.143 63.825 1.00 56.84 ? 2405 HOH A O   1 
HETATM 4823 O O   . HOH D 3 .   ? 3.083   53.870 63.685 1.00 24.72 ? 2406 HOH A O   1 
HETATM 4824 O O   . HOH D 3 .   ? 6.398   47.490 59.455 1.00 64.64 ? 2407 HOH A O   1 
HETATM 4825 O O   . HOH D 3 .   ? 6.597   48.177 55.891 1.00 33.31 ? 2408 HOH A O   1 
HETATM 4826 O O   . HOH D 3 .   ? 4.898   50.397 62.249 1.00 28.02 ? 2409 HOH A O   1 
HETATM 4827 O O   . HOH D 3 .   ? 2.993   41.468 61.208 1.00 61.62 ? 2410 HOH A O   1 
HETATM 4828 O O   . HOH D 3 .   ? 3.622   45.838 61.400 1.00 30.16 ? 2411 HOH A O   1 
HETATM 4829 O O   . HOH D 3 .   ? -5.561  44.735 57.538 1.00 34.18 ? 2412 HOH A O   1 
HETATM 4830 O O   . HOH D 3 .   ? 0.527   40.379 57.554 1.00 33.75 ? 2413 HOH A O   1 
HETATM 4831 O O   . HOH D 3 .   ? -4.266  39.987 62.867 1.00 40.33 ? 2414 HOH A O   1 
HETATM 4832 O O   . HOH D 3 .   ? 2.364   43.321 67.409 1.00 59.00 ? 2415 HOH A O   1 
HETATM 4833 O O   . HOH D 3 .   ? 0.116   41.545 64.511 1.00 42.81 ? 2416 HOH A O   1 
HETATM 4834 O O   . HOH D 3 .   ? -6.288  49.228 61.244 1.00 27.28 ? 2417 HOH A O   1 
HETATM 4835 O O   . HOH D 3 .   ? -10.085 39.497 62.368 1.00 52.69 ? 2418 HOH A O   1 
HETATM 4836 O O   . HOH D 3 .   ? -5.920  40.614 57.260 1.00 51.75 ? 2419 HOH A O   1 
HETATM 4837 O O   . HOH D 3 .   ? -11.464 37.553 58.910 1.00 73.41 ? 2420 HOH A O   1 
HETATM 4838 O O   . HOH D 3 .   ? -3.282  46.708 71.730 1.00 41.98 ? 2421 HOH A O   1 
HETATM 4839 O O   . HOH D 3 .   ? -5.206  42.635 70.110 1.00 44.93 ? 2422 HOH A O   1 
HETATM 4840 O O   . HOH D 3 .   ? -7.076  42.539 68.095 1.00 36.60 ? 2423 HOH A O   1 
HETATM 4841 O O   . HOH D 3 .   ? 3.790   47.456 65.555 1.00 38.50 ? 2424 HOH A O   1 
HETATM 4842 O O   . HOH D 3 .   ? 3.520   51.239 64.490 1.00 25.64 ? 2425 HOH A O   1 
HETATM 4843 O O   . HOH D 3 .   ? 4.412   49.771 66.996 1.00 33.51 ? 2426 HOH A O   1 
HETATM 4844 O O   . HOH D 3 .   ? -6.879  48.519 74.133 1.00 36.72 ? 2427 HOH A O   1 
HETATM 4845 O O   . HOH D 3 .   ? -8.266  44.483 75.215 1.00 61.59 ? 2428 HOH A O   1 
HETATM 4846 O O   . HOH D 3 .   ? -15.502 44.823 74.321 1.00 63.51 ? 2429 HOH A O   1 
HETATM 4847 O O   . HOH D 3 .   ? -11.756 47.908 76.262 1.00 54.46 ? 2430 HOH A O   1 
HETATM 4848 O O   . HOH D 3 .   ? -7.432  49.434 76.581 1.00 53.04 ? 2431 HOH A O   1 
HETATM 4849 O O   . HOH D 3 .   ? -20.132 42.316 72.942 1.00 82.53 ? 2432 HOH A O   1 
HETATM 4850 O O   . HOH D 3 .   ? -16.047 43.834 71.876 1.00 49.39 ? 2433 HOH A O   1 
HETATM 4851 O O   . HOH D 3 .   ? -21.446 46.035 67.167 1.00 55.17 ? 2434 HOH A O   1 
HETATM 4852 O O   . HOH D 3 .   ? -25.723 39.762 68.297 1.00 71.21 ? 2435 HOH A O   1 
HETATM 4853 O O   . HOH D 3 .   ? -23.816 38.602 69.766 1.00 75.31 ? 2436 HOH A O   1 
HETATM 4854 O O   . HOH D 3 .   ? -17.846 39.937 69.716 1.00 55.68 ? 2437 HOH A O   1 
HETATM 4855 O O   . HOH D 3 .   ? -12.042 39.223 65.019 1.00 65.17 ? 2438 HOH A O   1 
HETATM 4856 O O   . HOH D 3 .   ? -15.859 34.263 64.628 1.00 64.57 ? 2439 HOH A O   1 
HETATM 4857 O O   . HOH D 3 .   ? -13.640 40.707 54.832 1.00 52.14 ? 2440 HOH A O   1 
HETATM 4858 O O   . HOH D 3 .   ? -13.119 40.153 62.374 1.00 59.59 ? 2441 HOH A O   1 
HETATM 4859 O O   . HOH D 3 .   ? -14.952 38.622 58.551 1.00 52.06 ? 2442 HOH A O   1 
HETATM 4860 O O   . HOH D 3 .   ? -20.776 46.703 57.523 1.00 55.06 ? 2443 HOH A O   1 
HETATM 4861 O O   . HOH D 3 .   ? -24.739 44.429 61.018 1.00 67.84 ? 2444 HOH A O   1 
HETATM 4862 O O   . HOH D 3 .   ? -27.836 49.386 63.569 1.00 66.97 ? 2445 HOH A O   1 
HETATM 4863 O O   . HOH D 3 .   ? -23.633 51.338 60.056 1.00 59.60 ? 2446 HOH A O   1 
HETATM 4864 O O   . HOH D 3 .   ? -27.682 45.720 63.402 1.00 64.07 ? 2447 HOH A O   1 
HETATM 4865 O O   . HOH D 3 .   ? -20.153 56.756 59.612 1.00 36.59 ? 2448 HOH A O   1 
HETATM 4866 O O   . HOH D 3 .   ? -22.549 50.241 57.182 1.00 62.98 ? 2449 HOH A O   1 
HETATM 4867 O O   . HOH D 3 .   ? -24.412 55.777 59.524 1.00 72.67 ? 2450 HOH A O   1 
HETATM 4868 O O   . HOH D 3 .   ? -24.643 53.010 68.182 1.00 73.73 ? 2451 HOH A O   1 
HETATM 4869 O O   . HOH D 3 .   ? -21.469 49.161 70.156 1.00 60.78 ? 2452 HOH A O   1 
HETATM 4870 O O   . HOH D 3 .   ? -18.773 52.648 72.683 1.00 50.70 ? 2453 HOH A O   1 
HETATM 4871 O O   . HOH D 3 .   ? -22.013 58.391 62.772 1.00 68.67 ? 2454 HOH A O   1 
HETATM 4872 O O   . HOH D 3 .   ? -17.783 63.582 67.432 1.00 44.11 ? 2455 HOH A O   1 
HETATM 4873 O O   . HOH D 3 .   ? -21.842 57.886 73.189 1.00 73.43 ? 2456 HOH A O   1 
HETATM 4874 O O   . HOH D 3 .   ? -23.073 56.423 69.365 1.00 68.11 ? 2457 HOH A O   1 
HETATM 4875 O O   . HOH D 3 .   ? -15.378 56.377 72.818 1.00 36.49 ? 2458 HOH A O   1 
HETATM 4876 O O   . HOH D 3 .   ? -21.797 54.446 71.275 1.00 66.42 ? 2459 HOH A O   1 
HETATM 4877 O O   . HOH D 3 .   ? -18.055 55.499 72.998 1.00 49.40 ? 2460 HOH A O   1 
HETATM 4878 O O   . HOH D 3 .   ? -7.547  60.297 72.551 1.00 55.70 ? 2461 HOH A O   1 
HETATM 4879 O O   . HOH D 3 .   ? -16.141 58.766 73.644 1.00 43.94 ? 2462 HOH A O   1 
HETATM 4880 O O   . HOH D 3 .   ? -8.893  62.687 72.545 1.00 46.86 ? 2463 HOH A O   1 
HETATM 4881 O O   . HOH D 3 .   ? -6.829  56.695 73.854 1.00 51.42 ? 2464 HOH A O   1 
HETATM 4882 O O   . HOH D 3 .   ? -8.916  58.091 64.704 1.00 31.07 ? 2465 HOH A O   1 
HETATM 4883 O O   . HOH D 3 .   ? -2.323  57.241 66.878 1.00 37.21 ? 2466 HOH A O   1 
HETATM 4884 O O   . HOH D 3 .   ? -6.781  61.275 65.200 1.00 24.66 ? 2467 HOH A O   1 
HETATM 4885 O O   . HOH D 3 .   ? -3.865  56.959 64.004 1.00 29.57 ? 2468 HOH A O   1 
HETATM 4886 O O   . HOH D 3 .   ? -1.744  51.238 73.572 1.00 51.87 ? 2469 HOH A O   1 
HETATM 4887 O O   . HOH D 3 .   ? -0.298  45.450 74.235 1.00 79.54 ? 2470 HOH A O   1 
HETATM 4888 O O   . HOH D 3 .   ? 1.193   52.377 73.998 1.00 43.88 ? 2471 HOH A O   1 
HETATM 4889 O O   . HOH D 3 .   ? 8.746   49.726 75.071 1.00 34.66 ? 2472 HOH A O   1 
HETATM 4890 O O   . HOH D 3 .   ? 5.549   47.593 75.683 1.00 37.95 ? 2473 HOH A O   1 
HETATM 4891 O O   . HOH D 3 .   ? 5.399   53.595 80.861 1.00 44.96 ? 2474 HOH A O   1 
HETATM 4892 O O   . HOH D 3 .   ? 4.314   55.519 78.414 1.00 36.17 ? 2475 HOH A O   1 
HETATM 4893 O O   . HOH D 3 .   ? 8.709   50.481 77.926 1.00 62.53 ? 2476 HOH A O   1 
HETATM 4894 O O   . HOH D 3 .   ? 3.362   58.287 74.223 1.00 75.45 ? 2477 HOH A O   1 
HETATM 4895 O O   . HOH D 3 .   ? 1.578   56.434 73.550 1.00 64.75 ? 2478 HOH A O   1 
HETATM 4896 O O   . HOH D 3 .   ? 2.956   54.299 74.871 1.00 47.68 ? 2479 HOH A O   1 
HETATM 4897 O O   . HOH D 3 .   ? 3.618   50.380 69.738 1.00 28.64 ? 2480 HOH A O   1 
HETATM 4898 O O   . HOH D 3 .   ? 4.996   59.670 70.259 1.00 28.80 ? 2481 HOH A O   1 
HETATM 4899 O O   . HOH D 3 .   ? 3.787   56.224 70.429 1.00 36.01 ? 2482 HOH A O   1 
HETATM 4900 O O   . HOH D 3 .   ? 7.389   49.201 66.504 1.00 41.60 ? 2483 HOH A O   1 
HETATM 4901 O O   . HOH D 3 .   ? -3.658  49.906 62.192 1.00 30.56 ? 2484 HOH A O   1 
HETATM 4902 O O   . HOH D 3 .   ? -1.677  57.549 62.683 1.00 25.56 ? 2485 HOH A O   1 
HETATM 4903 O O   . HOH D 3 .   ? 1.422   43.188 54.941 1.00 28.89 ? 2486 HOH A O   1 
HETATM 4904 O O   . HOH D 3 .   ? -0.951  45.300 42.492 1.00 67.62 ? 2487 HOH A O   1 
HETATM 4905 O O   . HOH D 3 .   ? 11.167  42.329 51.918 1.00 49.52 ? 2488 HOH A O   1 
HETATM 4906 O O   . HOH D 3 .   ? 6.973   41.335 49.532 1.00 44.87 ? 2489 HOH A O   1 
HETATM 4907 O O   . HOH D 3 .   ? 7.257   46.708 53.765 1.00 29.58 ? 2490 HOH A O   1 
HETATM 4908 O O   . HOH D 3 .   ? 9.966   46.450 53.706 1.00 31.32 ? 2491 HOH A O   1 
HETATM 4909 O O   . HOH D 3 .   ? 13.143  49.592 53.906 1.00 45.79 ? 2492 HOH A O   1 
HETATM 4910 O O   . HOH D 3 .   ? 13.791  42.872 45.418 1.00 56.44 ? 2493 HOH A O   1 
HETATM 4911 O O   . HOH D 3 .   ? 9.543   40.606 45.950 1.00 76.33 ? 2494 HOH A O   1 
HETATM 4912 O O   . HOH D 3 .   ? 18.863  45.906 41.889 1.00 72.84 ? 2495 HOH A O   1 
HETATM 4913 O O   . HOH D 3 .   ? 19.617  48.364 45.133 1.00 54.43 ? 2496 HOH A O   1 
HETATM 4914 O O   . HOH D 3 .   ? 16.234  45.370 38.159 1.00 80.74 ? 2497 HOH A O   1 
HETATM 4915 O O   . HOH D 3 .   ? 10.612  44.094 43.581 1.00 67.41 ? 2498 HOH A O   1 
HETATM 4916 O O   . HOH D 3 .   ? 13.624  48.848 37.605 1.00 60.50 ? 2499 HOH A O   1 
HETATM 4917 O O   . HOH D 3 .   ? 9.894   46.795 38.827 1.00 70.29 ? 2500 HOH A O   1 
HETATM 4918 O O   . HOH D 3 .   ? 8.471   45.208 43.687 1.00 44.18 ? 2501 HOH A O   1 
HETATM 4919 O O   . HOH D 3 .   ? 4.761   46.561 40.599 1.00 39.80 ? 2502 HOH A O   1 
HETATM 4920 O O   . HOH D 3 .   ? 8.894   59.525 35.816 1.00 68.31 ? 2503 HOH A O   1 
HETATM 4921 O O   . HOH D 3 .   ? 6.570   62.579 35.242 1.00 31.59 ? 2504 HOH A O   1 
HETATM 4922 O O   . HOH D 3 .   ? 6.320   58.059 35.952 1.00 51.52 ? 2505 HOH A O   1 
HETATM 4923 O O   . HOH D 3 .   ? 9.759   56.369 36.289 1.00 33.04 ? 2506 HOH A O   1 
HETATM 4924 O O   . HOH D 3 .   ? 10.144  51.590 37.247 1.00 53.16 ? 2507 HOH A O   1 
HETATM 4925 O O   . HOH D 3 .   ? 23.835  70.198 70.111 1.00 76.25 ? 2508 HOH A O   1 
HETATM 4926 O O   . HOH D 3 .   ? 21.204  65.036 64.239 1.00 39.18 ? 2509 HOH A O   1 
HETATM 4927 O O   . HOH D 3 .   ? 25.795  69.553 68.191 1.00 71.71 ? 2510 HOH A O   1 
HETATM 4928 O O   . HOH D 3 .   ? 20.917  71.461 68.445 1.00 47.71 ? 2511 HOH A O   1 
HETATM 4929 O O   . HOH D 3 .   ? 18.962  65.354 68.666 1.00 49.55 ? 2512 HOH A O   1 
HETATM 4930 O O   . HOH D 3 .   ? 17.268  64.491 64.090 1.00 44.25 ? 2513 HOH A O   1 
HETATM 4931 O O   . HOH D 3 .   ? 11.635  67.357 67.564 1.00 24.77 ? 2514 HOH A O   1 
HETATM 4932 O O   . HOH D 3 .   ? 5.720   61.208 72.409 1.00 35.31 ? 2515 HOH A O   1 
HETATM 4933 O O   . HOH D 3 .   ? 6.134   66.642 79.357 1.00 37.52 ? 2516 HOH A O   1 
HETATM 4934 O O   . HOH D 3 .   ? 2.185   63.963 77.127 1.00 49.72 ? 2517 HOH A O   1 
HETATM 4935 O O   . HOH D 3 .   ? 4.581   57.530 76.283 1.00 45.10 ? 2518 HOH A O   1 
HETATM 4936 O O   . HOH D 3 .   ? 7.546   63.453 79.085 1.00 31.08 ? 2519 HOH A O   1 
HETATM 4937 O O   . HOH D 3 .   ? 13.370  59.155 79.138 1.00 34.33 ? 2520 HOH A O   1 
HETATM 4938 O O   . HOH D 3 .   ? 7.007   64.832 81.146 1.00 55.20 ? 2521 HOH A O   1 
HETATM 4939 O O   . HOH D 3 .   ? 12.214  67.358 83.717 1.00 38.29 ? 2522 HOH A O   1 
HETATM 4940 O O   . HOH D 3 .   ? 7.600   66.211 83.017 1.00 48.02 ? 2523 HOH A O   1 
HETATM 4941 O O   . HOH D 3 .   ? 10.215  76.396 78.389 1.00 38.61 ? 2524 HOH A O   1 
HETATM 4942 O O   . HOH D 3 .   ? 4.400   77.845 78.888 1.00 51.62 ? 2525 HOH A O   1 
HETATM 4943 O O   . HOH D 3 .   ? 3.961   75.200 82.633 1.00 62.37 ? 2526 HOH A O   1 
HETATM 4944 O O   . HOH D 3 .   ? 9.048   78.246 80.159 1.00 61.87 ? 2527 HOH A O   1 
HETATM 4945 O O   . HOH D 3 .   ? 5.347   77.618 81.587 1.00 47.58 ? 2528 HOH A O   1 
HETATM 4946 O O   . HOH D 3 .   ? 11.391  77.194 84.424 1.00 63.11 ? 2529 HOH A O   1 
HETATM 4947 O O   . HOH D 3 .   ? 14.077  75.509 79.928 1.00 63.56 ? 2530 HOH A O   1 
HETATM 4948 O O   . HOH D 3 .   ? 16.626  72.031 84.659 1.00 71.10 ? 2531 HOH A O   1 
HETATM 4949 O O   . HOH D 3 .   ? 15.036  65.015 84.363 1.00 39.99 ? 2532 HOH A O   1 
HETATM 4950 O O   . HOH D 3 .   ? 17.169  69.038 84.483 1.00 43.19 ? 2533 HOH A O   1 
HETATM 4951 O O   . HOH D 3 .   ? 23.214  51.865 81.161 1.00 55.07 ? 2534 HOH A O   1 
HETATM 4952 O O   . HOH D 3 .   ? 16.013  62.169 84.709 1.00 44.45 ? 2535 HOH A O   1 
HETATM 4953 O O   . HOH D 3 .   ? 12.238  55.965 84.582 1.00 55.24 ? 2536 HOH A O   1 
HETATM 4954 O O   . HOH D 3 .   ? 14.450  58.849 87.747 1.00 65.95 ? 2537 HOH A O   1 
HETATM 4955 O O   . HOH D 3 .   ? 10.893  58.059 86.349 1.00 64.42 ? 2538 HOH A O   1 
HETATM 4956 O O   . HOH D 3 .   ? 12.162  61.053 86.455 1.00 53.23 ? 2539 HOH A O   1 
HETATM 4957 O O   . HOH D 3 .   ? 16.693  50.020 78.131 1.00 54.62 ? 2540 HOH A O   1 
HETATM 4958 O O   . HOH D 3 .   ? 9.751   52.600 79.815 1.00 71.43 ? 2541 HOH A O   1 
HETATM 4959 O O   . HOH D 3 .   ? 8.392   44.513 77.490 1.00 70.31 ? 2542 HOH A O   1 
HETATM 4960 O O   . HOH D 3 .   ? 10.679  55.633 68.747 1.00 24.39 ? 2543 HOH A O   1 
HETATM 4961 O O   . HOH D 3 .   ? 8.458   47.276 74.281 1.00 41.37 ? 2544 HOH A O   1 
HETATM 4962 O O   . HOH D 3 .   ? 9.311   43.073 73.043 1.00 77.73 ? 2545 HOH A O   1 
HETATM 4963 O O   . HOH D 3 .   ? 11.730  48.521 62.866 1.00 75.88 ? 2546 HOH A O   1 
HETATM 4964 O O   . HOH D 3 .   ? 14.930  48.387 64.011 1.00 46.39 ? 2547 HOH A O   1 
HETATM 4965 O O   . HOH D 3 .   ? 11.000  40.210 71.483 1.00 66.64 ? 2548 HOH A O   1 
HETATM 4966 O O   . HOH D 3 .   ? 12.889  43.715 75.275 1.00 54.05 ? 2549 HOH A O   1 
HETATM 4967 O O   . HOH D 3 .   ? 11.862  46.934 73.727 1.00 48.41 ? 2550 HOH A O   1 
HETATM 4968 O O   . HOH D 3 .   ? 14.247  39.886 75.531 1.00 48.90 ? 2551 HOH A O   1 
HETATM 4969 O O   . HOH D 3 .   ? 13.018  40.516 78.178 1.00 72.24 ? 2552 HOH A O   1 
HETATM 4970 O O   . HOH D 3 .   ? 13.063  44.949 78.440 1.00 64.41 ? 2553 HOH A O   1 
HETATM 4971 O O   . HOH D 3 .   ? 17.613  45.958 78.891 1.00 58.86 ? 2554 HOH A O   1 
HETATM 4972 O O   . HOH D 3 .   ? 17.666  39.478 74.273 1.00 43.74 ? 2555 HOH A O   1 
HETATM 4973 O O   . HOH D 3 .   ? 24.995  43.910 77.405 1.00 52.32 ? 2556 HOH A O   1 
HETATM 4974 O O   . HOH D 3 .   ? 22.622  48.155 78.543 1.00 60.21 ? 2557 HOH A O   1 
HETATM 4975 O O   . HOH D 3 .   ? 24.834  48.310 76.982 1.00 45.68 ? 2558 HOH A O   1 
HETATM 4976 O O   . HOH D 3 .   ? 20.530  41.389 77.824 1.00 77.27 ? 2559 HOH A O   1 
HETATM 4977 O O   . HOH D 3 .   ? 23.956  59.290 75.957 1.00 62.74 ? 2560 HOH A O   1 
HETATM 4978 O O   . HOH D 3 .   ? 29.723  57.526 72.294 1.00 59.89 ? 2561 HOH A O   1 
HETATM 4979 O O   . HOH D 3 .   ? 30.034  62.303 74.287 1.00 62.81 ? 2562 HOH A O   1 
HETATM 4980 O O   . HOH D 3 .   ? 34.081  61.958 77.641 1.00 61.47 ? 2563 HOH A O   1 
HETATM 4981 O O   . HOH D 3 .   ? 26.446  59.466 77.086 1.00 46.29 ? 2564 HOH A O   1 
HETATM 4982 O O   . HOH D 3 .   ? 34.832  62.860 81.081 1.00 78.89 ? 2565 HOH A O   1 
HETATM 4983 O O   . HOH D 3 .   ? 36.168  59.061 82.936 1.00 50.37 ? 2566 HOH A O   1 
HETATM 4984 O O   . HOH D 3 .   ? 29.590  65.020 84.244 1.00 59.01 ? 2567 HOH A O   1 
HETATM 4985 O O   . HOH D 3 .   ? 33.613  63.600 83.454 1.00 67.13 ? 2568 HOH A O   1 
HETATM 4986 O O   . HOH D 3 .   ? 26.271  60.513 79.505 1.00 55.59 ? 2569 HOH A O   1 
HETATM 4987 O O   . HOH D 3 .   ? 29.377  60.839 84.538 1.00 46.53 ? 2570 HOH A O   1 
HETATM 4988 O O   . HOH D 3 .   ? 23.803  64.302 87.482 1.00 71.90 ? 2571 HOH A O   1 
HETATM 4989 O O   . HOH D 3 .   ? 24.192  55.156 86.513 1.00 73.19 ? 2572 HOH A O   1 
HETATM 4990 O O   . HOH D 3 .   ? 27.973  56.161 88.779 1.00 80.90 ? 2573 HOH A O   1 
HETATM 4991 O O   . HOH D 3 .   ? 29.547  59.632 87.900 1.00 65.73 ? 2574 HOH A O   1 
HETATM 4992 O O   . HOH D 3 .   ? 22.279  62.737 85.961 1.00 67.85 ? 2575 HOH A O   1 
HETATM 4993 O O   . HOH D 3 .   ? 22.554  59.369 86.381 1.00 55.32 ? 2576 HOH A O   1 
HETATM 4994 O O   . HOH D 3 .   ? 25.224  67.836 82.903 1.00 68.97 ? 2577 HOH A O   1 
HETATM 4995 O O   . HOH D 3 .   ? 28.461  68.162 78.700 1.00 55.49 ? 2578 HOH A O   1 
HETATM 4996 O O   . HOH D 3 .   ? 24.535  66.422 84.908 1.00 54.98 ? 2579 HOH A O   1 
HETATM 4997 O O   . HOH D 3 .   ? 33.204  65.671 76.655 1.00 66.22 ? 2580 HOH A O   1 
HETATM 4998 O O   . HOH D 3 .   ? 25.203  62.279 73.899 1.00 43.08 ? 2581 HOH A O   1 
HETATM 4999 O O   . HOH D 3 .   ? 22.578  72.055 76.581 1.00 49.99 ? 2582 HOH A O   1 
HETATM 5000 O O   . HOH D 3 .   ? 20.950  72.411 78.989 1.00 41.66 ? 2583 HOH A O   1 
HETATM 5001 O O   . HOH D 3 .   ? 23.546  70.330 74.157 1.00 46.50 ? 2584 HOH A O   1 
HETATM 5002 O O   . HOH D 3 .   ? 25.440  66.413 74.800 1.00 43.25 ? 2585 HOH A O   1 
HETATM 5003 O O   . HOH D 3 .   ? 18.328  67.402 73.209 1.00 36.99 ? 2586 HOH A O   1 
HETATM 5004 O O   . HOH D 3 .   ? 16.981  63.899 67.103 1.00 30.57 ? 2587 HOH A O   1 
HETATM 5005 O O   . HOH D 3 .   ? 24.331  65.001 70.372 1.00 65.20 ? 2588 HOH A O   1 
HETATM 5006 O O   . HOH D 3 .   ? 22.555  65.785 66.896 1.00 65.42 ? 2589 HOH A O   1 
HETATM 5007 O O   . HOH D 3 .   ? 25.235  60.652 68.748 1.00 68.68 ? 2590 HOH A O   1 
HETATM 5008 O O   . HOH D 3 .   ? 19.918  62.823 65.315 1.00 36.75 ? 2591 HOH A O   1 
HETATM 5009 O O   . HOH D 3 .   ? 15.565  52.975 61.892 1.00 34.18 ? 2592 HOH A O   1 
HETATM 5010 O O   . HOH D 3 .   ? 12.574  59.743 57.344 1.00 39.14 ? 2593 HOH A O   1 
HETATM 5011 O O   . HOH D 3 .   ? 21.422  52.046 53.901 1.00 45.41 ? 2594 HOH A O   1 
HETATM 5012 O O   . HOH D 3 .   ? 25.276  54.989 48.138 1.00 54.43 ? 2595 HOH A O   1 
HETATM 5013 O O   . HOH D 3 .   ? 18.024  50.575 44.991 1.00 30.09 ? 2596 HOH A O   1 
HETATM 5014 O O   . HOH D 3 .   ? 22.534  49.426 47.340 1.00 65.03 ? 2597 HOH A O   1 
HETATM 5015 O O   . HOH D 3 .   ? 20.253  46.540 51.863 1.00 63.07 ? 2598 HOH A O   1 
HETATM 5016 O O   . HOH D 3 .   ? 22.629  56.675 39.007 1.00 73.72 ? 2599 HOH A O   1 
HETATM 5017 O O   . HOH D 3 .   ? 20.846  59.479 41.064 1.00 36.12 ? 2600 HOH A O   1 
HETATM 5018 O O   . HOH D 3 .   ? 20.376  46.741 38.970 1.00 64.61 ? 2601 HOH A O   1 
HETATM 5019 O O   . HOH D 3 .   ? 20.189  55.327 37.071 1.00 51.74 ? 2602 HOH A O   1 
HETATM 5020 O O   . HOH D 3 .   ? 21.105  51.286 37.269 1.00 67.14 ? 2603 HOH A O   1 
HETATM 5021 O O   . HOH D 3 .   ? 16.643  57.440 36.193 1.00 32.27 ? 2604 HOH A O   1 
HETATM 5022 O O   . HOH D 3 .   ? 18.002  54.202 36.188 1.00 46.60 ? 2605 HOH A O   1 
HETATM 5023 O O   . HOH D 3 .   ? 20.697  58.042 37.306 1.00 54.40 ? 2606 HOH A O   1 
HETATM 5024 O O   . HOH D 3 .   ? 16.804  65.012 33.282 1.00 54.16 ? 2607 HOH A O   1 
HETATM 5025 O O   . HOH D 3 .   ? 19.258  65.715 37.096 1.00 43.79 ? 2608 HOH A O   1 
HETATM 5026 O O   . HOH D 3 .   ? 18.913  58.757 35.353 1.00 38.00 ? 2609 HOH A O   1 
HETATM 5027 O O   . HOH D 3 .   ? 18.360  60.120 41.919 1.00 30.66 ? 2610 HOH A O   1 
HETATM 5028 O O   . HOH D 3 .   ? 19.503  67.932 38.601 1.00 39.71 ? 2611 HOH A O   1 
HETATM 5029 O O   . HOH D 3 .   ? 23.772  69.933 40.124 1.00 50.77 ? 2612 HOH A O   1 
HETATM 5030 O O   . HOH D 3 .   ? 13.437  68.827 57.194 1.00 24.61 ? 2613 HOH A O   1 
HETATM 5031 O O   . HOH D 3 .   ? 24.912  70.682 63.306 1.00 41.11 ? 2614 HOH A O   1 
HETATM 5032 O O   . HOH D 3 .   ? 22.513  73.723 65.606 1.00 58.15 ? 2615 HOH A O   1 
HETATM 5033 O O   . HOH D 3 .   ? 26.535  73.292 60.030 1.00 57.66 ? 2616 HOH A O   1 
HETATM 5034 O O   . HOH D 3 .   ? 22.340  79.565 61.600 1.00 47.81 ? 2617 HOH A O   1 
HETATM 5035 O O   . HOH D 3 .   ? 15.788  80.028 69.813 1.00 39.83 ? 2618 HOH A O   1 
HETATM 5036 O O   . HOH D 3 .   ? 21.005  78.029 65.175 1.00 40.98 ? 2619 HOH A O   1 
HETATM 5037 O O   . HOH D 3 .   ? 14.286  76.408 64.056 1.00 41.10 ? 2620 HOH A O   1 
HETATM 5038 O O   . HOH D 3 .   ? 14.149  87.222 66.541 1.00 59.14 ? 2621 HOH A O   1 
HETATM 5039 O O   . HOH D 3 .   ? 16.796  84.517 70.311 1.00 69.68 ? 2622 HOH A O   1 
HETATM 5040 O O   . HOH D 3 .   ? 14.010  81.032 71.499 1.00 62.55 ? 2623 HOH A O   1 
HETATM 5041 O O   . HOH D 3 .   ? 8.399   76.699 76.449 1.00 36.39 ? 2624 HOH A O   1 
HETATM 5042 O O   . HOH D 3 .   ? 7.994   80.312 75.573 1.00 54.11 ? 2625 HOH A O   1 
HETATM 5043 O O   . HOH D 3 .   ? 7.853   78.711 68.635 1.00 52.01 ? 2626 HOH A O   1 
HETATM 5044 O O   . HOH D 3 .   ? 13.620  79.871 74.622 1.00 66.40 ? 2627 HOH A O   1 
HETATM 5045 O O   . HOH D 3 .   ? 18.902  75.112 71.129 1.00 40.33 ? 2628 HOH A O   1 
HETATM 5046 O O   . HOH D 3 .   ? 15.119  77.341 77.052 1.00 38.89 ? 2629 HOH A O   1 
HETATM 5047 O O   . HOH D 3 .   ? 16.396  74.138 77.819 1.00 32.32 ? 2630 HOH A O   1 
HETATM 5048 O O   . HOH D 3 .   ? 13.618  74.412 66.206 1.00 41.11 ? 2631 HOH A O   1 
HETATM 5049 O O   . HOH D 3 .   ? 4.484   65.819 62.427 1.00 46.20 ? 2632 HOH A O   1 
HETATM 5050 O O   . HOH D 3 .   ? 6.057   77.473 67.650 1.00 53.45 ? 2633 HOH A O   1 
HETATM 5051 O O   . HOH D 3 .   ? 12.143  77.512 62.982 1.00 42.86 ? 2634 HOH A O   1 
HETATM 5052 O O   . HOH D 3 .   ? 6.359   79.198 64.255 1.00 55.61 ? 2635 HOH A O   1 
HETATM 5053 O O   . HOH D 3 .   ? 7.695   75.685 61.035 1.00 29.76 ? 2636 HOH A O   1 
HETATM 5054 O O   . HOH D 3 .   ? 9.625   80.093 65.230 1.00 40.53 ? 2637 HOH A O   1 
HETATM 5055 O O   . HOH D 3 .   ? 6.831   83.688 65.171 1.00 64.15 ? 2638 HOH A O   1 
HETATM 5056 O O   . HOH D 3 .   ? 5.865   89.372 69.501 1.00 73.40 ? 2639 HOH A O   1 
HETATM 5057 O O   . HOH D 3 .   ? 4.754   87.742 67.643 1.00 69.22 ? 2640 HOH A O   1 
HETATM 5058 O O   . HOH D 3 .   ? 13.968  90.808 65.051 1.00 69.06 ? 2641 HOH A O   1 
HETATM 5059 O O   . HOH D 3 .   ? 19.492  84.909 62.979 1.00 39.79 ? 2642 HOH A O   1 
HETATM 5060 O O   . HOH D 3 .   ? 18.140  91.570 62.249 1.00 56.45 ? 2643 HOH A O   1 
HETATM 5061 O O   . HOH D 3 .   ? 17.335  89.889 54.800 1.00 41.81 ? 2644 HOH A O   1 
HETATM 5062 O O   . HOH D 3 .   ? 20.914  89.389 55.396 1.00 71.99 ? 2645 HOH A O   1 
HETATM 5063 O O   . HOH D 3 .   ? 20.993  84.021 56.221 1.00 45.17 ? 2646 HOH A O   1 
HETATM 5064 O O   . HOH D 3 .   ? 11.514  91.062 57.521 1.00 72.99 ? 2647 HOH A O   1 
HETATM 5065 O O   . HOH D 3 .   ? 15.247  91.161 51.324 1.00 57.52 ? 2648 HOH A O   1 
HETATM 5066 O O   . HOH D 3 .   ? 16.528  88.915 52.445 1.00 44.54 ? 2649 HOH A O   1 
HETATM 5067 O O   . HOH D 3 .   ? 18.725  85.177 50.573 1.00 36.87 ? 2650 HOH A O   1 
HETATM 5068 O O   . HOH D 3 .   ? 8.807   90.992 49.228 1.00 48.68 ? 2651 HOH A O   1 
HETATM 5069 O O   . HOH D 3 .   ? 12.917  83.545 47.644 1.00 31.45 ? 2652 HOH A O   1 
HETATM 5070 O O   . HOH D 3 .   ? 13.325  86.243 47.275 1.00 39.34 ? 2653 HOH A O   1 
HETATM 5071 O O   . HOH D 3 .   ? 21.189  84.220 51.382 1.00 62.20 ? 2654 HOH A O   1 
HETATM 5072 O O   . HOH D 3 .   ? 24.864  83.309 52.790 1.00 71.70 ? 2655 HOH A O   1 
HETATM 5073 O O   . HOH D 3 .   ? 24.858  80.462 50.246 1.00 61.37 ? 2656 HOH A O   1 
HETATM 5074 O O   . HOH D 3 .   ? 23.564  77.340 54.933 1.00 52.57 ? 2657 HOH A O   1 
HETATM 5075 O O   . HOH D 3 .   ? 17.761  84.393 48.038 1.00 43.81 ? 2658 HOH A O   1 
HETATM 5076 O O   . HOH D 3 .   ? 18.317  79.935 46.559 1.00 33.87 ? 2659 HOH A O   1 
HETATM 5077 O O   . HOH D 3 .   ? 23.317  79.012 47.148 1.00 50.08 ? 2660 HOH A O   1 
HETATM 5078 O O   . HOH D 3 .   ? 7.487   70.822 39.329 1.00 33.49 ? 2661 HOH A O   1 
HETATM 5079 O O   . HOH D 3 .   ? 14.820  78.540 34.415 1.00 76.10 ? 2662 HOH A O   1 
HETATM 5080 O O   . HOH D 3 .   ? 9.986   74.273 33.760 1.00 50.05 ? 2663 HOH A O   1 
HETATM 5081 O O   . HOH D 3 .   ? 8.040   80.520 37.247 1.00 60.67 ? 2664 HOH A O   1 
HETATM 5082 O O   . HOH D 3 .   ? 11.570  80.218 41.016 1.00 72.67 ? 2665 HOH A O   1 
HETATM 5083 O O   . HOH D 3 .   ? 10.524  81.374 36.904 1.00 59.96 ? 2666 HOH A O   1 
HETATM 5084 O O   . HOH D 3 .   ? 18.059  75.051 37.660 1.00 33.91 ? 2667 HOH A O   1 
HETATM 5085 O O   . HOH D 3 .   ? 20.535  69.742 36.099 1.00 58.70 ? 2668 HOH A O   1 
HETATM 5086 O O   . HOH D 3 .   ? 24.543  72.887 39.219 1.00 49.68 ? 2669 HOH A O   1 
HETATM 5087 O O   . HOH D 3 .   ? 18.755  78.741 43.839 1.00 43.24 ? 2670 HOH A O   1 
HETATM 5088 O O   . HOH D 3 .   ? 23.008  77.744 44.050 1.00 42.57 ? 2671 HOH A O   1 
HETATM 5089 O O   . HOH D 3 .   ? 21.193  79.027 42.718 1.00 61.34 ? 2672 HOH A O   1 
HETATM 5090 O O   . HOH D 3 .   ? 15.163  79.139 37.001 1.00 61.86 ? 2673 HOH A O   1 
HETATM 5091 O O   . HOH D 3 .   ? 30.697  81.635 46.384 1.00 71.07 ? 2674 HOH A O   1 
HETATM 5092 O O   . HOH D 3 .   ? 23.226  66.954 47.934 1.00 24.68 ? 2675 HOH A O   1 
HETATM 5093 O O   . HOH D 3 .   ? 27.690  63.528 46.059 1.00 29.92 ? 2676 HOH A O   1 
HETATM 5094 O O   . HOH D 3 .   ? 26.446  68.794 41.383 1.00 52.58 ? 2677 HOH A O   1 
HETATM 5095 O O   . HOH D 3 .   ? 28.019  65.831 43.112 1.00 37.56 ? 2678 HOH A O   1 
HETATM 5096 O O   . HOH D 3 .   ? 22.189  61.893 42.062 1.00 32.36 ? 2679 HOH A O   1 
HETATM 5097 O O   . HOH D 3 .   ? 29.959  64.305 43.957 1.00 57.18 ? 2680 HOH A O   1 
HETATM 5098 O O   . HOH D 3 .   ? 30.438  61.075 42.557 1.00 57.67 ? 2681 HOH A O   1 
HETATM 5099 O O   . HOH D 3 .   ? 24.642  54.466 41.643 1.00 57.66 ? 2682 HOH A O   1 
HETATM 5100 O O   . HOH D 3 .   ? 23.422  55.188 46.255 1.00 50.00 ? 2683 HOH A O   1 
HETATM 5101 O O   . HOH D 3 .   ? 25.022  58.365 41.443 1.00 42.50 ? 2684 HOH A O   1 
HETATM 5102 O O   . HOH D 3 .   ? 30.074  53.564 44.234 1.00 69.94 ? 2685 HOH A O   1 
HETATM 5103 O O   . HOH D 3 .   ? 34.142  60.997 41.220 1.00 77.91 ? 2686 HOH A O   1 
HETATM 5104 O O   . HOH D 3 .   ? 31.401  55.712 48.480 1.00 61.04 ? 2687 HOH A O   1 
HETATM 5105 O O   . HOH D 3 .   ? 31.484  58.607 50.143 1.00 56.61 ? 2688 HOH A O   1 
HETATM 5106 O O   . HOH D 3 .   ? 28.328  57.790 42.114 1.00 50.98 ? 2689 HOH A O   1 
HETATM 5107 O O   . HOH D 3 .   ? 34.825  65.296 45.295 1.00 67.22 ? 2690 HOH A O   1 
HETATM 5108 O O   . HOH D 3 .   ? 28.190  53.741 51.046 1.00 56.76 ? 2691 HOH A O   1 
HETATM 5109 O O   . HOH D 3 .   ? 25.215  58.900 52.589 1.00 34.96 ? 2692 HOH A O   1 
HETATM 5110 O O   . HOH D 3 .   ? 31.378  70.028 46.283 1.00 58.89 ? 2693 HOH A O   1 
HETATM 5111 O O   . HOH D 3 .   ? 27.280  75.040 58.231 1.00 59.48 ? 2694 HOH A O   1 
HETATM 5112 O O   . HOH D 3 .   ? 26.475  68.575 59.422 1.00 48.55 ? 2695 HOH A O   1 
HETATM 5113 O O   . HOH D 3 .   ? 22.000  84.256 62.918 1.00 72.31 ? 2696 HOH A O   1 
HETATM 5114 O O   . HOH D 3 .   ? 27.600  74.690 61.896 1.00 73.77 ? 2697 HOH A O   1 
HETATM 5115 O O   . HOH D 3 .   ? 25.248  75.792 63.196 1.00 64.21 ? 2698 HOH A O   1 
HETATM 5116 O O   . HOH D 3 .   ? 29.942  75.499 49.321 1.00 66.40 ? 2699 HOH A O   1 
HETATM 5117 O O   . HOH D 3 .   ? 30.010  78.893 57.014 1.00 64.40 ? 2700 HOH A O   1 
HETATM 5118 O O   . HOH D 3 .   ? 28.979  76.681 59.315 1.00 61.00 ? 2701 HOH A O   1 
HETATM 5119 O O   . HOH D 3 .   ? 32.423  67.812 56.609 1.00 66.34 ? 2702 HOH A O   1 
HETATM 5120 O O   . HOH D 3 .   ? 28.740  64.547 57.782 1.00 44.08 ? 2703 HOH A O   1 
HETATM 5121 O O   . HOH D 3 .   ? 31.948  65.467 55.524 1.00 46.94 ? 2704 HOH A O   1 
HETATM 5122 O O   . HOH D 3 .   ? 29.619  61.613 58.696 1.00 55.08 ? 2705 HOH A O   1 
HETATM 5123 O O   . HOH D 3 .   ? 25.248  61.624 52.954 1.00 27.83 ? 2706 HOH A O   1 
HETATM 5124 O O   . HOH D 3 .   ? 25.114  58.237 55.513 1.00 31.30 ? 2707 HOH A O   1 
HETATM 5125 O O   . HOH D 3 .   ? 25.493  65.167 62.510 1.00 62.10 ? 2708 HOH A O   1 
HETATM 5126 O O   . HOH D 3 .   ? 24.916  64.444 67.345 1.00 71.47 ? 2709 HOH A O   1 
HETATM 5127 O O   . HOH D 3 .   ? 23.681  65.933 64.505 1.00 65.01 ? 2710 HOH A O   1 
HETATM 5128 O O   . HOH D 3 .   ? 26.644  60.377 65.232 1.00 61.01 ? 2711 HOH A O   1 
HETATM 5129 O O   . HOH D 3 .   ? 27.068  63.665 59.556 1.00 38.24 ? 2712 HOH A O   1 
HETATM 5130 O O   . HOH D 3 .   ? 32.572  57.682 61.632 1.00 51.37 ? 2713 HOH A O   1 
HETATM 5131 O O   . HOH D 3 .   ? 30.125  52.301 65.792 1.00 39.18 ? 2714 HOH A O   1 
HETATM 5132 O O   . HOH D 3 .   ? 28.939  59.363 61.443 1.00 36.26 ? 2715 HOH A O   1 
HETATM 5133 O O   . HOH D 3 .   ? 26.663  58.990 62.968 1.00 31.02 ? 2716 HOH A O   1 
HETATM 5134 O O   . HOH D 3 .   ? 15.954  49.280 59.228 1.00 70.16 ? 2717 HOH A O   1 
HETATM 5135 O O   . HOH D 3 .   ? 16.124  50.353 62.844 1.00 40.12 ? 2718 HOH A O   1 
HETATM 5136 O O   . HOH D 3 .   ? 19.631  45.033 56.028 1.00 71.63 ? 2719 HOH A O   1 
HETATM 5137 O O   . HOH D 3 .   ? 22.760  54.378 55.307 1.00 46.43 ? 2720 HOH A O   1 
HETATM 5138 O O   . HOH D 3 .   ? 16.079  52.726 59.211 1.00 38.89 ? 2721 HOH A O   1 
HETATM 5139 O O   . HOH D 3 .   ? 26.177  51.764 53.667 1.00 75.64 ? 2722 HOH A O   1 
HETATM 5140 O O   . HOH D 3 .   ? 27.221  46.243 57.288 1.00 73.95 ? 2723 HOH A O   1 
HETATM 5141 O O   . HOH D 3 .   ? 20.996  43.738 57.888 1.00 49.36 ? 2724 HOH A O   1 
HETATM 5142 O O   . HOH D 3 .   ? 23.578  52.039 56.265 1.00 58.10 ? 2725 HOH A O   1 
HETATM 5143 O O   . HOH D 3 .   ? 28.295  48.977 55.290 1.00 67.09 ? 2726 HOH A O   1 
HETATM 5144 O O   . HOH D 3 .   ? 15.114  42.579 61.924 1.00 59.58 ? 2727 HOH A O   1 
HETATM 5145 O O   . HOH D 3 .   ? 17.130  35.482 58.581 1.00 75.48 ? 2728 HOH A O   1 
HETATM 5146 O O   . HOH D 3 .   ? 20.480  33.451 62.787 1.00 68.45 ? 2729 HOH A O   1 
HETATM 5147 O O   . HOH D 3 .   ? 21.956  59.954 38.629 1.00 57.92 ? 2730 HOH A O   1 
HETATM 5148 O O   . HOH D 3 .   ? 21.754  62.396 27.831 1.00 63.33 ? 2731 HOH A O   1 
HETATM 5149 O O   . HOH D 3 .   ? 16.452  58.904 32.219 1.00 62.62 ? 2732 HOH A O   1 
HETATM 5150 O O   . HOH D 3 .   ? 20.396  64.506 28.008 1.00 60.16 ? 2733 HOH A O   1 
HETATM 5151 O O   . HOH D 3 .   ? 23.584  59.566 33.364 1.00 59.85 ? 2734 HOH A O   1 
HETATM 5152 O O   . HOH D 3 .   ? 21.062  65.538 34.933 1.00 53.62 ? 2735 HOH A O   1 
HETATM 5153 O O   . HOH D 3 .   ? 23.030  61.087 29.603 1.00 53.97 ? 2736 HOH A O   1 
HETATM 5154 O O   . HOH D 3 .   ? 19.888  58.449 33.011 1.00 47.10 ? 2737 HOH A O   1 
HETATM 5155 O O   . HOH D 3 .   ? -18.926 82.775 44.960 1.00 57.85 ? 2738 HOH A O   1 
HETATM 5156 O O   . HOH D 3 .   ? -21.909 83.137 48.235 1.00 69.87 ? 2739 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   598  598  NAG NAG A . 
C 2 NAG 1   599  599  NAG NAG A . 
D 3 HOH 1   2001 2001 HOH HOH A . 
D 3 HOH 2   2002 2002 HOH HOH A . 
D 3 HOH 3   2003 2003 HOH HOH A . 
D 3 HOH 4   2004 2004 HOH HOH A . 
D 3 HOH 5   2005 2005 HOH HOH A . 
D 3 HOH 6   2006 2006 HOH HOH A . 
D 3 HOH 7   2007 2007 HOH HOH A . 
D 3 HOH 8   2008 2008 HOH HOH A . 
D 3 HOH 9   2009 2009 HOH HOH A . 
D 3 HOH 10  2010 2010 HOH HOH A . 
D 3 HOH 11  2011 2011 HOH HOH A . 
D 3 HOH 12  2012 2012 HOH HOH A . 
D 3 HOH 13  2013 2013 HOH HOH A . 
D 3 HOH 14  2014 2014 HOH HOH A . 
D 3 HOH 15  2015 2015 HOH HOH A . 
D 3 HOH 16  2016 2016 HOH HOH A . 
D 3 HOH 17  2017 2017 HOH HOH A . 
D 3 HOH 18  2018 2018 HOH HOH A . 
D 3 HOH 19  2019 2019 HOH HOH A . 
D 3 HOH 20  2020 2020 HOH HOH A . 
D 3 HOH 21  2021 2021 HOH HOH A . 
D 3 HOH 22  2022 2022 HOH HOH A . 
D 3 HOH 23  2023 2023 HOH HOH A . 
D 3 HOH 24  2024 2024 HOH HOH A . 
D 3 HOH 25  2025 2025 HOH HOH A . 
D 3 HOH 26  2026 2026 HOH HOH A . 
D 3 HOH 27  2027 2027 HOH HOH A . 
D 3 HOH 28  2028 2028 HOH HOH A . 
D 3 HOH 29  2029 2029 HOH HOH A . 
D 3 HOH 30  2030 2030 HOH HOH A . 
D 3 HOH 31  2031 2031 HOH HOH A . 
D 3 HOH 32  2032 2032 HOH HOH A . 
D 3 HOH 33  2033 2033 HOH HOH A . 
D 3 HOH 34  2034 2034 HOH HOH A . 
D 3 HOH 35  2035 2035 HOH HOH A . 
D 3 HOH 36  2036 2036 HOH HOH A . 
D 3 HOH 37  2037 2037 HOH HOH A . 
D 3 HOH 38  2038 2038 HOH HOH A . 
D 3 HOH 39  2039 2039 HOH HOH A . 
D 3 HOH 40  2040 2040 HOH HOH A . 
D 3 HOH 41  2041 2041 HOH HOH A . 
D 3 HOH 42  2042 2042 HOH HOH A . 
D 3 HOH 43  2043 2043 HOH HOH A . 
D 3 HOH 44  2044 2044 HOH HOH A . 
D 3 HOH 45  2045 2045 HOH HOH A . 
D 3 HOH 46  2046 2046 HOH HOH A . 
D 3 HOH 47  2047 2047 HOH HOH A . 
D 3 HOH 48  2048 2048 HOH HOH A . 
D 3 HOH 49  2049 2049 HOH HOH A . 
D 3 HOH 50  2050 2050 HOH HOH A . 
D 3 HOH 51  2051 2051 HOH HOH A . 
D 3 HOH 52  2052 2052 HOH HOH A . 
D 3 HOH 53  2053 2053 HOH HOH A . 
D 3 HOH 54  2054 2054 HOH HOH A . 
D 3 HOH 55  2055 2055 HOH HOH A . 
D 3 HOH 56  2056 2056 HOH HOH A . 
D 3 HOH 57  2057 2057 HOH HOH A . 
D 3 HOH 58  2058 2058 HOH HOH A . 
D 3 HOH 59  2059 2059 HOH HOH A . 
D 3 HOH 60  2060 2060 HOH HOH A . 
D 3 HOH 61  2061 2061 HOH HOH A . 
D 3 HOH 62  2062 2062 HOH HOH A . 
D 3 HOH 63  2063 2063 HOH HOH A . 
D 3 HOH 64  2064 2064 HOH HOH A . 
D 3 HOH 65  2065 2065 HOH HOH A . 
D 3 HOH 66  2066 2066 HOH HOH A . 
D 3 HOH 67  2067 2067 HOH HOH A . 
D 3 HOH 68  2068 2068 HOH HOH A . 
D 3 HOH 69  2069 2069 HOH HOH A . 
D 3 HOH 70  2070 2070 HOH HOH A . 
D 3 HOH 71  2071 2071 HOH HOH A . 
D 3 HOH 72  2072 2072 HOH HOH A . 
D 3 HOH 73  2073 2073 HOH HOH A . 
D 3 HOH 74  2074 2074 HOH HOH A . 
D 3 HOH 75  2075 2075 HOH HOH A . 
D 3 HOH 76  2076 2076 HOH HOH A . 
D 3 HOH 77  2077 2077 HOH HOH A . 
D 3 HOH 78  2078 2078 HOH HOH A . 
D 3 HOH 79  2079 2079 HOH HOH A . 
D 3 HOH 80  2080 2080 HOH HOH A . 
D 3 HOH 81  2081 2081 HOH HOH A . 
D 3 HOH 82  2082 2082 HOH HOH A . 
D 3 HOH 83  2083 2083 HOH HOH A . 
D 3 HOH 84  2084 2084 HOH HOH A . 
D 3 HOH 85  2085 2085 HOH HOH A . 
D 3 HOH 86  2086 2086 HOH HOH A . 
D 3 HOH 87  2087 2087 HOH HOH A . 
D 3 HOH 88  2088 2088 HOH HOH A . 
D 3 HOH 89  2089 2089 HOH HOH A . 
D 3 HOH 90  2090 2090 HOH HOH A . 
D 3 HOH 91  2091 2091 HOH HOH A . 
D 3 HOH 92  2092 2092 HOH HOH A . 
D 3 HOH 93  2093 2093 HOH HOH A . 
D 3 HOH 94  2094 2094 HOH HOH A . 
D 3 HOH 95  2095 2095 HOH HOH A . 
D 3 HOH 96  2096 2096 HOH HOH A . 
D 3 HOH 97  2097 2097 HOH HOH A . 
D 3 HOH 98  2098 2098 HOH HOH A . 
D 3 HOH 99  2099 2099 HOH HOH A . 
D 3 HOH 100 2100 2100 HOH HOH A . 
D 3 HOH 101 2101 2101 HOH HOH A . 
D 3 HOH 102 2102 2102 HOH HOH A . 
D 3 HOH 103 2103 2103 HOH HOH A . 
D 3 HOH 104 2104 2104 HOH HOH A . 
D 3 HOH 105 2105 2105 HOH HOH A . 
D 3 HOH 106 2106 2106 HOH HOH A . 
D 3 HOH 107 2107 2107 HOH HOH A . 
D 3 HOH 108 2108 2108 HOH HOH A . 
D 3 HOH 109 2109 2109 HOH HOH A . 
D 3 HOH 110 2110 2110 HOH HOH A . 
D 3 HOH 111 2111 2111 HOH HOH A . 
D 3 HOH 112 2112 2112 HOH HOH A . 
D 3 HOH 113 2113 2113 HOH HOH A . 
D 3 HOH 114 2114 2114 HOH HOH A . 
D 3 HOH 115 2115 2115 HOH HOH A . 
D 3 HOH 116 2116 2116 HOH HOH A . 
D 3 HOH 117 2117 2117 HOH HOH A . 
D 3 HOH 118 2118 2118 HOH HOH A . 
D 3 HOH 119 2119 2119 HOH HOH A . 
D 3 HOH 120 2120 2120 HOH HOH A . 
D 3 HOH 121 2121 2121 HOH HOH A . 
D 3 HOH 122 2122 2122 HOH HOH A . 
D 3 HOH 123 2123 2123 HOH HOH A . 
D 3 HOH 124 2124 2124 HOH HOH A . 
D 3 HOH 125 2125 2125 HOH HOH A . 
D 3 HOH 126 2126 2126 HOH HOH A . 
D 3 HOH 127 2127 2127 HOH HOH A . 
D 3 HOH 128 2128 2128 HOH HOH A . 
D 3 HOH 129 2129 2129 HOH HOH A . 
D 3 HOH 130 2130 2130 HOH HOH A . 
D 3 HOH 131 2131 2131 HOH HOH A . 
D 3 HOH 132 2132 2132 HOH HOH A . 
D 3 HOH 133 2133 2133 HOH HOH A . 
D 3 HOH 134 2134 2134 HOH HOH A . 
D 3 HOH 135 2135 2135 HOH HOH A . 
D 3 HOH 136 2136 2136 HOH HOH A . 
D 3 HOH 137 2137 2137 HOH HOH A . 
D 3 HOH 138 2138 2138 HOH HOH A . 
D 3 HOH 139 2139 2139 HOH HOH A . 
D 3 HOH 140 2140 2140 HOH HOH A . 
D 3 HOH 141 2141 2141 HOH HOH A . 
D 3 HOH 142 2142 2142 HOH HOH A . 
D 3 HOH 143 2143 2143 HOH HOH A . 
D 3 HOH 144 2144 2144 HOH HOH A . 
D 3 HOH 145 2145 2145 HOH HOH A . 
D 3 HOH 146 2146 2146 HOH HOH A . 
D 3 HOH 147 2147 2147 HOH HOH A . 
D 3 HOH 148 2148 2148 HOH HOH A . 
D 3 HOH 149 2149 2149 HOH HOH A . 
D 3 HOH 150 2150 2150 HOH HOH A . 
D 3 HOH 151 2151 2151 HOH HOH A . 
D 3 HOH 152 2152 2152 HOH HOH A . 
D 3 HOH 153 2153 2153 HOH HOH A . 
D 3 HOH 154 2154 2154 HOH HOH A . 
D 3 HOH 155 2155 2155 HOH HOH A . 
D 3 HOH 156 2156 2156 HOH HOH A . 
D 3 HOH 157 2157 2157 HOH HOH A . 
D 3 HOH 158 2158 2158 HOH HOH A . 
D 3 HOH 159 2159 2159 HOH HOH A . 
D 3 HOH 160 2160 2160 HOH HOH A . 
D 3 HOH 161 2161 2161 HOH HOH A . 
D 3 HOH 162 2162 2162 HOH HOH A . 
D 3 HOH 163 2163 2163 HOH HOH A . 
D 3 HOH 164 2164 2164 HOH HOH A . 
D 3 HOH 165 2165 2165 HOH HOH A . 
D 3 HOH 166 2166 2166 HOH HOH A . 
D 3 HOH 167 2167 2167 HOH HOH A . 
D 3 HOH 168 2168 2168 HOH HOH A . 
D 3 HOH 169 2169 2169 HOH HOH A . 
D 3 HOH 170 2170 2170 HOH HOH A . 
D 3 HOH 171 2171 2171 HOH HOH A . 
D 3 HOH 172 2172 2172 HOH HOH A . 
D 3 HOH 173 2173 2173 HOH HOH A . 
D 3 HOH 174 2174 2174 HOH HOH A . 
D 3 HOH 175 2175 2175 HOH HOH A . 
D 3 HOH 176 2176 2176 HOH HOH A . 
D 3 HOH 177 2177 2177 HOH HOH A . 
D 3 HOH 178 2178 2178 HOH HOH A . 
D 3 HOH 179 2179 2179 HOH HOH A . 
D 3 HOH 180 2180 2180 HOH HOH A . 
D 3 HOH 181 2181 2181 HOH HOH A . 
D 3 HOH 182 2182 2182 HOH HOH A . 
D 3 HOH 183 2183 2183 HOH HOH A . 
D 3 HOH 184 2184 2184 HOH HOH A . 
D 3 HOH 185 2185 2185 HOH HOH A . 
D 3 HOH 186 2186 2186 HOH HOH A . 
D 3 HOH 187 2187 2187 HOH HOH A . 
D 3 HOH 188 2188 2188 HOH HOH A . 
D 3 HOH 189 2189 2189 HOH HOH A . 
D 3 HOH 190 2190 2190 HOH HOH A . 
D 3 HOH 191 2191 2191 HOH HOH A . 
D 3 HOH 192 2192 2192 HOH HOH A . 
D 3 HOH 193 2193 2193 HOH HOH A . 
D 3 HOH 194 2194 2194 HOH HOH A . 
D 3 HOH 195 2195 2195 HOH HOH A . 
D 3 HOH 196 2196 2196 HOH HOH A . 
D 3 HOH 197 2197 2197 HOH HOH A . 
D 3 HOH 198 2198 2198 HOH HOH A . 
D 3 HOH 199 2199 2199 HOH HOH A . 
D 3 HOH 200 2200 2200 HOH HOH A . 
D 3 HOH 201 2201 2201 HOH HOH A . 
D 3 HOH 202 2202 2202 HOH HOH A . 
D 3 HOH 203 2203 2203 HOH HOH A . 
D 3 HOH 204 2204 2204 HOH HOH A . 
D 3 HOH 205 2205 2205 HOH HOH A . 
D 3 HOH 206 2206 2206 HOH HOH A . 
D 3 HOH 207 2207 2207 HOH HOH A . 
D 3 HOH 208 2208 2208 HOH HOH A . 
D 3 HOH 209 2209 2209 HOH HOH A . 
D 3 HOH 210 2210 2210 HOH HOH A . 
D 3 HOH 211 2211 2211 HOH HOH A . 
D 3 HOH 212 2212 2212 HOH HOH A . 
D 3 HOH 213 2213 2213 HOH HOH A . 
D 3 HOH 214 2214 2214 HOH HOH A . 
D 3 HOH 215 2215 2215 HOH HOH A . 
D 3 HOH 216 2216 2216 HOH HOH A . 
D 3 HOH 217 2217 2217 HOH HOH A . 
D 3 HOH 218 2218 2218 HOH HOH A . 
D 3 HOH 219 2219 2219 HOH HOH A . 
D 3 HOH 220 2220 2220 HOH HOH A . 
D 3 HOH 221 2221 2221 HOH HOH A . 
D 3 HOH 222 2222 2222 HOH HOH A . 
D 3 HOH 223 2223 2223 HOH HOH A . 
D 3 HOH 224 2224 2224 HOH HOH A . 
D 3 HOH 225 2225 2225 HOH HOH A . 
D 3 HOH 226 2226 2226 HOH HOH A . 
D 3 HOH 227 2227 2227 HOH HOH A . 
D 3 HOH 228 2228 2228 HOH HOH A . 
D 3 HOH 229 2229 2229 HOH HOH A . 
D 3 HOH 230 2230 2230 HOH HOH A . 
D 3 HOH 231 2231 2231 HOH HOH A . 
D 3 HOH 232 2232 2232 HOH HOH A . 
D 3 HOH 233 2233 2233 HOH HOH A . 
D 3 HOH 234 2234 2234 HOH HOH A . 
D 3 HOH 235 2235 2235 HOH HOH A . 
D 3 HOH 236 2236 2236 HOH HOH A . 
D 3 HOH 237 2237 2237 HOH HOH A . 
D 3 HOH 238 2238 2238 HOH HOH A . 
D 3 HOH 239 2239 2239 HOH HOH A . 
D 3 HOH 240 2240 2240 HOH HOH A . 
D 3 HOH 241 2241 2241 HOH HOH A . 
D 3 HOH 242 2242 2242 HOH HOH A . 
D 3 HOH 243 2243 2243 HOH HOH A . 
D 3 HOH 244 2244 2244 HOH HOH A . 
D 3 HOH 245 2245 2245 HOH HOH A . 
D 3 HOH 246 2246 2246 HOH HOH A . 
D 3 HOH 247 2247 2247 HOH HOH A . 
D 3 HOH 248 2248 2248 HOH HOH A . 
D 3 HOH 249 2249 2249 HOH HOH A . 
D 3 HOH 250 2250 2250 HOH HOH A . 
D 3 HOH 251 2251 2251 HOH HOH A . 
D 3 HOH 252 2252 2252 HOH HOH A . 
D 3 HOH 253 2253 2253 HOH HOH A . 
D 3 HOH 254 2254 2254 HOH HOH A . 
D 3 HOH 255 2255 2255 HOH HOH A . 
D 3 HOH 256 2256 2256 HOH HOH A . 
D 3 HOH 257 2257 2257 HOH HOH A . 
D 3 HOH 258 2258 2258 HOH HOH A . 
D 3 HOH 259 2259 2259 HOH HOH A . 
D 3 HOH 260 2260 2260 HOH HOH A . 
D 3 HOH 261 2261 2261 HOH HOH A . 
D 3 HOH 262 2262 2262 HOH HOH A . 
D 3 HOH 263 2263 2263 HOH HOH A . 
D 3 HOH 264 2264 2264 HOH HOH A . 
D 3 HOH 265 2265 2265 HOH HOH A . 
D 3 HOH 266 2266 2266 HOH HOH A . 
D 3 HOH 267 2267 2267 HOH HOH A . 
D 3 HOH 268 2268 2268 HOH HOH A . 
D 3 HOH 269 2269 2269 HOH HOH A . 
D 3 HOH 270 2270 2270 HOH HOH A . 
D 3 HOH 271 2271 2271 HOH HOH A . 
D 3 HOH 272 2272 2272 HOH HOH A . 
D 3 HOH 273 2273 2273 HOH HOH A . 
D 3 HOH 274 2274 2274 HOH HOH A . 
D 3 HOH 275 2275 2275 HOH HOH A . 
D 3 HOH 276 2276 2276 HOH HOH A . 
D 3 HOH 277 2277 2277 HOH HOH A . 
D 3 HOH 278 2278 2278 HOH HOH A . 
D 3 HOH 279 2279 2279 HOH HOH A . 
D 3 HOH 280 2280 2280 HOH HOH A . 
D 3 HOH 281 2281 2281 HOH HOH A . 
D 3 HOH 282 2282 2282 HOH HOH A . 
D 3 HOH 283 2283 2283 HOH HOH A . 
D 3 HOH 284 2284 2284 HOH HOH A . 
D 3 HOH 285 2285 2285 HOH HOH A . 
D 3 HOH 286 2286 2286 HOH HOH A . 
D 3 HOH 287 2287 2287 HOH HOH A . 
D 3 HOH 288 2288 2288 HOH HOH A . 
D 3 HOH 289 2289 2289 HOH HOH A . 
D 3 HOH 290 2290 2290 HOH HOH A . 
D 3 HOH 291 2291 2291 HOH HOH A . 
D 3 HOH 292 2292 2292 HOH HOH A . 
D 3 HOH 293 2293 2293 HOH HOH A . 
D 3 HOH 294 2294 2294 HOH HOH A . 
D 3 HOH 295 2295 2295 HOH HOH A . 
D 3 HOH 296 2296 2296 HOH HOH A . 
D 3 HOH 297 2297 2297 HOH HOH A . 
D 3 HOH 298 2298 2298 HOH HOH A . 
D 3 HOH 299 2299 2299 HOH HOH A . 
D 3 HOH 300 2300 2300 HOH HOH A . 
D 3 HOH 301 2301 2301 HOH HOH A . 
D 3 HOH 302 2302 2302 HOH HOH A . 
D 3 HOH 303 2303 2303 HOH HOH A . 
D 3 HOH 304 2304 2304 HOH HOH A . 
D 3 HOH 305 2305 2305 HOH HOH A . 
D 3 HOH 306 2306 2306 HOH HOH A . 
D 3 HOH 307 2307 2307 HOH HOH A . 
D 3 HOH 308 2308 2308 HOH HOH A . 
D 3 HOH 309 2309 2309 HOH HOH A . 
D 3 HOH 310 2310 2310 HOH HOH A . 
D 3 HOH 311 2311 2311 HOH HOH A . 
D 3 HOH 312 2312 2312 HOH HOH A . 
D 3 HOH 313 2313 2313 HOH HOH A . 
D 3 HOH 314 2314 2314 HOH HOH A . 
D 3 HOH 315 2315 2315 HOH HOH A . 
D 3 HOH 316 2316 2316 HOH HOH A . 
D 3 HOH 317 2317 2317 HOH HOH A . 
D 3 HOH 318 2318 2318 HOH HOH A . 
D 3 HOH 319 2319 2319 HOH HOH A . 
D 3 HOH 320 2320 2320 HOH HOH A . 
D 3 HOH 321 2321 2321 HOH HOH A . 
D 3 HOH 322 2322 2322 HOH HOH A . 
D 3 HOH 323 2323 2323 HOH HOH A . 
D 3 HOH 324 2324 2324 HOH HOH A . 
D 3 HOH 325 2325 2325 HOH HOH A . 
D 3 HOH 326 2326 2326 HOH HOH A . 
D 3 HOH 327 2327 2327 HOH HOH A . 
D 3 HOH 328 2328 2328 HOH HOH A . 
D 3 HOH 329 2329 2329 HOH HOH A . 
D 3 HOH 330 2330 2330 HOH HOH A . 
D 3 HOH 331 2331 2331 HOH HOH A . 
D 3 HOH 332 2332 2332 HOH HOH A . 
D 3 HOH 333 2333 2333 HOH HOH A . 
D 3 HOH 334 2334 2334 HOH HOH A . 
D 3 HOH 335 2335 2335 HOH HOH A . 
D 3 HOH 336 2336 2336 HOH HOH A . 
D 3 HOH 337 2337 2337 HOH HOH A . 
D 3 HOH 338 2338 2338 HOH HOH A . 
D 3 HOH 339 2339 2339 HOH HOH A . 
D 3 HOH 340 2340 2340 HOH HOH A . 
D 3 HOH 341 2341 2341 HOH HOH A . 
D 3 HOH 342 2342 2342 HOH HOH A . 
D 3 HOH 343 2343 2343 HOH HOH A . 
D 3 HOH 344 2344 2344 HOH HOH A . 
D 3 HOH 345 2345 2345 HOH HOH A . 
D 3 HOH 346 2346 2346 HOH HOH A . 
D 3 HOH 347 2347 2347 HOH HOH A . 
D 3 HOH 348 2348 2348 HOH HOH A . 
D 3 HOH 349 2349 2349 HOH HOH A . 
D 3 HOH 350 2350 2350 HOH HOH A . 
D 3 HOH 351 2351 2351 HOH HOH A . 
D 3 HOH 352 2352 2352 HOH HOH A . 
D 3 HOH 353 2353 2353 HOH HOH A . 
D 3 HOH 354 2354 2354 HOH HOH A . 
D 3 HOH 355 2355 2355 HOH HOH A . 
D 3 HOH 356 2356 2356 HOH HOH A . 
D 3 HOH 357 2357 2357 HOH HOH A . 
D 3 HOH 358 2358 2358 HOH HOH A . 
D 3 HOH 359 2359 2359 HOH HOH A . 
D 3 HOH 360 2360 2360 HOH HOH A . 
D 3 HOH 361 2361 2361 HOH HOH A . 
D 3 HOH 362 2362 2362 HOH HOH A . 
D 3 HOH 363 2363 2363 HOH HOH A . 
D 3 HOH 364 2364 2364 HOH HOH A . 
D 3 HOH 365 2365 2365 HOH HOH A . 
D 3 HOH 366 2366 2366 HOH HOH A . 
D 3 HOH 367 2367 2367 HOH HOH A . 
D 3 HOH 368 2368 2368 HOH HOH A . 
D 3 HOH 369 2369 2369 HOH HOH A . 
D 3 HOH 370 2370 2370 HOH HOH A . 
D 3 HOH 371 2371 2371 HOH HOH A . 
D 3 HOH 372 2372 2372 HOH HOH A . 
D 3 HOH 373 2373 2373 HOH HOH A . 
D 3 HOH 374 2374 2374 HOH HOH A . 
D 3 HOH 375 2375 2375 HOH HOH A . 
D 3 HOH 376 2376 2376 HOH HOH A . 
D 3 HOH 377 2377 2377 HOH HOH A . 
D 3 HOH 378 2378 2378 HOH HOH A . 
D 3 HOH 379 2379 2379 HOH HOH A . 
D 3 HOH 380 2380 2380 HOH HOH A . 
D 3 HOH 381 2381 2381 HOH HOH A . 
D 3 HOH 382 2382 2382 HOH HOH A . 
D 3 HOH 383 2383 2383 HOH HOH A . 
D 3 HOH 384 2384 2384 HOH HOH A . 
D 3 HOH 385 2385 2385 HOH HOH A . 
D 3 HOH 386 2386 2386 HOH HOH A . 
D 3 HOH 387 2387 2387 HOH HOH A . 
D 3 HOH 388 2388 2388 HOH HOH A . 
D 3 HOH 389 2389 2389 HOH HOH A . 
D 3 HOH 390 2390 2390 HOH HOH A . 
D 3 HOH 391 2391 2391 HOH HOH A . 
D 3 HOH 392 2392 2392 HOH HOH A . 
D 3 HOH 393 2393 2393 HOH HOH A . 
D 3 HOH 394 2394 2394 HOH HOH A . 
D 3 HOH 395 2395 2395 HOH HOH A . 
D 3 HOH 396 2396 2396 HOH HOH A . 
D 3 HOH 397 2397 2397 HOH HOH A . 
D 3 HOH 398 2398 2398 HOH HOH A . 
D 3 HOH 399 2399 2399 HOH HOH A . 
D 3 HOH 400 2400 2400 HOH HOH A . 
D 3 HOH 401 2401 2401 HOH HOH A . 
D 3 HOH 402 2402 2402 HOH HOH A . 
D 3 HOH 403 2403 2403 HOH HOH A . 
D 3 HOH 404 2404 2404 HOH HOH A . 
D 3 HOH 405 2405 2405 HOH HOH A . 
D 3 HOH 406 2406 2406 HOH HOH A . 
D 3 HOH 407 2407 2407 HOH HOH A . 
D 3 HOH 408 2408 2408 HOH HOH A . 
D 3 HOH 409 2409 2409 HOH HOH A . 
D 3 HOH 410 2410 2410 HOH HOH A . 
D 3 HOH 411 2411 2411 HOH HOH A . 
D 3 HOH 412 2412 2412 HOH HOH A . 
D 3 HOH 413 2413 2413 HOH HOH A . 
D 3 HOH 414 2414 2414 HOH HOH A . 
D 3 HOH 415 2415 2415 HOH HOH A . 
D 3 HOH 416 2416 2416 HOH HOH A . 
D 3 HOH 417 2417 2417 HOH HOH A . 
D 3 HOH 418 2418 2418 HOH HOH A . 
D 3 HOH 419 2419 2419 HOH HOH A . 
D 3 HOH 420 2420 2420 HOH HOH A . 
D 3 HOH 421 2421 2421 HOH HOH A . 
D 3 HOH 422 2422 2422 HOH HOH A . 
D 3 HOH 423 2423 2423 HOH HOH A . 
D 3 HOH 424 2424 2424 HOH HOH A . 
D 3 HOH 425 2425 2425 HOH HOH A . 
D 3 HOH 426 2426 2426 HOH HOH A . 
D 3 HOH 427 2427 2427 HOH HOH A . 
D 3 HOH 428 2428 2428 HOH HOH A . 
D 3 HOH 429 2429 2429 HOH HOH A . 
D 3 HOH 430 2430 2430 HOH HOH A . 
D 3 HOH 431 2431 2431 HOH HOH A . 
D 3 HOH 432 2432 2432 HOH HOH A . 
D 3 HOH 433 2433 2433 HOH HOH A . 
D 3 HOH 434 2434 2434 HOH HOH A . 
D 3 HOH 435 2435 2435 HOH HOH A . 
D 3 HOH 436 2436 2436 HOH HOH A . 
D 3 HOH 437 2437 2437 HOH HOH A . 
D 3 HOH 438 2438 2438 HOH HOH A . 
D 3 HOH 439 2439 2439 HOH HOH A . 
D 3 HOH 440 2440 2440 HOH HOH A . 
D 3 HOH 441 2441 2441 HOH HOH A . 
D 3 HOH 442 2442 2442 HOH HOH A . 
D 3 HOH 443 2443 2443 HOH HOH A . 
D 3 HOH 444 2444 2444 HOH HOH A . 
D 3 HOH 445 2445 2445 HOH HOH A . 
D 3 HOH 446 2446 2446 HOH HOH A . 
D 3 HOH 447 2447 2447 HOH HOH A . 
D 3 HOH 448 2448 2448 HOH HOH A . 
D 3 HOH 449 2449 2449 HOH HOH A . 
D 3 HOH 450 2450 2450 HOH HOH A . 
D 3 HOH 451 2451 2451 HOH HOH A . 
D 3 HOH 452 2452 2452 HOH HOH A . 
D 3 HOH 453 2453 2453 HOH HOH A . 
D 3 HOH 454 2454 2454 HOH HOH A . 
D 3 HOH 455 2455 2455 HOH HOH A . 
D 3 HOH 456 2456 2456 HOH HOH A . 
D 3 HOH 457 2457 2457 HOH HOH A . 
D 3 HOH 458 2458 2458 HOH HOH A . 
D 3 HOH 459 2459 2459 HOH HOH A . 
D 3 HOH 460 2460 2460 HOH HOH A . 
D 3 HOH 461 2461 2461 HOH HOH A . 
D 3 HOH 462 2462 2462 HOH HOH A . 
D 3 HOH 463 2463 2463 HOH HOH A . 
D 3 HOH 464 2464 2464 HOH HOH A . 
D 3 HOH 465 2465 2465 HOH HOH A . 
D 3 HOH 466 2466 2466 HOH HOH A . 
D 3 HOH 467 2467 2467 HOH HOH A . 
D 3 HOH 468 2468 2468 HOH HOH A . 
D 3 HOH 469 2469 2469 HOH HOH A . 
D 3 HOH 470 2470 2470 HOH HOH A . 
D 3 HOH 471 2471 2471 HOH HOH A . 
D 3 HOH 472 2472 2472 HOH HOH A . 
D 3 HOH 473 2473 2473 HOH HOH A . 
D 3 HOH 474 2474 2474 HOH HOH A . 
D 3 HOH 475 2475 2475 HOH HOH A . 
D 3 HOH 476 2476 2476 HOH HOH A . 
D 3 HOH 477 2477 2477 HOH HOH A . 
D 3 HOH 478 2478 2478 HOH HOH A . 
D 3 HOH 479 2479 2479 HOH HOH A . 
D 3 HOH 480 2480 2480 HOH HOH A . 
D 3 HOH 481 2481 2481 HOH HOH A . 
D 3 HOH 482 2482 2482 HOH HOH A . 
D 3 HOH 483 2483 2483 HOH HOH A . 
D 3 HOH 484 2484 2484 HOH HOH A . 
D 3 HOH 485 2485 2485 HOH HOH A . 
D 3 HOH 486 2486 2486 HOH HOH A . 
D 3 HOH 487 2487 2487 HOH HOH A . 
D 3 HOH 488 2488 2488 HOH HOH A . 
D 3 HOH 489 2489 2489 HOH HOH A . 
D 3 HOH 490 2490 2490 HOH HOH A . 
D 3 HOH 491 2491 2491 HOH HOH A . 
D 3 HOH 492 2492 2492 HOH HOH A . 
D 3 HOH 493 2493 2493 HOH HOH A . 
D 3 HOH 494 2494 2494 HOH HOH A . 
D 3 HOH 495 2495 2495 HOH HOH A . 
D 3 HOH 496 2496 2496 HOH HOH A . 
D 3 HOH 497 2497 2497 HOH HOH A . 
D 3 HOH 498 2498 2498 HOH HOH A . 
D 3 HOH 499 2499 2499 HOH HOH A . 
D 3 HOH 500 2500 2500 HOH HOH A . 
D 3 HOH 501 2501 2501 HOH HOH A . 
D 3 HOH 502 2502 2502 HOH HOH A . 
D 3 HOH 503 2503 2503 HOH HOH A . 
D 3 HOH 504 2504 2504 HOH HOH A . 
D 3 HOH 505 2505 2505 HOH HOH A . 
D 3 HOH 506 2506 2506 HOH HOH A . 
D 3 HOH 507 2507 2507 HOH HOH A . 
D 3 HOH 508 2508 2508 HOH HOH A . 
D 3 HOH 509 2509 2509 HOH HOH A . 
D 3 HOH 510 2510 2510 HOH HOH A . 
D 3 HOH 511 2511 2511 HOH HOH A . 
D 3 HOH 512 2512 2512 HOH HOH A . 
D 3 HOH 513 2513 2513 HOH HOH A . 
D 3 HOH 514 2514 2514 HOH HOH A . 
D 3 HOH 515 2515 2515 HOH HOH A . 
D 3 HOH 516 2516 2516 HOH HOH A . 
D 3 HOH 517 2517 2517 HOH HOH A . 
D 3 HOH 518 2518 2518 HOH HOH A . 
D 3 HOH 519 2519 2519 HOH HOH A . 
D 3 HOH 520 2520 2520 HOH HOH A . 
D 3 HOH 521 2521 2521 HOH HOH A . 
D 3 HOH 522 2522 2522 HOH HOH A . 
D 3 HOH 523 2523 2523 HOH HOH A . 
D 3 HOH 524 2524 2524 HOH HOH A . 
D 3 HOH 525 2525 2525 HOH HOH A . 
D 3 HOH 526 2526 2526 HOH HOH A . 
D 3 HOH 527 2527 2527 HOH HOH A . 
D 3 HOH 528 2528 2528 HOH HOH A . 
D 3 HOH 529 2529 2529 HOH HOH A . 
D 3 HOH 530 2530 2530 HOH HOH A . 
D 3 HOH 531 2531 2531 HOH HOH A . 
D 3 HOH 532 2532 2532 HOH HOH A . 
D 3 HOH 533 2533 2533 HOH HOH A . 
D 3 HOH 534 2534 2534 HOH HOH A . 
D 3 HOH 535 2535 2535 HOH HOH A . 
D 3 HOH 536 2536 2536 HOH HOH A . 
D 3 HOH 537 2537 2537 HOH HOH A . 
D 3 HOH 538 2538 2538 HOH HOH A . 
D 3 HOH 539 2539 2539 HOH HOH A . 
D 3 HOH 540 2540 2540 HOH HOH A . 
D 3 HOH 541 2541 2541 HOH HOH A . 
D 3 HOH 542 2542 2542 HOH HOH A . 
D 3 HOH 543 2543 2543 HOH HOH A . 
D 3 HOH 544 2544 2544 HOH HOH A . 
D 3 HOH 545 2545 2545 HOH HOH A . 
D 3 HOH 546 2546 2546 HOH HOH A . 
D 3 HOH 547 2547 2547 HOH HOH A . 
D 3 HOH 548 2548 2548 HOH HOH A . 
D 3 HOH 549 2549 2549 HOH HOH A . 
D 3 HOH 550 2550 2550 HOH HOH A . 
D 3 HOH 551 2551 2551 HOH HOH A . 
D 3 HOH 552 2552 2552 HOH HOH A . 
D 3 HOH 553 2553 2553 HOH HOH A . 
D 3 HOH 554 2554 2554 HOH HOH A . 
D 3 HOH 555 2555 2555 HOH HOH A . 
D 3 HOH 556 2556 2556 HOH HOH A . 
D 3 HOH 557 2557 2557 HOH HOH A . 
D 3 HOH 558 2558 2558 HOH HOH A . 
D 3 HOH 559 2559 2559 HOH HOH A . 
D 3 HOH 560 2560 2560 HOH HOH A . 
D 3 HOH 561 2561 2561 HOH HOH A . 
D 3 HOH 562 2562 2562 HOH HOH A . 
D 3 HOH 563 2563 2563 HOH HOH A . 
D 3 HOH 564 2564 2564 HOH HOH A . 
D 3 HOH 565 2565 2565 HOH HOH A . 
D 3 HOH 566 2566 2566 HOH HOH A . 
D 3 HOH 567 2567 2567 HOH HOH A . 
D 3 HOH 568 2568 2568 HOH HOH A . 
D 3 HOH 569 2569 2569 HOH HOH A . 
D 3 HOH 570 2570 2570 HOH HOH A . 
D 3 HOH 571 2571 2571 HOH HOH A . 
D 3 HOH 572 2572 2572 HOH HOH A . 
D 3 HOH 573 2573 2573 HOH HOH A . 
D 3 HOH 574 2574 2574 HOH HOH A . 
D 3 HOH 575 2575 2575 HOH HOH A . 
D 3 HOH 576 2576 2576 HOH HOH A . 
D 3 HOH 577 2577 2577 HOH HOH A . 
D 3 HOH 578 2578 2578 HOH HOH A . 
D 3 HOH 579 2579 2579 HOH HOH A . 
D 3 HOH 580 2580 2580 HOH HOH A . 
D 3 HOH 581 2581 2581 HOH HOH A . 
D 3 HOH 582 2582 2582 HOH HOH A . 
D 3 HOH 583 2583 2583 HOH HOH A . 
D 3 HOH 584 2584 2584 HOH HOH A . 
D 3 HOH 585 2585 2585 HOH HOH A . 
D 3 HOH 586 2586 2586 HOH HOH A . 
D 3 HOH 587 2587 2587 HOH HOH A . 
D 3 HOH 588 2588 2588 HOH HOH A . 
D 3 HOH 589 2589 2589 HOH HOH A . 
D 3 HOH 590 2590 2590 HOH HOH A . 
D 3 HOH 591 2591 2591 HOH HOH A . 
D 3 HOH 592 2592 2592 HOH HOH A . 
D 3 HOH 593 2593 2593 HOH HOH A . 
D 3 HOH 594 2594 2594 HOH HOH A . 
D 3 HOH 595 2595 2595 HOH HOH A . 
D 3 HOH 596 2596 2596 HOH HOH A . 
D 3 HOH 597 2597 2597 HOH HOH A . 
D 3 HOH 598 2598 2598 HOH HOH A . 
D 3 HOH 599 2599 2599 HOH HOH A . 
D 3 HOH 600 2600 2600 HOH HOH A . 
D 3 HOH 601 2601 2601 HOH HOH A . 
D 3 HOH 602 2602 2602 HOH HOH A . 
D 3 HOH 603 2603 2603 HOH HOH A . 
D 3 HOH 604 2604 2604 HOH HOH A . 
D 3 HOH 605 2605 2605 HOH HOH A . 
D 3 HOH 606 2606 2606 HOH HOH A . 
D 3 HOH 607 2607 2607 HOH HOH A . 
D 3 HOH 608 2608 2608 HOH HOH A . 
D 3 HOH 609 2609 2609 HOH HOH A . 
D 3 HOH 610 2610 2610 HOH HOH A . 
D 3 HOH 611 2611 2611 HOH HOH A . 
D 3 HOH 612 2612 2612 HOH HOH A . 
D 3 HOH 613 2613 2613 HOH HOH A . 
D 3 HOH 614 2614 2614 HOH HOH A . 
D 3 HOH 615 2615 2615 HOH HOH A . 
D 3 HOH 616 2616 2616 HOH HOH A . 
D 3 HOH 617 2617 2617 HOH HOH A . 
D 3 HOH 618 2618 2618 HOH HOH A . 
D 3 HOH 619 2619 2619 HOH HOH A . 
D 3 HOH 620 2620 2620 HOH HOH A . 
D 3 HOH 621 2621 2621 HOH HOH A . 
D 3 HOH 622 2622 2622 HOH HOH A . 
D 3 HOH 623 2623 2623 HOH HOH A . 
D 3 HOH 624 2624 2624 HOH HOH A . 
D 3 HOH 625 2625 2625 HOH HOH A . 
D 3 HOH 626 2626 2626 HOH HOH A . 
D 3 HOH 627 2627 2627 HOH HOH A . 
D 3 HOH 628 2628 2628 HOH HOH A . 
D 3 HOH 629 2629 2629 HOH HOH A . 
D 3 HOH 630 2630 2630 HOH HOH A . 
D 3 HOH 631 2631 2631 HOH HOH A . 
D 3 HOH 632 2632 2632 HOH HOH A . 
D 3 HOH 633 2633 2633 HOH HOH A . 
D 3 HOH 634 2634 2634 HOH HOH A . 
D 3 HOH 635 2635 2635 HOH HOH A . 
D 3 HOH 636 2636 2636 HOH HOH A . 
D 3 HOH 637 2637 2637 HOH HOH A . 
D 3 HOH 638 2638 2638 HOH HOH A . 
D 3 HOH 639 2639 2639 HOH HOH A . 
D 3 HOH 640 2640 2640 HOH HOH A . 
D 3 HOH 641 2641 2641 HOH HOH A . 
D 3 HOH 642 2642 2642 HOH HOH A . 
D 3 HOH 643 2643 2643 HOH HOH A . 
D 3 HOH 644 2644 2644 HOH HOH A . 
D 3 HOH 645 2645 2645 HOH HOH A . 
D 3 HOH 646 2646 2646 HOH HOH A . 
D 3 HOH 647 2647 2647 HOH HOH A . 
D 3 HOH 648 2648 2648 HOH HOH A . 
D 3 HOH 649 2649 2649 HOH HOH A . 
D 3 HOH 650 2650 2650 HOH HOH A . 
D 3 HOH 651 2651 2651 HOH HOH A . 
D 3 HOH 652 2652 2652 HOH HOH A . 
D 3 HOH 653 2653 2653 HOH HOH A . 
D 3 HOH 654 2654 2654 HOH HOH A . 
D 3 HOH 655 2655 2655 HOH HOH A . 
D 3 HOH 656 2656 2656 HOH HOH A . 
D 3 HOH 657 2657 2657 HOH HOH A . 
D 3 HOH 658 2658 2658 HOH HOH A . 
D 3 HOH 659 2659 2659 HOH HOH A . 
D 3 HOH 660 2660 2660 HOH HOH A . 
D 3 HOH 661 2661 2661 HOH HOH A . 
D 3 HOH 662 2662 2662 HOH HOH A . 
D 3 HOH 663 2663 2663 HOH HOH A . 
D 3 HOH 664 2664 2664 HOH HOH A . 
D 3 HOH 665 2665 2665 HOH HOH A . 
D 3 HOH 666 2666 2666 HOH HOH A . 
D 3 HOH 667 2667 2667 HOH HOH A . 
D 3 HOH 668 2668 2668 HOH HOH A . 
D 3 HOH 669 2669 2669 HOH HOH A . 
D 3 HOH 670 2670 2670 HOH HOH A . 
D 3 HOH 671 2671 2671 HOH HOH A . 
D 3 HOH 672 2672 2672 HOH HOH A . 
D 3 HOH 673 2673 2673 HOH HOH A . 
D 3 HOH 674 2674 2674 HOH HOH A . 
D 3 HOH 675 2675 2675 HOH HOH A . 
D 3 HOH 676 2676 2676 HOH HOH A . 
D 3 HOH 677 2677 2677 HOH HOH A . 
D 3 HOH 678 2678 2678 HOH HOH A . 
D 3 HOH 679 2679 2679 HOH HOH A . 
D 3 HOH 680 2680 2680 HOH HOH A . 
D 3 HOH 681 2681 2681 HOH HOH A . 
D 3 HOH 682 2682 2682 HOH HOH A . 
D 3 HOH 683 2683 2683 HOH HOH A . 
D 3 HOH 684 2684 2684 HOH HOH A . 
D 3 HOH 685 2685 2685 HOH HOH A . 
D 3 HOH 686 2686 2686 HOH HOH A . 
D 3 HOH 687 2687 2687 HOH HOH A . 
D 3 HOH 688 2688 2688 HOH HOH A . 
D 3 HOH 689 2689 2689 HOH HOH A . 
D 3 HOH 690 2690 2690 HOH HOH A . 
D 3 HOH 691 2691 2691 HOH HOH A . 
D 3 HOH 692 2692 2692 HOH HOH A . 
D 3 HOH 693 2693 2693 HOH HOH A . 
D 3 HOH 694 2694 2694 HOH HOH A . 
D 3 HOH 695 2695 2695 HOH HOH A . 
D 3 HOH 696 2696 2696 HOH HOH A . 
D 3 HOH 697 2697 2697 HOH HOH A . 
D 3 HOH 698 2698 2698 HOH HOH A . 
D 3 HOH 699 2699 2699 HOH HOH A . 
D 3 HOH 700 2700 2700 HOH HOH A . 
D 3 HOH 701 2701 2701 HOH HOH A . 
D 3 HOH 702 2702 2702 HOH HOH A . 
D 3 HOH 703 2703 2703 HOH HOH A . 
D 3 HOH 704 2704 2704 HOH HOH A . 
D 3 HOH 705 2705 2705 HOH HOH A . 
D 3 HOH 706 2706 2706 HOH HOH A . 
D 3 HOH 707 2707 2707 HOH HOH A . 
D 3 HOH 708 2708 2708 HOH HOH A . 
D 3 HOH 709 2709 2709 HOH HOH A . 
D 3 HOH 710 2710 2710 HOH HOH A . 
D 3 HOH 711 2711 2711 HOH HOH A . 
D 3 HOH 712 2712 2712 HOH HOH A . 
D 3 HOH 713 2713 2713 HOH HOH A . 
D 3 HOH 714 2714 2714 HOH HOH A . 
D 3 HOH 715 2715 2715 HOH HOH A . 
D 3 HOH 716 2716 2716 HOH HOH A . 
D 3 HOH 717 2717 2717 HOH HOH A . 
D 3 HOH 718 2718 2718 HOH HOH A . 
D 3 HOH 719 2719 2719 HOH HOH A . 
D 3 HOH 720 2720 2720 HOH HOH A . 
D 3 HOH 721 2721 2721 HOH HOH A . 
D 3 HOH 722 2722 2722 HOH HOH A . 
D 3 HOH 723 2723 2723 HOH HOH A . 
D 3 HOH 724 2724 2724 HOH HOH A . 
D 3 HOH 725 2725 2725 HOH HOH A . 
D 3 HOH 726 2726 2726 HOH HOH A . 
D 3 HOH 727 2727 2727 HOH HOH A . 
D 3 HOH 728 2728 2728 HOH HOH A . 
D 3 HOH 729 2729 2729 HOH HOH A . 
D 3 HOH 730 2730 2730 HOH HOH A . 
D 3 HOH 731 2731 2731 HOH HOH A . 
D 3 HOH 732 2732 2732 HOH HOH A . 
D 3 HOH 733 2733 2733 HOH HOH A . 
D 3 HOH 734 2734 2734 HOH HOH A . 
D 3 HOH 735 2735 2735 HOH HOH A . 
D 3 HOH 736 2736 2736 HOH HOH A . 
D 3 HOH 737 2737 2737 HOH HOH A . 
D 3 HOH 738 2738 2738 HOH HOH A . 
D 3 HOH 739 2739 2739 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2540  ? 
1 MORE         -4.9  ? 
1 'SSA (A^2)'  39100 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.5870000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2048 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-11-08 
2 'Structure model' 1 1 2011-09-07 
3 'Structure model' 2 0 2019-04-03 
4 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Derived calculations'      
2  2 'Structure model' 'Non-polymer description'   
3  2 'Structure model' Other                       
4  2 'Structure model' 'Refinement description'    
5  2 'Structure model' 'Structure summary'         
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' 'Atomic model'              
8  3 'Structure model' 'Data collection'           
9  3 'Structure model' 'Derived calculations'      
10 3 'Structure model' 'Experimental preparation'  
11 3 'Structure model' Other                       
12 4 'Structure model' 'Data collection'           
13 4 'Structure model' 'Derived calculations'      
14 4 'Structure model' Other                       
15 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' atom_site                 
2  3 'Structure model' exptl_crystal_grow        
3  3 'Structure model' pdbx_database_proc        
4  3 'Structure model' pdbx_database_status      
5  3 'Structure model' struct_conn               
6  4 'Structure model' chem_comp                 
7  4 'Structure model' entity                    
8  4 'Structure model' pdbx_chem_comp_identifier 
9  4 'Structure model' pdbx_database_status      
10 4 'Structure model' pdbx_entity_nonpoly       
11 4 'Structure model' struct_conn               
12 4 'Structure model' struct_site               
13 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.occupancy'                        
2  3 'Structure model' '_exptl_crystal_grow.temp'                    
3  3 'Structure model' '_pdbx_database_status.recvd_author_approval' 
4  3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
5  4 'Structure model' '_chem_comp.name'                             
6  4 'Structure model' '_chem_comp.type'                             
7  4 'Structure model' '_entity.pdbx_description'                    
8  4 'Structure model' '_pdbx_database_status.status_code_sf'        
9  4 'Structure model' '_pdbx_entity_nonpoly.name'                   
10 4 'Structure model' '_struct_conn.pdbx_role'                      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 1EA5 
_pdbx_entry_details.compound_details         
;HYDROLYZES CHOLINE RELEASED INTO THE SYNAPSE.
 CATALYTIC ACTIVITY: ACETYLCHOLINE + H(2)O = CHOLINE + ACETATE.
 INHIBITORS OF THE ENZYME ACETYLCHOLINESTERASE (ACHE) SLOW AND
 SOMETIMES REVERSE THE COGNITIVE DECLINE EXPERIENCED BY INDIVIDUALS
 WITH ALZHEIMER'S DISEASE.
 TORPEDO CALIFONICA ACETYLCHOLINESTERASE IS A G2 DIMER IN
 SOLUTION (SEE SUSSMAN 1988). THE ASYMMETRIC UNIT CONTAINS A
 MONOMER, WITH THE CRYSTALLOGRAPHIC TWO-FOLD AXIS RELATING
 THE TWO MONOMERS IN A DIMER.
 THIS IS THE HIGHEST RESOLUTION ACETYLCHLINESTERASE
 DETERMINED SO FAR.
 THERE IS RECENT EVIDENCE (SEE BUCHT 1996) THAT THE GPI
 ANCHOR IS ATTACHED TO EITHER SER 543 OR SER 544, NOT TO CYS
 537.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 2007 ? ? O   A HOH 2008 ? ? 2.15 
2 1 NH1 A ARG 221  ? B OE1 A GLN 318  ? ? 2.17 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    CG2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    THR 
_pdbx_validate_symm_contact.auth_seq_id_1     535 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    CG2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    THR 
_pdbx_validate_symm_contact.auth_seq_id_2     535 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              2.13 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A MET 16  ? B SD  A MET 16  ? B 1.641 1.807 -0.166 0.026 N 
2 1 CG A ARG 19  ? A CD  A ARG 19  ? A 1.226 1.515 -0.289 0.025 N 
3 1 CD A ARG 46  ? B NE  A ARG 46  ? B 1.666 1.460 0.206  0.017 N 
4 1 CD A GLN 526 ? A OE1 A GLN 526 ? A 1.422 1.235 0.187  0.022 N 
5 1 CD A GLN 526 ? B OE1 A GLN 526 ? B 1.452 1.235 0.217  0.022 N 
6 1 CD A GLN 526 ? A NE2 A GLN 526 ? A 1.174 1.324 -0.150 0.025 N 
7 1 CD A GLN 526 ? B NE2 A GLN 526 ? B 1.128 1.324 -0.196 0.025 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ARG 19  ? A CG A ARG 19  ? A CD  A ARG 19  ? A 135.39 111.60 23.79  2.60 N 
2 1 CG A ARG 46  ? B CD A ARG 46  ? B NE  A ARG 46  ? B 93.41  111.80 -18.39 2.10 N 
3 1 CA A PRO 283 ? ? N  A PRO 283 ? ? CD  A PRO 283 ? ? 98.49  111.70 -13.21 1.40 N 
4 1 CG A GLU 344 ? B CD A GLU 344 ? B OE2 A GLU 344 ? B 105.71 118.30 -12.59 2.00 N 
5 1 CG A GLN 526 ? A CD A GLN 526 ? A OE1 A GLN 526 ? A 107.06 121.60 -14.54 2.00 N 
6 1 CG A GLN 526 ? B CD A GLN 526 ? B OE1 A GLN 526 ? B 105.31 121.60 -16.29 2.00 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 22  ? ? -160.04 116.85  
2  1 PHE A 45  ? ? 81.66   -13.71  
3  1 ALA A 60  ? ? -109.04 48.18   
4  1 SER A 108 ? ? -158.01 78.14   
5  1 SER A 200 ? ? 54.52   -115.74 
6  1 GLU A 299 ? ? -121.82 -74.47  
7  1 THR A 317 ? ? -157.09 -159.19 
8  1 ASP A 380 ? ? -156.61 57.47   
9  1 VAL A 400 ? ? -126.73 -63.35  
10 1 HIS A 486 ? ? 70.96   36.80   
11 1 ARG A 517 ? ? 37.71   45.58   
12 1 GLN A 526 ? A -120.44 -54.62  
13 1 GLN A 526 ? B -120.17 -55.42  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    GLN 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     526 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    A 
_pdbx_validate_planes.rmsd            0.102 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2017 ? 6.13  . 
2  1 O ? A HOH 2022 ? 6.89  . 
3  1 O ? A HOH 2025 ? 7.40  . 
4  1 O ? A HOH 2032 ? 6.01  . 
5  1 O ? A HOH 2040 ? 9.19  . 
6  1 O ? A HOH 2041 ? 11.53 . 
7  1 O ? A HOH 2054 ? 5.97  . 
8  1 O ? A HOH 2056 ? 5.81  . 
9  1 O ? A HOH 2057 ? 5.83  . 
10 1 O ? A HOH 2058 ? 6.56  . 
11 1 O ? A HOH 2059 ? 7.11  . 
12 1 O ? A HOH 2083 ? 6.82  . 
13 1 O ? A HOH 2085 ? 7.03  . 
14 1 O ? A HOH 2108 ? 6.95  . 
15 1 O ? A HOH 2110 ? 7.17  . 
16 1 O ? A HOH 2120 ? 5.89  . 
17 1 O ? A HOH 2121 ? 6.88  . 
18 1 O ? A HOH 2157 ? 5.97  . 
19 1 O ? A HOH 2307 ? 6.08  . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 14  ? CE  ? A LYS 14  CE  
2  1 Y 1 A LYS 14  ? NZ  ? A LYS 14  NZ  
3  1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
4  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
5  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
6  1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
7  1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
8  1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
9  1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
10 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
11 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
12 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
13 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
14 1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
15 1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
16 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
17 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
18 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
19 1 Y 1 A GLU 489 ? CD  ? A GLU 489 CD  
20 1 Y 1 A GLU 489 ? OE1 ? A GLU 489 OE1 
21 1 Y 1 A GLU 489 ? OE2 ? A GLU 489 OE2 
22 1 Y 1 A SER 490 ? OG  ? A SER 490 OG  
23 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
24 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
25 1 Y 1 A LYS 530 ? CE  ? A LYS 530 CE  
26 1 Y 1 A LYS 530 ? NZ  ? A LYS 530 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A ALA 536 ? A ALA 536 
5 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
3 water                                    HOH 
#