data_1EAK
# 
_entry.id   1EAK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EAK         
PDBE  EBI-8313     
WWPDB D_1290008313 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CK7 unspecified 'GELATINASE A (FULL-LENGTH)'                                                    
PDB 1CXW unspecified 'THE SECOND TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2'                
PDB 1GEN unspecified 'C-TERMINAL DOMAIN OF GELATINASE A'                                             
PDB 1J7M unspecified 'THE THIRD FIBRONECTIN TYPE II MODULE FROM HUMAN MATRIXMETALLOPROTEINASE 2'     
PDB 1RTG unspecified 'C-TERMINAL DOMAIN (HAEMOPEXIN-LIKE DOMAIN) OF HUMAN MATRIXMETALLOPROTEINASE-2' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EAK 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bergmann, U.'   1 ? 
'Tuuttila, A.'   2 ? 
'Tryggvason, K.' 3 ? 
'Morgunova, E.'  4 ? 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of Human Mmp-2 Reveals a New P' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bergmann, U.'   1 ? 
primary 'Tuuttila, A.'   2 ? 
primary 'Morgunova, E.'  3 ? 
primary 'Tryggvason, K.' 4 ? 
# 
_cell.entry_id           1EAK 
_cell.length_a           117.670 
_cell.length_b           166.150 
_cell.length_c           170.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EAK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '72 KDA TYPE IV COLLAGENASE' 47304.348 4   3.4.24.24 YES 'CATALYTIC DOMAIN RESIDUES 32-452' ? 
2 polymer     syn 'INHIBITOR PEPTIDE'          622.671   2   ?         ?   ?                                  ? 
3 non-polymer syn 'SULFATE ION'                96.063    6   ?         ?   ?                                  ? 
4 non-polymer syn 'ZINC ION'                   65.409    8   ?         ?   ?                                  ? 
5 non-polymer syn 'CALCIUM ION'                40.078    8   ?         ?   ?                                  ? 
6 water       nat water                        18.015    109 ?         ?   ?                                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GELATINASE A, 72 KDA GELATINASE, MATRIX METALLOPROTEINASE-2, MMP-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYN
FFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLL
AHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKY
GFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVF
PFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYTKNF
RLSQDDIKGIQELYGASPDID
;
;SPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYN
FFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLL
AHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKY
GFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVF
PFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHQFGHAMGLEHSQDPGALMAPIYTYTKNF
RLSQDDIKGIQELYGASPDID
;
A,B,C,D ? 
2 'polypeptide(L)' no no GPAGPPGA GPAGPPGA P,R     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   PRO n 
1 3   ILE n 
1 4   ILE n 
1 5   LYS n 
1 6   PHE n 
1 7   PRO n 
1 8   GLY n 
1 9   ASP n 
1 10  VAL n 
1 11  ALA n 
1 12  PRO n 
1 13  LYS n 
1 14  THR n 
1 15  ASP n 
1 16  LYS n 
1 17  GLU n 
1 18  LEU n 
1 19  ALA n 
1 20  VAL n 
1 21  GLN n 
1 22  TYR n 
1 23  LEU n 
1 24  ASN n 
1 25  THR n 
1 26  PHE n 
1 27  TYR n 
1 28  GLY n 
1 29  CYS n 
1 30  PRO n 
1 31  LYS n 
1 32  GLU n 
1 33  SER n 
1 34  CYS n 
1 35  ASN n 
1 36  LEU n 
1 37  PHE n 
1 38  VAL n 
1 39  LEU n 
1 40  LYS n 
1 41  ASP n 
1 42  THR n 
1 43  LEU n 
1 44  LYS n 
1 45  LYS n 
1 46  MET n 
1 47  GLN n 
1 48  LYS n 
1 49  PHE n 
1 50  PHE n 
1 51  GLY n 
1 52  LEU n 
1 53  PRO n 
1 54  GLN n 
1 55  THR n 
1 56  GLY n 
1 57  ASP n 
1 58  LEU n 
1 59  ASP n 
1 60  GLN n 
1 61  ASN n 
1 62  THR n 
1 63  ILE n 
1 64  GLU n 
1 65  THR n 
1 66  MET n 
1 67  ARG n 
1 68  LYS n 
1 69  PRO n 
1 70  ARG n 
1 71  CYS n 
1 72  GLY n 
1 73  ASN n 
1 74  PRO n 
1 75  ASP n 
1 76  VAL n 
1 77  ALA n 
1 78  ASN n 
1 79  TYR n 
1 80  ASN n 
1 81  PHE n 
1 82  PHE n 
1 83  PRO n 
1 84  ARG n 
1 85  LYS n 
1 86  PRO n 
1 87  LYS n 
1 88  TRP n 
1 89  ASP n 
1 90  LYS n 
1 91  ASN n 
1 92  GLN n 
1 93  ILE n 
1 94  THR n 
1 95  TYR n 
1 96  ARG n 
1 97  ILE n 
1 98  ILE n 
1 99  GLY n 
1 100 TYR n 
1 101 THR n 
1 102 PRO n 
1 103 ASP n 
1 104 LEU n 
1 105 ASP n 
1 106 PRO n 
1 107 GLU n 
1 108 THR n 
1 109 VAL n 
1 110 ASP n 
1 111 ASP n 
1 112 ALA n 
1 113 PHE n 
1 114 ALA n 
1 115 ARG n 
1 116 ALA n 
1 117 PHE n 
1 118 GLN n 
1 119 VAL n 
1 120 TRP n 
1 121 SER n 
1 122 ASP n 
1 123 VAL n 
1 124 THR n 
1 125 PRO n 
1 126 LEU n 
1 127 ARG n 
1 128 PHE n 
1 129 SER n 
1 130 ARG n 
1 131 ILE n 
1 132 HIS n 
1 133 ASP n 
1 134 GLY n 
1 135 GLU n 
1 136 ALA n 
1 137 ASP n 
1 138 ILE n 
1 139 MET n 
1 140 ILE n 
1 141 ASN n 
1 142 PHE n 
1 143 GLY n 
1 144 ARG n 
1 145 TRP n 
1 146 GLU n 
1 147 HIS n 
1 148 GLY n 
1 149 ASP n 
1 150 GLY n 
1 151 TYR n 
1 152 PRO n 
1 153 PHE n 
1 154 ASP n 
1 155 GLY n 
1 156 LYS n 
1 157 ASP n 
1 158 GLY n 
1 159 LEU n 
1 160 LEU n 
1 161 ALA n 
1 162 HIS n 
1 163 ALA n 
1 164 PHE n 
1 165 ALA n 
1 166 PRO n 
1 167 GLY n 
1 168 THR n 
1 169 GLY n 
1 170 VAL n 
1 171 GLY n 
1 172 GLY n 
1 173 ASP n 
1 174 SER n 
1 175 HIS n 
1 176 PHE n 
1 177 ASP n 
1 178 ASP n 
1 179 ASP n 
1 180 GLU n 
1 181 LEU n 
1 182 TRP n 
1 183 THR n 
1 184 LEU n 
1 185 GLY n 
1 186 GLU n 
1 187 GLY n 
1 188 GLN n 
1 189 VAL n 
1 190 VAL n 
1 191 ARG n 
1 192 VAL n 
1 193 LYS n 
1 194 TYR n 
1 195 GLY n 
1 196 ASN n 
1 197 ALA n 
1 198 ASP n 
1 199 GLY n 
1 200 GLU n 
1 201 TYR n 
1 202 CYS n 
1 203 LYS n 
1 204 PHE n 
1 205 PRO n 
1 206 PHE n 
1 207 LEU n 
1 208 PHE n 
1 209 ASN n 
1 210 GLY n 
1 211 LYS n 
1 212 GLU n 
1 213 TYR n 
1 214 ASN n 
1 215 SER n 
1 216 CYS n 
1 217 THR n 
1 218 ASP n 
1 219 THR n 
1 220 GLY n 
1 221 ARG n 
1 222 SER n 
1 223 ASP n 
1 224 GLY n 
1 225 PHE n 
1 226 LEU n 
1 227 TRP n 
1 228 CYS n 
1 229 SER n 
1 230 THR n 
1 231 THR n 
1 232 TYR n 
1 233 ASN n 
1 234 PHE n 
1 235 GLU n 
1 236 LYS n 
1 237 ASP n 
1 238 GLY n 
1 239 LYS n 
1 240 TYR n 
1 241 GLY n 
1 242 PHE n 
1 243 CYS n 
1 244 PRO n 
1 245 HIS n 
1 246 GLU n 
1 247 ALA n 
1 248 LEU n 
1 249 PHE n 
1 250 THR n 
1 251 MET n 
1 252 GLY n 
1 253 GLY n 
1 254 ASN n 
1 255 ALA n 
1 256 GLU n 
1 257 GLY n 
1 258 GLN n 
1 259 PRO n 
1 260 CYS n 
1 261 LYS n 
1 262 PHE n 
1 263 PRO n 
1 264 PHE n 
1 265 ARG n 
1 266 PHE n 
1 267 GLN n 
1 268 GLY n 
1 269 THR n 
1 270 SER n 
1 271 TYR n 
1 272 ASP n 
1 273 SER n 
1 274 CYS n 
1 275 THR n 
1 276 THR n 
1 277 GLU n 
1 278 GLY n 
1 279 ARG n 
1 280 THR n 
1 281 ASP n 
1 282 GLY n 
1 283 TYR n 
1 284 ARG n 
1 285 TRP n 
1 286 CYS n 
1 287 GLY n 
1 288 THR n 
1 289 THR n 
1 290 GLU n 
1 291 ASP n 
1 292 TYR n 
1 293 ASP n 
1 294 ARG n 
1 295 ASP n 
1 296 LYS n 
1 297 LYS n 
1 298 TYR n 
1 299 GLY n 
1 300 PHE n 
1 301 CYS n 
1 302 PRO n 
1 303 GLU n 
1 304 THR n 
1 305 ALA n 
1 306 MET n 
1 307 SER n 
1 308 THR n 
1 309 VAL n 
1 310 GLY n 
1 311 GLY n 
1 312 ASN n 
1 313 SER n 
1 314 GLU n 
1 315 GLY n 
1 316 ALA n 
1 317 PRO n 
1 318 CYS n 
1 319 VAL n 
1 320 PHE n 
1 321 PRO n 
1 322 PHE n 
1 323 THR n 
1 324 PHE n 
1 325 LEU n 
1 326 GLY n 
1 327 ASN n 
1 328 LYS n 
1 329 TYR n 
1 330 GLU n 
1 331 SER n 
1 332 CYS n 
1 333 THR n 
1 334 SER n 
1 335 ALA n 
1 336 GLY n 
1 337 ARG n 
1 338 SER n 
1 339 ASP n 
1 340 GLY n 
1 341 LYS n 
1 342 MET n 
1 343 TRP n 
1 344 CYS n 
1 345 ALA n 
1 346 THR n 
1 347 THR n 
1 348 ALA n 
1 349 ASN n 
1 350 TYR n 
1 351 ASP n 
1 352 ASP n 
1 353 ASP n 
1 354 ARG n 
1 355 LYS n 
1 356 TRP n 
1 357 GLY n 
1 358 PHE n 
1 359 CYS n 
1 360 PRO n 
1 361 ASP n 
1 362 GLN n 
1 363 GLY n 
1 364 TYR n 
1 365 SER n 
1 366 LEU n 
1 367 PHE n 
1 368 LEU n 
1 369 VAL n 
1 370 ALA n 
1 371 ALA n 
1 372 HIS n 
1 373 GLN n 
1 374 PHE n 
1 375 GLY n 
1 376 HIS n 
1 377 ALA n 
1 378 MET n 
1 379 GLY n 
1 380 LEU n 
1 381 GLU n 
1 382 HIS n 
1 383 SER n 
1 384 GLN n 
1 385 ASP n 
1 386 PRO n 
1 387 GLY n 
1 388 ALA n 
1 389 LEU n 
1 390 MET n 
1 391 ALA n 
1 392 PRO n 
1 393 ILE n 
1 394 TYR n 
1 395 THR n 
1 396 TYR n 
1 397 THR n 
1 398 LYS n 
1 399 ASN n 
1 400 PHE n 
1 401 ARG n 
1 402 LEU n 
1 403 SER n 
1 404 GLN n 
1 405 ASP n 
1 406 ASP n 
1 407 ILE n 
1 408 LYS n 
1 409 GLY n 
1 410 ILE n 
1 411 GLN n 
1 412 GLU n 
1 413 LEU n 
1 414 TYR n 
1 415 GLY n 
1 416 ALA n 
1 417 SER n 
1 418 PRO n 
1 419 ASP n 
1 420 ILE n 
1 421 ASP n 
2 1   GLY n 
2 2   PRO n 
2 3   ALA n 
2 4   GLY n 
2 5   PRO n 
2 6   PRO n 
2 7   GLY n 
2 8   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'CABBAGE LOOPER' 
_entity_src_gen.pdbx_host_org_scientific_name      'TRICHOPLUSIA NI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'High Five' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL1393 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'SYNTHETIC CONSTRUCT' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MM02_HUMAN 1 ? ? P08253 ? 
2 PDB 1EAK       2 ? ? 1EAK   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EAK A 1 ? 421 ? P08253 32  ? 452 ? 32  452 
2 1 1EAK B 1 ? 421 ? P08253 32  ? 452 ? 32  452 
3 1 1EAK C 1 ? 421 ? P08253 32  ? 452 ? 32  452 
4 1 1EAK D 1 ? 421 ? P08253 32  ? 452 ? 32  452 
5 2 1EAK P 1 ? 8   ? 1EAK   746 ? 753 ? 746 753 
6 2 1EAK R 1 ? 8   ? 1EAK   746 ? 753 ? 746 753 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EAK GLN A 373 ? UNP P08253 GLU 404 'engineered mutation' 404 1 
2 1EAK GLN B 373 ? UNP P08253 GLU 404 'engineered mutation' 404 2 
3 1EAK GLN C 373 ? UNP P08253 GLU 404 'engineered mutation' 404 3 
4 1EAK GLN D 373 ? UNP P08253 GLU 404 'engineered mutation' 404 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1EAK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.41 
_exptl_crystal.density_percent_sol   71.70 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PH 8.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1997-10-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97984 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE D2AM' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM02 
_diffrn_source.pdbx_wavelength             0.97984 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1EAK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             37.500 
_reflns.d_resolution_high            2.650 
_reflns.number_obs                   84612 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.7 
_reflns.pdbx_Rmerge_I_obs            0.09300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.6000 
_reflns.B_iso_Wilson_estimate        39.90 
_reflns.pdbx_redundancy              1.700 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   60.8 
_reflns_shell.Rmerge_I_obs           0.03600 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.900 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1EAK 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     77543 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               1138461.890 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.58 
_refine.ls_d_res_high                            2.66 
_refine.ls_percent_reflns_obs                    80.2 
_refine.ls_R_factor_obs                          0.271 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.271 
_refine.ls_R_factor_R_free                       0.303 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  3899 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               42.10 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.31 
_refine.solvent_model_param_bsol                 27.42 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1CK7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1EAK 
_refine_analyze.Luzzati_coordinate_error_obs    0.54 
_refine_analyze.Luzzati_sigma_a_obs             0.66 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.54 
_refine_analyze.Luzzati_sigma_a_free            0.72 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13349 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             109 
_refine_hist.number_atoms_total               13504 
_refine_hist.d_res_high                       2.66 
_refine_hist.d_res_low                        35.58 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.057 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             2.30  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.30 ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      2.10  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             3970 
_refine_ls_shell.R_factor_R_work                  0.4990 
_refine_ls_shell.percent_reflns_obs               26.00 
_refine_ls_shell.R_factor_R_free                  0.5280 
_refine_ls_shell.R_factor_R_free_error            0.038 
_refine_ls_shell.percent_reflns_R_free            4.50 
_refine_ls_shell.number_reflns_R_free             189 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 ION.PARAM         ?           
'X-RAY DIFFRACTION' 3 WATER.PARAM       ?           
# 
_struct.entry_id                  1EAK 
_struct.title                     'Catalytic domain of proMMP-2 E404Q mutant' 
_struct.pdbx_descriptor           '72 KDA TYPE IV COLLAGENASE (E.C.3.4.24.24), INHIBITOR PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EAK 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'HYDROLASE-HYDROLASE INHIBITOR COMPLEX, HYDROLYSE, MATRIX METALLOPROTEINASE, GELATINASE A, HYDROLASE- HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 3 ? 
M  N N 3 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 3 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
FA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 14  ? PHE A 26  ? THR A 45  PHE A 57  1 ? 13 
HELX_P HELX_P2  2  ASN A 35  ? PHE A 50  ? ASN A 66  PHE A 81  1 ? 16 
HELX_P HELX_P3  3  ASP A 59  ? ARG A 67  ? ASP A 90  ARG A 98  1 ? 9  
HELX_P HELX_P4  4  ASP A 105 ? ASP A 122 ? ASP A 136 ASP A 153 1 ? 18 
HELX_P HELX_P5  5  TYR A 194 ? ASP A 198 ? TYR A 225 ASP A 229 5 ? 5  
HELX_P HELX_P6  6  ASN A 349 ? ARG A 354 ? ASN A 380 ARG A 385 1 ? 6  
HELX_P HELX_P7  7  LEU A 366 ? MET A 378 ? LEU A 397 MET A 409 1 ? 13 
HELX_P HELX_P8  8  SER A 403 ? GLY A 415 ? SER A 434 GLY A 446 1 ? 13 
HELX_P HELX_P9  9  THR B 14  ? TYR B 27  ? THR B 45  TYR B 58  1 ? 14 
HELX_P HELX_P10 10 ASN B 35  ? PHE B 50  ? ASN B 66  PHE B 81  1 ? 16 
HELX_P HELX_P11 11 ASP B 59  ? ARG B 67  ? ASP B 90  ARG B 98  1 ? 9  
HELX_P HELX_P12 12 ASP B 105 ? ASP B 122 ? ASP B 136 ASP B 153 1 ? 18 
HELX_P HELX_P13 13 ASN B 233 ? GLY B 238 ? ASN B 264 GLY B 269 1 ? 6  
HELX_P HELX_P14 14 ASP B 291 ? LYS B 296 ? ASP B 322 LYS B 327 1 ? 6  
HELX_P HELX_P15 15 ASN B 349 ? ARG B 354 ? ASN B 380 ARG B 385 1 ? 6  
HELX_P HELX_P16 16 LEU B 366 ? MET B 378 ? LEU B 397 MET B 409 1 ? 13 
HELX_P HELX_P17 17 SER B 403 ? GLY B 415 ? SER B 434 GLY B 446 1 ? 13 
HELX_P HELX_P18 18 THR C 14  ? PHE C 26  ? THR C 45  PHE C 57  1 ? 13 
HELX_P HELX_P19 19 LEU C 36  ? PHE C 50  ? LEU C 67  PHE C 81  1 ? 15 
HELX_P HELX_P20 20 ASP C 59  ? ARG C 67  ? ASP C 90  ARG C 98  1 ? 9  
HELX_P HELX_P21 21 ASP C 105 ? ASP C 122 ? ASP C 136 ASP C 153 1 ? 18 
HELX_P HELX_P22 22 ASP C 291 ? LYS C 296 ? ASP C 322 LYS C 327 1 ? 6  
HELX_P HELX_P23 23 LEU C 366 ? MET C 378 ? LEU C 397 MET C 409 1 ? 13 
HELX_P HELX_P24 24 SER C 403 ? GLU C 412 ? SER C 434 GLU C 443 1 ? 10 
HELX_P HELX_P25 25 THR D 14  ? TYR D 27  ? THR D 45  TYR D 58  1 ? 14 
HELX_P HELX_P26 26 VAL D 38  ? PHE D 50  ? VAL D 69  PHE D 81  1 ? 13 
HELX_P HELX_P27 27 ASP D 59  ? ARG D 67  ? ASP D 90  ARG D 98  1 ? 9  
HELX_P HELX_P28 28 ASP D 105 ? ASP D 122 ? ASP D 136 ASP D 153 1 ? 18 
HELX_P HELX_P29 29 LEU D 366 ? MET D 378 ? LEU D 397 MET D 409 1 ? 13 
HELX_P HELX_P30 30 SER D 403 ? TYR D 414 ? SER D 434 TYR D 445 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A  CYS 29  SG ? ? ? 1_555 A CYS 34  SG  ? ? A CYS 60  A CYS 65  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf2  disulf ? ? A  CYS 202 SG ? ? ? 1_555 A CYS 228 SG  ? ? A CYS 233 A CYS 259 1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf3  disulf ? ? A  CYS 216 SG ? ? ? 1_555 A CYS 243 SG  ? ? A CYS 247 A CYS 274 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf4  disulf ? ? A  CYS 260 SG ? ? ? 1_555 A CYS 286 SG  ? ? A CYS 291 A CYS 317 1_555 ? ? ? ? ? ? ? 2.067 ? 
disulf5  disulf ? ? A  CYS 274 SG ? ? ? 1_555 A CYS 301 SG  ? ? A CYS 305 A CYS 332 1_555 ? ? ? ? ? ? ? 2.375 ? 
disulf6  disulf ? ? A  CYS 318 SG ? ? ? 1_555 A CYS 344 SG  ? ? A CYS 349 A CYS 375 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf7  disulf ? ? A  CYS 332 SG ? ? ? 1_555 A CYS 359 SG  ? ? A CYS 363 A CYS 390 1_555 ? ? ? ? ? ? ? 1.950 ? 
disulf8  disulf ? ? B  CYS 29  SG ? ? ? 1_555 B CYS 34  SG  ? ? B CYS 60  B CYS 65  1_555 ? ? ? ? ? ? ? 1.980 ? 
disulf9  disulf ? ? B  CYS 202 SG ? ? ? 1_555 B CYS 228 SG  ? ? B CYS 233 B CYS 259 1_555 ? ? ? ? ? ? ? 2.206 ? 
disulf10 disulf ? ? B  CYS 216 SG ? ? ? 1_555 B CYS 243 SG  ? ? B CYS 247 B CYS 274 1_555 ? ? ? ? ? ? ? 2.228 ? 
disulf11 disulf ? ? B  CYS 260 SG ? ? ? 1_555 B CYS 286 SG  ? ? B CYS 291 B CYS 317 1_555 ? ? ? ? ? ? ? 2.084 ? 
disulf12 disulf ? ? B  CYS 274 SG ? ? ? 1_555 B CYS 301 SG  ? ? B CYS 305 B CYS 332 1_555 ? ? ? ? ? ? ? 1.968 ? 
disulf13 disulf ? ? B  CYS 318 SG ? ? ? 1_555 B CYS 344 SG  ? ? B CYS 349 B CYS 375 1_555 ? ? ? ? ? ? ? 2.106 ? 
disulf14 disulf ? ? B  CYS 332 SG ? ? ? 1_555 B CYS 359 SG  ? ? B CYS 363 B CYS 390 1_555 ? ? ? ? ? ? ? 2.180 ? 
disulf15 disulf ? ? C  CYS 29  SG ? ? ? 1_555 C CYS 34  SG  ? ? C CYS 60  C CYS 65  1_555 ? ? ? ? ? ? ? 2.079 ? 
disulf16 disulf ? ? C  CYS 202 SG ? ? ? 1_555 C CYS 228 SG  ? ? C CYS 233 C CYS 259 1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf17 disulf ? ? C  CYS 216 SG ? ? ? 1_555 C CYS 243 SG  ? ? C CYS 247 C CYS 274 1_555 ? ? ? ? ? ? ? 1.899 ? 
disulf18 disulf ? ? C  CYS 260 SG ? ? ? 1_555 C CYS 286 SG  ? ? C CYS 291 C CYS 317 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf19 disulf ? ? C  CYS 274 SG ? ? ? 1_555 C CYS 301 SG  ? ? C CYS 305 C CYS 332 1_555 ? ? ? ? ? ? ? 1.907 ? 
disulf20 disulf ? ? C  CYS 318 SG ? ? ? 1_555 C CYS 344 SG  ? ? C CYS 349 C CYS 375 1_555 ? ? ? ? ? ? ? 1.997 ? 
disulf21 disulf ? ? C  CYS 332 SG ? ? ? 1_555 C CYS 359 SG  ? ? C CYS 363 C CYS 390 1_555 ? ? ? ? ? ? ? 1.989 ? 
disulf22 disulf ? ? D  CYS 29  SG ? ? ? 1_555 D CYS 34  SG  ? ? D CYS 60  D CYS 65  1_555 ? ? ? ? ? ? ? 2.016 ? 
disulf23 disulf ? ? D  CYS 202 SG ? ? ? 1_555 D CYS 228 SG  ? ? D CYS 233 D CYS 259 1_555 ? ? ? ? ? ? ? 1.949 ? 
disulf24 disulf ? ? D  CYS 216 SG ? ? ? 1_555 D CYS 243 SG  ? ? D CYS 247 D CYS 274 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf25 disulf ? ? D  CYS 260 SG ? ? ? 1_555 D CYS 286 SG  ? ? D CYS 291 D CYS 317 1_555 ? ? ? ? ? ? ? 2.186 ? 
disulf26 disulf ? ? D  CYS 274 SG ? ? ? 1_555 D CYS 301 SG  ? ? D CYS 305 D CYS 332 1_555 ? ? ? ? ? ? ? 2.070 ? 
disulf27 disulf ? ? D  CYS 318 SG ? ? ? 1_555 D CYS 344 SG  ? ? D CYS 349 D CYS 375 1_555 ? ? ? ? ? ? ? 2.232 ? 
disulf28 disulf ? ? D  CYS 332 SG ? ? ? 1_555 D CYS 359 SG  ? ? D CYS 363 D CYS 390 1_555 ? ? ? ? ? ? ? 2.118 ? 
disulf29 disulf ? ? D  CYS 344 SG ? ? ? 1_555 D CYS 359 SG  ? ? D CYS 375 D CYS 390 1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc1  metalc ? ? H  ZN  .   ZN ? ? ? 1_555 A ASP 149 OD2 ? ? A ZN  996 A ASP 180 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc2  metalc ? ? H  ZN  .   ZN ? ? ? 1_555 A HIS 162 NE2 ? ? A ZN  996 A HIS 193 1_555 ? ? ? ? ? ? ? 2.103 ? 
metalc3  metalc ? ? H  ZN  .   ZN ? ? ? 1_555 A HIS 147 NE2 ? ? A ZN  996 A HIS 178 1_555 ? ? ? ? ? ? ? 1.918 ? 
metalc4  metalc ? ? H  ZN  .   ZN ? ? ? 1_555 A HIS 175 ND1 ? ? A ZN  996 A HIS 206 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc5  metalc ? ? I  ZN  .   ZN ? ? ? 1_555 A HIS 382 NE2 ? ? A ZN  997 A HIS 413 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc6  metalc ? ? I  ZN  .   ZN ? ? ? 1_555 A CYS 71  SG  ? ? A ZN  997 A CYS 102 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc7  metalc ? ? I  ZN  .   ZN ? ? ? 1_555 A HIS 376 NE2 ? ? A ZN  997 A HIS 407 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc8  metalc ? ? I  ZN  .   ZN ? ? ? 1_555 A HIS 372 NE2 ? ? A ZN  997 A HIS 403 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc9  metalc ? ? J  CA  .   CA ? ? ? 1_555 A ASP 154 OD1 ? ? A CA  998 A ASP 185 1_555 ? ? ? ? ? ? ? 2.607 ? 
metalc10 metalc ? ? J  CA  .   CA ? ? ? 1_555 A GLY 155 O   ? ? A CA  998 A GLY 186 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc11 metalc ? ? J  CA  .   CA ? ? ? 1_555 A LEU 159 O   ? ? A CA  998 A LEU 190 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc12 metalc ? ? J  CA  .   CA ? ? ? 1_555 A ASP 177 OD2 ? ? A CA  998 A ASP 208 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc13 metalc ? ? J  CA  .   CA ? ? ? 1_555 A ASP 157 O   ? ? A CA  998 A ASP 188 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc14 metalc ? ? J  CA  .   CA ? ? ? 1_555 A GLU 180 OE2 ? ? A CA  998 A GLU 211 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc15 metalc ? ? K  CA  .   CA ? ? ? 1_555 A GLY 169 O   ? ? A CA  999 A GLY 200 1_555 ? ? ? ? ? ? ? 3.208 ? 
metalc16 metalc ? ? K  CA  .   CA ? ? ? 1_555 A GLY 171 O   ? ? A CA  999 A GLY 202 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc17 metalc ? ? K  CA  .   CA ? ? ? 1_555 A ASP 137 O   ? ? A CA  999 A ASP 168 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc18 metalc ? ? N  ZN  .   ZN ? ? ? 1_555 B HIS 147 NE2 ? ? B ZN  996 B HIS 178 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc19 metalc ? ? N  ZN  .   ZN ? ? ? 1_555 B ASP 149 OD2 ? ? B ZN  996 B ASP 180 1_555 ? ? ? ? ? ? ? 2.342 ? 
metalc20 metalc ? ? N  ZN  .   ZN ? ? ? 1_555 B HIS 162 NE2 ? ? B ZN  996 B HIS 193 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc21 metalc ? ? N  ZN  .   ZN ? ? ? 1_555 B HIS 175 ND1 ? ? B ZN  996 B HIS 206 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc22 metalc ? ? O  ZN  .   ZN ? ? ? 1_555 B CYS 71  SG  ? ? B ZN  997 B CYS 102 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc23 metalc ? ? O  ZN  .   ZN ? ? ? 1_555 B HIS 372 NE2 ? ? B ZN  997 B HIS 403 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc24 metalc ? ? O  ZN  .   ZN ? ? ? 1_555 B HIS 376 NE2 ? ? B ZN  997 B HIS 407 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc25 metalc ? ? O  ZN  .   ZN ? ? ? 1_555 B HIS 382 NE2 ? ? B ZN  997 B HIS 413 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc26 metalc ? ? P  CA  .   CA ? ? ? 1_555 B GLU 180 OE2 ? ? B CA  998 B GLU 211 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc27 metalc ? ? P  CA  .   CA ? ? ? 1_555 B ASP 177 OD2 ? ? B CA  998 B ASP 208 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc28 metalc ? ? P  CA  .   CA ? ? ? 1_555 B GLY 155 O   ? ? B CA  998 B GLY 186 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc29 metalc ? ? P  CA  .   CA ? ? ? 1_555 B LEU 159 O   ? ? B CA  998 B LEU 190 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc30 metalc ? ? P  CA  .   CA ? ? ? 1_555 B ASP 157 O   ? ? B CA  998 B ASP 188 1_555 ? ? ? ? ? ? ? 2.633 ? 
metalc31 metalc ? ? P  CA  .   CA ? ? ? 1_555 B ASP 154 OD1 ? ? B CA  998 B ASP 185 1_555 ? ? ? ? ? ? ? 2.586 ? 
metalc32 metalc ? ? Q  CA  .   CA ? ? ? 1_555 B GLY 169 O   ? ? B CA  999 B GLY 200 1_555 ? ? ? ? ? ? ? 3.079 ? 
metalc33 metalc ? ? Q  CA  .   CA ? ? ? 1_555 B GLY 171 O   ? ? B CA  999 B GLY 202 1_555 ? ? ? ? ? ? ? 2.975 ? 
metalc34 metalc ? ? Q  CA  .   CA ? ? ? 1_555 B GLY 167 O   ? ? B CA  999 B GLY 198 1_555 ? ? ? ? ? ? ? 3.390 ? 
metalc35 metalc ? ? Q  CA  .   CA ? ? ? 1_555 B ASP 137 O   ? ? B CA  999 B ASP 168 1_555 ? ? ? ? ? ? ? 3.121 ? 
metalc36 metalc ? ? T  ZN  .   ZN ? ? ? 1_555 C HIS 162 NE2 ? ? C ZN  996 C HIS 193 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc37 metalc ? ? T  ZN  .   ZN ? ? ? 1_555 C HIS 147 NE2 ? ? C ZN  996 C HIS 178 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc38 metalc ? ? T  ZN  .   ZN ? ? ? 1_555 C ASP 149 OD2 ? ? C ZN  996 C ASP 180 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc39 metalc ? ? T  ZN  .   ZN ? ? ? 1_555 C HIS 175 ND1 ? ? C ZN  996 C HIS 206 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc40 metalc ? ? U  ZN  .   ZN ? ? ? 1_555 C HIS 382 NE2 ? ? C ZN  997 C HIS 413 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc41 metalc ? ? U  ZN  .   ZN ? ? ? 1_555 C CYS 71  SG  ? ? C ZN  997 C CYS 102 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc42 metalc ? ? U  ZN  .   ZN ? ? ? 1_555 C HIS 376 NE2 ? ? C ZN  997 C HIS 407 1_555 ? ? ? ? ? ? ? 2.464 ? 
metalc43 metalc ? ? U  ZN  .   ZN ? ? ? 1_555 C HIS 372 NE2 ? ? C ZN  997 C HIS 403 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc44 metalc ? ? V  CA  .   CA ? ? ? 1_555 C ASP 154 OD1 ? ? C CA  998 C ASP 185 1_555 ? ? ? ? ? ? ? 2.640 ? 
metalc45 metalc ? ? V  CA  .   CA ? ? ? 1_555 C GLY 155 O   ? ? C CA  998 C GLY 186 1_555 ? ? ? ? ? ? ? 2.539 ? 
metalc46 metalc ? ? V  CA  .   CA ? ? ? 1_555 C ASP 157 O   ? ? C CA  998 C ASP 188 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc47 metalc ? ? V  CA  .   CA ? ? ? 1_555 C LEU 159 O   ? ? C CA  998 C LEU 190 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc48 metalc ? ? V  CA  .   CA ? ? ? 1_555 C ASP 177 OD2 ? ? C CA  998 C ASP 208 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc49 metalc ? ? V  CA  .   CA ? ? ? 1_555 C GLU 180 OE2 ? ? C CA  998 C GLU 211 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc50 metalc ? ? W  CA  .   CA ? ? ? 1_555 C ASP 137 O   ? ? C CA  999 C ASP 168 1_555 ? ? ? ? ? ? ? 3.167 ? 
metalc51 metalc ? ? W  CA  .   CA ? ? ? 1_555 C GLY 171 O   ? ? C CA  999 C GLY 202 1_555 ? ? ? ? ? ? ? 3.085 ? 
metalc52 metalc ? ? W  CA  .   CA ? ? ? 1_555 C GLY 167 O   ? ? C CA  999 C GLY 198 1_555 ? ? ? ? ? ? ? 3.397 ? 
metalc53 metalc ? ? W  CA  .   CA ? ? ? 1_555 C GLY 169 O   ? ? C CA  999 C GLY 200 1_555 ? ? ? ? ? ? ? 3.091 ? 
metalc54 metalc ? ? Y  ZN  .   ZN ? ? ? 1_555 D HIS 175 ND1 ? ? D ZN  996 D HIS 206 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc55 metalc ? ? Y  ZN  .   ZN ? ? ? 1_555 D ASP 149 OD2 ? ? D ZN  996 D ASP 180 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc56 metalc ? ? Y  ZN  .   ZN ? ? ? 1_555 D HIS 147 NE2 ? ? D ZN  996 D HIS 178 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc57 metalc ? ? Y  ZN  .   ZN ? ? ? 1_555 D HIS 162 NE2 ? ? D ZN  996 D HIS 193 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc58 metalc ? ? Z  ZN  .   ZN ? ? ? 1_555 D HIS 382 NE2 ? ? D ZN  997 D HIS 413 1_555 ? ? ? ? ? ? ? 2.544 ? 
metalc59 metalc ? ? Z  ZN  .   ZN ? ? ? 1_555 D HIS 376 NE2 ? ? D ZN  997 D HIS 407 1_555 ? ? ? ? ? ? ? 2.564 ? 
metalc60 metalc ? ? Z  ZN  .   ZN ? ? ? 1_555 D HIS 372 NE2 ? ? D ZN  997 D HIS 403 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc61 metalc ? ? Z  ZN  .   ZN ? ? ? 1_555 D CYS 71  SG  ? ? D ZN  997 D CYS 102 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc62 metalc ? ? AA CA  .   CA ? ? ? 1_555 D GLY 155 O   ? ? D CA  998 D GLY 186 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc63 metalc ? ? AA CA  .   CA ? ? ? 1_555 D LEU 159 O   ? ? D CA  998 D LEU 190 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc64 metalc ? ? AA CA  .   CA ? ? ? 1_555 D ASP 177 OD2 ? ? D CA  998 D ASP 208 1_555 ? ? ? ? ? ? ? 3.114 ? 
metalc65 metalc ? ? AA CA  .   CA ? ? ? 1_555 D ASP 157 O   ? ? D CA  998 D ASP 188 1_555 ? ? ? ? ? ? ? 2.860 ? 
metalc66 metalc ? ? AA CA  .   CA ? ? ? 1_555 D ASP 154 OD1 ? ? D CA  998 D ASP 185 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc67 metalc ? ? AA CA  .   CA ? ? ? 1_555 D GLU 180 OE2 ? ? D CA  998 D GLU 211 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc68 metalc ? ? BA CA  .   CA ? ? ? 1_555 D ASP 137 O   ? ? D CA  999 D ASP 168 1_555 ? ? ? ? ? ? ? 3.230 ? 
metalc69 metalc ? ? BA CA  .   CA ? ? ? 1_555 D GLY 169 O   ? ? D CA  999 D GLY 200 1_555 ? ? ? ? ? ? ? 3.151 ? 
metalc70 metalc ? ? BA CA  .   CA ? ? ? 1_555 D ALA 136 O   ? ? D CA  999 D ALA 167 1_555 ? ? ? ? ? ? ? 3.211 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 204 A . ? PHE 235 A PRO 205 A ? PRO 236 A 1 -2.50 
2  PHE 262 A . ? PHE 293 A PRO 263 A ? PRO 294 A 1 1.44  
3  PHE 320 A . ? PHE 351 A PRO 321 A ? PRO 352 A 1 -2.00 
4  PHE 204 B . ? PHE 235 B PRO 205 B ? PRO 236 B 1 -1.00 
5  PHE 262 B . ? PHE 293 B PRO 263 B ? PRO 294 B 1 -6.70 
6  PHE 320 B . ? PHE 351 B PRO 321 B ? PRO 352 B 1 -0.81 
7  PHE 204 C . ? PHE 235 C PRO 205 C ? PRO 236 C 1 -0.09 
8  PHE 262 C . ? PHE 293 C PRO 263 C ? PRO 294 C 1 -5.77 
9  PHE 320 C . ? PHE 351 C PRO 321 C ? PRO 352 C 1 -1.10 
10 PHE 204 D . ? PHE 235 D PRO 205 D ? PRO 236 D 1 -2.40 
11 PHE 262 D . ? PHE 293 D PRO 263 D ? PRO 294 D 1 -1.00 
12 PHE 320 D . ? PHE 351 D PRO 321 D ? PRO 352 D 1 -0.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
BA ? 5 ? 
BB ? 2 ? 
BC ? 2 ? 
BD ? 2 ? 
BE ? 2 ? 
BF ? 2 ? 
BG ? 2 ? 
BH ? 2 ? 
CA ? 5 ? 
CB ? 2 ? 
CC ? 2 ? 
CD ? 2 ? 
CE ? 2 ? 
CF ? 2 ? 
CG ? 2 ? 
CH ? 2 ? 
DA ? 5 ? 
DB ? 2 ? 
DC ? 2 ? 
DD ? 2 ? 
DE ? 2 ? 
DF ? 2 ? 
DG ? 2 ? 
DH ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? parallel      
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BA 3 4 ? parallel      
BA 4 5 ? anti-parallel 
BB 1 2 ? parallel      
BC 1 2 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BH 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? parallel      
CA 3 4 ? parallel      
CA 4 5 ? anti-parallel 
CB 1 2 ? parallel      
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? anti-parallel 
CF 1 2 ? anti-parallel 
CG 1 2 ? anti-parallel 
CH 1 2 ? anti-parallel 
DA 1 2 ? parallel      
DA 2 3 ? parallel      
DA 3 4 ? parallel      
DA 4 5 ? anti-parallel 
DB 1 2 ? parallel      
DC 1 2 ? anti-parallel 
DD 1 2 ? anti-parallel 
DE 1 2 ? anti-parallel 
DF 1 2 ? anti-parallel 
DG 1 2 ? anti-parallel 
DH 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 127 ? ARG A 130 ? ARG A 158 ARG A 161 
AA 2 GLN A 92  ? ILE A 97  ? GLN A 123 ILE A 128 
AA 3 ILE A 138 ? GLY A 143 ? ILE A 169 GLY A 174 
AA 4 SER A 174 ? ASP A 177 ? SER A 205 ASP A 208 
AA 5 ALA A 161 ? ALA A 163 ? ALA A 192 ALA A 194 
AB 1 TRP A 182 ? THR A 183 ? TRP A 213 THR A 214 
AB 2 TYR A 364 ? SER A 365 ? TYR A 395 SER A 396 
AC 1 PHE A 206 ? PHE A 208 ? PHE A 237 PHE A 239 
AC 2 LYS A 211 ? TYR A 213 ? LYS A 242 TYR A 244 
AD 1 TRP A 227 ? SER A 229 ? TRP A 258 SER A 260 
AD 2 TYR A 240 ? PHE A 242 ? TYR A 271 PHE A 273 
AE 1 PHE A 264 ? PHE A 266 ? PHE A 295 PHE A 297 
AE 2 THR A 269 ? TYR A 271 ? THR A 300 TYR A 302 
AF 1 TRP A 285 ? GLY A 287 ? TRP A 316 GLY A 318 
AF 2 TYR A 298 ? PHE A 300 ? TYR A 329 PHE A 331 
AG 1 PHE A 322 ? PHE A 324 ? PHE A 353 PHE A 355 
AG 2 ASN A 327 ? TYR A 329 ? ASN A 358 TYR A 360 
AH 1 TRP A 343 ? ALA A 345 ? TRP A 374 ALA A 376 
AH 2 TRP A 356 ? PHE A 358 ? TRP A 387 PHE A 389 
BA 1 ARG B 127 ? ARG B 130 ? ARG B 158 ARG B 161 
BA 2 GLN B 92  ? ILE B 97  ? GLN B 123 ILE B 128 
BA 3 ILE B 138 ? GLY B 143 ? ILE B 169 GLY B 174 
BA 4 SER B 174 ? ASP B 177 ? SER B 205 ASP B 208 
BA 5 ALA B 161 ? ALA B 163 ? ALA B 192 ALA B 194 
BB 1 TRP B 182 ? THR B 183 ? TRP B 213 THR B 214 
BB 2 TYR B 364 ? SER B 365 ? TYR B 395 SER B 396 
BC 1 PHE B 206 ? PHE B 208 ? PHE B 237 PHE B 239 
BC 2 LYS B 211 ? TYR B 213 ? LYS B 242 TYR B 244 
BD 1 TRP B 227 ? SER B 229 ? TRP B 258 SER B 260 
BD 2 TYR B 240 ? PHE B 242 ? TYR B 271 PHE B 273 
BE 1 PHE B 264 ? PHE B 266 ? PHE B 295 PHE B 297 
BE 2 THR B 269 ? TYR B 271 ? THR B 300 TYR B 302 
BF 1 TRP B 285 ? GLY B 287 ? TRP B 316 GLY B 318 
BF 2 TYR B 298 ? PHE B 300 ? TYR B 329 PHE B 331 
BG 1 PHE B 322 ? PHE B 324 ? PHE B 353 PHE B 355 
BG 2 ASN B 327 ? TYR B 329 ? ASN B 358 TYR B 360 
BH 1 TRP B 343 ? ALA B 345 ? TRP B 374 ALA B 376 
BH 2 TRP B 356 ? PHE B 358 ? TRP B 387 PHE B 389 
CA 1 ARG C 127 ? ARG C 130 ? ARG C 158 ARG C 161 
CA 2 GLN C 92  ? ILE C 97  ? GLN C 123 ILE C 128 
CA 3 ILE C 138 ? GLY C 143 ? ILE C 169 GLY C 174 
CA 4 SER C 174 ? ASP C 177 ? SER C 205 ASP C 208 
CA 5 ALA C 161 ? ALA C 163 ? ALA C 192 ALA C 194 
CB 1 TRP C 182 ? THR C 183 ? TRP C 213 THR C 214 
CB 2 TYR C 364 ? SER C 365 ? TYR C 395 SER C 396 
CC 1 PHE C 206 ? LEU C 207 ? PHE C 237 LEU C 238 
CC 2 GLU C 212 ? TYR C 213 ? GLU C 243 TYR C 244 
CD 1 TRP C 227 ? SER C 229 ? TRP C 258 SER C 260 
CD 2 TYR C 240 ? PHE C 242 ? TYR C 271 PHE C 273 
CE 1 PHE C 264 ? ARG C 265 ? PHE C 295 ARG C 296 
CE 2 SER C 270 ? TYR C 271 ? SER C 301 TYR C 302 
CF 1 TRP C 285 ? GLY C 287 ? TRP C 316 GLY C 318 
CF 2 TYR C 298 ? PHE C 300 ? TYR C 329 PHE C 331 
CG 1 PHE C 322 ? PHE C 324 ? PHE C 353 PHE C 355 
CG 2 ASN C 327 ? TYR C 329 ? ASN C 358 TYR C 360 
CH 1 TRP C 343 ? ALA C 345 ? TRP C 374 ALA C 376 
CH 2 TRP C 356 ? PHE C 358 ? TRP C 387 PHE C 389 
DA 1 ARG D 127 ? ARG D 130 ? ARG D 158 ARG D 161 
DA 2 GLN D 92  ? ILE D 97  ? GLN D 123 ILE D 128 
DA 3 ILE D 138 ? GLY D 143 ? ILE D 169 GLY D 174 
DA 4 SER D 174 ? ASP D 177 ? SER D 205 ASP D 208 
DA 5 ALA D 161 ? ALA D 163 ? ALA D 192 ALA D 194 
DB 1 TRP D 182 ? THR D 183 ? TRP D 213 THR D 214 
DB 2 TYR D 364 ? SER D 365 ? TYR D 395 SER D 396 
DC 1 PHE D 206 ? LEU D 207 ? PHE D 237 LEU D 238 
DC 2 GLU D 212 ? TYR D 213 ? GLU D 243 TYR D 244 
DD 1 TRP D 227 ? SER D 229 ? TRP D 258 SER D 260 
DD 2 TYR D 240 ? PHE D 242 ? TYR D 271 PHE D 273 
DE 1 PHE D 264 ? PHE D 266 ? PHE D 295 PHE D 297 
DE 2 THR D 269 ? TYR D 271 ? THR D 300 TYR D 302 
DF 1 TRP D 285 ? GLY D 287 ? TRP D 316 GLY D 318 
DF 2 TYR D 298 ? PHE D 300 ? TYR D 329 PHE D 331 
DG 1 PHE D 322 ? PHE D 324 ? PHE D 353 PHE D 355 
DG 2 ASN D 327 ? TYR D 329 ? ASN D 358 TYR D 360 
DH 1 TRP D 343 ? ALA D 345 ? TRP D 374 ALA D 376 
DH 2 TRP D 356 ? PHE D 358 ? TRP D 387 PHE D 389 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 129 ? N SER A 160 O ILE A 93  ? O ILE A 124 
AA 2 3 N ARG A 96  ? N ARG A 127 O ILE A 138 ? O ILE A 169 
AA 3 4 N ASN A 141 ? N ASN A 172 O SER A 174 ? O SER A 205 
AA 4 5 N HIS A 175 ? N HIS A 206 O HIS A 162 ? O HIS A 193 
AB 1 2 N THR A 183 ? N THR A 214 O TYR A 364 ? O TYR A 395 
AC 1 2 N PHE A 208 ? N PHE A 239 O LYS A 211 ? O LYS A 242 
AD 1 2 N CYS A 228 ? N CYS A 259 O GLY A 241 ? O GLY A 272 
AE 1 2 N PHE A 266 ? N PHE A 297 O THR A 269 ? O THR A 300 
AF 1 2 N CYS A 286 ? N CYS A 317 O GLY A 299 ? O GLY A 330 
AG 1 2 N PHE A 324 ? N PHE A 355 O ASN A 327 ? O ASN A 358 
AH 1 2 N CYS A 344 ? N CYS A 375 O GLY A 357 ? O GLY A 388 
BA 1 2 N SER B 129 ? N SER B 160 O ILE B 93  ? O ILE B 124 
BA 2 3 N ARG B 96  ? N ARG B 127 O ILE B 138 ? O ILE B 169 
BA 3 4 N ASN B 141 ? N ASN B 172 O SER B 174 ? O SER B 205 
BA 4 5 N HIS B 175 ? N HIS B 206 O HIS B 162 ? O HIS B 193 
BB 1 2 N THR B 183 ? N THR B 214 O TYR B 364 ? O TYR B 395 
BC 1 2 N PHE B 208 ? N PHE B 239 O LYS B 211 ? O LYS B 242 
BD 1 2 N CYS B 228 ? N CYS B 259 O GLY B 241 ? O GLY B 272 
BE 1 2 N PHE B 266 ? N PHE B 297 O THR B 269 ? O THR B 300 
BF 1 2 N CYS B 286 ? N CYS B 317 O GLY B 299 ? O GLY B 330 
BG 1 2 N PHE B 324 ? N PHE B 355 O ASN B 327 ? O ASN B 358 
BH 1 2 N CYS B 344 ? N CYS B 375 O GLY B 357 ? O GLY B 388 
CA 1 2 N SER C 129 ? N SER C 160 O ILE C 93  ? O ILE C 124 
CA 2 3 N ARG C 96  ? N ARG C 127 O ILE C 138 ? O ILE C 169 
CA 3 4 N ASN C 141 ? N ASN C 172 O SER C 174 ? O SER C 205 
CA 4 5 N HIS C 175 ? N HIS C 206 O HIS C 162 ? O HIS C 193 
CB 1 2 N THR C 183 ? N THR C 214 O TYR C 364 ? O TYR C 395 
CC 1 2 N PHE C 206 ? N PHE C 237 O TYR C 213 ? O TYR C 244 
CD 1 2 N CYS C 228 ? N CYS C 259 O GLY C 241 ? O GLY C 272 
CE 1 2 N PHE C 264 ? N PHE C 295 O TYR C 271 ? O TYR C 302 
CF 1 2 N CYS C 286 ? N CYS C 317 O GLY C 299 ? O GLY C 330 
CG 1 2 N PHE C 324 ? N PHE C 355 O ASN C 327 ? O ASN C 358 
CH 1 2 N CYS C 344 ? N CYS C 375 O GLY C 357 ? O GLY C 388 
DA 1 2 N SER D 129 ? N SER D 160 O ILE D 93  ? O ILE D 124 
DA 2 3 N ARG D 96  ? N ARG D 127 O ILE D 138 ? O ILE D 169 
DA 3 4 N ASN D 141 ? N ASN D 172 O SER D 174 ? O SER D 205 
DA 4 5 N HIS D 175 ? N HIS D 206 O HIS D 162 ? O HIS D 193 
DB 1 2 N THR D 183 ? N THR D 214 O TYR D 364 ? O TYR D 395 
DC 1 2 N PHE D 206 ? N PHE D 237 O TYR D 213 ? O TYR D 244 
DD 1 2 N CYS D 228 ? N CYS D 259 O GLY D 241 ? O GLY D 272 
DE 1 2 N PHE D 266 ? N PHE D 297 O THR D 269 ? O THR D 300 
DF 1 2 N CYS D 286 ? N CYS D 317 O GLY D 299 ? O GLY D 330 
DG 1 2 N PHE D 324 ? N PHE D 355 O ASN D 327 ? O ASN D 358 
DH 1 2 N CYS D 344 ? N CYS D 375 O GLY D 357 ? O GLY D 388 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A 851'            
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 996'             
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 997'             
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 998'             
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 999'             
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 852'            
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 B 853'            
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 996'             
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 997'             
BC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 998'             
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA B 999'             
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 C 850'            
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 C 856'            
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 996'             
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 997'             
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 998'             
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA C 999'             
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE SO4 D 857'            
CC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 996'             
CC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 997'             
CC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 998'             
CC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA D 999'             
CC5 Software ? ? ? ? 14 'BINDING SITE FOR CHAIN P OF INHIBITOR PEPTIDE' 
CC6 Software ? ? ? ? 14 'BINDING SITE FOR CHAIN R OF INHIBITOR PEPTIDE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  GLN A 267 ? GLN A 298 . ? 1_555 ? 
2   AC1 4  GLY A 268 ? GLY A 299 . ? 1_555 ? 
3   AC1 4  THR A 269 ? THR A 300 . ? 1_555 ? 
4   AC1 4  THR C 276 ? THR C 307 . ? 1_555 ? 
5   AC2 4  HIS A 147 ? HIS A 178 . ? 1_555 ? 
6   AC2 4  ASP A 149 ? ASP A 180 . ? 1_555 ? 
7   AC2 4  HIS A 162 ? HIS A 193 . ? 1_555 ? 
8   AC2 4  HIS A 175 ? HIS A 206 . ? 1_555 ? 
9   AC3 4  CYS A 71  ? CYS A 102 . ? 1_555 ? 
10  AC3 4  HIS A 372 ? HIS A 403 . ? 1_555 ? 
11  AC3 4  HIS A 376 ? HIS A 407 . ? 1_555 ? 
12  AC3 4  HIS A 382 ? HIS A 413 . ? 1_555 ? 
13  AC4 6  ASP A 154 ? ASP A 185 . ? 1_555 ? 
14  AC4 6  GLY A 155 ? GLY A 186 . ? 1_555 ? 
15  AC4 6  ASP A 157 ? ASP A 188 . ? 1_555 ? 
16  AC4 6  LEU A 159 ? LEU A 190 . ? 1_555 ? 
17  AC4 6  ASP A 177 ? ASP A 208 . ? 1_555 ? 
18  AC4 6  GLU A 180 ? GLU A 211 . ? 1_555 ? 
19  AC5 5  ALA A 136 ? ALA A 167 . ? 1_555 ? 
20  AC5 5  ASP A 137 ? ASP A 168 . ? 1_555 ? 
21  AC5 5  GLY A 167 ? GLY A 198 . ? 1_555 ? 
22  AC5 5  GLY A 169 ? GLY A 200 . ? 1_555 ? 
23  AC5 5  GLY A 171 ? GLY A 202 . ? 1_555 ? 
24  AC6 5  GLN B 267 ? GLN B 298 . ? 1_555 ? 
25  AC6 5  GLY B 268 ? GLY B 299 . ? 1_555 ? 
26  AC6 5  THR B 269 ? THR B 300 . ? 1_555 ? 
27  AC6 5  THR D 276 ? THR D 307 . ? 1_555 ? 
28  AC6 5  ALA F 8   ? ALA R 753 . ? 1_555 ? 
29  AC7 4  LYS B 211 ? LYS B 242 . ? 1_555 ? 
30  AC7 4  TYR B 213 ? TYR B 244 . ? 1_555 ? 
31  AC7 4  ASN B 214 ? ASN B 245 . ? 1_555 ? 
32  AC7 4  SER B 215 ? SER B 246 . ? 1_555 ? 
33  AC8 4  HIS B 147 ? HIS B 178 . ? 1_555 ? 
34  AC8 4  ASP B 149 ? ASP B 180 . ? 1_555 ? 
35  AC8 4  HIS B 162 ? HIS B 193 . ? 1_555 ? 
36  AC8 4  HIS B 175 ? HIS B 206 . ? 1_555 ? 
37  AC9 4  CYS B 71  ? CYS B 102 . ? 1_555 ? 
38  AC9 4  HIS B 372 ? HIS B 403 . ? 1_555 ? 
39  AC9 4  HIS B 376 ? HIS B 407 . ? 1_555 ? 
40  AC9 4  HIS B 382 ? HIS B 413 . ? 1_555 ? 
41  BC1 6  ASP B 154 ? ASP B 185 . ? 1_555 ? 
42  BC1 6  GLY B 155 ? GLY B 186 . ? 1_555 ? 
43  BC1 6  ASP B 157 ? ASP B 188 . ? 1_555 ? 
44  BC1 6  LEU B 159 ? LEU B 190 . ? 1_555 ? 
45  BC1 6  ASP B 177 ? ASP B 208 . ? 1_555 ? 
46  BC1 6  GLU B 180 ? GLU B 211 . ? 1_555 ? 
47  BC2 4  ASP B 137 ? ASP B 168 . ? 1_555 ? 
48  BC2 4  GLY B 167 ? GLY B 198 . ? 1_555 ? 
49  BC2 4  GLY B 169 ? GLY B 200 . ? 1_555 ? 
50  BC2 4  GLY B 171 ? GLY B 202 . ? 1_555 ? 
51  BC3 5  THR A 276 ? THR A 307 . ? 1_555 ? 
52  BC3 5  GLN C 267 ? GLN C 298 . ? 1_555 ? 
53  BC3 5  GLY C 268 ? GLY C 299 . ? 1_555 ? 
54  BC3 5  THR C 269 ? THR C 300 . ? 1_555 ? 
55  BC3 5  ALA E 8   ? ALA P 753 . ? 1_555 ? 
56  BC4 3  ARG C 401 ? ARG C 432 . ? 1_555 ? 
57  BC4 3  SER C 403 ? SER C 434 . ? 1_555 ? 
58  BC4 3  GLN C 404 ? GLN C 435 . ? 1_555 ? 
59  BC5 4  HIS C 147 ? HIS C 178 . ? 1_555 ? 
60  BC5 4  ASP C 149 ? ASP C 180 . ? 1_555 ? 
61  BC5 4  HIS C 162 ? HIS C 193 . ? 1_555 ? 
62  BC5 4  HIS C 175 ? HIS C 206 . ? 1_555 ? 
63  BC6 4  CYS C 71  ? CYS C 102 . ? 1_555 ? 
64  BC6 4  HIS C 372 ? HIS C 403 . ? 1_555 ? 
65  BC6 4  HIS C 376 ? HIS C 407 . ? 1_555 ? 
66  BC6 4  HIS C 382 ? HIS C 413 . ? 1_555 ? 
67  BC7 6  ASP C 154 ? ASP C 185 . ? 1_555 ? 
68  BC7 6  GLY C 155 ? GLY C 186 . ? 1_555 ? 
69  BC7 6  ASP C 157 ? ASP C 188 . ? 1_555 ? 
70  BC7 6  LEU C 159 ? LEU C 190 . ? 1_555 ? 
71  BC7 6  ASP C 177 ? ASP C 208 . ? 1_555 ? 
72  BC7 6  GLU C 180 ? GLU C 211 . ? 1_555 ? 
73  BC8 4  ASP C 137 ? ASP C 168 . ? 1_555 ? 
74  BC8 4  GLY C 167 ? GLY C 198 . ? 1_555 ? 
75  BC8 4  GLY C 169 ? GLY C 200 . ? 1_555 ? 
76  BC8 4  GLY C 171 ? GLY C 202 . ? 1_555 ? 
77  BC9 3  THR B 276 ? THR B 307 . ? 1_555 ? 
78  BC9 3  GLY D 268 ? GLY D 299 . ? 1_555 ? 
79  BC9 3  THR D 269 ? THR D 300 . ? 1_555 ? 
80  CC1 4  HIS D 147 ? HIS D 178 . ? 1_555 ? 
81  CC1 4  ASP D 149 ? ASP D 180 . ? 1_555 ? 
82  CC1 4  HIS D 162 ? HIS D 193 . ? 1_555 ? 
83  CC1 4  HIS D 175 ? HIS D 206 . ? 1_555 ? 
84  CC2 4  CYS D 71  ? CYS D 102 . ? 1_555 ? 
85  CC2 4  HIS D 372 ? HIS D 403 . ? 1_555 ? 
86  CC2 4  HIS D 376 ? HIS D 407 . ? 1_555 ? 
87  CC2 4  HIS D 382 ? HIS D 413 . ? 1_555 ? 
88  CC3 6  ASP D 154 ? ASP D 185 . ? 1_555 ? 
89  CC3 6  GLY D 155 ? GLY D 186 . ? 1_555 ? 
90  CC3 6  ASP D 157 ? ASP D 188 . ? 1_555 ? 
91  CC3 6  LEU D 159 ? LEU D 190 . ? 1_555 ? 
92  CC3 6  ASP D 177 ? ASP D 208 . ? 1_555 ? 
93  CC3 6  GLU D 180 ? GLU D 211 . ? 1_555 ? 
94  CC4 4  ALA D 136 ? ALA D 167 . ? 1_555 ? 
95  CC4 4  ASP D 137 ? ASP D 168 . ? 1_555 ? 
96  CC4 4  GLY D 169 ? GLY D 200 . ? 1_555 ? 
97  CC4 4  GLY D 171 ? GLY D 202 . ? 1_555 ? 
98  CC5 14 GLY A 99  ? GLY A 130 . ? 1_555 ? 
99  CC5 14 TYR A 100 ? TYR A 131 . ? 1_555 ? 
100 CC5 14 PRO A 102 ? PRO A 133 . ? 1_555 ? 
101 CC5 14 ASP A 178 ? ASP A 209 . ? 1_555 ? 
102 CC5 14 HIS A 245 ? HIS A 276 . ? 1_555 ? 
103 CC5 14 GLU A 246 ? GLU A 277 . ? 1_555 ? 
104 CC5 14 ALA A 247 ? ALA A 278 . ? 1_555 ? 
105 CC5 14 PHE A 262 ? PHE A 293 . ? 1_555 ? 
106 CC5 14 ASP A 272 ? ASP A 303 . ? 1_555 ? 
107 CC5 14 SER A 273 ? SER A 304 . ? 1_555 ? 
108 CC5 14 ARG C 265 ? ARG C 296 . ? 1_555 ? 
109 CC5 14 GLY C 268 ? GLY C 299 . ? 1_555 ? 
110 CC5 14 SER C 270 ? SER C 301 . ? 1_555 ? 
111 CC5 14 SO4 R .   ? SO4 C 850 . ? 1_555 ? 
112 CC6 14 ARG B 265 ? ARG B 296 . ? 1_555 ? 
113 CC6 14 GLN B 267 ? GLN B 298 . ? 1_555 ? 
114 CC6 14 GLY B 268 ? GLY B 299 . ? 1_555 ? 
115 CC6 14 THR B 269 ? THR B 300 . ? 1_555 ? 
116 CC6 14 SER B 270 ? SER B 301 . ? 1_555 ? 
117 CC6 14 SO4 L .   ? SO4 B 852 . ? 1_555 ? 
118 CC6 14 PRO D 102 ? PRO D 133 . ? 1_555 ? 
119 CC6 14 ASP D 178 ? ASP D 209 . ? 1_555 ? 
120 CC6 14 HIS D 245 ? HIS D 276 . ? 1_555 ? 
121 CC6 14 GLU D 246 ? GLU D 277 . ? 1_555 ? 
122 CC6 14 ALA D 247 ? ALA D 278 . ? 1_555 ? 
123 CC6 14 PHE D 262 ? PHE D 293 . ? 1_555 ? 
124 CC6 14 SER D 273 ? SER D 304 . ? 1_555 ? 
125 CC6 14 THR D 275 ? THR D 306 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EAK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EAK 
_atom_sites.fract_transf_matrix[1][1]   0.008498 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006019 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005878 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A  1 1   ? 10.698  82.137  -4.774  1.00 89.07  ? 32   SER A N   1 
ATOM   2     C  CA  . SER A  1 1   ? 9.374   81.498  -4.551  1.00 89.23  ? 32   SER A CA  1 
ATOM   3     C  C   . SER A  1 1   ? 9.461   79.995  -4.327  1.00 88.89  ? 32   SER A C   1 
ATOM   4     O  O   . SER A  1 1   ? 8.796   79.452  -3.446  1.00 89.31  ? 32   SER A O   1 
ATOM   5     C  CB  . SER A  1 1   ? 8.424   81.789  -5.712  1.00 89.27  ? 32   SER A CB  1 
ATOM   6     O  OG  . SER A  1 1   ? 7.186   81.122  -5.539  1.00 88.45  ? 32   SER A OG  1 
ATOM   7     N  N   . PRO A  1 2   ? 10.288  79.306  -5.111  1.00 87.58  ? 33   PRO A N   1 
ATOM   8     C  CA  . PRO A  1 2   ? 10.410  77.846  -5.052  1.00 85.89  ? 33   PRO A CA  1 
ATOM   9     C  C   . PRO A  1 2   ? 11.055  77.312  -3.784  1.00 84.16  ? 33   PRO A C   1 
ATOM   10    O  O   . PRO A  1 2   ? 12.071  77.842  -3.329  1.00 85.06  ? 33   PRO A O   1 
ATOM   11    C  CB  . PRO A  1 2   ? 11.449  77.514  -6.113  1.00 85.45  ? 33   PRO A CB  1 
ATOM   12    C  CG  . PRO A  1 2   ? 11.496  78.701  -6.992  1.00 85.44  ? 33   PRO A CG  1 
ATOM   13    C  CD  . PRO A  1 2   ? 11.168  79.885  -6.134  1.00 85.94  ? 33   PRO A CD  1 
ATOM   14    N  N   . ILE A  1 3   ? 10.462  76.260  -3.254  1.00 80.94  ? 34   ILE A N   1 
ATOM   15    C  CA  . ILE A  1 3   ? 10.998  75.522  -2.116  1.00 77.59  ? 34   ILE A CA  1 
ATOM   16    C  C   . ILE A  1 3   ? 11.141  74.080  -2.575  1.00 75.78  ? 34   ILE A C   1 
ATOM   17    O  O   . ILE A  1 3   ? 10.187  73.306  -2.508  1.00 74.70  ? 34   ILE A O   1 
ATOM   18    C  CB  . ILE A  1 3   ? 10.073  75.646  -0.890  1.00 76.89  ? 34   ILE A CB  1 
ATOM   19    C  CG1 . ILE A  1 3   ? 10.386  74.557  0.138   1.00 76.21  ? 34   ILE A CG1 1 
ATOM   20    C  CG2 . ILE A  1 3   ? 8.617   75.575  -1.323  1.00 77.77  ? 34   ILE A CG2 1 
ATOM   21    C  CD1 . ILE A  1 3   ? 9.434   74.541  1.316   1.00 75.31  ? 34   ILE A CD1 1 
ATOM   22    N  N   . ILE A  1 4   ? 12.325  73.733  -3.068  1.00 74.87  ? 35   ILE A N   1 
ATOM   23    C  CA  . ILE A  1 4   ? 12.545  72.418  -3.655  1.00 73.84  ? 35   ILE A CA  1 
ATOM   24    C  C   . ILE A  1 4   ? 13.223  71.434  -2.722  1.00 73.64  ? 35   ILE A C   1 
ATOM   25    O  O   . ILE A  1 4   ? 13.785  71.819  -1.697  1.00 73.28  ? 35   ILE A O   1 
ATOM   26    C  CB  . ILE A  1 4   ? 13.412  72.499  -4.934  1.00 73.49  ? 35   ILE A CB  1 
ATOM   27    C  CG1 . ILE A  1 4   ? 14.901  72.583  -4.578  1.00 72.71  ? 35   ILE A CG1 1 
ATOM   28    C  CG2 . ILE A  1 4   ? 13.000  73.686  -5.791  1.00 74.28  ? 35   ILE A CG2 1 
ATOM   29    C  CD1 . ILE A  1 4   ? 15.826  72.428  -5.768  1.00 71.81  ? 35   ILE A CD1 1 
ATOM   30    N  N   . LYS A  1 5   ? 13.139  70.169  -3.113  1.00 73.86  ? 36   LYS A N   1 
ATOM   31    C  CA  . LYS A  1 5   ? 13.790  69.098  -2.387  1.00 73.89  ? 36   LYS A CA  1 
ATOM   32    C  C   . LYS A  1 5   ? 15.165  68.861  -3.008  1.00 73.21  ? 36   LYS A C   1 
ATOM   33    O  O   . LYS A  1 5   ? 15.268  68.590  -4.204  1.00 73.43  ? 36   LYS A O   1 
ATOM   34    C  CB  . LYS A  1 5   ? 12.918  67.837  -2.406  1.00 74.50  ? 36   LYS A CB  1 
ATOM   35    C  CG  . LYS A  1 5   ? 13.614  66.596  -2.945  1.00 75.32  ? 36   LYS A CG  1 
ATOM   36    C  CD  . LYS A  1 5   ? 12.606  65.519  -3.323  1.00 76.60  ? 36   LYS A CD  1 
ATOM   37    C  CE  . LYS A  1 5   ? 13.204  64.515  -4.296  1.00 77.35  ? 36   LYS A CE  1 
ATOM   38    N  NZ  . LYS A  1 5   ? 13.387  65.098  -5.654  1.00 78.26  ? 36   LYS A NZ  1 
ATOM   39    N  N   . PHE A  1 6   ? 16.208  69.051  -2.211  1.00 71.95  ? 37   PHE A N   1 
ATOM   40    C  CA  . PHE A  1 6   ? 17.553  68.904  -2.748  1.00 69.97  ? 37   PHE A CA  1 
ATOM   41    C  C   . PHE A  1 6   ? 17.907  67.469  -3.082  1.00 68.81  ? 37   PHE A C   1 
ATOM   42    O  O   . PHE A  1 6   ? 17.549  66.542  -2.359  1.00 68.87  ? 37   PHE A O   1 
ATOM   43    C  CB  . PHE A  1 6   ? 18.577  69.465  -1.757  1.00 70.00  ? 37   PHE A CB  1 
ATOM   44    C  CG  . PHE A  1 6   ? 18.615  70.968  -1.819  1.00 70.01  ? 37   PHE A CG  1 
ATOM   45    C  CD1 . PHE A  1 6   ? 18.986  71.605  -2.989  1.00 70.41  ? 37   PHE A CD1 1 
ATOM   46    C  CD2 . PHE A  1 6   ? 18.271  71.720  -0.714  1.00 69.66  ? 37   PHE A CD2 1 
ATOM   47    C  CE1 . PHE A  1 6   ? 19.021  72.984  -3.055  1.00 69.80  ? 37   PHE A CE1 1 
ATOM   48    C  CE2 . PHE A  1 6   ? 18.305  73.099  -0.772  1.00 69.46  ? 37   PHE A CE2 1 
ATOM   49    C  CZ  . PHE A  1 6   ? 18.677  73.723  -1.943  1.00 70.42  ? 37   PHE A CZ  1 
ATOM   50    N  N   . PRO A  1 7   ? 18.679  67.306  -4.151  1.00 66.90  ? 38   PRO A N   1 
ATOM   51    C  CA  . PRO A  1 7   ? 19.137  66.002  -4.578  1.00 65.43  ? 38   PRO A CA  1 
ATOM   52    C  C   . PRO A  1 7   ? 20.120  65.408  -3.584  1.00 64.27  ? 38   PRO A C   1 
ATOM   53    O  O   . PRO A  1 7   ? 21.328  65.472  -3.823  1.00 64.55  ? 38   PRO A O   1 
ATOM   54    C  CB  . PRO A  1 7   ? 19.849  66.274  -5.903  1.00 65.11  ? 38   PRO A CB  1 
ATOM   55    C  CG  . PRO A  1 7   ? 20.255  67.703  -5.828  1.00 66.37  ? 38   PRO A CG  1 
ATOM   56    C  CD  . PRO A  1 7   ? 19.166  68.386  -5.040  1.00 67.03  ? 38   PRO A CD  1 
ATOM   57    N  N   . GLY A  1 8   ? 19.666  64.815  -2.486  1.00 63.77  ? 39   GLY A N   1 
ATOM   58    C  CA  . GLY A  1 8   ? 20.569  64.203  -1.537  1.00 64.96  ? 39   GLY A CA  1 
ATOM   59    C  C   . GLY A  1 8   ? 20.205  64.382  -0.069  1.00 67.84  ? 39   GLY A C   1 
ATOM   60    O  O   . GLY A  1 8   ? 20.808  63.757  0.805   1.00 66.92  ? 39   GLY A O   1 
ATOM   61    N  N   . ASP A  1 9   ? 19.220  65.202  0.239   1.00 71.17  ? 40   ASP A N   1 
ATOM   62    C  CA  . ASP A  1 9   ? 18.923  65.489  1.637   1.00 74.38  ? 40   ASP A CA  1 
ATOM   63    C  C   . ASP A  1 9   ? 18.258  64.350  2.410   1.00 75.26  ? 40   ASP A C   1 
ATOM   64    O  O   . ASP A  1 9   ? 17.494  63.557  1.848   1.00 75.53  ? 40   ASP A O   1 
ATOM   65    C  CB  . ASP A  1 9   ? 18.085  66.749  1.783   1.00 76.11  ? 40   ASP A CB  1 
ATOM   66    C  CG  . ASP A  1 9   ? 18.805  67.780  2.627   1.00 79.58  ? 40   ASP A CG  1 
ATOM   67    O  OD1 . ASP A  1 9   ? 19.437  67.385  3.633   1.00 80.00  ? 40   ASP A OD1 1 
ATOM   68    O  OD2 . ASP A  1 9   ? 18.748  68.975  2.280   1.00 83.96  ? 40   ASP A OD2 1 
ATOM   69    N  N   . VAL A  1 10  ? 18.605  64.344  3.701   1.00 75.91  ? 41   VAL A N   1 
ATOM   70    C  CA  . VAL A  1 10  ? 18.091  63.399  4.675   1.00 76.01  ? 41   VAL A CA  1 
ATOM   71    C  C   . VAL A  1 10  ? 16.590  63.595  4.822   1.00 75.95  ? 41   VAL A C   1 
ATOM   72    O  O   . VAL A  1 10  ? 16.130  64.695  5.145   1.00 76.74  ? 41   VAL A O   1 
ATOM   73    C  CB  . VAL A  1 10  ? 18.844  63.566  6.013   1.00 75.63  ? 41   VAL A CB  1 
ATOM   74    C  CG1 . VAL A  1 10  ? 18.458  62.474  6.994   1.00 75.20  ? 41   VAL A CG1 1 
ATOM   75    C  CG2 . VAL A  1 10  ? 20.350  63.569  5.773   1.00 76.70  ? 41   VAL A CG2 1 
ATOM   76    N  N   . ALA A  1 11  ? 15.858  62.521  4.570   1.00 75.15  ? 42   ALA A N   1 
ATOM   77    C  CA  . ALA A  1 11  ? 14.461  62.373  4.358   1.00 73.89  ? 42   ALA A CA  1 
ATOM   78    C  C   . ALA A  1 11  ? 13.811  62.591  5.705   1.00 72.32  ? 42   ALA A C   1 
ATOM   79    O  O   . ALA A  1 11  ? 14.043  61.841  6.649   1.00 73.07  ? 42   ALA A O   1 
ATOM   80    C  CB  . ALA A  1 11  ? 14.006  61.045  3.773   1.00 74.67  ? 42   ALA A CB  1 
ATOM   81    N  N   . PRO A  1 12  ? 12.993  63.637  5.813   1.00 69.87  ? 43   PRO A N   1 
ATOM   82    C  CA  . PRO A  1 12  ? 12.274  63.934  7.041   1.00 69.45  ? 43   PRO A CA  1 
ATOM   83    C  C   . PRO A  1 12  ? 11.226  62.858  7.316   1.00 69.40  ? 43   PRO A C   1 
ATOM   84    O  O   . PRO A  1 12  ? 10.493  62.478  6.402   1.00 69.55  ? 43   PRO A O   1 
ATOM   85    C  CB  . PRO A  1 12  ? 11.513  65.221  6.716   1.00 69.23  ? 43   PRO A CB  1 
ATOM   86    C  CG  . PRO A  1 12  ? 12.225  65.786  5.545   1.00 69.29  ? 43   PRO A CG  1 
ATOM   87    C  CD  . PRO A  1 12  ? 12.702  64.605  4.756   1.00 69.12  ? 43   PRO A CD  1 
ATOM   88    N  N   . LYS A  1 13  ? 11.175  62.359  8.539   1.00 68.75  ? 44   LYS A N   1 
ATOM   89    C  CA  . LYS A  1 13  ? 10.185  61.316  8.833   1.00 68.09  ? 44   LYS A CA  1 
ATOM   90    C  C   . LYS A  1 13  ? 8.803   61.935  8.984   1.00 67.89  ? 44   LYS A C   1 
ATOM   91    O  O   . LYS A  1 13  ? 8.684   63.141  9.206   1.00 68.79  ? 44   LYS A O   1 
ATOM   92    C  CB  . LYS A  1 13  ? 10.607  60.554  10.084  1.00 67.97  ? 44   LYS A CB  1 
ATOM   93    C  CG  . LYS A  1 13  ? 11.212  61.434  11.165  1.00 68.43  ? 44   LYS A CG  1 
ATOM   94    C  CD  . LYS A  1 13  ? 12.593  60.956  11.581  1.00 68.46  ? 44   LYS A CD  1 
ATOM   95    C  CE  . LYS A  1 13  ? 13.414  62.079  12.194  1.00 68.35  ? 44   LYS A CE  1 
ATOM   96    N  NZ  . LYS A  1 13  ? 14.865  61.749  12.246  1.00 65.01  ? 44   LYS A NZ  1 
ATOM   97    N  N   . THR A  1 14  ? 7.763   61.121  8.826   1.00 66.97  ? 45   THR A N   1 
ATOM   98    C  CA  . THR A  1 14  ? 6.395   61.593  8.957   1.00 65.99  ? 45   THR A CA  1 
ATOM   99    C  C   . THR A  1 14  ? 6.077   61.945  10.410  1.00 66.06  ? 45   THR A C   1 
ATOM   100   O  O   . THR A  1 14  ? 6.459   61.228  11.332  1.00 66.50  ? 45   THR A O   1 
ATOM   101   C  CB  . THR A  1 14  ? 5.344   60.559  8.512   1.00 64.90  ? 45   THR A CB  1 
ATOM   102   O  OG1 . THR A  1 14  ? 5.202   59.556  9.521   1.00 64.45  ? 45   THR A OG1 1 
ATOM   103   C  CG2 . THR A  1 14  ? 5.687   59.932  7.183   1.00 65.76  ? 45   THR A CG2 1 
ATOM   104   N  N   . ASP A  1 15  ? 5.242   62.962  10.580  1.00 65.55  ? 46   ASP A N   1 
ATOM   105   C  CA  . ASP A  1 15  ? 4.786   63.361  11.907  1.00 65.55  ? 46   ASP A CA  1 
ATOM   106   C  C   . ASP A  1 15  ? 4.376   62.144  12.729  1.00 64.13  ? 46   ASP A C   1 
ATOM   107   O  O   . ASP A  1 15  ? 4.612   62.076  13.934  1.00 64.33  ? 46   ASP A O   1 
ATOM   108   C  CB  . ASP A  1 15  ? 3.612   64.335  11.769  1.00 67.74  ? 46   ASP A CB  1 
ATOM   109   C  CG  . ASP A  1 15  ? 4.032   65.784  11.915  1.00 70.04  ? 46   ASP A CG  1 
ATOM   110   O  OD1 . ASP A  1 15  ? 4.048   66.251  13.072  1.00 71.05  ? 46   ASP A OD1 1 
ATOM   111   O  OD2 . ASP A  1 15  ? 4.339   66.435  10.898  1.00 71.33  ? 46   ASP A OD2 1 
ATOM   112   N  N   . LYS A  1 16  ? 3.762   61.160  12.083  1.00 62.29  ? 47   LYS A N   1 
ATOM   113   C  CA  . LYS A  1 16  ? 3.336   59.940  12.744  1.00 60.78  ? 47   LYS A CA  1 
ATOM   114   C  C   . LYS A  1 16  ? 4.514   59.089  13.203  1.00 58.58  ? 47   LYS A C   1 
ATOM   115   O  O   . LYS A  1 16  ? 4.689   58.840  14.391  1.00 58.80  ? 47   LYS A O   1 
ATOM   116   C  CB  . LYS A  1 16  ? 2.452   59.093  11.825  1.00 62.62  ? 47   LYS A CB  1 
ATOM   117   C  CG  . LYS A  1 16  ? 1.306   59.836  11.170  1.00 66.40  ? 47   LYS A CG  1 
ATOM   118   C  CD  . LYS A  1 16  ? 0.472   58.924  10.283  1.00 69.52  ? 47   LYS A CD  1 
ATOM   119   C  CE  . LYS A  1 16  ? -0.991  59.338  10.264  1.00 70.65  ? 47   LYS A CE  1 
ATOM   120   N  NZ  . LYS A  1 16  ? -1.892  58.164  10.076  1.00 70.40  ? 47   LYS A NZ  1 
ATOM   121   N  N   . GLU A  1 17  ? 5.332   58.656  12.246  1.00 55.23  ? 48   GLU A N   1 
ATOM   122   C  CA  . GLU A  1 17  ? 6.477   57.808  12.543  1.00 51.40  ? 48   GLU A CA  1 
ATOM   123   C  C   . GLU A  1 17  ? 7.497   58.527  13.414  1.00 48.30  ? 48   GLU A C   1 
ATOM   124   O  O   . GLU A  1 17  ? 8.347   57.907  14.043  1.00 47.67  ? 48   GLU A O   1 
ATOM   125   C  CB  . GLU A  1 17  ? 7.112   57.287  11.262  1.00 51.55  ? 48   GLU A CB  1 
ATOM   126   C  CG  . GLU A  1 17  ? 7.621   58.374  10.337  1.00 52.82  ? 48   GLU A CG  1 
ATOM   127   C  CD  . GLU A  1 17  ? 7.798   57.891  8.913   1.00 53.85  ? 48   GLU A CD  1 
ATOM   128   O  OE1 . GLU A  1 17  ? 7.453   56.730  8.624   1.00 55.04  ? 48   GLU A OE1 1 
ATOM   129   O  OE2 . GLU A  1 17  ? 8.282   58.674  8.070   1.00 53.72  ? 48   GLU A OE2 1 
ATOM   130   N  N   . LEU A  1 18  ? 7.388   59.845  13.470  1.00 44.76  ? 49   LEU A N   1 
ATOM   131   C  CA  . LEU A  1 18  ? 8.208   60.662  14.348  1.00 42.78  ? 49   LEU A CA  1 
ATOM   132   C  C   . LEU A  1 18  ? 7.686   60.569  15.784  1.00 41.72  ? 49   LEU A C   1 
ATOM   133   O  O   . LEU A  1 18  ? 8.460   60.487  16.736  1.00 41.09  ? 49   LEU A O   1 
ATOM   134   C  CB  . LEU A  1 18  ? 8.189   62.109  13.873  1.00 42.87  ? 49   LEU A CB  1 
ATOM   135   C  CG  . LEU A  1 18  ? 8.799   63.183  14.759  1.00 43.61  ? 49   LEU A CG  1 
ATOM   136   C  CD1 . LEU A  1 18  ? 10.258  62.889  15.074  1.00 44.16  ? 49   LEU A CD1 1 
ATOM   137   C  CD2 . LEU A  1 18  ? 8.710   64.539  14.073  1.00 44.39  ? 49   LEU A CD2 1 
ATOM   138   N  N   . ALA A  1 19  ? 6.362   60.545  15.921  1.00 40.13  ? 50   ALA A N   1 
ATOM   139   C  CA  . ALA A  1 19  ? 5.752   60.468  17.242  1.00 39.70  ? 50   ALA A CA  1 
ATOM   140   C  C   . ALA A  1 19  ? 5.893   59.068  17.818  1.00 39.36  ? 50   ALA A C   1 
ATOM   141   O  O   . ALA A  1 19  ? 5.974   58.840  19.024  1.00 38.53  ? 50   ALA A O   1 
ATOM   142   C  CB  . ALA A  1 19  ? 4.296   60.891  17.189  1.00 39.79  ? 50   ALA A CB  1 
ATOM   143   N  N   . VAL A  1 20  ? 5.901   58.079  16.936  1.00 39.86  ? 51   VAL A N   1 
ATOM   144   C  CA  . VAL A  1 20  ? 5.997   56.689  17.376  1.00 41.75  ? 51   VAL A CA  1 
ATOM   145   C  C   . VAL A  1 20  ? 7.366   56.376  17.949  1.00 42.21  ? 51   VAL A C   1 
ATOM   146   O  O   . VAL A  1 20  ? 7.512   55.720  18.981  1.00 43.34  ? 51   VAL A O   1 
ATOM   147   C  CB  . VAL A  1 20  ? 5.687   55.734  16.212  1.00 42.39  ? 51   VAL A CB  1 
ATOM   148   C  CG1 . VAL A  1 20  ? 6.333   54.373  16.401  1.00 40.70  ? 51   VAL A CG1 1 
ATOM   149   C  CG2 . VAL A  1 20  ? 4.178   55.607  16.045  1.00 44.14  ? 51   VAL A CG2 1 
ATOM   150   N  N   . GLN A  1 21  ? 8.403   56.842  17.260  1.00 41.64  ? 52   GLN A N   1 
ATOM   151   C  CA  . GLN A  1 21  ? 9.768   56.598  17.714  1.00 40.30  ? 52   GLN A CA  1 
ATOM   152   C  C   . GLN A  1 21  ? 10.082  57.412  18.961  1.00 38.02  ? 52   GLN A C   1 
ATOM   153   O  O   . GLN A  1 21  ? 10.850  56.984  19.817  1.00 36.71  ? 52   GLN A O   1 
ATOM   154   C  CB  . GLN A  1 21  ? 10.749  56.894  16.589  1.00 42.00  ? 52   GLN A CB  1 
ATOM   155   C  CG  . GLN A  1 21  ? 12.173  56.463  16.857  1.00 48.39  ? 52   GLN A CG  1 
ATOM   156   C  CD  . GLN A  1 21  ? 12.355  54.966  16.975  1.00 51.93  ? 52   GLN A CD  1 
ATOM   157   O  OE1 . GLN A  1 21  ? 13.485  54.474  17.122  1.00 51.97  ? 52   GLN A OE1 1 
ATOM   158   N  NE2 . GLN A  1 21  ? 11.273  54.192  16.910  1.00 51.10  ? 52   GLN A NE2 1 
ATOM   159   N  N   . TYR A  1 22  ? 9.444   58.576  19.080  1.00 35.38  ? 53   TYR A N   1 
ATOM   160   C  CA  . TYR A  1 22  ? 9.671   59.463  20.218  1.00 33.25  ? 53   TYR A CA  1 
ATOM   161   C  C   . TYR A  1 22  ? 9.021   58.912  21.477  1.00 32.90  ? 53   TYR A C   1 
ATOM   162   O  O   . TYR A  1 22  ? 9.646   58.846  22.535  1.00 32.81  ? 53   TYR A O   1 
ATOM   163   C  CB  . TYR A  1 22  ? 9.175   60.873  19.955  1.00 30.16  ? 53   TYR A CB  1 
ATOM   164   C  CG  . TYR A  1 22  ? 9.639   61.951  20.911  1.00 28.80  ? 53   TYR A CG  1 
ATOM   165   C  CD1 . TYR A  1 22  ? 9.001   62.158  22.129  1.00 26.63  ? 53   TYR A CD1 1 
ATOM   166   C  CD2 . TYR A  1 22  ? 10.702  62.781  20.583  1.00 26.13  ? 53   TYR A CD2 1 
ATOM   167   C  CE1 . TYR A  1 22  ? 9.416   63.156  22.995  1.00 26.72  ? 53   TYR A CE1 1 
ATOM   168   C  CE2 . TYR A  1 22  ? 11.124  63.778  21.439  1.00 23.96  ? 53   TYR A CE2 1 
ATOM   169   C  CZ  . TYR A  1 22  ? 10.479  63.962  22.643  1.00 26.54  ? 53   TYR A CZ  1 
ATOM   170   O  OH  . TYR A  1 22  ? 10.904  64.955  23.495  1.00 24.10  ? 53   TYR A OH  1 
ATOM   171   N  N   . LEU A  1 23  ? 7.761   58.521  21.360  1.00 33.42  ? 54   LEU A N   1 
ATOM   172   C  CA  . LEU A  1 23  ? 7.051   57.951  22.492  1.00 33.08  ? 54   LEU A CA  1 
ATOM   173   C  C   . LEU A  1 23  ? 7.657   56.611  22.869  1.00 33.84  ? 54   LEU A C   1 
ATOM   174   O  O   . LEU A  1 23  ? 7.715   56.248  24.043  1.00 33.92  ? 54   LEU A O   1 
ATOM   175   C  CB  . LEU A  1 23  ? 5.570   57.799  22.162  1.00 33.17  ? 54   LEU A CB  1 
ATOM   176   C  CG  . LEU A  1 23  ? 4.769   59.093  22.049  1.00 32.76  ? 54   LEU A CG  1 
ATOM   177   C  CD1 . LEU A  1 23  ? 3.281   58.791  22.000  1.00 32.87  ? 54   LEU A CD1 1 
ATOM   178   C  CD2 . LEU A  1 23  ? 5.092   60.024  23.207  1.00 32.10  ? 54   LEU A CD2 1 
ATOM   179   N  N   . ASN A  1 24  ? 8.109   55.886  21.859  1.00 34.01  ? 55   ASN A N   1 
ATOM   180   C  CA  . ASN A  1 24  ? 8.718   54.588  22.068  1.00 34.15  ? 55   ASN A CA  1 
ATOM   181   C  C   . ASN A  1 24  ? 10.082  54.709  22.741  1.00 32.35  ? 55   ASN A C   1 
ATOM   182   O  O   . ASN A  1 24  ? 10.445  53.886  23.580  1.00 30.87  ? 55   ASN A O   1 
ATOM   183   C  CB  . ASN A  1 24  ? 8.867   53.847  20.740  1.00 37.76  ? 55   ASN A CB  1 
ATOM   184   C  CG  . ASN A  1 24  ? 9.959   52.799  20.793  1.00 43.69  ? 55   ASN A CG  1 
ATOM   185   O  OD1 . ASN A  1 24  ? 11.113  53.073  20.466  1.00 46.50  ? 55   ASN A OD1 1 
ATOM   186   N  ND2 . ASN A  1 24  ? 9.595   51.593  21.213  1.00 45.82  ? 55   ASN A ND2 1 
ATOM   187   N  N   . THR A  1 25  ? 10.834  55.742  22.373  1.00 30.69  ? 56   THR A N   1 
ATOM   188   C  CA  . THR A  1 25  ? 12.178  55.932  22.913  1.00 28.01  ? 56   THR A CA  1 
ATOM   189   C  C   . THR A  1 25  ? 12.190  56.663  24.253  1.00 27.01  ? 56   THR A C   1 
ATOM   190   O  O   . THR A  1 25  ? 12.931  56.294  25.166  1.00 25.61  ? 56   THR A O   1 
ATOM   191   C  CB  . THR A  1 25  ? 13.067  56.728  21.954  1.00 27.95  ? 56   THR A CB  1 
ATOM   192   O  OG1 . THR A  1 25  ? 13.221  56.006  20.727  1.00 28.03  ? 56   THR A OG1 1 
ATOM   193   C  CG2 . THR A  1 25  ? 14.432  56.979  22.577  1.00 25.59  ? 56   THR A CG2 1 
ATOM   194   N  N   . PHE A  1 26  ? 11.373  57.702  24.381  1.00 28.04  ? 57   PHE A N   1 
ATOM   195   C  CA  . PHE A  1 26  ? 11.375  58.501  25.601  1.00 29.33  ? 57   PHE A CA  1 
ATOM   196   C  C   . PHE A  1 26  ? 10.171  58.251  26.485  1.00 31.28  ? 57   PHE A C   1 
ATOM   197   O  O   . PHE A  1 26  ? 10.155  58.639  27.653  1.00 31.86  ? 57   PHE A O   1 
ATOM   198   C  CB  . PHE A  1 26  ? 11.457  59.981  25.262  1.00 28.53  ? 57   PHE A CB  1 
ATOM   199   C  CG  . PHE A  1 26  ? 12.597  60.293  24.354  1.00 28.91  ? 57   PHE A CG  1 
ATOM   200   C  CD1 . PHE A  1 26  ? 13.893  60.045  24.759  1.00 28.74  ? 57   PHE A CD1 1 
ATOM   201   C  CD2 . PHE A  1 26  ? 12.369  60.823  23.098  1.00 27.96  ? 57   PHE A CD2 1 
ATOM   202   C  CE1 . PHE A  1 26  ? 14.954  60.326  23.922  1.00 28.67  ? 57   PHE A CE1 1 
ATOM   203   C  CE2 . PHE A  1 26  ? 13.424  61.105  22.255  1.00 27.69  ? 57   PHE A CE2 1 
ATOM   204   C  CZ  . PHE A  1 26  ? 14.719  60.857  22.667  1.00 28.46  ? 57   PHE A CZ  1 
ATOM   205   N  N   . TYR A  1 27  ? 9.140   57.608  25.965  1.00 33.32  ? 58   TYR A N   1 
ATOM   206   C  CA  . TYR A  1 27  ? 7.992   57.366  26.809  1.00 35.75  ? 58   TYR A CA  1 
ATOM   207   C  C   . TYR A  1 27  ? 7.880   55.866  27.157  1.00 35.58  ? 58   TYR A C   1 
ATOM   208   O  O   . TYR A  1 27  ? 7.314   55.484  28.165  1.00 33.93  ? 58   TYR A O   1 
ATOM   209   C  CB  . TYR A  1 27  ? 6.780   58.100  26.239  1.00 38.59  ? 58   TYR A CB  1 
ATOM   210   C  CG  . TYR A  1 27  ? 6.864   59.601  26.528  1.00 40.02  ? 58   TYR A CG  1 
ATOM   211   C  CD1 . TYR A  1 27  ? 6.443   60.135  27.748  1.00 40.12  ? 58   TYR A CD1 1 
ATOM   212   C  CD2 . TYR A  1 27  ? 7.388   60.492  25.594  1.00 42.49  ? 58   TYR A CD2 1 
ATOM   213   C  CE1 . TYR A  1 27  ? 6.542   61.490  28.025  1.00 44.16  ? 58   TYR A CE1 1 
ATOM   214   C  CE2 . TYR A  1 27  ? 7.489   61.850  25.863  1.00 45.07  ? 58   TYR A CE2 1 
ATOM   215   C  CZ  . TYR A  1 27  ? 7.066   62.343  27.079  1.00 45.84  ? 58   TYR A CZ  1 
ATOM   216   O  OH  . TYR A  1 27  ? 7.168   63.691  27.349  1.00 50.17  ? 58   TYR A OH  1 
ATOM   217   N  N   . GLY A  1 28  ? 8.395   54.906  26.384  1.00 35.95  ? 59   GLY A N   1 
ATOM   218   C  CA  . GLY A  1 28  ? 7.930   53.522  26.496  1.00 37.50  ? 59   GLY A CA  1 
ATOM   219   C  C   . GLY A  1 28  ? 6.755   52.933  25.772  1.00 39.43  ? 59   GLY A C   1 
ATOM   220   O  O   . GLY A  1 28  ? 6.397   51.766  26.070  1.00 40.26  ? 59   GLY A O   1 
ATOM   221   N  N   . CYS A  1 29  ? 6.182   53.661  24.877  1.00 41.58  ? 60   CYS A N   1 
ATOM   222   C  CA  . CYS A  1 29  ? 5.094   53.140  24.088  1.00 43.40  ? 60   CYS A CA  1 
ATOM   223   C  C   . CYS A  1 29  ? 5.559   51.888  23.364  1.00 44.54  ? 60   CYS A C   1 
ATOM   224   O  O   . CYS A  1 29  ? 6.572   51.888  22.670  1.00 45.18  ? 60   CYS A O   1 
ATOM   225   C  CB  . CYS A  1 29  ? 4.616   54.216  23.111  1.00 44.50  ? 60   CYS A CB  1 
ATOM   226   S  SG  . CYS A  1 29  ? 2.954   53.944  22.431  1.00 47.60  ? 60   CYS A SG  1 
ATOM   227   N  N   . PRO A  1 30  ? 4.871   50.778  23.586  1.00 46.44  ? 61   PRO A N   1 
ATOM   228   C  CA  . PRO A  1 30  ? 5.175   49.486  23.000  1.00 46.97  ? 61   PRO A CA  1 
ATOM   229   C  C   . PRO A  1 30  ? 5.680   49.570  21.582  1.00 47.42  ? 61   PRO A C   1 
ATOM   230   O  O   . PRO A  1 30  ? 4.980   49.882  20.625  1.00 48.29  ? 61   PRO A O   1 
ATOM   231   C  CB  . PRO A  1 30  ? 3.854   48.734  23.124  1.00 47.53  ? 61   PRO A CB  1 
ATOM   232   C  CG  . PRO A  1 30  ? 3.272   49.249  24.398  1.00 47.92  ? 61   PRO A CG  1 
ATOM   233   C  CD  . PRO A  1 30  ? 3.663   50.696  24.453  1.00 47.95  ? 61   PRO A CD  1 
ATOM   234   N  N   . LYS A  1 31  ? 6.957   49.264  21.397  1.00 48.67  ? 62   LYS A N   1 
ATOM   235   C  CA  . LYS A  1 31  ? 7.621   49.331  20.116  1.00 49.79  ? 62   LYS A CA  1 
ATOM   236   C  C   . LYS A  1 31  ? 6.741   48.996  18.931  1.00 49.70  ? 62   LYS A C   1 
ATOM   237   O  O   . LYS A  1 31  ? 6.769   49.706  17.921  1.00 49.86  ? 62   LYS A O   1 
ATOM   238   C  CB  . LYS A  1 31  ? 8.885   48.467  20.106  1.00 51.11  ? 62   LYS A CB  1 
ATOM   239   C  CG  . LYS A  1 31  ? 9.637   48.450  21.430  1.00 51.96  ? 62   LYS A CG  1 
ATOM   240   C  CD  . LYS A  1 31  ? 9.020   47.468  22.415  1.00 52.01  ? 62   LYS A CD  1 
ATOM   241   C  CE  . LYS A  1 31  ? 9.526   47.706  23.828  1.00 51.00  ? 62   LYS A CE  1 
ATOM   242   N  NZ  . LYS A  1 31  ? 11.015  47.638  23.891  1.00 50.32  ? 62   LYS A NZ  1 
ATOM   243   N  N   . GLU A  1 32  ? 6.001   47.893  18.994  1.00 50.48  ? 63   GLU A N   1 
ATOM   244   C  CA  . GLU A  1 32  ? 5.164   47.469  17.885  1.00 50.57  ? 63   GLU A CA  1 
ATOM   245   C  C   . GLU A  1 32  ? 3.678   47.651  18.146  1.00 50.49  ? 63   GLU A C   1 
ATOM   246   O  O   . GLU A  1 32  ? 2.886   47.631  17.205  1.00 50.13  ? 63   GLU A O   1 
ATOM   247   C  CB  . GLU A  1 32  ? 5.427   46.011  17.518  1.00 50.24  ? 63   GLU A CB  1 
ATOM   248   C  CG  . GLU A  1 32  ? 6.881   45.605  17.611  1.00 51.13  ? 63   GLU A CG  1 
ATOM   249   C  CD  . GLU A  1 32  ? 7.044   44.101  17.741  1.00 53.01  ? 63   GLU A CD  1 
ATOM   250   O  OE1 . GLU A  1 32  ? 6.566   43.532  18.746  1.00 51.85  ? 63   GLU A OE1 1 
ATOM   251   O  OE2 . GLU A  1 32  ? 7.652   43.513  16.821  1.00 53.99  ? 63   GLU A OE2 1 
ATOM   252   N  N   . SER A  1 33  ? 3.302   47.806  19.401  1.00 51.10  ? 64   SER A N   1 
ATOM   253   C  CA  . SER A  1 33  ? 1.899   47.984  19.763  1.00 52.58  ? 64   SER A CA  1 
ATOM   254   C  C   . SER A  1 33  ? 1.614   49.408  20.216  1.00 53.17  ? 64   SER A C   1 
ATOM   255   O  O   . SER A  1 33  ? 0.897   49.643  21.184  1.00 51.85  ? 64   SER A O   1 
ATOM   256   C  CB  . SER A  1 33  ? 1.531   46.983  20.861  1.00 53.53  ? 64   SER A CB  1 
ATOM   257   O  OG  . SER A  1 33  ? 2.717   46.416  21.402  1.00 55.28  ? 64   SER A OG  1 
ATOM   258   N  N   . CYS A  1 34  ? 2.198   50.367  19.508  1.00 55.25  ? 65   CYS A N   1 
ATOM   259   C  CA  . CYS A  1 34  ? 1.995   51.783  19.821  1.00 58.06  ? 65   CYS A CA  1 
ATOM   260   C  C   . CYS A  1 34  ? 1.032   52.385  18.795  1.00 62.47  ? 65   CYS A C   1 
ATOM   261   O  O   . CYS A  1 34  ? 1.348   53.337  18.091  1.00 63.08  ? 65   CYS A O   1 
ATOM   262   C  CB  . CYS A  1 34  ? 3.325   52.535  19.783  1.00 54.56  ? 65   CYS A CB  1 
ATOM   263   S  SG  . CYS A  1 34  ? 3.264   54.216  20.432  1.00 49.08  ? 65   CYS A SG  1 
ATOM   264   N  N   . ASN A  1 35  ? -0.118  51.731  18.667  1.00 66.88  ? 66   ASN A N   1 
ATOM   265   C  CA  . ASN A  1 35  ? -1.142  52.134  17.717  1.00 70.09  ? 66   ASN A CA  1 
ATOM   266   C  C   . ASN A  1 35  ? -2.191  52.972  18.437  1.00 71.88  ? 66   ASN A C   1 
ATOM   267   O  O   . ASN A  1 35  ? -2.365  52.835  19.646  1.00 71.46  ? 66   ASN A O   1 
ATOM   268   C  CB  . ASN A  1 35  ? -1.754  50.924  17.029  1.00 72.52  ? 66   ASN A CB  1 
ATOM   269   C  CG  . ASN A  1 35  ? -2.176  51.205  15.601  1.00 76.21  ? 66   ASN A CG  1 
ATOM   270   O  OD1 . ASN A  1 35  ? -2.673  50.315  14.909  1.00 78.11  ? 66   ASN A OD1 1 
ATOM   271   N  ND2 . ASN A  1 35  ? -1.979  52.444  15.161  1.00 77.25  ? 66   ASN A ND2 1 
ATOM   272   N  N   . LEU A  1 36  ? -2.812  53.871  17.708  1.00 74.50  ? 67   LEU A N   1 
ATOM   273   C  CA  . LEU A  1 36  ? -3.755  54.843  18.171  1.00 76.45  ? 67   LEU A CA  1 
ATOM   274   C  C   . LEU A  1 36  ? -4.114  54.860  19.623  1.00 76.27  ? 67   LEU A C   1 
ATOM   275   O  O   . LEU A  1 36  ? -3.583  55.713  20.371  1.00 76.86  ? 67   LEU A O   1 
ATOM   276   C  CB  . LEU A  1 36  ? -4.929  55.008  17.219  1.00 77.50  ? 67   LEU A CB  1 
ATOM   277   C  CG  . LEU A  1 36  ? -4.714  55.965  16.037  1.00 78.54  ? 67   LEU A CG  1 
ATOM   278   C  CD1 . LEU A  1 36  ? -4.832  57.411  16.498  1.00 78.29  ? 67   LEU A CD1 1 
ATOM   279   C  CD2 . LEU A  1 36  ? -3.373  55.720  15.359  1.00 77.98  ? 67   LEU A CD2 1 
ATOM   280   N  N   . PHE A  1 37  ? -5.010  54.019  20.134  1.00 75.42  ? 68   PHE A N   1 
ATOM   281   C  CA  . PHE A  1 37  ? -5.372  54.172  21.543  1.00 75.90  ? 68   PHE A CA  1 
ATOM   282   C  C   . PHE A  1 37  ? -4.233  53.955  22.499  1.00 74.21  ? 68   PHE A C   1 
ATOM   283   O  O   . PHE A  1 37  ? -4.050  54.719  23.466  1.00 75.13  ? 68   PHE A O   1 
ATOM   284   C  CB  . PHE A  1 37  ? -6.617  53.379  21.880  1.00 79.93  ? 68   PHE A CB  1 
ATOM   285   C  CG  . PHE A  1 37  ? -6.912  53.226  23.340  1.00 84.39  ? 68   PHE A CG  1 
ATOM   286   C  CD1 . PHE A  1 37  ? -6.141  53.791  24.324  1.00 85.62  ? 68   PHE A CD1 1 
ATOM   287   C  CD2 . PHE A  1 37  ? -8.018  52.491  23.755  1.00 87.11  ? 68   PHE A CD2 1 
ATOM   288   C  CE1 . PHE A  1 37  ? -6.372  53.661  25.663  1.00 87.05  ? 68   PHE A CE1 1 
ATOM   289   C  CE2 . PHE A  1 37  ? -8.290  52.347  25.101  1.00 88.63  ? 68   PHE A CE2 1 
ATOM   290   C  CZ  . PHE A  1 37  ? -7.476  52.926  26.057  1.00 88.76  ? 68   PHE A CZ  1 
ATOM   291   N  N   . VAL A  1 38  ? -3.419  52.926  22.311  1.00 72.09  ? 69   VAL A N   1 
ATOM   292   C  CA  . VAL A  1 38  ? -2.327  52.642  23.242  1.00 69.91  ? 69   VAL A CA  1 
ATOM   293   C  C   . VAL A  1 38  ? -1.275  53.736  23.283  1.00 67.71  ? 69   VAL A C   1 
ATOM   294   O  O   . VAL A  1 38  ? -0.466  53.818  24.212  1.00 66.34  ? 69   VAL A O   1 
ATOM   295   C  CB  . VAL A  1 38  ? -1.686  51.284  22.937  1.00 71.20  ? 69   VAL A CB  1 
ATOM   296   C  CG1 . VAL A  1 38  ? -0.475  51.030  23.823  1.00 71.90  ? 69   VAL A CG1 1 
ATOM   297   C  CG2 . VAL A  1 38  ? -2.692  50.152  23.088  1.00 72.56  ? 69   VAL A CG2 1 
ATOM   298   N  N   . LEU A  1 39  ? -1.265  54.605  22.283  1.00 65.24  ? 70   LEU A N   1 
ATOM   299   C  CA  . LEU A  1 39  ? -0.337  55.721  22.208  1.00 61.50  ? 70   LEU A CA  1 
ATOM   300   C  C   . LEU A  1 39  ? -0.992  56.976  22.764  1.00 60.73  ? 70   LEU A C   1 
ATOM   301   O  O   . LEU A  1 39  ? -0.349  57.811  23.390  1.00 61.59  ? 70   LEU A O   1 
ATOM   302   C  CB  . LEU A  1 39  ? 0.129   55.913  20.772  1.00 58.55  ? 70   LEU A CB  1 
ATOM   303   C  CG  . LEU A  1 39  ? -0.247  57.196  20.045  1.00 54.77  ? 70   LEU A CG  1 
ATOM   304   C  CD1 . LEU A  1 39  ? 0.619   58.366  20.488  1.00 54.95  ? 70   LEU A CD1 1 
ATOM   305   C  CD2 . LEU A  1 39  ? -0.116  57.004  18.542  1.00 51.50  ? 70   LEU A CD2 1 
ATOM   306   N  N   . LYS A  1 40  ? -2.302  57.085  22.570  1.00 60.17  ? 71   LYS A N   1 
ATOM   307   C  CA  . LYS A  1 40  ? -3.049  58.235  23.073  1.00 60.53  ? 71   LYS A CA  1 
ATOM   308   C  C   . LYS A  1 40  ? -2.823  58.408  24.569  1.00 59.60  ? 71   LYS A C   1 
ATOM   309   O  O   . LYS A  1 40  ? -2.658  59.513  25.079  1.00 61.07  ? 71   LYS A O   1 
ATOM   310   C  CB  . LYS A  1 40  ? -4.539  58.098  22.761  1.00 61.31  ? 71   LYS A CB  1 
ATOM   311   C  CG  . LYS A  1 40  ? -5.443  58.875  23.706  1.00 61.52  ? 71   LYS A CG  1 
ATOM   312   C  CD  . LYS A  1 40  ? -6.908  58.716  23.346  1.00 61.53  ? 71   LYS A CD  1 
ATOM   313   C  CE  . LYS A  1 40  ? -7.776  58.683  24.596  1.00 59.59  ? 71   LYS A CE  1 
ATOM   314   N  NZ  . LYS A  1 40  ? -9.140  58.170  24.291  1.00 58.73  ? 71   LYS A NZ  1 
ATOM   315   N  N   . ASP A  1 41  ? -2.827  57.291  25.288  1.00 57.72  ? 72   ASP A N   1 
ATOM   316   C  CA  . ASP A  1 41  ? -2.573  57.322  26.724  1.00 56.88  ? 72   ASP A CA  1 
ATOM   317   C  C   . ASP A  1 41  ? -1.158  57.835  26.999  1.00 54.21  ? 72   ASP A C   1 
ATOM   318   O  O   . ASP A  1 41  ? -0.968  58.680  27.873  1.00 53.06  ? 72   ASP A O   1 
ATOM   319   C  CB  . ASP A  1 41  ? -2.773  55.924  27.311  1.00 60.27  ? 72   ASP A CB  1 
ATOM   320   C  CG  . ASP A  1 41  ? -3.742  55.910  28.478  1.00 64.44  ? 72   ASP A CG  1 
ATOM   321   O  OD1 . ASP A  1 41  ? -3.462  56.577  29.499  1.00 65.85  ? 72   ASP A OD1 1 
ATOM   322   O  OD2 . ASP A  1 41  ? -4.790  55.234  28.370  1.00 66.36  ? 72   ASP A OD2 1 
ATOM   323   N  N   . THR A  1 42  ? -0.187  57.317  26.261  1.00 51.07  ? 73   THR A N   1 
ATOM   324   C  CA  . THR A  1 42  ? 1.214   57.690  26.332  1.00 46.29  ? 73   THR A CA  1 
ATOM   325   C  C   . THR A  1 42  ? 1.422   59.129  25.852  1.00 44.05  ? 73   THR A C   1 
ATOM   326   O  O   . THR A  1 42  ? 1.927   59.983  26.569  1.00 43.82  ? 73   THR A O   1 
ATOM   327   C  CB  . THR A  1 42  ? 2.071   56.807  25.392  1.00 45.14  ? 73   THR A CB  1 
ATOM   328   O  OG1 . THR A  1 42  ? 2.178   55.486  25.911  1.00 42.86  ? 73   THR A OG1 1 
ATOM   329   C  CG2 . THR A  1 42  ? 3.447   57.425  25.217  1.00 43.81  ? 73   THR A CG2 1 
ATOM   330   N  N   . LEU A  1 43  ? 0.964   59.388  24.629  1.00 40.83  ? 74   LEU A N   1 
ATOM   331   C  CA  . LEU A  1 43  ? 1.041   60.716  24.043  1.00 38.71  ? 74   LEU A CA  1 
ATOM   332   C  C   . LEU A  1 43  ? 0.704   61.760  25.092  1.00 39.78  ? 74   LEU A C   1 
ATOM   333   O  O   . LEU A  1 43  ? 1.350   62.810  25.162  1.00 42.59  ? 74   LEU A O   1 
ATOM   334   C  CB  . LEU A  1 43  ? 0.154   60.824  22.824  1.00 33.73  ? 74   LEU A CB  1 
ATOM   335   C  CG  . LEU A  1 43  ? 0.331   61.968  21.839  1.00 30.89  ? 74   LEU A CG  1 
ATOM   336   C  CD1 . LEU A  1 43  ? 1.758   62.457  21.767  1.00 30.73  ? 74   LEU A CD1 1 
ATOM   337   C  CD2 . LEU A  1 43  ? -0.140  61.532  20.453  1.00 28.69  ? 74   LEU A CD2 1 
ATOM   338   N  N   . LYS A  1 44  ? -0.261  61.470  25.949  1.00 40.58  ? 75   LYS A N   1 
ATOM   339   C  CA  . LYS A  1 44  ? -0.655  62.382  27.008  1.00 42.41  ? 75   LYS A CA  1 
ATOM   340   C  C   . LYS A  1 44  ? 0.363   62.444  28.136  1.00 41.83  ? 75   LYS A C   1 
ATOM   341   O  O   . LYS A  1 44  ? 0.471   63.486  28.790  1.00 42.67  ? 75   LYS A O   1 
ATOM   342   C  CB  . LYS A  1 44  ? -2.032  62.039  27.559  1.00 44.76  ? 75   LYS A CB  1 
ATOM   343   C  CG  . LYS A  1 44  ? -3.188  62.430  26.658  1.00 47.51  ? 75   LYS A CG  1 
ATOM   344   C  CD  . LYS A  1 44  ? -4.518  62.266  27.371  1.00 50.00  ? 75   LYS A CD  1 
ATOM   345   C  CE  . LYS A  1 44  ? -5.277  61.045  26.879  1.00 50.69  ? 75   LYS A CE  1 
ATOM   346   N  NZ  . LYS A  1 44  ? -6.725  61.121  27.238  1.00 51.49  ? 75   LYS A NZ  1 
ATOM   347   N  N   . LYS A  1 45  ? 1.120   61.378  28.349  1.00 40.65  ? 76   LYS A N   1 
ATOM   348   C  CA  . LYS A  1 45  ? 2.180   61.373  29.353  1.00 40.08  ? 76   LYS A CA  1 
ATOM   349   C  C   . LYS A  1 45  ? 3.307   62.327  28.919  1.00 37.63  ? 76   LYS A C   1 
ATOM   350   O  O   . LYS A  1 45  ? 3.899   63.025  29.729  1.00 35.83  ? 76   LYS A O   1 
ATOM   351   C  CB  . LYS A  1 45  ? 2.772   59.986  29.537  1.00 43.00  ? 76   LYS A CB  1 
ATOM   352   C  CG  . LYS A  1 45  ? 1.822   58.860  29.860  1.00 48.03  ? 76   LYS A CG  1 
ATOM   353   C  CD  . LYS A  1 45  ? 2.554   57.734  30.585  1.00 52.44  ? 76   LYS A CD  1 
ATOM   354   C  CE  . LYS A  1 45  ? 1.582   56.737  31.188  1.00 56.28  ? 76   LYS A CE  1 
ATOM   355   N  NZ  . LYS A  1 45  ? 2.250   55.784  32.117  1.00 56.74  ? 76   LYS A NZ  1 
ATOM   356   N  N   . MET A  1 46  ? 3.598   62.306  27.623  1.00 35.23  ? 77   MET A N   1 
ATOM   357   C  CA  . MET A  1 46  ? 4.560   63.194  26.996  1.00 33.11  ? 77   MET A CA  1 
ATOM   358   C  C   . MET A  1 46  ? 4.096   64.640  27.144  1.00 33.11  ? 77   MET A C   1 
ATOM   359   O  O   . MET A  1 46  ? 4.829   65.531  27.523  1.00 32.38  ? 77   MET A O   1 
ATOM   360   C  CB  . MET A  1 46  ? 4.685   62.912  25.494  1.00 32.04  ? 77   MET A CB  1 
ATOM   361   C  CG  . MET A  1 46  ? 5.680   63.784  24.749  1.00 32.25  ? 77   MET A CG  1 
ATOM   362   S  SD  . MET A  1 46  ? 5.042   65.359  24.195  1.00 31.51  ? 77   MET A SD  1 
ATOM   363   C  CE  . MET A  1 46  ? 6.324   66.022  23.209  1.00 30.16  ? 77   MET A CE  1 
ATOM   364   N  N   . GLN A  1 47  ? 2.814   64.811  26.813  1.00 34.01  ? 78   GLN A N   1 
ATOM   365   C  CA  . GLN A  1 47  ? 2.189   66.121  26.902  1.00 34.40  ? 78   GLN A CA  1 
ATOM   366   C  C   . GLN A  1 47  ? 2.228   66.668  28.316  1.00 33.68  ? 78   GLN A C   1 
ATOM   367   O  O   . GLN A  1 47  ? 2.674   67.787  28.542  1.00 31.87  ? 78   GLN A O   1 
ATOM   368   C  CB  . GLN A  1 47  ? 0.757   66.048  26.380  1.00 33.48  ? 78   GLN A CB  1 
ATOM   369   C  CG  . GLN A  1 47  ? 0.663   66.270  24.881  1.00 34.91  ? 78   GLN A CG  1 
ATOM   370   C  CD  . GLN A  1 47  ? -0.431  65.459  24.231  1.00 36.96  ? 78   GLN A CD  1 
ATOM   371   O  OE1 . GLN A  1 47  ? -1.113  64.674  24.894  1.00 40.19  ? 78   GLN A OE1 1 
ATOM   372   N  NE2 . GLN A  1 47  ? -0.617  65.627  22.926  1.00 35.89  ? 78   GLN A NE2 1 
ATOM   373   N  N   . LYS A  1 48  ? 1.823   65.841  29.276  1.00 34.11  ? 79   LYS A N   1 
ATOM   374   C  CA  . LYS A  1 48  ? 1.858   66.257  30.671  1.00 36.87  ? 79   LYS A CA  1 
ATOM   375   C  C   . LYS A  1 48  ? 3.258   66.704  31.089  1.00 37.71  ? 79   LYS A C   1 
ATOM   376   O  O   . LYS A  1 48  ? 3.413   67.750  31.707  1.00 36.54  ? 79   LYS A O   1 
ATOM   377   C  CB  . LYS A  1 48  ? 1.385   65.132  31.592  1.00 36.16  ? 79   LYS A CB  1 
ATOM   378   C  CG  . LYS A  1 48  ? 1.283   65.543  33.052  1.00 38.95  ? 79   LYS A CG  1 
ATOM   379   C  CD  . LYS A  1 48  ? 1.262   64.337  33.977  1.00 42.55  ? 79   LYS A CD  1 
ATOM   380   C  CE  . LYS A  1 48  ? -0.019  63.536  33.842  1.00 46.05  ? 79   LYS A CE  1 
ATOM   381   N  NZ  . LYS A  1 48  ? 0.147   62.149  34.374  1.00 46.21  ? 79   LYS A NZ  1 
ATOM   382   N  N   . PHE A  1 49  ? 4.245   65.884  30.743  1.00 38.67  ? 80   PHE A N   1 
ATOM   383   C  CA  . PHE A  1 49  ? 5.634   66.121  31.058  1.00 39.71  ? 80   PHE A CA  1 
ATOM   384   C  C   . PHE A  1 49  ? 6.068   67.511  30.609  1.00 38.84  ? 80   PHE A C   1 
ATOM   385   O  O   . PHE A  1 49  ? 6.619   68.279  31.380  1.00 39.16  ? 80   PHE A O   1 
ATOM   386   C  CB  . PHE A  1 49  ? 6.560   65.080  30.407  1.00 42.87  ? 80   PHE A CB  1 
ATOM   387   C  CG  . PHE A  1 49  ? 7.987   65.205  30.884  1.00 44.33  ? 80   PHE A CG  1 
ATOM   388   C  CD1 . PHE A  1 49  ? 8.792   66.246  30.444  1.00 44.10  ? 80   PHE A CD1 1 
ATOM   389   C  CD2 . PHE A  1 49  ? 8.509   64.299  31.789  1.00 44.09  ? 80   PHE A CD2 1 
ATOM   390   C  CE1 . PHE A  1 49  ? 10.092  66.377  30.887  1.00 43.72  ? 80   PHE A CE1 1 
ATOM   391   C  CE2 . PHE A  1 49  ? 9.812   64.428  32.237  1.00 44.88  ? 80   PHE A CE2 1 
ATOM   392   C  CZ  . PHE A  1 49  ? 10.606  65.465  31.785  1.00 44.01  ? 80   PHE A CZ  1 
ATOM   393   N  N   . PHE A  1 50  ? 5.917   67.741  29.310  1.00 38.07  ? 81   PHE A N   1 
ATOM   394   C  CA  . PHE A  1 50  ? 6.226   69.087  28.806  1.00 39.66  ? 81   PHE A CA  1 
ATOM   395   C  C   . PHE A  1 50  ? 5.045   69.970  29.160  1.00 41.16  ? 81   PHE A C   1 
ATOM   396   O  O   . PHE A  1 50  ? 4.017   69.467  29.650  1.00 42.99  ? 81   PHE A O   1 
ATOM   397   C  CB  . PHE A  1 50  ? 6.495   69.038  27.311  1.00 39.60  ? 81   PHE A CB  1 
ATOM   398   C  CG  . PHE A  1 50  ? 7.749   68.277  26.970  1.00 40.45  ? 81   PHE A CG  1 
ATOM   399   C  CD1 . PHE A  1 50  ? 8.992   68.876  27.126  1.00 39.56  ? 81   PHE A CD1 1 
ATOM   400   C  CD2 . PHE A  1 50  ? 7.695   66.976  26.507  1.00 40.57  ? 81   PHE A CD2 1 
ATOM   401   C  CE1 . PHE A  1 50  ? 10.141  68.193  26.815  1.00 39.81  ? 81   PHE A CE1 1 
ATOM   402   C  CE2 . PHE A  1 50  ? 8.852   66.285  26.199  1.00 40.25  ? 81   PHE A CE2 1 
ATOM   403   C  CZ  . PHE A  1 50  ? 10.081  66.895  26.357  1.00 40.75  ? 81   PHE A CZ  1 
ATOM   404   N  N   . GLY A  1 51  ? 5.104   71.263  28.890  1.00 41.16  ? 82   GLY A N   1 
ATOM   405   C  CA  . GLY A  1 51  ? 3.981   72.119  29.262  1.00 44.54  ? 82   GLY A CA  1 
ATOM   406   C  C   . GLY A  1 51  ? 2.719   71.916  28.453  1.00 44.75  ? 82   GLY A C   1 
ATOM   407   O  O   . GLY A  1 51  ? 1.718   72.601  28.708  1.00 44.70  ? 82   GLY A O   1 
ATOM   408   N  N   . LEU A  1 52  ? 2.709   71.025  27.484  1.00 44.82  ? 83   LEU A N   1 
ATOM   409   C  CA  . LEU A  1 52  ? 1.623   70.803  26.571  1.00 44.96  ? 83   LEU A CA  1 
ATOM   410   C  C   . LEU A  1 52  ? 0.315   70.340  27.170  1.00 45.74  ? 83   LEU A C   1 
ATOM   411   O  O   . LEU A  1 52  ? 0.218   69.814  28.275  1.00 45.40  ? 83   LEU A O   1 
ATOM   412   C  CB  . LEU A  1 52  ? 2.093   69.877  25.435  1.00 44.51  ? 83   LEU A CB  1 
ATOM   413   C  CG  . LEU A  1 52  ? 3.310   70.403  24.658  1.00 43.21  ? 83   LEU A CG  1 
ATOM   414   C  CD1 . LEU A  1 52  ? 3.562   69.533  23.446  1.00 42.67  ? 83   LEU A CD1 1 
ATOM   415   C  CD2 . LEU A  1 52  ? 3.096   71.858  24.270  1.00 42.56  ? 83   LEU A CD2 1 
ATOM   416   N  N   . PRO A  1 53  ? -0.765  70.543  26.424  1.00 46.53  ? 84   PRO A N   1 
ATOM   417   C  CA  . PRO A  1 53  ? -2.129  70.198  26.764  1.00 46.91  ? 84   PRO A CA  1 
ATOM   418   C  C   . PRO A  1 53  ? -2.425  68.718  26.539  1.00 46.97  ? 84   PRO A C   1 
ATOM   419   O  O   . PRO A  1 53  ? -2.347  68.224  25.413  1.00 46.53  ? 84   PRO A O   1 
ATOM   420   C  CB  . PRO A  1 53  ? -2.981  71.040  25.818  1.00 46.19  ? 84   PRO A CB  1 
ATOM   421   C  CG  . PRO A  1 53  ? -2.055  71.910  25.056  1.00 47.00  ? 84   PRO A CG  1 
ATOM   422   C  CD  . PRO A  1 53  ? -0.727  71.208  25.084  1.00 47.10  ? 84   PRO A CD  1 
ATOM   423   N  N   . GLN A  1 54  ? -2.809  68.029  27.607  1.00 46.47  ? 85   GLN A N   1 
ATOM   424   C  CA  . GLN A  1 54  ? -3.057  66.604  27.579  1.00 45.90  ? 85   GLN A CA  1 
ATOM   425   C  C   . GLN A  1 54  ? -4.241  66.224  26.712  1.00 44.72  ? 85   GLN A C   1 
ATOM   426   O  O   . GLN A  1 54  ? -5.247  65.705  27.183  1.00 44.37  ? 85   GLN A O   1 
ATOM   427   C  CB  . GLN A  1 54  ? -3.200  66.039  28.991  1.00 46.18  ? 85   GLN A CB  1 
ATOM   428   C  CG  . GLN A  1 54  ? -1.865  65.784  29.672  1.00 48.49  ? 85   GLN A CG  1 
ATOM   429   C  CD  . GLN A  1 54  ? -1.885  66.118  31.147  1.00 49.82  ? 85   GLN A CD  1 
ATOM   430   O  OE1 . GLN A  1 54  ? -2.363  65.316  31.954  1.00 50.14  ? 85   GLN A OE1 1 
ATOM   431   N  NE2 . GLN A  1 54  ? -1.361  67.293  31.490  1.00 48.40  ? 85   GLN A NE2 1 
ATOM   432   N  N   . THR A  1 55  ? -4.089  66.441  25.413  1.00 43.43  ? 86   THR A N   1 
ATOM   433   C  CA  . THR A  1 55  ? -5.121  66.094  24.452  1.00 42.13  ? 86   THR A CA  1 
ATOM   434   C  C   . THR A  1 55  ? -5.005  64.621  24.090  1.00 43.90  ? 86   THR A C   1 
ATOM   435   O  O   . THR A  1 55  ? -5.984  63.881  24.076  1.00 45.13  ? 86   THR A O   1 
ATOM   436   C  CB  . THR A  1 55  ? -5.002  66.967  23.192  1.00 39.62  ? 86   THR A CB  1 
ATOM   437   O  OG1 . THR A  1 55  ? -4.003  66.448  22.313  1.00 38.64  ? 86   THR A OG1 1 
ATOM   438   C  CG2 . THR A  1 55  ? -4.621  68.390  23.573  1.00 38.26  ? 86   THR A CG2 1 
ATOM   439   N  N   . GLY A  1 56  ? -3.779  64.170  23.847  1.00 45.63  ? 87   GLY A N   1 
ATOM   440   C  CA  . GLY A  1 56  ? -3.553  62.777  23.450  1.00 47.59  ? 87   GLY A CA  1 
ATOM   441   C  C   . GLY A  1 56  ? -3.583  62.695  21.921  1.00 49.46  ? 87   GLY A C   1 
ATOM   442   O  O   . GLY A  1 56  ? -3.675  61.620  21.342  1.00 49.91  ? 87   GLY A O   1 
ATOM   443   N  N   . ASP A  1 57  ? -3.571  63.868  21.297  1.00 50.32  ? 88   ASP A N   1 
ATOM   444   C  CA  . ASP A  1 57  ? -3.624  63.972  19.845  1.00 51.93  ? 88   ASP A CA  1 
ATOM   445   C  C   . ASP A  1 57  ? -2.279  64.454  19.316  1.00 51.88  ? 88   ASP A C   1 
ATOM   446   O  O   . ASP A  1 57  ? -1.498  65.057  20.056  1.00 51.46  ? 88   ASP A O   1 
ATOM   447   C  CB  . ASP A  1 57  ? -4.736  64.943  19.443  1.00 55.06  ? 88   ASP A CB  1 
ATOM   448   C  CG  . ASP A  1 57  ? -5.997  64.768  20.264  1.00 57.94  ? 88   ASP A CG  1 
ATOM   449   O  OD1 . ASP A  1 57  ? -6.245  63.661  20.787  1.00 59.01  ? 88   ASP A OD1 1 
ATOM   450   O  OD2 . ASP A  1 57  ? -6.763  65.750  20.391  1.00 59.35  ? 88   ASP A OD2 1 
ATOM   451   N  N   . LEU A  1 58  ? -2.019  64.240  18.032  1.00 51.10  ? 89   LEU A N   1 
ATOM   452   C  CA  . LEU A  1 58  ? -0.769  64.676  17.433  1.00 49.96  ? 89   LEU A CA  1 
ATOM   453   C  C   . LEU A  1 58  ? -0.827  66.127  16.975  1.00 50.67  ? 89   LEU A C   1 
ATOM   454   O  O   . LEU A  1 58  ? -0.512  66.429  15.825  1.00 49.72  ? 89   LEU A O   1 
ATOM   455   C  CB  . LEU A  1 58  ? -0.396  63.784  16.246  1.00 48.83  ? 89   LEU A CB  1 
ATOM   456   C  CG  . LEU A  1 58  ? 1.005   63.160  16.346  1.00 49.14  ? 89   LEU A CG  1 
ATOM   457   C  CD1 . LEU A  1 58  ? 1.121   62.381  17.648  1.00 47.75  ? 89   LEU A CD1 1 
ATOM   458   C  CD2 . LEU A  1 58  ? 1.278   62.250  15.166  1.00 49.17  ? 89   LEU A CD2 1 
ATOM   459   N  N   . ASP A  1 59  ? -1.232  67.007  17.877  1.00 52.27  ? 90   ASP A N   1 
ATOM   460   C  CA  . ASP A  1 59  ? -1.323  68.430  17.591  1.00 55.38  ? 90   ASP A CA  1 
ATOM   461   C  C   . ASP A  1 59  ? 0.072   69.008  17.382  1.00 56.95  ? 90   ASP A C   1 
ATOM   462   O  O   . ASP A  1 59  ? 1.043   68.522  17.956  1.00 57.87  ? 90   ASP A O   1 
ATOM   463   C  CB  . ASP A  1 59  ? -2.058  69.159  18.712  1.00 57.18  ? 90   ASP A CB  1 
ATOM   464   C  CG  . ASP A  1 59  ? -1.638  68.718  20.098  1.00 59.97  ? 90   ASP A CG  1 
ATOM   465   O  OD1 . ASP A  1 59  ? -0.454  68.376  20.290  1.00 61.62  ? 90   ASP A OD1 1 
ATOM   466   O  OD2 . ASP A  1 59  ? -2.497  68.714  21.010  1.00 60.87  ? 90   ASP A OD2 1 
ATOM   467   N  N   . GLN A  1 60  ? 0.178   70.040  16.564  1.00 58.66  ? 91   GLN A N   1 
ATOM   468   C  CA  . GLN A  1 60  ? 1.425   70.683  16.220  1.00 59.78  ? 91   GLN A CA  1 
ATOM   469   C  C   . GLN A  1 60  ? 2.271   71.094  17.403  1.00 58.70  ? 91   GLN A C   1 
ATOM   470   O  O   . GLN A  1 60  ? 3.487   70.878  17.413  1.00 59.15  ? 91   GLN A O   1 
ATOM   471   C  CB  . GLN A  1 60  ? 1.180   71.890  15.306  1.00 61.92  ? 91   GLN A CB  1 
ATOM   472   C  CG  . GLN A  1 60  ? 2.289   72.116  14.292  1.00 66.77  ? 91   GLN A CG  1 
ATOM   473   C  CD  . GLN A  1 60  ? 2.480   70.952  13.345  1.00 69.10  ? 91   GLN A CD  1 
ATOM   474   O  OE1 . GLN A  1 60  ? 1.830   69.909  13.435  1.00 69.39  ? 91   GLN A OE1 1 
ATOM   475   N  NE2 . GLN A  1 60  ? 3.403   71.126  12.399  1.00 69.60  ? 91   GLN A NE2 1 
ATOM   476   N  N   . ASN A  1 61  ? 1.655   71.672  18.432  1.00 57.78  ? 92   ASN A N   1 
ATOM   477   C  CA  . ASN A  1 61  ? 2.433   72.071  19.606  1.00 57.74  ? 92   ASN A CA  1 
ATOM   478   C  C   . ASN A  1 61  ? 3.227   70.889  20.142  1.00 55.98  ? 92   ASN A C   1 
ATOM   479   O  O   . ASN A  1 61  ? 4.299   71.039  20.719  1.00 56.98  ? 92   ASN A O   1 
ATOM   480   C  CB  . ASN A  1 61  ? 1.537   72.666  20.681  1.00 59.75  ? 92   ASN A CB  1 
ATOM   481   C  CG  . ASN A  1 61  ? 1.799   74.141  20.912  1.00 61.69  ? 92   ASN A CG  1 
ATOM   482   O  OD1 . ASN A  1 61  ? 2.421   74.831  20.103  1.00 61.36  ? 92   ASN A OD1 1 
ATOM   483   N  ND2 . ASN A  1 61  ? 1.314   74.638  22.045  1.00 62.88  ? 92   ASN A ND2 1 
ATOM   484   N  N   . THR A  1 62  ? 2.682   69.695  19.953  1.00 53.14  ? 93   THR A N   1 
ATOM   485   C  CA  . THR A  1 62  ? 3.329   68.470  20.366  1.00 50.58  ? 93   THR A CA  1 
ATOM   486   C  C   . THR A  1 62  ? 4.467   68.068  19.447  1.00 49.79  ? 93   THR A C   1 
ATOM   487   O  O   . THR A  1 62  ? 5.579   67.838  19.916  1.00 51.98  ? 93   THR A O   1 
ATOM   488   C  CB  . THR A  1 62  ? 2.322   67.302  20.414  1.00 50.02  ? 93   THR A CB  1 
ATOM   489   O  OG1 . THR A  1 62  ? 1.573   67.407  21.630  1.00 51.11  ? 93   THR A OG1 1 
ATOM   490   C  CG2 . THR A  1 62  ? 3.014   65.959  20.376  1.00 49.09  ? 93   THR A CG2 1 
ATOM   491   N  N   . ILE A  1 63  ? 4.169   67.941  18.157  1.00 47.65  ? 94   ILE A N   1 
ATOM   492   C  CA  . ILE A  1 63  ? 5.161   67.444  17.214  1.00 47.05  ? 94   ILE A CA  1 
ATOM   493   C  C   . ILE A  1 63  ? 6.275   68.461  17.043  1.00 46.33  ? 94   ILE A C   1 
ATOM   494   O  O   . ILE A  1 63  ? 7.387   68.184  16.613  1.00 46.09  ? 94   ILE A O   1 
ATOM   495   C  CB  . ILE A  1 63  ? 4.578   67.052  15.860  1.00 47.08  ? 94   ILE A CB  1 
ATOM   496   C  CG1 . ILE A  1 63  ? 4.528   68.237  14.905  1.00 47.00  ? 94   ILE A CG1 1 
ATOM   497   C  CG2 . ILE A  1 63  ? 3.212   66.401  16.009  1.00 46.39  ? 94   ILE A CG2 1 
ATOM   498   C  CD1 . ILE A  1 63  ? 5.690   68.322  13.941  1.00 47.05  ? 94   ILE A CD1 1 
ATOM   499   N  N   . GLU A  1 64  ? 5.940   69.693  17.412  1.00 44.99  ? 95   GLU A N   1 
ATOM   500   C  CA  . GLU A  1 64  ? 6.933   70.763  17.373  1.00 43.12  ? 95   GLU A CA  1 
ATOM   501   C  C   . GLU A  1 64  ? 7.943   70.524  18.493  1.00 39.59  ? 95   GLU A C   1 
ATOM   502   O  O   . GLU A  1 64  ? 9.130   70.763  18.341  1.00 39.36  ? 95   GLU A O   1 
ATOM   503   C  CB  . GLU A  1 64  ? 6.251   72.115  17.559  1.00 45.53  ? 95   GLU A CB  1 
ATOM   504   C  CG  . GLU A  1 64  ? 7.004   73.262  16.909  1.00 50.77  ? 95   GLU A CG  1 
ATOM   505   C  CD  . GLU A  1 64  ? 6.490   74.615  17.364  1.00 54.43  ? 95   GLU A CD  1 
ATOM   506   O  OE1 . GLU A  1 64  ? 6.716   74.982  18.537  1.00 55.82  ? 95   GLU A OE1 1 
ATOM   507   O  OE2 . GLU A  1 64  ? 5.857   75.296  16.531  1.00 56.13  ? 95   GLU A OE2 1 
ATOM   508   N  N   . THR A  1 65  ? 7.447   70.019  19.616  1.00 36.15  ? 96   THR A N   1 
ATOM   509   C  CA  . THR A  1 65  ? 8.320   69.731  20.746  1.00 35.22  ? 96   THR A CA  1 
ATOM   510   C  C   . THR A  1 65  ? 9.138   68.483  20.460  1.00 36.89  ? 96   THR A C   1 
ATOM   511   O  O   . THR A  1 65  ? 10.329  68.389  20.743  1.00 38.49  ? 96   THR A O   1 
ATOM   512   C  CB  . THR A  1 65  ? 7.517   69.546  22.044  1.00 33.54  ? 96   THR A CB  1 
ATOM   513   O  OG1 . THR A  1 65  ? 7.055   70.817  22.517  1.00 32.52  ? 96   THR A OG1 1 
ATOM   514   C  CG2 . THR A  1 65  ? 8.374   68.923  23.136  1.00 32.42  ? 96   THR A CG2 1 
ATOM   515   N  N   . MET A  1 66  ? 8.488   67.504  19.846  1.00 37.51  ? 97   MET A N   1 
ATOM   516   C  CA  . MET A  1 66  ? 9.122   66.235  19.524  1.00 37.44  ? 97   MET A CA  1 
ATOM   517   C  C   . MET A  1 66  ? 10.255  66.392  18.524  1.00 36.85  ? 97   MET A C   1 
ATOM   518   O  O   . MET A  1 66  ? 11.202  65.606  18.528  1.00 36.56  ? 97   MET A O   1 
ATOM   519   C  CB  . MET A  1 66  ? 8.062   65.257  18.995  1.00 35.87  ? 97   MET A CB  1 
ATOM   520   C  CG  . MET A  1 66  ? 7.001   64.905  20.029  1.00 35.92  ? 97   MET A CG  1 
ATOM   521   S  SD  . MET A  1 66  ? 6.118   63.372  19.663  1.00 35.19  ? 97   MET A SD  1 
ATOM   522   C  CE  . MET A  1 66  ? 5.774   63.636  17.925  1.00 35.79  ? 97   MET A CE  1 
ATOM   523   N  N   . ARG A  1 67  ? 10.175  67.411  17.689  1.00 36.71  ? 98   ARG A N   1 
ATOM   524   C  CA  . ARG A  1 67  ? 11.150  67.703  16.669  1.00 35.89  ? 98   ARG A CA  1 
ATOM   525   C  C   . ARG A  1 67  ? 12.415  68.379  17.165  1.00 34.18  ? 98   ARG A C   1 
ATOM   526   O  O   . ARG A  1 67  ? 13.397  68.398  16.414  1.00 35.00  ? 98   ARG A O   1 
ATOM   527   C  CB  . ARG A  1 67  ? 10.509  68.594  15.590  1.00 39.48  ? 98   ARG A CB  1 
ATOM   528   C  CG  . ARG A  1 67  ? 10.855  68.182  14.177  1.00 45.19  ? 98   ARG A CG  1 
ATOM   529   C  CD  . ARG A  1 67  ? 9.621   67.703  13.418  1.00 51.16  ? 98   ARG A CD  1 
ATOM   530   N  NE  . ARG A  1 67  ? 10.009  66.957  12.223  1.00 57.46  ? 98   ARG A NE  1 
ATOM   531   C  CZ  . ARG A  1 67  ? 9.176   66.401  11.356  1.00 59.60  ? 98   ARG A CZ  1 
ATOM   532   N  NH1 . ARG A  1 67  ? 7.861   66.482  11.516  1.00 60.95  ? 98   ARG A NH1 1 
ATOM   533   N  NH2 . ARG A  1 67  ? 9.670   65.751  10.309  1.00 59.68  ? 98   ARG A NH2 1 
ATOM   534   N  N   . LYS A  1 68  ? 12.420  68.985  18.342  1.00 31.77  ? 99   LYS A N   1 
ATOM   535   C  CA  . LYS A  1 68  ? 13.599  69.705  18.826  1.00 28.53  ? 99   LYS A CA  1 
ATOM   536   C  C   . LYS A  1 68  ? 14.672  68.716  19.268  1.00 26.98  ? 99   LYS A C   1 
ATOM   537   O  O   . LYS A  1 68  ? 14.343  67.601  19.686  1.00 26.65  ? 99   LYS A O   1 
ATOM   538   C  CB  . LYS A  1 68  ? 13.230  70.601  20.010  1.00 28.37  ? 99   LYS A CB  1 
ATOM   539   C  CG  . LYS A  1 68  ? 12.136  71.619  19.818  1.00 30.58  ? 99   LYS A CG  1 
ATOM   540   C  CD  . LYS A  1 68  ? 11.457  72.008  21.127  1.00 30.91  ? 99   LYS A CD  1 
ATOM   541   C  CE  . LYS A  1 68  ? 10.701  73.321  21.011  1.00 30.02  ? 99   LYS A CE  1 
ATOM   542   N  NZ  . LYS A  1 68  ? 9.950   73.647  22.249  1.00 28.39  ? 99   LYS A NZ  1 
ATOM   543   N  N   . PRO A  1 69  ? 15.931  69.097  19.196  1.00 25.11  ? 100  PRO A N   1 
ATOM   544   C  CA  . PRO A  1 69  ? 17.040  68.244  19.596  1.00 22.70  ? 100  PRO A CA  1 
ATOM   545   C  C   . PRO A  1 69  ? 16.980  68.021  21.106  1.00 21.31  ? 100  PRO A C   1 
ATOM   546   O  O   . PRO A  1 69  ? 16.518  68.867  21.844  1.00 20.10  ? 100  PRO A O   1 
ATOM   547   C  CB  . PRO A  1 69  ? 18.290  69.037  19.252  1.00 23.71  ? 100  PRO A CB  1 
ATOM   548   C  CG  . PRO A  1 69  ? 17.840  70.110  18.336  1.00 24.74  ? 100  PRO A CG  1 
ATOM   549   C  CD  . PRO A  1 69  ? 16.415  70.389  18.689  1.00 25.84  ? 100  PRO A CD  1 
ATOM   550   N  N   . ARG A  1 70  ? 17.397  66.824  21.518  1.00 19.96  ? 101  ARG A N   1 
ATOM   551   C  CA  . ARG A  1 70  ? 17.280  66.543  22.954  1.00 19.17  ? 101  ARG A CA  1 
ATOM   552   C  C   . ARG A  1 70  ? 18.149  65.352  23.295  1.00 20.76  ? 101  ARG A C   1 
ATOM   553   O  O   . ARG A  1 70  ? 18.572  64.630  22.401  1.00 21.28  ? 101  ARG A O   1 
ATOM   554   C  CB  . ARG A  1 70  ? 15.816  66.335  23.302  1.00 19.59  ? 101  ARG A CB  1 
ATOM   555   C  CG  . ARG A  1 70  ? 15.122  65.189  22.553  1.00 19.81  ? 101  ARG A CG  1 
ATOM   556   C  CD  . ARG A  1 70  ? 14.889  64.014  23.448  1.00 21.21  ? 101  ARG A CD  1 
ATOM   557   N  NE  . ARG A  1 70  ? 13.722  64.161  24.298  1.00 25.19  ? 101  ARG A NE  1 
ATOM   558   C  CZ  . ARG A  1 70  ? 13.515  63.539  25.454  1.00 26.34  ? 101  ARG A CZ  1 
ATOM   559   N  NH1 . ARG A  1 70  ? 14.423  62.702  25.937  1.00 22.99  ? 101  ARG A NH1 1 
ATOM   560   N  NH2 . ARG A  1 70  ? 12.395  63.765  26.130  1.00 27.30  ? 101  ARG A NH2 1 
ATOM   561   N  N   . CYS A  1 71  ? 18.180  64.997  24.567  1.00 20.95  ? 102  CYS A N   1 
ATOM   562   C  CA  . CYS A  1 71  ? 18.886  63.855  25.103  1.00 22.23  ? 102  CYS A CA  1 
ATOM   563   C  C   . CYS A  1 71  ? 18.340  62.506  24.669  1.00 23.75  ? 102  CYS A C   1 
ATOM   564   O  O   . CYS A  1 71  ? 17.255  62.350  24.085  1.00 23.37  ? 102  CYS A O   1 
ATOM   565   C  CB  . CYS A  1 71  ? 18.864  63.957  26.633  1.00 22.21  ? 102  CYS A CB  1 
ATOM   566   S  SG  . CYS A  1 71  ? 19.679  62.598  27.435  1.00 24.44  ? 102  CYS A SG  1 
ATOM   567   N  N   . GLY A  1 72  ? 19.121  61.457  24.950  1.00 24.23  ? 103  GLY A N   1 
ATOM   568   C  CA  . GLY A  1 72  ? 18.774  60.113  24.583  1.00 24.45  ? 103  GLY A CA  1 
ATOM   569   C  C   . GLY A  1 72  ? 18.016  59.377  25.683  1.00 24.22  ? 103  GLY A C   1 
ATOM   570   O  O   . GLY A  1 72  ? 17.216  58.481  25.395  1.00 23.51  ? 103  GLY A O   1 
ATOM   571   N  N   . ASN A  1 73  ? 18.284  59.750  26.931  1.00 24.91  ? 104  ASN A N   1 
ATOM   572   C  CA  . ASN A  1 73  ? 17.614  59.146  28.080  1.00 25.66  ? 104  ASN A CA  1 
ATOM   573   C  C   . ASN A  1 73  ? 16.119  59.449  28.034  1.00 27.07  ? 104  ASN A C   1 
ATOM   574   O  O   . ASN A  1 73  ? 15.696  60.446  27.449  1.00 28.06  ? 104  ASN A O   1 
ATOM   575   C  CB  . ASN A  1 73  ? 18.236  59.643  29.389  1.00 27.96  ? 104  ASN A CB  1 
ATOM   576   C  CG  . ASN A  1 73  ? 19.545  58.951  29.733  1.00 30.02  ? 104  ASN A CG  1 
ATOM   577   O  OD1 . ASN A  1 73  ? 20.330  58.601  28.852  1.00 31.91  ? 104  ASN A OD1 1 
ATOM   578   N  ND2 . ASN A  1 73  ? 19.790  58.756  31.026  1.00 30.74  ? 104  ASN A ND2 1 
ATOM   579   N  N   . PRO A  1 74  ? 15.301  58.593  28.654  1.00 27.68  ? 105  PRO A N   1 
ATOM   580   C  CA  . PRO A  1 74  ? 13.838  58.723  28.641  1.00 27.81  ? 105  PRO A CA  1 
ATOM   581   C  C   . PRO A  1 74  ? 13.359  59.793  29.585  1.00 30.51  ? 105  PRO A C   1 
ATOM   582   O  O   . PRO A  1 74  ? 14.161  60.377  30.316  1.00 27.96  ? 105  PRO A O   1 
ATOM   583   C  CB  . PRO A  1 74  ? 13.338  57.486  29.364  1.00 25.79  ? 105  PRO A CB  1 
ATOM   584   C  CG  . PRO A  1 74  ? 14.490  56.577  29.412  1.00 25.85  ? 105  PRO A CG  1 
ATOM   585   C  CD  . PRO A  1 74  ? 15.722  57.431  29.440  1.00 26.98  ? 105  PRO A CD  1 
ATOM   586   N  N   . ASP A  1 75  ? 12.049  60.003  29.608  1.00 34.46  ? 106  ASP A N   1 
ATOM   587   C  CA  . ASP A  1 75  ? 11.435  60.965  30.519  1.00 38.06  ? 106  ASP A CA  1 
ATOM   588   C  C   . ASP A  1 75  ? 10.572  60.266  31.562  1.00 41.31  ? 106  ASP A C   1 
ATOM   589   O  O   . ASP A  1 75  ? 10.147  60.882  32.540  1.00 39.54  ? 106  ASP A O   1 
ATOM   590   C  CB  . ASP A  1 75  ? 10.571  61.964  29.760  1.00 38.91  ? 106  ASP A CB  1 
ATOM   591   C  CG  . ASP A  1 75  ? 11.342  62.716  28.704  1.00 39.08  ? 106  ASP A CG  1 
ATOM   592   O  OD1 . ASP A  1 75  ? 12.583  62.779  28.810  1.00 38.19  ? 106  ASP A OD1 1 
ATOM   593   O  OD2 . ASP A  1 75  ? 10.703  63.241  27.771  1.00 42.32  ? 106  ASP A OD2 1 
ATOM   594   N  N   . VAL A  1 76  ? 10.316  58.986  31.330  1.00 47.52  ? 107  VAL A N   1 
ATOM   595   C  CA  . VAL A  1 76  ? 9.506   58.185  32.238  1.00 54.26  ? 107  VAL A CA  1 
ATOM   596   C  C   . VAL A  1 76  ? 10.352  57.108  32.908  1.00 59.58  ? 107  VAL A C   1 
ATOM   597   O  O   . VAL A  1 76  ? 11.408  56.726  32.414  1.00 60.41  ? 107  VAL A O   1 
ATOM   598   C  CB  . VAL A  1 76  ? 8.334   57.514  31.498  1.00 53.34  ? 107  VAL A CB  1 
ATOM   599   C  CG1 . VAL A  1 76  ? 7.396   58.562  30.921  1.00 53.70  ? 107  VAL A CG1 1 
ATOM   600   C  CG2 . VAL A  1 76  ? 8.857   56.594  30.403  1.00 51.80  ? 107  VAL A CG2 1 
ATOM   601   N  N   . ALA A  1 77  ? 9.849   56.608  34.032  1.00 65.58  ? 108  ALA A N   1 
ATOM   602   C  CA  . ALA A  1 77  ? 10.554  55.546  34.745  1.00 71.30  ? 108  ALA A CA  1 
ATOM   603   C  C   . ALA A  1 77  ? 10.335  54.219  34.035  1.00 75.78  ? 108  ALA A C   1 
ATOM   604   O  O   . ALA A  1 77  ? 9.256   53.989  33.474  1.00 75.66  ? 108  ALA A O   1 
ATOM   605   C  CB  . ALA A  1 77  ? 10.057  55.470  36.180  1.00 70.84  ? 108  ALA A CB  1 
ATOM   606   N  N   . ASN A  1 78  ? 11.302  53.321  34.142  1.00 80.85  ? 109  ASN A N   1 
ATOM   607   C  CA  . ASN A  1 78  ? 11.170  51.970  33.586  1.00 85.98  ? 109  ASN A CA  1 
ATOM   608   C  C   . ASN A  1 78  ? 10.052  51.248  34.346  1.00 89.41  ? 109  ASN A C   1 
ATOM   609   O  O   . ASN A  1 78  ? 10.257  50.194  34.939  1.00 89.11  ? 109  ASN A O   1 
ATOM   610   C  CB  . ASN A  1 78  ? 12.492  51.218  33.755  1.00 85.68  ? 109  ASN A CB  1 
ATOM   611   C  CG  . ASN A  1 78  ? 13.642  52.131  34.132  1.00 86.20  ? 109  ASN A CG  1 
ATOM   612   O  OD1 . ASN A  1 78  ? 13.600  52.824  35.150  1.00 85.52  ? 109  ASN A OD1 1 
ATOM   613   N  ND2 . ASN A  1 78  ? 14.688  52.136  33.314  1.00 85.76  ? 109  ASN A ND2 1 
ATOM   614   N  N   . TYR A  1 79  ? 8.879   51.858  34.368  1.00 93.45  ? 110  TYR A N   1 
ATOM   615   C  CA  . TYR A  1 79  ? 7.727   51.455  35.115  1.00 96.77  ? 110  TYR A CA  1 
ATOM   616   C  C   . TYR A  1 79  ? 8.084   51.024  36.531  1.00 98.58  ? 110  TYR A C   1 
ATOM   617   O  O   . TYR A  1 79  ? 7.700   49.961  37.006  1.00 99.19  ? 110  TYR A O   1 
ATOM   618   C  CB  . TYR A  1 79  ? 6.882   50.412  34.396  1.00 96.87  ? 110  TYR A CB  1 
ATOM   619   C  CG  . TYR A  1 79  ? 5.399   50.602  34.663  1.00 96.52  ? 110  TYR A CG  1 
ATOM   620   C  CD1 . TYR A  1 79  ? 4.854   51.879  34.714  1.00 96.39  ? 110  TYR A CD1 1 
ATOM   621   C  CD2 . TYR A  1 79  ? 4.561   49.519  34.868  1.00 95.71  ? 110  TYR A CD2 1 
ATOM   622   C  CE1 . TYR A  1 79  ? 3.508   52.070  34.963  1.00 96.18  ? 110  TYR A CE1 1 
ATOM   623   C  CE2 . TYR A  1 79  ? 3.213   49.700  35.116  1.00 95.17  ? 110  TYR A CE2 1 
ATOM   624   C  CZ  . TYR A  1 79  ? 2.693   50.976  35.162  1.00 95.71  ? 110  TYR A CZ  1 
ATOM   625   O  OH  . TYR A  1 79  ? 1.351   51.156  35.409  1.00 95.37  ? 110  TYR A OH  1 
ATOM   626   N  N   . ASN A  1 80  ? 8.850   51.879  37.196  1.00 99.56  ? 111  ASN A N   1 
ATOM   627   C  CA  . ASN A  1 80  ? 9.272   51.721  38.554  1.00 100.00 ? 111  ASN A CA  1 
ATOM   628   C  C   . ASN A  1 80  ? 10.251  50.594  38.831  1.00 100.00 ? 111  ASN A C   1 
ATOM   629   O  O   . ASN A  1 80  ? 9.904   49.439  39.054  1.00 100.00 ? 111  ASN A O   1 
ATOM   630   C  CB  . ASN A  1 80  ? 8.085   51.676  39.516  1.00 100.00 ? 111  ASN A CB  1 
ATOM   631   C  CG  . ASN A  1 80  ? 8.277   52.632  40.681  1.00 100.00 ? 111  ASN A CG  1 
ATOM   632   O  OD1 . ASN A  1 80  ? 9.099   53.546  40.613  1.00 100.00 ? 111  ASN A OD1 1 
ATOM   633   N  ND2 . ASN A  1 80  ? 7.519   52.413  41.747  1.00 100.00 ? 111  ASN A ND2 1 
ATOM   634   N  N   . PHE A  1 81  ? 11.509  51.007  38.859  1.00 100.00 ? 112  PHE A N   1 
ATOM   635   C  CA  . PHE A  1 81  ? 12.663  50.198  39.229  1.00 100.00 ? 112  PHE A CA  1 
ATOM   636   C  C   . PHE A  1 81  ? 12.647  49.887  40.716  1.00 100.00 ? 112  PHE A C   1 
ATOM   637   O  O   . PHE A  1 81  ? 12.607  50.915  41.231  1.00 100.00 ? 112  PHE A O   1 
ATOM   638   C  CB  . PHE A  1 81  ? 13.960  50.912  38.850  1.00 100.00 ? 112  PHE A CB  1 
ATOM   639   C  CG  . PHE A  1 81  ? 15.142  50.318  38.149  1.00 100.00 ? 112  PHE A CG  1 
ATOM   640   C  CD1 . PHE A  1 81  ? 15.673  49.112  38.569  1.00 100.00 ? 112  PHE A CD1 1 
ATOM   641   C  CD2 . PHE A  1 81  ? 15.720  50.966  37.071  1.00 100.00 ? 112  PHE A CD2 1 
ATOM   642   C  CE1 . PHE A  1 81  ? 16.763  48.559  37.924  1.00 100.00 ? 112  PHE A CE1 1 
ATOM   643   C  CE2 . PHE A  1 81  ? 16.811  50.419  36.421  1.00 100.00 ? 112  PHE A CE2 1 
ATOM   644   C  CZ  . PHE A  1 81  ? 17.334  49.214  36.849  1.00 100.00 ? 112  PHE A CZ  1 
ATOM   645   N  N   . PHE A  1 82  ? 11.969  48.801  41.083  1.00 100.00 ? 113  PHE A N   1 
ATOM   646   C  CA  . PHE A  1 82  ? 11.949  48.400  42.491  1.00 100.00 ? 113  PHE A CA  1 
ATOM   647   C  C   . PHE A  1 82  ? 13.374  48.401  43.035  1.00 100.00 ? 113  PHE A C   1 
ATOM   648   O  O   . PHE A  1 82  ? 13.691  49.118  43.979  1.00 100.00 ? 113  PHE A O   1 
ATOM   649   C  CB  . PHE A  1 82  ? 11.343  47.005  42.665  1.00 99.36  ? 113  PHE A CB  1 
ATOM   650   C  CG  . PHE A  1 82  ? 9.856   46.980  42.460  1.00 98.56  ? 113  PHE A CG  1 
ATOM   651   C  CD1 . PHE A  1 82  ? 9.310   47.459  41.280  1.00 98.20  ? 113  PHE A CD1 1 
ATOM   652   C  CD2 . PHE A  1 82  ? 9.008   46.487  43.435  1.00 97.73  ? 113  PHE A CD2 1 
ATOM   653   C  CE1 . PHE A  1 82  ? 7.946   47.447  41.075  1.00 97.95  ? 113  PHE A CE1 1 
ATOM   654   C  CE2 . PHE A  1 82  ? 7.641   46.470  43.238  1.00 97.12  ? 113  PHE A CE2 1 
ATOM   655   C  CZ  . PHE A  1 82  ? 7.111   46.950  42.056  1.00 97.61  ? 113  PHE A CZ  1 
ATOM   656   N  N   . PRO A  1 83  ? 14.233  47.642  42.365  1.00 100.00 ? 114  PRO A N   1 
ATOM   657   C  CA  . PRO A  1 83  ? 15.614  47.514  42.758  1.00 100.00 ? 114  PRO A CA  1 
ATOM   658   C  C   . PRO A  1 83  ? 16.437  48.766  42.611  1.00 99.85  ? 114  PRO A C   1 
ATOM   659   O  O   . PRO A  1 83  ? 17.669  48.714  42.793  1.00 100.00 ? 114  PRO A O   1 
ATOM   660   C  CB  . PRO A  1 83  ? 16.125  46.322  41.967  1.00 100.00 ? 114  PRO A CB  1 
ATOM   661   C  CG  . PRO A  1 83  ? 15.012  45.790  41.154  1.00 100.00 ? 114  PRO A CG  1 
ATOM   662   C  CD  . PRO A  1 83  ? 13.887  46.769  41.214  1.00 100.00 ? 114  PRO A CD  1 
ATOM   663   N  N   . ARG A  1 84  ? 15.909  49.863  42.025  1.00 99.13  ? 115  ARG A N   1 
ATOM   664   C  CA  . ARG A  1 84  ? 16.795  50.961  41.717  1.00 97.74  ? 115  ARG A CA  1 
ATOM   665   C  C   . ARG A  1 84  ? 16.321  52.368  42.041  1.00 96.10  ? 115  ARG A C   1 
ATOM   666   O  O   . ARG A  1 84  ? 15.124  52.658  41.986  1.00 96.10  ? 115  ARG A O   1 
ATOM   667   C  CB  . ARG A  1 84  ? 17.297  50.917  40.277  1.00 98.94  ? 115  ARG A CB  1 
ATOM   668   C  CG  . ARG A  1 84  ? 17.858  49.569  39.857  1.00 99.49  ? 115  ARG A CG  1 
ATOM   669   C  CD  . ARG A  1 84  ? 16.753  48.539  39.696  1.00 100.00 ? 115  ARG A CD  1 
ATOM   670   N  NE  . ARG A  1 84  ? 17.283  47.184  39.576  1.00 100.00 ? 115  ARG A NE  1 
ATOM   671   C  CZ  . ARG A  1 84  ? 17.966  46.741  38.526  1.00 99.83  ? 115  ARG A CZ  1 
ATOM   672   N  NH1 . ARG A  1 84  ? 18.204  47.547  37.501  1.00 100.00 ? 115  ARG A NH1 1 
ATOM   673   N  NH2 . ARG A  1 84  ? 18.409  45.491  38.504  1.00 98.95  ? 115  ARG A NH2 1 
ATOM   674   N  N   . LYS A  1 85  ? 17.385  53.086  42.344  1.00 93.63  ? 116  LYS A N   1 
ATOM   675   C  CA  . LYS A  1 85  ? 17.481  54.484  42.707  1.00 90.12  ? 116  LYS A CA  1 
ATOM   676   C  C   . LYS A  1 85  ? 18.976  54.686  42.898  1.00 87.21  ? 116  LYS A C   1 
ATOM   677   O  O   . LYS A  1 85  ? 19.479  54.638  44.019  1.00 86.28  ? 116  LYS A O   1 
ATOM   678   C  CB  . LYS A  1 85  ? 16.644  54.793  43.953  1.00 89.93  ? 116  LYS A CB  1 
ATOM   679   C  CG  . LYS A  1 85  ? 17.049  56.077  44.668  1.00 89.01  ? 116  LYS A CG  1 
ATOM   680   C  CD  . LYS A  1 85  ? 15.908  56.631  45.507  1.00 88.39  ? 116  LYS A CD  1 
ATOM   681   C  CE  . LYS A  1 85  ? 15.517  58.030  45.056  1.00 87.55  ? 116  LYS A CE  1 
ATOM   682   N  NZ  . LYS A  1 85  ? 14.492  58.637  45.950  1.00 86.18  ? 116  LYS A NZ  1 
ATOM   683   N  N   . PRO A  1 86  ? 19.692  54.909  41.786  1.00 84.25  ? 117  PRO A N   1 
ATOM   684   C  CA  . PRO A  1 86  ? 21.155  54.900  41.761  1.00 81.03  ? 117  PRO A CA  1 
ATOM   685   C  C   . PRO A  1 86  ? 21.819  55.852  42.724  1.00 77.62  ? 117  PRO A C   1 
ATOM   686   O  O   . PRO A  1 86  ? 21.217  56.840  43.147  1.00 77.54  ? 117  PRO A O   1 
ATOM   687   C  CB  . PRO A  1 86  ? 21.505  55.305  40.330  1.00 82.55  ? 117  PRO A CB  1 
ATOM   688   C  CG  . PRO A  1 86  ? 20.295  54.953  39.542  1.00 83.64  ? 117  PRO A CG  1 
ATOM   689   C  CD  . PRO A  1 86  ? 19.136  55.208  40.459  1.00 83.94  ? 117  PRO A CD  1 
ATOM   690   N  N   . LYS A  1 87  ? 23.053  55.480  43.013  1.00 73.33  ? 118  LYS A N   1 
ATOM   691   C  CA  . LYS A  1 87  ? 23.920  56.213  43.900  1.00 68.74  ? 118  LYS A CA  1 
ATOM   692   C  C   . LYS A  1 87  ? 25.359  55.767  43.676  1.00 65.38  ? 118  LYS A C   1 
ATOM   693   O  O   . LYS A  1 87  ? 25.593  54.659  43.195  1.00 65.52  ? 118  LYS A O   1 
ATOM   694   C  CB  . LYS A  1 87  ? 23.491  56.002  45.353  1.00 69.94  ? 118  LYS A CB  1 
ATOM   695   C  CG  . LYS A  1 87  ? 23.666  57.223  46.238  1.00 70.42  ? 118  LYS A CG  1 
ATOM   696   C  CD  . LYS A  1 87  ? 23.256  56.926  47.671  1.00 74.01  ? 118  LYS A CD  1 
ATOM   697   C  CE  . LYS A  1 87  ? 23.786  57.982  48.627  1.00 75.16  ? 118  LYS A CE  1 
ATOM   698   N  NZ  . LYS A  1 87  ? 23.643  57.565  50.049  1.00 76.38  ? 118  LYS A NZ  1 
ATOM   699   N  N   . TRP A  1 88  ? 26.305  56.634  43.993  1.00 60.96  ? 119  TRP A N   1 
ATOM   700   C  CA  . TRP A  1 88  ? 27.701  56.167  43.885  1.00 56.58  ? 119  TRP A CA  1 
ATOM   701   C  C   . TRP A  1 88  ? 28.105  55.859  45.320  1.00 56.31  ? 119  TRP A C   1 
ATOM   702   O  O   . TRP A  1 88  ? 28.280  56.779  46.126  1.00 57.77  ? 119  TRP A O   1 
ATOM   703   C  CB  . TRP A  1 88  ? 28.577  57.177  43.195  1.00 53.31  ? 119  TRP A CB  1 
ATOM   704   C  CG  . TRP A  1 88  ? 28.464  57.284  41.707  1.00 46.63  ? 119  TRP A CG  1 
ATOM   705   C  CD1 . TRP A  1 88  ? 28.089  58.371  40.973  1.00 45.71  ? 119  TRP A CD1 1 
ATOM   706   C  CD2 . TRP A  1 88  ? 28.754  56.255  40.755  1.00 42.88  ? 119  TRP A CD2 1 
ATOM   707   N  NE1 . TRP A  1 88  ? 28.125  58.087  39.634  1.00 43.98  ? 119  TRP A NE1 1 
ATOM   708   C  CE2 . TRP A  1 88  ? 28.526  56.786  39.473  1.00 42.45  ? 119  TRP A CE2 1 
ATOM   709   C  CE3 . TRP A  1 88  ? 29.183  54.932  40.863  1.00 40.98  ? 119  TRP A CE3 1 
ATOM   710   C  CZ2 . TRP A  1 88  ? 28.705  56.040  38.312  1.00 40.92  ? 119  TRP A CZ2 1 
ATOM   711   C  CZ3 . TRP A  1 88  ? 29.362  54.197  39.712  1.00 39.89  ? 119  TRP A CZ3 1 
ATOM   712   C  CH2 . TRP A  1 88  ? 29.127  54.750  38.450  1.00 40.14  ? 119  TRP A CH2 1 
ATOM   713   N  N   . ASP A  1 89  ? 28.209  54.590  45.687  1.00 54.89  ? 120  ASP A N   1 
ATOM   714   C  CA  . ASP A  1 89  ? 28.592  54.197  47.033  1.00 53.26  ? 120  ASP A CA  1 
ATOM   715   C  C   . ASP A  1 89  ? 29.911  54.801  47.480  1.00 50.90  ? 120  ASP A C   1 
ATOM   716   O  O   . ASP A  1 89  ? 30.503  54.358  48.462  1.00 50.79  ? 120  ASP A O   1 
ATOM   717   C  CB  . ASP A  1 89  ? 28.570  52.685  47.203  1.00 53.94  ? 120  ASP A CB  1 
ATOM   718   C  CG  . ASP A  1 89  ? 29.340  51.930  46.146  1.00 55.28  ? 120  ASP A CG  1 
ATOM   719   O  OD1 . ASP A  1 89  ? 29.747  52.552  45.141  1.00 55.60  ? 120  ASP A OD1 1 
ATOM   720   O  OD2 . ASP A  1 89  ? 29.551  50.706  46.303  1.00 55.71  ? 120  ASP A OD2 1 
ATOM   721   N  N   . LYS A  1 90  ? 30.391  55.821  46.805  1.00 48.67  ? 121  LYS A N   1 
ATOM   722   C  CA  . LYS A  1 90  ? 31.579  56.581  47.056  1.00 45.88  ? 121  LYS A CA  1 
ATOM   723   C  C   . LYS A  1 90  ? 31.451  58.027  46.590  1.00 44.77  ? 121  LYS A C   1 
ATOM   724   O  O   . LYS A  1 90  ? 30.623  58.360  45.744  1.00 43.91  ? 121  LYS A O   1 
ATOM   725   C  CB  . LYS A  1 90  ? 32.799  55.916  46.420  1.00 45.08  ? 121  LYS A CB  1 
ATOM   726   C  CG  . LYS A  1 90  ? 32.503  55.026  45.233  1.00 44.84  ? 121  LYS A CG  1 
ATOM   727   C  CD  . LYS A  1 90  ? 33.072  55.577  43.939  1.00 44.38  ? 121  LYS A CD  1 
ATOM   728   C  CE  . LYS A  1 90  ? 33.784  54.493  43.149  1.00 43.45  ? 121  LYS A CE  1 
ATOM   729   N  NZ  . LYS A  1 90  ? 33.153  53.159  43.344  1.00 44.34  ? 121  LYS A NZ  1 
ATOM   730   N  N   . ASN A  1 91  ? 32.274  58.911  47.148  1.00 43.96  ? 122  ASN A N   1 
ATOM   731   C  CA  . ASN A  1 91  ? 32.255  60.317  46.772  1.00 43.47  ? 122  ASN A CA  1 
ATOM   732   C  C   . ASN A  1 91  ? 33.420  60.661  45.853  1.00 41.27  ? 122  ASN A C   1 
ATOM   733   O  O   . ASN A  1 91  ? 33.589  61.801  45.438  1.00 42.04  ? 122  ASN A O   1 
ATOM   734   C  CB  . ASN A  1 91  ? 32.263  61.224  47.996  1.00 46.25  ? 122  ASN A CB  1 
ATOM   735   C  CG  . ASN A  1 91  ? 31.011  61.075  48.837  1.00 49.62  ? 122  ASN A CG  1 
ATOM   736   O  OD1 . ASN A  1 91  ? 29.995  60.537  48.398  1.00 51.24  ? 122  ASN A OD1 1 
ATOM   737   N  ND2 . ASN A  1 91  ? 31.069  61.551  50.073  1.00 51.45  ? 122  ASN A ND2 1 
ATOM   738   N  N   . GLN A  1 92  ? 34.207  59.650  45.547  1.00 39.27  ? 123  GLN A N   1 
ATOM   739   C  CA  . GLN A  1 92  ? 35.352  59.767  44.659  1.00 37.68  ? 123  GLN A CA  1 
ATOM   740   C  C   . GLN A  1 92  ? 35.116  58.896  43.427  1.00 35.46  ? 123  GLN A C   1 
ATOM   741   O  O   . GLN A  1 92  ? 35.187  57.676  43.507  1.00 35.50  ? 123  GLN A O   1 
ATOM   742   C  CB  . GLN A  1 92  ? 36.614  59.327  45.405  1.00 39.97  ? 123  GLN A CB  1 
ATOM   743   C  CG  . GLN A  1 92  ? 36.737  59.869  46.815  1.00 43.40  ? 123  GLN A CG  1 
ATOM   744   C  CD  . GLN A  1 92  ? 36.297  58.924  47.909  1.00 45.68  ? 123  GLN A CD  1 
ATOM   745   O  OE1 . GLN A  1 92  ? 35.256  58.270  47.854  1.00 44.03  ? 123  GLN A OE1 1 
ATOM   746   N  NE2 . GLN A  1 92  ? 37.107  58.837  48.970  1.00 47.08  ? 123  GLN A NE2 1 
ATOM   747   N  N   . ILE A  1 93  ? 34.721  59.522  42.333  1.00 32.82  ? 124  ILE A N   1 
ATOM   748   C  CA  . ILE A  1 93  ? 34.422  58.810  41.094  1.00 30.91  ? 124  ILE A CA  1 
ATOM   749   C  C   . ILE A  1 93  ? 35.601  58.979  40.136  1.00 28.97  ? 124  ILE A C   1 
ATOM   750   O  O   . ILE A  1 93  ? 36.365  59.931  40.284  1.00 28.49  ? 124  ILE A O   1 
ATOM   751   C  CB  . ILE A  1 93  ? 33.161  59.382  40.417  1.00 31.99  ? 124  ILE A CB  1 
ATOM   752   C  CG1 . ILE A  1 93  ? 32.108  59.798  41.439  1.00 31.83  ? 124  ILE A CG1 1 
ATOM   753   C  CG2 . ILE A  1 93  ? 32.562  58.412  39.419  1.00 32.12  ? 124  ILE A CG2 1 
ATOM   754   C  CD1 . ILE A  1 93  ? 31.603  58.673  42.311  1.00 31.33  ? 124  ILE A CD1 1 
ATOM   755   N  N   . THR A  1 94  ? 35.744  58.047  39.211  1.00 27.15  ? 125  THR A N   1 
ATOM   756   C  CA  . THR A  1 94  ? 36.818  58.127  38.225  1.00 27.64  ? 125  THR A CA  1 
ATOM   757   C  C   . THR A  1 94  ? 36.200  58.028  36.830  1.00 27.97  ? 125  THR A C   1 
ATOM   758   O  O   . THR A  1 94  ? 35.290  57.218  36.646  1.00 27.14  ? 125  THR A O   1 
ATOM   759   C  CB  . THR A  1 94  ? 37.844  56.997  38.405  1.00 27.59  ? 125  THR A CB  1 
ATOM   760   O  OG1 . THR A  1 94  ? 37.193  55.741  38.152  1.00 27.47  ? 125  THR A OG1 1 
ATOM   761   C  CG2 . THR A  1 94  ? 38.422  56.948  39.805  1.00 27.11  ? 125  THR A CG2 1 
ATOM   762   N  N   . TYR A  1 95  ? 36.673  58.843  35.893  1.00 27.43  ? 126  TYR A N   1 
ATOM   763   C  CA  . TYR A  1 95  ? 36.166  58.786  34.523  1.00 24.91  ? 126  TYR A CA  1 
ATOM   764   C  C   . TYR A  1 95  ? 37.293  58.499  33.536  1.00 24.22  ? 126  TYR A C   1 
ATOM   765   O  O   . TYR A  1 95  ? 38.459  58.606  33.920  1.00 22.79  ? 126  TYR A O   1 
ATOM   766   C  CB  . TYR A  1 95  ? 35.428  60.054  34.140  1.00 23.10  ? 126  TYR A CB  1 
ATOM   767   C  CG  . TYR A  1 95  ? 36.243  61.316  34.071  1.00 19.99  ? 126  TYR A CG  1 
ATOM   768   C  CD1 . TYR A  1 95  ? 36.599  62.021  35.209  1.00 18.05  ? 126  TYR A CD1 1 
ATOM   769   C  CD2 . TYR A  1 95  ? 36.652  61.827  32.854  1.00 20.41  ? 126  TYR A CD2 1 
ATOM   770   C  CE1 . TYR A  1 95  ? 37.339  63.198  35.138  1.00 17.85  ? 126  TYR A CE1 1 
ATOM   771   C  CE2 . TYR A  1 95  ? 37.395  62.990  32.778  1.00 18.95  ? 126  TYR A CE2 1 
ATOM   772   C  CZ  . TYR A  1 95  ? 37.728  63.682  33.915  1.00 18.50  ? 126  TYR A CZ  1 
ATOM   773   O  OH  . TYR A  1 95  ? 38.468  64.836  33.792  1.00 16.58  ? 126  TYR A OH  1 
ATOM   774   N  N   . ARG A  1 96  ? 36.950  58.244  32.288  1.00 23.43  ? 127  ARG A N   1 
ATOM   775   C  CA  . ARG A  1 96  ? 37.975  57.997  31.270  1.00 23.63  ? 127  ARG A CA  1 
ATOM   776   C  C   . ARG A  1 96  ? 37.480  58.239  29.856  1.00 23.74  ? 127  ARG A C   1 
ATOM   777   O  O   . ARG A  1 96  ? 36.459  57.692  29.418  1.00 22.45  ? 127  ARG A O   1 
ATOM   778   C  CB  . ARG A  1 96  ? 38.536  56.583  31.435  1.00 23.62  ? 127  ARG A CB  1 
ATOM   779   C  CG  . ARG A  1 96  ? 39.536  56.181  30.371  1.00 25.73  ? 127  ARG A CG  1 
ATOM   780   C  CD  . ARG A  1 96  ? 39.970  54.742  30.502  1.00 25.54  ? 127  ARG A CD  1 
ATOM   781   N  NE  . ARG A  1 96  ? 40.480  54.189  29.251  1.00 26.08  ? 127  ARG A NE  1 
ATOM   782   C  CZ  . ARG A  1 96  ? 41.011  52.976  29.141  1.00 24.98  ? 127  ARG A CZ  1 
ATOM   783   N  NH1 . ARG A  1 96  ? 41.097  52.187  30.191  1.00 25.28  ? 127  ARG A NH1 1 
ATOM   784   N  NH2 . ARG A  1 96  ? 41.417  52.577  27.947  1.00 22.90  ? 127  ARG A NH2 1 
ATOM   785   N  N   . ILE A  1 97  ? 38.204  59.089  29.129  1.00 23.30  ? 128  ILE A N   1 
ATOM   786   C  CA  . ILE A  1 97  ? 37.808  59.428  27.757  1.00 23.13  ? 128  ILE A CA  1 
ATOM   787   C  C   . ILE A  1 97  ? 38.136  58.262  26.837  1.00 24.40  ? 128  ILE A C   1 
ATOM   788   O  O   . ILE A  1 97  ? 39.334  58.078  26.581  1.00 27.15  ? 128  ILE A O   1 
ATOM   789   C  CB  . ILE A  1 97  ? 38.491  60.700  27.233  1.00 20.08  ? 128  ILE A CB  1 
ATOM   790   C  CG1 . ILE A  1 97  ? 38.712  61.691  28.366  1.00 19.24  ? 128  ILE A CG1 1 
ATOM   791   C  CG2 . ILE A  1 97  ? 37.645  61.335  26.138  1.00 17.86  ? 128  ILE A CG2 1 
ATOM   792   C  CD1 . ILE A  1 97  ? 37.494  62.434  28.819  1.00 17.84  ? 128  ILE A CD1 1 
ATOM   793   N  N   . ILE A  1 98  ? 37.185  57.436  26.479  1.00 23.71  ? 129  ILE A N   1 
ATOM   794   C  CA  . ILE A  1 98  ? 37.483  56.241  25.704  1.00 24.32  ? 129  ILE A CA  1 
ATOM   795   C  C   . ILE A  1 98  ? 37.814  56.553  24.247  1.00 23.80  ? 129  ILE A C   1 
ATOM   796   O  O   . ILE A  1 98  ? 38.476  55.881  23.446  1.00 21.84  ? 129  ILE A O   1 
ATOM   797   C  CB  . ILE A  1 98  ? 36.373  55.191  25.784  1.00 25.37  ? 129  ILE A CB  1 
ATOM   798   C  CG1 . ILE A  1 98  ? 36.285  54.526  27.148  1.00 26.75  ? 129  ILE A CG1 1 
ATOM   799   C  CG2 . ILE A  1 98  ? 36.520  54.134  24.699  1.00 26.03  ? 129  ILE A CG2 1 
ATOM   800   C  CD1 . ILE A  1 98  ? 37.585  54.030  27.726  1.00 25.26  ? 129  ILE A CD1 1 
ATOM   801   N  N   . GLY A  1 99  ? 37.167  57.634  23.799  1.00 24.18  ? 130  GLY A N   1 
ATOM   802   C  CA  . GLY A  1 99  ? 37.228  58.126  22.439  1.00 24.09  ? 130  GLY A CA  1 
ATOM   803   C  C   . GLY A  1 99  ? 36.831  59.594  22.339  1.00 22.41  ? 130  GLY A C   1 
ATOM   804   O  O   . GLY A  1 99  ? 36.467  60.199  23.333  1.00 22.08  ? 130  GLY A O   1 
ATOM   805   N  N   . TYR A  1 100 ? 37.129  60.211  21.196  1.00 22.62  ? 131  TYR A N   1 
ATOM   806   C  CA  . TYR A  1 100 ? 36.902  61.641  21.024  1.00 24.88  ? 131  TYR A CA  1 
ATOM   807   C  C   . TYR A  1 100 ? 36.043  61.939  19.804  1.00 25.75  ? 131  TYR A C   1 
ATOM   808   O  O   . TYR A  1 100 ? 35.515  61.051  19.124  1.00 30.01  ? 131  TYR A O   1 
ATOM   809   C  CB  . TYR A  1 100 ? 38.263  62.346  20.882  1.00 24.41  ? 131  TYR A CB  1 
ATOM   810   C  CG  . TYR A  1 100 ? 39.147  62.217  22.105  1.00 25.14  ? 131  TYR A CG  1 
ATOM   811   C  CD1 . TYR A  1 100 ? 39.080  63.124  23.158  1.00 24.95  ? 131  TYR A CD1 1 
ATOM   812   C  CD2 . TYR A  1 100 ? 40.048  61.169  22.211  1.00 27.85  ? 131  TYR A CD2 1 
ATOM   813   C  CE1 . TYR A  1 100 ? 39.894  62.976  24.272  1.00 24.46  ? 131  TYR A CE1 1 
ATOM   814   C  CE2 . TYR A  1 100 ? 40.828  61.024  23.324  1.00 29.38  ? 131  TYR A CE2 1 
ATOM   815   C  CZ  . TYR A  1 100 ? 40.768  61.934  24.354  1.00 27.03  ? 131  TYR A CZ  1 
ATOM   816   O  OH  . TYR A  1 100 ? 41.523  61.896  25.494  1.00 29.88  ? 131  TYR A OH  1 
ATOM   817   N  N   . THR A  1 101 ? 35.952  63.199  19.455  1.00 23.35  ? 132  THR A N   1 
ATOM   818   C  CA  . THR A  1 101 ? 35.283  63.701  18.273  1.00 21.88  ? 132  THR A CA  1 
ATOM   819   C  C   . THR A  1 101 ? 36.276  64.555  17.484  1.00 21.64  ? 132  THR A C   1 
ATOM   820   O  O   . THR A  1 101 ? 36.995  65.394  18.042  1.00 21.68  ? 132  THR A O   1 
ATOM   821   C  CB  . THR A  1 101 ? 34.063  64.581  18.653  1.00 22.53  ? 132  THR A CB  1 
ATOM   822   O  OG1 . THR A  1 101 ? 33.379  65.033  17.494  1.00 22.49  ? 132  THR A OG1 1 
ATOM   823   C  CG2 . THR A  1 101 ? 34.503  65.798  19.442  1.00 19.98  ? 132  THR A CG2 1 
ATOM   824   N  N   . PRO A  1 102 ? 36.375  64.405  16.170  1.00 19.92  ? 133  PRO A N   1 
ATOM   825   C  CA  . PRO A  1 102 ? 37.204  65.275  15.341  1.00 18.90  ? 133  PRO A CA  1 
ATOM   826   C  C   . PRO A  1 102 ? 36.838  66.744  15.424  1.00 19.84  ? 133  PRO A C   1 
ATOM   827   O  O   . PRO A  1 102 ? 37.701  67.607  15.246  1.00 21.95  ? 133  PRO A O   1 
ATOM   828   C  CB  . PRO A  1 102 ? 36.982  64.760  13.930  1.00 17.47  ? 133  PRO A CB  1 
ATOM   829   C  CG  . PRO A  1 102 ? 36.387  63.422  14.092  1.00 18.27  ? 133  PRO A CG  1 
ATOM   830   C  CD  . PRO A  1 102 ? 35.549  63.490  15.355  1.00 17.09  ? 133  PRO A CD  1 
ATOM   831   N  N   . ASP A  1 103 ? 35.597  67.122  15.676  1.00 19.44  ? 134  ASP A N   1 
ATOM   832   C  CA  . ASP A  1 103 ? 35.210  68.511  15.775  1.00 19.19  ? 134  ASP A CA  1 
ATOM   833   C  C   . ASP A  1 103 ? 36.074  69.354  16.693  1.00 17.49  ? 134  ASP A C   1 
ATOM   834   O  O   . ASP A  1 103 ? 36.184  70.585  16.566  1.00 15.91  ? 134  ASP A O   1 
ATOM   835   C  CB  . ASP A  1 103 ? 33.752  68.619  16.247  1.00 20.76  ? 134  ASP A CB  1 
ATOM   836   C  CG  . ASP A  1 103 ? 32.798  67.945  15.286  1.00 21.71  ? 134  ASP A CG  1 
ATOM   837   O  OD1 . ASP A  1 103 ? 33.120  67.924  14.077  1.00 20.02  ? 134  ASP A OD1 1 
ATOM   838   O  OD2 . ASP A  1 103 ? 31.751  67.435  15.737  1.00 24.48  ? 134  ASP A OD2 1 
ATOM   839   N  N   . LEU A  1 104 ? 36.517  68.749  17.789  1.00 18.07  ? 135  LEU A N   1 
ATOM   840   C  CA  . LEU A  1 104 ? 37.331  69.404  18.800  1.00 19.35  ? 135  LEU A CA  1 
ATOM   841   C  C   . LEU A  1 104 ? 38.676  68.715  18.962  1.00 21.70  ? 135  LEU A C   1 
ATOM   842   O  O   . LEU A  1 104 ? 38.822  67.521  18.720  1.00 22.66  ? 135  LEU A O   1 
ATOM   843   C  CB  . LEU A  1 104 ? 36.562  69.383  20.112  1.00 17.80  ? 135  LEU A CB  1 
ATOM   844   C  CG  . LEU A  1 104 ? 35.513  70.446  20.385  1.00 17.12  ? 135  LEU A CG  1 
ATOM   845   C  CD1 . LEU A  1 104 ? 34.826  70.930  19.132  1.00 18.90  ? 135  LEU A CD1 1 
ATOM   846   C  CD2 . LEU A  1 104 ? 34.508  69.993  21.392  1.00 15.00  ? 135  LEU A CD2 1 
ATOM   847   N  N   . ASP A  1 105 ? 39.704  69.459  19.345  1.00 24.05  ? 136  ASP A N   1 
ATOM   848   C  CA  . ASP A  1 105 ? 41.032  68.879  19.616  1.00 24.46  ? 136  ASP A CA  1 
ATOM   849   C  C   . ASP A  1 105 ? 40.958  68.223  20.998  1.00 24.92  ? 136  ASP A C   1 
ATOM   850   O  O   . ASP A  1 105 ? 40.107  68.599  21.803  1.00 23.92  ? 136  ASP A O   1 
ATOM   851   C  CB  . ASP A  1 105 ? 42.080  69.984  19.622  1.00 25.23  ? 136  ASP A CB  1 
ATOM   852   C  CG  . ASP A  1 105 ? 41.887  70.929  20.787  1.00 28.16  ? 136  ASP A CG  1 
ATOM   853   O  OD1 . ASP A  1 105 ? 42.163  70.531  21.936  1.00 30.05  ? 136  ASP A OD1 1 
ATOM   854   O  OD2 . ASP A  1 105 ? 41.454  72.082  20.561  1.00 28.68  ? 136  ASP A OD2 1 
ATOM   855   N  N   . PRO A  1 106 ? 41.832  67.289  21.279  1.00 25.38  ? 137  PRO A N   1 
ATOM   856   C  CA  . PRO A  1 106 ? 41.777  66.521  22.510  1.00 26.19  ? 137  PRO A CA  1 
ATOM   857   C  C   . PRO A  1 106 ? 41.723  67.358  23.756  1.00 27.25  ? 137  PRO A C   1 
ATOM   858   O  O   . PRO A  1 106 ? 40.970  67.026  24.665  1.00 28.13  ? 137  PRO A O   1 
ATOM   859   C  CB  . PRO A  1 106 ? 43.005  65.629  22.456  1.00 25.17  ? 137  PRO A CB  1 
ATOM   860   C  CG  . PRO A  1 106 ? 43.210  65.432  20.994  1.00 25.33  ? 137  PRO A CG  1 
ATOM   861   C  CD  . PRO A  1 106 ? 42.886  66.759  20.373  1.00 26.03  ? 137  PRO A CD  1 
ATOM   862   N  N   . GLU A  1 107 ? 42.516  68.411  23.822  1.00 28.64  ? 138  GLU A N   1 
ATOM   863   C  CA  . GLU A  1 107 ? 42.523  69.229  25.028  1.00 29.83  ? 138  GLU A CA  1 
ATOM   864   C  C   . GLU A  1 107 ? 41.191  69.908  25.284  1.00 28.97  ? 138  GLU A C   1 
ATOM   865   O  O   . GLU A  1 107 ? 40.725  69.941  26.423  1.00 27.61  ? 138  GLU A O   1 
ATOM   866   C  CB  . GLU A  1 107 ? 43.631  70.263  24.963  1.00 33.02  ? 138  GLU A CB  1 
ATOM   867   C  CG  . GLU A  1 107 ? 45.029  69.694  24.827  1.00 36.57  ? 138  GLU A CG  1 
ATOM   868   C  CD  . GLU A  1 107 ? 46.063  70.656  25.394  1.00 40.67  ? 138  GLU A CD  1 
ATOM   869   O  OE1 . GLU A  1 107 ? 46.267  70.625  26.626  1.00 42.81  ? 138  GLU A OE1 1 
ATOM   870   O  OE2 . GLU A  1 107 ? 46.648  71.427  24.614  1.00 40.98  ? 138  GLU A OE2 1 
ATOM   871   N  N   . THR A  1 108 ? 40.602  70.519  24.256  1.00 28.92  ? 139  THR A N   1 
ATOM   872   C  CA  . THR A  1 108 ? 39.311  71.211  24.473  1.00 28.90  ? 139  THR A CA  1 
ATOM   873   C  C   . THR A  1 108 ? 38.337  70.194  25.060  1.00 29.74  ? 139  THR A C   1 
ATOM   874   O  O   . THR A  1 108 ? 37.700  70.446  26.077  1.00 31.05  ? 139  THR A O   1 
ATOM   875   C  CB  . THR A  1 108 ? 38.729  71.684  23.132  1.00 29.14  ? 139  THR A CB  1 
ATOM   876   O  OG1 . THR A  1 108 ? 39.650  72.593  22.498  1.00 31.05  ? 139  THR A OG1 1 
ATOM   877   C  CG2 . THR A  1 108 ? 37.423  72.431  23.348  1.00 28.30  ? 139  THR A CG2 1 
ATOM   878   N  N   . VAL A  1 109 ? 38.177  69.076  24.362  1.00 28.49  ? 140  VAL A N   1 
ATOM   879   C  CA  . VAL A  1 109 ? 37.292  68.032  24.860  1.00 27.78  ? 140  VAL A CA  1 
ATOM   880   C  C   . VAL A  1 109 ? 37.641  67.718  26.312  1.00 26.89  ? 140  VAL A C   1 
ATOM   881   O  O   . VAL A  1 109 ? 36.911  68.040  27.240  1.00 26.63  ? 140  VAL A O   1 
ATOM   882   C  CB  . VAL A  1 109 ? 37.485  66.757  24.009  1.00 28.50  ? 140  VAL A CB  1 
ATOM   883   C  CG1 . VAL A  1 109 ? 36.384  65.751  24.307  1.00 29.15  ? 140  VAL A CG1 1 
ATOM   884   C  CG2 . VAL A  1 109 ? 37.447  67.150  22.535  1.00 28.18  ? 140  VAL A CG2 1 
ATOM   885   N  N   . ASP A  1 110 ? 38.844  67.231  26.543  1.00 26.70  ? 141  ASP A N   1 
ATOM   886   C  CA  . ASP A  1 110 ? 39.289  66.878  27.888  1.00 27.04  ? 141  ASP A CA  1 
ATOM   887   C  C   . ASP A  1 110 ? 38.817  67.933  28.888  1.00 25.75  ? 141  ASP A C   1 
ATOM   888   O  O   . ASP A  1 110 ? 38.336  67.613  29.967  1.00 24.06  ? 141  ASP A O   1 
ATOM   889   C  CB  . ASP A  1 110 ? 40.791  66.682  27.948  1.00 28.59  ? 141  ASP A CB  1 
ATOM   890   C  CG  . ASP A  1 110 ? 41.319  65.446  27.266  1.00 31.69  ? 141  ASP A CG  1 
ATOM   891   O  OD1 . ASP A  1 110 ? 40.567  64.461  27.061  1.00 33.86  ? 141  ASP A OD1 1 
ATOM   892   O  OD2 . ASP A  1 110 ? 42.526  65.452  26.930  1.00 32.82  ? 141  ASP A OD2 1 
ATOM   893   N  N   . ASP A  1 111 ? 38.995  69.189  28.521  1.00 25.51  ? 142  ASP A N   1 
ATOM   894   C  CA  . ASP A  1 111 ? 38.646  70.299  29.392  1.00 25.65  ? 142  ASP A CA  1 
ATOM   895   C  C   . ASP A  1 111 ? 37.143  70.404  29.608  1.00 24.83  ? 142  ASP A C   1 
ATOM   896   O  O   . ASP A  1 111 ? 36.670  70.629  30.715  1.00 24.27  ? 142  ASP A O   1 
ATOM   897   C  CB  . ASP A  1 111 ? 39.156  71.613  28.804  1.00 25.27  ? 142  ASP A CB  1 
ATOM   898   C  CG  . ASP A  1 111 ? 38.784  72.789  29.692  1.00 26.28  ? 142  ASP A CG  1 
ATOM   899   O  OD1 . ASP A  1 111 ? 39.290  72.828  30.831  1.00 25.84  ? 142  ASP A OD1 1 
ATOM   900   O  OD2 . ASP A  1 111 ? 37.984  73.633  29.226  1.00 29.46  ? 142  ASP A OD2 1 
ATOM   901   N  N   . ALA A  1 112 ? 36.414  70.247  28.518  1.00 23.35  ? 143  ALA A N   1 
ATOM   902   C  CA  . ALA A  1 112 ? 34.951  70.316  28.603  1.00 22.66  ? 143  ALA A CA  1 
ATOM   903   C  C   . ALA A  1 112 ? 34.449  69.290  29.593  1.00 22.30  ? 143  ALA A C   1 
ATOM   904   O  O   . ALA A  1 112 ? 33.850  69.583  30.618  1.00 19.89  ? 143  ALA A O   1 
ATOM   905   C  CB  . ALA A  1 112 ? 34.417  70.135  27.207  1.00 22.11  ? 143  ALA A CB  1 
ATOM   906   N  N   . PHE A  1 113 ? 34.818  68.018  29.389  1.00 22.71  ? 144  PHE A N   1 
ATOM   907   C  CA  . PHE A  1 113 ? 34.450  66.950  30.311  1.00 23.76  ? 144  PHE A CA  1 
ATOM   908   C  C   . PHE A  1 113 ? 34.865  67.304  31.726  1.00 25.23  ? 144  PHE A C   1 
ATOM   909   O  O   . PHE A  1 113 ? 34.303  66.870  32.711  1.00 27.29  ? 144  PHE A O   1 
ATOM   910   C  CB  . PHE A  1 113 ? 34.992  65.601  29.884  1.00 21.92  ? 144  PHE A CB  1 
ATOM   911   C  CG  . PHE A  1 113 ? 34.451  65.076  28.587  1.00 23.04  ? 144  PHE A CG  1 
ATOM   912   C  CD1 . PHE A  1 113 ? 33.096  65.175  28.300  1.00 22.80  ? 144  PHE A CD1 1 
ATOM   913   C  CD2 . PHE A  1 113 ? 35.286  64.468  27.664  1.00 22.77  ? 144  PHE A CD2 1 
ATOM   914   C  CE1 . PHE A  1 113 ? 32.609  64.723  27.109  1.00 22.89  ? 144  PHE A CE1 1 
ATOM   915   C  CE2 . PHE A  1 113 ? 34.777  64.008  26.476  1.00 23.07  ? 144  PHE A CE2 1 
ATOM   916   C  CZ  . PHE A  1 113 ? 33.441  64.118  26.175  1.00 22.49  ? 144  PHE A CZ  1 
ATOM   917   N  N   . ALA A  1 114 ? 35.970  68.034  31.853  1.00 26.58  ? 145  ALA A N   1 
ATOM   918   C  CA  . ALA A  1 114 ? 36.444  68.435  33.173  1.00 26.64  ? 145  ALA A CA  1 
ATOM   919   C  C   . ALA A  1 114 ? 35.501  69.458  33.792  1.00 26.93  ? 145  ALA A C   1 
ATOM   920   O  O   . ALA A  1 114 ? 35.039  69.255  34.911  1.00 27.73  ? 145  ALA A O   1 
ATOM   921   C  CB  . ALA A  1 114 ? 37.842  69.005  33.090  1.00 25.06  ? 145  ALA A CB  1 
ATOM   922   N  N   . ARG A  1 115 ? 35.234  70.515  33.033  1.00 27.35  ? 146  ARG A N   1 
ATOM   923   C  CA  . ARG A  1 115 ? 34.362  71.590  33.475  1.00 27.44  ? 146  ARG A CA  1 
ATOM   924   C  C   . ARG A  1 115 ? 32.943  71.100  33.703  1.00 28.51  ? 146  ARG A C   1 
ATOM   925   O  O   . ARG A  1 115 ? 32.272  71.596  34.602  1.00 29.60  ? 146  ARG A O   1 
ATOM   926   C  CB  . ARG A  1 115 ? 34.348  72.748  32.475  1.00 26.70  ? 146  ARG A CB  1 
ATOM   927   C  CG  . ARG A  1 115 ? 35.727  73.345  32.216  1.00 23.35  ? 146  ARG A CG  1 
ATOM   928   C  CD  . ARG A  1 115 ? 35.652  74.672  31.490  1.00 20.36  ? 146  ARG A CD  1 
ATOM   929   N  NE  . ARG A  1 115 ? 35.406  74.526  30.068  1.00 19.56  ? 146  ARG A NE  1 
ATOM   930   C  CZ  . ARG A  1 115 ? 34.215  74.615  29.490  1.00 21.20  ? 146  ARG A CZ  1 
ATOM   931   N  NH1 . ARG A  1 115 ? 33.142  74.872  30.217  1.00 22.65  ? 146  ARG A NH1 1 
ATOM   932   N  NH2 . ARG A  1 115 ? 34.123  74.453  28.181  1.00 22.40  ? 146  ARG A NH2 1 
ATOM   933   N  N   . ALA A  1 116 ? 32.505  70.169  32.864  1.00 29.07  ? 147  ALA A N   1 
ATOM   934   C  CA  . ALA A  1 116 ? 31.184  69.571  33.040  1.00 29.64  ? 147  ALA A CA  1 
ATOM   935   C  C   . ALA A  1 116 ? 31.076  68.906  34.411  1.00 30.34  ? 147  ALA A C   1 
ATOM   936   O  O   . ALA A  1 116 ? 30.063  69.083  35.085  1.00 30.35  ? 147  ALA A O   1 
ATOM   937   C  CB  . ALA A  1 116 ? 30.963  68.536  31.950  1.00 29.96  ? 147  ALA A CB  1 
ATOM   938   N  N   . PHE A  1 117 ? 32.119  68.171  34.789  1.00 30.45  ? 148  PHE A N   1 
ATOM   939   C  CA  . PHE A  1 117 ? 32.191  67.465  36.046  1.00 30.85  ? 148  PHE A CA  1 
ATOM   940   C  C   . PHE A  1 117 ? 32.275  68.432  37.221  1.00 31.83  ? 148  PHE A C   1 
ATOM   941   O  O   . PHE A  1 117 ? 31.641  68.187  38.243  1.00 33.02  ? 148  PHE A O   1 
ATOM   942   C  CB  . PHE A  1 117 ? 33.380  66.503  36.124  1.00 30.60  ? 148  PHE A CB  1 
ATOM   943   C  CG  . PHE A  1 117 ? 33.162  65.156  35.512  1.00 30.90  ? 148  PHE A CG  1 
ATOM   944   C  CD1 . PHE A  1 117 ? 32.168  64.315  35.971  1.00 31.11  ? 148  PHE A CD1 1 
ATOM   945   C  CD2 . PHE A  1 117 ? 33.953  64.717  34.466  1.00 29.64  ? 148  PHE A CD2 1 
ATOM   946   C  CE1 . PHE A  1 117 ? 31.968  63.074  35.394  1.00 31.39  ? 148  PHE A CE1 1 
ATOM   947   C  CE2 . PHE A  1 117 ? 33.758  63.489  33.881  1.00 29.37  ? 148  PHE A CE2 1 
ATOM   948   C  CZ  . PHE A  1 117 ? 32.763  62.664  34.355  1.00 30.11  ? 148  PHE A CZ  1 
ATOM   949   N  N   . GLN A  1 118 ? 33.041  69.511  37.107  1.00 32.79  ? 149  GLN A N   1 
ATOM   950   C  CA  . GLN A  1 118 ? 33.135  70.451  38.227  1.00 35.07  ? 149  GLN A CA  1 
ATOM   951   C  C   . GLN A  1 118 ? 31.765  71.005  38.592  1.00 34.81  ? 149  GLN A C   1 
ATOM   952   O  O   . GLN A  1 118 ? 31.446  71.217  39.772  1.00 35.37  ? 149  GLN A O   1 
ATOM   953   C  CB  . GLN A  1 118 ? 34.128  71.571  37.939  1.00 37.84  ? 149  GLN A CB  1 
ATOM   954   C  CG  . GLN A  1 118 ? 34.419  72.497  39.098  1.00 43.96  ? 149  GLN A CG  1 
ATOM   955   C  CD  . GLN A  1 118 ? 34.836  73.898  38.716  1.00 49.40  ? 149  GLN A CD  1 
ATOM   956   O  OE1 . GLN A  1 118 ? 34.731  74.354  37.574  1.00 52.30  ? 149  GLN A OE1 1 
ATOM   957   N  NE2 . GLN A  1 118 ? 35.331  74.661  39.700  1.00 51.22  ? 149  GLN A NE2 1 
ATOM   958   N  N   . VAL A  1 119 ? 30.907  71.231  37.606  1.00 32.46  ? 150  VAL A N   1 
ATOM   959   C  CA  . VAL A  1 119 ? 29.568  71.733  37.824  1.00 31.50  ? 150  VAL A CA  1 
ATOM   960   C  C   . VAL A  1 119 ? 28.887  71.079  39.013  1.00 32.72  ? 150  VAL A C   1 
ATOM   961   O  O   . VAL A  1 119 ? 28.181  71.745  39.760  1.00 32.25  ? 150  VAL A O   1 
ATOM   962   C  CB  . VAL A  1 119 ? 28.684  71.561  36.575  1.00 30.66  ? 150  VAL A CB  1 
ATOM   963   C  CG1 . VAL A  1 119 ? 27.243  71.944  36.841  1.00 29.34  ? 150  VAL A CG1 1 
ATOM   964   C  CG2 . VAL A  1 119 ? 29.242  72.420  35.444  1.00 31.06  ? 150  VAL A CG2 1 
ATOM   965   N  N   . TRP A  1 120 ? 28.992  69.763  39.111  1.00 34.69  ? 151  TRP A N   1 
ATOM   966   C  CA  . TRP A  1 120 ? 28.370  69.005  40.192  1.00 36.14  ? 151  TRP A CA  1 
ATOM   967   C  C   . TRP A  1 120 ? 29.315  68.900  41.385  1.00 37.66  ? 151  TRP A C   1 
ATOM   968   O  O   . TRP A  1 120 ? 28.893  68.750  42.533  1.00 38.65  ? 151  TRP A O   1 
ATOM   969   C  CB  . TRP A  1 120 ? 28.037  67.577  39.731  1.00 33.53  ? 151  TRP A CB  1 
ATOM   970   C  CG  . TRP A  1 120 ? 27.134  67.559  38.535  1.00 29.62  ? 151  TRP A CG  1 
ATOM   971   C  CD1 . TRP A  1 120 ? 27.493  67.193  37.270  1.00 29.07  ? 151  TRP A CD1 1 
ATOM   972   C  CD2 . TRP A  1 120 ? 25.763  67.954  38.482  1.00 27.65  ? 151  TRP A CD2 1 
ATOM   973   N  NE1 . TRP A  1 120 ? 26.421  67.316  36.437  1.00 29.01  ? 151  TRP A NE1 1 
ATOM   974   C  CE2 . TRP A  1 120 ? 25.353  67.773  37.153  1.00 27.46  ? 151  TRP A CE2 1 
ATOM   975   C  CE3 . TRP A  1 120 ? 24.848  68.410  39.415  1.00 27.55  ? 151  TRP A CE3 1 
ATOM   976   C  CZ2 . TRP A  1 120 ? 24.060  68.069  36.724  1.00 27.70  ? 151  TRP A CZ2 1 
ATOM   977   C  CZ3 . TRP A  1 120 ? 23.562  68.704  39.007  1.00 27.86  ? 151  TRP A CZ3 1 
ATOM   978   C  CH2 . TRP A  1 120 ? 23.184  68.519  37.672  1.00 29.11  ? 151  TRP A CH2 1 
ATOM   979   N  N   . SER A  1 121 ? 30.610  68.990  41.103  1.00 38.19  ? 152  SER A N   1 
ATOM   980   C  CA  . SER A  1 121 ? 31.596  68.952  42.168  1.00 39.46  ? 152  SER A CA  1 
ATOM   981   C  C   . SER A  1 121 ? 31.543  70.217  43.013  1.00 40.05  ? 152  SER A C   1 
ATOM   982   O  O   . SER A  1 121 ? 31.949  70.196  44.174  1.00 40.11  ? 152  SER A O   1 
ATOM   983   C  CB  . SER A  1 121 ? 33.004  68.779  41.595  1.00 38.84  ? 152  SER A CB  1 
ATOM   984   O  OG  . SER A  1 121 ? 33.908  68.513  42.659  1.00 43.73  ? 152  SER A OG  1 
ATOM   985   N  N   . ASP A  1 122 ? 31.029  71.308  42.442  1.00 40.02  ? 153  ASP A N   1 
ATOM   986   C  CA  . ASP A  1 122 ? 30.953  72.563  43.166  1.00 40.86  ? 153  ASP A CA  1 
ATOM   987   C  C   . ASP A  1 122 ? 29.898  72.565  44.260  1.00 40.49  ? 153  ASP A C   1 
ATOM   988   O  O   . ASP A  1 122 ? 29.988  73.360  45.199  1.00 40.14  ? 153  ASP A O   1 
ATOM   989   C  CB  . ASP A  1 122 ? 30.695  73.743  42.234  1.00 42.34  ? 153  ASP A CB  1 
ATOM   990   C  CG  . ASP A  1 122 ? 31.827  74.021  41.270  1.00 43.38  ? 153  ASP A CG  1 
ATOM   991   O  OD1 . ASP A  1 122 ? 32.965  73.580  41.524  1.00 44.77  ? 153  ASP A OD1 1 
ATOM   992   O  OD2 . ASP A  1 122 ? 31.568  74.694  40.248  1.00 42.32  ? 153  ASP A OD2 1 
ATOM   993   N  N   . VAL A  1 123 ? 28.870  71.738  44.096  1.00 40.31  ? 154  VAL A N   1 
ATOM   994   C  CA  . VAL A  1 123 ? 27.786  71.725  45.066  1.00 40.55  ? 154  VAL A CA  1 
ATOM   995   C  C   . VAL A  1 123 ? 27.634  70.414  45.801  1.00 41.59  ? 154  VAL A C   1 
ATOM   996   O  O   . VAL A  1 123 ? 26.604  70.182  46.453  1.00 43.16  ? 154  VAL A O   1 
ATOM   997   C  CB  . VAL A  1 123 ? 26.455  72.096  44.378  1.00 39.54  ? 154  VAL A CB  1 
ATOM   998   C  CG1 . VAL A  1 123 ? 26.551  73.486  43.766  1.00 36.90  ? 154  VAL A CG1 1 
ATOM   999   C  CG2 . VAL A  1 123 ? 26.070  71.062  43.335  1.00 38.44  ? 154  VAL A CG2 1 
ATOM   1000  N  N   . THR A  1 124 ? 28.570  69.483  45.633  1.00 41.00  ? 155  THR A N   1 
ATOM   1001  C  CA  . THR A  1 124 ? 28.468  68.189  46.318  1.00 40.19  ? 155  THR A CA  1 
ATOM   1002  C  C   . THR A  1 124 ? 29.829  67.752  46.849  1.00 40.70  ? 155  THR A C   1 
ATOM   1003  O  O   . THR A  1 124 ? 30.859  68.338  46.494  1.00 42.62  ? 155  THR A O   1 
ATOM   1004  C  CB  . THR A  1 124 ? 27.936  67.115  45.353  1.00 39.48  ? 155  THR A CB  1 
ATOM   1005  O  OG1 . THR A  1 124 ? 29.016  66.566  44.583  1.00 39.37  ? 155  THR A OG1 1 
ATOM   1006  C  CG2 . THR A  1 124 ? 26.844  67.611  44.434  1.00 38.04  ? 155  THR A CG2 1 
ATOM   1007  N  N   . PRO A  1 125 ? 29.900  66.690  47.630  1.00 39.69  ? 156  PRO A N   1 
ATOM   1008  C  CA  . PRO A  1 125 ? 31.167  66.150  48.102  1.00 38.22  ? 156  PRO A CA  1 
ATOM   1009  C  C   . PRO A  1 125 ? 31.903  65.463  46.948  1.00 38.02  ? 156  PRO A C   1 
ATOM   1010  O  O   . PRO A  1 125 ? 33.109  65.243  46.991  1.00 38.36  ? 156  PRO A O   1 
ATOM   1011  C  CB  . PRO A  1 125 ? 30.756  65.089  49.120  1.00 37.60  ? 156  PRO A CB  1 
ATOM   1012  C  CG  . PRO A  1 125 ? 29.349  65.410  49.473  1.00 38.42  ? 156  PRO A CG  1 
ATOM   1013  C  CD  . PRO A  1 125 ? 28.755  65.923  48.178  1.00 39.91  ? 156  PRO A CD  1 
ATOM   1014  N  N   . LEU A  1 126 ? 31.127  65.087  45.939  1.00 37.16  ? 157  LEU A N   1 
ATOM   1015  C  CA  . LEU A  1 126 ? 31.644  64.410  44.765  1.00 36.40  ? 157  LEU A CA  1 
ATOM   1016  C  C   . LEU A  1 126 ? 32.868  65.129  44.210  1.00 37.68  ? 157  LEU A C   1 
ATOM   1017  O  O   . LEU A  1 126 ? 32.938  66.344  44.053  1.00 37.74  ? 157  LEU A O   1 
ATOM   1018  C  CB  . LEU A  1 126 ? 30.557  64.250  43.711  1.00 34.66  ? 157  LEU A CB  1 
ATOM   1019  C  CG  . LEU A  1 126 ? 29.488  63.194  43.984  1.00 35.07  ? 157  LEU A CG  1 
ATOM   1020  C  CD1 . LEU A  1 126 ? 28.284  63.478  43.106  1.00 33.24  ? 157  LEU A CD1 1 
ATOM   1021  C  CD2 . LEU A  1 126 ? 30.041  61.803  43.692  1.00 35.30  ? 157  LEU A CD2 1 
ATOM   1022  N  N   . ARG A  1 127 ? 33.889  64.325  43.992  1.00 37.87  ? 158  ARG A N   1 
ATOM   1023  C  CA  . ARG A  1 127 ? 35.205  64.665  43.496  1.00 36.68  ? 158  ARG A CA  1 
ATOM   1024  C  C   . ARG A  1 127 ? 35.519  63.712  42.332  1.00 35.08  ? 158  ARG A C   1 
ATOM   1025  O  O   . ARG A  1 127 ? 35.280  62.515  42.441  1.00 34.55  ? 158  ARG A O   1 
ATOM   1026  C  CB  . ARG A  1 127 ? 36.290  64.533  44.549  1.00 38.99  ? 158  ARG A CB  1 
ATOM   1027  C  CG  . ARG A  1 127 ? 36.162  65.397  45.779  1.00 45.17  ? 158  ARG A CG  1 
ATOM   1028  C  CD  . ARG A  1 127 ? 36.688  66.811  45.577  1.00 48.66  ? 158  ARG A CD  1 
ATOM   1029  N  NE  . ARG A  1 127 ? 36.113  67.752  46.530  1.00 52.11  ? 158  ARG A NE  1 
ATOM   1030  C  CZ  . ARG A  1 127 ? 34.870  68.210  46.540  1.00 53.03  ? 158  ARG A CZ  1 
ATOM   1031  N  NH1 . ARG A  1 127 ? 33.977  67.840  45.636  1.00 51.47  ? 158  ARG A NH1 1 
ATOM   1032  N  NH2 . ARG A  1 127 ? 34.505  69.070  47.488  1.00 54.32  ? 158  ARG A NH2 1 
ATOM   1033  N  N   . PHE A  1 128 ? 35.928  64.285  41.212  1.00 33.64  ? 159  PHE A N   1 
ATOM   1034  C  CA  . PHE A  1 128 ? 36.172  63.457  40.034  1.00 33.17  ? 159  PHE A CA  1 
ATOM   1035  C  C   . PHE A  1 128 ? 37.645  63.275  39.764  1.00 33.43  ? 159  PHE A C   1 
ATOM   1036  O  O   . PHE A  1 128 ? 38.489  64.026  40.258  1.00 35.14  ? 159  PHE A O   1 
ATOM   1037  C  CB  . PHE A  1 128 ? 35.403  64.014  38.843  1.00 32.07  ? 159  PHE A CB  1 
ATOM   1038  C  CG  . PHE A  1 128 ? 33.909  63.935  39.042  1.00 33.40  ? 159  PHE A CG  1 
ATOM   1039  C  CD1 . PHE A  1 128 ? 33.222  62.751  38.829  1.00 33.93  ? 159  PHE A CD1 1 
ATOM   1040  C  CD2 . PHE A  1 128 ? 33.197  65.047  39.455  1.00 33.76  ? 159  PHE A CD2 1 
ATOM   1041  C  CE1 . PHE A  1 128 ? 31.851  62.682  39.004  1.00 34.07  ? 159  PHE A CE1 1 
ATOM   1042  C  CE2 . PHE A  1 128 ? 31.839  64.976  39.646  1.00 34.05  ? 159  PHE A CE2 1 
ATOM   1043  C  CZ  . PHE A  1 128 ? 31.154  63.800  39.410  1.00 33.49  ? 159  PHE A CZ  1 
ATOM   1044  N  N   . SER A  1 129 ? 37.999  62.227  39.020  1.00 32.60  ? 160  SER A N   1 
ATOM   1045  C  CA  . SER A  1 129 ? 39.388  61.952  38.703  1.00 31.05  ? 160  SER A CA  1 
ATOM   1046  C  C   . SER A  1 129 ? 39.563  61.097  37.459  1.00 29.07  ? 160  SER A C   1 
ATOM   1047  O  O   . SER A  1 129 ? 39.131  59.959  37.346  1.00 28.36  ? 160  SER A O   1 
ATOM   1048  C  CB  . SER A  1 129 ? 40.130  61.335  39.882  1.00 32.65  ? 160  SER A CB  1 
ATOM   1049  O  OG  . SER A  1 129 ? 39.491  60.170  40.364  1.00 34.55  ? 160  SER A OG  1 
ATOM   1050  N  N   . ARG A  1 130 ? 40.261  61.674  36.490  1.00 26.57  ? 161  ARG A N   1 
ATOM   1051  C  CA  . ARG A  1 130 ? 40.532  60.992  35.228  1.00 25.47  ? 161  ARG A CA  1 
ATOM   1052  C  C   . ARG A  1 130 ? 41.604  59.925  35.418  1.00 27.37  ? 161  ARG A C   1 
ATOM   1053  O  O   . ARG A  1 130 ? 42.559  60.131  36.171  1.00 28.94  ? 161  ARG A O   1 
ATOM   1054  C  CB  . ARG A  1 130 ? 40.996  62.025  34.199  1.00 21.36  ? 161  ARG A CB  1 
ATOM   1055  C  CG  . ARG A  1 130 ? 41.193  61.531  32.779  1.00 18.18  ? 161  ARG A CG  1 
ATOM   1056  C  CD  . ARG A  1 130 ? 41.640  62.663  31.890  1.00 15.43  ? 161  ARG A CD  1 
ATOM   1057  N  NE  . ARG A  1 130 ? 41.996  62.272  30.547  1.00 15.81  ? 161  ARG A NE  1 
ATOM   1058  C  CZ  . ARG A  1 130 ? 42.342  63.104  29.576  1.00 18.50  ? 161  ARG A CZ  1 
ATOM   1059  N  NH1 . ARG A  1 130 ? 42.329  64.414  29.806  1.00 19.47  ? 161  ARG A NH1 1 
ATOM   1060  N  NH2 . ARG A  1 130 ? 42.669  62.680  28.382  1.00 19.83  ? 161  ARG A NH2 1 
ATOM   1061  N  N   . ILE A  1 131 ? 41.378  58.780  34.801  1.00 26.82  ? 162  ILE A N   1 
ATOM   1062  C  CA  . ILE A  1 131 ? 42.390  57.713  34.850  1.00 25.32  ? 162  ILE A CA  1 
ATOM   1063  C  C   . ILE A  1 131 ? 42.640  57.322  33.394  1.00 27.44  ? 162  ILE A C   1 
ATOM   1064  O  O   . ILE A  1 131 ? 41.832  57.684  32.537  1.00 28.82  ? 162  ILE A O   1 
ATOM   1065  C  CB  . ILE A  1 131 ? 41.876  56.481  35.606  1.00 23.96  ? 162  ILE A CB  1 
ATOM   1066  C  CG1 . ILE A  1 131 ? 40.853  55.739  34.747  1.00 23.90  ? 162  ILE A CG1 1 
ATOM   1067  C  CG2 . ILE A  1 131 ? 41.317  56.835  36.959  1.00 24.10  ? 162  ILE A CG2 1 
ATOM   1068  C  CD1 . ILE A  1 131 ? 40.193  54.585  35.476  1.00 23.89  ? 162  ILE A CD1 1 
ATOM   1069  N  N   . HIS A  1 132 ? 43.782  56.724  33.100  1.00 29.27  ? 163  HIS A N   1 
ATOM   1070  C  CA  . HIS A  1 132 ? 44.054  56.459  31.689  1.00 31.58  ? 163  HIS A CA  1 
ATOM   1071  C  C   . HIS A  1 132 ? 44.093  54.983  31.386  1.00 34.12  ? 163  HIS A C   1 
ATOM   1072  O  O   . HIS A  1 132 ? 44.336  54.618  30.232  1.00 34.79  ? 163  HIS A O   1 
ATOM   1073  C  CB  . HIS A  1 132 ? 45.384  57.103  31.283  1.00 30.63  ? 163  HIS A CB  1 
ATOM   1074  C  CG  . HIS A  1 132 ? 45.345  58.599  31.274  1.00 28.57  ? 163  HIS A CG  1 
ATOM   1075  N  ND1 . HIS A  1 132 ? 45.076  59.329  32.411  1.00 27.74  ? 163  HIS A ND1 1 
ATOM   1076  C  CD2 . HIS A  1 132 ? 45.531  59.493  30.275  1.00 27.54  ? 163  HIS A CD2 1 
ATOM   1077  C  CE1 . HIS A  1 132 ? 45.104  60.616  32.111  1.00 29.28  ? 163  HIS A CE1 1 
ATOM   1078  N  NE2 . HIS A  1 132 ? 45.374  60.738  30.820  1.00 29.87  ? 163  HIS A NE2 1 
ATOM   1079  N  N   . ASP A  1 133 ? 44.000  54.143  32.415  1.00 37.51  ? 164  ASP A N   1 
ATOM   1080  C  CA  . ASP A  1 133 ? 44.118  52.711  32.171  1.00 40.79  ? 164  ASP A CA  1 
ATOM   1081  C  C   . ASP A  1 133 ? 43.020  51.915  32.854  1.00 40.95  ? 164  ASP A C   1 
ATOM   1082  O  O   . ASP A  1 133 ? 42.613  52.202  33.976  1.00 41.46  ? 164  ASP A O   1 
ATOM   1083  C  CB  . ASP A  1 133 ? 45.496  52.211  32.604  1.00 45.15  ? 164  ASP A CB  1 
ATOM   1084  C  CG  . ASP A  1 133 ? 46.629  53.063  32.061  1.00 50.65  ? 164  ASP A CG  1 
ATOM   1085  O  OD1 . ASP A  1 133 ? 47.097  52.799  30.933  1.00 53.49  ? 164  ASP A OD1 1 
ATOM   1086  O  OD2 . ASP A  1 133 ? 47.042  54.020  32.755  1.00 52.98  ? 164  ASP A OD2 1 
ATOM   1087  N  N   . GLY A  1 134 ? 42.555  50.879  32.156  1.00 40.46  ? 165  GLY A N   1 
ATOM   1088  C  CA  . GLY A  1 134 ? 41.549  49.980  32.656  1.00 39.62  ? 165  GLY A CA  1 
ATOM   1089  C  C   . GLY A  1 134 ? 40.189  50.626  32.853  1.00 39.76  ? 165  GLY A C   1 
ATOM   1090  O  O   . GLY A  1 134 ? 39.940  51.771  32.501  1.00 40.69  ? 165  GLY A O   1 
ATOM   1091  N  N   . GLU A  1 135 ? 39.274  49.853  33.419  1.00 39.20  ? 166  GLU A N   1 
ATOM   1092  C  CA  . GLU A  1 135 ? 37.921  50.261  33.691  1.00 37.27  ? 166  GLU A CA  1 
ATOM   1093  C  C   . GLU A  1 135 ? 37.823  51.475  34.605  1.00 36.67  ? 166  GLU A C   1 
ATOM   1094  O  O   . GLU A  1 135 ? 38.571  51.598  35.568  1.00 37.35  ? 166  GLU A O   1 
ATOM   1095  C  CB  . GLU A  1 135 ? 37.169  49.093  34.348  1.00 37.89  ? 166  GLU A CB  1 
ATOM   1096  C  CG  . GLU A  1 135 ? 35.664  49.301  34.334  1.00 40.77  ? 166  GLU A CG  1 
ATOM   1097  C  CD  . GLU A  1 135 ? 35.161  49.602  32.933  1.00 41.45  ? 166  GLU A CD  1 
ATOM   1098  O  OE1 . GLU A  1 135 ? 35.721  49.039  31.974  1.00 42.88  ? 166  GLU A OE1 1 
ATOM   1099  O  OE2 . GLU A  1 135 ? 34.211  50.400  32.832  1.00 40.42  ? 166  GLU A OE2 1 
ATOM   1100  N  N   . ALA A  1 136 ? 36.867  52.346  34.307  1.00 35.00  ? 167  ALA A N   1 
ATOM   1101  C  CA  . ALA A  1 136 ? 36.644  53.562  35.085  1.00 32.37  ? 167  ALA A CA  1 
ATOM   1102  C  C   . ALA A  1 136 ? 35.205  53.569  35.583  1.00 31.37  ? 167  ALA A C   1 
ATOM   1103  O  O   . ALA A  1 136 ? 34.402  52.794  35.064  1.00 32.41  ? 167  ALA A O   1 
ATOM   1104  C  CB  . ALA A  1 136 ? 36.856  54.768  34.179  1.00 32.17  ? 167  ALA A CB  1 
ATOM   1105  N  N   . ASP A  1 137 ? 34.892  54.420  36.554  1.00 28.72  ? 168  ASP A N   1 
ATOM   1106  C  CA  . ASP A  1 137 ? 33.494  54.479  37.008  1.00 26.40  ? 168  ASP A CA  1 
ATOM   1107  C  C   . ASP A  1 137 ? 32.659  55.004  35.834  1.00 27.24  ? 168  ASP A C   1 
ATOM   1108  O  O   . ASP A  1 137 ? 31.735  54.352  35.377  1.00 28.08  ? 168  ASP A O   1 
ATOM   1109  C  CB  . ASP A  1 137 ? 33.326  55.409  38.189  1.00 23.85  ? 168  ASP A CB  1 
ATOM   1110  C  CG  . ASP A  1 137 ? 33.835  54.804  39.470  1.00 22.06  ? 168  ASP A CG  1 
ATOM   1111  O  OD1 . ASP A  1 137 ? 33.573  53.624  39.698  1.00 19.30  ? 168  ASP A OD1 1 
ATOM   1112  O  OD2 . ASP A  1 137 ? 34.471  55.529  40.249  1.00 23.10  ? 168  ASP A OD2 1 
ATOM   1113  N  N   . ILE A  1 138 ? 33.052  56.175  35.339  1.00 27.43  ? 169  ILE A N   1 
ATOM   1114  C  CA  . ILE A  1 138 ? 32.343  56.763  34.201  1.00 27.25  ? 169  ILE A CA  1 
ATOM   1115  C  C   . ILE A  1 138 ? 33.223  56.668  32.963  1.00 26.97  ? 169  ILE A C   1 
ATOM   1116  O  O   . ILE A  1 138 ? 34.243  57.339  32.878  1.00 27.55  ? 169  ILE A O   1 
ATOM   1117  C  CB  . ILE A  1 138 ? 31.993  58.219  34.510  1.00 27.83  ? 169  ILE A CB  1 
ATOM   1118  C  CG1 . ILE A  1 138 ? 31.004  58.344  35.678  1.00 26.12  ? 169  ILE A CG1 1 
ATOM   1119  C  CG2 . ILE A  1 138 ? 31.481  58.947  33.284  1.00 28.36  ? 169  ILE A CG2 1 
ATOM   1120  C  CD1 . ILE A  1 138 ? 30.795  59.792  36.089  1.00 24.89  ? 169  ILE A CD1 1 
ATOM   1121  N  N   . MET A  1 139 ? 32.826  55.841  32.001  1.00 26.05  ? 170  MET A N   1 
ATOM   1122  C  CA  . MET A  1 139 ? 33.576  55.681  30.759  1.00 27.09  ? 170  MET A CA  1 
ATOM   1123  C  C   . MET A  1 139 ? 32.972  56.499  29.622  1.00 27.09  ? 170  MET A C   1 
ATOM   1124  O  O   . MET A  1 139 ? 31.945  56.145  29.040  1.00 28.80  ? 170  MET A O   1 
ATOM   1125  C  CB  . MET A  1 139 ? 33.726  54.223  30.354  1.00 27.17  ? 170  MET A CB  1 
ATOM   1126  C  CG  . MET A  1 139 ? 34.349  53.302  31.368  1.00 27.33  ? 170  MET A CG  1 
ATOM   1127  S  SD  . MET A  1 139 ? 36.165  53.141  31.281  1.00 27.51  ? 170  MET A SD  1 
ATOM   1128  C  CE  . MET A  1 139 ? 36.271  51.887  30.004  1.00 27.90  ? 170  MET A CE  1 
ATOM   1129  N  N   . ILE A  1 140 ? 33.617  57.600  29.265  1.00 24.47  ? 171  ILE A N   1 
ATOM   1130  C  CA  . ILE A  1 140 ? 33.147  58.498  28.222  1.00 20.05  ? 171  ILE A CA  1 
ATOM   1131  C  C   . ILE A  1 140 ? 33.520  58.015  26.838  1.00 19.79  ? 171  ILE A C   1 
ATOM   1132  O  O   . ILE A  1 140 ? 34.629  57.514  26.632  1.00 23.36  ? 171  ILE A O   1 
ATOM   1133  C  CB  . ILE A  1 140 ? 33.676  59.935  28.459  1.00 15.66  ? 171  ILE A CB  1 
ATOM   1134  C  CG1 . ILE A  1 140 ? 33.483  60.331  29.914  1.00 15.00  ? 171  ILE A CG1 1 
ATOM   1135  C  CG2 . ILE A  1 140 ? 32.969  60.921  27.549  1.00 15.83  ? 171  ILE A CG2 1 
ATOM   1136  C  CD1 . ILE A  1 140 ? 33.957  61.671  30.377  1.00 15.00  ? 171  ILE A CD1 1 
ATOM   1137  N  N   . ASN A  1 141 ? 32.637  58.226  25.867  1.00 17.11  ? 172  ASN A N   1 
ATOM   1138  C  CA  . ASN A  1 141 ? 32.896  57.819  24.505  1.00 16.34  ? 172  ASN A CA  1 
ATOM   1139  C  C   . ASN A  1 141 ? 31.934  58.456  23.503  1.00 15.00  ? 172  ASN A C   1 
ATOM   1140  O  O   . ASN A  1 141 ? 30.830  58.864  23.861  1.00 15.02  ? 172  ASN A O   1 
ATOM   1141  C  CB  . ASN A  1 141 ? 32.884  56.313  24.344  1.00 18.24  ? 172  ASN A CB  1 
ATOM   1142  C  CG  . ASN A  1 141 ? 33.599  55.824  23.099  1.00 22.20  ? 172  ASN A CG  1 
ATOM   1143  O  OD1 . ASN A  1 141 ? 33.563  54.633  22.781  1.00 26.17  ? 172  ASN A OD1 1 
ATOM   1144  N  ND2 . ASN A  1 141 ? 34.250  56.737  22.392  1.00 24.10  ? 172  ASN A ND2 1 
ATOM   1145  N  N   . PHE A  1 142 ? 32.392  58.536  22.253  1.00 15.00  ? 173  PHE A N   1 
ATOM   1146  C  CA  . PHE A  1 142 ? 31.592  59.083  21.159  1.00 17.08  ? 173  PHE A CA  1 
ATOM   1147  C  C   . PHE A  1 142 ? 31.180  57.961  20.203  1.00 18.80  ? 173  PHE A C   1 
ATOM   1148  O  O   . PHE A  1 142 ? 31.982  57.088  19.876  1.00 20.58  ? 173  PHE A O   1 
ATOM   1149  C  CB  . PHE A  1 142 ? 32.383  60.162  20.404  1.00 16.89  ? 173  PHE A CB  1 
ATOM   1150  C  CG  . PHE A  1 142 ? 32.571  61.447  21.162  1.00 19.78  ? 173  PHE A CG  1 
ATOM   1151  C  CD1 . PHE A  1 142 ? 33.453  61.520  22.229  1.00 19.70  ? 173  PHE A CD1 1 
ATOM   1152  C  CD2 . PHE A  1 142 ? 31.867  62.584  20.803  1.00 18.68  ? 173  PHE A CD2 1 
ATOM   1153  C  CE1 . PHE A  1 142 ? 33.625  62.702  22.926  1.00 17.70  ? 173  PHE A CE1 1 
ATOM   1154  C  CE2 . PHE A  1 142 ? 32.034  63.769  21.497  1.00 17.55  ? 173  PHE A CE2 1 
ATOM   1155  C  CZ  . PHE A  1 142 ? 32.913  63.828  22.560  1.00 18.69  ? 173  PHE A CZ  1 
ATOM   1156  N  N   . GLY A  1 143 ? 29.928  57.960  19.743  1.00 19.52  ? 174  GLY A N   1 
ATOM   1157  C  CA  . GLY A  1 143 ? 29.464  56.914  18.833  1.00 21.54  ? 174  GLY A CA  1 
ATOM   1158  C  C   . GLY A  1 143 ? 28.302  57.389  17.958  1.00 24.10  ? 174  GLY A C   1 
ATOM   1159  O  O   . GLY A  1 143 ? 27.714  58.438  18.209  1.00 24.33  ? 174  GLY A O   1 
ATOM   1160  N  N   . ARG A  1 144 ? 27.972  56.611  16.920  1.00 25.29  ? 175  ARG A N   1 
ATOM   1161  C  CA  . ARG A  1 144 ? 26.867  56.956  16.014  1.00 27.64  ? 175  ARG A CA  1 
ATOM   1162  C  C   . ARG A  1 144 ? 25.848  55.817  15.939  1.00 31.53  ? 175  ARG A C   1 
ATOM   1163  O  O   . ARG A  1 144 ? 26.181  54.655  16.163  1.00 30.81  ? 175  ARG A O   1 
ATOM   1164  C  CB  . ARG A  1 144 ? 27.398  57.313  14.623  1.00 23.77  ? 175  ARG A CB  1 
ATOM   1165  C  CG  . ARG A  1 144 ? 28.388  56.313  14.053  1.00 20.84  ? 175  ARG A CG  1 
ATOM   1166  C  CD  . ARG A  1 144 ? 29.307  56.967  13.032  1.00 19.45  ? 175  ARG A CD  1 
ATOM   1167  N  NE  . ARG A  1 144 ? 28.583  57.862  12.132  1.00 17.54  ? 175  ARG A NE  1 
ATOM   1168  C  CZ  . ARG A  1 144 ? 28.093  57.499  10.951  1.00 15.00  ? 175  ARG A CZ  1 
ATOM   1169  N  NH1 . ARG A  1 144 ? 28.248  56.253  10.524  1.00 15.00  ? 175  ARG A NH1 1 
ATOM   1170  N  NH2 . ARG A  1 144 ? 27.449  58.381  10.199  1.00 15.00  ? 175  ARG A NH2 1 
ATOM   1171  N  N   . TRP A  1 145 ? 24.592  56.134  15.610  1.00 37.14  ? 176  TRP A N   1 
ATOM   1172  C  CA  . TRP A  1 145 ? 23.556  55.099  15.588  1.00 41.42  ? 176  TRP A CA  1 
ATOM   1173  C  C   . TRP A  1 145 ? 23.734  54.120  16.719  1.00 39.03  ? 176  TRP A C   1 
ATOM   1174  O  O   . TRP A  1 145 ? 23.767  54.508  17.890  1.00 39.01  ? 176  TRP A O   1 
ATOM   1175  C  CB  . TRP A  1 145 ? 23.602  54.198  14.349  1.00 49.43  ? 176  TRP A CB  1 
ATOM   1176  C  CG  . TRP A  1 145 ? 23.757  54.859  13.023  1.00 62.33  ? 176  TRP A CG  1 
ATOM   1177  C  CD1 . TRP A  1 145 ? 24.884  55.439  12.518  1.00 67.06  ? 176  TRP A CD1 1 
ATOM   1178  C  CD2 . TRP A  1 145 ? 22.748  54.985  12.022  1.00 69.64  ? 176  TRP A CD2 1 
ATOM   1179  N  NE1 . TRP A  1 145 ? 24.643  55.894  11.243  1.00 71.26  ? 176  TRP A NE1 1 
ATOM   1180  C  CE2 . TRP A  1 145 ? 23.341  55.616  10.912  1.00 72.61  ? 176  TRP A CE2 1 
ATOM   1181  C  CE3 . TRP A  1 145 ? 21.402  54.615  11.951  1.00 73.98  ? 176  TRP A CE3 1 
ATOM   1182  C  CZ2 . TRP A  1 145 ? 22.640  55.857  9.732   1.00 76.54  ? 176  TRP A CZ2 1 
ATOM   1183  C  CZ3 . TRP A  1 145 ? 20.705  54.870  10.787  1.00 76.81  ? 176  TRP A CZ3 1 
ATOM   1184  C  CH2 . TRP A  1 145 ? 21.325  55.482  9.692   1.00 78.25  ? 176  TRP A CH2 1 
ATOM   1185  N  N   . GLU A  1 146 ? 23.842  52.859  16.312  1.00 34.67  ? 177  GLU A N   1 
ATOM   1186  C  CA  . GLU A  1 146 ? 24.114  51.782  17.228  1.00 31.74  ? 177  GLU A CA  1 
ATOM   1187  C  C   . GLU A  1 146 ? 25.613  51.682  17.422  1.00 29.30  ? 177  GLU A C   1 
ATOM   1188  O  O   . GLU A  1 146 ? 26.358  51.490  16.453  1.00 28.59  ? 177  GLU A O   1 
ATOM   1189  C  CB  . GLU A  1 146 ? 23.502  50.472  16.747  1.00 30.99  ? 177  GLU A CB  1 
ATOM   1190  C  CG  . GLU A  1 146 ? 23.226  49.511  17.886  1.00 31.01  ? 177  GLU A CG  1 
ATOM   1191  C  CD  . GLU A  1 146 ? 23.929  49.936  19.162  1.00 37.32  ? 177  GLU A CD  1 
ATOM   1192  O  OE1 . GLU A  1 146 ? 23.869  51.138  19.507  1.00 42.02  ? 177  GLU A OE1 1 
ATOM   1193  O  OE2 . GLU A  1 146 ? 24.548  49.071  19.815  1.00 37.34  ? 177  GLU A OE2 1 
ATOM   1194  N  N   . HIS A  1 147 ? 26.006  51.822  18.672  1.00 26.18  ? 178  HIS A N   1 
ATOM   1195  C  CA  . HIS A  1 147 ? 27.401  51.865  19.055  1.00 23.91  ? 178  HIS A CA  1 
ATOM   1196  C  C   . HIS A  1 147 ? 27.760  50.830  20.123  1.00 24.33  ? 178  HIS A C   1 
ATOM   1197  O  O   . HIS A  1 147 ? 28.801  50.939  20.775  1.00 26.58  ? 178  HIS A O   1 
ATOM   1198  C  CB  . HIS A  1 147 ? 27.707  53.246  19.623  1.00 21.89  ? 178  HIS A CB  1 
ATOM   1199  C  CG  . HIS A  1 147 ? 26.658  53.686  20.680  1.00 23.40  ? 178  HIS A CG  1 
ATOM   1200  N  ND1 . HIS A  1 147 ? 25.409  54.165  20.340  1.00 21.60  ? 178  HIS A ND1 1 
ATOM   1201  C  CD2 . HIS A  1 147 ? 26.704  53.695  22.034  1.00 23.51  ? 178  HIS A CD2 1 
ATOM   1202  C  CE1 . HIS A  1 147 ? 24.733  54.450  21.440  1.00 22.01  ? 178  HIS A CE1 1 
ATOM   1203  N  NE2 . HIS A  1 147 ? 25.497  54.174  22.481  1.00 20.83  ? 178  HIS A NE2 1 
ATOM   1204  N  N   . GLY A  1 148 ? 26.911  49.832  20.350  1.00 24.08  ? 179  GLY A N   1 
ATOM   1205  C  CA  . GLY A  1 148 ? 27.281  48.760  21.261  1.00 23.72  ? 179  GLY A CA  1 
ATOM   1206  C  C   . GLY A  1 148 ? 26.494  48.661  22.533  1.00 24.40  ? 179  GLY A C   1 
ATOM   1207  O  O   . GLY A  1 148 ? 26.969  48.259  23.608  1.00 23.80  ? 179  GLY A O   1 
ATOM   1208  N  N   . ASP A  1 149 ? 25.206  49.010  22.491  1.00 25.45  ? 180  ASP A N   1 
ATOM   1209  C  CA  . ASP A  1 149 ? 24.421  48.853  23.708  1.00 25.80  ? 180  ASP A CA  1 
ATOM   1210  C  C   . ASP A  1 149 ? 22.932  48.830  23.443  1.00 26.89  ? 180  ASP A C   1 
ATOM   1211  O  O   . ASP A  1 149 ? 22.172  49.063  24.385  1.00 27.86  ? 180  ASP A O   1 
ATOM   1212  C  CB  . ASP A  1 149 ? 24.787  49.857  24.776  1.00 24.47  ? 180  ASP A CB  1 
ATOM   1213  C  CG  . ASP A  1 149 ? 24.464  51.290  24.396  1.00 25.53  ? 180  ASP A CG  1 
ATOM   1214  O  OD1 . ASP A  1 149 ? 24.095  51.525  23.229  1.00 23.37  ? 180  ASP A OD1 1 
ATOM   1215  O  OD2 . ASP A  1 149 ? 24.623  52.150  25.283  1.00 24.93  ? 180  ASP A OD2 1 
ATOM   1216  N  N   . GLY A  1 150 ? 22.535  48.672  22.189  1.00 27.65  ? 181  GLY A N   1 
ATOM   1217  C  CA  . GLY A  1 150 ? 21.167  48.575  21.801  1.00 29.10  ? 181  GLY A CA  1 
ATOM   1218  C  C   . GLY A  1 150 ? 20.286  49.780  22.029  1.00 28.18  ? 181  GLY A C   1 
ATOM   1219  O  O   . GLY A  1 150 ? 19.064  49.670  21.843  1.00 31.37  ? 181  GLY A O   1 
ATOM   1220  N  N   . TYR A  1 151 ? 20.867  50.923  22.308  1.00 26.55  ? 182  TYR A N   1 
ATOM   1221  C  CA  . TYR A  1 151 ? 20.180  52.208  22.403  1.00 23.93  ? 182  TYR A CA  1 
ATOM   1222  C  C   . TYR A  1 151 ? 20.873  53.128  21.389  1.00 23.95  ? 182  TYR A C   1 
ATOM   1223  O  O   . TYR A  1 151 ? 21.685  53.988  21.725  1.00 25.92  ? 182  TYR A O   1 
ATOM   1224  C  CB  . TYR A  1 151 ? 20.317  52.740  23.814  1.00 23.28  ? 182  TYR A CB  1 
ATOM   1225  C  CG  . TYR A  1 151 ? 19.789  51.875  24.919  1.00 24.45  ? 182  TYR A CG  1 
ATOM   1226  C  CD1 . TYR A  1 151 ? 18.432  51.644  25.074  1.00 25.30  ? 182  TYR A CD1 1 
ATOM   1227  C  CD2 . TYR A  1 151 ? 20.641  51.284  25.837  1.00 25.72  ? 182  TYR A CD2 1 
ATOM   1228  C  CE1 . TYR A  1 151 ? 17.952  50.854  26.096  1.00 26.05  ? 182  TYR A CE1 1 
ATOM   1229  C  CE2 . TYR A  1 151 ? 20.180  50.493  26.867  1.00 25.92  ? 182  TYR A CE2 1 
ATOM   1230  C  CZ  . TYR A  1 151 ? 18.829  50.285  26.990  1.00 27.63  ? 182  TYR A CZ  1 
ATOM   1231  O  OH  . TYR A  1 151 ? 18.311  49.501  27.995  1.00 30.30  ? 182  TYR A OH  1 
ATOM   1232  N  N   . PRO A  1 152 ? 20.674  52.868  20.105  1.00 21.82  ? 183  PRO A N   1 
ATOM   1233  C  CA  . PRO A  1 152 ? 21.328  53.556  19.011  1.00 20.73  ? 183  PRO A CA  1 
ATOM   1234  C  C   . PRO A  1 152 ? 21.011  55.027  18.897  1.00 20.79  ? 183  PRO A C   1 
ATOM   1235  O  O   . PRO A  1 152 ? 20.162  55.565  19.608  1.00 22.78  ? 183  PRO A O   1 
ATOM   1236  C  CB  . PRO A  1 152 ? 20.849  52.708  17.827  1.00 18.17  ? 183  PRO A CB  1 
ATOM   1237  C  CG  . PRO A  1 152 ? 19.427  52.427  18.227  1.00 19.70  ? 183  PRO A CG  1 
ATOM   1238  C  CD  . PRO A  1 152 ? 19.657  51.895  19.622  1.00 21.07  ? 183  PRO A CD  1 
ATOM   1239  N  N   . PHE A  1 153 ? 21.709  55.763  18.041  1.00 20.32  ? 184  PHE A N   1 
ATOM   1240  C  CA  . PHE A  1 153 ? 21.545  57.192  17.837  1.00 20.63  ? 184  PHE A CA  1 
ATOM   1241  C  C   . PHE A  1 153 ? 20.784  57.409  16.540  1.00 22.54  ? 184  PHE A C   1 
ATOM   1242  O  O   . PHE A  1 153 ? 20.124  56.436  16.122  1.00 23.28  ? 184  PHE A O   1 
ATOM   1243  C  CB  . PHE A  1 153 ? 22.842  57.967  17.954  1.00 20.00  ? 184  PHE A CB  1 
ATOM   1244  C  CG  . PHE A  1 153 ? 23.383  58.172  19.343  1.00 18.12  ? 184  PHE A CG  1 
ATOM   1245  C  CD1 . PHE A  1 153 ? 22.532  58.427  20.417  1.00 18.31  ? 184  PHE A CD1 1 
ATOM   1246  C  CD2 . PHE A  1 153 ? 24.730  58.047  19.614  1.00 17.23  ? 184  PHE A CD2 1 
ATOM   1247  C  CE1 . PHE A  1 153 ? 23.016  58.595  21.684  1.00 17.53  ? 184  PHE A CE1 1 
ATOM   1248  C  CE2 . PHE A  1 153 ? 25.227  58.222  20.887  1.00 16.62  ? 184  PHE A CE2 1 
ATOM   1249  C  CZ  . PHE A  1 153 ? 24.343  58.470  21.929  1.00 15.01  ? 184  PHE A CZ  1 
ATOM   1250  N  N   . ASP A  1 154 ? 20.784  58.577  15.905  1.00 25.13  ? 185  ASP A N   1 
ATOM   1251  C  CA  . ASP A  1 154 ? 19.922  58.846  14.776  1.00 27.67  ? 185  ASP A CA  1 
ATOM   1252  C  C   . ASP A  1 154 ? 20.361  59.774  13.671  1.00 28.06  ? 185  ASP A C   1 
ATOM   1253  O  O   . ASP A  1 154 ? 19.513  60.064  12.787  1.00 29.06  ? 185  ASP A O   1 
ATOM   1254  C  CB  . ASP A  1 154 ? 18.556  59.389  15.265  1.00 29.00  ? 185  ASP A CB  1 
ATOM   1255  C  CG  . ASP A  1 154 ? 18.729  60.585  16.178  1.00 30.93  ? 185  ASP A CG  1 
ATOM   1256  O  OD1 . ASP A  1 154 ? 19.840  60.710  16.696  1.00 28.95  ? 185  ASP A OD1 1 
ATOM   1257  O  OD2 . ASP A  1 154 ? 17.765  61.357  16.384  1.00 31.05  ? 185  ASP A OD2 1 
ATOM   1258  N  N   . GLY A  1 155 ? 21.590  60.233  13.638  1.00 27.64  ? 186  GLY A N   1 
ATOM   1259  C  CA  . GLY A  1 155 ? 22.032  61.150  12.567  1.00 28.92  ? 186  GLY A CA  1 
ATOM   1260  C  C   . GLY A  1 155 ? 22.191  62.542  13.175  1.00 29.82  ? 186  GLY A C   1 
ATOM   1261  O  O   . GLY A  1 155 ? 22.018  62.722  14.381  1.00 30.85  ? 186  GLY A O   1 
ATOM   1262  N  N   . LYS A  1 156 ? 22.523  63.550  12.377  1.00 29.35  ? 187  LYS A N   1 
ATOM   1263  C  CA  . LYS A  1 156 ? 22.657  64.895  12.935  1.00 28.86  ? 187  LYS A CA  1 
ATOM   1264  C  C   . LYS A  1 156 ? 21.323  65.364  13.547  1.00 28.20  ? 187  LYS A C   1 
ATOM   1265  O  O   . LYS A  1 156 ? 20.265  65.229  12.920  1.00 26.80  ? 187  LYS A O   1 
ATOM   1266  C  CB  . LYS A  1 156 ? 23.183  65.884  11.895  1.00 30.14  ? 187  LYS A CB  1 
ATOM   1267  C  CG  . LYS A  1 156 ? 24.611  66.345  12.145  1.00 34.06  ? 187  LYS A CG  1 
ATOM   1268  C  CD  . LYS A  1 156 ? 24.747  67.850  11.970  1.00 31.41  ? 187  LYS A CD  1 
ATOM   1269  C  CE  . LYS A  1 156 ? 25.692  68.443  13.004  1.00 32.33  ? 187  LYS A CE  1 
ATOM   1270  N  NZ  . LYS A  1 156 ? 25.082  68.469  14.362  1.00 30.26  ? 187  LYS A NZ  1 
ATOM   1271  N  N   . ASP A  1 157 ? 21.421  65.898  14.773  1.00 27.74  ? 188  ASP A N   1 
ATOM   1272  C  CA  . ASP A  1 157 ? 20.282  66.403  15.557  1.00 27.75  ? 188  ASP A CA  1 
ATOM   1273  C  C   . ASP A  1 157 ? 19.385  65.237  15.954  1.00 27.12  ? 188  ASP A C   1 
ATOM   1274  O  O   . ASP A  1 157 ? 19.793  64.079  15.912  1.00 28.72  ? 188  ASP A O   1 
ATOM   1275  C  CB  . ASP A  1 157 ? 19.732  67.658  14.899  1.00 27.60  ? 188  ASP A CB  1 
ATOM   1276  C  CG  . ASP A  1 157 ? 20.813  68.706  14.718  1.00 31.27  ? 188  ASP A CG  1 
ATOM   1277  O  OD1 . ASP A  1 157 ? 21.585  68.932  15.675  1.00 37.57  ? 188  ASP A OD1 1 
ATOM   1278  O  OD2 . ASP A  1 157 ? 20.895  69.294  13.621  1.00 30.10  ? 188  ASP A OD2 1 
ATOM   1279  N  N   . GLY A  1 158 ? 18.173  65.549  16.484  1.00 26.30  ? 189  GLY A N   1 
ATOM   1280  C  CA  . GLY A  1 158 ? 17.490  64.436  17.173  1.00 24.08  ? 189  GLY A CA  1 
ATOM   1281  C  C   . GLY A  1 158 ? 18.120  64.097  18.533  1.00 22.98  ? 189  GLY A C   1 
ATOM   1282  O  O   . GLY A  1 158 ? 18.282  64.971  19.382  1.00 22.79  ? 189  GLY A O   1 
ATOM   1283  N  N   . LEU A  1 159 ? 18.519  62.841  18.782  1.00 22.70  ? 190  LEU A N   1 
ATOM   1284  C  CA  . LEU A  1 159 ? 19.190  62.516  20.062  1.00 22.72  ? 190  LEU A CA  1 
ATOM   1285  C  C   . LEU A  1 159 ? 20.645  63.001  20.044  1.00 22.06  ? 190  LEU A C   1 
ATOM   1286  O  O   . LEU A  1 159 ? 21.326  62.911  19.024  1.00 21.44  ? 190  LEU A O   1 
ATOM   1287  C  CB  . LEU A  1 159 ? 19.159  61.010  20.359  1.00 25.16  ? 190  LEU A CB  1 
ATOM   1288  C  CG  . LEU A  1 159 ? 17.850  60.272  20.074  1.00 25.57  ? 190  LEU A CG  1 
ATOM   1289  C  CD1 . LEU A  1 159 ? 17.876  58.875  20.682  1.00 23.01  ? 190  LEU A CD1 1 
ATOM   1290  C  CD2 . LEU A  1 159 ? 16.658  61.057  20.597  1.00 22.73  ? 190  LEU A CD2 1 
ATOM   1291  N  N   . LEU A  1 160 ? 21.149  63.513  21.166  1.00 20.55  ? 191  LEU A N   1 
ATOM   1292  C  CA  . LEU A  1 160 ? 22.520  64.028  21.194  1.00 19.19  ? 191  LEU A CA  1 
ATOM   1293  C  C   . LEU A  1 160 ? 23.454  63.135  22.008  1.00 20.05  ? 191  LEU A C   1 
ATOM   1294  O  O   . LEU A  1 160 ? 24.600  62.900  21.622  1.00 19.59  ? 191  LEU A O   1 
ATOM   1295  C  CB  . LEU A  1 160 ? 22.530  65.462  21.721  1.00 16.97  ? 191  LEU A CB  1 
ATOM   1296  C  CG  . LEU A  1 160 ? 21.581  66.428  21.012  1.00 15.00  ? 191  LEU A CG  1 
ATOM   1297  C  CD1 . LEU A  1 160 ? 21.699  67.827  21.591  1.00 15.00  ? 191  LEU A CD1 1 
ATOM   1298  C  CD2 . LEU A  1 160 ? 21.852  66.442  19.514  1.00 16.05  ? 191  LEU A CD2 1 
ATOM   1299  N  N   . ALA A  1 161 ? 22.969  62.637  23.134  1.00 20.75  ? 192  ALA A N   1 
ATOM   1300  C  CA  . ALA A  1 161 ? 23.769  61.765  23.981  1.00 20.47  ? 192  ALA A CA  1 
ATOM   1301  C  C   . ALA A  1 161 ? 22.907  61.098  25.039  1.00 22.73  ? 192  ALA A C   1 
ATOM   1302  O  O   . ALA A  1 161 ? 21.689  61.260  25.104  1.00 25.21  ? 192  ALA A O   1 
ATOM   1303  C  CB  . ALA A  1 161 ? 24.904  62.544  24.627  1.00 17.03  ? 192  ALA A CB  1 
ATOM   1304  N  N   . HIS A  1 162 ? 23.550  60.294  25.884  1.00 22.34  ? 193  HIS A N   1 
ATOM   1305  C  CA  . HIS A  1 162 ? 22.845  59.679  27.007  1.00 22.86  ? 193  HIS A CA  1 
ATOM   1306  C  C   . HIS A  1 162 ? 23.840  59.112  28.005  1.00 22.21  ? 193  HIS A C   1 
ATOM   1307  O  O   . HIS A  1 162 ? 25.015  59.068  27.790  1.00 22.61  ? 193  HIS A O   1 
ATOM   1308  C  CB  . HIS A  1 162 ? 22.036  58.462  26.529  1.00 23.79  ? 193  HIS A CB  1 
ATOM   1309  C  CG  . HIS A  1 162 ? 22.884  57.420  25.878  1.00 29.64  ? 193  HIS A CG  1 
ATOM   1310  N  ND1 . HIS A  1 162 ? 22.289  56.340  25.281  1.00 27.41  ? 193  HIS A ND1 1 
ATOM   1311  C  CD2 . HIS A  1 162 ? 24.229  57.326  25.698  1.00 35.85  ? 193  HIS A CD2 1 
ATOM   1312  C  CE1 . HIS A  1 162 ? 23.250  55.556  24.824  1.00 31.67  ? 193  HIS A CE1 1 
ATOM   1313  N  NE2 . HIS A  1 162 ? 24.419  56.130  25.066  1.00 37.79  ? 193  HIS A NE2 1 
ATOM   1314  N  N   . ALA A  1 163 ? 23.369  58.857  29.224  1.00 22.97  ? 194  ALA A N   1 
ATOM   1315  C  CA  . ALA A  1 163 ? 24.293  58.097  30.060  1.00 23.43  ? 194  ALA A CA  1 
ATOM   1316  C  C   . ALA A  1 163 ? 23.596  57.150  31.005  1.00 25.11  ? 194  ALA A C   1 
ATOM   1317  O  O   . ALA A  1 163 ? 22.410  57.329  31.289  1.00 24.99  ? 194  ALA A O   1 
ATOM   1318  C  CB  . ALA A  1 163 ? 25.310  59.010  30.681  1.00 24.76  ? 194  ALA A CB  1 
ATOM   1319  N  N   . PHE A  1 164 ? 24.215  56.021  31.365  1.00 26.35  ? 195  PHE A N   1 
ATOM   1320  C  CA  . PHE A  1 164 ? 23.553  55.107  32.296  1.00 27.05  ? 195  PHE A CA  1 
ATOM   1321  C  C   . PHE A  1 164 ? 23.690  55.573  33.731  1.00 29.36  ? 195  PHE A C   1 
ATOM   1322  O  O   . PHE A  1 164 ? 24.658  56.260  34.048  1.00 31.08  ? 195  PHE A O   1 
ATOM   1323  C  CB  . PHE A  1 164 ? 24.201  53.738  32.097  1.00 25.70  ? 195  PHE A CB  1 
ATOM   1324  C  CG  . PHE A  1 164 ? 24.089  53.275  30.678  1.00 26.65  ? 195  PHE A CG  1 
ATOM   1325  C  CD1 . PHE A  1 164 ? 25.060  53.652  29.766  1.00 27.81  ? 195  PHE A CD1 1 
ATOM   1326  C  CD2 . PHE A  1 164 ? 23.025  52.488  30.266  1.00 25.70  ? 195  PHE A CD2 1 
ATOM   1327  C  CE1 . PHE A  1 164 ? 24.978  53.237  28.449  1.00 27.89  ? 195  PHE A CE1 1 
ATOM   1328  C  CE2 . PHE A  1 164 ? 22.934  52.064  28.956  1.00 25.29  ? 195  PHE A CE2 1 
ATOM   1329  C  CZ  . PHE A  1 164 ? 23.912  52.444  28.058  1.00 26.67  ? 195  PHE A CZ  1 
ATOM   1330  N  N   . ALA A  1 165 ? 22.706  55.216  34.552  1.00 30.35  ? 196  ALA A N   1 
ATOM   1331  C  CA  . ALA A  1 165 ? 22.744  55.587  35.967  1.00 30.98  ? 196  ALA A CA  1 
ATOM   1332  C  C   . ALA A  1 165 ? 23.913  54.909  36.653  1.00 30.81  ? 196  ALA A C   1 
ATOM   1333  O  O   . ALA A  1 165 ? 24.542  54.018  36.085  1.00 32.07  ? 196  ALA A O   1 
ATOM   1334  C  CB  . ALA A  1 165 ? 21.437  55.222  36.644  1.00 31.36  ? 196  ALA A CB  1 
ATOM   1335  N  N   . PRO A  1 166 ? 24.226  55.295  37.895  1.00 30.16  ? 197  PRO A N   1 
ATOM   1336  C  CA  . PRO A  1 166 ? 25.341  54.702  38.619  1.00 30.40  ? 197  PRO A CA  1 
ATOM   1337  C  C   . PRO A  1 166 ? 25.157  53.202  38.771  1.00 30.14  ? 197  PRO A C   1 
ATOM   1338  O  O   . PRO A  1 166 ? 24.039  52.720  38.952  1.00 28.48  ? 197  PRO A O   1 
ATOM   1339  C  CB  . PRO A  1 166 ? 25.276  55.371  39.994  1.00 29.02  ? 197  PRO A CB  1 
ATOM   1340  C  CG  . PRO A  1 166 ? 24.534  56.639  39.756  1.00 29.46  ? 197  PRO A CG  1 
ATOM   1341  C  CD  . PRO A  1 166 ? 23.541  56.331  38.678  1.00 31.19  ? 197  PRO A CD  1 
ATOM   1342  N  N   . GLY A  1 167 ? 26.259  52.475  38.687  1.00 31.29  ? 198  GLY A N   1 
ATOM   1343  C  CA  . GLY A  1 167 ? 26.231  51.034  38.809  1.00 34.46  ? 198  GLY A CA  1 
ATOM   1344  C  C   . GLY A  1 167 ? 27.457  50.412  38.158  1.00 35.74  ? 198  GLY A C   1 
ATOM   1345  O  O   . GLY A  1 167 ? 28.374  51.121  37.742  1.00 38.00  ? 198  GLY A O   1 
ATOM   1346  N  N   . THR A  1 168 ? 27.463  49.088  38.083  1.00 37.00  ? 199  THR A N   1 
ATOM   1347  C  CA  . THR A  1 168 ? 28.570  48.367  37.470  1.00 38.99  ? 199  THR A CA  1 
ATOM   1348  C  C   . THR A  1 168 ? 28.299  48.129  35.999  1.00 37.91  ? 199  THR A C   1 
ATOM   1349  O  O   . THR A  1 168 ? 27.235  48.478  35.491  1.00 39.31  ? 199  THR A O   1 
ATOM   1350  C  CB  . THR A  1 168 ? 28.777  47.002  38.120  1.00 40.87  ? 199  THR A CB  1 
ATOM   1351  O  OG1 . THR A  1 168 ? 27.540  46.543  38.679  1.00 39.04  ? 199  THR A OG1 1 
ATOM   1352  C  CG2 . THR A  1 168 ? 29.833  47.087  39.212  1.00 41.91  ? 199  THR A CG2 1 
ATOM   1353  N  N   . GLY A  1 169 ? 29.247  47.515  35.314  1.00 36.16  ? 200  GLY A N   1 
ATOM   1354  C  CA  . GLY A  1 169 ? 29.090  47.280  33.901  1.00 36.46  ? 200  GLY A CA  1 
ATOM   1355  C  C   . GLY A  1 169 ? 29.142  48.605  33.167  1.00 36.53  ? 200  GLY A C   1 
ATOM   1356  O  O   . GLY A  1 169 ? 30.159  49.291  33.182  1.00 39.26  ? 200  GLY A O   1 
ATOM   1357  N  N   . VAL A  1 170 ? 28.052  48.990  32.526  1.00 34.00  ? 201  VAL A N   1 
ATOM   1358  C  CA  . VAL A  1 170 ? 28.042  50.267  31.831  1.00 31.50  ? 201  VAL A CA  1 
ATOM   1359  C  C   . VAL A  1 170 ? 27.478  51.362  32.728  1.00 30.65  ? 201  VAL A C   1 
ATOM   1360  O  O   . VAL A  1 170 ? 27.251  52.486  32.286  1.00 30.71  ? 201  VAL A O   1 
ATOM   1361  C  CB  . VAL A  1 170 ? 27.263  50.194  30.507  1.00 30.67  ? 201  VAL A CB  1 
ATOM   1362  C  CG1 . VAL A  1 170 ? 27.617  48.924  29.749  1.00 30.43  ? 201  VAL A CG1 1 
ATOM   1363  C  CG2 . VAL A  1 170 ? 25.768  50.276  30.762  1.00 31.25  ? 201  VAL A CG2 1 
ATOM   1364  N  N   . GLY A  1 171 ? 27.254  51.029  33.995  1.00 28.94  ? 202  GLY A N   1 
ATOM   1365  C  CA  . GLY A  1 171 ? 26.714  51.982  34.944  1.00 28.31  ? 202  GLY A CA  1 
ATOM   1366  C  C   . GLY A  1 171 ? 27.531  53.270  34.959  1.00 28.21  ? 202  GLY A C   1 
ATOM   1367  O  O   . GLY A  1 171 ? 28.720  53.265  35.266  1.00 31.25  ? 202  GLY A O   1 
ATOM   1368  N  N   . GLY A  1 172 ? 26.898  54.386  34.619  1.00 27.17  ? 203  GLY A N   1 
ATOM   1369  C  CA  . GLY A  1 172 ? 27.583  55.664  34.630  1.00 25.22  ? 203  GLY A CA  1 
ATOM   1370  C  C   . GLY A  1 172 ? 28.158  56.017  33.279  1.00 24.16  ? 203  GLY A C   1 
ATOM   1371  O  O   . GLY A  1 172 ? 28.454  57.206  33.057  1.00 26.30  ? 203  GLY A O   1 
ATOM   1372  N  N   . ASP A  1 173 ? 28.319  55.069  32.384  1.00 22.83  ? 204  ASP A N   1 
ATOM   1373  C  CA  . ASP A  1 173 ? 28.901  55.407  31.085  1.00 23.06  ? 204  ASP A CA  1 
ATOM   1374  C  C   . ASP A  1 173 ? 28.118  56.533  30.412  1.00 21.41  ? 204  ASP A C   1 
ATOM   1375  O  O   . ASP A  1 173 ? 26.887  56.485  30.412  1.00 21.26  ? 204  ASP A O   1 
ATOM   1376  C  CB  . ASP A  1 173 ? 28.968  54.198  30.175  1.00 26.68  ? 204  ASP A CB  1 
ATOM   1377  C  CG  . ASP A  1 173 ? 30.060  53.223  30.582  1.00 29.30  ? 204  ASP A CG  1 
ATOM   1378  O  OD1 . ASP A  1 173 ? 30.674  53.444  31.648  1.00 31.02  ? 204  ASP A OD1 1 
ATOM   1379  O  OD2 . ASP A  1 173 ? 30.270  52.255  29.816  1.00 28.63  ? 204  ASP A OD2 1 
ATOM   1380  N  N   . SER A  1 174 ? 28.828  57.514  29.877  1.00 19.84  ? 205  SER A N   1 
ATOM   1381  C  CA  . SER A  1 174 ? 28.215  58.605  29.133  1.00 20.70  ? 205  SER A CA  1 
ATOM   1382  C  C   . SER A  1 174 ? 28.619  58.497  27.669  1.00 20.68  ? 205  SER A C   1 
ATOM   1383  O  O   . SER A  1 174 ? 29.749  58.370  27.286  1.00 20.63  ? 205  SER A O   1 
ATOM   1384  C  CB  . SER A  1 174 ? 28.724  59.934  29.703  1.00 21.75  ? 205  SER A CB  1 
ATOM   1385  O  OG  . SER A  1 174 ? 28.637  59.949  31.111  1.00 22.25  ? 205  SER A OG  1 
ATOM   1386  N  N   . HIS A  1 175 ? 27.641  58.518  26.764  1.00 20.67  ? 206  HIS A N   1 
ATOM   1387  C  CA  . HIS A  1 175 ? 27.879  58.341  25.332  1.00 19.43  ? 206  HIS A CA  1 
ATOM   1388  C  C   . HIS A  1 175 ? 27.306  59.514  24.542  1.00 19.17  ? 206  HIS A C   1 
ATOM   1389  O  O   . HIS A  1 175 ? 26.133  59.854  24.694  1.00 20.61  ? 206  HIS A O   1 
ATOM   1390  C  CB  . HIS A  1 175 ? 27.235  57.045  24.837  1.00 18.31  ? 206  HIS A CB  1 
ATOM   1391  C  CG  . HIS A  1 175 ? 27.697  55.810  25.530  1.00 21.31  ? 206  HIS A CG  1 
ATOM   1392  N  ND1 . HIS A  1 175 ? 26.990  54.665  25.715  1.00 19.49  ? 206  HIS A ND1 1 
ATOM   1393  C  CD2 . HIS A  1 175 ? 28.897  55.537  26.127  1.00 25.00  ? 206  HIS A CD2 1 
ATOM   1394  C  CE1 . HIS A  1 175 ? 27.652  53.749  26.341  1.00 22.76  ? 206  HIS A CE1 1 
ATOM   1395  N  NE2 . HIS A  1 175 ? 28.836  54.264  26.614  1.00 27.41  ? 206  HIS A NE2 1 
ATOM   1396  N  N   . PHE A  1 176 ? 28.137  60.124  23.716  1.00 17.64  ? 207  PHE A N   1 
ATOM   1397  C  CA  . PHE A  1 176 ? 27.749  61.231  22.882  1.00 16.06  ? 207  PHE A CA  1 
ATOM   1398  C  C   . PHE A  1 176 ? 27.646  60.904  21.398  1.00 15.51  ? 207  PHE A C   1 
ATOM   1399  O  O   . PHE A  1 176 ? 28.513  60.167  20.920  1.00 15.94  ? 207  PHE A O   1 
ATOM   1400  C  CB  . PHE A  1 176 ? 28.713  62.393  23.094  1.00 15.00  ? 207  PHE A CB  1 
ATOM   1401  C  CG  . PHE A  1 176 ? 28.833  62.845  24.520  1.00 15.00  ? 207  PHE A CG  1 
ATOM   1402  C  CD1 . PHE A  1 176 ? 29.626  62.115  25.377  1.00 15.00  ? 207  PHE A CD1 1 
ATOM   1403  C  CD2 . PHE A  1 176 ? 28.185  63.959  25.004  1.00 15.99  ? 207  PHE A CD2 1 
ATOM   1404  C  CE1 . PHE A  1 176 ? 29.792  62.443  26.694  1.00 15.73  ? 207  PHE A CE1 1 
ATOM   1405  C  CE2 . PHE A  1 176 ? 28.333  64.318  26.331  1.00 19.06  ? 207  PHE A CE2 1 
ATOM   1406  C  CZ  . PHE A  1 176 ? 29.141  63.577  27.179  1.00 17.38  ? 207  PHE A CZ  1 
ATOM   1407  N  N   . ASP A  1 177 ? 26.626  61.342  20.748  1.00 18.09  ? 208  ASP A N   1 
ATOM   1408  C  CA  . ASP A  1 177 ? 26.387  61.014  19.352  1.00 20.71  ? 208  ASP A CA  1 
ATOM   1409  C  C   . ASP A  1 177 ? 27.502  61.591  18.489  1.00 22.27  ? 208  ASP A C   1 
ATOM   1410  O  O   . ASP A  1 177 ? 27.675  62.809  18.412  1.00 22.26  ? 208  ASP A O   1 
ATOM   1411  C  CB  . ASP A  1 177 ? 25.024  61.542  18.916  1.00 23.28  ? 208  ASP A CB  1 
ATOM   1412  C  CG  . ASP A  1 177 ? 24.700  61.040  17.523  1.00 25.75  ? 208  ASP A CG  1 
ATOM   1413  O  OD1 . ASP A  1 177 ? 25.602  60.538  16.833  1.00 28.15  ? 208  ASP A OD1 1 
ATOM   1414  O  OD2 . ASP A  1 177 ? 23.557  61.115  17.099  1.00 25.40  ? 208  ASP A OD2 1 
ATOM   1415  N  N   . ASP A  1 178 ? 28.240  60.731  17.813  1.00 23.05  ? 209  ASP A N   1 
ATOM   1416  C  CA  . ASP A  1 178 ? 29.353  61.146  16.983  1.00 23.50  ? 209  ASP A CA  1 
ATOM   1417  C  C   . ASP A  1 178 ? 28.910  61.753  15.666  1.00 23.22  ? 209  ASP A C   1 
ATOM   1418  O  O   . ASP A  1 178 ? 29.741  62.121  14.811  1.00 23.12  ? 209  ASP A O   1 
ATOM   1419  C  CB  . ASP A  1 178 ? 30.301  59.989  16.729  1.00 26.37  ? 209  ASP A CB  1 
ATOM   1420  C  CG  . ASP A  1 178 ? 31.542  60.394  15.981  1.00 27.94  ? 209  ASP A CG  1 
ATOM   1421  O  OD1 . ASP A  1 178 ? 32.248  61.293  16.489  1.00 32.16  ? 209  ASP A OD1 1 
ATOM   1422  O  OD2 . ASP A  1 178 ? 31.859  59.858  14.906  1.00 28.40  ? 209  ASP A OD2 1 
ATOM   1423  N  N   . ASP A  1 179 ? 27.624  61.969  15.448  1.00 21.32  ? 210  ASP A N   1 
ATOM   1424  C  CA  . ASP A  1 179 ? 27.152  62.603  14.231  1.00 21.73  ? 210  ASP A CA  1 
ATOM   1425  C  C   . ASP A  1 179 ? 26.722  64.045  14.445  1.00 21.11  ? 210  ASP A C   1 
ATOM   1426  O  O   . ASP A  1 179 ? 26.060  64.638  13.593  1.00 19.06  ? 210  ASP A O   1 
ATOM   1427  C  CB  . ASP A  1 179 ? 26.062  61.752  13.596  1.00 24.04  ? 210  ASP A CB  1 
ATOM   1428  C  CG  . ASP A  1 179 ? 26.606  60.568  12.821  1.00 24.43  ? 210  ASP A CG  1 
ATOM   1429  O  OD1 . ASP A  1 179 ? 27.511  60.769  11.984  1.00 25.64  ? 210  ASP A OD1 1 
ATOM   1430  O  OD2 . ASP A  1 179 ? 26.123  59.438  13.047  1.00 25.99  ? 210  ASP A OD2 1 
ATOM   1431  N  N   . GLU A  1 180 ? 27.114  64.610  15.573  1.00 22.30  ? 211  GLU A N   1 
ATOM   1432  C  CA  . GLU A  1 180 ? 26.792  65.993  15.879  1.00 25.30  ? 211  GLU A CA  1 
ATOM   1433  C  C   . GLU A  1 180 ? 27.980  66.905  15.617  1.00 27.50  ? 211  GLU A C   1 
ATOM   1434  O  O   . GLU A  1 180 ? 29.130  66.468  15.663  1.00 31.15  ? 211  GLU A O   1 
ATOM   1435  C  CB  . GLU A  1 180 ? 26.367  66.143  17.341  1.00 24.90  ? 211  GLU A CB  1 
ATOM   1436  C  CG  . GLU A  1 180 ? 25.094  65.404  17.703  1.00 26.01  ? 211  GLU A CG  1 
ATOM   1437  C  CD  . GLU A  1 180 ? 23.966  65.689  16.735  1.00 25.95  ? 211  GLU A CD  1 
ATOM   1438  O  OE1 . GLU A  1 180 ? 24.017  66.735  16.055  1.00 26.66  ? 211  GLU A OE1 1 
ATOM   1439  O  OE2 . GLU A  1 180 ? 23.033  64.865  16.656  1.00 23.75  ? 211  GLU A OE2 1 
ATOM   1440  N  N   . LEU A  1 181 ? 27.696  68.168  15.331  1.00 25.37  ? 212  LEU A N   1 
ATOM   1441  C  CA  . LEU A  1 181 ? 28.757  69.146  15.157  1.00 21.70  ? 212  LEU A CA  1 
ATOM   1442  C  C   . LEU A  1 181 ? 29.109  69.697  16.535  1.00 21.53  ? 212  LEU A C   1 
ATOM   1443  O  O   . LEU A  1 181 ? 28.563  70.730  16.950  1.00 24.20  ? 212  LEU A O   1 
ATOM   1444  C  CB  . LEU A  1 181 ? 28.330  70.218  14.149  1.00 21.80  ? 212  LEU A CB  1 
ATOM   1445  C  CG  . LEU A  1 181 ? 29.452  70.974  13.422  1.00 20.28  ? 212  LEU A CG  1 
ATOM   1446  C  CD1 . LEU A  1 181 ? 29.632  72.358  14.028  1.00 18.59  ? 212  LEU A CD1 1 
ATOM   1447  C  CD2 . LEU A  1 181 ? 30.759  70.198  13.465  1.00 21.13  ? 212  LEU A CD2 1 
ATOM   1448  N  N   . TRP A  1 182 ? 30.002  68.953  17.193  1.00 20.98  ? 213  TRP A N   1 
ATOM   1449  C  CA  . TRP A  1 182 ? 30.451  69.236  18.553  1.00 21.24  ? 213  TRP A CA  1 
ATOM   1450  C  C   . TRP A  1 182 ? 31.289  70.493  18.623  1.00 23.08  ? 213  TRP A C   1 
ATOM   1451  O  O   . TRP A  1 182 ? 32.344  70.585  17.993  1.00 25.96  ? 213  TRP A O   1 
ATOM   1452  C  CB  . TRP A  1 182 ? 31.181  68.019  19.118  1.00 21.12  ? 213  TRP A CB  1 
ATOM   1453  C  CG  . TRP A  1 182 ? 30.244  66.880  19.351  1.00 22.07  ? 213  TRP A CG  1 
ATOM   1454  C  CD1 . TRP A  1 182 ? 30.241  65.673  18.718  1.00 20.49  ? 213  TRP A CD1 1 
ATOM   1455  C  CD2 . TRP A  1 182 ? 29.159  66.851  20.287  1.00 21.04  ? 213  TRP A CD2 1 
ATOM   1456  N  NE1 . TRP A  1 182 ? 29.204  64.900  19.184  1.00 20.29  ? 213  TRP A NE1 1 
ATOM   1457  C  CE2 . TRP A  1 182 ? 28.519  65.605  20.139  1.00 22.28  ? 213  TRP A CE2 1 
ATOM   1458  C  CE3 . TRP A  1 182 ? 28.658  67.759  21.225  1.00 21.01  ? 213  TRP A CE3 1 
ATOM   1459  C  CZ2 . TRP A  1 182 ? 27.390  65.254  20.876  1.00 23.10  ? 213  TRP A CZ2 1 
ATOM   1460  C  CZ3 . TRP A  1 182 ? 27.545  67.404  21.965  1.00 20.35  ? 213  TRP A CZ3 1 
ATOM   1461  C  CH2 . TRP A  1 182 ? 26.921  66.163  21.784  1.00 21.08  ? 213  TRP A CH2 1 
ATOM   1462  N  N   . THR A  1 183 ? 30.782  71.422  19.405  1.00 23.26  ? 214  THR A N   1 
ATOM   1463  C  CA  . THR A  1 183 ? 31.395  72.715  19.563  1.00 24.09  ? 214  THR A CA  1 
ATOM   1464  C  C   . THR A  1 183 ? 31.391  73.152  21.031  1.00 24.70  ? 214  THR A C   1 
ATOM   1465  O  O   . THR A  1 183 ? 31.257  72.360  21.946  1.00 24.78  ? 214  THR A O   1 
ATOM   1466  C  CB  . THR A  1 183 ? 30.613  73.765  18.771  1.00 25.67  ? 214  THR A CB  1 
ATOM   1467  O  OG1 . THR A  1 183 ? 29.304  73.915  19.351  1.00 24.51  ? 214  THR A OG1 1 
ATOM   1468  C  CG2 . THR A  1 183 ? 30.471  73.343  17.317  1.00 24.24  ? 214  THR A CG2 1 
ATOM   1469  N  N   . LEU A  1 184 ? 31.524  74.452  21.232  1.00 24.64  ? 215  LEU A N   1 
ATOM   1470  C  CA  . LEU A  1 184 ? 31.385  75.012  22.568  1.00 25.51  ? 215  LEU A CA  1 
ATOM   1471  C  C   . LEU A  1 184 ? 30.092  75.799  22.700  1.00 27.29  ? 215  LEU A C   1 
ATOM   1472  O  O   . LEU A  1 184 ? 29.835  76.437  23.718  1.00 29.58  ? 215  LEU A O   1 
ATOM   1473  C  CB  . LEU A  1 184 ? 32.569  75.844  23.020  1.00 23.30  ? 215  LEU A CB  1 
ATOM   1474  C  CG  . LEU A  1 184 ? 33.823  75.023  23.341  1.00 24.54  ? 215  LEU A CG  1 
ATOM   1475  C  CD1 . LEU A  1 184 ? 34.983  75.929  23.702  1.00 24.94  ? 215  LEU A CD1 1 
ATOM   1476  C  CD2 . LEU A  1 184 ? 33.540  74.069  24.492  1.00 25.27  ? 215  LEU A CD2 1 
ATOM   1477  N  N   . GLY A  1 185 ? 29.215  75.636  21.707  1.00 26.76  ? 216  GLY A N   1 
ATOM   1478  C  CA  . GLY A  1 185 ? 27.909  76.233  21.737  1.00 27.59  ? 216  GLY A CA  1 
ATOM   1479  C  C   . GLY A  1 185 ? 27.680  77.337  20.732  1.00 27.90  ? 216  GLY A C   1 
ATOM   1480  O  O   . GLY A  1 185 ? 26.520  77.665  20.431  1.00 29.21  ? 216  GLY A O   1 
ATOM   1481  N  N   . GLU A  1 186 ? 28.733  77.984  20.251  1.00 26.71  ? 217  GLU A N   1 
ATOM   1482  C  CA  . GLU A  1 186 ? 28.585  79.104  19.335  1.00 24.24  ? 217  GLU A CA  1 
ATOM   1483  C  C   . GLU A  1 186 ? 29.280  78.887  18.004  1.00 21.87  ? 217  GLU A C   1 
ATOM   1484  O  O   . GLU A  1 186 ? 30.107  79.698  17.601  1.00 22.88  ? 217  GLU A O   1 
ATOM   1485  C  CB  . GLU A  1 186 ? 29.135  80.377  19.978  1.00 25.93  ? 217  GLU A CB  1 
ATOM   1486  C  CG  . GLU A  1 186 ? 28.560  80.705  21.335  1.00 29.87  ? 217  GLU A CG  1 
ATOM   1487  C  CD  . GLU A  1 186 ? 29.047  82.044  21.850  1.00 33.63  ? 217  GLU A CD  1 
ATOM   1488  O  OE1 . GLU A  1 186 ? 28.847  83.061  21.150  1.00 36.03  ? 217  GLU A OE1 1 
ATOM   1489  O  OE2 . GLU A  1 186 ? 29.634  82.082  22.953  1.00 34.86  ? 217  GLU A OE2 1 
ATOM   1490  N  N   . GLY A  1 187 ? 28.935  77.834  17.285  1.00 20.27  ? 218  GLY A N   1 
ATOM   1491  C  CA  . GLY A  1 187 ? 29.555  77.561  15.997  1.00 19.59  ? 218  GLY A CA  1 
ATOM   1492  C  C   . GLY A  1 187 ? 30.786  76.674  16.039  1.00 19.05  ? 218  GLY A C   1 
ATOM   1493  O  O   . GLY A  1 187 ? 31.424  76.472  17.079  1.00 19.03  ? 218  GLY A O   1 
ATOM   1494  N  N   . GLN A  1 188 ? 31.222  76.221  14.865  1.00 18.92  ? 219  GLN A N   1 
ATOM   1495  C  CA  . GLN A  1 188 ? 32.380  75.363  14.736  1.00 20.39  ? 219  GLN A CA  1 
ATOM   1496  C  C   . GLN A  1 188 ? 33.580  75.880  15.503  1.00 19.78  ? 219  GLN A C   1 
ATOM   1497  O  O   . GLN A  1 188 ? 33.930  77.044  15.444  1.00 21.90  ? 219  GLN A O   1 
ATOM   1498  C  CB  . GLN A  1 188 ? 32.755  75.196  13.257  1.00 22.80  ? 219  GLN A CB  1 
ATOM   1499  C  CG  . GLN A  1 188 ? 33.812  74.127  12.988  1.00 25.04  ? 219  GLN A CG  1 
ATOM   1500  C  CD  . GLN A  1 188 ? 34.163  74.067  11.505  1.00 27.09  ? 219  GLN A CD  1 
ATOM   1501  O  OE1 . GLN A  1 188 ? 34.837  73.160  11.065  1.00 23.37  ? 219  GLN A OE1 1 
ATOM   1502  N  NE2 . GLN A  1 188 ? 33.716  75.075  10.770  1.00 27.29  ? 219  GLN A NE2 1 
ATOM   1503  N  N   . VAL A  1 189 ? 34.281  75.000  16.202  1.00 18.83  ? 220  VAL A N   1 
ATOM   1504  C  CA  . VAL A  1 189 ? 35.486  75.333  16.931  1.00 17.33  ? 220  VAL A CA  1 
ATOM   1505  C  C   . VAL A  1 189 ? 36.689  74.594  16.384  1.00 18.74  ? 220  VAL A C   1 
ATOM   1506  O  O   . VAL A  1 189 ? 36.693  73.369  16.231  1.00 20.11  ? 220  VAL A O   1 
ATOM   1507  C  CB  . VAL A  1 189 ? 35.405  74.971  18.425  1.00 15.00  ? 220  VAL A CB  1 
ATOM   1508  C  CG1 . VAL A  1 189 ? 36.789  74.880  19.046  1.00 16.61  ? 220  VAL A CG1 1 
ATOM   1509  C  CG2 . VAL A  1 189 ? 34.534  75.921  19.208  1.00 15.00  ? 220  VAL A CG2 1 
ATOM   1510  N  N   . VAL A  1 190 ? 37.683  75.330  15.916  1.00 18.85  ? 221  VAL A N   1 
ATOM   1511  C  CA  . VAL A  1 190 ? 38.886  74.721  15.341  1.00 18.69  ? 221  VAL A CA  1 
ATOM   1512  C  C   . VAL A  1 190 ? 40.097  75.388  15.985  1.00 19.05  ? 221  VAL A C   1 
ATOM   1513  O  O   . VAL A  1 190 ? 40.110  76.615  15.993  1.00 18.39  ? 221  VAL A O   1 
ATOM   1514  C  CB  . VAL A  1 190 ? 38.941  74.823  13.825  1.00 16.57  ? 221  VAL A CB  1 
ATOM   1515  C  CG1 . VAL A  1 190 ? 38.120  75.977  13.270  1.00 15.00  ? 221  VAL A CG1 1 
ATOM   1516  C  CG2 . VAL A  1 190 ? 40.382  75.012  13.340  1.00 15.00  ? 221  VAL A CG2 1 
ATOM   1517  N  N   . ARG A  1 191 ? 41.009  74.623  16.554  1.00 20.44  ? 222  ARG A N   1 
ATOM   1518  C  CA  . ARG A  1 191 ? 42.204  75.159  17.201  1.00 20.29  ? 222  ARG A CA  1 
ATOM   1519  C  C   . ARG A  1 191 ? 43.354  75.145  16.207  1.00 21.10  ? 222  ARG A C   1 
ATOM   1520  O  O   . ARG A  1 191 ? 43.772  74.103  15.717  1.00 20.80  ? 222  ARG A O   1 
ATOM   1521  C  CB  . ARG A  1 191 ? 42.469  74.484  18.513  1.00 18.77  ? 222  ARG A CB  1 
ATOM   1522  C  CG  . ARG A  1 191 ? 43.736  74.929  19.214  1.00 19.85  ? 222  ARG A CG  1 
ATOM   1523  C  CD  . ARG A  1 191 ? 43.533  74.790  20.703  1.00 23.21  ? 222  ARG A CD  1 
ATOM   1524  N  NE  . ARG A  1 191 ? 44.642  74.186  21.448  1.00 25.71  ? 222  ARG A NE  1 
ATOM   1525  C  CZ  . ARG A  1 191 ? 44.638  74.200  22.785  1.00 28.02  ? 222  ARG A CZ  1 
ATOM   1526  N  NH1 . ARG A  1 191 ? 43.605  74.787  23.399  1.00 31.61  ? 222  ARG A NH1 1 
ATOM   1527  N  NH2 . ARG A  1 191 ? 45.596  73.679  23.515  1.00 25.26  ? 222  ARG A NH2 1 
ATOM   1528  N  N   . VAL A  1 192 ? 43.845  76.343  15.945  1.00 22.28  ? 223  VAL A N   1 
ATOM   1529  C  CA  . VAL A  1 192 ? 44.880  76.598  14.968  1.00 22.32  ? 223  VAL A CA  1 
ATOM   1530  C  C   . VAL A  1 192 ? 46.235  75.990  15.277  1.00 24.00  ? 223  VAL A C   1 
ATOM   1531  O  O   . VAL A  1 192 ? 46.632  75.876  16.433  1.00 23.09  ? 223  VAL A O   1 
ATOM   1532  C  CB  . VAL A  1 192 ? 45.006  78.100  14.739  1.00 20.45  ? 223  VAL A CB  1 
ATOM   1533  C  CG1 . VAL A  1 192 ? 46.360  78.554  14.348  1.00 19.53  ? 223  VAL A CG1 1 
ATOM   1534  C  CG2 . VAL A  1 192 ? 43.870  78.608  13.876  1.00 18.09  ? 223  VAL A CG2 1 
ATOM   1535  N  N   . LYS A  1 193 ? 46.930  75.620  14.214  1.00 26.67  ? 224  LYS A N   1 
ATOM   1536  C  CA  . LYS A  1 193 ? 48.237  75.008  14.237  1.00 28.80  ? 224  LYS A CA  1 
ATOM   1537  C  C   . LYS A  1 193 ? 49.238  75.895  13.506  1.00 30.70  ? 224  LYS A C   1 
ATOM   1538  O  O   . LYS A  1 193 ? 49.036  76.221  12.342  1.00 31.34  ? 224  LYS A O   1 
ATOM   1539  C  CB  . LYS A  1 193 ? 48.219  73.631  13.541  1.00 27.75  ? 224  LYS A CB  1 
ATOM   1540  C  CG  . LYS A  1 193 ? 48.008  72.500  14.549  1.00 26.32  ? 224  LYS A CG  1 
ATOM   1541  C  CD  . LYS A  1 193 ? 49.099  72.580  15.612  1.00 28.30  ? 224  LYS A CD  1 
ATOM   1542  C  CE  . LYS A  1 193 ? 48.622  72.130  16.972  1.00 28.49  ? 224  LYS A CE  1 
ATOM   1543  N  NZ  . LYS A  1 193 ? 49.739  71.998  17.949  1.00 29.40  ? 224  LYS A NZ  1 
ATOM   1544  N  N   . TYR A  1 194 ? 50.314  76.229  14.211  1.00 32.04  ? 225  TYR A N   1 
ATOM   1545  C  CA  . TYR A  1 194 ? 51.375  77.047  13.635  1.00 33.37  ? 225  TYR A CA  1 
ATOM   1546  C  C   . TYR A  1 194 ? 50.856  78.376  13.175  1.00 35.11  ? 225  TYR A C   1 
ATOM   1547  O  O   . TYR A  1 194 ? 49.791  78.810  13.643  1.00 37.06  ? 225  TYR A O   1 
ATOM   1548  C  CB  . TYR A  1 194 ? 52.139  76.246  12.580  1.00 31.87  ? 225  TYR A CB  1 
ATOM   1549  C  CG  . TYR A  1 194 ? 52.565  74.907  13.146  1.00 34.75  ? 225  TYR A CG  1 
ATOM   1550  C  CD1 . TYR A  1 194 ? 53.208  74.856  14.380  1.00 37.59  ? 225  TYR A CD1 1 
ATOM   1551  C  CD2 . TYR A  1 194 ? 52.313  73.715  12.492  1.00 33.24  ? 225  TYR A CD2 1 
ATOM   1552  C  CE1 . TYR A  1 194 ? 53.595  73.648  14.945  1.00 37.85  ? 225  TYR A CE1 1 
ATOM   1553  C  CE2 . TYR A  1 194 ? 52.700  72.502  13.038  1.00 34.83  ? 225  TYR A CE2 1 
ATOM   1554  C  CZ  . TYR A  1 194 ? 53.340  72.478  14.259  1.00 37.67  ? 225  TYR A CZ  1 
ATOM   1555  O  OH  . TYR A  1 194 ? 53.727  71.267  14.796  1.00 39.42  ? 225  TYR A OH  1 
ATOM   1556  N  N   . GLY A  1 195 ? 51.576  79.129  12.348  1.00 36.39  ? 226  GLY A N   1 
ATOM   1557  C  CA  . GLY A  1 195 ? 51.090  80.497  12.052  1.00 36.66  ? 226  GLY A CA  1 
ATOM   1558  C  C   . GLY A  1 195 ? 51.509  81.387  13.230  1.00 37.20  ? 226  GLY A C   1 
ATOM   1559  O  O   . GLY A  1 195 ? 52.181  80.913  14.155  1.00 36.49  ? 226  GLY A O   1 
ATOM   1560  N  N   . ASN A  1 196 ? 51.097  82.651  13.256  1.00 36.95  ? 227  ASN A N   1 
ATOM   1561  C  CA  . ASN A  1 196 ? 51.506  83.536  14.338  1.00 37.75  ? 227  ASN A CA  1 
ATOM   1562  C  C   . ASN A  1 196 ? 50.623  83.437  15.567  1.00 37.39  ? 227  ASN A C   1 
ATOM   1563  O  O   . ASN A  1 196 ? 50.763  84.215  16.514  1.00 37.84  ? 227  ASN A O   1 
ATOM   1564  C  CB  . ASN A  1 196 ? 51.558  84.994  13.862  1.00 39.38  ? 227  ASN A CB  1 
ATOM   1565  C  CG  . ASN A  1 196 ? 50.209  85.468  13.365  1.00 41.45  ? 227  ASN A CG  1 
ATOM   1566  O  OD1 . ASN A  1 196 ? 49.192  84.808  13.587  1.00 44.49  ? 227  ASN A OD1 1 
ATOM   1567  N  ND2 . ASN A  1 196 ? 50.207  86.603  12.686  1.00 42.84  ? 227  ASN A ND2 1 
ATOM   1568  N  N   . ALA A  1 197 ? 49.681  82.509  15.558  1.00 36.92  ? 228  ALA A N   1 
ATOM   1569  C  CA  . ALA A  1 197 ? 48.745  82.361  16.659  1.00 35.94  ? 228  ALA A CA  1 
ATOM   1570  C  C   . ALA A  1 197 ? 48.506  80.904  17.001  1.00 35.19  ? 228  ALA A C   1 
ATOM   1571  O  O   . ALA A  1 197 ? 47.399  80.523  17.380  1.00 38.74  ? 228  ALA A O   1 
ATOM   1572  C  CB  . ALA A  1 197 ? 47.432  83.036  16.286  1.00 35.64  ? 228  ALA A CB  1 
ATOM   1573  N  N   . ASP A  1 198 ? 49.505  80.059  16.838  1.00 33.15  ? 229  ASP A N   1 
ATOM   1574  C  CA  . ASP A  1 198 ? 49.373  78.658  17.228  1.00 31.03  ? 229  ASP A CA  1 
ATOM   1575  C  C   . ASP A  1 198 ? 48.727  78.525  18.602  1.00 30.57  ? 229  ASP A C   1 
ATOM   1576  O  O   . ASP A  1 198 ? 49.013  79.292  19.527  1.00 28.98  ? 229  ASP A O   1 
ATOM   1577  C  CB  . ASP A  1 198 ? 50.777  78.028  17.270  1.00 29.91  ? 229  ASP A CB  1 
ATOM   1578  C  CG  . ASP A  1 198 ? 50.748  76.612  17.812  1.00 28.42  ? 229  ASP A CG  1 
ATOM   1579  O  OD1 . ASP A  1 198 ? 50.540  75.697  17.000  1.00 28.96  ? 229  ASP A OD1 1 
ATOM   1580  O  OD2 . ASP A  1 198 ? 50.912  76.419  19.031  1.00 26.02  ? 229  ASP A OD2 1 
ATOM   1581  N  N   . GLY A  1 199 ? 47.815  77.560  18.729  1.00 29.89  ? 230  GLY A N   1 
ATOM   1582  C  CA  . GLY A  1 199 ? 46.944  77.290  19.803  1.00 30.23  ? 230  GLY A CA  1 
ATOM   1583  C  C   . GLY A  1 199 ? 45.676  78.081  20.001  1.00 32.31  ? 230  GLY A C   1 
ATOM   1584  O  O   . GLY A  1 199 ? 44.824  77.705  20.819  1.00 34.13  ? 230  GLY A O   1 
ATOM   1585  N  N   . GLU A  1 200 ? 45.520  79.201  19.301  1.00 31.56  ? 231  GLU A N   1 
ATOM   1586  C  CA  . GLU A  1 200 ? 44.300  79.984  19.432  1.00 30.49  ? 231  GLU A CA  1 
ATOM   1587  C  C   . GLU A  1 200 ? 43.224  79.384  18.532  1.00 30.76  ? 231  GLU A C   1 
ATOM   1588  O  O   . GLU A  1 200 ? 43.546  78.724  17.542  1.00 30.98  ? 231  GLU A O   1 
ATOM   1589  C  CB  . GLU A  1 200 ? 44.567  81.437  19.080  1.00 32.34  ? 231  GLU A CB  1 
ATOM   1590  C  CG  . GLU A  1 200 ? 45.771  82.034  19.805  1.00 33.69  ? 231  GLU A CG  1 
ATOM   1591  C  CD  . GLU A  1 200 ? 45.520  82.038  21.301  1.00 34.19  ? 231  GLU A CD  1 
ATOM   1592  O  OE1 . GLU A  1 200 ? 44.432  82.534  21.667  1.00 37.47  ? 231  GLU A OE1 1 
ATOM   1593  O  OE2 . GLU A  1 200 ? 46.354  81.565  22.081  1.00 34.85  ? 231  GLU A OE2 1 
ATOM   1594  N  N   . TYR A  1 201 ? 41.957  79.682  18.818  1.00 28.77  ? 232  TYR A N   1 
ATOM   1595  C  CA  . TYR A  1 201 ? 40.901  79.056  18.040  1.00 27.93  ? 232  TYR A CA  1 
ATOM   1596  C  C   . TYR A  1 201 ? 40.569  79.952  16.850  1.00 26.60  ? 232  TYR A C   1 
ATOM   1597  O  O   . TYR A  1 201 ? 40.615  81.175  17.018  1.00 26.51  ? 232  TYR A O   1 
ATOM   1598  C  CB  . TYR A  1 201 ? 39.646  78.884  18.867  1.00 28.97  ? 232  TYR A CB  1 
ATOM   1599  C  CG  . TYR A  1 201 ? 39.624  77.883  19.977  1.00 29.32  ? 232  TYR A CG  1 
ATOM   1600  C  CD1 . TYR A  1 201 ? 39.777  76.531  19.780  1.00 28.00  ? 232  TYR A CD1 1 
ATOM   1601  C  CD2 . TYR A  1 201 ? 39.372  78.300  21.283  1.00 30.28  ? 232  TYR A CD2 1 
ATOM   1602  C  CE1 . TYR A  1 201 ? 39.704  75.629  20.809  1.00 31.26  ? 232  TYR A CE1 1 
ATOM   1603  C  CE2 . TYR A  1 201 ? 39.302  77.415  22.337  1.00 31.59  ? 232  TYR A CE2 1 
ATOM   1604  C  CZ  . TYR A  1 201 ? 39.474  76.071  22.087  1.00 31.22  ? 232  TYR A CZ  1 
ATOM   1605  O  OH  . TYR A  1 201 ? 39.418  75.170  23.120  1.00 33.65  ? 232  TYR A OH  1 
ATOM   1606  N  N   . CYS A  1 202 ? 40.190  79.378  15.734  1.00 25.14  ? 233  CYS A N   1 
ATOM   1607  C  CA  . CYS A  1 202 ? 39.751  80.225  14.603  1.00 24.64  ? 233  CYS A CA  1 
ATOM   1608  C  C   . CYS A  1 202 ? 38.516  80.963  15.162  1.00 25.85  ? 233  CYS A C   1 
ATOM   1609  O  O   . CYS A  1 202 ? 37.887  80.487  16.110  1.00 27.18  ? 233  CYS A O   1 
ATOM   1610  C  CB  . CYS A  1 202 ? 39.319  79.319  13.418  1.00 23.94  ? 233  CYS A CB  1 
ATOM   1611  S  SG  . CYS A  1 202 ? 40.663  78.535  12.463  1.00 27.91  ? 233  CYS A SG  1 
ATOM   1612  N  N   . LYS A  1 203 ? 38.333  82.167  14.668  1.00 25.43  ? 234  LYS A N   1 
ATOM   1613  C  CA  . LYS A  1 203 ? 37.333  83.122  15.104  1.00 24.99  ? 234  LYS A CA  1 
ATOM   1614  C  C   . LYS A  1 203 ? 36.343  83.291  13.945  1.00 25.61  ? 234  LYS A C   1 
ATOM   1615  O  O   . LYS A  1 203 ? 36.719  83.713  12.860  1.00 24.12  ? 234  LYS A O   1 
ATOM   1616  C  CB  . LYS A  1 203 ? 37.891  84.493  15.480  1.00 25.27  ? 234  LYS A CB  1 
ATOM   1617  C  CG  . LYS A  1 203 ? 36.856  85.425  16.113  1.00 23.50  ? 234  LYS A CG  1 
ATOM   1618  C  CD  . LYS A  1 203 ? 36.997  85.444  17.623  1.00 24.59  ? 234  LYS A CD  1 
ATOM   1619  C  CE  . LYS A  1 203 ? 35.735  85.910  18.315  1.00 26.21  ? 234  LYS A CE  1 
ATOM   1620  N  NZ  . LYS A  1 203 ? 35.816  85.778  19.800  1.00 28.52  ? 234  LYS A NZ  1 
ATOM   1621  N  N   . PHE A  1 204 ? 35.164  82.721  14.159  1.00 26.24  ? 235  PHE A N   1 
ATOM   1622  C  CA  . PHE A  1 204 ? 34.172  82.792  13.086  1.00 27.14  ? 235  PHE A CA  1 
ATOM   1623  C  C   . PHE A  1 204 ? 33.017  83.674  13.521  1.00 28.92  ? 235  PHE A C   1 
ATOM   1624  O  O   . PHE A  1 204 ? 32.521  83.514  14.639  1.00 31.31  ? 235  PHE A O   1 
ATOM   1625  C  CB  . PHE A  1 204 ? 33.657  81.401  12.724  1.00 24.49  ? 235  PHE A CB  1 
ATOM   1626  C  CG  . PHE A  1 204 ? 34.715  80.497  12.164  1.00 24.13  ? 235  PHE A CG  1 
ATOM   1627  C  CD1 . PHE A  1 204 ? 35.479  80.874  11.079  1.00 23.93  ? 235  PHE A CD1 1 
ATOM   1628  C  CD2 . PHE A  1 204 ? 34.972  79.266  12.741  1.00 24.82  ? 235  PHE A CD2 1 
ATOM   1629  C  CE1 . PHE A  1 204 ? 36.474  80.043  10.583  1.00 21.68  ? 235  PHE A CE1 1 
ATOM   1630  C  CE2 . PHE A  1 204 ? 35.957  78.435  12.233  1.00 23.62  ? 235  PHE A CE2 1 
ATOM   1631  C  CZ  . PHE A  1 204 ? 36.705  78.829  11.146  1.00 21.87  ? 235  PHE A CZ  1 
ATOM   1632  N  N   . PRO A  1 205 ? 32.606  84.605  12.682  1.00 28.29  ? 236  PRO A N   1 
ATOM   1633  C  CA  . PRO A  1 205 ? 33.194  84.898  11.393  1.00 28.89  ? 236  PRO A CA  1 
ATOM   1634  C  C   . PRO A  1 205 ? 34.379  85.857  11.512  1.00 29.66  ? 236  PRO A C   1 
ATOM   1635  O  O   . PRO A  1 205 ? 34.441  86.650  12.445  1.00 30.07  ? 236  PRO A O   1 
ATOM   1636  C  CB  . PRO A  1 205 ? 32.054  85.639  10.677  1.00 27.53  ? 236  PRO A CB  1 
ATOM   1637  C  CG  . PRO A  1 205 ? 31.361  86.366  11.763  1.00 28.14  ? 236  PRO A CG  1 
ATOM   1638  C  CD  . PRO A  1 205 ? 31.472  85.516  12.987  1.00 27.23  ? 236  PRO A CD  1 
ATOM   1639  N  N   . PHE A  1 206 ? 35.292  85.804  10.553  1.00 30.44  ? 237  PHE A N   1 
ATOM   1640  C  CA  . PHE A  1 206 ? 36.447  86.685  10.527  1.00 29.86  ? 237  PHE A CA  1 
ATOM   1641  C  C   . PHE A  1 206 ? 36.456  87.529  9.265   1.00 29.82  ? 237  PHE A C   1 
ATOM   1642  O  O   . PHE A  1 206 ? 36.049  87.122  8.186   1.00 27.87  ? 237  PHE A O   1 
ATOM   1643  C  CB  . PHE A  1 206 ? 37.767  85.969  10.733  1.00 29.09  ? 237  PHE A CB  1 
ATOM   1644  C  CG  . PHE A  1 206 ? 38.279  85.144  9.599   1.00 27.78  ? 237  PHE A CG  1 
ATOM   1645  C  CD1 . PHE A  1 206 ? 39.066  85.721  8.620   1.00 28.03  ? 237  PHE A CD1 1 
ATOM   1646  C  CD2 . PHE A  1 206 ? 38.010  83.790  9.500   1.00 26.95  ? 237  PHE A CD2 1 
ATOM   1647  C  CE1 . PHE A  1 206 ? 39.566  84.981  7.572   1.00 28.19  ? 237  PHE A CE1 1 
ATOM   1648  C  CE2 . PHE A  1 206 ? 38.502  83.041  8.450   1.00 26.89  ? 237  PHE A CE2 1 
ATOM   1649  C  CZ  . PHE A  1 206 ? 39.286  83.636  7.480   1.00 25.91  ? 237  PHE A CZ  1 
ATOM   1650  N  N   . LEU A  1 207 ? 36.917  88.767  9.414   1.00 32.51  ? 238  LEU A N   1 
ATOM   1651  C  CA  . LEU A  1 207 ? 36.951  89.698  8.293   1.00 34.77  ? 238  LEU A CA  1 
ATOM   1652  C  C   . LEU A  1 207 ? 38.292  89.697  7.583   1.00 36.23  ? 238  LEU A C   1 
ATOM   1653  O  O   . LEU A  1 207 ? 39.293  90.082  8.185   1.00 36.76  ? 238  LEU A O   1 
ATOM   1654  C  CB  . LEU A  1 207 ? 36.642  91.108  8.808   1.00 34.07  ? 238  LEU A CB  1 
ATOM   1655  C  CG  . LEU A  1 207 ? 36.505  92.184  7.729   1.00 33.70  ? 238  LEU A CG  1 
ATOM   1656  C  CD1 . LEU A  1 207 ? 35.452  91.797  6.712   1.00 30.68  ? 238  LEU A CD1 1 
ATOM   1657  C  CD2 . LEU A  1 207 ? 36.208  93.534  8.357   1.00 33.23  ? 238  LEU A CD2 1 
ATOM   1658  N  N   . PHE A  1 208 ? 38.310  89.322  6.309   1.00 38.12  ? 239  PHE A N   1 
ATOM   1659  C  CA  . PHE A  1 208 ? 39.549  89.274  5.554   1.00 40.48  ? 239  PHE A CA  1 
ATOM   1660  C  C   . PHE A  1 208 ? 39.399  89.750  4.121   1.00 42.12  ? 239  PHE A C   1 
ATOM   1661  O  O   . PHE A  1 208 ? 38.685  89.175  3.311   1.00 43.13  ? 239  PHE A O   1 
ATOM   1662  C  CB  . PHE A  1 208 ? 40.154  87.871  5.566   1.00 41.65  ? 239  PHE A CB  1 
ATOM   1663  C  CG  . PHE A  1 208 ? 41.255  87.686  4.562   1.00 42.49  ? 239  PHE A CG  1 
ATOM   1664  C  CD1 . PHE A  1 208 ? 42.444  88.368  4.719   1.00 42.50  ? 239  PHE A CD1 1 
ATOM   1665  C  CD2 . PHE A  1 208 ? 41.097  86.847  3.475   1.00 44.58  ? 239  PHE A CD2 1 
ATOM   1666  C  CE1 . PHE A  1 208 ? 43.465  88.216  3.803   1.00 43.53  ? 239  PHE A CE1 1 
ATOM   1667  C  CE2 . PHE A  1 208 ? 42.116  86.687  2.557   1.00 46.41  ? 239  PHE A CE2 1 
ATOM   1668  C  CZ  . PHE A  1 208 ? 43.301  87.378  2.724   1.00 45.22  ? 239  PHE A CZ  1 
ATOM   1669  N  N   . ASN A  1 209 ? 40.157  90.792  3.790   1.00 44.01  ? 240  ASN A N   1 
ATOM   1670  C  CA  . ASN A  1 209 ? 40.124  91.340  2.438   1.00 45.91  ? 240  ASN A CA  1 
ATOM   1671  C  C   . ASN A  1 209 ? 38.715  91.769  2.060   1.00 45.30  ? 240  ASN A C   1 
ATOM   1672  O  O   . ASN A  1 209 ? 38.219  91.455  0.982   1.00 45.42  ? 240  ASN A O   1 
ATOM   1673  C  CB  . ASN A  1 209 ? 40.664  90.312  1.446   1.00 50.47  ? 240  ASN A CB  1 
ATOM   1674  C  CG  . ASN A  1 209 ? 41.155  90.937  0.157   1.00 53.69  ? 240  ASN A CG  1 
ATOM   1675  O  OD1 . ASN A  1 209 ? 41.439  92.132  0.098   1.00 54.85  ? 240  ASN A OD1 1 
ATOM   1676  N  ND2 . ASN A  1 209 ? 41.256  90.123  -0.888  1.00 55.95  ? 240  ASN A ND2 1 
ATOM   1677  N  N   . GLY A  1 210 ? 38.040  92.465  2.969   1.00 44.63  ? 241  GLY A N   1 
ATOM   1678  C  CA  . GLY A  1 210 ? 36.691  92.947  2.764   1.00 43.97  ? 241  GLY A CA  1 
ATOM   1679  C  C   . GLY A  1 210 ? 35.653  91.839  2.690   1.00 43.21  ? 241  GLY A C   1 
ATOM   1680  O  O   . GLY A  1 210 ? 34.503  92.068  2.313   1.00 43.51  ? 241  GLY A O   1 
ATOM   1681  N  N   . LYS A  1 211 ? 36.047  90.625  3.042   1.00 42.91  ? 242  LYS A N   1 
ATOM   1682  C  CA  . LYS A  1 211 ? 35.159  89.477  2.996   1.00 42.16  ? 242  LYS A CA  1 
ATOM   1683  C  C   . LYS A  1 211 ? 35.014  88.877  4.394   1.00 40.92  ? 242  LYS A C   1 
ATOM   1684  O  O   . LYS A  1 211 ? 35.883  89.038  5.244   1.00 41.27  ? 242  LYS A O   1 
ATOM   1685  C  CB  . LYS A  1 211 ? 35.703  88.405  2.050   1.00 43.81  ? 242  LYS A CB  1 
ATOM   1686  C  CG  . LYS A  1 211 ? 34.944  88.233  0.749   1.00 46.09  ? 242  LYS A CG  1 
ATOM   1687  C  CD  . LYS A  1 211 ? 35.474  87.062  -0.058  1.00 48.60  ? 242  LYS A CD  1 
ATOM   1688  C  CE  . LYS A  1 211 ? 34.436  86.443  -0.978  1.00 48.03  ? 242  LYS A CE  1 
ATOM   1689  N  NZ  . LYS A  1 211 ? 34.976  85.248  -1.692  1.00 44.72  ? 242  LYS A NZ  1 
ATOM   1690  N  N   . GLU A  1 212 ? 33.896  88.204  4.606   1.00 37.85  ? 243  GLU A N   1 
ATOM   1691  C  CA  . GLU A  1 212 ? 33.684  87.532  5.883   1.00 35.22  ? 243  GLU A CA  1 
ATOM   1692  C  C   . GLU A  1 212 ? 33.754  86.024  5.603   1.00 32.83  ? 243  GLU A C   1 
ATOM   1693  O  O   . GLU A  1 212 ? 33.205  85.595  4.594   1.00 33.53  ? 243  GLU A O   1 
ATOM   1694  C  CB  . GLU A  1 212 ? 32.301  87.832  6.433   1.00 37.76  ? 243  GLU A CB  1 
ATOM   1695  C  CG  . GLU A  1 212 ? 32.100  89.244  6.929   1.00 39.92  ? 243  GLU A CG  1 
ATOM   1696  C  CD  . GLU A  1 212 ? 31.293  89.256  8.218   1.00 42.54  ? 243  GLU A CD  1 
ATOM   1697  O  OE1 . GLU A  1 212 ? 30.370  88.429  8.365   1.00 39.47  ? 243  GLU A OE1 1 
ATOM   1698  O  OE2 . GLU A  1 212 ? 31.622  90.116  9.059   1.00 44.55  ? 243  GLU A OE2 1 
ATOM   1699  N  N   . TYR A  1 213 ? 34.462  85.334  6.467   1.00 28.75  ? 244  TYR A N   1 
ATOM   1700  C  CA  . TYR A  1 213 ? 34.618  83.896  6.335   1.00 24.90  ? 244  TYR A CA  1 
ATOM   1701  C  C   . TYR A  1 213 ? 34.124  83.256  7.626   1.00 26.04  ? 244  TYR A C   1 
ATOM   1702  O  O   . TYR A  1 213 ? 34.476  83.737  8.695   1.00 25.42  ? 244  TYR A O   1 
ATOM   1703  C  CB  . TYR A  1 213 ? 36.066  83.538  6.046   1.00 22.07  ? 244  TYR A CB  1 
ATOM   1704  C  CG  . TYR A  1 213 ? 36.553  84.107  4.732   1.00 23.64  ? 244  TYR A CG  1 
ATOM   1705  C  CD1 . TYR A  1 213 ? 36.315  83.454  3.537   1.00 24.31  ? 244  TYR A CD1 1 
ATOM   1706  C  CD2 . TYR A  1 213 ? 37.247  85.310  4.686   1.00 26.49  ? 244  TYR A CD2 1 
ATOM   1707  C  CE1 . TYR A  1 213 ? 36.747  83.960  2.326   1.00 25.97  ? 244  TYR A CE1 1 
ATOM   1708  C  CE2 . TYR A  1 213 ? 37.687  85.833  3.485   1.00 29.23  ? 244  TYR A CE2 1 
ATOM   1709  C  CZ  . TYR A  1 213 ? 37.433  85.152  2.309   1.00 30.10  ? 244  TYR A CZ  1 
ATOM   1710  O  OH  . TYR A  1 213 ? 37.885  85.689  1.128   1.00 31.72  ? 244  TYR A OH  1 
ATOM   1711  N  N   . ASN A  1 214 ? 33.255  82.259  7.511   1.00 26.80  ? 245  ASN A N   1 
ATOM   1712  C  CA  . ASN A  1 214 ? 32.730  81.572  8.674   1.00 25.79  ? 245  ASN A CA  1 
ATOM   1713  C  C   . ASN A  1 214 ? 33.285  80.164  8.813   1.00 26.64  ? 245  ASN A C   1 
ATOM   1714  O  O   . ASN A  1 214 ? 32.783  79.352  9.589   1.00 25.50  ? 245  ASN A O   1 
ATOM   1715  C  CB  . ASN A  1 214 ? 31.210  81.521  8.613   1.00 25.66  ? 245  ASN A CB  1 
ATOM   1716  C  CG  . ASN A  1 214 ? 30.559  82.540  9.520   1.00 27.22  ? 245  ASN A CG  1 
ATOM   1717  O  OD1 . ASN A  1 214 ? 30.534  83.725  9.201   1.00 25.36  ? 245  ASN A OD1 1 
ATOM   1718  N  ND2 . ASN A  1 214 ? 30.027  82.080  10.645  1.00 27.64  ? 245  ASN A ND2 1 
ATOM   1719  N  N   . SER A  1 215 ? 34.412  79.912  8.164   1.00 28.93  ? 246  SER A N   1 
ATOM   1720  C  CA  . SER A  1 215 ? 35.072  78.616  8.241   1.00 31.95  ? 246  SER A CA  1 
ATOM   1721  C  C   . SER A  1 215 ? 36.484  78.749  7.702   1.00 33.32  ? 246  SER A C   1 
ATOM   1722  O  O   . SER A  1 215 ? 36.794  79.687  6.974   1.00 35.10  ? 246  SER A O   1 
ATOM   1723  C  CB  . SER A  1 215 ? 34.409  77.650  7.223   1.00 32.82  ? 246  SER A CB  1 
ATOM   1724  O  OG  . SER A  1 215 ? 35.004  77.781  5.943   1.00 35.49  ? 246  SER A OG  1 
ATOM   1725  N  N   . CYS A  1 216 ? 37.369  77.823  7.995   1.00 34.59  ? 247  CYS A N   1 
ATOM   1726  C  CA  . CYS A  1 216 ? 38.703  77.916  7.425   1.00 34.33  ? 247  CYS A CA  1 
ATOM   1727  C  C   . CYS A  1 216 ? 38.631  77.903  5.885   1.00 34.95  ? 247  CYS A C   1 
ATOM   1728  O  O   . CYS A  1 216 ? 37.865  77.121  5.299   1.00 36.74  ? 247  CYS A O   1 
ATOM   1729  C  CB  . CYS A  1 216 ? 39.585  76.811  7.984   1.00 32.37  ? 247  CYS A CB  1 
ATOM   1730  S  SG  . CYS A  1 216 ? 39.815  76.902  9.792   1.00 34.74  ? 247  CYS A SG  1 
ATOM   1731  N  N   . THR A  1 217 ? 39.446  78.782  5.287   1.00 36.59  ? 248  THR A N   1 
ATOM   1732  C  CA  . THR A  1 217 ? 39.524  78.975  3.834   1.00 39.45  ? 248  THR A CA  1 
ATOM   1733  C  C   . THR A  1 217 ? 40.962  78.860  3.320   1.00 40.66  ? 248  THR A C   1 
ATOM   1734  O  O   . THR A  1 217 ? 41.917  79.102  4.060   1.00 40.03  ? 248  THR A O   1 
ATOM   1735  C  CB  . THR A  1 217 ? 39.022  80.373  3.447   1.00 41.07  ? 248  THR A CB  1 
ATOM   1736  O  OG1 . THR A  1 217 ? 39.103  80.547  2.028   1.00 40.65  ? 248  THR A OG1 1 
ATOM   1737  C  CG2 . THR A  1 217 ? 39.863  81.445  4.136   1.00 40.51  ? 248  THR A CG2 1 
ATOM   1738  N  N   . ASP A  1 218 ? 41.108  78.493  2.050   1.00 42.03  ? 249  ASP A N   1 
ATOM   1739  C  CA  . ASP A  1 218 ? 42.421  78.391  1.423   1.00 43.27  ? 249  ASP A CA  1 
ATOM   1740  C  C   . ASP A  1 218 ? 42.654  79.586  0.512   1.00 43.38  ? 249  ASP A C   1 
ATOM   1741  O  O   . ASP A  1 218 ? 43.503  79.548  -0.379  1.00 43.74  ? 249  ASP A O   1 
ATOM   1742  C  CB  . ASP A  1 218 ? 42.554  77.079  0.649   1.00 45.38  ? 249  ASP A CB  1 
ATOM   1743  C  CG  . ASP A  1 218 ? 41.675  77.042  -0.584  1.00 47.89  ? 249  ASP A CG  1 
ATOM   1744  O  OD1 . ASP A  1 218 ? 40.858  77.971  -0.758  1.00 49.93  ? 249  ASP A OD1 1 
ATOM   1745  O  OD2 . ASP A  1 218 ? 41.801  76.084  -1.375  1.00 46.80  ? 249  ASP A OD2 1 
ATOM   1746  N  N   . THR A  1 219 ? 41.881  80.641  0.746   1.00 43.33  ? 250  THR A N   1 
ATOM   1747  C  CA  . THR A  1 219 ? 42.013  81.846  -0.045  1.00 43.95  ? 250  THR A CA  1 
ATOM   1748  C  C   . THR A  1 219 ? 43.385  82.491  0.155   1.00 44.42  ? 250  THR A C   1 
ATOM   1749  O  O   . THR A  1 219 ? 43.862  82.599  1.278   1.00 43.20  ? 250  THR A O   1 
ATOM   1750  C  CB  . THR A  1 219 ? 40.964  82.902  0.303   1.00 44.24  ? 250  THR A CB  1 
ATOM   1751  O  OG1 . THR A  1 219 ? 41.094  84.016  -0.595  1.00 43.27  ? 250  THR A OG1 1 
ATOM   1752  C  CG2 . THR A  1 219 ? 41.149  83.383  1.735   1.00 44.21  ? 250  THR A CG2 1 
ATOM   1753  N  N   . GLY A  1 220 ? 43.948  82.943  -0.953  1.00 46.15  ? 251  GLY A N   1 
ATOM   1754  C  CA  . GLY A  1 220 ? 45.214  83.655  -0.935  1.00 48.46  ? 251  GLY A CA  1 
ATOM   1755  C  C   . GLY A  1 220 ? 46.406  82.723  -0.985  1.00 49.53  ? 251  GLY A C   1 
ATOM   1756  O  O   . GLY A  1 220 ? 47.566  83.140  -0.924  1.00 50.35  ? 251  GLY A O   1 
ATOM   1757  N  N   . ARG A  1 221 ? 46.141  81.420  -1.057  1.00 49.61  ? 252  ARG A N   1 
ATOM   1758  C  CA  . ARG A  1 221 ? 47.232  80.458  -1.065  1.00 49.52  ? 252  ARG A CA  1 
ATOM   1759  C  C   . ARG A  1 221 ? 47.131  79.523  -2.262  1.00 50.60  ? 252  ARG A C   1 
ATOM   1760  O  O   . ARG A  1 221 ? 46.063  79.288  -2.823  1.00 50.96  ? 252  ARG A O   1 
ATOM   1761  C  CB  . ARG A  1 221 ? 47.225  79.646  0.231   1.00 49.26  ? 252  ARG A CB  1 
ATOM   1762  C  CG  . ARG A  1 221 ? 46.733  80.370  1.468   1.00 47.69  ? 252  ARG A CG  1 
ATOM   1763  C  CD  . ARG A  1 221 ? 47.875  80.611  2.452   1.00 47.96  ? 252  ARG A CD  1 
ATOM   1764  N  NE  . ARG A  1 221 ? 48.711  79.413  2.562   1.00 46.65  ? 252  ARG A NE  1 
ATOM   1765  C  CZ  . ARG A  1 221 ? 49.761  79.327  3.371   1.00 46.88  ? 252  ARG A CZ  1 
ATOM   1766  N  NH1 . ARG A  1 221 ? 50.098  80.361  4.135   1.00 46.40  ? 252  ARG A NH1 1 
ATOM   1767  N  NH2 . ARG A  1 221 ? 50.467  78.205  3.411   1.00 45.98  ? 252  ARG A NH2 1 
ATOM   1768  N  N   . SER A  1 222 ? 48.265  78.923  -2.609  1.00 50.58  ? 253  SER A N   1 
ATOM   1769  C  CA  . SER A  1 222 ? 48.312  77.954  -3.694  1.00 50.16  ? 253  SER A CA  1 
ATOM   1770  C  C   . SER A  1 222 ? 48.705  76.576  -3.180  1.00 50.00  ? 253  SER A C   1 
ATOM   1771  O  O   . SER A  1 222 ? 48.515  75.580  -3.886  1.00 52.40  ? 253  SER A O   1 
ATOM   1772  C  CB  . SER A  1 222 ? 49.288  78.421  -4.772  1.00 50.12  ? 253  SER A CB  1 
ATOM   1773  O  OG  . SER A  1 222 ? 50.505  78.865  -4.181  1.00 52.69  ? 253  SER A OG  1 
ATOM   1774  N  N   . ASP A  1 223 ? 49.208  76.482  -1.951  1.00 46.50  ? 254  ASP A N   1 
ATOM   1775  C  CA  . ASP A  1 223 ? 49.544  75.193  -1.368  1.00 43.63  ? 254  ASP A CA  1 
ATOM   1776  C  C   . ASP A  1 223 ? 48.284  74.463  -0.908  1.00 42.22  ? 254  ASP A C   1 
ATOM   1777  O  O   . ASP A  1 223 ? 48.336  73.290  -0.529  1.00 44.09  ? 254  ASP A O   1 
ATOM   1778  C  CB  . ASP A  1 223 ? 50.519  75.319  -0.215  1.00 43.94  ? 254  ASP A CB  1 
ATOM   1779  C  CG  . ASP A  1 223 ? 50.282  76.545  0.641   1.00 43.90  ? 254  ASP A CG  1 
ATOM   1780  O  OD1 . ASP A  1 223 ? 49.117  76.911  0.879   1.00 43.15  ? 254  ASP A OD1 1 
ATOM   1781  O  OD2 . ASP A  1 223 ? 51.300  77.133  1.071   1.00 42.67  ? 254  ASP A OD2 1 
ATOM   1782  N  N   . GLY A  1 224 ? 47.150  75.144  -0.932  1.00 38.18  ? 255  GLY A N   1 
ATOM   1783  C  CA  . GLY A  1 224 ? 45.874  74.571  -0.592  1.00 34.80  ? 255  GLY A CA  1 
ATOM   1784  C  C   . GLY A  1 224 ? 45.642  74.360  0.884   1.00 32.12  ? 255  GLY A C   1 
ATOM   1785  O  O   . GLY A  1 224 ? 44.708  73.658  1.284   1.00 32.66  ? 255  GLY A O   1 
ATOM   1786  N  N   . PHE A  1 225 ? 46.438  74.969  1.739   1.00 29.58  ? 256  PHE A N   1 
ATOM   1787  C  CA  . PHE A  1 225 ? 46.310  74.795  3.188   1.00 28.06  ? 256  PHE A CA  1 
ATOM   1788  C  C   . PHE A  1 225 ? 45.203  75.722  3.683   1.00 27.61  ? 256  PHE A C   1 
ATOM   1789  O  O   . PHE A  1 225 ? 45.053  76.812  3.185   1.00 28.92  ? 256  PHE A O   1 
ATOM   1790  C  CB  . PHE A  1 225 ? 47.628  75.198  3.858   1.00 29.46  ? 256  PHE A CB  1 
ATOM   1791  C  CG  . PHE A  1 225 ? 48.645  74.093  3.762   1.00 30.87  ? 256  PHE A CG  1 
ATOM   1792  C  CD1 . PHE A  1 225 ? 49.182  73.762  2.539   1.00 31.50  ? 256  PHE A CD1 1 
ATOM   1793  C  CD2 . PHE A  1 225 ? 49.040  73.392  4.881   1.00 30.81  ? 256  PHE A CD2 1 
ATOM   1794  C  CE1 . PHE A  1 225 ? 50.114  72.739  2.431   1.00 31.81  ? 256  PHE A CE1 1 
ATOM   1795  C  CE2 . PHE A  1 225 ? 49.970  72.370  4.786   1.00 30.14  ? 256  PHE A CE2 1 
ATOM   1796  C  CZ  . PHE A  1 225 ? 50.505  72.046  3.562   1.00 31.28  ? 256  PHE A CZ  1 
ATOM   1797  N  N   . LEU A  1 226 ? 44.459  75.217  4.658   1.00 27.38  ? 257  LEU A N   1 
ATOM   1798  C  CA  . LEU A  1 226 ? 43.361  76.022  5.200   1.00 27.11  ? 257  LEU A CA  1 
ATOM   1799  C  C   . LEU A  1 226 ? 43.881  76.816  6.401   1.00 27.63  ? 257  LEU A C   1 
ATOM   1800  O  O   . LEU A  1 226 ? 44.568  76.294  7.266   1.00 28.03  ? 257  LEU A O   1 
ATOM   1801  C  CB  . LEU A  1 226 ? 42.158  75.181  5.597   1.00 26.42  ? 257  LEU A CB  1 
ATOM   1802  C  CG  . LEU A  1 226 ? 41.600  74.152  4.630   1.00 25.18  ? 257  LEU A CG  1 
ATOM   1803  C  CD1 . LEU A  1 226 ? 40.522  73.309  5.306   1.00 23.91  ? 257  LEU A CD1 1 
ATOM   1804  C  CD2 . LEU A  1 226 ? 41.056  74.802  3.373   1.00 24.93  ? 257  LEU A CD2 1 
ATOM   1805  N  N   . TRP A  1 227 ? 43.604  78.102  6.390   1.00 26.91  ? 258  TRP A N   1 
ATOM   1806  C  CA  . TRP A  1 227 ? 43.994  79.011  7.460   1.00 25.99  ? 258  TRP A CA  1 
ATOM   1807  C  C   . TRP A  1 227 ? 42.771  79.833  7.879   1.00 26.79  ? 258  TRP A C   1 
ATOM   1808  O  O   . TRP A  1 227 ? 41.716  79.721  7.247   1.00 26.75  ? 258  TRP A O   1 
ATOM   1809  C  CB  . TRP A  1 227 ? 45.087  79.954  6.933   1.00 23.31  ? 258  TRP A CB  1 
ATOM   1810  C  CG  . TRP A  1 227 ? 44.517  80.923  5.935   1.00 22.00  ? 258  TRP A CG  1 
ATOM   1811  C  CD1 . TRP A  1 227 ? 44.331  80.684  4.608   1.00 21.67  ? 258  TRP A CD1 1 
ATOM   1812  C  CD2 . TRP A  1 227 ? 44.045  82.252  6.172   1.00 22.34  ? 258  TRP A CD2 1 
ATOM   1813  N  NE1 . TRP A  1 227 ? 43.768  81.787  4.005   1.00 20.53  ? 258  TRP A NE1 1 
ATOM   1814  C  CE2 . TRP A  1 227 ? 43.598  82.765  4.945   1.00 21.24  ? 258  TRP A CE2 1 
ATOM   1815  C  CE3 . TRP A  1 227 ? 43.983  83.059  7.312   1.00 21.40  ? 258  TRP A CE3 1 
ATOM   1816  C  CZ2 . TRP A  1 227 ? 43.083  84.046  4.809   1.00 20.44  ? 258  TRP A CZ2 1 
ATOM   1817  C  CZ3 . TRP A  1 227 ? 43.475  84.333  7.180   1.00 21.55  ? 258  TRP A CZ3 1 
ATOM   1818  C  CH2 . TRP A  1 227 ? 43.032  84.816  5.942   1.00 20.61  ? 258  TRP A CH2 1 
ATOM   1819  N  N   . CYS A  1 228 ? 42.927  80.645  8.909   1.00 26.79  ? 259  CYS A N   1 
ATOM   1820  C  CA  . CYS A  1 228 ? 41.812  81.473  9.388   1.00 26.55  ? 259  CYS A CA  1 
ATOM   1821  C  C   . CYS A  1 228 ? 42.375  82.533  10.333  1.00 25.83  ? 259  CYS A C   1 
ATOM   1822  O  O   . CYS A  1 228 ? 43.559  82.535  10.628  1.00 26.02  ? 259  CYS A O   1 
ATOM   1823  C  CB  . CYS A  1 228 ? 40.863  80.551  10.196  1.00 26.53  ? 259  CYS A CB  1 
ATOM   1824  S  SG  . CYS A  1 228 ? 41.765  80.028  11.678  1.00 30.67  ? 259  CYS A SG  1 
ATOM   1825  N  N   . SER A  1 229 ? 41.539  83.482  10.720  1.00 24.28  ? 260  SER A N   1 
ATOM   1826  C  CA  . SER A  1 229 ? 41.985  84.527  11.623  1.00 25.23  ? 260  SER A CA  1 
ATOM   1827  C  C   . SER A  1 229 ? 41.645  84.175  13.053  1.00 26.83  ? 260  SER A C   1 
ATOM   1828  O  O   . SER A  1 229 ? 40.489  83.824  13.313  1.00 28.42  ? 260  SER A O   1 
ATOM   1829  C  CB  . SER A  1 229 ? 41.316  85.850  11.259  1.00 24.84  ? 260  SER A CB  1 
ATOM   1830  O  OG  . SER A  1 229 ? 41.695  86.891  12.136  1.00 22.05  ? 260  SER A OG  1 
ATOM   1831  N  N   . THR A  1 230 ? 42.579  84.306  13.983  1.00 27.68  ? 261  THR A N   1 
ATOM   1832  C  CA  . THR A  1 230 ? 42.249  84.005  15.372  1.00 28.96  ? 261  THR A CA  1 
ATOM   1833  C  C   . THR A  1 230 ? 41.514  85.163  16.036  1.00 29.53  ? 261  THR A C   1 
ATOM   1834  O  O   . THR A  1 230 ? 41.220  85.087  17.230  1.00 29.44  ? 261  THR A O   1 
ATOM   1835  C  CB  . THR A  1 230 ? 43.494  83.669  16.201  1.00 28.23  ? 261  THR A CB  1 
ATOM   1836  O  OG1 . THR A  1 230 ? 44.225  84.877  16.416  1.00 29.65  ? 261  THR A OG1 1 
ATOM   1837  C  CG2 . THR A  1 230 ? 44.325  82.643  15.460  1.00 29.08  ? 261  THR A CG2 1 
ATOM   1838  N  N   . THR A  1 231 ? 41.241  86.204  15.269  1.00 29.40  ? 262  THR A N   1 
ATOM   1839  C  CA  . THR A  1 231 ? 40.508  87.379  15.710  1.00 29.47  ? 262  THR A CA  1 
ATOM   1840  C  C   . THR A  1 231 ? 39.544  87.829  14.611  1.00 29.67  ? 262  THR A C   1 
ATOM   1841  O  O   . THR A  1 231 ? 39.621  87.281  13.510  1.00 29.55  ? 262  THR A O   1 
ATOM   1842  C  CB  . THR A  1 231 ? 41.454  88.563  15.982  1.00 29.82  ? 262  THR A CB  1 
ATOM   1843  O  OG1 . THR A  1 231 ? 42.302  88.737  14.841  1.00 32.75  ? 262  THR A OG1 1 
ATOM   1844  C  CG2 . THR A  1 231 ? 42.281  88.340  17.225  1.00 30.54  ? 262  THR A CG2 1 
ATOM   1845  N  N   . TYR A  1 232 ? 38.710  88.823  14.904  1.00 29.98  ? 263  TYR A N   1 
ATOM   1846  C  CA  . TYR A  1 232 ? 37.739  89.258  13.917  1.00 31.12  ? 263  TYR A CA  1 
ATOM   1847  C  C   . TYR A  1 232 ? 38.365  90.009  12.753  1.00 32.80  ? 263  TYR A C   1 
ATOM   1848  O  O   . TYR A  1 232 ? 38.138  89.666  11.595  1.00 33.00  ? 263  TYR A O   1 
ATOM   1849  C  CB  . TYR A  1 232 ? 36.617  90.106  14.531  1.00 31.20  ? 263  TYR A CB  1 
ATOM   1850  C  CG  . TYR A  1 232 ? 35.719  90.688  13.448  1.00 32.44  ? 263  TYR A CG  1 
ATOM   1851  C  CD1 . TYR A  1 232 ? 34.866  89.849  12.746  1.00 33.58  ? 263  TYR A CD1 1 
ATOM   1852  C  CD2 . TYR A  1 232 ? 35.742  92.028  13.108  1.00 31.41  ? 263  TYR A CD2 1 
ATOM   1853  C  CE1 . TYR A  1 232 ? 34.054  90.336  11.742  1.00 32.86  ? 263  TYR A CE1 1 
ATOM   1854  C  CE2 . TYR A  1 232 ? 34.935  92.527  12.105  1.00 30.88  ? 263  TYR A CE2 1 
ATOM   1855  C  CZ  . TYR A  1 232 ? 34.097  91.673  11.429  1.00 32.75  ? 263  TYR A CZ  1 
ATOM   1856  O  OH  . TYR A  1 232 ? 33.291  92.172  10.436  1.00 34.35  ? 263  TYR A OH  1 
ATOM   1857  N  N   . ASN A  1 233 ? 39.035  91.113  13.057  1.00 35.62  ? 264  ASN A N   1 
ATOM   1858  C  CA  . ASN A  1 233 ? 39.606  91.969  12.023  1.00 38.55  ? 264  ASN A CA  1 
ATOM   1859  C  C   . ASN A  1 233 ? 41.031  91.555  11.706  1.00 39.05  ? 264  ASN A C   1 
ATOM   1860  O  O   . ASN A  1 233 ? 41.947  91.819  12.479  1.00 38.73  ? 264  ASN A O   1 
ATOM   1861  C  CB  . ASN A  1 233 ? 39.568  93.431  12.464  1.00 41.65  ? 264  ASN A CB  1 
ATOM   1862  C  CG  . ASN A  1 233 ? 39.403  94.387  11.299  1.00 46.33  ? 264  ASN A CG  1 
ATOM   1863  O  OD1 . ASN A  1 233 ? 40.180  94.356  10.343  1.00 49.03  ? 264  ASN A OD1 1 
ATOM   1864  N  ND2 . ASN A  1 233 ? 38.388  95.241  11.387  1.00 47.91  ? 264  ASN A ND2 1 
ATOM   1865  N  N   . PHE A  1 234 ? 41.232  90.910  10.564  1.00 39.73  ? 265  PHE A N   1 
ATOM   1866  C  CA  . PHE A  1 234 ? 42.557  90.434  10.191  1.00 40.14  ? 265  PHE A CA  1 
ATOM   1867  C  C   . PHE A  1 234 ? 43.464  91.577  9.763   1.00 41.80  ? 265  PHE A C   1 
ATOM   1868  O  O   . PHE A  1 234 ? 44.688  91.465  9.815   1.00 40.91  ? 265  PHE A O   1 
ATOM   1869  C  CB  . PHE A  1 234 ? 42.453  89.435  9.041   1.00 40.08  ? 265  PHE A CB  1 
ATOM   1870  C  CG  . PHE A  1 234 ? 43.768  88.808  8.680   1.00 40.38  ? 265  PHE A CG  1 
ATOM   1871  C  CD1 . PHE A  1 234 ? 44.481  88.083  9.615   1.00 39.18  ? 265  PHE A CD1 1 
ATOM   1872  C  CD2 . PHE A  1 234 ? 44.273  88.938  7.397   1.00 40.05  ? 265  PHE A CD2 1 
ATOM   1873  C  CE1 . PHE A  1 234 ? 45.686  87.503  9.285   1.00 37.67  ? 265  PHE A CE1 1 
ATOM   1874  C  CE2 . PHE A  1 234 ? 45.477  88.356  7.061   1.00 39.70  ? 265  PHE A CE2 1 
ATOM   1875  C  CZ  . PHE A  1 234 ? 46.180  87.639  8.006   1.00 39.18  ? 265  PHE A CZ  1 
ATOM   1876  N  N   . GLU A  1 235 ? 42.849  92.673  9.332   1.00 43.50  ? 266  GLU A N   1 
ATOM   1877  C  CA  . GLU A  1 235 ? 43.641  93.824  8.922   1.00 44.17  ? 266  GLU A CA  1 
ATOM   1878  C  C   . GLU A  1 235 ? 44.276  94.472  10.144  1.00 42.88  ? 266  GLU A C   1 
ATOM   1879  O  O   . GLU A  1 235 ? 45.490  94.652  10.194  1.00 44.43  ? 266  GLU A O   1 
ATOM   1880  C  CB  . GLU A  1 235 ? 42.783  94.834  8.168   1.00 47.57  ? 266  GLU A CB  1 
ATOM   1881  C  CG  . GLU A  1 235 ? 43.601  95.793  7.312   1.00 51.65  ? 266  GLU A CG  1 
ATOM   1882  C  CD  . GLU A  1 235 ? 42.766  96.533  6.288   1.00 54.25  ? 266  GLU A CD  1 
ATOM   1883  O  OE1 . GLU A  1 235 ? 41.597  96.865  6.588   1.00 55.98  ? 266  GLU A OE1 1 
ATOM   1884  O  OE2 . GLU A  1 235 ? 43.298  96.776  5.184   1.00 55.40  ? 266  GLU A OE2 1 
ATOM   1885  N  N   . LYS A  1 236 ? 43.458  94.780  11.141  1.00 40.54  ? 267  LYS A N   1 
ATOM   1886  C  CA  . LYS A  1 236 ? 43.986  95.412  12.345  1.00 39.08  ? 267  LYS A CA  1 
ATOM   1887  C  C   . LYS A  1 236 ? 44.946  94.489  13.077  1.00 39.19  ? 267  LYS A C   1 
ATOM   1888  O  O   . LYS A  1 236 ? 46.135  94.773  13.226  1.00 38.52  ? 267  LYS A O   1 
ATOM   1889  C  CB  . LYS A  1 236 ? 42.851  95.889  13.249  1.00 37.41  ? 267  LYS A CB  1 
ATOM   1890  C  CG  . LYS A  1 236 ? 41.704  96.548  12.494  1.00 36.23  ? 267  LYS A CG  1 
ATOM   1891  C  CD  . LYS A  1 236 ? 40.971  97.594  13.298  1.00 34.64  ? 267  LYS A CD  1 
ATOM   1892  C  CE  . LYS A  1 236 ? 40.482  98.749  12.435  1.00 33.20  ? 267  LYS A CE  1 
ATOM   1893  N  NZ  . LYS A  1 236 ? 39.620  99.678  13.214  1.00 32.96  ? 267  LYS A NZ  1 
ATOM   1894  N  N   . ASP A  1 237 ? 44.418  93.376  13.571  1.00 39.29  ? 268  ASP A N   1 
ATOM   1895  C  CA  . ASP A  1 237 ? 45.247  92.388  14.269  1.00 39.16  ? 268  ASP A CA  1 
ATOM   1896  C  C   . ASP A  1 237 ? 45.666  91.386  13.192  1.00 39.43  ? 268  ASP A C   1 
ATOM   1897  O  O   . ASP A  1 237 ? 44.849  91.076  12.323  1.00 41.65  ? 268  ASP A O   1 
ATOM   1898  C  CB  . ASP A  1 237 ? 44.481  91.694  15.378  1.00 38.91  ? 268  ASP A CB  1 
ATOM   1899  C  CG  . ASP A  1 237 ? 43.343  92.513  15.948  1.00 40.29  ? 268  ASP A CG  1 
ATOM   1900  O  OD1 . ASP A  1 237 ? 43.571  93.703  16.247  1.00 40.12  ? 268  ASP A OD1 1 
ATOM   1901  O  OD2 . ASP A  1 237 ? 42.228  91.966  16.094  1.00 39.55  ? 268  ASP A OD2 1 
ATOM   1902  N  N   . GLY A  1 238 ? 46.929  91.016  13.141  1.00 38.07  ? 269  GLY A N   1 
ATOM   1903  C  CA  . GLY A  1 238 ? 47.354  90.145  12.046  1.00 38.61  ? 269  GLY A CA  1 
ATOM   1904  C  C   . GLY A  1 238 ? 47.517  88.701  12.475  1.00 39.45  ? 269  GLY A C   1 
ATOM   1905  O  O   . GLY A  1 238 ? 48.362  87.992  11.927  1.00 39.29  ? 269  GLY A O   1 
ATOM   1906  N  N   . LYS A  1 239 ? 46.736  88.253  13.449  1.00 39.79  ? 270  LYS A N   1 
ATOM   1907  C  CA  . LYS A  1 239 ? 46.855  86.896  13.959  1.00 38.72  ? 270  LYS A CA  1 
ATOM   1908  C  C   . LYS A  1 239 ? 46.050  85.913  13.118  1.00 37.46  ? 270  LYS A C   1 
ATOM   1909  O  O   . LYS A  1 239 ? 44.889  86.169  12.815  1.00 36.98  ? 270  LYS A O   1 
ATOM   1910  C  CB  . LYS A  1 239 ? 46.427  86.826  15.422  1.00 38.71  ? 270  LYS A CB  1 
ATOM   1911  C  CG  . LYS A  1 239 ? 46.941  87.976  16.262  1.00 40.39  ? 270  LYS A CG  1 
ATOM   1912  C  CD  . LYS A  1 239 ? 48.379  87.760  16.700  1.00 41.99  ? 270  LYS A CD  1 
ATOM   1913  C  CE  . LYS A  1 239 ? 48.416  87.295  18.150  1.00 46.45  ? 270  LYS A CE  1 
ATOM   1914  N  NZ  . LYS A  1 239 ? 49.656  87.720  18.855  1.00 47.16  ? 270  LYS A NZ  1 
ATOM   1915  N  N   . TYR A  1 240 ? 46.692  84.823  12.732  1.00 35.22  ? 271  TYR A N   1 
ATOM   1916  C  CA  . TYR A  1 240 ? 46.101  83.763  11.937  1.00 31.32  ? 271  TYR A CA  1 
ATOM   1917  C  C   . TYR A  1 240 ? 46.836  82.452  12.221  1.00 28.81  ? 271  TYR A C   1 
ATOM   1918  O  O   . TYR A  1 240 ? 47.872  82.447  12.855  1.00 26.37  ? 271  TYR A O   1 
ATOM   1919  C  CB  . TYR A  1 240 ? 46.241  84.069  10.432  1.00 32.56  ? 271  TYR A CB  1 
ATOM   1920  C  CG  . TYR A  1 240 ? 47.624  83.704  9.930   1.00 35.48  ? 271  TYR A CG  1 
ATOM   1921  C  CD1 . TYR A  1 240 ? 48.671  84.605  10.055  1.00 36.01  ? 271  TYR A CD1 1 
ATOM   1922  C  CD2 . TYR A  1 240 ? 47.889  82.466  9.364   1.00 35.15  ? 271  TYR A CD2 1 
ATOM   1923  C  CE1 . TYR A  1 240 ? 49.938  84.268  9.615   1.00 37.31  ? 271  TYR A CE1 1 
ATOM   1924  C  CE2 . TYR A  1 240 ? 49.151  82.121  8.929   1.00 35.14  ? 271  TYR A CE2 1 
ATOM   1925  C  CZ  . TYR A  1 240 ? 50.172  83.032  9.055   1.00 37.12  ? 271  TYR A CZ  1 
ATOM   1926  O  OH  . TYR A  1 240 ? 51.437  82.709  8.617   1.00 37.98  ? 271  TYR A OH  1 
ATOM   1927  N  N   . GLY A  1 241 ? 46.336  81.363  11.660  1.00 28.56  ? 272  GLY A N   1 
ATOM   1928  C  CA  . GLY A  1 241 ? 47.010  80.088  11.809  1.00 26.51  ? 272  GLY A CA  1 
ATOM   1929  C  C   . GLY A  1 241 ? 46.480  79.038  10.845  1.00 24.95  ? 272  GLY A C   1 
ATOM   1930  O  O   . GLY A  1 241 ? 45.624  79.332  10.012  1.00 24.13  ? 272  GLY A O   1 
ATOM   1931  N  N   . PHE A  1 242 ? 46.991  77.816  11.020  1.00 24.95  ? 273  PHE A N   1 
ATOM   1932  C  CA  . PHE A  1 242 ? 46.545  76.757  10.107  1.00 26.93  ? 273  PHE A CA  1 
ATOM   1933  C  C   . PHE A  1 242 ? 45.534  75.810  10.699  1.00 26.85  ? 273  PHE A C   1 
ATOM   1934  O  O   . PHE A  1 242 ? 45.625  75.353  11.834  1.00 26.69  ? 273  PHE A O   1 
ATOM   1935  C  CB  . PHE A  1 242 ? 47.781  76.026  9.561   1.00 28.10  ? 273  PHE A CB  1 
ATOM   1936  C  CG  . PHE A  1 242 ? 48.526  76.911  8.585   1.00 28.90  ? 273  PHE A CG  1 
ATOM   1937  C  CD1 . PHE A  1 242 ? 48.037  77.147  7.316   1.00 28.44  ? 273  PHE A CD1 1 
ATOM   1938  C  CD2 . PHE A  1 242 ? 49.710  77.499  8.982   1.00 28.45  ? 273  PHE A CD2 1 
ATOM   1939  C  CE1 . PHE A  1 242 ? 48.722  77.958  6.443   1.00 28.97  ? 273  PHE A CE1 1 
ATOM   1940  C  CE2 . PHE A  1 242 ? 50.399  78.321  8.107   1.00 27.98  ? 273  PHE A CE2 1 
ATOM   1941  C  CZ  . PHE A  1 242 ? 49.907  78.546  6.842   1.00 27.57  ? 273  PHE A CZ  1 
ATOM   1942  N  N   . CYS A  1 243 ? 44.501  75.476  9.926   1.00 26.32  ? 274  CYS A N   1 
ATOM   1943  C  CA  . CYS A  1 243 ? 43.458  74.585  10.411  1.00 25.95  ? 274  CYS A CA  1 
ATOM   1944  C  C   . CYS A  1 243 ? 43.840  73.138  10.191  1.00 24.49  ? 274  CYS A C   1 
ATOM   1945  O  O   . CYS A  1 243 ? 44.298  72.730  9.132   1.00 24.95  ? 274  CYS A O   1 
ATOM   1946  C  CB  . CYS A  1 243 ? 42.147  74.856  9.651   1.00 27.21  ? 274  CYS A CB  1 
ATOM   1947  S  SG  . CYS A  1 243 ? 41.862  76.632  9.608   1.00 32.86  ? 274  CYS A SG  1 
ATOM   1948  N  N   . PRO A  1 244 ? 43.697  72.343  11.251  1.00 22.62  ? 275  PRO A N   1 
ATOM   1949  C  CA  . PRO A  1 244 ? 43.899  70.910  11.215  1.00 21.56  ? 275  PRO A CA  1 
ATOM   1950  C  C   . PRO A  1 244 ? 43.166  70.292  10.038  1.00 23.74  ? 275  PRO A C   1 
ATOM   1951  O  O   . PRO A  1 244 ? 42.068  70.712  9.687   1.00 24.42  ? 275  PRO A O   1 
ATOM   1952  C  CB  . PRO A  1 244 ? 43.337  70.444  12.536  1.00 20.18  ? 275  PRO A CB  1 
ATOM   1953  C  CG  . PRO A  1 244 ? 43.363  71.607  13.433  1.00 22.20  ? 275  PRO A CG  1 
ATOM   1954  C  CD  . PRO A  1 244 ? 43.095  72.789  12.538  1.00 23.26  ? 275  PRO A CD  1 
ATOM   1955  N  N   . HIS A  1 245 ? 43.739  69.222  9.491   1.00 25.65  ? 276  HIS A N   1 
ATOM   1956  C  CA  . HIS A  1 245 ? 43.102  68.435  8.459   1.00 26.43  ? 276  HIS A CA  1 
ATOM   1957  C  C   . HIS A  1 245 ? 44.054  67.389  7.911   1.00 27.64  ? 276  HIS A C   1 
ATOM   1958  O  O   . HIS A  1 245 ? 44.971  67.754  7.175   1.00 28.36  ? 276  HIS A O   1 
ATOM   1959  C  CB  . HIS A  1 245 ? 42.602  69.317  7.308   1.00 24.89  ? 276  HIS A CB  1 
ATOM   1960  C  CG  . HIS A  1 245 ? 41.726  68.522  6.387   1.00 26.11  ? 276  HIS A CG  1 
ATOM   1961  N  ND1 . HIS A  1 245 ? 42.129  67.348  5.820   1.00 26.32  ? 276  HIS A ND1 1 
ATOM   1962  C  CD2 . HIS A  1 245 ? 40.462  68.748  5.965   1.00 25.61  ? 276  HIS A CD2 1 
ATOM   1963  C  CE1 . HIS A  1 245 ? 41.160  66.870  5.082   1.00 25.09  ? 276  HIS A CE1 1 
ATOM   1964  N  NE2 . HIS A  1 245 ? 40.150  67.702  5.143   1.00 27.55  ? 276  HIS A NE2 1 
ATOM   1965  N  N   . GLU A  1 246 ? 43.845  66.130  8.252   1.00 28.65  ? 277  GLU A N   1 
ATOM   1966  C  CA  . GLU A  1 246 ? 44.659  64.998  7.933   1.00 28.51  ? 277  GLU A CA  1 
ATOM   1967  C  C   . GLU A  1 246 ? 45.030  64.782  6.489   1.00 27.17  ? 277  GLU A C   1 
ATOM   1968  O  O   . GLU A  1 246 ? 45.875  63.898  6.240   1.00 28.96  ? 277  GLU A O   1 
ATOM   1969  C  CB  . GLU A  1 246 ? 44.076  63.690  8.479   1.00 29.86  ? 277  GLU A CB  1 
ATOM   1970  C  CG  . GLU A  1 246 ? 42.668  63.394  7.999   1.00 29.22  ? 277  GLU A CG  1 
ATOM   1971  C  CD  . GLU A  1 246 ? 41.595  64.038  8.822   1.00 28.63  ? 277  GLU A CD  1 
ATOM   1972  O  OE1 . GLU A  1 246 ? 41.654  65.249  9.041   1.00 31.00  ? 277  GLU A OE1 1 
ATOM   1973  O  OE2 . GLU A  1 246 ? 40.689  63.295  9.252   1.00 28.23  ? 277  GLU A OE2 1 
ATOM   1974  N  N   . ALA A  1 247 ? 44.383  65.450  5.527   1.00 24.93  ? 278  ALA A N   1 
ATOM   1975  C  CA  . ALA A  1 247 ? 44.669  65.226  4.131   1.00 26.01  ? 278  ALA A CA  1 
ATOM   1976  C  C   . ALA A  1 247 ? 45.715  66.295  3.784   1.00 29.46  ? 278  ALA A C   1 
ATOM   1977  O  O   . ALA A  1 247 ? 46.287  66.302  2.713   1.00 31.26  ? 278  ALA A O   1 
ATOM   1978  C  CB  . ALA A  1 247 ? 43.483  65.447  3.255   1.00 27.51  ? 278  ALA A CB  1 
ATOM   1979  N  N   . LEU A  1 248 ? 45.956  67.187  4.741   1.00 31.62  ? 279  LEU A N   1 
ATOM   1980  C  CA  . LEU A  1 248 ? 46.900  68.257  4.580   1.00 31.27  ? 279  LEU A CA  1 
ATOM   1981  C  C   . LEU A  1 248 ? 48.243  67.974  5.235   1.00 32.69  ? 279  LEU A C   1 
ATOM   1982  O  O   . LEU A  1 248 ? 49.294  68.176  4.622   1.00 34.27  ? 279  LEU A O   1 
ATOM   1983  C  CB  . LEU A  1 248 ? 46.352  69.520  5.313   1.00 29.78  ? 279  LEU A CB  1 
ATOM   1984  C  CG  . LEU A  1 248 ? 45.245  70.280  4.580   1.00 29.61  ? 279  LEU A CG  1 
ATOM   1985  C  CD1 . LEU A  1 248 ? 45.058  71.667  5.170   1.00 32.58  ? 279  LEU A CD1 1 
ATOM   1986  C  CD2 . LEU A  1 248 ? 45.551  70.368  3.091   1.00 25.72  ? 279  LEU A CD2 1 
ATOM   1987  N  N   . PHE A  1 249 ? 48.156  67.530  6.487   1.00 33.58  ? 280  PHE A N   1 
ATOM   1988  C  CA  . PHE A  1 249 ? 49.295  67.428  7.389   1.00 36.31  ? 280  PHE A CA  1 
ATOM   1989  C  C   . PHE A  1 249 ? 48.961  66.521  8.575   1.00 36.02  ? 280  PHE A C   1 
ATOM   1990  O  O   . PHE A  1 249 ? 47.827  66.454  9.028   1.00 35.24  ? 280  PHE A O   1 
ATOM   1991  C  CB  . PHE A  1 249 ? 49.735  68.764  8.005   1.00 40.35  ? 280  PHE A CB  1 
ATOM   1992  C  CG  . PHE A  1 249 ? 48.913  69.189  9.199   1.00 48.72  ? 280  PHE A CG  1 
ATOM   1993  C  CD1 . PHE A  1 249 ? 49.240  68.759  10.477  1.00 53.81  ? 280  PHE A CD1 1 
ATOM   1994  C  CD2 . PHE A  1 249 ? 47.810  70.019  9.049   1.00 51.97  ? 280  PHE A CD2 1 
ATOM   1995  C  CE1 . PHE A  1 249 ? 48.490  69.149  11.575  1.00 58.62  ? 280  PHE A CE1 1 
ATOM   1996  C  CE2 . PHE A  1 249 ? 47.057  70.412  10.142  1.00 57.03  ? 280  PHE A CE2 1 
ATOM   1997  C  CZ  . PHE A  1 249 ? 47.398  69.977  11.406  1.00 59.74  ? 280  PHE A CZ  1 
ATOM   1998  N  N   . THR A  1 250 ? 49.914  65.770  9.110   1.00 36.78  ? 281  THR A N   1 
ATOM   1999  C  CA  . THR A  1 250 ? 49.617  65.046  10.348  1.00 36.86  ? 281  THR A CA  1 
ATOM   2000  C  C   . THR A  1 250 ? 50.096  65.903  11.531  1.00 36.73  ? 281  THR A C   1 
ATOM   2001  O  O   . THR A  1 250 ? 50.697  66.961  11.341  1.00 38.06  ? 281  THR A O   1 
ATOM   2002  C  CB  . THR A  1 250 ? 50.261  63.669  10.387  1.00 38.79  ? 281  THR A CB  1 
ATOM   2003  O  OG1 . THR A  1 250 ? 51.498  63.705  9.671   1.00 42.08  ? 281  THR A OG1 1 
ATOM   2004  C  CG2 . THR A  1 250 ? 49.334  62.631  9.778   1.00 39.19  ? 281  THR A CG2 1 
ATOM   2005  N  N   . MET A  1 251 ? 49.858  65.471  12.772  1.00 36.30  ? 282  MET A N   1 
ATOM   2006  C  CA  . MET A  1 251 ? 50.401  66.215  13.927  1.00 36.68  ? 282  MET A CA  1 
ATOM   2007  C  C   . MET A  1 251 ? 51.692  65.703  14.568  1.00 36.91  ? 282  MET A C   1 
ATOM   2008  O  O   . MET A  1 251 ? 52.606  66.475  14.850  1.00 41.55  ? 282  MET A O   1 
ATOM   2009  C  CB  . MET A  1 251 ? 49.301  66.273  14.988  1.00 39.44  ? 282  MET A CB  1 
ATOM   2010  C  CG  . MET A  1 251 ? 49.321  67.538  15.832  1.00 42.91  ? 282  MET A CG  1 
ATOM   2011  S  SD  . MET A  1 251 ? 49.917  68.974  14.917  1.00 47.94  ? 282  MET A SD  1 
ATOM   2012  C  CE  . MET A  1 251 ? 51.530  69.205  15.660  1.00 45.34  ? 282  MET A CE  1 
ATOM   2013  N  N   . GLY A  1 252 ? 51.787  64.400  14.815  1.00 34.51  ? 283  GLY A N   1 
ATOM   2014  C  CA  . GLY A  1 252 ? 52.805  63.828  15.680  1.00 33.82  ? 283  GLY A CA  1 
ATOM   2015  C  C   . GLY A  1 252 ? 53.433  62.696  14.874  1.00 34.07  ? 283  GLY A C   1 
ATOM   2016  O  O   . GLY A  1 252 ? 53.722  62.851  13.688  1.00 34.04  ? 283  GLY A O   1 
ATOM   2017  N  N   . GLY A  1 253 ? 53.648  61.565  15.534  1.00 34.19  ? 284  GLY A N   1 
ATOM   2018  C  CA  . GLY A  1 253 ? 54.214  60.397  14.889  1.00 32.66  ? 284  GLY A CA  1 
ATOM   2019  C  C   . GLY A  1 253 ? 55.650  60.631  14.425  1.00 32.17  ? 284  GLY A C   1 
ATOM   2020  O  O   . GLY A  1 253 ? 56.414  61.351  15.072  1.00 32.43  ? 284  GLY A O   1 
ATOM   2021  N  N   . ASN A  1 254 ? 55.991  60.013  13.296  1.00 31.68  ? 285  ASN A N   1 
ATOM   2022  C  CA  . ASN A  1 254 ? 57.334  60.098  12.737  1.00 32.55  ? 285  ASN A CA  1 
ATOM   2023  C  C   . ASN A  1 254 ? 57.333  60.569  11.280  1.00 33.65  ? 285  ASN A C   1 
ATOM   2024  O  O   . ASN A  1 254 ? 58.390  60.772  10.685  1.00 34.74  ? 285  ASN A O   1 
ATOM   2025  C  CB  . ASN A  1 254 ? 58.018  58.734  12.807  1.00 33.91  ? 285  ASN A CB  1 
ATOM   2026  C  CG  . ASN A  1 254 ? 57.310  57.701  11.952  1.00 35.12  ? 285  ASN A CG  1 
ATOM   2027  O  OD1 . ASN A  1 254 ? 57.708  56.538  11.907  1.00 38.05  ? 285  ASN A OD1 1 
ATOM   2028  N  ND2 . ASN A  1 254 ? 56.251  58.126  11.269  1.00 35.66  ? 285  ASN A ND2 1 
ATOM   2029  N  N   . ALA A  1 255 ? 56.162  60.756  10.680  1.00 34.23  ? 286  ALA A N   1 
ATOM   2030  C  CA  . ALA A  1 255 ? 56.103  61.342  9.330   1.00 34.04  ? 286  ALA A CA  1 
ATOM   2031  C  C   . ALA A  1 255 ? 56.484  62.807  9.113   1.00 34.00  ? 286  ALA A C   1 
ATOM   2032  O  O   . ALA A  1 255 ? 56.445  63.308  7.990   1.00 33.66  ? 286  ALA A O   1 
ATOM   2033  C  CB  . ALA A  1 255 ? 54.718  61.084  8.768   1.00 35.41  ? 286  ALA A CB  1 
ATOM   2034  N  N   . GLU A  1 256 ? 56.842  63.495  10.182  1.00 34.12  ? 287  GLU A N   1 
ATOM   2035  C  CA  . GLU A  1 256 ? 57.261  64.890  10.095  1.00 34.60  ? 287  GLU A CA  1 
ATOM   2036  C  C   . GLU A  1 256 ? 56.234  65.790  9.405   1.00 33.99  ? 287  GLU A C   1 
ATOM   2037  O  O   . GLU A  1 256 ? 56.578  66.566  8.511   1.00 33.72  ? 287  GLU A O   1 
ATOM   2038  C  CB  . GLU A  1 256 ? 58.603  65.009  9.381   1.00 37.00  ? 287  GLU A CB  1 
ATOM   2039  C  CG  . GLU A  1 256 ? 59.800  64.877  10.303  1.00 43.15  ? 287  GLU A CG  1 
ATOM   2040  C  CD  . GLU A  1 256 ? 60.997  64.266  9.609   1.00 47.25  ? 287  GLU A CD  1 
ATOM   2041  O  OE1 . GLU A  1 256 ? 61.212  64.578  8.419   1.00 48.85  ? 287  GLU A OE1 1 
ATOM   2042  O  OE2 . GLU A  1 256 ? 61.718  63.477  10.253  1.00 50.70  ? 287  GLU A OE2 1 
ATOM   2043  N  N   . GLY A  1 257 ? 54.981  65.677  9.821   1.00 31.78  ? 288  GLY A N   1 
ATOM   2044  C  CA  . GLY A  1 257 ? 53.923  66.546  9.334   1.00 27.78  ? 288  GLY A CA  1 
ATOM   2045  C  C   . GLY A  1 257 ? 53.422  66.222  7.958   1.00 27.19  ? 288  GLY A C   1 
ATOM   2046  O  O   . GLY A  1 257 ? 52.472  66.878  7.480   1.00 26.40  ? 288  GLY A O   1 
ATOM   2047  N  N   . GLN A  1 258 ? 53.806  65.078  7.401   1.00 27.52  ? 289  GLN A N   1 
ATOM   2048  C  CA  . GLN A  1 258 ? 53.284  64.764  6.073   1.00 28.61  ? 289  GLN A CA  1 
ATOM   2049  C  C   . GLN A  1 258 ? 51.820  64.392  6.217   1.00 28.24  ? 289  GLN A C   1 
ATOM   2050  O  O   . GLN A  1 258 ? 51.327  63.866  7.227   1.00 27.61  ? 289  GLN A O   1 
ATOM   2051  C  CB  . GLN A  1 258 ? 54.098  63.591  5.501   1.00 29.82  ? 289  GLN A CB  1 
ATOM   2052  C  CG  . GLN A  1 258 ? 55.427  64.071  4.946   1.00 33.79  ? 289  GLN A CG  1 
ATOM   2053  C  CD  . GLN A  1 258 ? 55.161  64.775  3.617   1.00 36.30  ? 289  GLN A CD  1 
ATOM   2054  O  OE1 . GLN A  1 258 ? 54.677  64.118  2.687   1.00 39.30  ? 289  GLN A OE1 1 
ATOM   2055  N  NE2 . GLN A  1 258 ? 55.453  66.058  3.527   1.00 35.79  ? 289  GLN A NE2 1 
ATOM   2056  N  N   . PRO A  1 259 ? 51.021  64.694  5.204   1.00 26.17  ? 290  PRO A N   1 
ATOM   2057  C  CA  . PRO A  1 259 ? 49.607  64.341  5.265   1.00 25.56  ? 290  PRO A CA  1 
ATOM   2058  C  C   . PRO A  1 259 ? 49.368  62.839  5.208   1.00 25.49  ? 290  PRO A C   1 
ATOM   2059  O  O   . PRO A  1 259 ? 50.151  62.085  4.636   1.00 27.46  ? 290  PRO A O   1 
ATOM   2060  C  CB  . PRO A  1 259 ? 49.035  65.006  4.009   1.00 25.26  ? 290  PRO A CB  1 
ATOM   2061  C  CG  . PRO A  1 259 ? 50.200  65.023  3.077   1.00 22.82  ? 290  PRO A CG  1 
ATOM   2062  C  CD  . PRO A  1 259 ? 51.380  65.376  3.943   1.00 24.84  ? 290  PRO A CD  1 
ATOM   2063  N  N   . CYS A  1 260 ? 48.292  62.363  5.809   1.00 24.31  ? 291  CYS A N   1 
ATOM   2064  C  CA  . CYS A  1 260 ? 47.811  60.999  5.697   1.00 25.09  ? 291  CYS A CA  1 
ATOM   2065  C  C   . CYS A  1 260 ? 47.605  60.575  4.233   1.00 26.12  ? 291  CYS A C   1 
ATOM   2066  O  O   . CYS A  1 260 ? 47.124  61.353  3.415   1.00 27.44  ? 291  CYS A O   1 
ATOM   2067  C  CB  . CYS A  1 260 ? 46.470  60.932  6.460   1.00 24.30  ? 291  CYS A CB  1 
ATOM   2068  S  SG  . CYS A  1 260 ? 46.463  61.138  8.189   1.00 27.54  ? 291  CYS A SG  1 
ATOM   2069  N  N   . LYS A  1 261 ? 47.906  59.315  3.964   1.00 24.32  ? 292  LYS A N   1 
ATOM   2070  C  CA  . LYS A  1 261 ? 47.919  58.624  2.704   1.00 24.02  ? 292  LYS A CA  1 
ATOM   2071  C  C   . LYS A  1 261 ? 46.773  57.619  2.670   1.00 25.58  ? 292  LYS A C   1 
ATOM   2072  O  O   . LYS A  1 261 ? 46.754  56.591  3.338   1.00 27.39  ? 292  LYS A O   1 
ATOM   2073  C  CB  . LYS A  1 261 ? 49.223  57.906  2.371   1.00 20.68  ? 292  LYS A CB  1 
ATOM   2074  C  CG  . LYS A  1 261 ? 49.087  57.082  1.106   1.00 17.25  ? 292  LYS A CG  1 
ATOM   2075  C  CD  . LYS A  1 261 ? 48.718  57.864  -0.092  1.00 15.57  ? 292  LYS A CD  1 
ATOM   2076  C  CE  . LYS A  1 261 ? 49.739  58.152  -1.141  1.00 16.46  ? 292  LYS A CE  1 
ATOM   2077  N  NZ  . LYS A  1 261 ? 49.156  58.194  -2.513  1.00 16.21  ? 292  LYS A NZ  1 
ATOM   2078  N  N   . PHE A  1 262 ? 45.723  57.941  1.945   1.00 24.74  ? 293  PHE A N   1 
ATOM   2079  C  CA  . PHE A  1 262 ? 44.533  57.105  1.966   1.00 25.69  ? 293  PHE A CA  1 
ATOM   2080  C  C   . PHE A  1 262 ? 44.278  56.396  0.648   1.00 27.65  ? 293  PHE A C   1 
ATOM   2081  O  O   . PHE A  1 262 ? 44.248  57.059  -0.387  1.00 30.61  ? 293  PHE A O   1 
ATOM   2082  C  CB  . PHE A  1 262 ? 43.322  57.988  2.296   1.00 24.56  ? 293  PHE A CB  1 
ATOM   2083  C  CG  . PHE A  1 262 ? 43.343  58.644  3.632   1.00 22.45  ? 293  PHE A CG  1 
ATOM   2084  C  CD1 . PHE A  1 262 ? 43.525  57.908  4.783   1.00 23.25  ? 293  PHE A CD1 1 
ATOM   2085  C  CD2 . PHE A  1 262 ? 43.185  60.004  3.767   1.00 21.63  ? 293  PHE A CD2 1 
ATOM   2086  C  CE1 . PHE A  1 262 ? 43.546  58.510  6.023   1.00 22.51  ? 293  PHE A CE1 1 
ATOM   2087  C  CE2 . PHE A  1 262 ? 43.204  60.621  4.990   1.00 21.63  ? 293  PHE A CE2 1 
ATOM   2088  C  CZ  . PHE A  1 262 ? 43.361  59.867  6.125   1.00 22.66  ? 293  PHE A CZ  1 
ATOM   2089  N  N   . PRO A  1 263 ? 44.050  55.093  0.660   1.00 27.34  ? 294  PRO A N   1 
ATOM   2090  C  CA  . PRO A  1 263 ? 43.996  54.284  1.864   1.00 27.49  ? 294  PRO A CA  1 
ATOM   2091  C  C   . PRO A  1 263 ? 45.383  53.767  2.176   1.00 28.98  ? 294  PRO A C   1 
ATOM   2092  O  O   . PRO A  1 263 ? 46.168  53.601  1.247   1.00 29.81  ? 294  PRO A O   1 
ATOM   2093  C  CB  . PRO A  1 263 ? 43.150  53.069  1.423   1.00 25.73  ? 294  PRO A CB  1 
ATOM   2094  C  CG  . PRO A  1 263 ? 43.620  52.871  0.018   1.00 23.06  ? 294  PRO A CG  1 
ATOM   2095  C  CD  . PRO A  1 263 ? 43.730  54.256  -0.533  1.00 24.79  ? 294  PRO A CD  1 
ATOM   2096  N  N   . PHE A  1 264 ? 45.639  53.480  3.425   1.00 28.68  ? 295  PHE A N   1 
ATOM   2097  C  CA  . PHE A  1 264 ? 46.911  52.961  3.895   1.00 28.54  ? 295  PHE A CA  1 
ATOM   2098  C  C   . PHE A  1 264 ? 46.599  51.610  4.546   1.00 31.53  ? 295  PHE A C   1 
ATOM   2099  O  O   . PHE A  1 264 ? 45.562  51.445  5.190   1.00 32.91  ? 295  PHE A O   1 
ATOM   2100  C  CB  . PHE A  1 264 ? 47.596  53.903  4.859   1.00 25.47  ? 295  PHE A CB  1 
ATOM   2101  C  CG  . PHE A  1 264 ? 46.866  54.059  6.156   1.00 22.56  ? 295  PHE A CG  1 
ATOM   2102  C  CD1 . PHE A  1 264 ? 47.090  53.177  7.196   1.00 22.23  ? 295  PHE A CD1 1 
ATOM   2103  C  CD2 . PHE A  1 264 ? 45.946  55.083  6.351   1.00 21.39  ? 295  PHE A CD2 1 
ATOM   2104  C  CE1 . PHE A  1 264 ? 46.420  53.306  8.404   1.00 21.76  ? 295  PHE A CE1 1 
ATOM   2105  C  CE2 . PHE A  1 264 ? 45.260  55.211  7.522   1.00 22.45  ? 295  PHE A CE2 1 
ATOM   2106  C  CZ  . PHE A  1 264 ? 45.521  54.342  8.568   1.00 22.53  ? 295  PHE A CZ  1 
ATOM   2107  N  N   . ARG A  1 265 ? 47.447  50.633  4.277   1.00 31.34  ? 296  ARG A N   1 
ATOM   2108  C  CA  . ARG A  1 265 ? 47.216  49.274  4.747   1.00 29.14  ? 296  ARG A CA  1 
ATOM   2109  C  C   . ARG A  1 265 ? 47.859  49.009  6.093   1.00 27.93  ? 296  ARG A C   1 
ATOM   2110  O  O   . ARG A  1 265 ? 49.069  49.181  6.253   1.00 30.71  ? 296  ARG A O   1 
ATOM   2111  C  CB  . ARG A  1 265 ? 47.797  48.282  3.742   1.00 30.49  ? 296  ARG A CB  1 
ATOM   2112  C  CG  . ARG A  1 265 ? 47.416  46.837  3.934   1.00 32.83  ? 296  ARG A CG  1 
ATOM   2113  C  CD  . ARG A  1 265 ? 47.760  46.041  2.681   1.00 34.53  ? 296  ARG A CD  1 
ATOM   2114  N  NE  . ARG A  1 265 ? 48.327  44.733  2.978   1.00 38.67  ? 296  ARG A NE  1 
ATOM   2115  C  CZ  . ARG A  1 265 ? 47.678  43.805  3.672   1.00 40.32  ? 296  ARG A CZ  1 
ATOM   2116  N  NH1 . ARG A  1 265 ? 46.461  44.086  4.123   1.00 40.52  ? 296  ARG A NH1 1 
ATOM   2117  N  NH2 . ARG A  1 265 ? 48.229  42.624  3.922   1.00 40.34  ? 296  ARG A NH2 1 
ATOM   2118  N  N   . PHE A  1 266 ? 47.079  48.611  7.072   1.00 26.39  ? 297  PHE A N   1 
ATOM   2119  C  CA  . PHE A  1 266 ? 47.578  48.230  8.393   1.00 25.80  ? 297  PHE A CA  1 
ATOM   2120  C  C   . PHE A  1 266 ? 47.057  46.813  8.660   1.00 28.19  ? 297  PHE A C   1 
ATOM   2121  O  O   . PHE A  1 266 ? 45.871  46.579  8.860   1.00 26.79  ? 297  PHE A O   1 
ATOM   2122  C  CB  . PHE A  1 266 ? 47.014  49.173  9.446   1.00 25.21  ? 297  PHE A CB  1 
ATOM   2123  C  CG  . PHE A  1 266 ? 47.384  48.844  10.851  1.00 22.97  ? 297  PHE A CG  1 
ATOM   2124  C  CD1 . PHE A  1 266 ? 48.660  48.417  11.157  1.00 22.88  ? 297  PHE A CD1 1 
ATOM   2125  C  CD2 . PHE A  1 266 ? 46.486  49.002  11.900  1.00 22.13  ? 297  PHE A CD2 1 
ATOM   2126  C  CE1 . PHE A  1 266 ? 49.028  48.117  12.452  1.00 22.93  ? 297  PHE A CE1 1 
ATOM   2127  C  CE2 . PHE A  1 266 ? 46.865  48.705  13.201  1.00 20.54  ? 297  PHE A CE2 1 
ATOM   2128  C  CZ  . PHE A  1 266 ? 48.125  48.248  13.488  1.00 19.31  ? 297  PHE A CZ  1 
ATOM   2129  N  N   . GLN A  1 267 ? 48.003  45.881  8.569   1.00 30.55  ? 298  GLN A N   1 
ATOM   2130  C  CA  . GLN A  1 267 ? 47.686  44.471  8.747   1.00 29.93  ? 298  GLN A CA  1 
ATOM   2131  C  C   . GLN A  1 267 ? 46.663  44.090  7.685   1.00 29.96  ? 298  GLN A C   1 
ATOM   2132  O  O   . GLN A  1 267 ? 46.772  44.658  6.592   1.00 29.48  ? 298  GLN A O   1 
ATOM   2133  C  CB  . GLN A  1 267 ? 47.229  44.174  10.162  1.00 29.95  ? 298  GLN A CB  1 
ATOM   2134  C  CG  . GLN A  1 267 ? 48.321  44.306  11.219  1.00 30.84  ? 298  GLN A CG  1 
ATOM   2135  C  CD  . GLN A  1 267 ? 49.617  43.591  10.921  1.00 31.42  ? 298  GLN A CD  1 
ATOM   2136  O  OE1 . GLN A  1 267 ? 49.682  42.363  10.786  1.00 31.68  ? 298  GLN A OE1 1 
ATOM   2137  N  NE2 . GLN A  1 267 ? 50.720  44.332  10.818  1.00 31.40  ? 298  GLN A NE2 1 
ATOM   2138  N  N   . GLY A  1 268 ? 45.676  43.277  8.015   1.00 29.77  ? 299  GLY A N   1 
ATOM   2139  C  CA  . GLY A  1 268 ? 44.684  42.844  7.055   1.00 30.17  ? 299  GLY A CA  1 
ATOM   2140  C  C   . GLY A  1 268 ? 43.640  43.864  6.724   1.00 32.31  ? 299  GLY A C   1 
ATOM   2141  O  O   . GLY A  1 268 ? 42.459  43.495  6.577   1.00 37.17  ? 299  GLY A O   1 
ATOM   2142  N  N   . THR A  1 269 ? 43.872  45.157  6.793   1.00 32.81  ? 300  THR A N   1 
ATOM   2143  C  CA  . THR A  1 269 ? 42.792  46.108  6.561   1.00 31.50  ? 300  THR A CA  1 
ATOM   2144  C  C   . THR A  1 269 ? 43.389  47.373  5.939   1.00 32.25  ? 300  THR A C   1 
ATOM   2145  O  O   . THR A  1 269 ? 44.513  47.717  6.281   1.00 34.09  ? 300  THR A O   1 
ATOM   2146  C  CB  . THR A  1 269 ? 42.027  46.466  7.837   1.00 30.98  ? 300  THR A CB  1 
ATOM   2147  O  OG1 . THR A  1 269 ? 41.637  45.279  8.538   1.00 30.96  ? 300  THR A OG1 1 
ATOM   2148  C  CG2 . THR A  1 269 ? 40.736  47.211  7.503   1.00 29.43  ? 300  THR A CG2 1 
ATOM   2149  N  N   . SER A  1 270 ? 42.621  47.935  5.026   1.00 29.99  ? 301  SER A N   1 
ATOM   2150  C  CA  . SER A  1 270 ? 43.011  49.139  4.317   1.00 28.37  ? 301  SER A CA  1 
ATOM   2151  C  C   . SER A  1 270 ? 42.142  50.299  4.773   1.00 27.84  ? 301  SER A C   1 
ATOM   2152  O  O   . SER A  1 270 ? 40.971  50.385  4.417   1.00 29.34  ? 301  SER A O   1 
ATOM   2153  C  CB  . SER A  1 270 ? 42.916  48.908  2.815   1.00 29.07  ? 301  SER A CB  1 
ATOM   2154  O  OG  . SER A  1 270 ? 42.280  49.975  2.139   1.00 29.69  ? 301  SER A OG  1 
ATOM   2155  N  N   . TYR A  1 271 ? 42.707  51.153  5.617   1.00 25.08  ? 302  TYR A N   1 
ATOM   2156  C  CA  . TYR A  1 271 ? 41.934  52.262  6.151   1.00 23.86  ? 302  TYR A CA  1 
ATOM   2157  C  C   . TYR A  1 271 ? 41.966  53.418  5.184   1.00 25.05  ? 302  TYR A C   1 
ATOM   2158  O  O   . TYR A  1 271 ? 43.028  53.757  4.662   1.00 25.29  ? 302  TYR A O   1 
ATOM   2159  C  CB  . TYR A  1 271 ? 42.484  52.678  7.523   1.00 21.68  ? 302  TYR A CB  1 
ATOM   2160  C  CG  . TYR A  1 271 ? 42.581  51.474  8.456   1.00 19.23  ? 302  TYR A CG  1 
ATOM   2161  C  CD1 . TYR A  1 271 ? 43.539  50.503  8.223   1.00 18.98  ? 302  TYR A CD1 1 
ATOM   2162  C  CD2 . TYR A  1 271 ? 41.744  51.339  9.500   1.00 18.52  ? 302  TYR A CD2 1 
ATOM   2163  C  CE1 . TYR A  1 271 ? 43.634  49.403  9.066   1.00 21.72  ? 302  TYR A CE1 1 
ATOM   2164  C  CE2 . TYR A  1 271 ? 41.812  50.265  10.367  1.00 21.87  ? 302  TYR A CE2 1 
ATOM   2165  C  CZ  . TYR A  1 271 ? 42.747  49.297  10.109  1.00 22.98  ? 302  TYR A CZ  1 
ATOM   2166  O  OH  . TYR A  1 271 ? 42.837  48.224  10.965  1.00 28.59  ? 302  TYR A OH  1 
ATOM   2167  N  N   . ASP A  1 272 ? 40.819  54.024  4.975   1.00 25.36  ? 303  ASP A N   1 
ATOM   2168  C  CA  . ASP A  1 272 ? 40.686  55.173  4.087   1.00 23.62  ? 303  ASP A CA  1 
ATOM   2169  C  C   . ASP A  1 272 ? 40.525  56.455  4.892   1.00 23.45  ? 303  ASP A C   1 
ATOM   2170  O  O   . ASP A  1 272 ? 40.287  57.536  4.384   1.00 23.53  ? 303  ASP A O   1 
ATOM   2171  C  CB  . ASP A  1 272 ? 39.415  54.994  3.253   1.00 23.52  ? 303  ASP A CB  1 
ATOM   2172  C  CG  . ASP A  1 272 ? 39.329  56.027  2.140   1.00 25.49  ? 303  ASP A CG  1 
ATOM   2173  O  OD1 . ASP A  1 272 ? 40.264  55.956  1.311   1.00 23.34  ? 303  ASP A OD1 1 
ATOM   2174  O  OD2 . ASP A  1 272 ? 38.377  56.822  2.146   1.00 30.37  ? 303  ASP A OD2 1 
ATOM   2175  N  N   . SER A  1 273 ? 40.708  56.345  6.201   1.00 23.57  ? 304  SER A N   1 
ATOM   2176  C  CA  . SER A  1 273 ? 40.631  57.564  7.021   1.00 23.20  ? 304  SER A CA  1 
ATOM   2177  C  C   . SER A  1 273 ? 41.470  57.349  8.275   1.00 23.15  ? 304  SER A C   1 
ATOM   2178  O  O   . SER A  1 273 ? 41.963  56.258  8.453   1.00 21.59  ? 304  SER A O   1 
ATOM   2179  C  CB  . SER A  1 273 ? 39.174  57.655  7.496   1.00 23.14  ? 304  SER A CB  1 
ATOM   2180  O  OG  . SER A  1 273 ? 39.024  56.879  8.676   1.00 24.64  ? 304  SER A OG  1 
ATOM   2181  N  N   . CYS A  1 274 ? 41.562  58.364  9.131   1.00 22.36  ? 305  CYS A N   1 
ATOM   2182  C  CA  . CYS A  1 274 ? 42.304  58.072  10.385  1.00 21.64  ? 305  CYS A CA  1 
ATOM   2183  C  C   . CYS A  1 274 ? 41.561  57.082  11.244  1.00 20.62  ? 305  CYS A C   1 
ATOM   2184  O  O   . CYS A  1 274 ? 40.342  56.991  11.136  1.00 20.19  ? 305  CYS A O   1 
ATOM   2185  C  CB  . CYS A  1 274 ? 42.606  59.370  11.112  1.00 22.16  ? 305  CYS A CB  1 
ATOM   2186  S  SG  . CYS A  1 274 ? 43.321  60.536  9.919   1.00 23.95  ? 305  CYS A SG  1 
ATOM   2187  N  N   . THR A  1 275 ? 42.285  56.287  12.012  1.00 20.19  ? 306  THR A N   1 
ATOM   2188  C  CA  . THR A  1 275 ? 41.615  55.288  12.855  1.00 21.14  ? 306  THR A CA  1 
ATOM   2189  C  C   . THR A  1 275 ? 42.161  55.410  14.276  1.00 20.83  ? 306  THR A C   1 
ATOM   2190  O  O   . THR A  1 275 ? 43.175  56.084  14.478  1.00 22.07  ? 306  THR A O   1 
ATOM   2191  C  CB  . THR A  1 275 ? 41.899  53.848  12.403  1.00 22.13  ? 306  THR A CB  1 
ATOM   2192  O  OG1 . THR A  1 275 ? 42.328  53.776  11.041  1.00 25.99  ? 306  THR A OG1 1 
ATOM   2193  C  CG2 . THR A  1 275 ? 40.676  52.977  12.626  1.00 19.38  ? 306  THR A CG2 1 
ATOM   2194  N  N   . THR A  1 276 ? 41.640  54.616  15.190  1.00 19.66  ? 307  THR A N   1 
ATOM   2195  C  CA  . THR A  1 276 ? 42.275  54.459  16.506  1.00 20.79  ? 307  THR A CA  1 
ATOM   2196  C  C   . THR A  1 276 ? 42.725  53.000  16.676  1.00 22.77  ? 307  THR A C   1 
ATOM   2197  O  O   . THR A  1 276 ? 43.180  52.627  17.751  1.00 23.22  ? 307  THR A O   1 
ATOM   2198  C  CB  . THR A  1 276 ? 41.221  54.666  17.596  1.00 20.67  ? 307  THR A CB  1 
ATOM   2199  O  OG1 . THR A  1 276 ? 40.285  53.598  17.561  1.00 23.00  ? 307  THR A OG1 1 
ATOM   2200  C  CG2 . THR A  1 276 ? 40.516  55.982  17.412  1.00 18.87  ? 307  THR A CG2 1 
ATOM   2201  N  N   . GLU A  1 277 ? 42.568  52.230  15.620  1.00 24.95  ? 308  GLU A N   1 
ATOM   2202  C  CA  . GLU A  1 277 ? 42.964  50.844  15.563  1.00 27.04  ? 308  GLU A CA  1 
ATOM   2203  C  C   . GLU A  1 277 ? 44.388  50.628  16.052  1.00 27.32  ? 308  GLU A C   1 
ATOM   2204  O  O   . GLU A  1 277 ? 45.347  51.266  15.618  1.00 29.15  ? 308  GLU A O   1 
ATOM   2205  C  CB  . GLU A  1 277 ? 42.806  50.220  14.182  1.00 28.55  ? 308  GLU A CB  1 
ATOM   2206  C  CG  . GLU A  1 277 ? 42.793  48.704  14.210  1.00 32.74  ? 308  GLU A CG  1 
ATOM   2207  C  CD  . GLU A  1 277 ? 41.695  48.160  15.112  1.00 37.99  ? 308  GLU A CD  1 
ATOM   2208  O  OE1 . GLU A  1 277 ? 40.518  48.312  14.750  1.00 40.38  ? 308  GLU A OE1 1 
ATOM   2209  O  OE2 . GLU A  1 277 ? 42.072  47.591  16.159  1.00 41.25  ? 308  GLU A OE2 1 
ATOM   2210  N  N   . GLY A  1 278 ? 44.508  49.731  17.023  1.00 26.69  ? 309  GLY A N   1 
ATOM   2211  C  CA  . GLY A  1 278 ? 45.699  49.445  17.765  1.00 26.55  ? 309  GLY A CA  1 
ATOM   2212  C  C   . GLY A  1 278 ? 46.035  50.448  18.855  1.00 27.11  ? 309  GLY A C   1 
ATOM   2213  O  O   . GLY A  1 278 ? 47.112  50.356  19.447  1.00 29.52  ? 309  GLY A O   1 
ATOM   2214  N  N   . ARG A  1 279 ? 45.121  51.354  19.155  1.00 27.68  ? 310  ARG A N   1 
ATOM   2215  C  CA  . ARG A  1 279 ? 45.358  52.358  20.185  1.00 30.01  ? 310  ARG A CA  1 
ATOM   2216  C  C   . ARG A  1 279 ? 44.324  52.272  21.300  1.00 31.45  ? 310  ARG A C   1 
ATOM   2217  O  O   . ARG A  1 279 ? 43.231  51.738  21.121  1.00 32.02  ? 310  ARG A O   1 
ATOM   2218  C  CB  . ARG A  1 279 ? 45.337  53.766  19.604  1.00 31.98  ? 310  ARG A CB  1 
ATOM   2219  C  CG  . ARG A  1 279 ? 46.501  54.073  18.675  1.00 33.45  ? 310  ARG A CG  1 
ATOM   2220  C  CD  . ARG A  1 279 ? 46.619  55.563  18.421  1.00 34.47  ? 310  ARG A CD  1 
ATOM   2221  N  NE  . ARG A  1 279 ? 47.978  56.041  18.623  1.00 37.87  ? 310  ARG A NE  1 
ATOM   2222  C  CZ  . ARG A  1 279 ? 48.554  56.146  19.817  1.00 39.04  ? 310  ARG A CZ  1 
ATOM   2223  N  NH1 . ARG A  1 279 ? 47.873  55.789  20.895  1.00 40.09  ? 310  ARG A NH1 1 
ATOM   2224  N  NH2 . ARG A  1 279 ? 49.795  56.597  19.938  1.00 39.73  ? 310  ARG A NH2 1 
ATOM   2225  N  N   . THR A  1 280 ? 44.691  52.810  22.460  1.00 32.63  ? 311  THR A N   1 
ATOM   2226  C  CA  . THR A  1 280 ? 43.806  52.793  23.617  1.00 33.20  ? 311  THR A CA  1 
ATOM   2227  C  C   . THR A  1 280 ? 43.373  54.204  24.029  1.00 33.64  ? 311  THR A C   1 
ATOM   2228  O  O   . THR A  1 280 ? 42.324  54.362  24.658  1.00 35.19  ? 311  THR A O   1 
ATOM   2229  C  CB  . THR A  1 280 ? 44.494  52.196  24.864  1.00 33.10  ? 311  THR A CB  1 
ATOM   2230  O  OG1 . THR A  1 280 ? 44.871  53.276  25.742  1.00 35.75  ? 311  THR A OG1 1 
ATOM   2231  C  CG2 . THR A  1 280 ? 45.710  51.380  24.489  1.00 33.29  ? 311  THR A CG2 1 
ATOM   2232  N  N   . ASP A  1 281 ? 44.223  55.183  23.766  1.00 31.25  ? 312  ASP A N   1 
ATOM   2233  C  CA  . ASP A  1 281 ? 44.027  56.561  24.141  1.00 28.89  ? 312  ASP A CA  1 
ATOM   2234  C  C   . ASP A  1 281 ? 42.960  57.297  23.348  1.00 27.99  ? 312  ASP A C   1 
ATOM   2235  O  O   . ASP A  1 281 ? 42.619  58.463  23.573  1.00 26.03  ? 312  ASP A O   1 
ATOM   2236  C  CB  . ASP A  1 281 ? 45.349  57.326  24.079  1.00 29.91  ? 312  ASP A CB  1 
ATOM   2237  C  CG  . ASP A  1 281 ? 46.139  57.022  22.828  1.00 32.32  ? 312  ASP A CG  1 
ATOM   2238  O  OD1 . ASP A  1 281 ? 45.513  56.810  21.764  1.00 33.27  ? 312  ASP A OD1 1 
ATOM   2239  O  OD2 . ASP A  1 281 ? 47.389  56.999  22.908  1.00 32.19  ? 312  ASP A OD2 1 
ATOM   2240  N  N   . GLY A  1 282 ? 42.417  56.628  22.324  1.00 26.55  ? 313  GLY A N   1 
ATOM   2241  C  CA  . GLY A  1 282 ? 41.367  57.213  21.502  1.00 25.14  ? 313  GLY A CA  1 
ATOM   2242  C  C   . GLY A  1 282 ? 41.899  58.311  20.597  1.00 24.22  ? 313  GLY A C   1 
ATOM   2243  O  O   . GLY A  1 282 ? 41.082  59.060  20.044  1.00 21.77  ? 313  GLY A O   1 
ATOM   2244  N  N   . TYR A  1 283 ? 43.218  58.418  20.461  1.00 25.76  ? 314  TYR A N   1 
ATOM   2245  C  CA  . TYR A  1 283 ? 43.793  59.390  19.541  1.00 27.60  ? 314  TYR A CA  1 
ATOM   2246  C  C   . TYR A  1 283 ? 43.837  58.794  18.142  1.00 28.26  ? 314  TYR A C   1 
ATOM   2247  O  O   . TYR A  1 283 ? 44.437  57.736  17.972  1.00 27.15  ? 314  TYR A O   1 
ATOM   2248  C  CB  . TYR A  1 283 ? 45.193  59.837  19.965  1.00 27.57  ? 314  TYR A CB  1 
ATOM   2249  C  CG  . TYR A  1 283 ? 45.234  60.649  21.235  1.00 30.29  ? 314  TYR A CG  1 
ATOM   2250  C  CD1 . TYR A  1 283 ? 44.666  61.910  21.279  1.00 32.68  ? 314  TYR A CD1 1 
ATOM   2251  C  CD2 . TYR A  1 283 ? 45.829  60.177  22.391  1.00 31.50  ? 314  TYR A CD2 1 
ATOM   2252  C  CE1 . TYR A  1 283 ? 44.678  62.670  22.431  1.00 35.60  ? 314  TYR A CE1 1 
ATOM   2253  C  CE2 . TYR A  1 283 ? 45.851  60.930  23.548  1.00 34.57  ? 314  TYR A CE2 1 
ATOM   2254  C  CZ  . TYR A  1 283 ? 45.272  62.177  23.570  1.00 35.36  ? 314  TYR A CZ  1 
ATOM   2255  O  OH  . TYR A  1 283 ? 45.294  62.932  24.726  1.00 37.53  ? 314  TYR A OH  1 
ATOM   2256  N  N   . ARG A  1 284 ? 43.142  59.379  17.194  1.00 29.70  ? 315  ARG A N   1 
ATOM   2257  C  CA  . ARG A  1 284 ? 43.212  58.909  15.814  1.00 30.36  ? 315  ARG A CA  1 
ATOM   2258  C  C   . ARG A  1 284 ? 44.669  59.103  15.339  1.00 30.86  ? 315  ARG A C   1 
ATOM   2259  O  O   . ARG A  1 284 ? 45.325  60.055  15.756  1.00 32.45  ? 315  ARG A O   1 
ATOM   2260  C  CB  . ARG A  1 284 ? 42.290  59.680  14.868  1.00 30.16  ? 315  ARG A CB  1 
ATOM   2261  C  CG  . ARG A  1 284 ? 40.962  60.107  15.441  1.00 27.78  ? 315  ARG A CG  1 
ATOM   2262  C  CD  . ARG A  1 284 ? 39.884  60.157  14.351  1.00 28.80  ? 315  ARG A CD  1 
ATOM   2263  N  NE  . ARG A  1 284 ? 40.053  61.258  13.406  1.00 24.43  ? 315  ARG A NE  1 
ATOM   2264  C  CZ  . ARG A  1 284 ? 40.105  62.545  13.667  1.00 22.49  ? 315  ARG A CZ  1 
ATOM   2265  N  NH1 . ARG A  1 284 ? 39.987  62.973  14.911  1.00 22.10  ? 315  ARG A NH1 1 
ATOM   2266  N  NH2 . ARG A  1 284 ? 40.291  63.440  12.702  1.00 18.91  ? 315  ARG A NH2 1 
ATOM   2267  N  N   . TRP A  1 285 ? 45.071  58.209  14.468  1.00 29.28  ? 316  TRP A N   1 
ATOM   2268  C  CA  . TRP A  1 285 ? 46.381  58.277  13.821  1.00 27.91  ? 316  TRP A CA  1 
ATOM   2269  C  C   . TRP A  1 285 ? 46.207  57.744  12.407  1.00 27.84  ? 316  TRP A C   1 
ATOM   2270  O  O   . TRP A  1 285 ? 45.112  57.248  12.099  1.00 27.15  ? 316  TRP A O   1 
ATOM   2271  C  CB  . TRP A  1 285 ? 47.359  57.370  14.575  1.00 28.21  ? 316  TRP A CB  1 
ATOM   2272  C  CG  . TRP A  1 285 ? 47.015  55.911  14.454  1.00 27.92  ? 316  TRP A CG  1 
ATOM   2273  C  CD1 . TRP A  1 285 ? 46.137  55.206  15.224  1.00 27.24  ? 316  TRP A CD1 1 
ATOM   2274  C  CD2 . TRP A  1 285 ? 47.543  54.970  13.513  1.00 27.73  ? 316  TRP A CD2 1 
ATOM   2275  N  NE1 . TRP A  1 285 ? 46.076  53.898  14.818  1.00 26.95  ? 316  TRP A NE1 1 
ATOM   2276  C  CE2 . TRP A  1 285 ? 46.945  53.730  13.779  1.00 29.09  ? 316  TRP A CE2 1 
ATOM   2277  C  CE3 . TRP A  1 285 ? 48.468  55.052  12.472  1.00 26.28  ? 316  TRP A CE3 1 
ATOM   2278  C  CZ2 . TRP A  1 285 ? 47.231  52.581  13.033  1.00 29.21  ? 316  TRP A CZ2 1 
ATOM   2279  C  CZ3 . TRP A  1 285 ? 48.759  53.924  11.741  1.00 26.26  ? 316  TRP A CZ3 1 
ATOM   2280  C  CH2 . TRP A  1 285 ? 48.140  52.698  12.021  1.00 28.49  ? 316  TRP A CH2 1 
ATOM   2281  N  N   . CYS A  1 286 ? 47.179  57.834  11.541  1.00 28.58  ? 317  CYS A N   1 
ATOM   2282  C  CA  . CYS A  1 286 ? 47.073  57.299  10.204  1.00 30.08  ? 317  CYS A CA  1 
ATOM   2283  C  C   . CYS A  1 286 ? 48.447  57.028  9.584   1.00 30.96  ? 317  CYS A C   1 
ATOM   2284  O  O   . CYS A  1 286 ? 49.509  57.356  10.092  1.00 31.79  ? 317  CYS A O   1 
ATOM   2285  C  CB  . CYS A  1 286 ? 46.399  58.357  9.297   1.00 29.05  ? 317  CYS A CB  1 
ATOM   2286  S  SG  . CYS A  1 286 ? 47.623  59.672  9.071   1.00 31.37  ? 317  CYS A SG  1 
ATOM   2287  N  N   . GLY A  1 287 ? 48.387  56.322  8.459   1.00 31.41  ? 318  GLY A N   1 
ATOM   2288  C  CA  . GLY A  1 287 ? 49.588  55.966  7.719   1.00 29.75  ? 318  GLY A CA  1 
ATOM   2289  C  C   . GLY A  1 287 ? 49.855  57.050  6.676   1.00 28.60  ? 318  GLY A C   1 
ATOM   2290  O  O   . GLY A  1 287 ? 49.032  57.376  5.819   1.00 27.16  ? 318  GLY A O   1 
ATOM   2291  N  N   . THR A  1 288 ? 51.053  57.629  6.770   1.00 29.26  ? 319  THR A N   1 
ATOM   2292  C  CA  . THR A  1 288 ? 51.405  58.684  5.807   1.00 29.13  ? 319  THR A CA  1 
ATOM   2293  C  C   . THR A  1 288 ? 52.068  58.093  4.567   1.00 27.90  ? 319  THR A C   1 
ATOM   2294  O  O   . THR A  1 288 ? 52.818  58.777  3.868   1.00 28.28  ? 319  THR A O   1 
ATOM   2295  C  CB  . THR A  1 288 ? 52.245  59.752  6.521   1.00 29.67  ? 319  THR A CB  1 
ATOM   2296  O  OG1 . THR A  1 288 ? 53.218  59.117  7.360   1.00 30.86  ? 319  THR A OG1 1 
ATOM   2297  C  CG2 . THR A  1 288 ? 51.355  60.656  7.361   1.00 25.38  ? 319  THR A CG2 1 
ATOM   2298  N  N   . THR A  1 289 ? 51.753  56.825  4.337   1.00 26.59  ? 320  THR A N   1 
ATOM   2299  C  CA  . THR A  1 289 ? 52.216  56.080  3.172   1.00 27.16  ? 320  THR A CA  1 
ATOM   2300  C  C   . THR A  1 289 ? 51.119  55.102  2.764   1.00 27.32  ? 320  THR A C   1 
ATOM   2301  O  O   . THR A  1 289 ? 50.065  55.040  3.394   1.00 28.78  ? 320  THR A O   1 
ATOM   2302  C  CB  . THR A  1 289 ? 53.527  55.342  3.455   1.00 29.43  ? 320  THR A CB  1 
ATOM   2303  O  OG1 . THR A  1 289 ? 53.767  54.379  2.420   1.00 30.09  ? 320  THR A OG1 1 
ATOM   2304  C  CG2 . THR A  1 289 ? 53.464  54.643  4.803   1.00 28.55  ? 320  THR A CG2 1 
ATOM   2305  N  N   . GLU A  1 290 ? 51.323  54.316  1.717   1.00 28.68  ? 321  GLU A N   1 
ATOM   2306  C  CA  . GLU A  1 290 ? 50.281  53.382  1.292   1.00 29.95  ? 321  GLU A CA  1 
ATOM   2307  C  C   . GLU A  1 290 ? 50.458  51.999  1.933   1.00 29.31  ? 321  GLU A C   1 
ATOM   2308  O  O   . GLU A  1 290 ? 49.720  51.065  1.626   1.00 27.74  ? 321  GLU A O   1 
ATOM   2309  C  CB  . GLU A  1 290 ? 50.228  53.282  -0.233  1.00 33.78  ? 321  GLU A CB  1 
ATOM   2310  C  CG  . GLU A  1 290 ? 51.361  52.490  -0.856  1.00 43.56  ? 321  GLU A CG  1 
ATOM   2311  C  CD  . GLU A  1 290 ? 51.329  52.544  -2.371  1.00 49.29  ? 321  GLU A CD  1 
ATOM   2312  O  OE1 . GLU A  1 290 ? 50.374  53.132  -2.923  1.00 50.40  ? 321  GLU A OE1 1 
ATOM   2313  O  OE2 . GLU A  1 290 ? 52.257  52.001  -3.005  1.00 50.89  ? 321  GLU A OE2 1 
ATOM   2314  N  N   . ASP A  1 291 ? 51.432  51.847  2.832   1.00 29.96  ? 322  ASP A N   1 
ATOM   2315  C  CA  . ASP A  1 291 ? 51.646  50.561  3.514   1.00 30.01  ? 322  ASP A CA  1 
ATOM   2316  C  C   . ASP A  1 291 ? 52.334  50.752  4.867   1.00 30.22  ? 322  ASP A C   1 
ATOM   2317  O  O   . ASP A  1 291 ? 53.487  50.346  5.050   1.00 31.46  ? 322  ASP A O   1 
ATOM   2318  C  CB  . ASP A  1 291 ? 52.461  49.596  2.651   1.00 29.16  ? 322  ASP A CB  1 
ATOM   2319  C  CG  . ASP A  1 291 ? 52.554  48.208  3.265   1.00 29.07  ? 322  ASP A CG  1 
ATOM   2320  O  OD1 . ASP A  1 291 ? 52.751  48.110  4.496   1.00 26.04  ? 322  ASP A OD1 1 
ATOM   2321  O  OD2 . ASP A  1 291 ? 52.429  47.215  2.517   1.00 30.14  ? 322  ASP A OD2 1 
ATOM   2322  N  N   . TYR A  1 292 ? 51.552  51.194  5.846   1.00 29.17  ? 323  TYR A N   1 
ATOM   2323  C  CA  . TYR A  1 292 ? 52.108  51.420  7.175   1.00 27.80  ? 323  TYR A CA  1 
ATOM   2324  C  C   . TYR A  1 292 ? 53.031  50.302  7.618   1.00 29.27  ? 323  TYR A C   1 
ATOM   2325  O  O   . TYR A  1 292 ? 54.152  50.488  8.085   1.00 29.51  ? 323  TYR A O   1 
ATOM   2326  C  CB  . TYR A  1 292 ? 50.969  51.594  8.190   1.00 22.99  ? 323  TYR A CB  1 
ATOM   2327  C  CG  . TYR A  1 292 ? 51.523  51.649  9.602   1.00 21.87  ? 323  TYR A CG  1 
ATOM   2328  C  CD1 . TYR A  1 292 ? 52.275  52.735  10.016  1.00 19.74  ? 323  TYR A CD1 1 
ATOM   2329  C  CD2 . TYR A  1 292 ? 51.303  50.613  10.492  1.00 22.25  ? 323  TYR A CD2 1 
ATOM   2330  C  CE1 . TYR A  1 292 ? 52.781  52.785  11.305  1.00 22.21  ? 323  TYR A CE1 1 
ATOM   2331  C  CE2 . TYR A  1 292 ? 51.814  50.646  11.769  1.00 22.18  ? 323  TYR A CE2 1 
ATOM   2332  C  CZ  . TYR A  1 292 ? 52.556  51.734  12.162  1.00 22.85  ? 323  TYR A CZ  1 
ATOM   2333  O  OH  . TYR A  1 292 ? 53.055  51.744  13.450  1.00 26.51  ? 323  TYR A OH  1 
ATOM   2334  N  N   . ASP A  1 293 ? 52.566  49.078  7.510   1.00 30.47  ? 324  ASP A N   1 
ATOM   2335  C  CA  . ASP A  1 293 ? 53.370  47.946  7.980   1.00 31.39  ? 324  ASP A CA  1 
ATOM   2336  C  C   . ASP A  1 293 ? 54.751  47.962  7.338   1.00 32.51  ? 324  ASP A C   1 
ATOM   2337  O  O   . ASP A  1 293 ? 55.765  47.808  8.022   1.00 32.88  ? 324  ASP A O   1 
ATOM   2338  C  CB  . ASP A  1 293 ? 52.619  46.672  7.645   1.00 31.37  ? 324  ASP A CB  1 
ATOM   2339  C  CG  . ASP A  1 293 ? 51.379  46.471  8.486   1.00 30.65  ? 324  ASP A CG  1 
ATOM   2340  O  OD1 . ASP A  1 293 ? 51.501  46.481  9.727   1.00 27.84  ? 324  ASP A OD1 1 
ATOM   2341  O  OD2 . ASP A  1 293 ? 50.290  46.299  7.899   1.00 30.11  ? 324  ASP A OD2 1 
ATOM   2342  N  N   . ARG A  1 294 ? 54.790  48.153  6.015   1.00 33.93  ? 325  ARG A N   1 
ATOM   2343  C  CA  . ARG A  1 294 ? 56.061  48.171  5.303   1.00 35.45  ? 325  ARG A CA  1 
ATOM   2344  C  C   . ARG A  1 294 ? 56.963  49.302  5.789   1.00 35.22  ? 325  ARG A C   1 
ATOM   2345  O  O   . ARG A  1 294 ? 58.019  49.044  6.359   1.00 37.30  ? 325  ARG A O   1 
ATOM   2346  C  CB  . ARG A  1 294 ? 55.896  48.274  3.751   1.00 37.82  ? 325  ARG A CB  1 
ATOM   2347  C  CG  . ARG A  1 294 ? 57.186  48.077  2.939   1.00 42.75  ? 325  ARG A CG  1 
ATOM   2348  C  CD  . ARG A  1 294 ? 57.035  48.721  1.568   1.00 51.09  ? 325  ARG A CD  1 
ATOM   2349  N  NE  . ARG A  1 294 ? 55.746  49.384  1.516   1.00 57.84  ? 325  ARG A NE  1 
ATOM   2350  C  CZ  . ARG A  1 294 ? 55.445  50.520  0.894   1.00 60.54  ? 325  ARG A CZ  1 
ATOM   2351  N  NH1 . ARG A  1 294 ? 56.340  51.171  0.176   1.00 61.06  ? 325  ARG A NH1 1 
ATOM   2352  N  NH2 . ARG A  1 294 ? 54.209  51.001  1.009   1.00 60.67  ? 325  ARG A NH2 1 
ATOM   2353  N  N   . ASP A  1 295 ? 56.537  50.527  5.518   1.00 33.89  ? 326  ASP A N   1 
ATOM   2354  C  CA  . ASP A  1 295 ? 57.279  51.688  6.018   1.00 34.09  ? 326  ASP A CA  1 
ATOM   2355  C  C   . ASP A  1 295 ? 56.527  52.273  7.194   1.00 34.62  ? 326  ASP A C   1 
ATOM   2356  O  O   . ASP A  1 295 ? 55.453  52.866  7.004   1.00 38.51  ? 326  ASP A O   1 
ATOM   2357  C  CB  . ASP A  1 295 ? 57.470  52.714  4.903   1.00 33.20  ? 326  ASP A CB  1 
ATOM   2358  C  CG  . ASP A  1 295 ? 56.818  52.270  3.607   1.00 32.76  ? 326  ASP A CG  1 
ATOM   2359  O  OD1 . ASP A  1 295 ? 57.184  51.188  3.096   1.00 34.21  ? 326  ASP A OD1 1 
ATOM   2360  O  OD2 . ASP A  1 295 ? 55.929  52.998  3.125   1.00 33.25  ? 326  ASP A OD2 1 
ATOM   2361  N  N   . LYS A  1 296 ? 56.968  52.065  8.414   1.00 34.21  ? 327  LYS A N   1 
ATOM   2362  C  CA  . LYS A  1 296 ? 56.228  52.384  9.623   1.00 34.37  ? 327  LYS A CA  1 
ATOM   2363  C  C   . LYS A  1 296 ? 56.028  53.879  9.800   1.00 34.82  ? 327  LYS A C   1 
ATOM   2364  O  O   . LYS A  1 296 ? 55.913  54.335  10.948  1.00 34.45  ? 327  LYS A O   1 
ATOM   2365  C  CB  . LYS A  1 296 ? 56.888  51.785  10.868  1.00 35.03  ? 327  LYS A CB  1 
ATOM   2366  C  CG  . LYS A  1 296 ? 57.277  50.325  10.791  1.00 36.58  ? 327  LYS A CG  1 
ATOM   2367  C  CD  . LYS A  1 296 ? 58.462  50.045  9.881   1.00 40.00  ? 327  LYS A CD  1 
ATOM   2368  C  CE  . LYS A  1 296 ? 58.217  48.785  9.072   1.00 39.04  ? 327  LYS A CE  1 
ATOM   2369  N  NZ  . LYS A  1 296 ? 59.030  47.639  9.545   1.00 40.35  ? 327  LYS A NZ  1 
ATOM   2370  N  N   . LYS A  1 297 ? 55.969  54.683  8.755   1.00 34.88  ? 328  LYS A N   1 
ATOM   2371  C  CA  . LYS A  1 297 ? 55.760  56.116  8.817   1.00 34.20  ? 328  LYS A CA  1 
ATOM   2372  C  C   . LYS A  1 297 ? 54.286  56.436  9.068   1.00 33.50  ? 328  LYS A C   1 
ATOM   2373  O  O   . LYS A  1 297 ? 53.415  55.964  8.331   1.00 34.51  ? 328  LYS A O   1 
ATOM   2374  C  CB  . LYS A  1 297 ? 56.197  56.755  7.498   1.00 35.77  ? 328  LYS A CB  1 
ATOM   2375  C  CG  . LYS A  1 297 ? 57.685  56.837  7.255   1.00 38.70  ? 328  LYS A CG  1 
ATOM   2376  C  CD  . LYS A  1 297 ? 58.390  57.647  8.329   1.00 42.50  ? 328  LYS A CD  1 
ATOM   2377  C  CE  . LYS A  1 297 ? 59.639  58.297  7.749   1.00 45.61  ? 328  LYS A CE  1 
ATOM   2378  N  NZ  . LYS A  1 297 ? 59.566  59.785  7.927   1.00 46.82  ? 328  LYS A NZ  1 
ATOM   2379  N  N   . TYR A  1 298 ? 53.984  57.268  10.055  1.00 30.19  ? 329  TYR A N   1 
ATOM   2380  C  CA  . TYR A  1 298 ? 52.628  57.590  10.420  1.00 28.44  ? 329  TYR A CA  1 
ATOM   2381  C  C   . TYR A  1 298 ? 52.488  58.927  11.132  1.00 30.22  ? 329  TYR A C   1 
ATOM   2382  O  O   . TYR A  1 298 ? 53.480  59.437  11.642  1.00 31.05  ? 329  TYR A O   1 
ATOM   2383  C  CB  . TYR A  1 298 ? 52.136  56.498  11.394  1.00 26.44  ? 329  TYR A CB  1 
ATOM   2384  C  CG  . TYR A  1 298 ? 52.743  56.688  12.767  1.00 24.02  ? 329  TYR A CG  1 
ATOM   2385  C  CD1 . TYR A  1 298 ? 54.055  56.342  13.005  1.00 24.33  ? 329  TYR A CD1 1 
ATOM   2386  C  CD2 . TYR A  1 298 ? 52.013  57.208  13.824  1.00 24.73  ? 329  TYR A CD2 1 
ATOM   2387  C  CE1 . TYR A  1 298 ? 54.605  56.505  14.256  1.00 24.97  ? 329  TYR A CE1 1 
ATOM   2388  C  CE2 . TYR A  1 298 ? 52.540  57.383  15.078  1.00 23.87  ? 329  TYR A CE2 1 
ATOM   2389  C  CZ  . TYR A  1 298 ? 53.846  57.028  15.287  1.00 23.42  ? 329  TYR A CZ  1 
ATOM   2390  O  OH  . TYR A  1 298 ? 54.443  57.178  16.519  1.00 21.57  ? 329  TYR A OH  1 
ATOM   2391  N  N   . GLY A  1 299 ? 51.252  59.434  11.213  1.00 30.52  ? 330  GLY A N   1 
ATOM   2392  C  CA  . GLY A  1 299 ? 50.977  60.676  11.919  1.00 29.18  ? 330  GLY A CA  1 
ATOM   2393  C  C   . GLY A  1 299 ? 49.639  60.618  12.648  1.00 28.97  ? 330  GLY A C   1 
ATOM   2394  O  O   . GLY A  1 299 ? 48.839  59.709  12.408  1.00 30.05  ? 330  GLY A O   1 
ATOM   2395  N  N   . PHE A  1 300 ? 49.390  61.620  13.482  1.00 27.36  ? 331  PHE A N   1 
ATOM   2396  C  CA  . PHE A  1 300 ? 48.152  61.716  14.239  1.00 26.05  ? 331  PHE A CA  1 
ATOM   2397  C  C   . PHE A  1 300 ? 47.175  62.750  13.686  1.00 24.82  ? 331  PHE A C   1 
ATOM   2398  O  O   . PHE A  1 300 ? 47.622  63.803  13.253  1.00 26.37  ? 331  PHE A O   1 
ATOM   2399  C  CB  . PHE A  1 300 ? 48.465  62.120  15.691  1.00 26.32  ? 331  PHE A CB  1 
ATOM   2400  C  CG  . PHE A  1 300 ? 49.054  60.987  16.480  1.00 27.84  ? 331  PHE A CG  1 
ATOM   2401  C  CD1 . PHE A  1 300 ? 48.218  60.059  17.084  1.00 29.99  ? 331  PHE A CD1 1 
ATOM   2402  C  CD2 . PHE A  1 300 ? 50.420  60.837  16.629  1.00 28.64  ? 331  PHE A CD2 1 
ATOM   2403  C  CE1 . PHE A  1 300 ? 48.744  59.013  17.823  1.00 29.86  ? 331  PHE A CE1 1 
ATOM   2404  C  CE2 . PHE A  1 300 ? 50.942  59.804  17.371  1.00 29.18  ? 331  PHE A CE2 1 
ATOM   2405  C  CZ  . PHE A  1 300 ? 50.112  58.887  17.965  1.00 29.20  ? 331  PHE A CZ  1 
ATOM   2406  N  N   . CYS A  1 301 ? 45.863  62.481  13.781  1.00 22.41  ? 332  CYS A N   1 
ATOM   2407  C  CA  . CYS A  1 301 ? 44.923  63.519  13.272  1.00 22.05  ? 332  CYS A CA  1 
ATOM   2408  C  C   . CYS A  1 301 ? 44.046  64.029  14.404  1.00 21.39  ? 332  CYS A C   1 
ATOM   2409  O  O   . CYS A  1 301 ? 42.928  63.549  14.610  1.00 25.44  ? 332  CYS A O   1 
ATOM   2410  C  CB  . CYS A  1 301 ? 44.050  62.861  12.183  1.00 21.38  ? 332  CYS A CB  1 
ATOM   2411  S  SG  . CYS A  1 301 ? 44.930  61.519  11.363  1.00 21.64  ? 332  CYS A SG  1 
ATOM   2412  N  N   . PRO A  1 302 ? 44.539  64.950  15.221  1.00 18.46  ? 333  PRO A N   1 
ATOM   2413  C  CA  . PRO A  1 302 ? 43.955  65.460  16.440  1.00 17.50  ? 333  PRO A CA  1 
ATOM   2414  C  C   . PRO A  1 302 ? 42.688  66.255  16.315  1.00 19.72  ? 333  PRO A C   1 
ATOM   2415  O  O   . PRO A  1 302 ? 42.060  66.633  17.305  1.00 21.19  ? 333  PRO A O   1 
ATOM   2416  C  CB  . PRO A  1 302 ? 45.080  66.281  17.069  1.00 16.75  ? 333  PRO A CB  1 
ATOM   2417  C  CG  . PRO A  1 302 ? 46.321  65.682  16.479  1.00 18.75  ? 333  PRO A CG  1 
ATOM   2418  C  CD  . PRO A  1 302 ? 45.910  65.530  15.037  1.00 17.78  ? 333  PRO A CD  1 
ATOM   2419  N  N   . GLU A  1 303 ? 42.366  66.691  15.113  1.00 19.94  ? 334  GLU A N   1 
ATOM   2420  C  CA  . GLU A  1 303 ? 41.140  67.442  14.874  1.00 20.73  ? 334  GLU A CA  1 
ATOM   2421  C  C   . GLU A  1 303 ? 40.768  67.456  13.409  1.00 21.22  ? 334  GLU A C   1 
ATOM   2422  O  O   . GLU A  1 303 ? 41.644  67.186  12.597  1.00 22.32  ? 334  GLU A O   1 
ATOM   2423  C  CB  . GLU A  1 303 ? 41.366  68.894  15.302  1.00 23.10  ? 334  GLU A CB  1 
ATOM   2424  C  CG  . GLU A  1 303 ? 40.288  69.839  14.747  1.00 28.60  ? 334  GLU A CG  1 
ATOM   2425  C  CD  . GLU A  1 303 ? 40.093  70.996  15.694  1.00 31.15  ? 334  GLU A CD  1 
ATOM   2426  O  OE1 . GLU A  1 303 ? 41.106  71.494  16.227  1.00 33.67  ? 334  GLU A OE1 1 
ATOM   2427  O  OE2 . GLU A  1 303 ? 38.975  71.457  15.965  1.00 33.62  ? 334  GLU A OE2 1 
ATOM   2428  N  N   . THR A  1 304 ? 39.573  67.934  13.080  1.00 20.58  ? 335  THR A N   1 
ATOM   2429  C  CA  . THR A  1 304 ? 39.346  68.174  11.646  1.00 20.48  ? 335  THR A CA  1 
ATOM   2430  C  C   . THR A  1 304 ? 38.517  69.407  11.363  1.00 21.52  ? 335  THR A C   1 
ATOM   2431  O  O   . THR A  1 304 ? 37.515  69.651  12.029  1.00 21.55  ? 335  THR A O   1 
ATOM   2432  C  CB  . THR A  1 304 ? 38.813  66.918  10.979  1.00 17.37  ? 335  THR A CB  1 
ATOM   2433  O  OG1 . THR A  1 304 ? 39.739  65.838  11.178  1.00 15.00  ? 335  THR A OG1 1 
ATOM   2434  C  CG2 . THR A  1 304 ? 38.644  67.142  9.482   1.00 17.63  ? 335  THR A CG2 1 
ATOM   2435  N  N   . ALA A  1 305 ? 38.940  70.193  10.379  1.00 23.32  ? 336  ALA A N   1 
ATOM   2436  C  CA  . ALA A  1 305 ? 38.237  71.413  9.996   1.00 22.95  ? 336  ALA A CA  1 
ATOM   2437  C  C   . ALA A  1 305 ? 37.086  71.035  9.076   1.00 23.32  ? 336  ALA A C   1 
ATOM   2438  O  O   . ALA A  1 305 ? 37.369  70.581  7.965   1.00 23.06  ? 336  ALA A O   1 
ATOM   2439  C  CB  . ALA A  1 305 ? 39.248  72.250  9.227   1.00 22.64  ? 336  ALA A CB  1 
ATOM   2440  N  N   . MET A  1 306 ? 35.878  71.299  9.498   1.00 24.77  ? 337  MET A N   1 
ATOM   2441  C  CA  . MET A  1 306 ? 34.688  70.919  8.755   1.00 28.53  ? 337  MET A CA  1 
ATOM   2442  C  C   . MET A  1 306 ? 34.357  72.000  7.744   1.00 28.74  ? 337  MET A C   1 
ATOM   2443  O  O   . MET A  1 306 ? 33.934  73.096  8.113   1.00 27.88  ? 337  MET A O   1 
ATOM   2444  C  CB  . MET A  1 306 ? 33.500  70.776  9.727   1.00 33.66  ? 337  MET A CB  1 
ATOM   2445  C  CG  . MET A  1 306 ? 33.463  69.407  10.399  1.00 37.81  ? 337  MET A CG  1 
ATOM   2446  S  SD  . MET A  1 306 ? 33.077  68.142  9.158   1.00 46.52  ? 337  MET A SD  1 
ATOM   2447  C  CE  . MET A  1 306 ? 31.293  68.178  9.192   1.00 44.80  ? 337  MET A CE  1 
ATOM   2448  N  N   . SER A  1 307 ? 34.484  71.692  6.457   1.00 29.25  ? 338  SER A N   1 
ATOM   2449  C  CA  . SER A  1 307 ? 34.050  72.716  5.500   1.00 30.59  ? 338  SER A CA  1 
ATOM   2450  C  C   . SER A  1 307 ? 32.530  72.754  5.422   1.00 30.88  ? 338  SER A C   1 
ATOM   2451  O  O   . SER A  1 307 ? 31.924  73.814  5.568   1.00 30.97  ? 338  SER A O   1 
ATOM   2452  C  CB  . SER A  1 307 ? 34.627  72.453  4.119   1.00 31.38  ? 338  SER A CB  1 
ATOM   2453  O  OG  . SER A  1 307 ? 36.029  72.640  4.114   1.00 34.59  ? 338  SER A OG  1 
ATOM   2454  N  N   . THR A  1 308 ? 31.924  71.622  5.074   1.00 30.26  ? 339  THR A N   1 
ATOM   2455  C  CA  . THR A  1 308 ? 30.485  71.566  4.891   1.00 29.15  ? 339  THR A CA  1 
ATOM   2456  C  C   . THR A  1 308 ? 30.015  70.262  5.556   1.00 30.11  ? 339  THR A C   1 
ATOM   2457  O  O   . THR A  1 308 ? 30.800  69.331  5.614   1.00 29.90  ? 339  THR A O   1 
ATOM   2458  C  CB  . THR A  1 308 ? 30.020  71.462  3.438   1.00 28.82  ? 339  THR A CB  1 
ATOM   2459  O  OG1 . THR A  1 308 ? 30.544  70.269  2.849   1.00 27.41  ? 339  THR A OG1 1 
ATOM   2460  C  CG2 . THR A  1 308 ? 30.347  72.681  2.620   1.00 29.66  ? 339  THR A CG2 1 
ATOM   2461  N  N   . VAL A  1 309 ? 28.774  70.279  5.979   1.00 31.30  ? 340  VAL A N   1 
ATOM   2462  C  CA  . VAL A  1 309 ? 28.187  69.129  6.665   1.00 30.37  ? 340  VAL A CA  1 
ATOM   2463  C  C   . VAL A  1 309 ? 27.056  68.557  5.825   1.00 30.63  ? 340  VAL A C   1 
ATOM   2464  O  O   . VAL A  1 309 ? 26.300  69.304  5.218   1.00 30.85  ? 340  VAL A O   1 
ATOM   2465  C  CB  . VAL A  1 309 ? 27.639  69.594  8.030   1.00 28.98  ? 340  VAL A CB  1 
ATOM   2466  C  CG1 . VAL A  1 309 ? 26.835  68.534  8.741   1.00 29.63  ? 340  VAL A CG1 1 
ATOM   2467  C  CG2 . VAL A  1 309 ? 28.784  70.098  8.887   1.00 29.48  ? 340  VAL A CG2 1 
ATOM   2468  N  N   . GLY A  1 310 ? 26.947  67.238  5.794   1.00 33.14  ? 341  GLY A N   1 
ATOM   2469  C  CA  . GLY A  1 310 ? 25.885  66.577  5.052   1.00 34.16  ? 341  GLY A CA  1 
ATOM   2470  C  C   . GLY A  1 310 ? 25.952  66.924  3.573   1.00 35.07  ? 341  GLY A C   1 
ATOM   2471  O  O   . GLY A  1 310 ? 27.023  67.068  3.000   1.00 36.54  ? 341  GLY A O   1 
ATOM   2472  N  N   . GLY A  1 311 ? 24.788  67.061  2.962   1.00 35.56  ? 342  GLY A N   1 
ATOM   2473  C  CA  . GLY A  1 311 ? 24.696  67.385  1.550   1.00 35.95  ? 342  GLY A CA  1 
ATOM   2474  C  C   . GLY A  1 311 ? 25.075  66.188  0.691   1.00 36.71  ? 342  GLY A C   1 
ATOM   2475  O  O   . GLY A  1 311 ? 24.682  65.053  0.933   1.00 36.51  ? 342  GLY A O   1 
ATOM   2476  N  N   . ASN A  1 312 ? 25.842  66.473  -0.352  1.00 38.85  ? 343  ASN A N   1 
ATOM   2477  C  CA  . ASN A  1 312 ? 26.304  65.411  -1.240  1.00 41.84  ? 343  ASN A CA  1 
ATOM   2478  C  C   . ASN A  1 312 ? 27.808  65.497  -1.462  1.00 43.78  ? 343  ASN A C   1 
ATOM   2479  O  O   . ASN A  1 312 ? 28.362  64.644  -2.158  1.00 45.08  ? 343  ASN A O   1 
ATOM   2480  C  CB  . ASN A  1 312 ? 25.573  65.548  -2.572  1.00 42.87  ? 343  ASN A CB  1 
ATOM   2481  C  CG  . ASN A  1 312 ? 26.333  66.295  -3.632  1.00 46.45  ? 343  ASN A CG  1 
ATOM   2482  O  OD1 . ASN A  1 312 ? 27.437  66.813  -3.498  1.00 50.60  ? 343  ASN A OD1 1 
ATOM   2483  N  ND2 . ASN A  1 312 ? 25.733  66.370  -4.819  1.00 48.06  ? 343  ASN A ND2 1 
ATOM   2484  N  N   . SER A  1 313 ? 28.416  66.586  -1.008  1.00 44.20  ? 344  SER A N   1 
ATOM   2485  C  CA  . SER A  1 313 ? 29.699  67.094  -1.544  1.00 43.64  ? 344  SER A CA  1 
ATOM   2486  C  C   . SER A  1 313 ? 30.819  66.519  -0.709  1.00 44.27  ? 344  SER A C   1 
ATOM   2487  O  O   . SER A  1 313 ? 31.984  66.900  -0.794  1.00 43.55  ? 344  SER A O   1 
ATOM   2488  C  CB  . SER A  1 313 ? 29.783  68.626  -1.523  1.00 43.05  ? 344  SER A CB  1 
ATOM   2489  O  OG  . SER A  1 313 ? 28.728  69.103  -2.356  1.00 42.22  ? 344  SER A OG  1 
ATOM   2490  N  N   . GLU A  1 314 ? 30.450  65.526  0.094   1.00 45.06  ? 345  GLU A N   1 
ATOM   2491  C  CA  . GLU A  1 314 ? 31.368  64.822  0.962   1.00 46.14  ? 345  GLU A CA  1 
ATOM   2492  C  C   . GLU A  1 314 ? 32.201  65.801  1.776   1.00 46.21  ? 345  GLU A C   1 
ATOM   2493  O  O   . GLU A  1 314 ? 33.393  65.572  1.969   1.00 48.02  ? 345  GLU A O   1 
ATOM   2494  C  CB  . GLU A  1 314 ? 32.302  63.920  0.159   1.00 46.75  ? 345  GLU A CB  1 
ATOM   2495  C  CG  . GLU A  1 314 ? 31.789  63.531  -1.215  1.00 48.38  ? 345  GLU A CG  1 
ATOM   2496  C  CD  . GLU A  1 314 ? 32.120  62.099  -1.569  1.00 50.65  ? 345  GLU A CD  1 
ATOM   2497  O  OE1 . GLU A  1 314 ? 33.311  61.793  -1.786  1.00 53.27  ? 345  GLU A OE1 1 
ATOM   2498  O  OE2 . GLU A  1 314 ? 31.168  61.287  -1.618  1.00 48.18  ? 345  GLU A OE2 1 
ATOM   2499  N  N   . GLY A  1 315 ? 31.618  66.898  2.246   1.00 45.15  ? 346  GLY A N   1 
ATOM   2500  C  CA  . GLY A  1 315 ? 32.453  67.834  2.999   1.00 43.56  ? 346  GLY A CA  1 
ATOM   2501  C  C   . GLY A  1 315 ? 33.073  68.891  2.102   1.00 43.86  ? 346  GLY A C   1 
ATOM   2502  O  O   . GLY A  1 315 ? 33.502  69.932  2.627   1.00 44.56  ? 346  GLY A O   1 
ATOM   2503  N  N   . ALA A  1 316 ? 33.052  68.735  0.787   1.00 43.07  ? 347  ALA A N   1 
ATOM   2504  C  CA  . ALA A  1 316 ? 33.609  69.746  -0.110  1.00 42.47  ? 347  ALA A CA  1 
ATOM   2505  C  C   . ALA A  1 316 ? 33.187  71.159  0.284   1.00 41.63  ? 347  ALA A C   1 
ATOM   2506  O  O   . ALA A  1 316 ? 32.012  71.398  0.567   1.00 42.85  ? 347  ALA A O   1 
ATOM   2507  C  CB  . ALA A  1 316 ? 33.228  69.442  -1.547  1.00 42.69  ? 347  ALA A CB  1 
ATOM   2508  N  N   . PRO A  1 317 ? 34.117  72.105  0.281   1.00 40.49  ? 348  PRO A N   1 
ATOM   2509  C  CA  . PRO A  1 317 ? 33.919  73.478  0.677   1.00 40.10  ? 348  PRO A CA  1 
ATOM   2510  C  C   . PRO A  1 317 ? 32.949  74.283  -0.166  1.00 40.66  ? 348  PRO A C   1 
ATOM   2511  O  O   . PRO A  1 317 ? 32.936  74.174  -1.390  1.00 40.58  ? 348  PRO A O   1 
ATOM   2512  C  CB  . PRO A  1 317 ? 35.321  74.101  0.553   1.00 38.52  ? 348  PRO A CB  1 
ATOM   2513  C  CG  . PRO A  1 317 ? 36.237  72.937  0.757   1.00 37.99  ? 348  PRO A CG  1 
ATOM   2514  C  CD  . PRO A  1 317 ? 35.558  71.820  0.015   1.00 39.03  ? 348  PRO A CD  1 
ATOM   2515  N  N   . CYS A  1 318 ? 32.158  75.144  0.482   1.00 40.77  ? 349  CYS A N   1 
ATOM   2516  C  CA  . CYS A  1 318 ? 31.293  76.063  -0.242  1.00 42.46  ? 349  CYS A CA  1 
ATOM   2517  C  C   . CYS A  1 318 ? 32.074  76.861  -1.278  1.00 44.96  ? 349  CYS A C   1 
ATOM   2518  O  O   . CYS A  1 318 ? 33.297  77.039  -1.152  1.00 44.68  ? 349  CYS A O   1 
ATOM   2519  C  CB  . CYS A  1 318 ? 30.585  77.010  0.730   1.00 42.13  ? 349  CYS A CB  1 
ATOM   2520  S  SG  . CYS A  1 318 ? 29.420  76.198  1.848   1.00 43.26  ? 349  CYS A SG  1 
ATOM   2521  N  N   . VAL A  1 319 ? 31.377  77.301  -2.297  1.00 47.73  ? 350  VAL A N   1 
ATOM   2522  C  CA  . VAL A  1 319 ? 31.950  78.036  -3.409  1.00 48.75  ? 350  VAL A CA  1 
ATOM   2523  C  C   . VAL A  1 319 ? 31.188  79.346  -3.582  1.00 51.51  ? 350  VAL A C   1 
ATOM   2524  O  O   . VAL A  1 319 ? 29.996  79.355  -3.858  1.00 51.09  ? 350  VAL A O   1 
ATOM   2525  C  CB  . VAL A  1 319 ? 31.918  77.250  -4.725  1.00 48.28  ? 350  VAL A CB  1 
ATOM   2526  C  CG1 . VAL A  1 319 ? 32.021  78.195  -5.913  1.00 46.65  ? 350  VAL A CG1 1 
ATOM   2527  C  CG2 . VAL A  1 319 ? 33.049  76.224  -4.753  1.00 45.23  ? 350  VAL A CG2 1 
ATOM   2528  N  N   . PHE A  1 320 ? 31.905  80.426  -3.305  1.00 55.44  ? 351  PHE A N   1 
ATOM   2529  C  CA  . PHE A  1 320 ? 31.303  81.745  -3.405  1.00 59.56  ? 351  PHE A CA  1 
ATOM   2530  C  C   . PHE A  1 320 ? 31.934  82.547  -4.539  1.00 60.85  ? 351  PHE A C   1 
ATOM   2531  O  O   . PHE A  1 320 ? 33.159  82.653  -4.623  1.00 60.74  ? 351  PHE A O   1 
ATOM   2532  C  CB  . PHE A  1 320 ? 31.481  82.507  -2.083  1.00 61.62  ? 351  PHE A CB  1 
ATOM   2533  C  CG  . PHE A  1 320 ? 30.746  81.897  -0.925  1.00 64.32  ? 351  PHE A CG  1 
ATOM   2534  C  CD1 . PHE A  1 320 ? 29.378  81.706  -0.989  1.00 64.93  ? 351  PHE A CD1 1 
ATOM   2535  C  CD2 . PHE A  1 320 ? 31.407  81.514  0.228   1.00 65.06  ? 351  PHE A CD2 1 
ATOM   2536  C  CE1 . PHE A  1 320 ? 28.695  81.143  0.065   1.00 65.28  ? 351  PHE A CE1 1 
ATOM   2537  C  CE2 . PHE A  1 320 ? 30.720  80.954  1.289   1.00 65.47  ? 351  PHE A CE2 1 
ATOM   2538  C  CZ  . PHE A  1 320 ? 29.355  80.768  1.215   1.00 65.13  ? 351  PHE A CZ  1 
ATOM   2539  N  N   . PRO A  1 321 ? 31.093  83.132  -5.365  1.00 61.47  ? 352  PRO A N   1 
ATOM   2540  C  CA  . PRO A  1 321 ? 29.641  83.008  -5.262  1.00 61.15  ? 352  PRO A CA  1 
ATOM   2541  C  C   . PRO A  1 321 ? 29.180  81.784  -6.050  1.00 61.34  ? 352  PRO A C   1 
ATOM   2542  O  O   . PRO A  1 321 ? 30.000  81.178  -6.746  1.00 61.94  ? 352  PRO A O   1 
ATOM   2543  C  CB  . PRO A  1 321 ? 29.130  84.300  -5.888  1.00 61.79  ? 352  PRO A CB  1 
ATOM   2544  C  CG  . PRO A  1 321 ? 30.314  85.110  -6.271  1.00 61.61  ? 352  PRO A CG  1 
ATOM   2545  C  CD  . PRO A  1 321 ? 31.425  84.084  -6.461  1.00 61.74  ? 352  PRO A CD  1 
ATOM   2546  N  N   . PHE A  1 322 ? 27.925  81.404  -5.898  1.00 61.79  ? 353  PHE A N   1 
ATOM   2547  C  CA  . PHE A  1 322 ? 27.343  80.264  -6.595  1.00 61.85  ? 353  PHE A CA  1 
ATOM   2548  C  C   . PHE A  1 322 ? 25.939  80.605  -7.072  1.00 63.69  ? 353  PHE A C   1 
ATOM   2549  O  O   . PHE A  1 322 ? 25.213  81.335  -6.388  1.00 63.50  ? 353  PHE A O   1 
ATOM   2550  C  CB  . PHE A  1 322 ? 27.336  79.014  -5.715  1.00 59.59  ? 353  PHE A CB  1 
ATOM   2551  C  CG  . PHE A  1 322 ? 26.367  79.086  -4.576  1.00 58.96  ? 353  PHE A CG  1 
ATOM   2552  C  CD1 . PHE A  1 322 ? 25.047  78.715  -4.748  1.00 59.29  ? 353  PHE A CD1 1 
ATOM   2553  C  CD2 . PHE A  1 322 ? 26.763  79.532  -3.328  1.00 58.47  ? 353  PHE A CD2 1 
ATOM   2554  C  CE1 . PHE A  1 322 ? 24.138  78.783  -3.709  1.00 58.51  ? 353  PHE A CE1 1 
ATOM   2555  C  CE2 . PHE A  1 322 ? 25.861  79.606  -2.284  1.00 58.21  ? 353  PHE A CE2 1 
ATOM   2556  C  CZ  . PHE A  1 322 ? 24.546  79.231  -2.470  1.00 57.73  ? 353  PHE A CZ  1 
ATOM   2557  N  N   . THR A  1 323 ? 25.560  80.129  -8.256  1.00 66.03  ? 354  THR A N   1 
ATOM   2558  C  CA  . THR A  1 323 ? 24.234  80.437  -8.788  1.00 68.07  ? 354  THR A CA  1 
ATOM   2559  C  C   . THR A  1 323 ? 23.234  79.337  -8.451  1.00 68.87  ? 354  THR A C   1 
ATOM   2560  O  O   . THR A  1 323 ? 23.493  78.156  -8.686  1.00 69.02  ? 354  THR A O   1 
ATOM   2561  C  CB  . THR A  1 323 ? 24.228  80.657  -10.308 1.00 67.96  ? 354  THR A CB  1 
ATOM   2562  O  OG1 . THR A  1 323 ? 25.568  80.871  -10.768 1.00 68.67  ? 354  THR A OG1 1 
ATOM   2563  C  CG2 . THR A  1 323 ? 23.364  81.856  -10.669 1.00 66.20  ? 354  THR A CG2 1 
ATOM   2564  N  N   . PHE A  1 324 ? 22.103  79.747  -7.893  1.00 68.62  ? 355  PHE A N   1 
ATOM   2565  C  CA  . PHE A  1 324 ? 21.036  78.819  -7.545  1.00 68.73  ? 355  PHE A CA  1 
ATOM   2566  C  C   . PHE A  1 324 ? 19.726  79.284  -8.158  1.00 71.10  ? 355  PHE A C   1 
ATOM   2567  O  O   . PHE A  1 324 ? 19.046  80.147  -7.617  1.00 71.28  ? 355  PHE A O   1 
ATOM   2568  C  CB  . PHE A  1 324 ? 20.902  78.691  -6.019  1.00 65.08  ? 355  PHE A CB  1 
ATOM   2569  C  CG  . PHE A  1 324 ? 19.660  77.961  -5.557  1.00 60.33  ? 355  PHE A CG  1 
ATOM   2570  C  CD1 . PHE A  1 324 ? 19.473  76.620  -5.855  1.00 57.16  ? 355  PHE A CD1 1 
ATOM   2571  C  CD2 . PHE A  1 324 ? 18.681  78.614  -4.821  1.00 58.15  ? 355  PHE A CD2 1 
ATOM   2572  C  CE1 . PHE A  1 324 ? 18.340  75.947  -5.428  1.00 55.95  ? 355  PHE A CE1 1 
ATOM   2573  C  CE2 . PHE A  1 324 ? 17.547  77.947  -4.392  1.00 56.06  ? 355  PHE A CE2 1 
ATOM   2574  C  CZ  . PHE A  1 324 ? 17.377  76.612  -4.696  1.00 54.94  ? 355  PHE A CZ  1 
ATOM   2575  N  N   . LEU A  1 325 ? 19.366  78.733  -9.304  1.00 72.95  ? 356  LEU A N   1 
ATOM   2576  C  CA  . LEU A  1 325 ? 18.106  79.106  -9.933  1.00 74.65  ? 356  LEU A CA  1 
ATOM   2577  C  C   . LEU A  1 325 ? 18.051  80.583  -10.360 1.00 76.49  ? 356  LEU A C   1 
ATOM   2578  O  O   . LEU A  1 325 ? 17.139  81.316  -9.984  1.00 77.21  ? 356  LEU A O   1 
ATOM   2579  C  CB  . LEU A  1 325 ? 16.931  78.820  -8.994  1.00 74.20  ? 356  LEU A CB  1 
ATOM   2580  C  CG  . LEU A  1 325 ? 16.499  77.358  -8.874  1.00 74.44  ? 356  LEU A CG  1 
ATOM   2581  C  CD1 . LEU A  1 325 ? 17.699  76.463  -8.609  1.00 75.15  ? 356  LEU A CD1 1 
ATOM   2582  C  CD2 . LEU A  1 325 ? 15.456  77.193  -7.780  1.00 74.25  ? 356  LEU A CD2 1 
ATOM   2583  N  N   . GLY A  1 326 ? 19.025  81.039  -11.146 1.00 77.57  ? 357  GLY A N   1 
ATOM   2584  C  CA  . GLY A  1 326 ? 19.003  82.402  -11.682 1.00 79.45  ? 357  GLY A CA  1 
ATOM   2585  C  C   . GLY A  1 326 ? 19.408  83.487  -10.673 1.00 80.06  ? 357  GLY A C   1 
ATOM   2586  O  O   . GLY A  1 326 ? 19.511  84.665  -11.021 1.00 79.44  ? 357  GLY A O   1 
ATOM   2587  N  N   . ASN A  1 327 ? 19.637  83.123  -9.420  1.00 81.53  ? 358  ASN A N   1 
ATOM   2588  C  CA  . ASN A  1 327 ? 20.048  84.106  -8.418  1.00 83.76  ? 358  ASN A CA  1 
ATOM   2589  C  C   . ASN A  1 327 ? 21.439  83.778  -7.881  1.00 84.96  ? 358  ASN A C   1 
ATOM   2590  O  O   . ASN A  1 327 ? 21.666  82.698  -7.339  1.00 85.57  ? 358  ASN A O   1 
ATOM   2591  C  CB  . ASN A  1 327 ? 19.026  84.180  -7.278  1.00 85.04  ? 358  ASN A CB  1 
ATOM   2592  C  CG  . ASN A  1 327 ? 18.302  85.515  -7.217  1.00 86.25  ? 358  ASN A CG  1 
ATOM   2593  O  OD1 . ASN A  1 327 ? 18.928  86.576  -7.223  1.00 86.27  ? 358  ASN A OD1 1 
ATOM   2594  N  ND2 . ASN A  1 327 ? 16.975  85.467  -7.155  1.00 86.25  ? 358  ASN A ND2 1 
ATOM   2595  N  N   . LYS A  1 328 ? 22.378  84.711  -8.037  1.00 85.40  ? 359  LYS A N   1 
ATOM   2596  C  CA  . LYS A  1 328 ? 23.741  84.495  -7.553  1.00 84.99  ? 359  LYS A CA  1 
ATOM   2597  C  C   . LYS A  1 328 ? 23.805  84.619  -6.035  1.00 84.92  ? 359  LYS A C   1 
ATOM   2598  O  O   . LYS A  1 328 ? 23.142  85.474  -5.445  1.00 84.79  ? 359  LYS A O   1 
ATOM   2599  C  CB  . LYS A  1 328 ? 24.711  85.480  -8.212  1.00 84.26  ? 359  LYS A CB  1 
ATOM   2600  C  CG  . LYS A  1 328 ? 24.669  86.882  -7.624  1.00 84.56  ? 359  LYS A CG  1 
ATOM   2601  C  CD  . LYS A  1 328 ? 25.945  87.203  -6.861  1.00 84.08  ? 359  LYS A CD  1 
ATOM   2602  C  CE  . LYS A  1 328 ? 25.872  88.579  -6.217  1.00 83.57  ? 359  LYS A CE  1 
ATOM   2603  N  NZ  . LYS A  1 328 ? 27.143  88.942  -5.532  1.00 82.33  ? 359  LYS A NZ  1 
ATOM   2604  N  N   . TYR A  1 329 ? 24.585  83.745  -5.400  1.00 83.88  ? 360  TYR A N   1 
ATOM   2605  C  CA  . TYR A  1 329 ? 24.692  83.776  -3.946  1.00 82.45  ? 360  TYR A CA  1 
ATOM   2606  C  C   . TYR A  1 329 ? 26.120  83.982  -3.484  1.00 81.08  ? 360  TYR A C   1 
ATOM   2607  O  O   . TYR A  1 329 ? 27.064  83.478  -4.080  1.00 80.24  ? 360  TYR A O   1 
ATOM   2608  C  CB  . TYR A  1 329 ? 24.056  82.528  -3.334  1.00 83.32  ? 360  TYR A CB  1 
ATOM   2609  C  CG  . TYR A  1 329 ? 22.539  82.590  -3.425  1.00 83.82  ? 360  TYR A CG  1 
ATOM   2610  C  CD1 . TYR A  1 329 ? 21.805  83.213  -2.429  1.00 84.01  ? 360  TYR A CD1 1 
ATOM   2611  C  CD2 . TYR A  1 329 ? 21.869  82.054  -4.512  1.00 84.01  ? 360  TYR A CD2 1 
ATOM   2612  C  CE1 . TYR A  1 329 ? 20.427  83.288  -2.511  1.00 84.67  ? 360  TYR A CE1 1 
ATOM   2613  C  CE2 . TYR A  1 329 ? 20.492  82.128  -4.601  1.00 84.64  ? 360  TYR A CE2 1 
ATOM   2614  C  CZ  . TYR A  1 329 ? 19.777  82.746  -3.599  1.00 84.48  ? 360  TYR A CZ  1 
ATOM   2615  O  OH  . TYR A  1 329 ? 18.406  82.822  -3.677  1.00 83.34  ? 360  TYR A OH  1 
ATOM   2616  N  N   . GLU A  1 330 ? 26.277  84.751  -2.423  1.00 79.99  ? 361  GLU A N   1 
ATOM   2617  C  CA  . GLU A  1 330 ? 27.553  85.134  -1.857  1.00 78.87  ? 361  GLU A CA  1 
ATOM   2618  C  C   . GLU A  1 330 ? 27.729  84.635  -0.426  1.00 77.08  ? 361  GLU A C   1 
ATOM   2619  O  O   . GLU A  1 330 ? 28.751  84.900  0.209   1.00 77.59  ? 361  GLU A O   1 
ATOM   2620  C  CB  . GLU A  1 330 ? 27.662  86.671  -1.859  1.00 79.21  ? 361  GLU A CB  1 
ATOM   2621  C  CG  . GLU A  1 330 ? 26.646  87.351  -0.958  1.00 81.03  ? 361  GLU A CG  1 
ATOM   2622  C  CD  . GLU A  1 330 ? 25.242  86.807  -1.108  1.00 82.65  ? 361  GLU A CD  1 
ATOM   2623  O  OE1 . GLU A  1 330 ? 24.685  86.860  -2.225  1.00 82.67  ? 361  GLU A OE1 1 
ATOM   2624  O  OE2 . GLU A  1 330 ? 24.687  86.296  -0.113  1.00 83.30  ? 361  GLU A OE2 1 
ATOM   2625  N  N   . SER A  1 331 ? 26.750  83.898  0.075   1.00 74.57  ? 362  SER A N   1 
ATOM   2626  C  CA  . SER A  1 331 ? 26.804  83.334  1.415   1.00 70.94  ? 362  SER A CA  1 
ATOM   2627  C  C   . SER A  1 331 ? 25.942  82.076  1.507   1.00 68.03  ? 362  SER A C   1 
ATOM   2628  O  O   . SER A  1 331 ? 25.403  81.613  0.506   1.00 68.04  ? 362  SER A O   1 
ATOM   2629  C  CB  . SER A  1 331 ? 26.354  84.348  2.459   1.00 70.70  ? 362  SER A CB  1 
ATOM   2630  O  OG  . SER A  1 331 ? 26.114  83.722  3.709   1.00 69.26  ? 362  SER A OG  1 
ATOM   2631  N  N   . CYS A  1 332 ? 25.908  81.446  2.677   1.00 64.79  ? 363  CYS A N   1 
ATOM   2632  C  CA  . CYS A  1 332 ? 24.941  80.384  2.913   1.00 61.78  ? 363  CYS A CA  1 
ATOM   2633  C  C   . CYS A  1 332 ? 23.516  80.919  2.901   1.00 61.27  ? 363  CYS A C   1 
ATOM   2634  O  O   . CYS A  1 332 ? 23.273  82.099  3.089   1.00 61.04  ? 363  CYS A O   1 
ATOM   2635  C  CB  . CYS A  1 332 ? 25.232  79.682  4.241   1.00 58.93  ? 363  CYS A CB  1 
ATOM   2636  S  SG  . CYS A  1 332 ? 26.798  78.781  4.282   1.00 50.96  ? 363  CYS A SG  1 
ATOM   2637  N  N   . THR A  1 333 ? 22.520  80.015  2.679   1.00 60.85  ? 364  THR A N   1 
ATOM   2638  C  CA  . THR A  1 333 ? 21.132  80.445  2.613   1.00 60.70  ? 364  THR A CA  1 
ATOM   2639  C  C   . THR A  1 333 ? 20.127  79.363  2.962   1.00 60.86  ? 364  THR A C   1 
ATOM   2640  O  O   . THR A  1 333 ? 20.459  78.207  3.208   1.00 62.83  ? 364  THR A O   1 
ATOM   2641  C  CB  . THR A  1 333 ? 20.802  80.986  1.203   1.00 60.83  ? 364  THR A CB  1 
ATOM   2642  O  OG1 . THR A  1 333 ? 19.387  80.949  0.997   1.00 59.55  ? 364  THR A OG1 1 
ATOM   2643  C  CG2 . THR A  1 333 ? 21.485  80.166  0.122   1.00 59.81  ? 364  THR A CG2 1 
ATOM   2644  N  N   . SER A  1 334 ? 18.858  79.758  2.986   1.00 59.80  ? 365  SER A N   1 
ATOM   2645  C  CA  . SER A  1 334 ? 17.759  78.826  3.231   1.00 59.99  ? 365  SER A CA  1 
ATOM   2646  C  C   . SER A  1 334 ? 16.929  78.735  1.943   1.00 59.45  ? 365  SER A C   1 
ATOM   2647  O  O   . SER A  1 334 ? 15.874  78.127  1.886   1.00 57.90  ? 365  SER A O   1 
ATOM   2648  C  CB  . SER A  1 334 ? 16.890  79.299  4.389   1.00 60.14  ? 365  SER A CB  1 
ATOM   2649  O  OG  . SER A  1 334 ? 17.535  80.314  5.141   1.00 61.56  ? 365  SER A OG  1 
ATOM   2650  N  N   . ALA A  1 335 ? 17.476  79.367  0.905   1.00 59.66  ? 366  ALA A N   1 
ATOM   2651  C  CA  . ALA A  1 335 ? 16.856  79.420  -0.402  1.00 59.74  ? 366  ALA A CA  1 
ATOM   2652  C  C   . ALA A  1 335 ? 16.647  78.023  -0.972  1.00 59.63  ? 366  ALA A C   1 
ATOM   2653  O  O   . ALA A  1 335 ? 17.601  77.280  -1.163  1.00 60.68  ? 366  ALA A O   1 
ATOM   2654  C  CB  . ALA A  1 335 ? 17.678  80.254  -1.372  1.00 58.44  ? 366  ALA A CB  1 
ATOM   2655  N  N   . GLY A  1 336 ? 15.395  77.702  -1.267  1.00 58.77  ? 367  GLY A N   1 
ATOM   2656  C  CA  . GLY A  1 336 ? 15.038  76.405  -1.812  1.00 57.78  ? 367  GLY A CA  1 
ATOM   2657  C  C   . GLY A  1 336 ? 14.687  75.441  -0.684  1.00 57.49  ? 367  GLY A C   1 
ATOM   2658  O  O   . GLY A  1 336 ? 14.211  74.339  -0.939  1.00 57.40  ? 367  GLY A O   1 
ATOM   2659  N  N   . ARG A  1 337 ? 14.949  75.851  0.550   1.00 57.70  ? 368  ARG A N   1 
ATOM   2660  C  CA  . ARG A  1 337 ? 14.669  75.000  1.701   1.00 58.59  ? 368  ARG A CA  1 
ATOM   2661  C  C   . ARG A  1 337 ? 13.316  75.363  2.317   1.00 57.76  ? 368  ARG A C   1 
ATOM   2662  O  O   . ARG A  1 337 ? 12.443  75.935  1.668   1.00 57.76  ? 368  ARG A O   1 
ATOM   2663  C  CB  . ARG A  1 337 ? 15.771  75.144  2.754   1.00 60.22  ? 368  ARG A CB  1 
ATOM   2664  C  CG  . ARG A  1 337 ? 17.084  74.450  2.441   1.00 60.16  ? 368  ARG A CG  1 
ATOM   2665  C  CD  . ARG A  1 337 ? 16.879  72.979  2.174   1.00 61.47  ? 368  ARG A CD  1 
ATOM   2666  N  NE  . ARG A  1 337 ? 17.399  72.116  3.226   1.00 59.92  ? 368  ARG A NE  1 
ATOM   2667  C  CZ  . ARG A  1 337 ? 17.276  70.796  3.146   1.00 61.38  ? 368  ARG A CZ  1 
ATOM   2668  N  NH1 . ARG A  1 337 ? 16.684  70.241  2.093   1.00 62.71  ? 368  ARG A NH1 1 
ATOM   2669  N  NH2 . ARG A  1 337 ? 17.768  70.048  4.118   1.00 61.50  ? 368  ARG A NH2 1 
ATOM   2670  N  N   . SER A  1 338 ? 13.171  75.024  3.586   1.00 56.46  ? 369  SER A N   1 
ATOM   2671  C  CA  . SER A  1 338 ? 12.010  75.363  4.383   1.00 54.80  ? 369  SER A CA  1 
ATOM   2672  C  C   . SER A  1 338 ? 12.457  75.511  5.850   1.00 56.39  ? 369  SER A C   1 
ATOM   2673  O  O   . SER A  1 338 ? 12.567  76.603  6.383   1.00 57.76  ? 369  SER A O   1 
ATOM   2674  C  CB  . SER A  1 338 ? 10.910  74.309  4.299   1.00 51.73  ? 369  SER A CB  1 
ATOM   2675  O  OG  . SER A  1 338 ? 10.082  74.405  5.450   1.00 47.07  ? 369  SER A OG  1 
ATOM   2676  N  N   . ASP A  1 339 ? 12.794  74.371  6.415   1.00 57.39  ? 370  ASP A N   1 
ATOM   2677  C  CA  . ASP A  1 339 ? 13.231  74.105  7.752   1.00 57.51  ? 370  ASP A CA  1 
ATOM   2678  C  C   . ASP A  1 339 ? 13.864  75.286  8.465   1.00 56.85  ? 370  ASP A C   1 
ATOM   2679  O  O   . ASP A  1 339 ? 13.303  75.895  9.376   1.00 59.49  ? 370  ASP A O   1 
ATOM   2680  C  CB  . ASP A  1 339 ? 14.208  72.913  7.775   1.00 57.41  ? 370  ASP A CB  1 
ATOM   2681  C  CG  . ASP A  1 339 ? 15.036  72.831  6.510   1.00 58.47  ? 370  ASP A CG  1 
ATOM   2682  O  OD1 . ASP A  1 339 ? 15.319  73.885  5.904   1.00 58.82  ? 370  ASP A OD1 1 
ATOM   2683  O  OD2 . ASP A  1 339 ? 15.437  71.723  6.094   1.00 59.77  ? 370  ASP A OD2 1 
ATOM   2684  N  N   . GLY A  1 340 ? 15.079  75.600  8.042   1.00 54.56  ? 371  GLY A N   1 
ATOM   2685  C  CA  . GLY A  1 340 ? 15.839  76.692  8.643   1.00 52.95  ? 371  GLY A CA  1 
ATOM   2686  C  C   . GLY A  1 340 ? 17.313  76.512  8.273   1.00 51.81  ? 371  GLY A C   1 
ATOM   2687  O  O   . GLY A  1 340 ? 18.140  77.364  8.551   1.00 51.41  ? 371  GLY A O   1 
ATOM   2688  N  N   . LYS A  1 341 ? 17.591  75.386  7.635   1.00 50.79  ? 372  LYS A N   1 
ATOM   2689  C  CA  . LYS A  1 341 ? 18.919  74.967  7.273   1.00 48.13  ? 372  LYS A CA  1 
ATOM   2690  C  C   . LYS A  1 341 ? 19.623  75.876  6.285   1.00 46.64  ? 372  LYS A C   1 
ATOM   2691  O  O   . LYS A  1 341 ? 19.152  76.094  5.174   1.00 46.24  ? 372  LYS A O   1 
ATOM   2692  C  CB  . LYS A  1 341 ? 18.871  73.540  6.703   1.00 48.48  ? 372  LYS A CB  1 
ATOM   2693  C  CG  . LYS A  1 341 ? 18.030  72.583  7.518   1.00 49.56  ? 372  LYS A CG  1 
ATOM   2694  C  CD  . LYS A  1 341 ? 18.828  71.833  8.560   1.00 50.20  ? 372  LYS A CD  1 
ATOM   2695  C  CE  . LYS A  1 341 ? 18.401  70.375  8.640   1.00 50.57  ? 372  LYS A CE  1 
ATOM   2696  N  NZ  . LYS A  1 341 ? 19.031  69.544  7.575   1.00 49.93  ? 372  LYS A NZ  1 
ATOM   2697  N  N   . MET A  1 342 ? 20.818  76.326  6.658   1.00 45.07  ? 373  MET A N   1 
ATOM   2698  C  CA  . MET A  1 342 ? 21.620  77.160  5.770   1.00 43.66  ? 373  MET A CA  1 
ATOM   2699  C  C   . MET A  1 342 ? 22.553  76.278  4.947   1.00 42.55  ? 373  MET A C   1 
ATOM   2700  O  O   . MET A  1 342 ? 23.275  75.455  5.506   1.00 42.04  ? 373  MET A O   1 
ATOM   2701  C  CB  . MET A  1 342 ? 22.402  78.206  6.544   1.00 45.34  ? 373  MET A CB  1 
ATOM   2702  C  CG  . MET A  1 342 ? 21.598  79.140  7.414   1.00 48.71  ? 373  MET A CG  1 
ATOM   2703  S  SD  . MET A  1 342 ? 20.590  80.324  6.512   1.00 53.15  ? 373  MET A SD  1 
ATOM   2704  C  CE  . MET A  1 342 ? 21.824  81.499  5.964   1.00 52.56  ? 373  MET A CE  1 
ATOM   2705  N  N   . TRP A  1 343 ? 22.520  76.421  3.628   1.00 40.99  ? 374  TRP A N   1 
ATOM   2706  C  CA  . TRP A  1 343 ? 23.375  75.611  2.767   1.00 39.41  ? 374  TRP A CA  1 
ATOM   2707  C  C   . TRP A  1 343 ? 24.143  76.499  1.785   1.00 40.39  ? 374  TRP A C   1 
ATOM   2708  O  O   . TRP A  1 343 ? 23.852  77.676  1.639   1.00 41.17  ? 374  TRP A O   1 
ATOM   2709  C  CB  . TRP A  1 343 ? 22.521  74.665  1.911   1.00 37.67  ? 374  TRP A CB  1 
ATOM   2710  C  CG  . TRP A  1 343 ? 21.662  75.370  0.906   1.00 35.03  ? 374  TRP A CG  1 
ATOM   2711  C  CD1 . TRP A  1 343 ? 20.532  76.084  1.175   1.00 36.19  ? 374  TRP A CD1 1 
ATOM   2712  C  CD2 . TRP A  1 343 ? 21.842  75.427  -0.511  1.00 33.71  ? 374  TRP A CD2 1 
ATOM   2713  N  NE1 . TRP A  1 343 ? 20.006  76.582  0.009   1.00 36.29  ? 374  TRP A NE1 1 
ATOM   2714  C  CE2 . TRP A  1 343 ? 20.786  76.190  -1.041  1.00 33.85  ? 374  TRP A CE2 1 
ATOM   2715  C  CE3 . TRP A  1 343 ? 22.784  74.902  -1.391  1.00 33.69  ? 374  TRP A CE3 1 
ATOM   2716  C  CZ2 . TRP A  1 343 ? 20.651  76.440  -2.399  1.00 33.56  ? 374  TRP A CZ2 1 
ATOM   2717  C  CZ3 . TRP A  1 343 ? 22.657  75.153  -2.741  1.00 32.38  ? 374  TRP A CZ3 1 
ATOM   2718  C  CH2 . TRP A  1 343 ? 21.593  75.915  -3.232  1.00 33.10  ? 374  TRP A CH2 1 
ATOM   2719  N  N   . CYS A  1 344 ? 25.031  75.853  1.045   1.00 40.92  ? 375  CYS A N   1 
ATOM   2720  C  CA  . CYS A  1 344 ? 25.616  76.528  -0.136  1.00 42.44  ? 375  CYS A CA  1 
ATOM   2721  C  C   . CYS A  1 344 ? 26.063  75.479  -1.169  1.00 43.38  ? 375  CYS A C   1 
ATOM   2722  O  O   . CYS A  1 344 ? 26.159  74.287  -0.880  1.00 43.90  ? 375  CYS A O   1 
ATOM   2723  C  CB  . CYS A  1 344 ? 26.950  77.083  0.434   1.00 41.76  ? 375  CYS A CB  1 
ATOM   2724  S  SG  . CYS A  1 344 ? 28.081  75.647  0.390   1.00 43.06  ? 375  CYS A SG  1 
ATOM   2725  N  N   . ALA A  1 345 ? 26.398  75.956  -2.357  1.00 44.62  ? 376  ALA A N   1 
ATOM   2726  C  CA  . ALA A  1 345 ? 26.817  74.999  -3.390  1.00 46.83  ? 376  ALA A CA  1 
ATOM   2727  C  C   . ALA A  1 345 ? 28.307  74.756  -3.265  1.00 48.70  ? 376  ALA A C   1 
ATOM   2728  O  O   . ALA A  1 345 ? 29.081  75.690  -3.051  1.00 49.06  ? 376  ALA A O   1 
ATOM   2729  C  CB  . ALA A  1 345 ? 26.447  75.567  -4.749  1.00 47.28  ? 376  ALA A CB  1 
ATOM   2730  N  N   . THR A  1 346 ? 28.732  73.506  -3.422  1.00 50.45  ? 377  THR A N   1 
ATOM   2731  C  CA  . THR A  1 346 ? 30.166  73.234  -3.319  1.00 53.43  ? 377  THR A CA  1 
ATOM   2732  C  C   . THR A  1 346 ? 30.802  73.224  -4.695  1.00 56.35  ? 377  THR A C   1 
ATOM   2733  O  O   . THR A  1 346 ? 31.934  72.794  -4.902  1.00 58.54  ? 377  THR A O   1 
ATOM   2734  C  CB  . THR A  1 346 ? 30.424  71.933  -2.550  1.00 53.08  ? 377  THR A CB  1 
ATOM   2735  O  OG1 . THR A  1 346 ? 29.725  70.892  -3.228  1.00 51.84  ? 377  THR A OG1 1 
ATOM   2736  C  CG2 . THR A  1 346 ? 29.888  72.039  -1.127  1.00 53.85  ? 377  THR A CG2 1 
ATOM   2737  N  N   . THR A  1 347 ? 30.050  73.763  -5.643  1.00 58.93  ? 378  THR A N   1 
ATOM   2738  C  CA  . THR A  1 347 ? 30.619  74.148  -6.960  1.00 61.80  ? 378  THR A CA  1 
ATOM   2739  C  C   . THR A  1 347 ? 30.194  75.555  -7.411  1.00 64.06  ? 378  THR A C   1 
ATOM   2740  O  O   . THR A  1 347 ? 29.198  76.097  -6.931  1.00 64.30  ? 378  THR A O   1 
ATOM   2741  C  CB  . THR A  1 347 ? 30.088  73.052  -7.893  1.00 62.31  ? 378  THR A CB  1 
ATOM   2742  O  OG1 . THR A  1 347 ? 30.985  72.884  -8.998  1.00 61.80  ? 378  THR A OG1 1 
ATOM   2743  C  CG2 . THR A  1 347 ? 28.703  73.415  -8.407  1.00 62.52  ? 378  THR A CG2 1 
ATOM   2744  N  N   . ALA A  1 348 ? 30.966  76.120  -8.352  1.00 66.49  ? 379  ALA A N   1 
ATOM   2745  C  CA  . ALA A  1 348 ? 30.714  77.463  -8.896  1.00 68.80  ? 379  ALA A CA  1 
ATOM   2746  C  C   . ALA A  1 348 ? 29.223  77.790  -8.941  1.00 70.57  ? 379  ALA A C   1 
ATOM   2747  O  O   . ALA A  1 348 ? 28.727  78.603  -8.168  1.00 70.13  ? 379  ALA A O   1 
ATOM   2748  C  CB  . ALA A  1 348 ? 31.327  77.597  -10.282 1.00 68.55  ? 379  ALA A CB  1 
ATOM   2749  N  N   . ASN A  1 349 ? 28.491  77.176  -9.859  1.00 72.60  ? 380  ASN A N   1 
ATOM   2750  C  CA  . ASN A  1 349 ? 27.049  77.388  -9.928  1.00 74.64  ? 380  ASN A CA  1 
ATOM   2751  C  C   . ASN A  1 349 ? 26.347  76.064  -9.653  1.00 75.57  ? 380  ASN A C   1 
ATOM   2752  O  O   . ASN A  1 349 ? 26.817  75.007  -10.066 1.00 75.49  ? 380  ASN A O   1 
ATOM   2753  C  CB  . ASN A  1 349 ? 26.663  78.025  -11.266 1.00 76.23  ? 380  ASN A CB  1 
ATOM   2754  C  CG  . ASN A  1 349 ? 25.824  77.114  -12.134 1.00 78.57  ? 380  ASN A CG  1 
ATOM   2755  O  OD1 . ASN A  1 349 ? 26.359  76.347  -12.934 1.00 80.70  ? 380  ASN A OD1 1 
ATOM   2756  N  ND2 . ASN A  1 349 ? 24.508  77.197  -11.983 1.00 78.08  ? 380  ASN A ND2 1 
ATOM   2757  N  N   . TYR A  1 350 ? 25.225  76.105  -8.951  1.00 76.24  ? 381  TYR A N   1 
ATOM   2758  C  CA  . TYR A  1 350 ? 24.529  74.875  -8.576  1.00 76.85  ? 381  TYR A CA  1 
ATOM   2759  C  C   . TYR A  1 350 ? 23.767  74.246  -9.746  1.00 77.04  ? 381  TYR A C   1 
ATOM   2760  O  O   . TYR A  1 350 ? 23.884  73.048  -10.003 1.00 76.47  ? 381  TYR A O   1 
ATOM   2761  C  CB  . TYR A  1 350 ? 23.594  75.152  -7.397  1.00 77.49  ? 381  TYR A CB  1 
ATOM   2762  C  CG  . TYR A  1 350 ? 22.580  74.064  -7.115  1.00 78.05  ? 381  TYR A CG  1 
ATOM   2763  C  CD1 . TYR A  1 350 ? 22.969  72.831  -6.604  1.00 78.42  ? 381  TYR A CD1 1 
ATOM   2764  C  CD2 . TYR A  1 350 ? 21.230  74.276  -7.353  1.00 77.82  ? 381  TYR A CD2 1 
ATOM   2765  C  CE1 . TYR A  1 350 ? 22.038  71.843  -6.335  1.00 78.02  ? 381  TYR A CE1 1 
ATOM   2766  C  CE2 . TYR A  1 350 ? 20.292  73.297  -7.087  1.00 78.53  ? 381  TYR A CE2 1 
ATOM   2767  C  CZ  . TYR A  1 350 ? 20.701  72.083  -6.577  1.00 78.12  ? 381  TYR A CZ  1 
ATOM   2768  O  OH  . TYR A  1 350 ? 19.767  71.108  -6.309  1.00 77.80  ? 381  TYR A OH  1 
ATOM   2769  N  N   . ASP A  1 351 ? 22.988  75.053  -10.452 1.00 77.12  ? 382  ASP A N   1 
ATOM   2770  C  CA  . ASP A  1 351 ? 22.175  74.566  -11.565 1.00 76.86  ? 382  ASP A CA  1 
ATOM   2771  C  C   . ASP A  1 351 ? 22.942  73.621  -12.492 1.00 77.74  ? 382  ASP A C   1 
ATOM   2772  O  O   . ASP A  1 351 ? 22.446  72.554  -12.856 1.00 77.75  ? 382  ASP A O   1 
ATOM   2773  C  CB  . ASP A  1 351 ? 21.612  75.741  -12.363 1.00 75.26  ? 382  ASP A CB  1 
ATOM   2774  C  CG  . ASP A  1 351 ? 20.686  76.604  -11.530 1.00 74.08  ? 382  ASP A CG  1 
ATOM   2775  O  OD1 . ASP A  1 351 ? 19.842  76.039  -10.803 1.00 72.73  ? 382  ASP A OD1 1 
ATOM   2776  O  OD2 . ASP A  1 351 ? 20.805  77.845  -11.603 1.00 73.28  ? 382  ASP A OD2 1 
ATOM   2777  N  N   . ASP A  1 352 ? 24.151  74.006  -12.879 1.00 79.10  ? 383  ASP A N   1 
ATOM   2778  C  CA  . ASP A  1 352 ? 24.957  73.195  -13.789 1.00 80.78  ? 383  ASP A CA  1 
ATOM   2779  C  C   . ASP A  1 352 ? 25.394  71.875  -13.164 1.00 80.98  ? 383  ASP A C   1 
ATOM   2780  O  O   . ASP A  1 352 ? 25.272  70.829  -13.807 1.00 82.34  ? 383  ASP A O   1 
ATOM   2781  C  CB  . ASP A  1 352 ? 26.197  73.968  -14.244 1.00 82.75  ? 383  ASP A CB  1 
ATOM   2782  C  CG  . ASP A  1 352 ? 25.906  74.929  -15.379 1.00 84.83  ? 383  ASP A CG  1 
ATOM   2783  O  OD1 . ASP A  1 352 ? 24.988  75.762  -15.230 1.00 85.12  ? 383  ASP A OD1 1 
ATOM   2784  O  OD2 . ASP A  1 352 ? 26.596  74.848  -16.417 1.00 86.06  ? 383  ASP A OD2 1 
ATOM   2785  N  N   . ASP A  1 353 ? 25.953  71.929  -11.960 1.00 80.01  ? 384  ASP A N   1 
ATOM   2786  C  CA  . ASP A  1 353 ? 26.520  70.764  -11.309 1.00 78.72  ? 384  ASP A CA  1 
ATOM   2787  C  C   . ASP A  1 353 ? 25.629  70.087  -10.288 1.00 76.67  ? 384  ASP A C   1 
ATOM   2788  O  O   . ASP A  1 353 ? 25.708  68.866  -10.106 1.00 74.86  ? 384  ASP A O   1 
ATOM   2789  C  CB  . ASP A  1 353 ? 27.870  71.121  -10.673 1.00 80.98  ? 384  ASP A CB  1 
ATOM   2790  C  CG  . ASP A  1 353 ? 28.792  71.836  -11.642 1.00 82.62  ? 384  ASP A CG  1 
ATOM   2791  O  OD1 . ASP A  1 353 ? 28.398  72.905  -12.155 1.00 83.31  ? 384  ASP A OD1 1 
ATOM   2792  O  OD2 . ASP A  1 353 ? 29.910  71.339  -11.896 1.00 83.53  ? 384  ASP A OD2 1 
ATOM   2793  N  N   . ARG A  1 354 ? 24.813  70.852  -9.581  1.00 74.49  ? 385  ARG A N   1 
ATOM   2794  C  CA  . ARG A  1 354 ? 23.890  70.333  -8.593  1.00 72.18  ? 385  ARG A CA  1 
ATOM   2795  C  C   . ARG A  1 354 ? 24.569  69.550  -7.477  1.00 68.32  ? 385  ARG A C   1 
ATOM   2796  O  O   . ARG A  1 354 ? 24.114  68.476  -7.089  1.00 68.63  ? 385  ARG A O   1 
ATOM   2797  C  CB  . ARG A  1 354 ? 22.774  69.521  -9.244  1.00 75.15  ? 385  ARG A CB  1 
ATOM   2798  C  CG  . ARG A  1 354 ? 22.135  70.161  -10.461 1.00 80.40  ? 385  ARG A CG  1 
ATOM   2799  C  CD  . ARG A  1 354 ? 20.756  70.727  -10.184 1.00 84.60  ? 385  ARG A CD  1 
ATOM   2800  N  NE  . ARG A  1 354 ? 20.447  71.892  -11.012 1.00 88.74  ? 385  ARG A NE  1 
ATOM   2801  C  CZ  . ARG A  1 354 ? 19.230  72.380  -11.209 1.00 90.14  ? 385  ARG A CZ  1 
ATOM   2802  N  NH1 . ARG A  1 354 ? 18.181  71.800  -10.637 1.00 91.22  ? 385  ARG A NH1 1 
ATOM   2803  N  NH2 . ARG A  1 354 ? 19.043  73.447  -11.975 1.00 90.65  ? 385  ARG A NH2 1 
ATOM   2804  N  N   . LYS A  1 355 ? 25.627  70.122  -6.932  1.00 62.77  ? 386  LYS A N   1 
ATOM   2805  C  CA  . LYS A  1 355 ? 26.403  69.594  -5.821  1.00 56.47  ? 386  LYS A CA  1 
ATOM   2806  C  C   . LYS A  1 355 ? 26.351  70.602  -4.663  1.00 53.05  ? 386  LYS A C   1 
ATOM   2807  O  O   . LYS A  1 355 ? 26.805  71.736  -4.851  1.00 52.83  ? 386  LYS A O   1 
ATOM   2808  C  CB  . LYS A  1 355 ? 27.860  69.393  -6.246  1.00 56.24  ? 386  LYS A CB  1 
ATOM   2809  C  CG  . LYS A  1 355 ? 28.212  68.048  -6.841  1.00 55.75  ? 386  LYS A CG  1 
ATOM   2810  C  CD  . LYS A  1 355 ? 29.616  68.042  -7.432  1.00 58.12  ? 386  LYS A CD  1 
ATOM   2811  C  CE  . LYS A  1 355 ? 30.703  68.042  -6.377  1.00 58.82  ? 386  LYS A CE  1 
ATOM   2812  N  NZ  . LYS A  1 355 ? 31.942  68.754  -6.795  1.00 57.99  ? 386  LYS A NZ  1 
ATOM   2813  N  N   . TRP A  1 356 ? 25.788  70.209  -3.530  1.00 48.28  ? 387  TRP A N   1 
ATOM   2814  C  CA  . TRP A  1 356 ? 25.633  71.112  -2.395  1.00 43.52  ? 387  TRP A CA  1 
ATOM   2815  C  C   . TRP A  1 356 ? 26.103  70.487  -1.089  1.00 39.77  ? 387  TRP A C   1 
ATOM   2816  O  O   . TRP A  1 356 ? 26.517  69.334  -1.054  1.00 40.12  ? 387  TRP A O   1 
ATOM   2817  C  CB  . TRP A  1 356 ? 24.144  71.510  -2.225  1.00 41.91  ? 387  TRP A CB  1 
ATOM   2818  C  CG  . TRP A  1 356 ? 23.300  70.321  -1.878  1.00 40.35  ? 387  TRP A CG  1 
ATOM   2819  C  CD1 . TRP A  1 356 ? 22.969  69.310  -2.733  1.00 40.60  ? 387  TRP A CD1 1 
ATOM   2820  C  CD2 . TRP A  1 356 ? 22.706  69.991  -0.625  1.00 39.25  ? 387  TRP A CD2 1 
ATOM   2821  N  NE1 . TRP A  1 356 ? 22.207  68.368  -2.092  1.00 38.82  ? 387  TRP A NE1 1 
ATOM   2822  C  CE2 . TRP A  1 356 ? 22.031  68.764  -0.796  1.00 37.91  ? 387  TRP A CE2 1 
ATOM   2823  C  CE3 . TRP A  1 356 ? 22.677  70.608  0.630   1.00 38.98  ? 387  TRP A CE3 1 
ATOM   2824  C  CZ2 . TRP A  1 356 ? 21.338  68.148  0.239   1.00 36.42  ? 387  TRP A CZ2 1 
ATOM   2825  C  CZ3 . TRP A  1 356 ? 21.991  69.998  1.664   1.00 36.50  ? 387  TRP A CZ3 1 
ATOM   2826  C  CH2 . TRP A  1 356 ? 21.349  68.782  1.444   1.00 37.20  ? 387  TRP A CH2 1 
ATOM   2827  N  N   . GLY A  1 357 ? 26.016  71.260  -0.017  1.00 35.85  ? 388  GLY A N   1 
ATOM   2828  C  CA  . GLY A  1 357 ? 26.318  70.766  1.321   1.00 34.01  ? 388  GLY A CA  1 
ATOM   2829  C  C   . GLY A  1 357 ? 25.762  71.715  2.370   1.00 33.53  ? 388  GLY A C   1 
ATOM   2830  O  O   . GLY A  1 357 ? 25.508  72.887  2.077   1.00 34.46  ? 388  GLY A O   1 
ATOM   2831  N  N   . PHE A  1 358 ? 25.522  71.265  3.590   1.00 33.97  ? 389  PHE A N   1 
ATOM   2832  C  CA  . PHE A  1 358 ? 25.061  72.186  4.625   1.00 34.00  ? 389  PHE A CA  1 
ATOM   2833  C  C   . PHE A  1 358 ? 26.262  72.944  5.199   1.00 36.13  ? 389  PHE A C   1 
ATOM   2834  O  O   . PHE A  1 358 ? 27.342  72.381  5.333   1.00 39.07  ? 389  PHE A O   1 
ATOM   2835  C  CB  . PHE A  1 358 ? 24.388  71.450  5.770   1.00 32.37  ? 389  PHE A CB  1 
ATOM   2836  C  CG  . PHE A  1 358 ? 23.018  70.943  5.430   1.00 31.45  ? 389  PHE A CG  1 
ATOM   2837  C  CD1 . PHE A  1 358 ? 22.079  71.794  4.885   1.00 31.53  ? 389  PHE A CD1 1 
ATOM   2838  C  CD2 . PHE A  1 358 ? 22.681  69.634  5.688   1.00 30.82  ? 389  PHE A CD2 1 
ATOM   2839  C  CE1 . PHE A  1 358 ? 20.812  71.344  4.574   1.00 29.52  ? 389  PHE A CE1 1 
ATOM   2840  C  CE2 . PHE A  1 358 ? 21.414  69.184  5.381   1.00 31.93  ? 389  PHE A CE2 1 
ATOM   2841  C  CZ  . PHE A  1 358 ? 20.488  70.031  4.823   1.00 30.72  ? 389  PHE A CZ  1 
ATOM   2842  N  N   . CYS A  1 359 ? 26.031  74.209  5.482   1.00 37.42  ? 390  CYS A N   1 
ATOM   2843  C  CA  . CYS A  1 359 ? 27.072  75.041  6.093   1.00 37.59  ? 390  CYS A CA  1 
ATOM   2844  C  C   . CYS A  1 359 ? 27.063  74.751  7.579   1.00 35.88  ? 390  CYS A C   1 
ATOM   2845  O  O   . CYS A  1 359 ? 26.004  74.662  8.209   1.00 36.02  ? 390  CYS A O   1 
ATOM   2846  C  CB  . CYS A  1 359 ? 26.739  76.505  5.792   1.00 40.95  ? 390  CYS A CB  1 
ATOM   2847  S  SG  . CYS A  1 359 ? 26.872  76.852  4.005   1.00 46.41  ? 390  CYS A SG  1 
ATOM   2848  N  N   . PRO A  1 360 ? 28.202  74.432  8.160   1.00 34.91  ? 391  PRO A N   1 
ATOM   2849  C  CA  . PRO A  1 360 ? 28.215  74.101  9.589   1.00 33.49  ? 391  PRO A CA  1 
ATOM   2850  C  C   . PRO A  1 360 ? 27.414  75.140  10.360  1.00 32.69  ? 391  PRO A C   1 
ATOM   2851  O  O   . PRO A  1 360 ? 27.536  76.326  10.070  1.00 33.30  ? 391  PRO A O   1 
ATOM   2852  C  CB  . PRO A  1 360 ? 29.687  74.133  9.936   1.00 33.68  ? 391  PRO A CB  1 
ATOM   2853  C  CG  . PRO A  1 360 ? 30.371  73.783  8.654   1.00 34.94  ? 391  PRO A CG  1 
ATOM   2854  C  CD  . PRO A  1 360 ? 29.545  74.396  7.555   1.00 34.81  ? 391  PRO A CD  1 
ATOM   2855  N  N   . ASP A  1 361 ? 26.584  74.697  11.279  1.00 33.09  ? 392  ASP A N   1 
ATOM   2856  C  CA  . ASP A  1 361 ? 25.727  75.547  12.092  1.00 31.10  ? 392  ASP A CA  1 
ATOM   2857  C  C   . ASP A  1 361 ? 26.319  75.847  13.457  1.00 29.17  ? 392  ASP A C   1 
ATOM   2858  O  O   . ASP A  1 361 ? 27.529  75.938  13.655  1.00 30.30  ? 392  ASP A O   1 
ATOM   2859  C  CB  . ASP A  1 361 ? 24.352  74.893  12.248  1.00 32.41  ? 392  ASP A CB  1 
ATOM   2860  C  CG  . ASP A  1 361 ? 24.392  73.566  12.971  1.00 34.13  ? 392  ASP A CG  1 
ATOM   2861  O  OD1 . ASP A  1 361 ? 25.461  72.932  13.063  1.00 35.12  ? 392  ASP A OD1 1 
ATOM   2862  O  OD2 . ASP A  1 361 ? 23.310  73.151  13.455  1.00 34.92  ? 392  ASP A OD2 1 
ATOM   2863  N  N   . GLN A  1 362 ? 25.467  76.001  14.471  1.00 26.95  ? 393  GLN A N   1 
ATOM   2864  C  CA  . GLN A  1 362 ? 25.955  76.336  15.807  1.00 26.48  ? 393  GLN A CA  1 
ATOM   2865  C  C   . GLN A  1 362 ? 26.441  75.141  16.593  1.00 25.12  ? 393  GLN A C   1 
ATOM   2866  O  O   . GLN A  1 362 ? 27.163  75.285  17.574  1.00 25.76  ? 393  GLN A O   1 
ATOM   2867  C  CB  . GLN A  1 362 ? 24.841  77.060  16.580  1.00 28.45  ? 393  GLN A CB  1 
ATOM   2868  C  CG  . GLN A  1 362 ? 24.692  78.513  16.162  1.00 31.50  ? 393  GLN A CG  1 
ATOM   2869  C  CD  . GLN A  1 362 ? 25.769  79.406  16.735  1.00 34.13  ? 393  GLN A CD  1 
ATOM   2870  O  OE1 . GLN A  1 362 ? 25.819  79.622  17.949  1.00 35.48  ? 393  GLN A OE1 1 
ATOM   2871  N  NE2 . GLN A  1 362 ? 26.623  79.923  15.857  1.00 35.13  ? 393  GLN A NE2 1 
ATOM   2872  N  N   . GLY A  1 363 ? 26.058  73.934  16.179  1.00 23.13  ? 394  GLY A N   1 
ATOM   2873  C  CA  . GLY A  1 363 ? 26.425  72.734  16.913  1.00 20.75  ? 394  GLY A CA  1 
ATOM   2874  C  C   . GLY A  1 363 ? 26.043  72.776  18.391  1.00 19.79  ? 394  GLY A C   1 
ATOM   2875  O  O   . GLY A  1 363 ? 25.320  73.680  18.799  1.00 19.49  ? 394  GLY A O   1 
ATOM   2876  N  N   . TYR A  1 364 ? 26.447  71.780  19.142  1.00 18.81  ? 395  TYR A N   1 
ATOM   2877  C  CA  . TYR A  1 364 ? 26.069  71.596  20.530  1.00 18.68  ? 395  TYR A CA  1 
ATOM   2878  C  C   . TYR A  1 364 ? 27.241  71.684  21.487  1.00 17.74  ? 395  TYR A C   1 
ATOM   2879  O  O   . TYR A  1 364 ? 28.192  70.910  21.393  1.00 20.67  ? 395  TYR A O   1 
ATOM   2880  C  CB  . TYR A  1 364 ? 25.361  70.241  20.628  1.00 18.09  ? 395  TYR A CB  1 
ATOM   2881  C  CG  . TYR A  1 364 ? 24.158  70.130  19.713  1.00 18.71  ? 395  TYR A CG  1 
ATOM   2882  C  CD1 . TYR A  1 364 ? 23.016  70.888  19.940  1.00 20.01  ? 395  TYR A CD1 1 
ATOM   2883  C  CD2 . TYR A  1 364 ? 24.164  69.274  18.618  1.00 20.35  ? 395  TYR A CD2 1 
ATOM   2884  C  CE1 . TYR A  1 364 ? 21.917  70.796  19.106  1.00 21.60  ? 395  TYR A CE1 1 
ATOM   2885  C  CE2 . TYR A  1 364 ? 23.070  69.176  17.779  1.00 21.48  ? 395  TYR A CE2 1 
ATOM   2886  C  CZ  . TYR A  1 364 ? 21.950  69.939  18.027  1.00 22.15  ? 395  TYR A CZ  1 
ATOM   2887  O  OH  . TYR A  1 364 ? 20.859  69.843  17.194  1.00 21.20  ? 395  TYR A OH  1 
ATOM   2888  N  N   . SER A  1 365 ? 27.150  72.630  22.413  1.00 16.10  ? 396  SER A N   1 
ATOM   2889  C  CA  . SER A  1 365 ? 28.184  72.810  23.411  1.00 16.65  ? 396  SER A CA  1 
ATOM   2890  C  C   . SER A  1 365 ? 28.392  71.519  24.195  1.00 18.15  ? 396  SER A C   1 
ATOM   2891  O  O   . SER A  1 365 ? 27.524  71.116  24.976  1.00 20.17  ? 396  SER A O   1 
ATOM   2892  C  CB  . SER A  1 365 ? 27.834  73.978  24.334  1.00 15.91  ? 396  SER A CB  1 
ATOM   2893  O  OG  . SER A  1 365 ? 28.159  73.682  25.680  1.00 16.10  ? 396  SER A OG  1 
ATOM   2894  N  N   . LEU A  1 366 ? 29.542  70.897  23.955  1.00 18.52  ? 397  LEU A N   1 
ATOM   2895  C  CA  . LEU A  1 366 ? 29.914  69.655  24.621  1.00 17.65  ? 397  LEU A CA  1 
ATOM   2896  C  C   . LEU A  1 366 ? 29.885  69.834  26.127  1.00 18.07  ? 397  LEU A C   1 
ATOM   2897  O  O   . LEU A  1 366 ? 29.544  68.909  26.867  1.00 18.35  ? 397  LEU A O   1 
ATOM   2898  C  CB  . LEU A  1 366 ? 31.296  69.208  24.135  1.00 18.56  ? 397  LEU A CB  1 
ATOM   2899  C  CG  . LEU A  1 366 ? 31.871  67.930  24.747  1.00 19.42  ? 397  LEU A CG  1 
ATOM   2900  C  CD1 . LEU A  1 366 ? 30.845  66.810  24.720  1.00 18.76  ? 397  LEU A CD1 1 
ATOM   2901  C  CD2 . LEU A  1 366 ? 33.139  67.511  24.016  1.00 16.81  ? 397  LEU A CD2 1 
ATOM   2902  N  N   . PHE A  1 367 ? 30.251  71.031  26.571  1.00 18.38  ? 398  PHE A N   1 
ATOM   2903  C  CA  . PHE A  1 367 ? 30.219  71.326  27.986  1.00 19.81  ? 398  PHE A CA  1 
ATOM   2904  C  C   . PHE A  1 367 ? 28.797  71.156  28.525  1.00 20.91  ? 398  PHE A C   1 
ATOM   2905  O  O   . PHE A  1 367 ? 28.568  70.332  29.399  1.00 23.06  ? 398  PHE A O   1 
ATOM   2906  C  CB  . PHE A  1 367 ? 30.706  72.744  28.282  1.00 19.16  ? 398  PHE A CB  1 
ATOM   2907  C  CG  . PHE A  1 367 ? 30.318  73.221  29.655  1.00 18.42  ? 398  PHE A CG  1 
ATOM   2908  C  CD1 . PHE A  1 367 ? 30.977  72.746  30.777  1.00 20.14  ? 398  PHE A CD1 1 
ATOM   2909  C  CD2 . PHE A  1 367 ? 29.292  74.136  29.827  1.00 18.60  ? 398  PHE A CD2 1 
ATOM   2910  C  CE1 . PHE A  1 367 ? 30.623  73.174  32.042  1.00 20.26  ? 398  PHE A CE1 1 
ATOM   2911  C  CE2 . PHE A  1 367 ? 28.933  74.569  31.091  1.00 17.48  ? 398  PHE A CE2 1 
ATOM   2912  C  CZ  . PHE A  1 367 ? 29.600  74.087  32.200  1.00 17.63  ? 398  PHE A CZ  1 
ATOM   2913  N  N   . LEU A  1 368 ? 27.859  71.927  27.976  1.00 20.90  ? 399  LEU A N   1 
ATOM   2914  C  CA  . LEU A  1 368 ? 26.493  71.794  28.436  1.00 21.86  ? 399  LEU A CA  1 
ATOM   2915  C  C   . LEU A  1 368 ? 25.956  70.380  28.285  1.00 23.10  ? 399  LEU A C   1 
ATOM   2916  O  O   . LEU A  1 368 ? 25.396  69.867  29.250  1.00 23.80  ? 399  LEU A O   1 
ATOM   2917  C  CB  . LEU A  1 368 ? 25.572  72.772  27.706  1.00 20.82  ? 399  LEU A CB  1 
ATOM   2918  C  CG  . LEU A  1 368 ? 25.935  74.232  27.973  1.00 21.88  ? 399  LEU A CG  1 
ATOM   2919  C  CD1 . LEU A  1 368 ? 25.050  75.185  27.185  1.00 21.81  ? 399  LEU A CD1 1 
ATOM   2920  C  CD2 . LEU A  1 368 ? 25.806  74.539  29.455  1.00 21.36  ? 399  LEU A CD2 1 
ATOM   2921  N  N   . VAL A  1 369 ? 26.065  69.791  27.114  1.00 23.52  ? 400  VAL A N   1 
ATOM   2922  C  CA  . VAL A  1 369 ? 25.517  68.462  26.859  1.00 23.54  ? 400  VAL A CA  1 
ATOM   2923  C  C   . VAL A  1 369 ? 26.157  67.440  27.784  1.00 24.25  ? 400  VAL A C   1 
ATOM   2924  O  O   . VAL A  1 369 ? 25.491  66.542  28.298  1.00 24.64  ? 400  VAL A O   1 
ATOM   2925  C  CB  . VAL A  1 369 ? 25.631  68.015  25.396  1.00 22.35  ? 400  VAL A CB  1 
ATOM   2926  C  CG1 . VAL A  1 369 ? 25.484  66.510  25.250  1.00 20.03  ? 400  VAL A CG1 1 
ATOM   2927  C  CG2 . VAL A  1 369 ? 24.526  68.691  24.562  1.00 22.68  ? 400  VAL A CG2 1 
ATOM   2928  N  N   . ALA A  1 370 ? 27.449  67.613  28.043  1.00 24.40  ? 401  ALA A N   1 
ATOM   2929  C  CA  . ALA A  1 370 ? 28.167  66.682  28.909  1.00 25.02  ? 401  ALA A CA  1 
ATOM   2930  C  C   . ALA A  1 370 ? 27.748  66.882  30.356  1.00 25.04  ? 401  ALA A C   1 
ATOM   2931  O  O   . ALA A  1 370 ? 27.379  65.952  31.056  1.00 26.15  ? 401  ALA A O   1 
ATOM   2932  C  CB  . ALA A  1 370 ? 29.649  66.844  28.697  1.00 23.75  ? 401  ALA A CB  1 
ATOM   2933  N  N   . ALA A  1 371 ? 27.760  68.146  30.777  1.00 24.16  ? 402  ALA A N   1 
ATOM   2934  C  CA  . ALA A  1 371 ? 27.387  68.448  32.160  1.00 23.37  ? 402  ALA A CA  1 
ATOM   2935  C  C   . ALA A  1 371 ? 26.115  67.669  32.505  1.00 23.75  ? 402  ALA A C   1 
ATOM   2936  O  O   . ALA A  1 371 ? 26.008  66.969  33.495  1.00 22.30  ? 402  ALA A O   1 
ATOM   2937  C  CB  . ALA A  1 371 ? 27.284  69.934  32.395  1.00 21.34  ? 402  ALA A CB  1 
ATOM   2938  N  N   . HIS A  1 372 ? 25.136  67.826  31.617  1.00 25.19  ? 403  HIS A N   1 
ATOM   2939  C  CA  . HIS A  1 372 ? 23.864  67.155  31.709  1.00 26.60  ? 403  HIS A CA  1 
ATOM   2940  C  C   . HIS A  1 372 ? 24.047  65.643  31.773  1.00 26.54  ? 403  HIS A C   1 
ATOM   2941  O  O   . HIS A  1 372 ? 23.653  65.035  32.765  1.00 27.64  ? 403  HIS A O   1 
ATOM   2942  C  CB  . HIS A  1 372 ? 23.017  67.463  30.460  1.00 30.09  ? 403  HIS A CB  1 
ATOM   2943  C  CG  . HIS A  1 372 ? 21.591  67.024  30.346  1.00 34.18  ? 403  HIS A CG  1 
ATOM   2944  N  ND1 . HIS A  1 372 ? 20.545  67.914  30.323  1.00 37.46  ? 403  HIS A ND1 1 
ATOM   2945  C  CD2 . HIS A  1 372 ? 21.042  65.787  30.253  1.00 34.09  ? 403  HIS A CD2 1 
ATOM   2946  C  CE1 . HIS A  1 372 ? 19.410  67.247  30.228  1.00 38.29  ? 403  HIS A CE1 1 
ATOM   2947  N  NE2 . HIS A  1 372 ? 19.685  65.956  30.181  1.00 34.11  ? 403  HIS A NE2 1 
ATOM   2948  N  N   . GLN A  1 373 ? 24.650  65.058  30.738  1.00 25.85  ? 404  GLN A N   1 
ATOM   2949  C  CA  . GLN A  1 373 ? 24.902  63.627  30.735  1.00 25.40  ? 404  GLN A CA  1 
ATOM   2950  C  C   . GLN A  1 373 ? 25.493  63.123  32.034  1.00 24.57  ? 404  GLN A C   1 
ATOM   2951  O  O   . GLN A  1 373 ? 25.102  62.089  32.571  1.00 26.28  ? 404  GLN A O   1 
ATOM   2952  C  CB  . GLN A  1 373 ? 25.827  63.206  29.584  1.00 26.23  ? 404  GLN A CB  1 
ATOM   2953  C  CG  . GLN A  1 373 ? 25.170  63.349  28.223  1.00 27.65  ? 404  GLN A CG  1 
ATOM   2954  C  CD  . GLN A  1 373 ? 23.791  62.734  28.183  1.00 28.67  ? 404  GLN A CD  1 
ATOM   2955  O  OE1 . GLN A  1 373 ? 23.582  61.645  28.695  1.00 28.38  ? 404  GLN A OE1 1 
ATOM   2956  N  NE2 . GLN A  1 373 ? 22.840  63.444  27.594  1.00 28.72  ? 404  GLN A NE2 1 
ATOM   2957  N  N   . PHE A  1 374 ? 26.412  63.874  32.612  1.00 24.25  ? 405  PHE A N   1 
ATOM   2958  C  CA  . PHE A  1 374 ? 27.006  63.497  33.881  1.00 23.94  ? 405  PHE A CA  1 
ATOM   2959  C  C   . PHE A  1 374 ? 26.032  63.616  35.032  1.00 22.30  ? 405  PHE A C   1 
ATOM   2960  O  O   . PHE A  1 374 ? 26.171  62.953  36.061  1.00 21.69  ? 405  PHE A O   1 
ATOM   2961  C  CB  . PHE A  1 374 ? 28.291  64.285  34.163  1.00 25.95  ? 405  PHE A CB  1 
ATOM   2962  C  CG  . PHE A  1 374 ? 29.332  64.128  33.096  1.00 28.07  ? 405  PHE A CG  1 
ATOM   2963  C  CD1 . PHE A  1 374 ? 29.347  62.981  32.298  1.00 29.80  ? 405  PHE A CD1 1 
ATOM   2964  C  CD2 . PHE A  1 374 ? 30.273  65.090  32.845  1.00 29.97  ? 405  PHE A CD2 1 
ATOM   2965  C  CE1 . PHE A  1 374 ? 30.268  62.814  31.293  1.00 31.46  ? 405  PHE A CE1 1 
ATOM   2966  C  CE2 . PHE A  1 374 ? 31.216  64.925  31.853  1.00 33.75  ? 405  PHE A CE2 1 
ATOM   2967  C  CZ  . PHE A  1 374 ? 31.224  63.783  31.075  1.00 33.87  ? 405  PHE A CZ  1 
ATOM   2968  N  N   . GLY A  1 375 ? 25.019  64.461  34.866  1.00 22.19  ? 406  GLY A N   1 
ATOM   2969  C  CA  . GLY A  1 375 ? 24.029  64.598  35.927  1.00 22.77  ? 406  GLY A CA  1 
ATOM   2970  C  C   . GLY A  1 375 ? 23.380  63.220  36.080  1.00 24.78  ? 406  GLY A C   1 
ATOM   2971  O  O   . GLY A  1 375 ? 23.127  62.788  37.196  1.00 26.67  ? 406  GLY A O   1 
ATOM   2972  N  N   . HIS A  1 376 ? 23.095  62.575  34.964  1.00 25.77  ? 407  HIS A N   1 
ATOM   2973  C  CA  . HIS A  1 376 ? 22.526  61.236  34.941  1.00 26.71  ? 407  HIS A CA  1 
ATOM   2974  C  C   . HIS A  1 376 ? 23.483  60.228  35.577  1.00 28.72  ? 407  HIS A C   1 
ATOM   2975  O  O   . HIS A  1 376 ? 23.088  59.483  36.465  1.00 28.94  ? 407  HIS A O   1 
ATOM   2976  C  CB  . HIS A  1 376 ? 22.325  60.768  33.491  1.00 27.11  ? 407  HIS A CB  1 
ATOM   2977  C  CG  . HIS A  1 376 ? 21.076  61.293  32.886  1.00 31.14  ? 407  HIS A CG  1 
ATOM   2978  N  ND1 . HIS A  1 376 ? 19.879  61.342  33.554  1.00 34.37  ? 407  HIS A ND1 1 
ATOM   2979  C  CD2 . HIS A  1 376 ? 20.846  61.818  31.662  1.00 33.22  ? 407  HIS A CD2 1 
ATOM   2980  C  CE1 . HIS A  1 376 ? 18.955  61.858  32.768  1.00 34.59  ? 407  HIS A CE1 1 
ATOM   2981  N  NE2 . HIS A  1 376 ? 19.526  62.169  31.644  1.00 32.67  ? 407  HIS A NE2 1 
ATOM   2982  N  N   . ALA A  1 377 ? 24.725  60.222  35.093  1.00 29.29  ? 408  ALA A N   1 
ATOM   2983  C  CA  . ALA A  1 377 ? 25.739  59.320  35.610  1.00 30.22  ? 408  ALA A CA  1 
ATOM   2984  C  C   . ALA A  1 377 ? 25.781  59.375  37.129  1.00 31.89  ? 408  ALA A C   1 
ATOM   2985  O  O   . ALA A  1 377 ? 26.139  58.374  37.748  1.00 36.05  ? 408  ALA A O   1 
ATOM   2986  C  CB  . ALA A  1 377 ? 27.099  59.600  35.020  1.00 27.76  ? 408  ALA A CB  1 
ATOM   2987  N  N   . MET A  1 378 ? 25.402  60.491  37.731  1.00 31.24  ? 409  MET A N   1 
ATOM   2988  C  CA  . MET A  1 378 ? 25.357  60.604  39.181  1.00 31.12  ? 409  MET A CA  1 
ATOM   2989  C  C   . MET A  1 378 ? 24.037  60.068  39.725  1.00 32.27  ? 409  MET A C   1 
ATOM   2990  O  O   . MET A  1 378 ? 23.901  59.786  40.913  1.00 32.07  ? 409  MET A O   1 
ATOM   2991  C  CB  . MET A  1 378 ? 25.579  62.041  39.629  1.00 30.61  ? 409  MET A CB  1 
ATOM   2992  C  CG  . MET A  1 378 ? 26.765  62.734  38.979  1.00 32.63  ? 409  MET A CG  1 
ATOM   2993  S  SD  . MET A  1 378 ? 28.248  61.687  39.011  1.00 33.97  ? 409  MET A SD  1 
ATOM   2994  C  CE  . MET A  1 378 ? 28.323  61.373  40.774  1.00 34.96  ? 409  MET A CE  1 
ATOM   2995  N  N   . GLY A  1 379 ? 23.060  59.894  38.841  1.00 34.05  ? 410  GLY A N   1 
ATOM   2996  C  CA  . GLY A  1 379 ? 21.774  59.338  39.215  1.00 34.83  ? 410  GLY A CA  1 
ATOM   2997  C  C   . GLY A  1 379 ? 20.597  60.224  38.868  1.00 35.71  ? 410  GLY A C   1 
ATOM   2998  O  O   . GLY A  1 379 ? 19.450  59.764  38.893  1.00 37.44  ? 410  GLY A O   1 
ATOM   2999  N  N   . LEU A  1 380 ? 20.820  61.501  38.600  1.00 36.01  ? 411  LEU A N   1 
ATOM   3000  C  CA  . LEU A  1 380 ? 19.712  62.416  38.331  1.00 37.20  ? 411  LEU A CA  1 
ATOM   3001  C  C   . LEU A  1 380 ? 18.934  62.042  37.078  1.00 39.06  ? 411  LEU A C   1 
ATOM   3002  O  O   . LEU A  1 380 ? 19.477  61.476  36.132  1.00 40.49  ? 411  LEU A O   1 
ATOM   3003  C  CB  . LEU A  1 380 ? 20.243  63.844  38.192  1.00 33.60  ? 411  LEU A CB  1 
ATOM   3004  C  CG  . LEU A  1 380 ? 20.933  64.388  39.436  1.00 32.04  ? 411  LEU A CG  1 
ATOM   3005  C  CD1 . LEU A  1 380 ? 21.474  65.791  39.221  1.00 31.17  ? 411  LEU A CD1 1 
ATOM   3006  C  CD2 . LEU A  1 380 ? 19.993  64.355  40.630  1.00 33.42  ? 411  LEU A CD2 1 
ATOM   3007  N  N   . GLU A  1 381 ? 17.644  62.346  37.070  1.00 40.34  ? 412  GLU A N   1 
ATOM   3008  C  CA  . GLU A  1 381 ? 16.746  62.195  35.961  1.00 41.88  ? 412  GLU A CA  1 
ATOM   3009  C  C   . GLU A  1 381 ? 16.180  63.505  35.406  1.00 41.51  ? 412  GLU A C   1 
ATOM   3010  O  O   . GLU A  1 381 ? 16.305  64.566  36.028  1.00 41.43  ? 412  GLU A O   1 
ATOM   3011  C  CB  . GLU A  1 381 ? 15.602  61.281  36.381  1.00 44.99  ? 412  GLU A CB  1 
ATOM   3012  C  CG  . GLU A  1 381 ? 15.943  59.816  36.582  1.00 51.01  ? 412  GLU A CG  1 
ATOM   3013  C  CD  . GLU A  1 381 ? 16.630  59.201  35.380  1.00 54.74  ? 412  GLU A CD  1 
ATOM   3014  O  OE1 . GLU A  1 381 ? 16.114  59.394  34.256  1.00 57.69  ? 412  GLU A OE1 1 
ATOM   3015  O  OE2 . GLU A  1 381 ? 17.681  58.539  35.539  1.00 56.44  ? 412  GLU A OE2 1 
ATOM   3016  N  N   . HIS A  1 382 ? 15.538  63.438  34.246  1.00 40.17  ? 413  HIS A N   1 
ATOM   3017  C  CA  . HIS A  1 382 ? 14.997  64.637  33.635  1.00 39.91  ? 413  HIS A CA  1 
ATOM   3018  C  C   . HIS A  1 382 ? 14.068  65.423  34.543  1.00 39.64  ? 413  HIS A C   1 
ATOM   3019  O  O   . HIS A  1 382 ? 13.218  64.888  35.255  1.00 40.29  ? 413  HIS A O   1 
ATOM   3020  C  CB  . HIS A  1 382 ? 14.250  64.274  32.352  1.00 40.21  ? 413  HIS A CB  1 
ATOM   3021  C  CG  . HIS A  1 382 ? 15.158  63.748  31.292  1.00 40.71  ? 413  HIS A CG  1 
ATOM   3022  N  ND1 . HIS A  1 382 ? 14.687  63.303  30.078  1.00 42.80  ? 413  HIS A ND1 1 
ATOM   3023  C  CD2 . HIS A  1 382 ? 16.498  63.596  31.260  1.00 40.22  ? 413  HIS A CD2 1 
ATOM   3024  C  CE1 . HIS A  1 382 ? 15.701  62.900  29.333  1.00 42.51  ? 413  HIS A CE1 1 
ATOM   3025  N  NE2 . HIS A  1 382 ? 16.792  63.058  30.033  1.00 40.33  ? 413  HIS A NE2 1 
ATOM   3026  N  N   . SER A  1 383 ? 14.175  66.743  34.462  1.00 38.38  ? 414  SER A N   1 
ATOM   3027  C  CA  . SER A  1 383 ? 13.295  67.615  35.222  1.00 37.95  ? 414  SER A CA  1 
ATOM   3028  C  C   . SER A  1 383 ? 12.367  68.287  34.208  1.00 38.27  ? 414  SER A C   1 
ATOM   3029  O  O   . SER A  1 383 ? 12.715  68.391  33.040  1.00 37.69  ? 414  SER A O   1 
ATOM   3030  C  CB  . SER A  1 383 ? 14.091  68.699  35.948  1.00 38.59  ? 414  SER A CB  1 
ATOM   3031  O  OG  . SER A  1 383 ? 14.230  69.834  35.110  1.00 38.93  ? 414  SER A OG  1 
ATOM   3032  N  N   . GLN A  1 384 ? 11.222  68.734  34.699  1.00 38.36  ? 415  GLN A N   1 
ATOM   3033  C  CA  . GLN A  1 384 ? 10.272  69.379  33.803  1.00 37.13  ? 415  GLN A CA  1 
ATOM   3034  C  C   . GLN A  1 384 ? 10.536  70.873  33.740  1.00 36.25  ? 415  GLN A C   1 
ATOM   3035  O  O   . GLN A  1 384 ? 9.965   71.539  32.882  1.00 36.33  ? 415  GLN A O   1 
ATOM   3036  C  CB  . GLN A  1 384 ? 8.852   69.099  34.246  1.00 37.35  ? 415  GLN A CB  1 
ATOM   3037  C  CG  . GLN A  1 384 ? 8.427   67.655  33.994  1.00 37.65  ? 415  GLN A CG  1 
ATOM   3038  C  CD  . GLN A  1 384 ? 7.140   67.358  34.738  1.00 38.68  ? 415  GLN A CD  1 
ATOM   3039  O  OE1 . GLN A  1 384 ? 7.134   67.368  35.967  1.00 40.30  ? 415  GLN A OE1 1 
ATOM   3040  N  NE2 . GLN A  1 384 ? 6.068   67.121  34.001  1.00 37.66  ? 415  GLN A NE2 1 
ATOM   3041  N  N   . ASP A  1 385 ? 11.352  71.354  34.661  1.00 34.57  ? 416  ASP A N   1 
ATOM   3042  C  CA  . ASP A  1 385 ? 11.734  72.773  34.656  1.00 33.13  ? 416  ASP A CA  1 
ATOM   3043  C  C   . ASP A  1 385 ? 12.651  72.974  33.462  1.00 32.15  ? 416  ASP A C   1 
ATOM   3044  O  O   . ASP A  1 385 ? 13.731  72.380  33.423  1.00 34.52  ? 416  ASP A O   1 
ATOM   3045  C  CB  . ASP A  1 385 ? 12.463  73.065  35.968  1.00 35.19  ? 416  ASP A CB  1 
ATOM   3046  C  CG  . ASP A  1 385 ? 12.926  74.501  36.058  1.00 38.81  ? 416  ASP A CG  1 
ATOM   3047  O  OD1 . ASP A  1 385 ? 12.898  75.175  35.009  1.00 39.51  ? 416  ASP A OD1 1 
ATOM   3048  O  OD2 . ASP A  1 385 ? 13.313  74.941  37.158  1.00 41.66  ? 416  ASP A OD2 1 
ATOM   3049  N  N   . PRO A  1 386 ? 12.246  73.739  32.467  1.00 29.83  ? 417  PRO A N   1 
ATOM   3050  C  CA  . PRO A  1 386 ? 12.849  73.789  31.158  1.00 28.09  ? 417  PRO A CA  1 
ATOM   3051  C  C   . PRO A  1 386 ? 14.126  74.585  31.317  1.00 28.63  ? 417  PRO A C   1 
ATOM   3052  O  O   . PRO A  1 386 ? 14.992  74.604  30.448  1.00 27.88  ? 417  PRO A O   1 
ATOM   3053  C  CB  . PRO A  1 386 ? 11.890  74.435  30.186  1.00 27.11  ? 417  PRO A CB  1 
ATOM   3054  C  CG  . PRO A  1 386 ? 10.546  74.284  30.789  1.00 28.64  ? 417  PRO A CG  1 
ATOM   3055  C  CD  . PRO A  1 386 ? 10.756  74.224  32.276  1.00 28.99  ? 417  PRO A CD  1 
ATOM   3056  N  N   . GLY A  1 387 ? 14.255  75.268  32.447  1.00 28.65  ? 418  GLY A N   1 
ATOM   3057  C  CA  . GLY A  1 387 ? 15.443  76.039  32.729  1.00 28.14  ? 418  GLY A CA  1 
ATOM   3058  C  C   . GLY A  1 387 ? 16.515  75.187  33.385  1.00 28.77  ? 418  GLY A C   1 
ATOM   3059  O  O   . GLY A  1 387 ? 17.669  75.601  33.409  1.00 32.67  ? 418  GLY A O   1 
ATOM   3060  N  N   . ALA A  1 388 ? 16.149  74.028  33.900  1.00 28.45  ? 419  ALA A N   1 
ATOM   3061  C  CA  . ALA A  1 388 ? 17.070  73.143  34.590  1.00 27.07  ? 419  ALA A CA  1 
ATOM   3062  C  C   . ALA A  1 388 ? 17.966  72.397  33.621  1.00 26.87  ? 419  ALA A C   1 
ATOM   3063  O  O   . ALA A  1 388 ? 17.520  71.887  32.598  1.00 26.50  ? 419  ALA A O   1 
ATOM   3064  C  CB  . ALA A  1 388 ? 16.299  72.175  35.471  1.00 29.02  ? 419  ALA A CB  1 
ATOM   3065  N  N   . LEU A  1 389 ? 19.229  72.273  33.993  1.00 25.92  ? 420  LEU A N   1 
ATOM   3066  C  CA  . LEU A  1 389 ? 20.227  71.608  33.162  1.00 24.67  ? 420  LEU A CA  1 
ATOM   3067  C  C   . LEU A  1 389 ? 19.783  70.197  32.813  1.00 25.67  ? 420  LEU A C   1 
ATOM   3068  O  O   . LEU A  1 389 ? 20.115  69.647  31.767  1.00 25.54  ? 420  LEU A O   1 
ATOM   3069  C  CB  . LEU A  1 389 ? 21.551  71.605  33.902  1.00 23.29  ? 420  LEU A CB  1 
ATOM   3070  C  CG  . LEU A  1 389 ? 22.644  70.646  33.429  1.00 20.93  ? 420  LEU A CG  1 
ATOM   3071  C  CD1 . LEU A  1 389 ? 23.128  70.948  32.052  1.00 19.10  ? 420  LEU A CD1 1 
ATOM   3072  C  CD2 . LEU A  1 389 ? 23.699  70.660  34.522  1.00 19.56  ? 420  LEU A CD2 1 
ATOM   3073  N  N   . MET A  1 390 ? 19.015  69.583  33.714  1.00 26.05  ? 421  MET A N   1 
ATOM   3074  C  CA  . MET A  1 390 ? 18.556  68.217  33.508  1.00 27.30  ? 421  MET A CA  1 
ATOM   3075  C  C   . MET A  1 390 ? 17.296  68.111  32.660  1.00 27.65  ? 421  MET A C   1 
ATOM   3076  O  O   . MET A  1 390 ? 16.675  67.052  32.542  1.00 27.76  ? 421  MET A O   1 
ATOM   3077  C  CB  . MET A  1 390 ? 18.322  67.541  34.862  1.00 27.99  ? 421  MET A CB  1 
ATOM   3078  C  CG  . MET A  1 390 ? 19.610  67.276  35.635  1.00 30.38  ? 421  MET A CG  1 
ATOM   3079  S  SD  . MET A  1 390 ? 20.777  66.349  34.648  1.00 30.42  ? 421  MET A SD  1 
ATOM   3080  C  CE  . MET A  1 390 ? 20.295  64.672  34.991  1.00 32.65  ? 421  MET A CE  1 
ATOM   3081  N  N   . ALA A  1 391 ? 16.897  69.190  32.032  1.00 26.16  ? 422  ALA A N   1 
ATOM   3082  C  CA  . ALA A  1 391 ? 15.758  69.194  31.125  1.00 24.56  ? 422  ALA A CA  1 
ATOM   3083  C  C   . ALA A  1 391 ? 16.150  68.385  29.881  1.00 23.15  ? 422  ALA A C   1 
ATOM   3084  O  O   . ALA A  1 391 ? 17.203  68.564  29.312  1.00 20.40  ? 422  ALA A O   1 
ATOM   3085  C  CB  . ALA A  1 391 ? 15.430  70.634  30.756  1.00 28.10  ? 422  ALA A CB  1 
ATOM   3086  N  N   . PRO A  1 392 ? 15.183  67.670  29.317  1.00 23.09  ? 423  PRO A N   1 
ATOM   3087  C  CA  . PRO A  1 392 ? 15.385  66.876  28.128  1.00 24.02  ? 423  PRO A CA  1 
ATOM   3088  C  C   . PRO A  1 392 ? 15.944  67.610  26.941  1.00 24.37  ? 423  PRO A C   1 
ATOM   3089  O  O   . PRO A  1 392 ? 16.935  67.187  26.359  1.00 24.49  ? 423  PRO A O   1 
ATOM   3090  C  CB  . PRO A  1 392 ? 13.992  66.302  27.842  1.00 23.56  ? 423  PRO A CB  1 
ATOM   3091  C  CG  . PRO A  1 392 ? 13.413  66.216  29.208  1.00 24.35  ? 423  PRO A CG  1 
ATOM   3092  C  CD  . PRO A  1 392 ? 13.825  67.496  29.889  1.00 23.82  ? 423  PRO A CD  1 
ATOM   3093  N  N   . ILE A  1 393 ? 15.321  68.702  26.541  1.00 24.84  ? 424  ILE A N   1 
ATOM   3094  C  CA  . ILE A  1 393 ? 15.666  69.440  25.343  1.00 25.58  ? 424  ILE A CA  1 
ATOM   3095  C  C   . ILE A  1 393 ? 16.912  70.277  25.514  1.00 27.80  ? 424  ILE A C   1 
ATOM   3096  O  O   . ILE A  1 393 ? 17.212  70.778  26.593  1.00 29.73  ? 424  ILE A O   1 
ATOM   3097  C  CB  . ILE A  1 393 ? 14.479  70.313  24.874  1.00 24.04  ? 424  ILE A CB  1 
ATOM   3098  C  CG1 . ILE A  1 393 ? 13.235  69.428  24.789  1.00 24.57  ? 424  ILE A CG1 1 
ATOM   3099  C  CG2 . ILE A  1 393 ? 14.789  70.977  23.551  1.00 24.08  ? 424  ILE A CG2 1 
ATOM   3100  C  CD1 . ILE A  1 393 ? 11.961  70.088  24.356  1.00 22.65  ? 424  ILE A CD1 1 
ATOM   3101  N  N   . TYR A  1 394 ? 17.683  70.417  24.431  1.00 28.51  ? 425  TYR A N   1 
ATOM   3102  C  CA  . TYR A  1 394 ? 18.931  71.155  24.465  1.00 27.40  ? 425  TYR A CA  1 
ATOM   3103  C  C   . TYR A  1 394 ? 18.698  72.649  24.240  1.00 27.49  ? 425  TYR A C   1 
ATOM   3104  O  O   . TYR A  1 394 ? 17.978  72.996  23.317  1.00 27.73  ? 425  TYR A O   1 
ATOM   3105  C  CB  . TYR A  1 394 ? 19.884  70.670  23.363  1.00 28.05  ? 425  TYR A CB  1 
ATOM   3106  C  CG  . TYR A  1 394 ? 21.041  71.621  23.134  1.00 28.07  ? 425  TYR A CG  1 
ATOM   3107  C  CD1 . TYR A  1 394 ? 22.166  71.555  23.941  1.00 28.05  ? 425  TYR A CD1 1 
ATOM   3108  C  CD2 . TYR A  1 394 ? 21.020  72.580  22.135  1.00 27.40  ? 425  TYR A CD2 1 
ATOM   3109  C  CE1 . TYR A  1 394 ? 23.241  72.402  23.763  1.00 27.46  ? 425  TYR A CE1 1 
ATOM   3110  C  CE2 . TYR A  1 394 ? 22.086  73.433  21.947  1.00 27.15  ? 425  TYR A CE2 1 
ATOM   3111  C  CZ  . TYR A  1 394 ? 23.193  73.338  22.757  1.00 28.05  ? 425  TYR A CZ  1 
ATOM   3112  O  OH  . TYR A  1 394 ? 24.243  74.211  22.535  1.00 30.69  ? 425  TYR A OH  1 
ATOM   3113  N  N   . THR A  1 395 ? 19.410  73.448  25.003  1.00 28.33  ? 426  THR A N   1 
ATOM   3114  C  CA  . THR A  1 395 ? 19.336  74.904  24.918  1.00 27.61  ? 426  THR A CA  1 
ATOM   3115  C  C   . THR A  1 395 ? 20.688  75.531  25.214  1.00 28.83  ? 426  THR A C   1 
ATOM   3116  O  O   . THR A  1 395 ? 21.228  75.323  26.299  1.00 26.83  ? 426  THR A O   1 
ATOM   3117  C  CB  . THR A  1 395 ? 18.337  75.427  25.975  1.00 26.22  ? 426  THR A CB  1 
ATOM   3118  O  OG1 . THR A  1 395 ? 17.018  75.180  25.454  1.00 25.34  ? 426  THR A OG1 1 
ATOM   3119  C  CG2 . THR A  1 395 ? 18.517  76.885  26.270  1.00 25.54  ? 426  THR A CG2 1 
ATOM   3120  N  N   . TYR A  1 396 ? 21.219  76.354  24.323  1.00 30.96  ? 427  TYR A N   1 
ATOM   3121  C  CA  . TYR A  1 396 ? 22.515  76.954  24.607  1.00 33.15  ? 427  TYR A CA  1 
ATOM   3122  C  C   . TYR A  1 396 ? 22.411  78.127  25.565  1.00 34.02  ? 427  TYR A C   1 
ATOM   3123  O  O   . TYR A  1 396 ? 21.538  78.977  25.422  1.00 35.40  ? 427  TYR A O   1 
ATOM   3124  C  CB  . TYR A  1 396 ? 23.188  77.401  23.316  1.00 34.77  ? 427  TYR A CB  1 
ATOM   3125  C  CG  . TYR A  1 396 ? 24.438  78.220  23.617  1.00 37.80  ? 427  TYR A CG  1 
ATOM   3126  C  CD1 . TYR A  1 396 ? 25.471  77.746  24.419  1.00 39.03  ? 427  TYR A CD1 1 
ATOM   3127  C  CD2 . TYR A  1 396 ? 24.573  79.454  23.018  1.00 37.99  ? 427  TYR A CD2 1 
ATOM   3128  C  CE1 . TYR A  1 396 ? 26.596  78.514  24.635  1.00 39.88  ? 427  TYR A CE1 1 
ATOM   3129  C  CE2 . TYR A  1 396 ? 25.688  80.228  23.246  1.00 39.39  ? 427  TYR A CE2 1 
ATOM   3130  C  CZ  . TYR A  1 396 ? 26.693  79.755  24.057  1.00 39.70  ? 427  TYR A CZ  1 
ATOM   3131  O  OH  . TYR A  1 396 ? 27.807  80.528  24.285  1.00 40.91  ? 427  TYR A OH  1 
ATOM   3132  N  N   . THR A  1 397 ? 23.328  78.222  26.513  1.00 34.53  ? 428  THR A N   1 
ATOM   3133  C  CA  . THR A  1 397 ? 23.350  79.306  27.488  1.00 35.11  ? 428  THR A CA  1 
ATOM   3134  C  C   . THR A  1 397 ? 24.738  79.921  27.595  1.00 38.39  ? 428  THR A C   1 
ATOM   3135  O  O   . THR A  1 397 ? 25.597  79.364  28.279  1.00 42.35  ? 428  THR A O   1 
ATOM   3136  C  CB  . THR A  1 397 ? 22.946  78.757  28.873  1.00 32.93  ? 428  THR A CB  1 
ATOM   3137  O  OG1 . THR A  1 397 ? 21.563  78.412  28.849  1.00 30.79  ? 428  THR A OG1 1 
ATOM   3138  C  CG2 . THR A  1 397 ? 23.224  79.745  29.983  1.00 33.99  ? 428  THR A CG2 1 
ATOM   3139  N  N   . LYS A  1 398 ? 24.970  81.061  26.966  1.00 39.94  ? 429  LYS A N   1 
ATOM   3140  C  CA  . LYS A  1 398 ? 26.263  81.724  26.984  1.00 40.01  ? 429  LYS A CA  1 
ATOM   3141  C  C   . LYS A  1 398 ? 26.999  81.475  28.290  1.00 40.08  ? 429  LYS A C   1 
ATOM   3142  O  O   . LYS A  1 398 ? 28.092  80.920  28.292  1.00 42.05  ? 429  LYS A O   1 
ATOM   3143  C  CB  . LYS A  1 398 ? 26.146  83.230  26.761  1.00 41.86  ? 429  LYS A CB  1 
ATOM   3144  C  CG  . LYS A  1 398 ? 27.441  83.987  27.030  1.00 42.81  ? 429  LYS A CG  1 
ATOM   3145  C  CD  . LYS A  1 398 ? 28.513  83.644  26.016  1.00 43.40  ? 429  LYS A CD  1 
ATOM   3146  C  CE  . LYS A  1 398 ? 28.240  84.301  24.676  1.00 43.47  ? 429  LYS A CE  1 
ATOM   3147  N  NZ  . LYS A  1 398 ? 26.903  83.944  24.126  1.00 44.46  ? 429  LYS A NZ  1 
ATOM   3148  N  N   . ASN A  1 399 ? 26.438  81.936  29.395  1.00 39.62  ? 430  ASN A N   1 
ATOM   3149  C  CA  . ASN A  1 399 ? 27.072  81.727  30.691  1.00 41.45  ? 430  ASN A CA  1 
ATOM   3150  C  C   . ASN A  1 399 ? 26.180  80.849  31.559  1.00 41.19  ? 430  ASN A C   1 
ATOM   3151  O  O   . ASN A  1 399 ? 25.163  81.298  32.072  1.00 41.26  ? 430  ASN A O   1 
ATOM   3152  C  CB  . ASN A  1 399 ? 27.343  83.053  31.392  1.00 44.88  ? 430  ASN A CB  1 
ATOM   3153  C  CG  . ASN A  1 399 ? 28.321  83.915  30.617  1.00 47.44  ? 430  ASN A CG  1 
ATOM   3154  O  OD1 . ASN A  1 399 ? 29.363  83.436  30.167  1.00 47.73  ? 430  ASN A OD1 1 
ATOM   3155  N  ND2 . ASN A  1 399 ? 27.980  85.183  30.457  1.00 49.09  ? 430  ASN A ND2 1 
ATOM   3156  N  N   . PHE A  1 400 ? 26.567  79.589  31.664  1.00 41.35  ? 431  PHE A N   1 
ATOM   3157  C  CA  . PHE A  1 400 ? 25.804  78.599  32.393  1.00 41.67  ? 431  PHE A CA  1 
ATOM   3158  C  C   . PHE A  1 400 ? 25.771  78.846  33.890  1.00 42.27  ? 431  PHE A C   1 
ATOM   3159  O  O   . PHE A  1 400 ? 26.620  79.503  34.475  1.00 41.85  ? 431  PHE A O   1 
ATOM   3160  C  CB  . PHE A  1 400 ? 26.343  77.196  32.113  1.00 40.80  ? 431  PHE A CB  1 
ATOM   3161  C  CG  . PHE A  1 400 ? 25.553  76.111  32.779  1.00 40.68  ? 431  PHE A CG  1 
ATOM   3162  C  CD1 . PHE A  1 400 ? 24.321  75.727  32.285  1.00 39.88  ? 431  PHE A CD1 1 
ATOM   3163  C  CD2 . PHE A  1 400 ? 26.045  75.475  33.907  1.00 41.57  ? 431  PHE A CD2 1 
ATOM   3164  C  CE1 . PHE A  1 400 ? 23.599  74.724  32.903  1.00 40.40  ? 431  PHE A CE1 1 
ATOM   3165  C  CE2 . PHE A  1 400 ? 25.322  74.478  34.532  1.00 40.56  ? 431  PHE A CE2 1 
ATOM   3166  C  CZ  . PHE A  1 400 ? 24.098  74.100  34.026  1.00 39.81  ? 431  PHE A CZ  1 
ATOM   3167  N  N   . ARG A  1 401 ? 24.745  78.301  34.525  1.00 44.08  ? 432  ARG A N   1 
ATOM   3168  C  CA  . ARG A  1 401 ? 24.575  78.384  35.968  1.00 47.17  ? 432  ARG A CA  1 
ATOM   3169  C  C   . ARG A  1 401 ? 23.651  77.247  36.403  1.00 46.43  ? 432  ARG A C   1 
ATOM   3170  O  O   . ARG A  1 401 ? 22.610  77.072  35.769  1.00 46.03  ? 432  ARG A O   1 
ATOM   3171  C  CB  . ARG A  1 401 ? 23.941  79.722  36.367  1.00 52.75  ? 432  ARG A CB  1 
ATOM   3172  C  CG  . ARG A  1 401 ? 23.884  79.937  37.870  1.00 60.14  ? 432  ARG A CG  1 
ATOM   3173  C  CD  . ARG A  1 401 ? 22.777  80.879  38.304  1.00 66.44  ? 432  ARG A CD  1 
ATOM   3174  N  NE  . ARG A  1 401 ? 22.317  80.609  39.667  1.00 73.38  ? 432  ARG A NE  1 
ATOM   3175  C  CZ  . ARG A  1 401 ? 21.469  79.642  39.999  1.00 75.60  ? 432  ARG A CZ  1 
ATOM   3176  N  NH1 . ARG A  1 401 ? 20.978  78.853  39.053  1.00 77.12  ? 432  ARG A NH1 1 
ATOM   3177  N  NH2 . ARG A  1 401 ? 21.112  79.471  41.264  1.00 75.56  ? 432  ARG A NH2 1 
ATOM   3178  N  N   . LEU A  1 402 ? 24.014  76.477  37.418  1.00 45.51  ? 433  LEU A N   1 
ATOM   3179  C  CA  . LEU A  1 402 ? 23.133  75.381  37.806  1.00 43.88  ? 433  LEU A CA  1 
ATOM   3180  C  C   . LEU A  1 402 ? 21.808  75.914  38.335  1.00 45.00  ? 433  LEU A C   1 
ATOM   3181  O  O   . LEU A  1 402 ? 21.821  76.807  39.172  1.00 44.41  ? 433  LEU A O   1 
ATOM   3182  C  CB  . LEU A  1 402 ? 23.762  74.480  38.861  1.00 40.81  ? 433  LEU A CB  1 
ATOM   3183  C  CG  . LEU A  1 402 ? 24.327  73.164  38.324  1.00 36.59  ? 433  LEU A CG  1 
ATOM   3184  C  CD1 . LEU A  1 402 ? 24.870  72.346  39.467  1.00 35.56  ? 433  LEU A CD1 1 
ATOM   3185  C  CD2 . LEU A  1 402 ? 23.270  72.419  37.531  1.00 36.67  ? 433  LEU A CD2 1 
ATOM   3186  N  N   . SER A  1 403 ? 20.715  75.345  37.867  1.00 46.80  ? 434  SER A N   1 
ATOM   3187  C  CA  . SER A  1 403 ? 19.371  75.712  38.294  1.00 48.03  ? 434  SER A CA  1 
ATOM   3188  C  C   . SER A  1 403 ? 19.136  75.244  39.725  1.00 48.94  ? 434  SER A C   1 
ATOM   3189  O  O   . SER A  1 403 ? 19.556  74.151  40.100  1.00 49.43  ? 434  SER A O   1 
ATOM   3190  C  CB  . SER A  1 403 ? 18.359  75.033  37.358  1.00 47.97  ? 434  SER A CB  1 
ATOM   3191  O  OG  . SER A  1 403 ? 17.022  75.349  37.689  1.00 53.40  ? 434  SER A OG  1 
ATOM   3192  N  N   . GLN A  1 404 ? 18.405  76.037  40.509  1.00 51.72  ? 435  GLN A N   1 
ATOM   3193  C  CA  . GLN A  1 404 ? 18.057  75.634  41.865  1.00 53.78  ? 435  GLN A CA  1 
ATOM   3194  C  C   . GLN A  1 404 ? 17.564  74.192  41.900  1.00 52.27  ? 435  GLN A C   1 
ATOM   3195  O  O   . GLN A  1 404 ? 18.041  73.355  42.652  1.00 53.01  ? 435  GLN A O   1 
ATOM   3196  C  CB  . GLN A  1 404 ? 17.000  76.573  42.450  1.00 58.57  ? 435  GLN A CB  1 
ATOM   3197  C  CG  . GLN A  1 404 ? 16.743  76.370  43.933  1.00 65.10  ? 435  GLN A CG  1 
ATOM   3198  C  CD  . GLN A  1 404 ? 15.678  77.305  44.473  1.00 68.10  ? 435  GLN A CD  1 
ATOM   3199  O  OE1 . GLN A  1 404 ? 15.120  78.117  43.734  1.00 69.95  ? 435  GLN A OE1 1 
ATOM   3200  N  NE2 . GLN A  1 404 ? 15.242  77.363  45.726  1.00 69.07  ? 435  GLN A NE2 1 
ATOM   3201  N  N   . ASP A  1 405 ? 16.648  73.899  40.979  1.00 50.08  ? 436  ASP A N   1 
ATOM   3202  C  CA  . ASP A  1 405 ? 16.110  72.558  40.830  1.00 48.39  ? 436  ASP A CA  1 
ATOM   3203  C  C   . ASP A  1 405 ? 17.228  71.530  40.757  1.00 46.71  ? 436  ASP A C   1 
ATOM   3204  O  O   . ASP A  1 405 ? 17.209  70.517  41.448  1.00 46.95  ? 436  ASP A O   1 
ATOM   3205  C  CB  . ASP A  1 405 ? 15.226  72.478  39.584  1.00 48.72  ? 436  ASP A CB  1 
ATOM   3206  C  CG  . ASP A  1 405 ? 14.770  71.060  39.300  1.00 50.06  ? 436  ASP A CG  1 
ATOM   3207  O  OD1 . ASP A  1 405 ? 14.253  70.407  40.231  1.00 50.83  ? 436  ASP A OD1 1 
ATOM   3208  O  OD2 . ASP A  1 405 ? 14.941  70.607  38.151  1.00 50.73  ? 436  ASP A OD2 1 
ATOM   3209  N  N   . ASP A  1 406 ? 18.218  71.791  39.912  1.00 45.40  ? 437  ASP A N   1 
ATOM   3210  C  CA  . ASP A  1 406 ? 19.349  70.876  39.789  1.00 44.32  ? 437  ASP A CA  1 
ATOM   3211  C  C   . ASP A  1 406 ? 20.074  70.759  41.124  1.00 43.50  ? 437  ASP A C   1 
ATOM   3212  O  O   . ASP A  1 406 ? 20.262  69.652  41.633  1.00 43.80  ? 437  ASP A O   1 
ATOM   3213  C  CB  . ASP A  1 406 ? 20.305  71.319  38.692  1.00 43.72  ? 437  ASP A CB  1 
ATOM   3214  C  CG  . ASP A  1 406 ? 19.685  71.394  37.321  1.00 44.29  ? 437  ASP A CG  1 
ATOM   3215  O  OD1 . ASP A  1 406 ? 19.064  70.408  36.864  1.00 45.10  ? 437  ASP A OD1 1 
ATOM   3216  O  OD2 . ASP A  1 406 ? 19.803  72.451  36.669  1.00 43.85  ? 437  ASP A OD2 1 
ATOM   3217  N  N   . ILE A  1 407 ? 20.447  71.902  41.700  1.00 41.75  ? 438  ILE A N   1 
ATOM   3218  C  CA  . ILE A  1 407 ? 21.156  71.895  42.971  1.00 40.31  ? 438  ILE A CA  1 
ATOM   3219  C  C   . ILE A  1 407 ? 20.376  71.150  44.042  1.00 41.96  ? 438  ILE A C   1 
ATOM   3220  O  O   . ILE A  1 407 ? 20.961  70.404  44.825  1.00 42.48  ? 438  ILE A O   1 
ATOM   3221  C  CB  . ILE A  1 407 ? 21.492  73.306  43.462  1.00 38.27  ? 438  ILE A CB  1 
ATOM   3222  C  CG1 . ILE A  1 407 ? 22.361  74.022  42.423  1.00 37.23  ? 438  ILE A CG1 1 
ATOM   3223  C  CG2 . ILE A  1 407 ? 22.206  73.256  44.802  1.00 36.25  ? 438  ILE A CG2 1 
ATOM   3224  C  CD1 . ILE A  1 407 ? 22.538  75.499  42.684  1.00 36.27  ? 438  ILE A CD1 1 
ATOM   3225  N  N   . LYS A  1 408 ? 19.055  71.314  44.048  1.00 42.85  ? 439  LYS A N   1 
ATOM   3226  C  CA  . LYS A  1 408 ? 18.220  70.596  45.000  1.00 43.19  ? 439  LYS A CA  1 
ATOM   3227  C  C   . LYS A  1 408 ? 18.240  69.093  44.713  1.00 42.16  ? 439  LYS A C   1 
ATOM   3228  O  O   . LYS A  1 408 ? 18.199  68.298  45.644  1.00 41.32  ? 439  LYS A O   1 
ATOM   3229  C  CB  . LYS A  1 408 ? 16.763  71.069  44.928  1.00 45.57  ? 439  LYS A CB  1 
ATOM   3230  C  CG  . LYS A  1 408 ? 15.839  70.262  45.832  1.00 50.07  ? 439  LYS A CG  1 
ATOM   3231  C  CD  . LYS A  1 408 ? 14.425  70.205  45.284  1.00 55.15  ? 439  LYS A CD  1 
ATOM   3232  C  CE  . LYS A  1 408 ? 13.576  69.191  46.041  1.00 57.53  ? 439  LYS A CE  1 
ATOM   3233  N  NZ  . LYS A  1 408 ? 12.142  69.273  45.634  1.00 59.73  ? 439  LYS A NZ  1 
ATOM   3234  N  N   . GLY A  1 409 ? 18.280  68.758  43.436  1.00 41.13  ? 440  GLY A N   1 
ATOM   3235  C  CA  . GLY A  1 409 ? 18.292  67.399  42.955  1.00 40.26  ? 440  GLY A CA  1 
ATOM   3236  C  C   . GLY A  1 409 ? 19.557  66.624  43.246  1.00 39.58  ? 440  GLY A C   1 
ATOM   3237  O  O   . GLY A  1 409 ? 19.477  65.523  43.809  1.00 39.79  ? 440  GLY A O   1 
ATOM   3238  N  N   . ILE A  1 410 ? 20.724  67.118  42.842  1.00 38.96  ? 441  ILE A N   1 
ATOM   3239  C  CA  . ILE A  1 410 ? 21.981  66.398  43.080  1.00 36.77  ? 441  ILE A CA  1 
ATOM   3240  C  C   . ILE A  1 410 ? 22.279  66.272  44.565  1.00 37.44  ? 441  ILE A C   1 
ATOM   3241  O  O   . ILE A  1 410 ? 22.748  65.246  45.043  1.00 36.75  ? 441  ILE A O   1 
ATOM   3242  C  CB  . ILE A  1 410 ? 23.173  67.037  42.349  1.00 34.22  ? 441  ILE A CB  1 
ATOM   3243  C  CG1 . ILE A  1 410 ? 24.388  66.114  42.371  1.00 31.04  ? 441  ILE A CG1 1 
ATOM   3244  C  CG2 . ILE A  1 410 ? 23.536  68.407  42.864  1.00 31.05  ? 441  ILE A CG2 1 
ATOM   3245  C  CD1 . ILE A  1 410 ? 24.067  64.728  41.841  1.00 29.94  ? 441  ILE A CD1 1 
ATOM   3246  N  N   . GLN A  1 411 ? 21.970  67.321  45.329  1.00 38.60  ? 442  GLN A N   1 
ATOM   3247  C  CA  . GLN A  1 411 ? 22.229  67.324  46.758  1.00 40.19  ? 442  GLN A CA  1 
ATOM   3248  C  C   . GLN A  1 411 ? 21.310  66.424  47.544  1.00 41.68  ? 442  GLN A C   1 
ATOM   3249  O  O   . GLN A  1 411 ? 21.721  65.695  48.444  1.00 42.14  ? 442  GLN A O   1 
ATOM   3250  C  CB  . GLN A  1 411 ? 22.122  68.739  47.327  1.00 38.80  ? 442  GLN A CB  1 
ATOM   3251  C  CG  . GLN A  1 411 ? 23.104  69.711  46.705  1.00 37.33  ? 442  GLN A CG  1 
ATOM   3252  C  CD  . GLN A  1 411 ? 23.171  70.994  47.509  1.00 37.01  ? 442  GLN A CD  1 
ATOM   3253  O  OE1 . GLN A  1 411 ? 22.153  71.496  47.981  1.00 36.41  ? 442  GLN A OE1 1 
ATOM   3254  N  NE2 . GLN A  1 411 ? 24.390  71.491  47.648  1.00 36.27  ? 442  GLN A NE2 1 
ATOM   3255  N  N   . GLU A  1 412 ? 20.016  66.393  47.200  1.00 43.26  ? 443  GLU A N   1 
ATOM   3256  C  CA  . GLU A  1 412 ? 19.162  65.464  47.955  1.00 44.55  ? 443  GLU A CA  1 
ATOM   3257  C  C   . GLU A  1 412 ? 19.751  64.065  47.793  1.00 44.44  ? 443  GLU A C   1 
ATOM   3258  O  O   . GLU A  1 412 ? 19.442  63.175  48.576  1.00 46.40  ? 443  GLU A O   1 
ATOM   3259  C  CB  . GLU A  1 412 ? 17.722  65.515  47.486  1.00 47.79  ? 443  GLU A CB  1 
ATOM   3260  C  CG  . GLU A  1 412 ? 17.266  64.384  46.586  1.00 51.15  ? 443  GLU A CG  1 
ATOM   3261  C  CD  . GLU A  1 412 ? 15.784  64.411  46.273  1.00 53.26  ? 443  GLU A CD  1 
ATOM   3262  O  OE1 . GLU A  1 412 ? 15.330  65.347  45.580  1.00 52.84  ? 443  GLU A OE1 1 
ATOM   3263  O  OE2 . GLU A  1 412 ? 15.063  63.492  46.720  1.00 54.35  ? 443  GLU A OE2 1 
ATOM   3264  N  N   . LEU A  1 413 ? 20.557  63.875  46.757  1.00 42.55  ? 444  LEU A N   1 
ATOM   3265  C  CA  . LEU A  1 413 ? 21.157  62.598  46.455  1.00 40.02  ? 444  LEU A CA  1 
ATOM   3266  C  C   . LEU A  1 413 ? 22.543  62.394  47.034  1.00 39.85  ? 444  LEU A C   1 
ATOM   3267  O  O   . LEU A  1 413 ? 22.896  61.269  47.385  1.00 39.24  ? 444  LEU A O   1 
ATOM   3268  C  CB  . LEU A  1 413 ? 21.204  62.404  44.937  1.00 38.61  ? 444  LEU A CB  1 
ATOM   3269  C  CG  . LEU A  1 413 ? 21.212  60.948  44.465  1.00 37.49  ? 444  LEU A CG  1 
ATOM   3270  C  CD1 . LEU A  1 413 ? 19.807  60.376  44.587  1.00 37.39  ? 444  LEU A CD1 1 
ATOM   3271  C  CD2 . LEU A  1 413 ? 21.686  60.860  43.024  1.00 37.05  ? 444  LEU A CD2 1 
ATOM   3272  N  N   . TYR A  1 414 ? 23.358  63.442  47.068  1.00 39.96  ? 445  TYR A N   1 
ATOM   3273  C  CA  . TYR A  1 414 ? 24.711  63.341  47.584  1.00 39.39  ? 445  TYR A CA  1 
ATOM   3274  C  C   . TYR A  1 414 ? 24.944  64.259  48.773  1.00 40.58  ? 445  TYR A C   1 
ATOM   3275  O  O   . TYR A  1 414 ? 26.015  64.219  49.379  1.00 40.15  ? 445  TYR A O   1 
ATOM   3276  C  CB  . TYR A  1 414 ? 25.724  63.691  46.486  1.00 37.69  ? 445  TYR A CB  1 
ATOM   3277  C  CG  . TYR A  1 414 ? 25.769  62.645  45.397  1.00 37.01  ? 445  TYR A CG  1 
ATOM   3278  C  CD1 . TYR A  1 414 ? 26.635  61.565  45.501  1.00 37.77  ? 445  TYR A CD1 1 
ATOM   3279  C  CD2 . TYR A  1 414 ? 24.945  62.731  44.292  1.00 36.00  ? 445  TYR A CD2 1 
ATOM   3280  C  CE1 . TYR A  1 414 ? 26.677  60.593  44.522  1.00 38.51  ? 445  TYR A CE1 1 
ATOM   3281  C  CE2 . TYR A  1 414 ? 24.983  61.766  43.305  1.00 37.70  ? 445  TYR A CE2 1 
ATOM   3282  C  CZ  . TYR A  1 414 ? 25.848  60.700  43.426  1.00 39.31  ? 445  TYR A CZ  1 
ATOM   3283  O  OH  . TYR A  1 414 ? 25.894  59.732  42.453  1.00 41.93  ? 445  TYR A OH  1 
ATOM   3284  N  N   . GLY A  1 415 ? 23.963  65.094  49.063  1.00 42.32  ? 446  GLY A N   1 
ATOM   3285  C  CA  . GLY A  1 415 ? 24.086  66.106  50.104  1.00 43.78  ? 446  GLY A CA  1 
ATOM   3286  C  C   . GLY A  1 415 ? 24.968  67.240  49.603  1.00 45.38  ? 446  GLY A C   1 
ATOM   3287  O  O   . GLY A  1 415 ? 25.679  67.100  48.608  1.00 47.05  ? 446  GLY A O   1 
ATOM   3288  N  N   . ALA A  1 416 ? 24.934  68.363  50.294  1.00 47.10  ? 447  ALA A N   1 
ATOM   3289  C  CA  . ALA A  1 416 ? 25.711  69.520  49.868  1.00 49.41  ? 447  ALA A CA  1 
ATOM   3290  C  C   . ALA A  1 416 ? 27.201  69.325  50.101  1.00 51.08  ? 447  ALA A C   1 
ATOM   3291  O  O   . ALA A  1 416 ? 27.638  68.482  50.866  1.00 51.86  ? 447  ALA A O   1 
ATOM   3292  C  CB  . ALA A  1 416 ? 25.263  70.726  50.705  1.00 49.79  ? 447  ALA A CB  1 
ATOM   3293  N  N   . SER A  1 417 ? 27.964  70.257  49.539  1.00 53.22  ? 448  SER A N   1 
ATOM   3294  C  CA  . SER A  1 417 ? 29.391  70.300  49.959  1.00 55.15  ? 448  SER A CA  1 
ATOM   3295  C  C   . SER A  1 417 ? 29.535  70.448  51.473  1.00 55.79  ? 448  SER A C   1 
ATOM   3296  O  O   . SER A  1 417 ? 28.796  71.212  52.098  1.00 56.57  ? 448  SER A O   1 
ATOM   3297  C  CB  . SER A  1 417 ? 30.051  71.478  49.240  1.00 53.84  ? 448  SER A CB  1 
ATOM   3298  O  OG  . SER A  1 417 ? 31.188  71.906  49.954  1.00 54.95  ? 448  SER A OG  1 
ATOM   3299  N  N   . PRO A  1 418 ? 30.465  69.732  52.091  1.00 57.20  ? 449  PRO A N   1 
ATOM   3300  C  CA  . PRO A  1 418 ? 30.670  69.765  53.525  1.00 60.27  ? 449  PRO A CA  1 
ATOM   3301  C  C   . PRO A  1 418 ? 31.025  71.154  54.035  1.00 64.09  ? 449  PRO A C   1 
ATOM   3302  O  O   . PRO A  1 418 ? 31.931  71.802  53.518  1.00 64.56  ? 449  PRO A O   1 
ATOM   3303  C  CB  . PRO A  1 418 ? 31.842  68.816  53.773  1.00 57.86  ? 449  PRO A CB  1 
ATOM   3304  C  CG  . PRO A  1 418 ? 31.966  67.998  52.551  1.00 56.49  ? 449  PRO A CG  1 
ATOM   3305  C  CD  . PRO A  1 418 ? 31.388  68.790  51.423  1.00 55.85  ? 449  PRO A CD  1 
ATOM   3306  N  N   . ASP A  1 419 ? 30.317  71.582  55.076  1.00 68.96  ? 450  ASP A N   1 
ATOM   3307  C  CA  . ASP A  1 419 ? 30.576  72.886  55.663  1.00 73.36  ? 450  ASP A CA  1 
ATOM   3308  C  C   . ASP A  1 419 ? 31.809  72.812  56.561  1.00 75.37  ? 450  ASP A C   1 
ATOM   3309  O  O   . ASP A  1 419 ? 31.787  72.288  57.664  1.00 76.28  ? 450  ASP A O   1 
ATOM   3310  C  CB  . ASP A  1 419 ? 29.382  73.420  56.429  1.00 74.79  ? 450  ASP A CB  1 
ATOM   3311  C  CG  . ASP A  1 419 ? 28.680  72.346  57.237  1.00 76.00  ? 450  ASP A CG  1 
ATOM   3312  O  OD1 . ASP A  1 419 ? 27.936  71.540  56.641  1.00 77.70  ? 450  ASP A OD1 1 
ATOM   3313  O  OD2 . ASP A  1 419 ? 28.870  72.302  58.470  1.00 76.02  ? 450  ASP A OD2 1 
ATOM   3314  N  N   . ILE A  1 420 ? 32.885  73.317  55.977  1.00 77.25  ? 451  ILE A N   1 
ATOM   3315  C  CA  . ILE A  1 420 ? 34.156  73.365  56.683  1.00 79.10  ? 451  ILE A CA  1 
ATOM   3316  C  C   . ILE A  1 420 ? 34.210  74.635  57.522  1.00 80.70  ? 451  ILE A C   1 
ATOM   3317  O  O   . ILE A  1 420 ? 34.283  75.742  57.000  1.00 81.81  ? 451  ILE A O   1 
ATOM   3318  C  CB  . ILE A  1 420 ? 35.319  73.359  55.682  1.00 79.19  ? 451  ILE A CB  1 
ATOM   3319  C  CG1 . ILE A  1 420 ? 35.316  72.014  54.942  1.00 78.00  ? 451  ILE A CG1 1 
ATOM   3320  C  CG2 . ILE A  1 420 ? 36.646  73.581  56.381  1.00 78.54  ? 451  ILE A CG2 1 
ATOM   3321  C  CD1 . ILE A  1 420 ? 36.354  71.918  53.851  1.00 76.21  ? 451  ILE A CD1 1 
ATOM   3322  N  N   . ASP A  1 421 ? 34.125  74.416  58.833  1.00 100.00 ? 452  ASP A N   1 
ATOM   3323  C  CA  . ASP A  1 421 ? 34.138  75.563  59.739  1.00 100.00 ? 452  ASP A CA  1 
ATOM   3324  C  C   . ASP A  1 421 ? 32.954  76.477  59.455  1.00 100.00 ? 452  ASP A C   1 
ATOM   3325  O  O   . ASP A  1 421 ? 33.092  77.424  58.652  1.00 100.00 ? 452  ASP A O   1 
ATOM   3326  C  CB  . ASP A  1 421 ? 35.451  76.338  59.561  1.00 100.00 ? 452  ASP A CB  1 
ATOM   3327  C  CG  . ASP A  1 421 ? 36.351  76.163  60.772  1.00 99.06  ? 452  ASP A CG  1 
ATOM   3328  O  OD1 . ASP A  1 421 ? 37.098  75.167  60.819  1.00 99.08  ? 452  ASP A OD1 1 
ATOM   3329  O  OD2 . ASP A  1 421 ? 36.294  77.025  61.673  1.00 98.74  ? 452  ASP A OD2 1 
ATOM   3330  O  OXT . ASP A  1 421 ? 34.092  76.424  59.652  1.00 100.00 ? 452  ASP A OXT 1 
ATOM   3331  N  N   . SER B  1 1   ? -39.640 129.193 -19.533 1.00 67.12  ? 32   SER B N   1 
ATOM   3332  C  CA  . SER B  1 1   ? -38.564 128.269 -19.080 1.00 67.16  ? 32   SER B CA  1 
ATOM   3333  C  C   . SER B  1 1   ? -39.080 127.242 -18.083 1.00 67.51  ? 32   SER B C   1 
ATOM   3334  O  O   . SER B  1 1   ? -39.634 127.601 -17.040 1.00 68.06  ? 32   SER B O   1 
ATOM   3335  C  CB  . SER B  1 1   ? -37.415 129.075 -18.457 1.00 66.58  ? 32   SER B CB  1 
ATOM   3336  O  OG  . SER B  1 1   ? -36.374 128.223 -18.022 1.00 65.13  ? 32   SER B OG  1 
ATOM   3337  N  N   . PRO B  1 2   ? -38.878 125.963 -18.355 1.00 67.65  ? 33   PRO B N   1 
ATOM   3338  C  CA  . PRO B  1 2   ? -39.295 124.884 -17.475 1.00 67.68  ? 33   PRO B CA  1 
ATOM   3339  C  C   . PRO B  1 2   ? -38.365 124.740 -16.279 1.00 67.35  ? 33   PRO B C   1 
ATOM   3340  O  O   . PRO B  1 2   ? -37.147 124.659 -16.441 1.00 68.39  ? 33   PRO B O   1 
ATOM   3341  C  CB  . PRO B  1 2   ? -39.222 123.637 -18.347 1.00 68.09  ? 33   PRO B CB  1 
ATOM   3342  C  CG  . PRO B  1 2   ? -38.933 124.087 -19.727 1.00 68.41  ? 33   PRO B CG  1 
ATOM   3343  C  CD  . PRO B  1 2   ? -38.258 125.426 -19.594 1.00 67.76  ? 33   PRO B CD  1 
ATOM   3344  N  N   . ILE B  1 3   ? -38.930 124.705 -15.075 1.00 66.28  ? 34   ILE B N   1 
ATOM   3345  C  CA  . ILE B  1 3   ? -38.089 124.547 -13.884 1.00 65.95  ? 34   ILE B CA  1 
ATOM   3346  C  C   . ILE B  1 3   ? -37.415 123.178 -13.905 1.00 64.94  ? 34   ILE B C   1 
ATOM   3347  O  O   . ILE B  1 3   ? -38.073 122.147 -13.787 1.00 64.85  ? 34   ILE B O   1 
ATOM   3348  C  CB  . ILE B  1 3   ? -38.896 124.718 -12.596 1.00 67.11  ? 34   ILE B CB  1 
ATOM   3349  C  CG1 . ILE B  1 3   ? -38.069 124.316 -11.374 1.00 68.78  ? 34   ILE B CG1 1 
ATOM   3350  C  CG2 . ILE B  1 3   ? -40.185 123.915 -12.663 1.00 67.71  ? 34   ILE B CG2 1 
ATOM   3351  C  CD1 . ILE B  1 3   ? -38.745 124.608 -10.051 1.00 70.18  ? 34   ILE B CD1 1 
ATOM   3352  N  N   . ILE B  1 4   ? -36.100 123.175 -14.064 1.00 63.87  ? 35   ILE B N   1 
ATOM   3353  C  CA  . ILE B  1 4   ? -35.304 121.953 -14.142 1.00 61.94  ? 35   ILE B CA  1 
ATOM   3354  C  C   . ILE B  1 4   ? -34.659 121.591 -12.815 1.00 61.42  ? 35   ILE B C   1 
ATOM   3355  O  O   . ILE B  1 4   ? -34.583 122.404 -11.896 1.00 61.30  ? 35   ILE B O   1 
ATOM   3356  C  CB  . ILE B  1 4   ? -34.217 122.118 -15.222 1.00 61.07  ? 35   ILE B CB  1 
ATOM   3357  C  CG1 . ILE B  1 4   ? -34.874 122.039 -16.608 1.00 61.26  ? 35   ILE B CG1 1 
ATOM   3358  C  CG2 . ILE B  1 4   ? -33.087 121.125 -15.108 1.00 61.75  ? 35   ILE B CG2 1 
ATOM   3359  C  CD1 . ILE B  1 4   ? -33.988 122.559 -17.717 1.00 62.32  ? 35   ILE B CD1 1 
ATOM   3360  N  N   . LYS B  1 5   ? -34.202 120.349 -12.700 1.00 61.37  ? 36   LYS B N   1 
ATOM   3361  C  CA  . LYS B  1 5   ? -33.491 119.869 -11.520 1.00 61.40  ? 36   LYS B CA  1 
ATOM   3362  C  C   . LYS B  1 5   ? -31.981 119.925 -11.770 1.00 60.42  ? 36   LYS B C   1 
ATOM   3363  O  O   . LYS B  1 5   ? -31.467 119.186 -12.606 1.00 59.56  ? 36   LYS B O   1 
ATOM   3364  C  CB  . LYS B  1 5   ? -33.903 118.434 -11.183 1.00 62.51  ? 36   LYS B CB  1 
ATOM   3365  C  CG  . LYS B  1 5   ? -33.387 117.921 -9.849  1.00 63.91  ? 36   LYS B CG  1 
ATOM   3366  C  CD  . LYS B  1 5   ? -33.790 118.834 -8.704  1.00 66.39  ? 36   LYS B CD  1 
ATOM   3367  C  CE  . LYS B  1 5   ? -33.093 118.468 -7.409  1.00 67.91  ? 36   LYS B CE  1 
ATOM   3368  N  NZ  . LYS B  1 5   ? -31.615 118.368 -7.566  1.00 68.03  ? 36   LYS B NZ  1 
ATOM   3369  N  N   . PHE B  1 6   ? -31.287 120.826 -11.090 1.00 59.34  ? 37   PHE B N   1 
ATOM   3370  C  CA  . PHE B  1 6   ? -29.853 121.011 -11.265 1.00 57.04  ? 37   PHE B CA  1 
ATOM   3371  C  C   . PHE B  1 6   ? -29.020 119.991 -10.506 1.00 54.03  ? 37   PHE B C   1 
ATOM   3372  O  O   . PHE B  1 6   ? -29.286 119.654 -9.354  1.00 53.52  ? 37   PHE B O   1 
ATOM   3373  C  CB  . PHE B  1 6   ? -29.447 122.423 -10.841 1.00 58.79  ? 37   PHE B CB  1 
ATOM   3374  C  CG  . PHE B  1 6   ? -29.867 123.494 -11.805 1.00 60.08  ? 37   PHE B CG  1 
ATOM   3375  C  CD1 . PHE B  1 6   ? -29.181 123.658 -12.994 1.00 60.04  ? 37   PHE B CD1 1 
ATOM   3376  C  CD2 . PHE B  1 6   ? -30.930 124.333 -11.521 1.00 60.45  ? 37   PHE B CD2 1 
ATOM   3377  C  CE1 . PHE B  1 6   ? -29.547 124.640 -13.892 1.00 60.33  ? 37   PHE B CE1 1 
ATOM   3378  C  CE2 . PHE B  1 6   ? -31.300 125.318 -12.416 1.00 60.92  ? 37   PHE B CE2 1 
ATOM   3379  C  CZ  . PHE B  1 6   ? -30.610 125.470 -13.599 1.00 61.08  ? 37   PHE B CZ  1 
ATOM   3380  N  N   . PRO B  1 7   ? -27.957 119.500 -11.129 1.00 51.26  ? 38   PRO B N   1 
ATOM   3381  C  CA  . PRO B  1 7   ? -27.100 118.492 -10.539 1.00 50.18  ? 38   PRO B CA  1 
ATOM   3382  C  C   . PRO B  1 7   ? -26.696 118.798 -9.118  1.00 50.74  ? 38   PRO B C   1 
ATOM   3383  O  O   . PRO B  1 7   ? -26.302 119.914 -8.776  1.00 51.82  ? 38   PRO B O   1 
ATOM   3384  C  CB  . PRO B  1 7   ? -25.897 118.449 -11.467 1.00 49.91  ? 38   PRO B CB  1 
ATOM   3385  C  CG  . PRO B  1 7   ? -26.421 118.874 -12.788 1.00 49.70  ? 38   PRO B CG  1 
ATOM   3386  C  CD  . PRO B  1 7   ? -27.532 119.841 -12.504 1.00 50.93  ? 38   PRO B CD  1 
ATOM   3387  N  N   . GLY B  1 8   ? -26.825 117.816 -8.237  1.00 51.24  ? 39   GLY B N   1 
ATOM   3388  C  CA  . GLY B  1 8   ? -26.473 117.946 -6.844  1.00 52.45  ? 39   GLY B CA  1 
ATOM   3389  C  C   . GLY B  1 8   ? -27.063 119.130 -6.119  1.00 52.04  ? 39   GLY B C   1 
ATOM   3390  O  O   . GLY B  1 8   ? -26.586 119.529 -5.050  1.00 50.59  ? 39   GLY B O   1 
ATOM   3391  N  N   . ASP B  1 9   ? -28.148 119.704 -6.631  1.00 52.81  ? 40   ASP B N   1 
ATOM   3392  C  CA  . ASP B  1 9   ? -28.763 120.835 -5.940  1.00 54.45  ? 40   ASP B CA  1 
ATOM   3393  C  C   . ASP B  1 9   ? -29.824 120.301 -4.985  1.00 56.99  ? 40   ASP B C   1 
ATOM   3394  O  O   . ASP B  1 9   ? -30.169 119.117 -5.057  1.00 57.71  ? 40   ASP B O   1 
ATOM   3395  C  CB  . ASP B  1 9   ? -29.369 121.816 -6.940  1.00 51.70  ? 40   ASP B CB  1 
ATOM   3396  C  CG  . ASP B  1 9   ? -29.987 123.016 -6.244  1.00 50.44  ? 40   ASP B CG  1 
ATOM   3397  O  OD1 . ASP B  1 9   ? -29.479 123.365 -5.157  1.00 47.54  ? 40   ASP B OD1 1 
ATOM   3398  O  OD2 . ASP B  1 9   ? -30.965 123.573 -6.774  1.00 51.16  ? 40   ASP B OD2 1 
ATOM   3399  N  N   . VAL B  1 10  ? -30.326 121.161 -4.114  1.00 59.00  ? 41   VAL B N   1 
ATOM   3400  C  CA  . VAL B  1 10  ? -31.353 120.773 -3.160  1.00 59.71  ? 41   VAL B CA  1 
ATOM   3401  C  C   . VAL B  1 10  ? -32.744 120.685 -3.780  1.00 59.82  ? 41   VAL B C   1 
ATOM   3402  O  O   . VAL B  1 10  ? -33.121 121.474 -4.646  1.00 59.21  ? 41   VAL B O   1 
ATOM   3403  C  CB  . VAL B  1 10  ? -31.390 121.763 -1.976  1.00 58.91  ? 41   VAL B CB  1 
ATOM   3404  C  CG1 . VAL B  1 10  ? -30.139 121.626 -1.123  1.00 58.16  ? 41   VAL B CG1 1 
ATOM   3405  C  CG2 . VAL B  1 10  ? -31.523 123.183 -2.508  1.00 58.43  ? 41   VAL B CG2 1 
ATOM   3406  N  N   . ALA B  1 11  ? -33.523 119.710 -3.304  1.00 58.79  ? 42   ALA B N   1 
ATOM   3407  C  CA  . ALA B  1 11  ? -34.906 119.551 -3.755  1.00 57.82  ? 42   ALA B CA  1 
ATOM   3408  C  C   . ALA B  1 11  ? -35.728 120.740 -3.248  1.00 57.64  ? 42   ALA B C   1 
ATOM   3409  O  O   . ALA B  1 11  ? -35.670 121.056 -2.060  1.00 57.28  ? 42   ALA B O   1 
ATOM   3410  C  CB  . ALA B  1 11  ? -35.485 118.250 -3.228  1.00 58.82  ? 42   ALA B CB  1 
ATOM   3411  N  N   . PRO B  1 12  ? -36.423 121.412 -4.150  1.00 56.75  ? 43   PRO B N   1 
ATOM   3412  C  CA  . PRO B  1 12  ? -37.196 122.600 -3.837  1.00 53.42  ? 43   PRO B CA  1 
ATOM   3413  C  C   . PRO B  1 12  ? -38.397 122.303 -2.957  1.00 51.00  ? 43   PRO B C   1 
ATOM   3414  O  O   . PRO B  1 12  ? -39.122 121.341 -3.200  1.00 51.84  ? 43   PRO B O   1 
ATOM   3415  C  CB  . PRO B  1 12  ? -37.657 123.108 -5.202  1.00 53.74  ? 43   PRO B CB  1 
ATOM   3416  C  CG  . PRO B  1 12  ? -37.680 121.893 -6.061  1.00 54.97  ? 43   PRO B CG  1 
ATOM   3417  C  CD  . PRO B  1 12  ? -36.502 121.071 -5.596  1.00 56.60  ? 43   PRO B CD  1 
ATOM   3418  N  N   . LYS B  1 13  ? -38.594 123.124 -1.934  1.00 47.51  ? 44   LYS B N   1 
ATOM   3419  C  CA  . LYS B  1 13  ? -39.726 122.982 -1.027  1.00 44.31  ? 44   LYS B CA  1 
ATOM   3420  C  C   . LYS B  1 13  ? -40.929 123.728 -1.607  1.00 41.90  ? 44   LYS B C   1 
ATOM   3421  O  O   . LYS B  1 13  ? -40.767 124.658 -2.398  1.00 41.29  ? 44   LYS B O   1 
ATOM   3422  C  CB  . LYS B  1 13  ? -39.407 123.531 0.359   1.00 44.94  ? 44   LYS B CB  1 
ATOM   3423  C  CG  . LYS B  1 13  ? -38.199 122.935 1.043   1.00 46.68  ? 44   LYS B CG  1 
ATOM   3424  C  CD  . LYS B  1 13  ? -38.558 121.769 1.942   1.00 49.62  ? 44   LYS B CD  1 
ATOM   3425  C  CE  . LYS B  1 13  ? -37.949 120.465 1.451   1.00 50.73  ? 44   LYS B CE  1 
ATOM   3426  N  NZ  . LYS B  1 13  ? -36.460 120.491 1.526   1.00 49.87  ? 44   LYS B NZ  1 
ATOM   3427  N  N   . THR B  1 14  ? -42.133 123.312 -1.229  1.00 38.56  ? 45   THR B N   1 
ATOM   3428  C  CA  . THR B  1 14  ? -43.328 123.987 -1.721  1.00 34.96  ? 45   THR B CA  1 
ATOM   3429  C  C   . THR B  1 14  ? -43.842 124.972 -0.676  1.00 32.66  ? 45   THR B C   1 
ATOM   3430  O  O   . THR B  1 14  ? -43.681 124.770 0.520   1.00 32.68  ? 45   THR B O   1 
ATOM   3431  C  CB  . THR B  1 14  ? -44.466 123.011 -2.046  1.00 35.78  ? 45   THR B CB  1 
ATOM   3432  O  OG1 . THR B  1 14  ? -44.895 122.378 -0.837  1.00 38.18  ? 45   THR B OG1 1 
ATOM   3433  C  CG2 . THR B  1 14  ? -44.040 121.976 -3.062  1.00 35.09  ? 45   THR B CG2 1 
ATOM   3434  N  N   . ASP B  1 15  ? -44.561 125.979 -1.138  1.00 31.27  ? 46   ASP B N   1 
ATOM   3435  C  CA  . ASP B  1 15  ? -45.090 127.022 -0.281  1.00 29.66  ? 46   ASP B CA  1 
ATOM   3436  C  C   . ASP B  1 15  ? -45.565 126.513 1.060   1.00 27.63  ? 46   ASP B C   1 
ATOM   3437  O  O   . ASP B  1 15  ? -45.279 127.041 2.129   1.00 26.92  ? 46   ASP B O   1 
ATOM   3438  C  CB  . ASP B  1 15  ? -46.212 127.773 -0.991  1.00 31.33  ? 46   ASP B CB  1 
ATOM   3439  C  CG  . ASP B  1 15  ? -45.731 128.675 -2.100  1.00 33.34  ? 46   ASP B CG  1 
ATOM   3440  O  OD1 . ASP B  1 15  ? -45.005 128.210 -2.998  1.00 32.20  ? 46   ASP B OD1 1 
ATOM   3441  O  OD2 . ASP B  1 15  ? -46.088 129.869 -2.086  1.00 36.81  ? 46   ASP B OD2 1 
ATOM   3442  N  N   . LYS B  1 16  ? -46.369 125.457 1.049   1.00 25.44  ? 47   LYS B N   1 
ATOM   3443  C  CA  . LYS B  1 16  ? -46.878 124.932 2.311   1.00 24.84  ? 47   LYS B CA  1 
ATOM   3444  C  C   . LYS B  1 16  ? -45.797 124.230 3.119   1.00 26.64  ? 47   LYS B C   1 
ATOM   3445  O  O   . LYS B  1 16  ? -45.721 124.439 4.316   1.00 27.52  ? 47   LYS B O   1 
ATOM   3446  C  CB  . LYS B  1 16  ? -48.058 123.997 2.102   1.00 22.55  ? 47   LYS B CB  1 
ATOM   3447  C  CG  . LYS B  1 16  ? -48.853 123.763 3.384   1.00 22.31  ? 47   LYS B CG  1 
ATOM   3448  C  CD  . LYS B  1 16  ? -50.099 122.952 3.070   1.00 24.83  ? 47   LYS B CD  1 
ATOM   3449  C  CE  . LYS B  1 16  ? -50.567 122.121 4.244   1.00 29.24  ? 47   LYS B CE  1 
ATOM   3450  N  NZ  . LYS B  1 16  ? -51.767 121.305 3.879   1.00 29.20  ? 47   LYS B NZ  1 
ATOM   3451  N  N   . GLU B  1 17  ? -44.983 123.448 2.428   1.00 29.30  ? 48   GLU B N   1 
ATOM   3452  C  CA  . GLU B  1 17  ? -43.893 122.718 3.087   1.00 30.71  ? 48   GLU B CA  1 
ATOM   3453  C  C   . GLU B  1 17  ? -43.042 123.723 3.865   1.00 30.20  ? 48   GLU B C   1 
ATOM   3454  O  O   . GLU B  1 17  ? -42.808 123.603 5.055   1.00 28.09  ? 48   GLU B O   1 
ATOM   3455  C  CB  . GLU B  1 17  ? -43.017 122.000 2.062   1.00 32.27  ? 48   GLU B CB  1 
ATOM   3456  C  CG  . GLU B  1 17  ? -43.704 120.852 1.354   1.00 35.63  ? 48   GLU B CG  1 
ATOM   3457  C  CD  . GLU B  1 17  ? -42.807 120.038 0.452   1.00 38.46  ? 48   GLU B CD  1 
ATOM   3458  O  OE1 . GLU B  1 17  ? -42.045 120.593 -0.368  1.00 38.96  ? 48   GLU B OE1 1 
ATOM   3459  O  OE2 . GLU B  1 17  ? -42.861 118.788 0.547   1.00 39.62  ? 48   GLU B OE2 1 
ATOM   3460  N  N   . LEU B  1 18  ? -42.623 124.748 3.139   1.00 31.49  ? 49   LEU B N   1 
ATOM   3461  C  CA  . LEU B  1 18  ? -41.924 125.882 3.711   1.00 33.32  ? 49   LEU B CA  1 
ATOM   3462  C  C   . LEU B  1 18  ? -42.651 126.453 4.923   1.00 33.07  ? 49   LEU B C   1 
ATOM   3463  O  O   . LEU B  1 18  ? -42.052 126.602 5.988   1.00 34.28  ? 49   LEU B O   1 
ATOM   3464  C  CB  . LEU B  1 18  ? -41.775 126.977 2.657   1.00 35.72  ? 49   LEU B CB  1 
ATOM   3465  C  CG  . LEU B  1 18  ? -41.290 128.360 3.069   1.00 38.66  ? 49   LEU B CG  1 
ATOM   3466  C  CD1 . LEU B  1 18  ? -40.057 128.347 3.965   1.00 37.75  ? 49   LEU B CD1 1 
ATOM   3467  C  CD2 . LEU B  1 18  ? -40.967 129.183 1.814   1.00 39.24  ? 49   LEU B CD2 1 
ATOM   3468  N  N   . ALA B  1 19  ? -43.926 126.800 4.775   1.00 31.92  ? 50   ALA B N   1 
ATOM   3469  C  CA  . ALA B  1 19  ? -44.674 127.412 5.865   1.00 29.79  ? 50   ALA B CA  1 
ATOM   3470  C  C   . ALA B  1 19  ? -44.667 126.538 7.106   1.00 28.21  ? 50   ALA B C   1 
ATOM   3471  O  O   . ALA B  1 19  ? -44.380 126.982 8.198   1.00 27.70  ? 50   ALA B O   1 
ATOM   3472  C  CB  . ALA B  1 19  ? -46.063 127.807 5.411   1.00 29.27  ? 50   ALA B CB  1 
ATOM   3473  N  N   . VAL B  1 20  ? -45.055 125.279 6.906   1.00 27.23  ? 51   VAL B N   1 
ATOM   3474  C  CA  . VAL B  1 20  ? -45.141 124.340 8.028   1.00 28.07  ? 51   VAL B CA  1 
ATOM   3475  C  C   . VAL B  1 20  ? -43.797 124.182 8.718   1.00 29.97  ? 51   VAL B C   1 
ATOM   3476  O  O   . VAL B  1 20  ? -43.660 123.987 9.926   1.00 30.17  ? 51   VAL B O   1 
ATOM   3477  C  CB  . VAL B  1 20  ? -45.674 122.970 7.548   1.00 26.04  ? 51   VAL B CB  1 
ATOM   3478  C  CG1 . VAL B  1 20  ? -45.981 122.062 8.730   1.00 25.09  ? 51   VAL B CG1 1 
ATOM   3479  C  CG2 . VAL B  1 20  ? -46.916 123.139 6.701   1.00 24.37  ? 51   VAL B CG2 1 
ATOM   3480  N  N   . GLN B  1 21  ? -42.724 124.234 7.924   1.00 30.15  ? 52   GLN B N   1 
ATOM   3481  C  CA  . GLN B  1 21  ? -41.389 124.169 8.505   1.00 30.12  ? 52   GLN B CA  1 
ATOM   3482  C  C   . GLN B  1 21  ? -41.106 125.459 9.266   1.00 28.80  ? 52   GLN B C   1 
ATOM   3483  O  O   . GLN B  1 21  ? -40.703 125.464 10.420  1.00 29.63  ? 52   GLN B O   1 
ATOM   3484  C  CB  . GLN B  1 21  ? -40.357 124.023 7.379   1.00 33.18  ? 52   GLN B CB  1 
ATOM   3485  C  CG  . GLN B  1 21  ? -39.026 123.456 7.868   1.00 38.79  ? 52   GLN B CG  1 
ATOM   3486  C  CD  . GLN B  1 21  ? -37.955 123.586 6.802   1.00 42.91  ? 52   GLN B CD  1 
ATOM   3487  O  OE1 . GLN B  1 21  ? -38.159 123.202 5.645   1.00 44.08  ? 52   GLN B OE1 1 
ATOM   3488  N  NE2 . GLN B  1 21  ? -36.793 124.134 7.147   1.00 42.58  ? 52   GLN B NE2 1 
ATOM   3489  N  N   . TYR B  1 22  ? -41.345 126.589 8.595   1.00 27.30  ? 53   TYR B N   1 
ATOM   3490  C  CA  . TYR B  1 22  ? -41.091 127.907 9.163   1.00 25.63  ? 53   TYR B CA  1 
ATOM   3491  C  C   . TYR B  1 22  ? -41.793 128.067 10.513  1.00 23.92  ? 53   TYR B C   1 
ATOM   3492  O  O   . TYR B  1 22  ? -41.217 128.492 11.505  1.00 23.40  ? 53   TYR B O   1 
ATOM   3493  C  CB  . TYR B  1 22  ? -41.577 129.012 8.241   1.00 25.58  ? 53   TYR B CB  1 
ATOM   3494  C  CG  . TYR B  1 22  ? -41.032 130.399 8.480   1.00 25.60  ? 53   TYR B CG  1 
ATOM   3495  C  CD1 . TYR B  1 22  ? -41.532 131.216 9.486   1.00 25.54  ? 53   TYR B CD1 1 
ATOM   3496  C  CD2 . TYR B  1 22  ? -40.022 130.937 7.687   1.00 24.35  ? 53   TYR B CD2 1 
ATOM   3497  C  CE1 . TYR B  1 22  ? -41.062 132.490 9.708   1.00 25.04  ? 53   TYR B CE1 1 
ATOM   3498  C  CE2 . TYR B  1 22  ? -39.548 132.212 7.899   1.00 24.51  ? 53   TYR B CE2 1 
ATOM   3499  C  CZ  . TYR B  1 22  ? -40.050 132.993 8.898   1.00 24.60  ? 53   TYR B CZ  1 
ATOM   3500  O  OH  . TYR B  1 22  ? -39.603 134.266 9.160   1.00 22.53  ? 53   TYR B OH  1 
ATOM   3501  N  N   . LEU B  1 23  ? -43.080 127.732 10.477  1.00 24.42  ? 54   LEU B N   1 
ATOM   3502  C  CA  . LEU B  1 23  ? -43.898 127.822 11.682  1.00 24.39  ? 54   LEU B CA  1 
ATOM   3503  C  C   . LEU B  1 23  ? -43.472 126.785 12.708  1.00 24.54  ? 54   LEU B C   1 
ATOM   3504  O  O   . LEU B  1 23  ? -43.542 127.032 13.911  1.00 22.91  ? 54   LEU B O   1 
ATOM   3505  C  CB  . LEU B  1 23  ? -45.361 127.647 11.336  1.00 20.71  ? 54   LEU B CB  1 
ATOM   3506  C  CG  . LEU B  1 23  ? -46.008 128.734 10.512  1.00 19.68  ? 54   LEU B CG  1 
ATOM   3507  C  CD1 . LEU B  1 23  ? -47.268 128.233 9.862   1.00 17.92  ? 54   LEU B CD1 1 
ATOM   3508  C  CD2 . LEU B  1 23  ? -46.264 129.964 11.369  1.00 18.87  ? 54   LEU B CD2 1 
ATOM   3509  N  N   . ASN B  1 24  ? -42.983 125.659 12.238  1.00 25.91  ? 55   ASN B N   1 
ATOM   3510  C  CA  . ASN B  1 24  ? -42.506 124.622 13.133  1.00 29.41  ? 55   ASN B CA  1 
ATOM   3511  C  C   . ASN B  1 24  ? -41.232 124.994 13.877  1.00 29.31  ? 55   ASN B C   1 
ATOM   3512  O  O   . ASN B  1 24  ? -41.038 124.556 15.023  1.00 29.28  ? 55   ASN B O   1 
ATOM   3513  C  CB  . ASN B  1 24  ? -42.298 123.315 12.366  1.00 32.88  ? 55   ASN B CB  1 
ATOM   3514  C  CG  . ASN B  1 24  ? -41.766 122.221 13.268  1.00 37.81  ? 55   ASN B CG  1 
ATOM   3515  O  OD1 . ASN B  1 24  ? -42.354 121.908 14.301  1.00 40.06  ? 55   ASN B OD1 1 
ATOM   3516  N  ND2 . ASN B  1 24  ? -40.639 121.640 12.874  1.00 40.33  ? 55   ASN B ND2 1 
ATOM   3517  N  N   . THR B  1 25  ? -40.331 125.737 13.232  1.00 27.49  ? 56   THR B N   1 
ATOM   3518  C  CA  . THR B  1 25  ? -39.067 126.113 13.854  1.00 24.35  ? 56   THR B CA  1 
ATOM   3519  C  C   . THR B  1 25  ? -39.231 127.383 14.688  1.00 26.12  ? 56   THR B C   1 
ATOM   3520  O  O   . THR B  1 25  ? -38.858 127.496 15.845  1.00 26.44  ? 56   THR B O   1 
ATOM   3521  C  CB  . THR B  1 25  ? -37.969 126.413 12.813  1.00 22.80  ? 56   THR B CB  1 
ATOM   3522  O  OG1 . THR B  1 25  ? -38.199 125.678 11.620  1.00 23.59  ? 56   THR B OG1 1 
ATOM   3523  C  CG2 . THR B  1 25  ? -36.591 126.084 13.369  1.00 19.01  ? 56   THR B CG2 1 
ATOM   3524  N  N   . PHE B  1 26  ? -39.827 128.385 14.061  1.00 27.71  ? 57   PHE B N   1 
ATOM   3525  C  CA  . PHE B  1 26  ? -40.001 129.691 14.639  1.00 27.34  ? 57   PHE B CA  1 
ATOM   3526  C  C   . PHE B  1 26  ? -41.212 129.923 15.488  1.00 28.20  ? 57   PHE B C   1 
ATOM   3527  O  O   . PHE B  1 26  ? -41.223 130.945 16.214  1.00 29.41  ? 57   PHE B O   1 
ATOM   3528  C  CB  . PHE B  1 26  ? -39.976 130.709 13.478  1.00 29.25  ? 57   PHE B CB  1 
ATOM   3529  C  CG  . PHE B  1 26  ? -38.746 130.536 12.615  1.00 27.86  ? 57   PHE B CG  1 
ATOM   3530  C  CD1 . PHE B  1 26  ? -37.497 130.377 13.176  1.00 27.98  ? 57   PHE B CD1 1 
ATOM   3531  C  CD2 . PHE B  1 26  ? -38.886 130.551 11.245  1.00 26.26  ? 57   PHE B CD2 1 
ATOM   3532  C  CE1 . PHE B  1 26  ? -36.385 130.230 12.364  1.00 29.69  ? 57   PHE B CE1 1 
ATOM   3533  C  CE2 . PHE B  1 26  ? -37.781 130.419 10.436  1.00 28.12  ? 57   PHE B CE2 1 
ATOM   3534  C  CZ  . PHE B  1 26  ? -36.535 130.260 10.994  1.00 29.24  ? 57   PHE B CZ  1 
ATOM   3535  N  N   . TYR B  1 27  ? -42.310 129.184 15.349  1.00 27.66  ? 58   TYR B N   1 
ATOM   3536  C  CA  . TYR B  1 27  ? -43.511 129.466 16.131  1.00 26.36  ? 58   TYR B CA  1 
ATOM   3537  C  C   . TYR B  1 27  ? -44.018 128.316 16.955  1.00 26.57  ? 58   TYR B C   1 
ATOM   3538  O  O   . TYR B  1 27  ? -44.976 128.441 17.722  1.00 26.66  ? 58   TYR B O   1 
ATOM   3539  C  CB  . TYR B  1 27  ? -44.616 130.093 15.261  1.00 26.69  ? 58   TYR B CB  1 
ATOM   3540  C  CG  . TYR B  1 27  ? -44.206 131.497 14.846  1.00 26.86  ? 58   TYR B CG  1 
ATOM   3541  C  CD1 . TYR B  1 27  ? -43.347 131.675 13.769  1.00 26.81  ? 58   TYR B CD1 1 
ATOM   3542  C  CD2 . TYR B  1 27  ? -44.601 132.608 15.556  1.00 26.48  ? 58   TYR B CD2 1 
ATOM   3543  C  CE1 . TYR B  1 27  ? -42.907 132.937 13.397  1.00 25.43  ? 58   TYR B CE1 1 
ATOM   3544  C  CE2 . TYR B  1 27  ? -44.183 133.864 15.199  1.00 26.02  ? 58   TYR B CE2 1 
ATOM   3545  C  CZ  . TYR B  1 27  ? -43.329 134.027 14.114  1.00 26.00  ? 58   TYR B CZ  1 
ATOM   3546  O  OH  . TYR B  1 27  ? -42.955 135.297 13.806  1.00 25.84  ? 58   TYR B OH  1 
ATOM   3547  N  N   . GLY B  1 28  ? -43.414 127.144 16.825  1.00 26.95  ? 59   GLY B N   1 
ATOM   3548  C  CA  . GLY B  1 28  ? -43.724 126.017 17.654  1.00 27.74  ? 59   GLY B CA  1 
ATOM   3549  C  C   . GLY B  1 28  ? -44.861 125.130 17.261  1.00 29.36  ? 59   GLY B C   1 
ATOM   3550  O  O   . GLY B  1 28  ? -45.118 124.142 17.980  1.00 29.93  ? 59   GLY B O   1 
ATOM   3551  N  N   . CYS B  1 29  ? -45.609 125.382 16.184  1.00 31.24  ? 60   CYS B N   1 
ATOM   3552  C  CA  . CYS B  1 29  ? -46.715 124.433 15.916  1.00 34.48  ? 60   CYS B CA  1 
ATOM   3553  C  C   . CYS B  1 29  ? -46.068 123.088 15.596  1.00 35.04  ? 60   CYS B C   1 
ATOM   3554  O  O   . CYS B  1 29  ? -45.066 123.031 14.889  1.00 32.76  ? 60   CYS B O   1 
ATOM   3555  C  CB  . CYS B  1 29  ? -47.653 124.920 14.824  1.00 34.13  ? 60   CYS B CB  1 
ATOM   3556  S  SG  . CYS B  1 29  ? -46.939 124.924 13.193  1.00 39.17  ? 60   CYS B SG  1 
ATOM   3557  N  N   . PRO B  1 30  ? -46.562 122.017 16.198  1.00 36.85  ? 61   PRO B N   1 
ATOM   3558  C  CA  . PRO B  1 30  ? -46.042 120.673 16.064  1.00 37.87  ? 61   PRO B CA  1 
ATOM   3559  C  C   . PRO B  1 30  ? -45.858 120.175 14.649  1.00 39.27  ? 61   PRO B C   1 
ATOM   3560  O  O   . PRO B  1 30  ? -46.707 120.369 13.786  1.00 40.03  ? 61   PRO B O   1 
ATOM   3561  C  CB  . PRO B  1 30  ? -47.092 119.821 16.783  1.00 37.48  ? 61   PRO B CB  1 
ATOM   3562  C  CG  . PRO B  1 30  ? -47.616 120.735 17.842  1.00 36.21  ? 61   PRO B CG  1 
ATOM   3563  C  CD  . PRO B  1 30  ? -47.709 122.066 17.150  1.00 36.07  ? 61   PRO B CD  1 
ATOM   3564  N  N   . LYS B  1 31  ? -44.783 119.427 14.421  1.00 41.86  ? 62   LYS B N   1 
ATOM   3565  C  CA  . LYS B  1 31  ? -44.463 118.890 13.108  1.00 44.99  ? 62   LYS B CA  1 
ATOM   3566  C  C   . LYS B  1 31  ? -45.685 118.201 12.503  1.00 47.16  ? 62   LYS B C   1 
ATOM   3567  O  O   . LYS B  1 31  ? -46.049 118.451 11.360  1.00 48.48  ? 62   LYS B O   1 
ATOM   3568  C  CB  . LYS B  1 31  ? -43.310 117.891 13.170  1.00 44.40  ? 62   LYS B CB  1 
ATOM   3569  C  CG  . LYS B  1 31  ? -42.001 118.434 13.710  1.00 46.34  ? 62   LYS B CG  1 
ATOM   3570  C  CD  . LYS B  1 31  ? -41.818 118.131 15.188  1.00 46.57  ? 62   LYS B CD  1 
ATOM   3571  C  CE  . LYS B  1 31  ? -42.441 119.176 16.091  1.00 46.46  ? 62   LYS B CE  1 
ATOM   3572  N  NZ  . LYS B  1 31  ? -43.285 118.587 17.169  1.00 44.08  ? 62   LYS B NZ  1 
ATOM   3573  N  N   . GLU B  1 32  ? -46.304 117.344 13.293  1.00 48.17  ? 63   GLU B N   1 
ATOM   3574  C  CA  . GLU B  1 32  ? -47.429 116.531 12.900  1.00 48.81  ? 63   GLU B CA  1 
ATOM   3575  C  C   . GLU B  1 32  ? -48.768 117.234 12.898  1.00 48.76  ? 63   GLU B C   1 
ATOM   3576  O  O   . GLU B  1 32  ? -49.483 117.208 11.887  1.00 48.27  ? 63   GLU B O   1 
ATOM   3577  C  CB  . GLU B  1 32  ? -47.482 115.269 13.772  1.00 51.40  ? 63   GLU B CB  1 
ATOM   3578  C  CG  . GLU B  1 32  ? -46.120 114.774 14.225  1.00 55.44  ? 63   GLU B CG  1 
ATOM   3579  C  CD  . GLU B  1 32  ? -45.173 114.405 13.105  1.00 57.41  ? 63   GLU B CD  1 
ATOM   3580  O  OE1 . GLU B  1 32  ? -45.498 114.624 11.917  1.00 57.63  ? 63   GLU B OE1 1 
ATOM   3581  O  OE2 . GLU B  1 32  ? -44.069 113.886 13.401  1.00 57.63  ? 63   GLU B OE2 1 
ATOM   3582  N  N   . SER B  1 33  ? -49.149 117.882 13.993  1.00 47.56  ? 64   SER B N   1 
ATOM   3583  C  CA  . SER B  1 33  ? -50.425 118.558 14.097  1.00 45.60  ? 64   SER B CA  1 
ATOM   3584  C  C   . SER B  1 33  ? -50.489 119.977 13.580  1.00 45.25  ? 64   SER B C   1 
ATOM   3585  O  O   . SER B  1 33  ? -51.458 120.700 13.882  1.00 45.14  ? 64   SER B O   1 
ATOM   3586  C  CB  . SER B  1 33  ? -50.955 118.490 15.533  1.00 45.22  ? 64   SER B CB  1 
ATOM   3587  O  OG  . SER B  1 33  ? -50.420 119.538 16.323  1.00 45.95  ? 64   SER B OG  1 
ATOM   3588  N  N   . CYS B  1 34  ? -49.549 120.448 12.768  1.00 43.62  ? 65   CYS B N   1 
ATOM   3589  C  CA  . CYS B  1 34  ? -49.614 121.798 12.210  1.00 41.01  ? 65   CYS B CA  1 
ATOM   3590  C  C   . CYS B  1 34  ? -50.330 121.795 10.859  1.00 40.72  ? 65   CYS B C   1 
ATOM   3591  O  O   . CYS B  1 34  ? -49.742 121.629 9.794   1.00 39.43  ? 65   CYS B O   1 
ATOM   3592  C  CB  . CYS B  1 34  ? -48.218 122.409 12.066  1.00 38.82  ? 65   CYS B CB  1 
ATOM   3593  S  SG  . CYS B  1 34  ? -48.262 124.209 11.905  1.00 35.73  ? 65   CYS B SG  1 
ATOM   3594  N  N   . ASN B  1 35  ? -51.648 121.952 10.934  1.00 40.64  ? 66   ASN B N   1 
ATOM   3595  C  CA  . ASN B  1 35  ? -52.581 121.869 9.835   1.00 40.81  ? 66   ASN B CA  1 
ATOM   3596  C  C   . ASN B  1 35  ? -53.885 122.623 10.078  1.00 39.90  ? 66   ASN B C   1 
ATOM   3597  O  O   . ASN B  1 35  ? -54.013 123.384 11.027  1.00 38.89  ? 66   ASN B O   1 
ATOM   3598  C  CB  . ASN B  1 35  ? -52.904 120.407 9.499   1.00 42.56  ? 66   ASN B CB  1 
ATOM   3599  C  CG  . ASN B  1 35  ? -53.435 119.644 10.694  1.00 46.05  ? 66   ASN B CG  1 
ATOM   3600  O  OD1 . ASN B  1 35  ? -54.303 120.123 11.424  1.00 48.57  ? 66   ASN B OD1 1 
ATOM   3601  N  ND2 . ASN B  1 35  ? -52.917 118.442 10.918  1.00 47.36  ? 66   ASN B ND2 1 
ATOM   3602  N  N   . LEU B  1 36  ? -54.849 122.413 9.191   1.00 40.52  ? 67   LEU B N   1 
ATOM   3603  C  CA  . LEU B  1 36  ? -56.100 123.105 9.170   1.00 41.28  ? 67   LEU B CA  1 
ATOM   3604  C  C   . LEU B  1 36  ? -56.321 124.105 10.298  1.00 40.51  ? 67   LEU B C   1 
ATOM   3605  O  O   . LEU B  1 36  ? -56.090 125.294 10.151  1.00 39.17  ? 67   LEU B O   1 
ATOM   3606  C  CB  . LEU B  1 36  ? -57.335 122.273 8.850   1.00 43.37  ? 67   LEU B CB  1 
ATOM   3607  C  CG  . LEU B  1 36  ? -58.599 123.071 8.522   1.00 45.36  ? 67   LEU B CG  1 
ATOM   3608  C  CD1 . LEU B  1 36  ? -58.277 124.218 7.574   1.00 50.71  ? 67   LEU B CD1 1 
ATOM   3609  C  CD2 . LEU B  1 36  ? -59.669 122.170 7.929   1.00 45.34  ? 67   LEU B CD2 1 
ATOM   3610  N  N   . PHE B  1 37  ? -56.773 123.780 11.482  1.00 39.50  ? 68   PHE B N   1 
ATOM   3611  C  CA  . PHE B  1 37  ? -57.014 124.912 12.380  1.00 37.95  ? 68   PHE B CA  1 
ATOM   3612  C  C   . PHE B  1 37  ? -55.750 125.416 13.077  1.00 36.98  ? 68   PHE B C   1 
ATOM   3613  O  O   . PHE B  1 37  ? -55.543 126.622 13.214  1.00 37.92  ? 68   PHE B O   1 
ATOM   3614  C  CB  . PHE B  1 37  ? -58.136 124.606 13.341  1.00 39.25  ? 68   PHE B CB  1 
ATOM   3615  C  CG  . PHE B  1 37  ? -59.446 124.515 12.630  1.00 40.89  ? 68   PHE B CG  1 
ATOM   3616  C  CD1 . PHE B  1 37  ? -59.858 125.528 11.775  1.00 41.20  ? 68   PHE B CD1 1 
ATOM   3617  C  CD2 . PHE B  1 37  ? -60.252 123.414 12.800  1.00 41.66  ? 68   PHE B CD2 1 
ATOM   3618  C  CE1 . PHE B  1 37  ? -61.061 125.436 11.103  1.00 41.22  ? 68   PHE B CE1 1 
ATOM   3619  C  CE2 . PHE B  1 37  ? -61.456 123.313 12.131  1.00 41.36  ? 68   PHE B CE2 1 
ATOM   3620  C  CZ  . PHE B  1 37  ? -61.862 124.324 11.281  1.00 39.92  ? 68   PHE B CZ  1 
ATOM   3621  N  N   . VAL B  1 38  ? -54.885 124.522 13.523  1.00 36.01  ? 69   VAL B N   1 
ATOM   3622  C  CA  . VAL B  1 38  ? -53.664 124.953 14.207  1.00 33.30  ? 69   VAL B CA  1 
ATOM   3623  C  C   . VAL B  1 38  ? -52.788 125.803 13.296  1.00 33.26  ? 69   VAL B C   1 
ATOM   3624  O  O   . VAL B  1 38  ? -52.278 126.838 13.716  1.00 33.04  ? 69   VAL B O   1 
ATOM   3625  C  CB  . VAL B  1 38  ? -52.875 123.743 14.741  1.00 32.66  ? 69   VAL B CB  1 
ATOM   3626  C  CG1 . VAL B  1 38  ? -51.492 124.168 15.203  1.00 33.34  ? 69   VAL B CG1 1 
ATOM   3627  C  CG2 . VAL B  1 38  ? -53.640 123.068 15.871  1.00 30.61  ? 69   VAL B CG2 1 
ATOM   3628  N  N   . LEU B  1 39  ? -52.660 125.395 12.041  1.00 32.58  ? 70   LEU B N   1 
ATOM   3629  C  CA  . LEU B  1 39  ? -51.881 126.128 11.052  1.00 31.96  ? 70   LEU B CA  1 
ATOM   3630  C  C   . LEU B  1 39  ? -52.437 127.537 10.876  1.00 33.91  ? 70   LEU B C   1 
ATOM   3631  O  O   . LEU B  1 39  ? -51.692 128.506 10.727  1.00 34.47  ? 70   LEU B O   1 
ATOM   3632  C  CB  . LEU B  1 39  ? -51.860 125.391 9.719   1.00 28.95  ? 70   LEU B CB  1 
ATOM   3633  C  CG  . LEU B  1 39  ? -51.355 126.149 8.500   1.00 25.84  ? 70   LEU B CG  1 
ATOM   3634  C  CD1 . LEU B  1 39  ? -49.864 126.425 8.622   1.00 28.37  ? 70   LEU B CD1 1 
ATOM   3635  C  CD2 . LEU B  1 39  ? -51.649 125.420 7.202   1.00 23.10  ? 70   LEU B CD2 1 
ATOM   3636  N  N   . LYS B  1 40  ? -53.763 127.642 10.937  1.00 34.93  ? 71   LYS B N   1 
ATOM   3637  C  CA  . LYS B  1 40  ? -54.439 128.911 10.793  1.00 35.05  ? 71   LYS B CA  1 
ATOM   3638  C  C   . LYS B  1 40  ? -54.040 129.885 11.881  1.00 34.25  ? 71   LYS B C   1 
ATOM   3639  O  O   . LYS B  1 40  ? -53.454 130.917 11.600  1.00 34.62  ? 71   LYS B O   1 
ATOM   3640  C  CB  . LYS B  1 40  ? -55.956 128.760 10.792  1.00 37.89  ? 71   LYS B CB  1 
ATOM   3641  C  CG  . LYS B  1 40  ? -56.619 128.974 9.442   1.00 42.08  ? 71   LYS B CG  1 
ATOM   3642  C  CD  . LYS B  1 40  ? -58.136 128.995 9.583   1.00 44.37  ? 71   LYS B CD  1 
ATOM   3643  C  CE  . LYS B  1 40  ? -58.835 128.591 8.297   1.00 46.97  ? 71   LYS B CE  1 
ATOM   3644  N  NZ  . LYS B  1 40  ? -60.216 129.141 8.192   1.00 44.19  ? 71   LYS B NZ  1 
ATOM   3645  N  N   . ASP B  1 41  ? -54.350 129.551 13.130  1.00 35.38  ? 72   ASP B N   1 
ATOM   3646  C  CA  . ASP B  1 41  ? -54.112 130.515 14.195  1.00 38.94  ? 72   ASP B CA  1 
ATOM   3647  C  C   . ASP B  1 41  ? -52.675 130.598 14.637  1.00 38.69  ? 72   ASP B C   1 
ATOM   3648  O  O   . ASP B  1 41  ? -52.298 131.393 15.500  1.00 39.68  ? 72   ASP B O   1 
ATOM   3649  C  CB  . ASP B  1 41  ? -55.098 130.373 15.332  1.00 42.67  ? 72   ASP B CB  1 
ATOM   3650  C  CG  . ASP B  1 41  ? -54.648 129.413 16.404  1.00 46.11  ? 72   ASP B CG  1 
ATOM   3651  O  OD1 . ASP B  1 41  ? -53.584 129.648 17.012  1.00 51.19  ? 72   ASP B OD1 1 
ATOM   3652  O  OD2 . ASP B  1 41  ? -55.362 128.420 16.641  1.00 46.60  ? 72   ASP B OD2 1 
ATOM   3653  N  N   . THR B  1 42  ? -51.829 129.771 14.042  1.00 37.56  ? 73   THR B N   1 
ATOM   3654  C  CA  . THR B  1 42  ? -50.398 129.851 14.307  1.00 35.44  ? 73   THR B CA  1 
ATOM   3655  C  C   . THR B  1 42  ? -49.796 130.763 13.228  1.00 33.85  ? 73   THR B C   1 
ATOM   3656  O  O   . THR B  1 42  ? -48.838 131.475 13.450  1.00 34.41  ? 73   THR B O   1 
ATOM   3657  C  CB  . THR B  1 42  ? -49.709 128.489 14.242  1.00 37.09  ? 73   THR B CB  1 
ATOM   3658  O  OG1 . THR B  1 42  ? -50.077 127.712 15.391  1.00 38.97  ? 73   THR B OG1 1 
ATOM   3659  C  CG2 . THR B  1 42  ? -48.198 128.687 14.280  1.00 36.27  ? 73   THR B CG2 1 
ATOM   3660  N  N   . LEU B  1 43  ? -50.442 130.731 12.063  1.00 30.72  ? 74   LEU B N   1 
ATOM   3661  C  CA  . LEU B  1 43  ? -50.043 131.624 10.972  1.00 27.18  ? 74   LEU B CA  1 
ATOM   3662  C  C   . LEU B  1 43  ? -50.288 133.050 11.472  1.00 28.13  ? 74   LEU B C   1 
ATOM   3663  O  O   . LEU B  1 43  ? -49.505 133.967 11.269  1.00 29.82  ? 74   LEU B O   1 
ATOM   3664  C  CB  . LEU B  1 43  ? -50.880 131.391 9.737   1.00 23.38  ? 74   LEU B CB  1 
ATOM   3665  C  CG  . LEU B  1 43  ? -50.354 130.851 8.442   1.00 20.47  ? 74   LEU B CG  1 
ATOM   3666  C  CD1 . LEU B  1 43  ? -48.862 130.716 8.350   1.00 20.32  ? 74   LEU B CD1 1 
ATOM   3667  C  CD2 . LEU B  1 43  ? -51.057 129.571 8.026   1.00 18.63  ? 74   LEU B CD2 1 
ATOM   3668  N  N   . LYS B  1 44  ? -51.405 133.245 12.171  1.00 29.35  ? 75   LYS B N   1 
ATOM   3669  C  CA  . LYS B  1 44  ? -51.742 134.581 12.651  1.00 30.99  ? 75   LYS B CA  1 
ATOM   3670  C  C   . LYS B  1 44  ? -50.727 135.144 13.634  1.00 30.64  ? 75   LYS B C   1 
ATOM   3671  O  O   . LYS B  1 44  ? -50.542 136.359 13.706  1.00 30.12  ? 75   LYS B O   1 
ATOM   3672  C  CB  . LYS B  1 44  ? -53.133 134.610 13.260  1.00 32.50  ? 75   LYS B CB  1 
ATOM   3673  C  CG  . LYS B  1 44  ? -54.264 134.195 12.343  1.00 34.18  ? 75   LYS B CG  1 
ATOM   3674  C  CD  . LYS B  1 44  ? -55.449 135.141 12.446  1.00 36.30  ? 75   LYS B CD  1 
ATOM   3675  C  CE  . LYS B  1 44  ? -56.763 134.386 12.529  1.00 35.66  ? 75   LYS B CE  1 
ATOM   3676  N  NZ  . LYS B  1 44  ? -57.032 133.866 13.899  1.00 35.98  ? 75   LYS B NZ  1 
ATOM   3677  N  N   . LYS B  1 45  ? -50.122 134.284 14.438  1.00 29.49  ? 76   LYS B N   1 
ATOM   3678  C  CA  . LYS B  1 45  ? -49.129 134.676 15.421  1.00 27.37  ? 76   LYS B CA  1 
ATOM   3679  C  C   . LYS B  1 45  ? -47.906 135.288 14.733  1.00 25.31  ? 76   LYS B C   1 
ATOM   3680  O  O   . LYS B  1 45  ? -47.326 136.256 15.214  1.00 24.13  ? 76   LYS B O   1 
ATOM   3681  C  CB  . LYS B  1 45  ? -48.656 133.462 16.228  1.00 29.00  ? 76   LYS B CB  1 
ATOM   3682  C  CG  . LYS B  1 45  ? -49.376 133.242 17.545  1.00 31.84  ? 76   LYS B CG  1 
ATOM   3683  C  CD  . LYS B  1 45  ? -48.542 132.457 18.545  1.00 35.14  ? 76   LYS B CD  1 
ATOM   3684  C  CE  . LYS B  1 45  ? -49.399 131.724 19.563  1.00 36.73  ? 76   LYS B CE  1 
ATOM   3685  N  NZ  . LYS B  1 45  ? -48.653 130.622 20.238  1.00 37.56  ? 76   LYS B NZ  1 
ATOM   3686  N  N   . MET B  1 46  ? -47.507 134.640 13.653  1.00 23.53  ? 77   MET B N   1 
ATOM   3687  C  CA  . MET B  1 46  ? -46.350 135.050 12.867  1.00 22.62  ? 77   MET B CA  1 
ATOM   3688  C  C   . MET B  1 46  ? -46.696 136.262 12.034  1.00 24.26  ? 77   MET B C   1 
ATOM   3689  O  O   . MET B  1 46  ? -46.024 137.285 11.990  1.00 24.08  ? 77   MET B O   1 
ATOM   3690  C  CB  . MET B  1 46  ? -45.833 133.872 12.051  1.00 18.86  ? 77   MET B CB  1 
ATOM   3691  C  CG  . MET B  1 46  ? -46.277 133.879 10.598  1.00 16.17  ? 77   MET B CG  1 
ATOM   3692  S  SD  . MET B  1 46  ? -45.097 134.944 9.672   1.00 22.83  ? 77   MET B SD  1 
ATOM   3693  C  CE  . MET B  1 46  ? -45.956 134.994 8.104   1.00 19.74  ? 77   MET B CE  1 
ATOM   3694  N  N   . GLN B  1 47  ? -47.902 136.197 11.462  1.00 27.77  ? 78   GLN B N   1 
ATOM   3695  C  CA  . GLN B  1 47  ? -48.383 137.320 10.657  1.00 29.72  ? 78   GLN B CA  1 
ATOM   3696  C  C   . GLN B  1 47  ? -48.399 138.606 11.475  1.00 28.16  ? 78   GLN B C   1 
ATOM   3697  O  O   . GLN B  1 47  ? -48.125 139.672 10.955  1.00 27.24  ? 78   GLN B O   1 
ATOM   3698  C  CB  . GLN B  1 47  ? -49.792 137.007 10.134  1.00 29.86  ? 78   GLN B CB  1 
ATOM   3699  C  CG  . GLN B  1 47  ? -49.787 135.852 9.138   1.00 31.62  ? 78   GLN B CG  1 
ATOM   3700  C  CD  . GLN B  1 47  ? -51.187 135.341 8.890   1.00 35.63  ? 78   GLN B CD  1 
ATOM   3701  O  OE1 . GLN B  1 47  ? -51.993 135.157 9.799   1.00 37.32  ? 78   GLN B OE1 1 
ATOM   3702  N  NE2 . GLN B  1 47  ? -51.509 135.113 7.626   1.00 37.24  ? 78   GLN B NE2 1 
ATOM   3703  N  N   . LYS B  1 48  ? -48.761 138.487 12.738  1.00 28.32  ? 79   LYS B N   1 
ATOM   3704  C  CA  . LYS B  1 48  ? -48.844 139.578 13.682  1.00 28.87  ? 79   LYS B CA  1 
ATOM   3705  C  C   . LYS B  1 48  ? -47.456 140.093 14.051  1.00 29.12  ? 79   LYS B C   1 
ATOM   3706  O  O   . LYS B  1 48  ? -47.212 141.289 14.106  1.00 29.76  ? 79   LYS B O   1 
ATOM   3707  C  CB  . LYS B  1 48  ? -49.534 139.126 14.975  1.00 28.61  ? 79   LYS B CB  1 
ATOM   3708  C  CG  . LYS B  1 48  ? -49.834 140.270 15.932  1.00 30.74  ? 79   LYS B CG  1 
ATOM   3709  C  CD  . LYS B  1 48  ? -51.002 139.899 16.837  1.00 33.90  ? 79   LYS B CD  1 
ATOM   3710  C  CE  . LYS B  1 48  ? -50.562 139.823 18.286  1.00 35.75  ? 79   LYS B CE  1 
ATOM   3711  N  NZ  . LYS B  1 48  ? -49.892 141.093 18.704  1.00 41.88  ? 79   LYS B NZ  1 
ATOM   3712  N  N   . PHE B  1 49  ? -46.557 139.151 14.299  1.00 29.07  ? 80   PHE B N   1 
ATOM   3713  C  CA  . PHE B  1 49  ? -45.179 139.478 14.607  1.00 28.54  ? 80   PHE B CA  1 
ATOM   3714  C  C   . PHE B  1 49  ? -44.587 140.366 13.524  1.00 28.94  ? 80   PHE B C   1 
ATOM   3715  O  O   . PHE B  1 49  ? -44.052 141.426 13.836  1.00 32.19  ? 80   PHE B O   1 
ATOM   3716  C  CB  . PHE B  1 49  ? -44.344 138.196 14.745  1.00 27.93  ? 80   PHE B CB  1 
ATOM   3717  C  CG  . PHE B  1 49  ? -42.972 138.472 15.293  1.00 27.24  ? 80   PHE B CG  1 
ATOM   3718  C  CD1 . PHE B  1 49  ? -41.968 138.932 14.460  1.00 26.34  ? 80   PHE B CD1 1 
ATOM   3719  C  CD2 . PHE B  1 49  ? -42.696 138.295 16.637  1.00 26.59  ? 80   PHE B CD2 1 
ATOM   3720  C  CE1 . PHE B  1 49  ? -40.706 139.212 14.943  1.00 24.54  ? 80   PHE B CE1 1 
ATOM   3721  C  CE2 . PHE B  1 49  ? -41.440 138.573 17.134  1.00 26.67  ? 80   PHE B CE2 1 
ATOM   3722  C  CZ  . PHE B  1 49  ? -40.451 139.021 16.285  1.00 26.24  ? 80   PHE B CZ  1 
ATOM   3723  N  N   . PHE B  1 50  ? -44.688 139.971 12.263  1.00 28.46  ? 81   PHE B N   1 
ATOM   3724  C  CA  . PHE B  1 50  ? -44.126 140.733 11.161  1.00 28.72  ? 81   PHE B CA  1 
ATOM   3725  C  C   . PHE B  1 50  ? -45.024 141.835 10.633  1.00 29.85  ? 81   PHE B C   1 
ATOM   3726  O  O   . PHE B  1 50  ? -44.720 142.444 9.598   1.00 30.17  ? 81   PHE B O   1 
ATOM   3727  C  CB  . PHE B  1 50  ? -43.683 139.797 10.024  1.00 27.56  ? 81   PHE B CB  1 
ATOM   3728  C  CG  . PHE B  1 50  ? -42.628 138.813 10.460  1.00 25.89  ? 81   PHE B CG  1 
ATOM   3729  C  CD1 . PHE B  1 50  ? -41.326 139.236 10.661  1.00 23.15  ? 81   PHE B CD1 1 
ATOM   3730  C  CD2 . PHE B  1 50  ? -42.930 137.481 10.684  1.00 26.74  ? 81   PHE B CD2 1 
ATOM   3731  C  CE1 . PHE B  1 50  ? -40.354 138.357 11.071  1.00 23.95  ? 81   PHE B CE1 1 
ATOM   3732  C  CE2 . PHE B  1 50  ? -41.962 136.596 11.098  1.00 26.71  ? 81   PHE B CE2 1 
ATOM   3733  C  CZ  . PHE B  1 50  ? -40.664 137.028 11.293  1.00 25.82  ? 81   PHE B CZ  1 
ATOM   3734  N  N   . GLY B  1 51  ? -46.129 142.126 11.311  1.00 29.35  ? 82   GLY B N   1 
ATOM   3735  C  CA  . GLY B  1 51  ? -47.048 143.172 10.924  1.00 30.31  ? 82   GLY B CA  1 
ATOM   3736  C  C   . GLY B  1 51  ? -47.740 142.911 9.604   1.00 32.16  ? 82   GLY B C   1 
ATOM   3737  O  O   . GLY B  1 51  ? -48.009 143.794 8.785   1.00 32.50  ? 82   GLY B O   1 
ATOM   3738  N  N   . LEU B  1 52  ? -48.043 141.639 9.357   1.00 32.89  ? 83   LEU B N   1 
ATOM   3739  C  CA  . LEU B  1 52  ? -48.752 141.271 8.123   1.00 31.16  ? 83   LEU B CA  1 
ATOM   3740  C  C   . LEU B  1 52  ? -50.240 141.217 8.425   1.00 31.32  ? 83   LEU B C   1 
ATOM   3741  O  O   . LEU B  1 52  ? -50.616 141.116 9.598   1.00 32.41  ? 83   LEU B O   1 
ATOM   3742  C  CB  . LEU B  1 52  ? -48.223 139.921 7.637   1.00 26.94  ? 83   LEU B CB  1 
ATOM   3743  C  CG  . LEU B  1 52  ? -46.807 139.957 7.055   1.00 25.33  ? 83   LEU B CG  1 
ATOM   3744  C  CD1 . LEU B  1 52  ? -46.223 138.558 6.984   1.00 26.47  ? 83   LEU B CD1 1 
ATOM   3745  C  CD2 . LEU B  1 52  ? -46.822 140.601 5.680   1.00 23.15  ? 83   LEU B CD2 1 
ATOM   3746  N  N   . PRO B  1 53  ? -51.089 141.239 7.416   1.00 30.84  ? 84   PRO B N   1 
ATOM   3747  C  CA  . PRO B  1 53  ? -52.523 141.184 7.550   1.00 30.00  ? 84   PRO B CA  1 
ATOM   3748  C  C   . PRO B  1 53  ? -53.093 140.217 8.525   1.00 30.19  ? 84   PRO B C   1 
ATOM   3749  O  O   . PRO B  1 53  ? -54.236 140.397 8.989   1.00 34.58  ? 84   PRO B O   1 
ATOM   3750  C  CB  . PRO B  1 53  ? -53.037 141.038 6.126   1.00 29.75  ? 84   PRO B CB  1 
ATOM   3751  C  CG  . PRO B  1 53  ? -52.030 141.852 5.378   1.00 29.96  ? 84   PRO B CG  1 
ATOM   3752  C  CD  . PRO B  1 53  ? -50.702 141.409 5.984   1.00 30.97  ? 84   PRO B CD  1 
ATOM   3753  N  N   . GLN B  1 54  ? -52.424 139.174 8.981   1.00 28.20  ? 85   GLN B N   1 
ATOM   3754  C  CA  . GLN B  1 54  ? -53.016 138.373 10.057  1.00 27.67  ? 85   GLN B CA  1 
ATOM   3755  C  C   . GLN B  1 54  ? -54.308 137.722 9.579   1.00 26.66  ? 85   GLN B C   1 
ATOM   3756  O  O   . GLN B  1 54  ? -55.271 137.591 10.326  1.00 23.70  ? 85   GLN B O   1 
ATOM   3757  C  CB  . GLN B  1 54  ? -53.344 139.251 11.277  1.00 27.89  ? 85   GLN B CB  1 
ATOM   3758  C  CG  . GLN B  1 54  ? -53.442 138.486 12.582  1.00 30.80  ? 85   GLN B CG  1 
ATOM   3759  C  CD  . GLN B  1 54  ? -53.092 139.284 13.817  1.00 30.81  ? 85   GLN B CD  1 
ATOM   3760  O  OE1 . GLN B  1 54  ? -53.266 138.784 14.935  1.00 30.63  ? 85   GLN B OE1 1 
ATOM   3761  N  NE2 . GLN B  1 54  ? -52.605 140.507 13.637  1.00 29.55  ? 85   GLN B NE2 1 
ATOM   3762  N  N   . THR B  1 55  ? -54.297 137.290 8.331   1.00 25.69  ? 86   THR B N   1 
ATOM   3763  C  CA  . THR B  1 55  ? -55.402 136.626 7.685   1.00 25.21  ? 86   THR B CA  1 
ATOM   3764  C  C   . THR B  1 55  ? -55.561 135.226 8.252   1.00 25.88  ? 86   THR B C   1 
ATOM   3765  O  O   . THR B  1 55  ? -56.648 134.659 8.225   1.00 27.12  ? 86   THR B O   1 
ATOM   3766  C  CB  . THR B  1 55  ? -55.209 136.506 6.154   1.00 25.77  ? 86   THR B CB  1 
ATOM   3767  O  OG1 . THR B  1 55  ? -54.040 135.732 5.919   1.00 25.63  ? 86   THR B OG1 1 
ATOM   3768  C  CG2 . THR B  1 55  ? -55.071 137.879 5.527   1.00 28.38  ? 86   THR B CG2 1 
ATOM   3769  N  N   . GLY B  1 56  ? -54.457 134.605 8.674   1.00 26.61  ? 87   GLY B N   1 
ATOM   3770  C  CA  . GLY B  1 56  ? -54.561 133.233 9.186   1.00 25.56  ? 87   GLY B CA  1 
ATOM   3771  C  C   . GLY B  1 56  ? -54.403 132.218 8.067   1.00 25.59  ? 87   GLY B C   1 
ATOM   3772  O  O   . GLY B  1 56  ? -54.338 131.010 8.320   1.00 24.62  ? 87   GLY B O   1 
ATOM   3773  N  N   . ASP B  1 57  ? -54.364 132.687 6.832   1.00 25.46  ? 88   ASP B N   1 
ATOM   3774  C  CA  . ASP B  1 57  ? -54.186 131.829 5.674   1.00 27.03  ? 88   ASP B CA  1 
ATOM   3775  C  C   . ASP B  1 57  ? -52.739 131.885 5.213   1.00 27.21  ? 88   ASP B C   1 
ATOM   3776  O  O   . ASP B  1 57  ? -51.932 132.675 5.668   1.00 29.48  ? 88   ASP B O   1 
ATOM   3777  C  CB  . ASP B  1 57  ? -55.081 132.283 4.514   1.00 29.57  ? 88   ASP B CB  1 
ATOM   3778  C  CG  . ASP B  1 57  ? -56.464 132.684 4.991   1.00 32.55  ? 88   ASP B CG  1 
ATOM   3779  O  OD1 . ASP B  1 57  ? -57.246 131.759 5.303   1.00 33.33  ? 88   ASP B OD1 1 
ATOM   3780  O  OD2 . ASP B  1 57  ? -56.710 133.906 5.038   1.00 32.67  ? 88   ASP B OD2 1 
ATOM   3781  N  N   . LEU B  1 58  ? -52.446 131.149 4.170   1.00 28.46  ? 89   LEU B N   1 
ATOM   3782  C  CA  . LEU B  1 58  ? -51.119 131.166 3.541   1.00 28.80  ? 89   LEU B CA  1 
ATOM   3783  C  C   . LEU B  1 58  ? -51.185 132.188 2.418   1.00 30.77  ? 89   LEU B C   1 
ATOM   3784  O  O   . LEU B  1 58  ? -51.964 131.980 1.493   1.00 32.73  ? 89   LEU B O   1 
ATOM   3785  C  CB  . LEU B  1 58  ? -50.959 129.775 2.951   1.00 27.48  ? 89   LEU B CB  1 
ATOM   3786  C  CG  . LEU B  1 58  ? -49.584 129.332 2.508   1.00 27.20  ? 89   LEU B CG  1 
ATOM   3787  C  CD1 . LEU B  1 58  ? -48.493 129.934 3.362   1.00 28.20  ? 89   LEU B CD1 1 
ATOM   3788  C  CD2 . LEU B  1 58  ? -49.564 127.819 2.632   1.00 25.80  ? 89   LEU B CD2 1 
ATOM   3789  N  N   . ASP B  1 59  ? -50.449 133.280 2.440   1.00 34.05  ? 90   ASP B N   1 
ATOM   3790  C  CA  . ASP B  1 59  ? -50.713 134.204 1.332   1.00 35.66  ? 90   ASP B CA  1 
ATOM   3791  C  C   . ASP B  1 59  ? -49.453 134.883 0.869   1.00 37.45  ? 90   ASP B C   1 
ATOM   3792  O  O   . ASP B  1 59  ? -48.542 135.091 1.665   1.00 40.00  ? 90   ASP B O   1 
ATOM   3793  C  CB  . ASP B  1 59  ? -51.808 135.191 1.724   1.00 33.48  ? 90   ASP B CB  1 
ATOM   3794  C  CG  . ASP B  1 59  ? -51.519 135.967 2.988   1.00 35.38  ? 90   ASP B CG  1 
ATOM   3795  O  OD1 . ASP B  1 59  ? -51.583 135.353 4.068   1.00 36.84  ? 90   ASP B OD1 1 
ATOM   3796  O  OD2 . ASP B  1 59  ? -51.247 137.187 2.961   1.00 36.15  ? 90   ASP B OD2 1 
ATOM   3797  N  N   . GLN B  1 60  ? -49.468 135.246 -0.406  1.00 38.76  ? 91   GLN B N   1 
ATOM   3798  C  CA  . GLN B  1 60  ? -48.340 135.938 -1.006  1.00 40.57  ? 91   GLN B CA  1 
ATOM   3799  C  C   . GLN B  1 60  ? -47.626 136.820 0.014   1.00 39.24  ? 91   GLN B C   1 
ATOM   3800  O  O   . GLN B  1 60  ? -46.399 136.845 0.081   1.00 38.61  ? 91   GLN B O   1 
ATOM   3801  C  CB  . GLN B  1 60  ? -48.796 136.702 -2.244  1.00 42.72  ? 91   GLN B CB  1 
ATOM   3802  C  CG  . GLN B  1 60  ? -47.663 137.280 -3.072  1.00 46.82  ? 91   GLN B CG  1 
ATOM   3803  C  CD  . GLN B  1 60  ? -46.725 136.213 -3.593  1.00 50.21  ? 91   GLN B CD  1 
ATOM   3804  O  OE1 . GLN B  1 60  ? -47.164 135.177 -4.092  1.00 51.27  ? 91   GLN B OE1 1 
ATOM   3805  N  NE2 . GLN B  1 60  ? -45.399 136.258 -3.578  1.00 51.93  ? 91   GLN B NE2 1 
ATOM   3806  N  N   . ASN B  1 61  ? -48.383 137.541 0.826   1.00 39.82  ? 92   ASN B N   1 
ATOM   3807  C  CA  . ASN B  1 61  ? -47.789 138.417 1.830   1.00 39.49  ? 92   ASN B CA  1 
ATOM   3808  C  C   . ASN B  1 61  ? -46.942 137.649 2.852   1.00 36.94  ? 92   ASN B C   1 
ATOM   3809  O  O   . ASN B  1 61  ? -45.834 138.063 3.194   1.00 37.93  ? 92   ASN B O   1 
ATOM   3810  C  CB  . ASN B  1 61  ? -48.870 139.202 2.563   1.00 43.66  ? 92   ASN B CB  1 
ATOM   3811  C  CG  . ASN B  1 61  ? -48.664 140.696 2.471   1.00 45.58  ? 92   ASN B CG  1 
ATOM   3812  O  OD1 . ASN B  1 61  ? -47.535 141.170 2.348   1.00 47.67  ? 92   ASN B OD1 1 
ATOM   3813  N  ND2 . ASN B  1 61  ? -49.759 141.443 2.530   1.00 46.83  ? 92   ASN B ND2 1 
ATOM   3814  N  N   . THR B  1 62  ? -47.458 136.524 3.354   1.00 34.65  ? 93   THR B N   1 
ATOM   3815  C  CA  . THR B  1 62  ? -46.729 135.753 4.366   1.00 33.17  ? 93   THR B CA  1 
ATOM   3816  C  C   . THR B  1 62  ? -45.764 134.746 3.748   1.00 34.50  ? 93   THR B C   1 
ATOM   3817  O  O   . THR B  1 62  ? -44.796 134.328 4.383   1.00 36.00  ? 93   THR B O   1 
ATOM   3818  C  CB  . THR B  1 62  ? -47.670 134.999 5.310   1.00 31.35  ? 93   THR B CB  1 
ATOM   3819  O  OG1 . THR B  1 62  ? -47.481 133.587 5.154   1.00 29.90  ? 93   THR B OG1 1 
ATOM   3820  C  CG2 . THR B  1 62  ? -49.117 135.359 5.024   1.00 27.49  ? 93   THR B CG2 1 
ATOM   3821  N  N   . ILE B  1 63  ? -46.019 134.344 2.511   1.00 34.80  ? 94   ILE B N   1 
ATOM   3822  C  CA  . ILE B  1 63  ? -45.140 133.397 1.842   1.00 35.80  ? 94   ILE B CA  1 
ATOM   3823  C  C   . ILE B  1 63  ? -43.823 134.053 1.447   1.00 35.56  ? 94   ILE B C   1 
ATOM   3824  O  O   . ILE B  1 63  ? -42.753 133.575 1.769   1.00 36.99  ? 94   ILE B O   1 
ATOM   3825  C  CB  . ILE B  1 63  ? -45.770 132.810 0.564   1.00 36.32  ? 94   ILE B CB  1 
ATOM   3826  C  CG1 . ILE B  1 63  ? -47.110 132.145 0.874   1.00 37.21  ? 94   ILE B CG1 1 
ATOM   3827  C  CG2 . ILE B  1 63  ? -44.816 131.819 -0.089  1.00 35.45  ? 94   ILE B CG2 1 
ATOM   3828  C  CD1 . ILE B  1 63  ? -47.946 131.864 -0.356  1.00 37.94  ? 94   ILE B CD1 1 
ATOM   3829  N  N   . GLU B  1 64  ? -43.939 135.161 0.733   1.00 34.51  ? 95   GLU B N   1 
ATOM   3830  C  CA  . GLU B  1 64  ? -42.793 135.923 0.277   1.00 33.88  ? 95   GLU B CA  1 
ATOM   3831  C  C   . GLU B  1 64  ? -42.016 136.512 1.441   1.00 31.81  ? 95   GLU B C   1 
ATOM   3832  O  O   . GLU B  1 64  ? -40.838 136.860 1.304   1.00 31.51  ? 95   GLU B O   1 
ATOM   3833  C  CB  . GLU B  1 64  ? -43.228 136.972 -0.739  1.00 35.27  ? 95   GLU B CB  1 
ATOM   3834  C  CG  . GLU B  1 64  ? -43.588 138.330 -0.171  1.00 41.69  ? 95   GLU B CG  1 
ATOM   3835  C  CD  . GLU B  1 64  ? -44.082 139.295 -1.231  1.00 45.13  ? 95   GLU B CD  1 
ATOM   3836  O  OE1 . GLU B  1 64  ? -43.605 139.201 -2.385  1.00 45.09  ? 95   GLU B OE1 1 
ATOM   3837  O  OE2 . GLU B  1 64  ? -44.948 140.146 -0.929  1.00 45.59  ? 95   GLU B OE2 1 
ATOM   3838  N  N   . THR B  1 65  ? -42.636 136.587 2.606   1.00 29.18  ? 96   THR B N   1 
ATOM   3839  C  CA  . THR B  1 65  ? -41.965 137.088 3.795   1.00 29.29  ? 96   THR B CA  1 
ATOM   3840  C  C   . THR B  1 65  ? -41.176 135.948 4.434   1.00 30.91  ? 96   THR B C   1 
ATOM   3841  O  O   . THR B  1 65  ? -40.062 136.147 4.888   1.00 32.54  ? 96   THR B O   1 
ATOM   3842  C  CB  . THR B  1 65  ? -42.962 137.631 4.832   1.00 29.20  ? 96   THR B CB  1 
ATOM   3843  O  OG1 . THR B  1 65  ? -43.407 138.933 4.436   1.00 31.79  ? 96   THR B OG1 1 
ATOM   3844  C  CG2 . THR B  1 65  ? -42.349 137.712 6.215   1.00 28.76  ? 96   THR B CG2 1 
ATOM   3845  N  N   . MET B  1 66  ? -41.788 134.774 4.419   1.00 30.92  ? 97   MET B N   1 
ATOM   3846  C  CA  . MET B  1 66  ? -41.225 133.564 4.975   1.00 29.34  ? 97   MET B CA  1 
ATOM   3847  C  C   . MET B  1 66  ? -40.024 133.067 4.183   1.00 29.57  ? 97   MET B C   1 
ATOM   3848  O  O   . MET B  1 66  ? -39.223 132.304 4.730   1.00 30.95  ? 97   MET B O   1 
ATOM   3849  C  CB  . MET B  1 66  ? -42.277 132.454 5.108   1.00 28.82  ? 97   MET B CB  1 
ATOM   3850  C  CG  . MET B  1 66  ? -43.024 132.408 6.435   1.00 24.31  ? 97   MET B CG  1 
ATOM   3851  S  SD  . MET B  1 66  ? -44.388 131.233 6.524   1.00 18.20  ? 97   MET B SD  1 
ATOM   3852  C  CE  . MET B  1 66  ? -44.359 130.575 4.853   1.00 18.29  ? 97   MET B CE  1 
ATOM   3853  N  N   . ARG B  1 67  ? -39.867 133.535 2.955   1.00 29.35  ? 98   ARG B N   1 
ATOM   3854  C  CA  . ARG B  1 67  ? -38.733 133.143 2.127   1.00 31.48  ? 98   ARG B CA  1 
ATOM   3855  C  C   . ARG B  1 67  ? -37.582 134.130 2.284   1.00 31.05  ? 98   ARG B C   1 
ATOM   3856  O  O   . ARG B  1 67  ? -36.628 134.141 1.497   1.00 31.73  ? 98   ARG B O   1 
ATOM   3857  C  CB  . ARG B  1 67  ? -39.111 133.055 0.660   1.00 34.92  ? 98   ARG B CB  1 
ATOM   3858  C  CG  . ARG B  1 67  ? -40.258 132.147 0.310   1.00 43.06  ? 98   ARG B CG  1 
ATOM   3859  C  CD  . ARG B  1 67  ? -40.379 131.982 -1.198  1.00 50.96  ? 98   ARG B CD  1 
ATOM   3860  N  NE  . ARG B  1 67  ? -41.651 131.381 -1.577  1.00 60.28  ? 98   ARG B NE  1 
ATOM   3861  C  CZ  . ARG B  1 67  ? -41.960 130.994 -2.810  1.00 63.95  ? 98   ARG B CZ  1 
ATOM   3862  N  NH1 . ARG B  1 67  ? -41.070 131.146 -3.786  1.00 67.13  ? 98   ARG B NH1 1 
ATOM   3863  N  NH2 . ARG B  1 67  ? -43.143 130.458 -3.075  1.00 64.91  ? 98   ARG B NH2 1 
ATOM   3864  N  N   . LYS B  1 68  ? -37.644 135.002 3.289   1.00 29.89  ? 99   LYS B N   1 
ATOM   3865  C  CA  . LYS B  1 68  ? -36.489 135.876 3.535   1.00 27.58  ? 99   LYS B CA  1 
ATOM   3866  C  C   . LYS B  1 68  ? -35.404 135.329 4.456   1.00 25.88  ? 99   LYS B C   1 
ATOM   3867  O  O   . LYS B  1 68  ? -35.741 134.840 5.531   1.00 27.25  ? 99   LYS B O   1 
ATOM   3868  C  CB  . LYS B  1 68  ? -37.024 137.179 4.112   1.00 27.97  ? 99   LYS B CB  1 
ATOM   3869  C  CG  . LYS B  1 68  ? -37.437 138.257 3.134   1.00 28.49  ? 99   LYS B CG  1 
ATOM   3870  C  CD  . LYS B  1 68  ? -38.425 139.199 3.798   1.00 34.72  ? 99   LYS B CD  1 
ATOM   3871  C  CE  . LYS B  1 68  ? -38.818 140.391 2.952   1.00 36.76  ? 99   LYS B CE  1 
ATOM   3872  N  NZ  . LYS B  1 68  ? -40.025 141.075 3.526   1.00 36.59  ? 99   LYS B NZ  1 
ATOM   3873  N  N   . PRO B  1 69  ? -34.151 135.507 4.067   1.00 22.93  ? 100  PRO B N   1 
ATOM   3874  C  CA  . PRO B  1 69  ? -33.037 135.042 4.900   1.00 20.05  ? 100  PRO B CA  1 
ATOM   3875  C  C   . PRO B  1 69  ? -33.260 135.694 6.252   1.00 16.65  ? 100  PRO B C   1 
ATOM   3876  O  O   . PRO B  1 69  ? -33.484 136.903 6.272   1.00 16.03  ? 100  PRO B O   1 
ATOM   3877  C  CB  . PRO B  1 69  ? -31.829 135.656 4.194   1.00 20.18  ? 100  PRO B CB  1 
ATOM   3878  C  CG  . PRO B  1 69  ? -32.233 135.688 2.764   1.00 20.28  ? 100  PRO B CG  1 
ATOM   3879  C  CD  . PRO B  1 69  ? -33.686 136.099 2.804   1.00 22.62  ? 100  PRO B CD  1 
ATOM   3880  N  N   . ARG B  1 70  ? -33.183 134.939 7.310   1.00 15.00  ? 101  ARG B N   1 
ATOM   3881  C  CA  . ARG B  1 70  ? -33.336 135.445 8.660   1.00 15.04  ? 101  ARG B CA  1 
ATOM   3882  C  C   . ARG B  1 70  ? -32.530 134.590 9.641   1.00 17.82  ? 101  ARG B C   1 
ATOM   3883  O  O   . ARG B  1 70  ? -31.942 133.568 9.303   1.00 20.56  ? 101  ARG B O   1 
ATOM   3884  C  CB  . ARG B  1 70  ? -34.818 135.297 9.042   1.00 16.06  ? 101  ARG B CB  1 
ATOM   3885  C  CG  . ARG B  1 70  ? -35.418 133.944 8.708   1.00 16.92  ? 101  ARG B CG  1 
ATOM   3886  C  CD  . ARG B  1 70  ? -35.967 133.225 9.918   1.00 15.00  ? 101  ARG B CD  1 
ATOM   3887  N  NE  . ARG B  1 70  ? -37.100 133.867 10.562  1.00 18.11  ? 101  ARG B NE  1 
ATOM   3888  C  CZ  . ARG B  1 70  ? -37.260 134.023 11.871  1.00 18.07  ? 101  ARG B CZ  1 
ATOM   3889  N  NH1 . ARG B  1 70  ? -36.416 133.580 12.742  1.00 15.00  ? 101  ARG B NH1 1 
ATOM   3890  N  NH2 . ARG B  1 70  ? -38.340 134.646 12.313  1.00 18.07  ? 101  ARG B NH2 1 
ATOM   3891  N  N   . CYS B  1 71  ? -32.547 135.037 10.878  1.00 17.67  ? 102  CYS B N   1 
ATOM   3892  C  CA  . CYS B  1 71  ? -32.037 134.187 11.977  1.00 18.50  ? 102  CYS B CA  1 
ATOM   3893  C  C   . CYS B  1 71  ? -32.864 132.937 12.296  1.00 20.69  ? 102  CYS B C   1 
ATOM   3894  O  O   . CYS B  1 71  ? -34.092 132.950 12.179  1.00 25.77  ? 102  CYS B O   1 
ATOM   3895  C  CB  . CYS B  1 71  ? -31.941 135.146 13.178  1.00 17.68  ? 102  CYS B CB  1 
ATOM   3896  S  SG  . CYS B  1 71  ? -31.372 134.359 14.718  1.00 25.50  ? 102  CYS B SG  1 
ATOM   3897  N  N   . GLY B  1 72  ? -32.123 131.902 12.736  1.00 20.96  ? 103  GLY B N   1 
ATOM   3898  C  CA  . GLY B  1 72  ? -32.654 130.576 13.029  1.00 21.36  ? 103  GLY B CA  1 
ATOM   3899  C  C   . GLY B  1 72  ? -33.184 130.444 14.446  1.00 21.99  ? 103  GLY B C   1 
ATOM   3900  O  O   . GLY B  1 72  ? -33.421 129.328 14.923  1.00 21.62  ? 103  GLY B O   1 
ATOM   3901  N  N   . ASN B  1 73  ? -33.365 131.583 15.087  1.00 23.39  ? 104  ASN B N   1 
ATOM   3902  C  CA  . ASN B  1 73  ? -33.913 131.642 16.429  1.00 24.96  ? 104  ASN B CA  1 
ATOM   3903  C  C   . ASN B  1 73  ? -35.427 131.841 16.378  1.00 26.67  ? 104  ASN B C   1 
ATOM   3904  O  O   . ASN B  1 73  ? -35.943 132.518 15.486  1.00 25.64  ? 104  ASN B O   1 
ATOM   3905  C  CB  . ASN B  1 73  ? -33.257 132.775 17.217  1.00 26.03  ? 104  ASN B CB  1 
ATOM   3906  C  CG  . ASN B  1 73  ? -32.260 132.294 18.255  1.00 25.59  ? 104  ASN B CG  1 
ATOM   3907  O  OD1 . ASN B  1 73  ? -31.200 131.767 17.919  1.00 22.13  ? 104  ASN B OD1 1 
ATOM   3908  N  ND2 . ASN B  1 73  ? -32.597 132.486 19.525  1.00 26.18  ? 104  ASN B ND2 1 
ATOM   3909  N  N   . PRO B  1 74  ? -36.131 131.243 17.340  1.00 26.89  ? 105  PRO B N   1 
ATOM   3910  C  CA  . PRO B  1 74  ? -37.595 131.318 17.447  1.00 27.66  ? 105  PRO B CA  1 
ATOM   3911  C  C   . PRO B  1 74  ? -38.112 132.728 17.700  1.00 30.71  ? 105  PRO B C   1 
ATOM   3912  O  O   . PRO B  1 74  ? -37.417 133.537 18.305  1.00 31.34  ? 105  PRO B O   1 
ATOM   3913  C  CB  . PRO B  1 74  ? -37.905 130.475 18.689  1.00 25.92  ? 105  PRO B CB  1 
ATOM   3914  C  CG  . PRO B  1 74  ? -36.711 129.603 18.851  1.00 25.48  ? 105  PRO B CG  1 
ATOM   3915  C  CD  . PRO B  1 74  ? -35.549 130.432 18.410  1.00 25.82  ? 105  PRO B CD  1 
ATOM   3916  N  N   . ASP B  1 75  ? -39.334 133.000 17.236  1.00 34.51  ? 106  ASP B N   1 
ATOM   3917  C  CA  . ASP B  1 75  ? -39.956 134.299 17.465  1.00 37.70  ? 106  ASP B CA  1 
ATOM   3918  C  C   . ASP B  1 75  ? -40.871 134.242 18.685  1.00 41.90  ? 106  ASP B C   1 
ATOM   3919  O  O   . ASP B  1 75  ? -41.201 135.260 19.272  1.00 42.14  ? 106  ASP B O   1 
ATOM   3920  C  CB  . ASP B  1 75  ? -40.751 134.760 16.251  1.00 35.49  ? 106  ASP B CB  1 
ATOM   3921  C  CG  . ASP B  1 75  ? -39.875 134.997 15.053  1.00 34.42  ? 106  ASP B CG  1 
ATOM   3922  O  OD1 . ASP B  1 75  ? -38.668 135.251 15.231  1.00 33.43  ? 106  ASP B OD1 1 
ATOM   3923  O  OD2 . ASP B  1 75  ? -40.358 134.937 13.903  1.00 36.33  ? 106  ASP B OD2 1 
ATOM   3924  N  N   . VAL B  1 76  ? -41.258 133.030 19.063  1.00 47.94  ? 107  VAL B N   1 
ATOM   3925  C  CA  . VAL B  1 76  ? -42.155 132.877 20.205  1.00 55.72  ? 107  VAL B CA  1 
ATOM   3926  C  C   . VAL B  1 76  ? -41.444 132.539 21.483  1.00 61.78  ? 107  VAL B C   1 
ATOM   3927  O  O   . VAL B  1 76  ? -40.560 131.688 21.508  1.00 63.41  ? 107  VAL B O   1 
ATOM   3928  C  CB  . VAL B  1 76  ? -43.128 131.705 19.965  1.00 55.73  ? 107  VAL B CB  1 
ATOM   3929  C  CG1 . VAL B  1 76  ? -44.182 132.090 18.938  1.00 55.36  ? 107  VAL B CG1 1 
ATOM   3930  C  CG2 . VAL B  1 76  ? -42.368 130.465 19.520  1.00 54.14  ? 107  VAL B CG2 1 
ATOM   3931  N  N   . ALA B  1 77  ? -41.790 133.181 22.589  1.00 68.37  ? 108  ALA B N   1 
ATOM   3932  C  CA  . ALA B  1 77  ? -41.211 132.692 23.808  1.00 74.04  ? 108  ALA B CA  1 
ATOM   3933  C  C   . ALA B  1 77  ? -41.307 131.181 23.663  1.00 78.47  ? 108  ALA B C   1 
ATOM   3934  O  O   . ALA B  1 77  ? -42.273 130.588 24.190  1.00 78.21  ? 108  ALA B O   1 
ATOM   3935  C  CB  . ALA B  1 77  ? -41.909 133.291 25.011  1.00 73.13  ? 108  ALA B CB  1 
ATOM   3936  N  N   . ASN B  1 78  ? -40.305 130.725 22.900  1.00 84.28  ? 109  ASN B N   1 
ATOM   3937  C  CA  . ASN B  1 78  ? -40.074 129.356 22.432  1.00 89.88  ? 109  ASN B CA  1 
ATOM   3938  C  C   . ASN B  1 78  ? -40.462 128.327 23.472  1.00 92.87  ? 109  ASN B C   1 
ATOM   3939  O  O   . ASN B  1 78  ? -41.211 127.404 23.183  1.00 94.42  ? 109  ASN B O   1 
ATOM   3940  C  CB  . ASN B  1 78  ? -38.618 129.229 21.897  1.00 91.12  ? 109  ASN B CB  1 
ATOM   3941  C  CG  . ASN B  1 78  ? -37.717 128.306 22.700  1.00 92.24  ? 109  ASN B CG  1 
ATOM   3942  O  OD1 . ASN B  1 78  ? -37.805 128.250 23.922  1.00 94.72  ? 109  ASN B OD1 1 
ATOM   3943  N  ND2 . ASN B  1 78  ? -36.835 127.583 22.009  1.00 91.49  ? 109  ASN B ND2 1 
ATOM   3944  N  N   . TYR B  1 79  ? -39.985 128.445 24.701  1.00 95.35  ? 110  TYR B N   1 
ATOM   3945  C  CA  . TYR B  1 79  ? -40.405 127.478 25.717  1.00 97.26  ? 110  TYR B CA  1 
ATOM   3946  C  C   . TYR B  1 79  ? -41.389 128.066 26.715  1.00 97.79  ? 110  TYR B C   1 
ATOM   3947  O  O   . TYR B  1 79  ? -42.514 128.432 26.336  1.00 97.65  ? 110  TYR B O   1 
ATOM   3948  C  CB  . TYR B  1 79  ? -39.249 126.956 26.583  1.00 98.60  ? 110  TYR B CB  1 
ATOM   3949  C  CG  . TYR B  1 79  ? -37.924 126.755 25.892  1.00 100.00 ? 110  TYR B CG  1 
ATOM   3950  C  CD1 . TYR B  1 79  ? -37.221 127.826 25.360  1.00 100.00 ? 110  TYR B CD1 1 
ATOM   3951  C  CD2 . TYR B  1 79  ? -37.371 125.487 25.792  1.00 100.00 ? 110  TYR B CD2 1 
ATOM   3952  C  CE1 . TYR B  1 79  ? -35.997 127.637 24.744  1.00 100.00 ? 110  TYR B CE1 1 
ATOM   3953  C  CE2 . TYR B  1 79  ? -36.149 125.288 25.179  1.00 100.00 ? 110  TYR B CE2 1 
ATOM   3954  C  CZ  . TYR B  1 79  ? -35.467 126.367 24.657  1.00 100.00 ? 110  TYR B CZ  1 
ATOM   3955  O  OH  . TYR B  1 79  ? -34.249 126.171 24.047  1.00 100.00 ? 110  TYR B OH  1 
ATOM   3956  N  N   . ASN B  1 80  ? -40.864 128.093 27.939  1.00 98.77  ? 111  ASN B N   1 
ATOM   3957  C  CA  . ASN B  1 80  ? -41.491 128.628 29.136  1.00 99.53  ? 111  ASN B CA  1 
ATOM   3958  C  C   . ASN B  1 80  ? -40.393 129.063 30.128  1.00 99.93  ? 111  ASN B C   1 
ATOM   3959  O  O   . ASN B  1 80  ? -39.246 128.618 30.039  1.00 100.00 ? 111  ASN B O   1 
ATOM   3960  C  CB  . ASN B  1 80  ? -42.455 127.607 29.754  1.00 98.57  ? 111  ASN B CB  1 
ATOM   3961  C  CG  . ASN B  1 80  ? -41.756 126.389 30.334  1.00 97.68  ? 111  ASN B CG  1 
ATOM   3962  O  OD1 . ASN B  1 80  ? -40.556 126.196 30.144  1.00 96.62  ? 111  ASN B OD1 1 
ATOM   3963  N  ND2 . ASN B  1 80  ? -42.514 125.558 31.045  1.00 97.25  ? 111  ASN B ND2 1 
ATOM   3964  N  N   . PHE B  1 81  ? -40.752 129.932 31.063  1.00 100.00 ? 112  PHE B N   1 
ATOM   3965  C  CA  . PHE B  1 81  ? -39.810 130.467 32.052  1.00 100.00 ? 112  PHE B CA  1 
ATOM   3966  C  C   . PHE B  1 81  ? -39.104 129.383 32.876  1.00 100.00 ? 112  PHE B C   1 
ATOM   3967  O  O   . PHE B  1 81  ? -39.592 128.259 32.990  1.00 100.00 ? 112  PHE B O   1 
ATOM   3968  C  CB  . PHE B  1 81  ? -40.546 131.372 33.025  1.00 100.00 ? 112  PHE B CB  1 
ATOM   3969  C  CG  . PHE B  1 81  ? -41.610 130.630 33.762  1.00 100.00 ? 112  PHE B CG  1 
ATOM   3970  C  CD1 . PHE B  1 81  ? -42.368 129.680 33.103  1.00 100.00 ? 112  PHE B CD1 1 
ATOM   3971  C  CD2 . PHE B  1 81  ? -41.843 130.868 35.104  1.00 100.00 ? 112  PHE B CD2 1 
ATOM   3972  C  CE1 . PHE B  1 81  ? -43.346 128.973 33.774  1.00 100.00 ? 112  PHE B CE1 1 
ATOM   3973  C  CE2 . PHE B  1 81  ? -42.820 130.165 35.781  1.00 100.00 ? 112  PHE B CE2 1 
ATOM   3974  C  CZ  . PHE B  1 81  ? -43.572 129.215 35.115  1.00 100.00 ? 112  PHE B CZ  1 
ATOM   3975  N  N   . PHE B  1 82  ? -37.958 129.768 33.440  1.00 100.00 ? 113  PHE B N   1 
ATOM   3976  C  CA  . PHE B  1 82  ? -37.159 128.906 34.318  1.00 100.00 ? 113  PHE B CA  1 
ATOM   3977  C  C   . PHE B  1 82  ? -36.789 129.737 35.556  1.00 100.00 ? 113  PHE B C   1 
ATOM   3978  O  O   . PHE B  1 82  ? -37.438 130.735 35.862  1.00 100.00 ? 113  PHE B O   1 
ATOM   3979  C  CB  . PHE B  1 82  ? -35.954 128.364 33.540  1.00 100.00 ? 113  PHE B CB  1 
ATOM   3980  C  CG  . PHE B  1 82  ? -35.013 127.516 34.348  1.00 100.00 ? 113  PHE B CG  1 
ATOM   3981  C  CD1 . PHE B  1 82  ? -35.374 126.241 34.761  1.00 100.00 ? 113  PHE B CD1 1 
ATOM   3982  C  CD2 . PHE B  1 82  ? -33.762 127.995 34.689  1.00 100.00 ? 113  PHE B CD2 1 
ATOM   3983  C  CE1 . PHE B  1 82  ? -34.500 125.463 35.501  1.00 100.00 ? 113  PHE B CE1 1 
ATOM   3984  C  CE2 . PHE B  1 82  ? -32.884 127.224 35.428  1.00 100.00 ? 113  PHE B CE2 1 
ATOM   3985  C  CZ  . PHE B  1 82  ? -33.253 125.957 35.835  1.00 100.00 ? 113  PHE B CZ  1 
ATOM   3986  N  N   . PRO B  1 83  ? -35.737 129.411 36.334  1.00 100.00 ? 114  PRO B N   1 
ATOM   3987  C  CA  . PRO B  1 83  ? -35.286 130.343 37.398  1.00 100.00 ? 114  PRO B CA  1 
ATOM   3988  C  C   . PRO B  1 83  ? -35.206 131.778 36.995  1.00 100.00 ? 114  PRO B C   1 
ATOM   3989  O  O   . PRO B  1 83  ? -35.534 132.633 37.838  1.00 100.00 ? 114  PRO B O   1 
ATOM   3990  C  CB  . PRO B  1 83  ? -33.908 129.813 37.802  1.00 99.86  ? 114  PRO B CB  1 
ATOM   3991  C  CG  . PRO B  1 83  ? -33.855 128.440 37.226  1.00 100.00 ? 114  PRO B CG  1 
ATOM   3992  C  CD  . PRO B  1 83  ? -34.625 128.507 35.934  1.00 100.00 ? 114  PRO B CD  1 
ATOM   3993  N  N   . ARG B  1 84  ? -34.837 132.139 35.769  1.00 99.16  ? 115  ARG B N   1 
ATOM   3994  C  CA  . ARG B  1 84  ? -34.785 133.525 35.323  1.00 97.16  ? 115  ARG B CA  1 
ATOM   3995  C  C   . ARG B  1 84  ? -34.753 133.664 33.795  1.00 95.51  ? 115  ARG B C   1 
ATOM   3996  O  O   . ARG B  1 84  ? -34.221 132.775 33.126  1.00 96.21  ? 115  ARG B O   1 
ATOM   3997  C  CB  . ARG B  1 84  ? -33.471 134.182 35.791  1.00 96.92  ? 115  ARG B CB  1 
ATOM   3998  C  CG  . ARG B  1 84  ? -33.217 134.362 37.255  1.00 96.82  ? 115  ARG B CG  1 
ATOM   3999  C  CD  . ARG B  1 84  ? -34.186 135.311 37.929  1.00 96.33  ? 115  ARG B CD  1 
ATOM   4000  N  NE  . ARG B  1 84  ? -34.761 134.758 39.154  1.00 95.84  ? 115  ARG B NE  1 
ATOM   4001  C  CZ  . ARG B  1 84  ? -35.609 135.428 39.930  1.00 94.44  ? 115  ARG B CZ  1 
ATOM   4002  N  NH1 . ARG B  1 84  ? -35.967 136.664 39.605  1.00 93.57  ? 115  ARG B NH1 1 
ATOM   4003  N  NH2 . ARG B  1 84  ? -36.091 134.859 41.023  1.00 92.76  ? 115  ARG B NH2 1 
ATOM   4004  N  N   . LYS B  1 85  ? -35.076 134.848 33.259  1.00 92.49  ? 116  LYS B N   1 
ATOM   4005  C  CA  . LYS B  1 85  ? -34.707 135.011 31.813  1.00 88.50  ? 116  LYS B CA  1 
ATOM   4006  C  C   . LYS B  1 85  ? -33.186 134.911 31.724  1.00 85.04  ? 116  LYS B C   1 
ATOM   4007  O  O   . LYS B  1 85  ? -32.492 135.448 32.605  1.00 85.36  ? 116  LYS B O   1 
ATOM   4008  C  CB  . LYS B  1 85  ? -35.221 136.359 31.315  1.00 88.59  ? 116  LYS B CB  1 
ATOM   4009  C  CG  . LYS B  1 85  ? -36.689 136.345 30.920  1.00 89.72  ? 116  LYS B CG  1 
ATOM   4010  C  CD  . LYS B  1 85  ? -37.217 137.699 30.494  1.00 90.49  ? 116  LYS B CD  1 
ATOM   4011  C  CE  . LYS B  1 85  ? -38.742 137.704 30.387  1.00 90.22  ? 116  LYS B CE  1 
ATOM   4012  N  NZ  . LYS B  1 85  ? -39.209 138.885 29.606  1.00 89.77  ? 116  LYS B NZ  1 
ATOM   4013  N  N   . PRO B  1 86  ? -32.602 134.193 30.775  1.00 80.58  ? 117  PRO B N   1 
ATOM   4014  C  CA  . PRO B  1 86  ? -31.154 134.010 30.732  1.00 76.32  ? 117  PRO B CA  1 
ATOM   4015  C  C   . PRO B  1 86  ? -30.403 135.324 30.770  1.00 72.55  ? 117  PRO B C   1 
ATOM   4016  O  O   . PRO B  1 86  ? -30.716 136.249 30.019  1.00 73.23  ? 117  PRO B O   1 
ATOM   4017  C  CB  . PRO B  1 86  ? -30.919 133.224 29.456  1.00 77.24  ? 117  PRO B CB  1 
ATOM   4018  C  CG  . PRO B  1 86  ? -32.209 132.515 29.214  1.00 78.49  ? 117  PRO B CG  1 
ATOM   4019  C  CD  . PRO B  1 86  ? -33.285 133.469 29.681  1.00 79.68  ? 117  PRO B CD  1 
ATOM   4020  N  N   . LYS B  1 87  ? -29.416 135.428 31.652  1.00 66.86  ? 118  LYS B N   1 
ATOM   4021  C  CA  . LYS B  1 87  ? -28.630 136.655 31.832  1.00 60.24  ? 118  LYS B CA  1 
ATOM   4022  C  C   . LYS B  1 87  ? -27.303 136.345 32.510  1.00 57.20  ? 118  LYS B C   1 
ATOM   4023  O  O   . LYS B  1 87  ? -27.268 135.595 33.492  1.00 57.00  ? 118  LYS B O   1 
ATOM   4024  C  CB  . LYS B  1 87  ? -29.461 137.623 32.660  1.00 58.78  ? 118  LYS B CB  1 
ATOM   4025  C  CG  . LYS B  1 87  ? -28.813 138.894 33.143  1.00 58.56  ? 118  LYS B CG  1 
ATOM   4026  C  CD  . LYS B  1 87  ? -29.692 139.577 34.184  1.00 58.54  ? 118  LYS B CD  1 
ATOM   4027  C  CE  . LYS B  1 87  ? -29.034 140.814 34.753  1.00 59.86  ? 118  LYS B CE  1 
ATOM   4028  N  NZ  . LYS B  1 87  ? -27.695 140.530 35.334  1.00 62.26  ? 118  LYS B NZ  1 
ATOM   4029  N  N   . TRP B  1 88  ? -26.192 136.890 32.006  1.00 53.12  ? 119  TRP B N   1 
ATOM   4030  C  CA  . TRP B  1 88  ? -24.904 136.580 32.618  1.00 48.98  ? 119  TRP B CA  1 
ATOM   4031  C  C   . TRP B  1 88  ? -24.801 137.161 34.015  1.00 49.14  ? 119  TRP B C   1 
ATOM   4032  O  O   . TRP B  1 88  ? -25.094 138.329 34.237  1.00 49.40  ? 119  TRP B O   1 
ATOM   4033  C  CB  . TRP B  1 88  ? -23.748 137.088 31.761  1.00 44.48  ? 119  TRP B CB  1 
ATOM   4034  C  CG  . TRP B  1 88  ? -23.740 136.448 30.410  1.00 38.99  ? 119  TRP B CG  1 
ATOM   4035  C  CD1 . TRP B  1 88  ? -24.049 137.032 29.223  1.00 37.64  ? 119  TRP B CD1 1 
ATOM   4036  C  CD2 . TRP B  1 88  ? -23.415 135.088 30.121  1.00 36.39  ? 119  TRP B CD2 1 
ATOM   4037  N  NE1 . TRP B  1 88  ? -23.932 136.122 28.204  1.00 36.68  ? 119  TRP B NE1 1 
ATOM   4038  C  CE2 . TRP B  1 88  ? -23.548 134.919 28.733  1.00 36.32  ? 119  TRP B CE2 1 
ATOM   4039  C  CE3 . TRP B  1 88  ? -23.024 134.005 30.910  1.00 34.28  ? 119  TRP B CE3 1 
ATOM   4040  C  CZ2 . TRP B  1 88  ? -23.303 133.703 28.102  1.00 35.61  ? 119  TRP B CZ2 1 
ATOM   4041  C  CZ3 . TRP B  1 88  ? -22.787 132.800 30.279  1.00 34.87  ? 119  TRP B CZ3 1 
ATOM   4042  C  CH2 . TRP B  1 88  ? -22.925 132.660 28.892  1.00 34.76  ? 119  TRP B CH2 1 
ATOM   4043  N  N   . ASP B  1 89  ? -24.275 136.372 34.943  1.00 49.23  ? 120  ASP B N   1 
ATOM   4044  C  CA  . ASP B  1 89  ? -24.064 136.836 36.314  1.00 48.29  ? 120  ASP B CA  1 
ATOM   4045  C  C   . ASP B  1 89  ? -22.692 137.497 36.416  1.00 46.52  ? 120  ASP B C   1 
ATOM   4046  O  O   . ASP B  1 89  ? -21.970 137.344 37.399  1.00 45.39  ? 120  ASP B O   1 
ATOM   4047  C  CB  . ASP B  1 89  ? -24.155 135.665 37.291  1.00 50.30  ? 120  ASP B CB  1 
ATOM   4048  C  CG  . ASP B  1 89  ? -23.175 134.556 36.967  1.00 52.61  ? 120  ASP B CG  1 
ATOM   4049  O  OD1 . ASP B  1 89  ? -21.981 134.854 36.758  1.00 52.98  ? 120  ASP B OD1 1 
ATOM   4050  O  OD2 . ASP B  1 89  ? -23.582 133.374 36.917  1.00 54.81  ? 120  ASP B OD2 1 
ATOM   4051  N  N   . LYS B  1 90  ? -22.326 138.205 35.352  1.00 45.19  ? 121  LYS B N   1 
ATOM   4052  C  CA  . LYS B  1 90  ? -21.014 138.842 35.283  1.00 44.20  ? 121  LYS B CA  1 
ATOM   4053  C  C   . LYS B  1 90  ? -20.967 139.852 34.145  1.00 44.04  ? 121  LYS B C   1 
ATOM   4054  O  O   . LYS B  1 90  ? -21.745 139.736 33.202  1.00 44.65  ? 121  LYS B O   1 
ATOM   4055  C  CB  . LYS B  1 90  ? -19.971 137.741 34.982  1.00 43.82  ? 121  LYS B CB  1 
ATOM   4056  C  CG  . LYS B  1 90  ? -20.374 136.913 33.773  1.00 44.61  ? 121  LYS B CG  1 
ATOM   4057  C  CD  . LYS B  1 90  ? -19.521 135.684 33.598  1.00 42.44  ? 121  LYS B CD  1 
ATOM   4058  C  CE  . LYS B  1 90  ? -19.663 135.134 32.171  1.00 44.65  ? 121  LYS B CE  1 
ATOM   4059  N  NZ  . LYS B  1 90  ? -18.886 133.848 32.232  1.00 43.25  ? 121  LYS B NZ  1 
ATOM   4060  N  N   . ASN B  1 91  ? -20.055 140.813 34.235  1.00 43.65  ? 122  ASN B N   1 
ATOM   4061  C  CA  . ASN B  1 91  ? -19.921 141.764 33.127  1.00 44.50  ? 122  ASN B CA  1 
ATOM   4062  C  C   . ASN B  1 91  ? -18.721 141.355 32.277  1.00 44.41  ? 122  ASN B C   1 
ATOM   4063  O  O   . ASN B  1 91  ? -18.584 141.768 31.130  1.00 44.79  ? 122  ASN B O   1 
ATOM   4064  C  CB  . ASN B  1 91  ? -19.790 143.193 33.626  1.00 45.75  ? 122  ASN B CB  1 
ATOM   4065  C  CG  . ASN B  1 91  ? -21.076 143.730 34.224  1.00 46.11  ? 122  ASN B CG  1 
ATOM   4066  O  OD1 . ASN B  1 91  ? -22.090 143.039 34.230  1.00 47.14  ? 122  ASN B OD1 1 
ATOM   4067  N  ND2 . ASN B  1 91  ? -21.042 144.953 34.724  1.00 46.06  ? 122  ASN B ND2 1 
ATOM   4068  N  N   . GLN B  1 92  ? -17.859 140.519 32.845  1.00 43.89  ? 123  GLN B N   1 
ATOM   4069  C  CA  . GLN B  1 92  ? -16.692 140.006 32.143  1.00 42.27  ? 123  GLN B CA  1 
ATOM   4070  C  C   . GLN B  1 92  ? -17.045 138.715 31.400  1.00 40.87  ? 123  GLN B C   1 
ATOM   4071  O  O   . GLN B  1 92  ? -17.168 137.658 31.998  1.00 37.93  ? 123  GLN B O   1 
ATOM   4072  C  CB  . GLN B  1 92  ? -15.555 139.744 33.123  1.00 43.16  ? 123  GLN B CB  1 
ATOM   4073  C  CG  . GLN B  1 92  ? -15.605 140.601 34.381  1.00 47.06  ? 123  GLN B CG  1 
ATOM   4074  C  CD  . GLN B  1 92  ? -14.695 141.806 34.259  1.00 50.05  ? 123  GLN B CD  1 
ATOM   4075  O  OE1 . GLN B  1 92  ? -13.526 141.650 33.901  1.00 51.90  ? 123  GLN B OE1 1 
ATOM   4076  N  NE2 . GLN B  1 92  ? -15.198 143.005 34.534  1.00 52.18  ? 123  GLN B NE2 1 
ATOM   4077  N  N   . ILE B  1 93  ? -17.222 138.837 30.092  1.00 40.85  ? 124  ILE B N   1 
ATOM   4078  C  CA  . ILE B  1 93  ? -17.584 137.711 29.246  1.00 39.84  ? 124  ILE B CA  1 
ATOM   4079  C  C   . ILE B  1 93  ? -16.423 137.323 28.334  1.00 38.15  ? 124  ILE B C   1 
ATOM   4080  O  O   . ILE B  1 93  ? -15.945 138.159 27.563  1.00 40.05  ? 124  ILE B O   1 
ATOM   4081  C  CB  . ILE B  1 93  ? -18.805 138.055 28.361  1.00 40.03  ? 124  ILE B CB  1 
ATOM   4082  C  CG1 . ILE B  1 93  ? -19.911 138.700 29.194  1.00 39.72  ? 124  ILE B CG1 1 
ATOM   4083  C  CG2 . ILE B  1 93  ? -19.322 136.811 27.664  1.00 40.27  ? 124  ILE B CG2 1 
ATOM   4084  C  CD1 . ILE B  1 93  ? -20.479 137.788 30.257  1.00 39.58  ? 124  ILE B CD1 1 
ATOM   4085  N  N   . THR B  1 94  ? -15.986 136.078 28.431  1.00 35.07  ? 125  THR B N   1 
ATOM   4086  C  CA  . THR B  1 94  ? -14.913 135.590 27.566  1.00 33.52  ? 125  THR B CA  1 
ATOM   4087  C  C   . THR B  1 94  ? -15.538 134.928 26.335  1.00 32.33  ? 125  THR B C   1 
ATOM   4088  O  O   . THR B  1 94  ? -16.587 134.293 26.440  1.00 32.16  ? 125  THR B O   1 
ATOM   4089  C  CB  . THR B  1 94  ? -14.022 134.557 28.274  1.00 33.93  ? 125  THR B CB  1 
ATOM   4090  O  OG1 . THR B  1 94  ? -14.824 133.442 28.706  1.00 34.30  ? 125  THR B OG1 1 
ATOM   4091  C  CG2 . THR B  1 94  ? -13.279 135.163 29.439  1.00 31.56  ? 125  THR B CG2 1 
ATOM   4092  N  N   . TYR B  1 95  ? -14.889 135.078 25.192  1.00 29.78  ? 126  TYR B N   1 
ATOM   4093  C  CA  . TYR B  1 95  ? -15.417 134.454 23.974  1.00 27.59  ? 126  TYR B CA  1 
ATOM   4094  C  C   . TYR B  1 95  ? -14.261 133.814 23.209  1.00 26.81  ? 126  TYR B C   1 
ATOM   4095  O  O   . TYR B  1 95  ? -13.167 134.359 23.203  1.00 28.08  ? 126  TYR B O   1 
ATOM   4096  C  CB  . TYR B  1 95  ? -16.103 135.486 23.113  1.00 26.39  ? 126  TYR B CB  1 
ATOM   4097  C  CG  . TYR B  1 95  ? -15.218 136.432 22.344  1.00 26.26  ? 126  TYR B CG  1 
ATOM   4098  C  CD1 . TYR B  1 95  ? -14.616 136.066 21.158  1.00 26.36  ? 126  TYR B CD1 1 
ATOM   4099  C  CD2 . TYR B  1 95  ? -15.023 137.736 22.781  1.00 27.11  ? 126  TYR B CD2 1 
ATOM   4100  C  CE1 . TYR B  1 95  ? -13.843 136.933 20.426  1.00 27.71  ? 126  TYR B CE1 1 
ATOM   4101  C  CE2 . TYR B  1 95  ? -14.237 138.620 22.073  1.00 28.16  ? 126  TYR B CE2 1 
ATOM   4102  C  CZ  . TYR B  1 95  ? -13.644 138.221 20.899  1.00 28.96  ? 126  TYR B CZ  1 
ATOM   4103  O  OH  . TYR B  1 95  ? -12.871 139.055 20.134  1.00 28.07  ? 126  TYR B OH  1 
ATOM   4104  N  N   . ARG B  1 96  ? -14.546 132.679 22.579  1.00 24.46  ? 127  ARG B N   1 
ATOM   4105  C  CA  . ARG B  1 96  ? -13.491 132.010 21.827  1.00 21.09  ? 127  ARG B CA  1 
ATOM   4106  C  C   . ARG B  1 96  ? -13.961 131.642 20.448  1.00 19.68  ? 127  ARG B C   1 
ATOM   4107  O  O   . ARG B  1 96  ? -14.981 130.953 20.320  1.00 18.77  ? 127  ARG B O   1 
ATOM   4108  C  CB  . ARG B  1 96  ? -12.995 130.799 22.593  1.00 20.46  ? 127  ARG B CB  1 
ATOM   4109  C  CG  . ARG B  1 96  ? -12.344 129.743 21.730  1.00 20.63  ? 127  ARG B CG  1 
ATOM   4110  C  CD  . ARG B  1 96  ? -11.600 128.757 22.597  1.00 22.41  ? 127  ARG B CD  1 
ATOM   4111  N  NE  . ARG B  1 96  ? -10.726 127.896 21.797  1.00 23.64  ? 127  ARG B NE  1 
ATOM   4112  C  CZ  . ARG B  1 96  ? -10.320 126.720 22.283  1.00 26.14  ? 127  ARG B CZ  1 
ATOM   4113  N  NH1 . ARG B  1 96  ? -10.698 126.372 23.500  1.00 25.72  ? 127  ARG B NH1 1 
ATOM   4114  N  NH2 . ARG B  1 96  ? -9.547  125.960 21.537  1.00 27.54  ? 127  ARG B NH2 1 
ATOM   4115  N  N   . ILE B  1 97  ? -13.281 132.153 19.426  1.00 18.28  ? 128  ILE B N   1 
ATOM   4116  C  CA  . ILE B  1 97  ? -13.630 131.777 18.055  1.00 17.07  ? 128  ILE B CA  1 
ATOM   4117  C  C   . ILE B  1 97  ? -12.927 130.456 17.739  1.00 17.77  ? 128  ILE B C   1 
ATOM   4118  O  O   . ILE B  1 97  ? -11.694 130.359 17.802  1.00 19.08  ? 128  ILE B O   1 
ATOM   4119  C  CB  . ILE B  1 97  ? -13.440 132.865 17.034  1.00 16.71  ? 128  ILE B CB  1 
ATOM   4120  C  CG1 . ILE B  1 97  ? -12.549 132.444 15.863  1.00 17.83  ? 128  ILE B CG1 1 
ATOM   4121  C  CG2 . ILE B  1 97  ? -13.081 134.259 17.472  1.00 15.00  ? 128  ILE B CG2 1 
ATOM   4122  C  CD1 . ILE B  1 97  ? -13.235 131.509 14.904  1.00 19.77  ? 128  ILE B CD1 1 
ATOM   4123  N  N   . ILE B  1 98  ? -13.695 129.392 17.522  1.00 18.03  ? 129  ILE B N   1 
ATOM   4124  C  CA  . ILE B  1 98  ? -13.162 128.067 17.284  1.00 17.29  ? 129  ILE B CA  1 
ATOM   4125  C  C   . ILE B  1 98  ? -13.484 127.553 15.883  1.00 17.04  ? 129  ILE B C   1 
ATOM   4126  O  O   . ILE B  1 98  ? -13.252 126.372 15.620  1.00 17.76  ? 129  ILE B O   1 
ATOM   4127  C  CB  . ILE B  1 98  ? -13.736 127.049 18.277  1.00 15.81  ? 129  ILE B CB  1 
ATOM   4128  C  CG1 . ILE B  1 98  ? -15.236 126.844 18.011  1.00 15.00  ? 129  ILE B CG1 1 
ATOM   4129  C  CG2 . ILE B  1 98  ? -13.510 127.430 19.711  1.00 19.11  ? 129  ILE B CG2 1 
ATOM   4130  C  CD1 . ILE B  1 98  ? -15.805 125.938 19.094  1.00 15.00  ? 129  ILE B CD1 1 
ATOM   4131  N  N   . GLY B  1 99  ? -13.817 128.442 14.970  1.00 15.64  ? 130  GLY B N   1 
ATOM   4132  C  CA  . GLY B  1 99  ? -14.163 127.996 13.615  1.00 15.80  ? 130  GLY B CA  1 
ATOM   4133  C  C   . GLY B  1 99  ? -14.314 129.212 12.707  1.00 17.34  ? 130  GLY B C   1 
ATOM   4134  O  O   . GLY B  1 99  ? -14.915 130.217 13.134  1.00 18.01  ? 130  GLY B O   1 
ATOM   4135  N  N   . TYR B  1 100 ? -13.690 129.194 11.534  1.00 16.47  ? 131  TYR B N   1 
ATOM   4136  C  CA  . TYR B  1 100 ? -13.802 130.333 10.633  1.00 16.46  ? 131  TYR B CA  1 
ATOM   4137  C  C   . TYR B  1 100 ? -14.646 130.018 9.409   1.00 16.35  ? 131  TYR B C   1 
ATOM   4138  O  O   . TYR B  1 100 ? -15.368 129.071 9.318   1.00 15.00  ? 131  TYR B O   1 
ATOM   4139  C  CB  . TYR B  1 100 ? -12.409 130.804 10.142  1.00 16.57  ? 131  TYR B CB  1 
ATOM   4140  C  CG  . TYR B  1 100 ? -11.643 131.401 11.292  1.00 16.23  ? 131  TYR B CG  1 
ATOM   4141  C  CD1 . TYR B  1 100 ? -11.108 130.614 12.293  1.00 16.70  ? 131  TYR B CD1 1 
ATOM   4142  C  CD2 . TYR B  1 100 ? -11.451 132.774 11.360  1.00 18.48  ? 131  TYR B CD2 1 
ATOM   4143  C  CE1 . TYR B  1 100 ? -10.417 131.200 13.348  1.00 19.14  ? 131  TYR B CE1 1 
ATOM   4144  C  CE2 . TYR B  1 100 ? -10.770 133.366 12.405  1.00 19.81  ? 131  TYR B CE2 1 
ATOM   4145  C  CZ  . TYR B  1 100 ? -10.262 132.560 13.392  1.00 20.88  ? 131  TYR B CZ  1 
ATOM   4146  O  OH  . TYR B  1 100 ? -9.571  133.145 14.436  1.00 25.93  ? 131  TYR B OH  1 
ATOM   4147  N  N   . THR B  1 101 ? -14.549 130.970 8.474   1.00 16.44  ? 132  THR B N   1 
ATOM   4148  C  CA  . THR B  1 101 ? -15.282 130.698 7.226   1.00 18.44  ? 132  THR B CA  1 
ATOM   4149  C  C   . THR B  1 101 ? -14.349 131.019 6.072   1.00 20.35  ? 132  THR B C   1 
ATOM   4150  O  O   . THR B  1 101 ? -13.853 132.140 6.042   1.00 22.37  ? 132  THR B O   1 
ATOM   4151  C  CB  . THR B  1 101 ? -16.514 131.618 7.100   1.00 19.90  ? 132  THR B CB  1 
ATOM   4152  O  OG1 . THR B  1 101 ? -16.997 131.455 5.757   1.00 20.57  ? 132  THR B OG1 1 
ATOM   4153  C  CG2 . THR B  1 101 ? -16.170 133.065 7.329   1.00 20.36  ? 132  THR B CG2 1 
ATOM   4154  N  N   . PRO B  1 102 ? -14.165 130.092 5.157   1.00 21.03  ? 133  PRO B N   1 
ATOM   4155  C  CA  . PRO B  1 102 ? -13.293 130.313 4.002   1.00 22.42  ? 133  PRO B CA  1 
ATOM   4156  C  C   . PRO B  1 102 ? -13.547 131.625 3.289   1.00 24.38  ? 133  PRO B C   1 
ATOM   4157  O  O   . PRO B  1 102 ? -12.642 132.166 2.650   1.00 27.04  ? 133  PRO B O   1 
ATOM   4158  C  CB  . PRO B  1 102 ? -13.686 129.128 3.141   1.00 19.50  ? 133  PRO B CB  1 
ATOM   4159  C  CG  . PRO B  1 102 ? -14.039 128.032 4.055   1.00 17.28  ? 133  PRO B CG  1 
ATOM   4160  C  CD  . PRO B  1 102 ? -14.757 128.743 5.172   1.00 20.07  ? 133  PRO B CD  1 
ATOM   4161  N  N   . ASP B  1 103 ? -14.743 132.184 3.369   1.00 26.00  ? 134  ASP B N   1 
ATOM   4162  C  CA  . ASP B  1 103 ? -15.041 133.408 2.672   1.00 27.05  ? 134  ASP B CA  1 
ATOM   4163  C  C   . ASP B  1 103 ? -14.279 134.628 3.124   1.00 26.68  ? 134  ASP B C   1 
ATOM   4164  O  O   . ASP B  1 103 ? -14.178 135.601 2.365   1.00 26.99  ? 134  ASP B O   1 
ATOM   4165  C  CB  . ASP B  1 103 ? -16.560 133.654 2.746   1.00 28.73  ? 134  ASP B CB  1 
ATOM   4166  C  CG  . ASP B  1 103 ? -17.276 132.603 1.920   1.00 30.13  ? 134  ASP B CG  1 
ATOM   4167  O  OD1 . ASP B  1 103 ? -16.908 132.437 0.748   1.00 29.91  ? 134  ASP B OD1 1 
ATOM   4168  O  OD2 . ASP B  1 103 ? -18.203 131.999 2.476   1.00 33.48  ? 134  ASP B OD2 1 
ATOM   4169  N  N   . LEU B  1 104 ? -13.770 134.642 4.341   1.00 25.03  ? 135  LEU B N   1 
ATOM   4170  C  CA  . LEU B  1 104 ? -13.096 135.832 4.837   1.00 24.21  ? 135  LEU B CA  1 
ATOM   4171  C  C   . LEU B  1 104 ? -11.815 135.404 5.547   1.00 25.09  ? 135  LEU B C   1 
ATOM   4172  O  O   . LEU B  1 104 ? -11.886 134.396 6.264   1.00 25.86  ? 135  LEU B O   1 
ATOM   4173  C  CB  . LEU B  1 104 ? -13.984 136.549 5.867   1.00 23.29  ? 135  LEU B CB  1 
ATOM   4174  C  CG  . LEU B  1 104 ? -15.375 137.039 5.533   1.00 20.83  ? 135  LEU B CG  1 
ATOM   4175  C  CD1 . LEU B  1 104 ? -16.152 137.509 6.764   1.00 19.03  ? 135  LEU B CD1 1 
ATOM   4176  C  CD2 . LEU B  1 104 ? -15.245 138.218 4.574   1.00 18.86  ? 135  LEU B CD2 1 
ATOM   4177  N  N   . ASP B  1 105 ? -10.731 136.136 5.407   1.00 25.27  ? 136  ASP B N   1 
ATOM   4178  C  CA  . ASP B  1 105 ? -9.477  135.733 6.051   1.00 24.70  ? 136  ASP B CA  1 
ATOM   4179  C  C   . ASP B  1 105 ? -9.577  135.798 7.562   1.00 22.16  ? 136  ASP B C   1 
ATOM   4180  O  O   . ASP B  1 105 ? -10.325 136.589 8.105   1.00 21.54  ? 136  ASP B O   1 
ATOM   4181  C  CB  . ASP B  1 105 ? -8.293  136.542 5.542   1.00 25.88  ? 136  ASP B CB  1 
ATOM   4182  C  CG  . ASP B  1 105 ? -8.369  137.964 6.063   1.00 26.71  ? 136  ASP B CG  1 
ATOM   4183  O  OD1 . ASP B  1 105 ? -9.208  138.709 5.551   1.00 27.16  ? 136  ASP B OD1 1 
ATOM   4184  O  OD2 . ASP B  1 105 ? -7.614  138.283 6.988   1.00 26.48  ? 136  ASP B OD2 1 
ATOM   4185  N  N   . PRO B  1 106 ? -8.764  135.026 8.266   1.00 22.18  ? 137  PRO B N   1 
ATOM   4186  C  CA  . PRO B  1 106 ? -8.803  134.893 9.699   1.00 21.80  ? 137  PRO B CA  1 
ATOM   4187  C  C   . PRO B  1 106 ? -8.915  136.193 10.453  1.00 21.21  ? 137  PRO B C   1 
ATOM   4188  O  O   . PRO B  1 106 ? -9.607  136.296 11.453  1.00 21.14  ? 137  PRO B O   1 
ATOM   4189  C  CB  . PRO B  1 106 ? -7.551  134.093 10.022  1.00 21.33  ? 137  PRO B CB  1 
ATOM   4190  C  CG  . PRO B  1 106 ? -7.269  133.290 8.793   1.00 20.32  ? 137  PRO B CG  1 
ATOM   4191  C  CD  . PRO B  1 106 ? -7.776  134.097 7.648   1.00 21.66  ? 137  PRO B CD  1 
ATOM   4192  N  N   . GLU B  1 107 ? -8.176  137.194 9.998   1.00 21.77  ? 138  GLU B N   1 
ATOM   4193  C  CA  . GLU B  1 107 ? -8.120  138.484 10.661  1.00 22.81  ? 138  GLU B CA  1 
ATOM   4194  C  C   . GLU B  1 107 ? -9.401  139.291 10.472  1.00 22.25  ? 138  GLU B C   1 
ATOM   4195  O  O   . GLU B  1 107 ? -9.906  139.969 11.360  1.00 22.21  ? 138  GLU B O   1 
ATOM   4196  C  CB  . GLU B  1 107 ? -6.939  139.302 10.161  1.00 23.88  ? 138  GLU B CB  1 
ATOM   4197  C  CG  . GLU B  1 107 ? -5.595  138.609 10.179  1.00 29.15  ? 138  GLU B CG  1 
ATOM   4198  C  CD  . GLU B  1 107 ? -4.436  139.562 10.410  1.00 34.89  ? 138  GLU B CD  1 
ATOM   4199  O  OE1 . GLU B  1 107 ? -4.257  140.525 9.626   1.00 35.96  ? 138  GLU B OE1 1 
ATOM   4200  O  OE2 . GLU B  1 107 ? -3.685  139.350 11.391  1.00 36.19  ? 138  GLU B OE2 1 
ATOM   4201  N  N   . THR B  1 108 ? -9.908  139.304 9.242   1.00 20.68  ? 139  THR B N   1 
ATOM   4202  C  CA  . THR B  1 108 ? -11.151 139.992 8.938   1.00 19.26  ? 139  THR B CA  1 
ATOM   4203  C  C   . THR B  1 108 ? -12.272 139.385 9.782   1.00 20.37  ? 139  THR B C   1 
ATOM   4204  O  O   . THR B  1 108 ? -13.042 140.119 10.384  1.00 21.49  ? 139  THR B O   1 
ATOM   4205  C  CB  . THR B  1 108 ? -11.530 139.848 7.457   1.00 16.62  ? 139  THR B CB  1 
ATOM   4206  O  OG1 . THR B  1 108 ? -10.586 140.659 6.711   1.00 15.00  ? 139  THR B OG1 1 
ATOM   4207  C  CG2 . THR B  1 108 ? -12.933 140.374 7.225   1.00 16.48  ? 139  THR B CG2 1 
ATOM   4208  N  N   . VAL B  1 109 ? -12.368 138.068 9.792   1.00 19.12  ? 140  VAL B N   1 
ATOM   4209  C  CA  . VAL B  1 109 ? -13.390 137.395 10.580  1.00 20.29  ? 140  VAL B CA  1 
ATOM   4210  C  C   . VAL B  1 109 ? -13.199 137.751 12.045  1.00 22.10  ? 140  VAL B C   1 
ATOM   4211  O  O   . VAL B  1 109 ? -14.111 138.211 12.715  1.00 25.00  ? 140  VAL B O   1 
ATOM   4212  C  CB  . VAL B  1 109 ? -13.310 135.862 10.438  1.00 16.32  ? 140  VAL B CB  1 
ATOM   4213  C  CG1 . VAL B  1 109 ? -14.233 135.149 11.411  1.00 15.00  ? 140  VAL B CG1 1 
ATOM   4214  C  CG2 . VAL B  1 109 ? -13.725 135.515 9.021   1.00 15.00  ? 140  VAL B CG2 1 
ATOM   4215  N  N   . ASP B  1 110 ? -11.970 137.600 12.525  1.00 23.06  ? 141  ASP B N   1 
ATOM   4216  C  CA  . ASP B  1 110 ? -11.653 137.908 13.917  1.00 25.91  ? 141  ASP B CA  1 
ATOM   4217  C  C   . ASP B  1 110 ? -12.144 139.292 14.330  1.00 27.44  ? 141  ASP B C   1 
ATOM   4218  O  O   . ASP B  1 110 ? -12.670 139.494 15.424  1.00 28.04  ? 141  ASP B O   1 
ATOM   4219  C  CB  . ASP B  1 110 ? -10.141 137.826 14.108  1.00 26.89  ? 141  ASP B CB  1 
ATOM   4220  C  CG  . ASP B  1 110 ? -9.672  136.474 14.558  1.00 29.63  ? 141  ASP B CG  1 
ATOM   4221  O  OD1 . ASP B  1 110 ? -10.347 135.438 14.331  1.00 31.13  ? 141  ASP B OD1 1 
ATOM   4222  O  OD2 . ASP B  1 110 ? -8.583  136.440 15.164  1.00 29.70  ? 141  ASP B OD2 1 
ATOM   4223  N  N   . ASP B  1 111 ? -11.880 140.282 13.485  1.00 27.12  ? 142  ASP B N   1 
ATOM   4224  C  CA  . ASP B  1 111 ? -12.270 141.652 13.803  1.00 27.18  ? 142  ASP B CA  1 
ATOM   4225  C  C   . ASP B  1 111 ? -13.779 141.811 13.769  1.00 27.03  ? 142  ASP B C   1 
ATOM   4226  O  O   . ASP B  1 111 ? -14.365 142.542 14.566  1.00 25.61  ? 142  ASP B O   1 
ATOM   4227  C  CB  . ASP B  1 111 ? -11.557 142.592 12.833  1.00 26.50  ? 142  ASP B CB  1 
ATOM   4228  C  CG  . ASP B  1 111 ? -12.266 143.912 12.674  1.00 26.40  ? 142  ASP B CG  1 
ATOM   4229  O  OD1 . ASP B  1 111 ? -13.336 143.887 12.035  1.00 30.29  ? 142  ASP B OD1 1 
ATOM   4230  O  OD2 . ASP B  1 111 ? -11.751 144.918 13.186  1.00 24.37  ? 142  ASP B OD2 1 
ATOM   4231  N  N   . ALA B  1 112 ? -14.423 141.102 12.833  1.00 25.81  ? 143  ALA B N   1 
ATOM   4232  C  CA  . ALA B  1 112 ? -15.877 141.226 12.719  1.00 24.47  ? 143  ALA B CA  1 
ATOM   4233  C  C   . ALA B  1 112 ? -16.520 140.888 14.061  1.00 22.48  ? 143  ALA B C   1 
ATOM   4234  O  O   . ALA B  1 112 ? -17.301 141.665 14.598  1.00 21.69  ? 143  ALA B O   1 
ATOM   4235  C  CB  . ALA B  1 112 ? -16.413 140.280 11.664  1.00 22.65  ? 143  ALA B CB  1 
ATOM   4236  N  N   . PHE B  1 113 ? -16.163 139.717 14.600  1.00 20.64  ? 144  PHE B N   1 
ATOM   4237  C  CA  . PHE B  1 113 ? -16.696 139.331 15.898  1.00 21.10  ? 144  PHE B CA  1 
ATOM   4238  C  C   . PHE B  1 113 ? -16.374 140.356 16.962  1.00 21.55  ? 144  PHE B C   1 
ATOM   4239  O  O   . PHE B  1 113 ? -17.191 140.731 17.801  1.00 20.32  ? 144  PHE B O   1 
ATOM   4240  C  CB  . PHE B  1 113 ? -16.241 137.936 16.291  1.00 17.83  ? 144  PHE B CB  1 
ATOM   4241  C  CG  . PHE B  1 113 ? -16.698 136.862 15.351  1.00 18.06  ? 144  PHE B CG  1 
ATOM   4242  C  CD1 . PHE B  1 113 ? -18.033 136.696 15.028  1.00 17.34  ? 144  PHE B CD1 1 
ATOM   4243  C  CD2 . PHE B  1 113 ? -15.774 135.981 14.812  1.00 18.48  ? 144  PHE B CD2 1 
ATOM   4244  C  CE1 . PHE B  1 113 ? -18.413 135.702 14.138  1.00 19.03  ? 144  PHE B CE1 1 
ATOM   4245  C  CE2 . PHE B  1 113 ? -16.167 134.965 13.964  1.00 22.13  ? 144  PHE B CE2 1 
ATOM   4246  C  CZ  . PHE B  1 113 ? -17.512 134.828 13.631  1.00 20.81  ? 144  PHE B CZ  1 
ATOM   4247  N  N   . ALA B  1 114 ? -15.150 140.873 16.923  1.00 23.12  ? 145  ALA B N   1 
ATOM   4248  C  CA  . ALA B  1 114 ? -14.690 141.873 17.877  1.00 23.05  ? 145  ALA B CA  1 
ATOM   4249  C  C   . ALA B  1 114 ? -15.564 143.124 17.868  1.00 23.97  ? 145  ALA B C   1 
ATOM   4250  O  O   . ALA B  1 114 ? -15.941 143.634 18.918  1.00 23.78  ? 145  ALA B O   1 
ATOM   4251  C  CB  . ALA B  1 114 ? -13.281 142.284 17.463  1.00 21.11  ? 145  ALA B CB  1 
ATOM   4252  N  N   . ARG B  1 115 ? -15.818 143.633 16.667  1.00 23.83  ? 146  ARG B N   1 
ATOM   4253  C  CA  . ARG B  1 115 ? -16.575 144.846 16.495  1.00 22.97  ? 146  ARG B CA  1 
ATOM   4254  C  C   . ARG B  1 115 ? -18.047 144.631 16.786  1.00 23.44  ? 146  ARG B C   1 
ATOM   4255  O  O   . ARG B  1 115 ? -18.753 145.559 17.163  1.00 24.08  ? 146  ARG B O   1 
ATOM   4256  C  CB  . ARG B  1 115 ? -16.402 145.427 15.100  1.00 21.32  ? 146  ARG B CB  1 
ATOM   4257  C  CG  . ARG B  1 115 ? -14.990 145.837 14.746  1.00 21.34  ? 146  ARG B CG  1 
ATOM   4258  C  CD  . ARG B  1 115 ? -14.900 146.577 13.421  1.00 19.57  ? 146  ARG B CD  1 
ATOM   4259  N  NE  . ARG B  1 115 ? -15.068 145.694 12.273  1.00 18.00  ? 146  ARG B NE  1 
ATOM   4260  C  CZ  . ARG B  1 115 ? -16.195 145.659 11.577  1.00 17.34  ? 146  ARG B CZ  1 
ATOM   4261  N  NH1 . ARG B  1 115 ? -17.163 146.474 11.959  1.00 18.46  ? 146  ARG B NH1 1 
ATOM   4262  N  NH2 . ARG B  1 115 ? -16.338 144.857 10.546  1.00 16.25  ? 146  ARG B NH2 1 
ATOM   4263  N  N   . ALA B  1 116 ? -18.535 143.408 16.600  1.00 23.24  ? 147  ALA B N   1 
ATOM   4264  C  CA  . ALA B  1 116 ? -19.929 143.086 16.882  1.00 23.07  ? 147  ALA B CA  1 
ATOM   4265  C  C   . ALA B  1 116 ? -20.150 143.066 18.398  1.00 23.17  ? 147  ALA B C   1 
ATOM   4266  O  O   . ALA B  1 116 ? -21.178 143.463 18.872  1.00 23.14  ? 147  ALA B O   1 
ATOM   4267  C  CB  . ALA B  1 116 ? -20.282 141.736 16.306  1.00 23.38  ? 147  ALA B CB  1 
ATOM   4268  N  N   . PHE B  1 117 ? -19.130 142.634 19.123  1.00 24.26  ? 148  PHE B N   1 
ATOM   4269  C  CA  . PHE B  1 117 ? -19.185 142.627 20.582  1.00 24.29  ? 148  PHE B CA  1 
ATOM   4270  C  C   . PHE B  1 117 ? -19.179 144.075 21.060  1.00 26.18  ? 148  PHE B C   1 
ATOM   4271  O  O   . PHE B  1 117 ? -19.985 144.485 21.888  1.00 28.34  ? 148  PHE B O   1 
ATOM   4272  C  CB  . PHE B  1 117 ? -18.040 141.848 21.214  1.00 21.59  ? 148  PHE B CB  1 
ATOM   4273  C  CG  . PHE B  1 117 ? -18.279 140.364 21.279  1.00 18.19  ? 148  PHE B CG  1 
ATOM   4274  C  CD1 . PHE B  1 117 ? -19.275 139.842 22.080  1.00 18.15  ? 148  PHE B CD1 1 
ATOM   4275  C  CD2 . PHE B  1 117 ? -17.509 139.480 20.540  1.00 17.38  ? 148  PHE B CD2 1 
ATOM   4276  C  CE1 . PHE B  1 117 ? -19.511 138.494 22.143  1.00 17.12  ? 148  PHE B CE1 1 
ATOM   4277  C  CE2 . PHE B  1 117 ? -17.742 138.115 20.610  1.00 15.47  ? 148  PHE B CE2 1 
ATOM   4278  C  CZ  . PHE B  1 117 ? -18.761 137.620 21.396  1.00 15.19  ? 148  PHE B CZ  1 
ATOM   4279  N  N   . GLN B  1 118 ? -18.289 144.859 20.452  1.00 26.56  ? 149  GLN B N   1 
ATOM   4280  C  CA  . GLN B  1 118 ? -18.237 146.273 20.780  1.00 29.03  ? 149  GLN B CA  1 
ATOM   4281  C  C   . GLN B  1 118 ? -19.621 146.911 20.783  1.00 30.34  ? 149  GLN B C   1 
ATOM   4282  O  O   . GLN B  1 118 ? -19.993 147.631 21.710  1.00 33.46  ? 149  GLN B O   1 
ATOM   4283  C  CB  . GLN B  1 118 ? -17.355 147.031 19.794  1.00 30.83  ? 149  GLN B CB  1 
ATOM   4284  C  CG  . GLN B  1 118 ? -16.727 148.282 20.385  1.00 35.28  ? 149  GLN B CG  1 
ATOM   4285  C  CD  . GLN B  1 118 ? -16.128 149.182 19.324  1.00 38.08  ? 149  GLN B CD  1 
ATOM   4286  O  OE1 . GLN B  1 118 ? -15.544 148.732 18.338  1.00 37.81  ? 149  GLN B OE1 1 
ATOM   4287  N  NE2 . GLN B  1 118 ? -16.271 150.489 19.520  1.00 39.41  ? 149  GLN B NE2 1 
ATOM   4288  N  N   . VAL B  1 119 ? -20.397 146.661 19.727  1.00 28.65  ? 150  VAL B N   1 
ATOM   4289  C  CA  . VAL B  1 119 ? -21.732 147.208 19.612  1.00 26.11  ? 150  VAL B CA  1 
ATOM   4290  C  C   . VAL B  1 119 ? -22.457 147.140 20.942  1.00 25.00  ? 150  VAL B C   1 
ATOM   4291  O  O   . VAL B  1 119 ? -23.157 148.060 21.316  1.00 24.76  ? 150  VAL B O   1 
ATOM   4292  C  CB  . VAL B  1 119 ? -22.581 146.485 18.558  1.00 27.31  ? 150  VAL B CB  1 
ATOM   4293  C  CG1 . VAL B  1 119 ? -23.966 147.103 18.455  1.00 27.60  ? 150  VAL B CG1 1 
ATOM   4294  C  CG2 . VAL B  1 119 ? -21.900 146.528 17.203  1.00 28.38  ? 150  VAL B CG2 1 
ATOM   4295  N  N   . TRP B  1 120 ? -22.327 146.016 21.642  1.00 25.06  ? 151  TRP B N   1 
ATOM   4296  C  CA  . TRP B  1 120 ? -23.020 145.874 22.911  1.00 27.49  ? 151  TRP B CA  1 
ATOM   4297  C  C   . TRP B  1 120 ? -22.286 146.489 24.078  1.00 28.29  ? 151  TRP B C   1 
ATOM   4298  O  O   . TRP B  1 120 ? -22.921 146.943 25.031  1.00 29.41  ? 151  TRP B O   1 
ATOM   4299  C  CB  . TRP B  1 120 ? -23.372 144.405 23.204  1.00 26.85  ? 151  TRP B CB  1 
ATOM   4300  C  CG  . TRP B  1 120 ? -24.243 143.855 22.113  1.00 26.22  ? 151  TRP B CG  1 
ATOM   4301  C  CD1 . TRP B  1 120 ? -23.889 143.022 21.112  1.00 26.52  ? 151  TRP B CD1 1 
ATOM   4302  C  CD2 . TRP B  1 120 ? -25.647 144.106 21.970  1.00 26.97  ? 151  TRP B CD2 1 
ATOM   4303  N  NE1 . TRP B  1 120 ? -24.975 142.747 20.330  1.00 28.43  ? 151  TRP B NE1 1 
ATOM   4304  C  CE2 . TRP B  1 120 ? -26.072 143.395 20.826  1.00 28.02  ? 151  TRP B CE2 1 
ATOM   4305  C  CE3 . TRP B  1 120 ? -26.594 144.850 22.676  1.00 26.99  ? 151  TRP B CE3 1 
ATOM   4306  C  CZ2 . TRP B  1 120 ? -27.390 143.418 20.381  1.00 28.51  ? 151  TRP B CZ2 1 
ATOM   4307  C  CZ3 . TRP B  1 120 ? -27.890 144.884 22.249  1.00 27.82  ? 151  TRP B CZ3 1 
ATOM   4308  C  CH2 . TRP B  1 120 ? -28.283 144.176 21.102  1.00 28.41  ? 151  TRP B CH2 1 
ATOM   4309  N  N   . SER B  1 121 ? -20.966 146.381 24.100  1.00 29.73  ? 152  SER B N   1 
ATOM   4310  C  CA  . SER B  1 121 ? -20.156 146.939 25.172  1.00 30.24  ? 152  SER B CA  1 
ATOM   4311  C  C   . SER B  1 121 ? -20.183 148.458 25.183  1.00 29.54  ? 152  SER B C   1 
ATOM   4312  O  O   . SER B  1 121 ? -20.002 149.096 26.226  1.00 29.03  ? 152  SER B O   1 
ATOM   4313  C  CB  . SER B  1 121 ? -18.747 146.377 25.134  1.00 31.78  ? 152  SER B CB  1 
ATOM   4314  O  OG  . SER B  1 121 ? -18.177 146.354 23.843  1.00 33.62  ? 152  SER B OG  1 
ATOM   4315  N  N   . ASP B  1 122 ? -20.478 149.068 24.038  1.00 28.63  ? 153  ASP B N   1 
ATOM   4316  C  CA  . ASP B  1 122 ? -20.611 150.504 23.948  1.00 29.40  ? 153  ASP B CA  1 
ATOM   4317  C  C   . ASP B  1 122 ? -21.722 151.083 24.807  1.00 30.51  ? 153  ASP B C   1 
ATOM   4318  O  O   . ASP B  1 122 ? -21.625 152.268 25.150  1.00 30.58  ? 153  ASP B O   1 
ATOM   4319  C  CB  . ASP B  1 122 ? -20.836 150.935 22.497  1.00 29.94  ? 153  ASP B CB  1 
ATOM   4320  C  CG  . ASP B  1 122 ? -19.548 150.931 21.701  1.00 31.52  ? 153  ASP B CG  1 
ATOM   4321  O  OD1 . ASP B  1 122 ? -18.471 151.093 22.304  1.00 29.95  ? 153  ASP B OD1 1 
ATOM   4322  O  OD2 . ASP B  1 122 ? -19.653 150.777 20.463  1.00 33.26  ? 153  ASP B OD2 1 
ATOM   4323  N  N   . VAL B  1 123 ? -22.778 150.337 25.088  1.00 31.60  ? 154  VAL B N   1 
ATOM   4324  C  CA  . VAL B  1 123 ? -23.905 150.846 25.842  1.00 32.04  ? 154  VAL B CA  1 
ATOM   4325  C  C   . VAL B  1 123 ? -24.127 150.153 27.168  1.00 33.57  ? 154  VAL B C   1 
ATOM   4326  O  O   . VAL B  1 123 ? -25.205 150.317 27.760  1.00 34.68  ? 154  VAL B O   1 
ATOM   4327  C  CB  . VAL B  1 123 ? -25.229 150.771 25.046  1.00 31.03  ? 154  VAL B CB  1 
ATOM   4328  C  CG1 . VAL B  1 123 ? -25.057 151.493 23.718  1.00 29.43  ? 154  VAL B CG1 1 
ATOM   4329  C  CG2 . VAL B  1 123 ? -25.696 149.340 24.867  1.00 31.25  ? 154  VAL B CG2 1 
ATOM   4330  N  N   . THR B  1 124 ? -23.217 149.280 27.578  1.00 34.45  ? 155  THR B N   1 
ATOM   4331  C  CA  . THR B  1 124 ? -23.424 148.516 28.811  1.00 35.98  ? 155  THR B CA  1 
ATOM   4332  C  C   . THR B  1 124 ? -22.117 148.351 29.579  1.00 38.30  ? 155  THR B C   1 
ATOM   4333  O  O   . THR B  1 124 ? -21.015 148.578 29.055  1.00 40.99  ? 155  THR B O   1 
ATOM   4334  C  CB  . THR B  1 124 ? -23.948 147.109 28.458  1.00 35.57  ? 155  THR B CB  1 
ATOM   4335  O  OG1 . THR B  1 124 ? -22.887 146.404 27.792  1.00 35.65  ? 155  THR B OG1 1 
ATOM   4336  C  CG2 . THR B  1 124 ? -25.171 147.123 27.566  1.00 35.19  ? 155  THR B CG2 1 
ATOM   4337  N  N   . PRO B  1 125 ? -22.189 147.835 30.800  1.00 38.02  ? 156  PRO B N   1 
ATOM   4338  C  CA  . PRO B  1 125 ? -21.023 147.567 31.618  1.00 37.45  ? 156  PRO B CA  1 
ATOM   4339  C  C   . PRO B  1 125 ? -20.330 146.272 31.212  1.00 36.34  ? 156  PRO B C   1 
ATOM   4340  O  O   . PRO B  1 125 ? -19.469 145.778 31.937  1.00 36.52  ? 156  PRO B O   1 
ATOM   4341  C  CB  . PRO B  1 125 ? -21.562 147.416 33.029  1.00 37.91  ? 156  PRO B CB  1 
ATOM   4342  C  CG  . PRO B  1 125 ? -23.026 147.552 32.969  1.00 39.14  ? 156  PRO B CG  1 
ATOM   4343  C  CD  . PRO B  1 125 ? -23.436 147.509 31.526  1.00 38.51  ? 156  PRO B CD  1 
ATOM   4344  N  N   . LEU B  1 126 ? -20.797 145.667 30.138  1.00 35.43  ? 157  LEU B N   1 
ATOM   4345  C  CA  . LEU B  1 126 ? -20.260 144.419 29.643  1.00 34.75  ? 157  LEU B CA  1 
ATOM   4346  C  C   . LEU B  1 126 ? -18.865 144.633 29.066  1.00 36.17  ? 157  LEU B C   1 
ATOM   4347  O  O   . LEU B  1 126 ? -18.666 145.612 28.353  1.00 35.96  ? 157  LEU B O   1 
ATOM   4348  C  CB  . LEU B  1 126 ? -21.185 143.901 28.527  1.00 33.11  ? 157  LEU B CB  1 
ATOM   4349  C  CG  . LEU B  1 126 ? -22.552 143.428 29.049  1.00 32.00  ? 157  LEU B CG  1 
ATOM   4350  C  CD1 . LEU B  1 126 ? -23.455 143.018 27.909  1.00 29.14  ? 157  LEU B CD1 1 
ATOM   4351  C  CD2 . LEU B  1 126 ? -22.340 142.277 30.027  1.00 31.35  ? 157  LEU B CD2 1 
ATOM   4352  N  N   . ARG B  1 127 ? -17.976 143.728 29.409  1.00 37.59  ? 158  ARG B N   1 
ATOM   4353  C  CA  . ARG B  1 127 ? -16.604 143.710 28.928  1.00 37.25  ? 158  ARG B CA  1 
ATOM   4354  C  C   . ARG B  1 127 ? -16.379 142.340 28.280  1.00 36.43  ? 158  ARG B C   1 
ATOM   4355  O  O   . ARG B  1 127 ? -16.698 141.330 28.908  1.00 36.53  ? 158  ARG B O   1 
ATOM   4356  C  CB  . ARG B  1 127 ? -15.615 143.867 30.072  1.00 40.12  ? 158  ARG B CB  1 
ATOM   4357  C  CG  . ARG B  1 127 ? -15.609 145.163 30.843  1.00 43.58  ? 158  ARG B CG  1 
ATOM   4358  C  CD  . ARG B  1 127 ? -14.719 145.086 32.079  1.00 47.80  ? 158  ARG B CD  1 
ATOM   4359  N  NE  . ARG B  1 127 ? -13.318 144.873 31.746  1.00 52.43  ? 158  ARG B NE  1 
ATOM   4360  C  CZ  . ARG B  1 127 ? -12.726 143.711 31.500  1.00 53.14  ? 158  ARG B CZ  1 
ATOM   4361  N  NH1 . ARG B  1 127 ? -13.395 142.566 31.537  1.00 52.88  ? 158  ARG B NH1 1 
ATOM   4362  N  NH2 . ARG B  1 127 ? -11.431 143.658 31.199  1.00 51.78  ? 158  ARG B NH2 1 
ATOM   4363  N  N   . PHE B  1 128 ? -15.914 142.343 27.042  1.00 35.62  ? 159  PHE B N   1 
ATOM   4364  C  CA  . PHE B  1 128 ? -15.692 141.048 26.386  1.00 36.08  ? 159  PHE B CA  1 
ATOM   4365  C  C   . PHE B  1 128 ? -14.200 140.826 26.198  1.00 35.24  ? 159  PHE B C   1 
ATOM   4366  O  O   . PHE B  1 128 ? -13.450 141.741 25.846  1.00 35.60  ? 159  PHE B O   1 
ATOM   4367  C  CB  . PHE B  1 128 ? -16.456 140.968 25.072  1.00 37.99  ? 159  PHE B CB  1 
ATOM   4368  C  CG  . PHE B  1 128 ? -17.942 141.136 25.190  1.00 39.23  ? 159  PHE B CG  1 
ATOM   4369  C  CD1 . PHE B  1 128 ? -18.508 142.383 25.102  1.00 40.58  ? 159  PHE B CD1 1 
ATOM   4370  C  CD2 . PHE B  1 128 ? -18.783 140.058 25.380  1.00 39.54  ? 159  PHE B CD2 1 
ATOM   4371  C  CE1 . PHE B  1 128 ? -19.868 142.590 25.203  1.00 40.00  ? 159  PHE B CE1 1 
ATOM   4372  C  CE2 . PHE B  1 128 ? -20.149 140.243 25.483  1.00 41.52  ? 159  PHE B CE2 1 
ATOM   4373  C  CZ  . PHE B  1 128 ? -20.704 141.507 25.390  1.00 40.12  ? 159  PHE B CZ  1 
ATOM   4374  N  N   . SER B  1 129 ? -13.752 139.605 26.451  1.00 33.38  ? 160  SER B N   1 
ATOM   4375  C  CA  . SER B  1 129 ? -12.359 139.216 26.267  1.00 29.96  ? 160  SER B CA  1 
ATOM   4376  C  C   . SER B  1 129 ? -12.284 137.960 25.413  1.00 27.95  ? 160  SER B C   1 
ATOM   4377  O  O   . SER B  1 129 ? -13.111 137.054 25.536  1.00 28.54  ? 160  SER B O   1 
ATOM   4378  C  CB  . SER B  1 129 ? -11.669 138.965 27.600  1.00 29.38  ? 160  SER B CB  1 
ATOM   4379  O  OG  . SER B  1 129 ? -12.449 139.437 28.684  1.00 32.62  ? 160  SER B OG  1 
ATOM   4380  N  N   . ARG B  1 130 ? -11.221 137.845 24.624  1.00 24.46  ? 161  ARG B N   1 
ATOM   4381  C  CA  . ARG B  1 130 ? -11.084 136.674 23.787  1.00 22.82  ? 161  ARG B CA  1 
ATOM   4382  C  C   . ARG B  1 130 ? -10.088 135.721 24.446  1.00 22.03  ? 161  ARG B C   1 
ATOM   4383  O  O   . ARG B  1 130 ? -9.080  136.167 24.978  1.00 22.66  ? 161  ARG B O   1 
ATOM   4384  C  CB  . ARG B  1 130 ? -10.535 137.030 22.416  1.00 20.58  ? 161  ARG B CB  1 
ATOM   4385  C  CG  . ARG B  1 130 ? -10.454 135.851 21.445  1.00 21.26  ? 161  ARG B CG  1 
ATOM   4386  C  CD  . ARG B  1 130 ? -9.823  136.338 20.153  1.00 19.46  ? 161  ARG B CD  1 
ATOM   4387  N  NE  . ARG B  1 130 ? -9.617  135.257 19.183  1.00 18.15  ? 161  ARG B NE  1 
ATOM   4388  C  CZ  . ARG B  1 130 ? -9.045  135.538 17.999  1.00 17.27  ? 161  ARG B CZ  1 
ATOM   4389  N  NH1 . ARG B  1 130 ? -8.633  136.766 17.753  1.00 15.00  ? 161  ARG B NH1 1 
ATOM   4390  N  NH2 . ARG B  1 130 ? -8.831  134.558 17.134  1.00 16.78  ? 161  ARG B NH2 1 
ATOM   4391  N  N   . ILE B  1 131 ? -10.416 134.442 24.470  1.00 19.91  ? 162  ILE B N   1 
ATOM   4392  C  CA  . ILE B  1 131 ? -9.462  133.469 25.006  1.00 20.15  ? 162  ILE B CA  1 
ATOM   4393  C  C   . ILE B  1 131 ? -9.131  132.497 23.876  1.00 21.70  ? 162  ILE B C   1 
ATOM   4394  O  O   . ILE B  1 131 ? -9.919  132.365 22.941  1.00 21.54  ? 162  ILE B O   1 
ATOM   4395  C  CB  . ILE B  1 131 ? -10.046 132.700 26.186  1.00 18.13  ? 162  ILE B CB  1 
ATOM   4396  C  CG1 . ILE B  1 131 ? -11.091 131.697 25.702  1.00 20.13  ? 162  ILE B CG1 1 
ATOM   4397  C  CG2 . ILE B  1 131 ? -10.578 133.644 27.243  1.00 15.00  ? 162  ILE B CG2 1 
ATOM   4398  C  CD1 . ILE B  1 131 ? -11.772 130.923 26.814  1.00 18.85  ? 162  ILE B CD1 1 
ATOM   4399  N  N   . HIS B  1 132 ? -7.921  131.945 23.874  1.00 24.33  ? 163  HIS B N   1 
ATOM   4400  C  CA  . HIS B  1 132 ? -7.495  131.115 22.753  1.00 25.79  ? 163  HIS B CA  1 
ATOM   4401  C  C   . HIS B  1 132 ? -7.503  129.634 23.020  1.00 26.75  ? 163  HIS B C   1 
ATOM   4402  O  O   . HIS B  1 132 ? -7.258  128.816 22.130  1.00 25.95  ? 163  HIS B O   1 
ATOM   4403  C  CB  . HIS B  1 132 ? -6.171  131.545 22.169  1.00 23.74  ? 163  HIS B CB  1 
ATOM   4404  C  CG  . HIS B  1 132 ? -6.272  132.798 21.364  1.00 24.78  ? 163  HIS B CG  1 
ATOM   4405  N  ND1 . HIS B  1 132 ? -6.586  133.998 21.936  1.00 25.61  ? 163  HIS B ND1 1 
ATOM   4406  C  CD2 . HIS B  1 132 ? -6.095  133.031 20.050  1.00 25.11  ? 163  HIS B CD2 1 
ATOM   4407  C  CE1 . HIS B  1 132 ? -6.611  134.937 21.001  1.00 26.59  ? 163  HIS B CE1 1 
ATOM   4408  N  NE2 . HIS B  1 132 ? -6.297  134.375 19.845  1.00 27.55  ? 163  HIS B NE2 1 
ATOM   4409  N  N   . ASP B  1 133 ? -7.805  129.300 24.258  1.00 29.37  ? 164  ASP B N   1 
ATOM   4410  C  CA  . ASP B  1 133 ? -7.886  127.893 24.612  1.00 33.80  ? 164  ASP B CA  1 
ATOM   4411  C  C   . ASP B  1 133 ? -8.738  127.769 25.868  1.00 33.82  ? 164  ASP B C   1 
ATOM   4412  O  O   . ASP B  1 133 ? -8.782  128.686 26.676  1.00 31.44  ? 164  ASP B O   1 
ATOM   4413  C  CB  . ASP B  1 133 ? -6.505  127.299 24.809  1.00 39.52  ? 164  ASP B CB  1 
ATOM   4414  C  CG  . ASP B  1 133 ? -5.933  127.567 26.185  1.00 46.48  ? 164  ASP B CG  1 
ATOM   4415  O  OD1 . ASP B  1 133 ? -5.779  128.748 26.560  1.00 51.47  ? 164  ASP B OD1 1 
ATOM   4416  O  OD2 . ASP B  1 133 ? -5.637  126.581 26.898  1.00 50.43  ? 164  ASP B OD2 1 
ATOM   4417  N  N   . GLY B  1 134 ? -9.428  126.646 25.981  1.00 35.64  ? 165  GLY B N   1 
ATOM   4418  C  CA  . GLY B  1 134 ? -10.275 126.437 27.158  1.00 37.56  ? 165  GLY B CA  1 
ATOM   4419  C  C   . GLY B  1 134 ? -11.704 126.821 26.768  1.00 37.85  ? 165  GLY B C   1 
ATOM   4420  O  O   . GLY B  1 134 ? -11.891 127.366 25.687  1.00 38.93  ? 165  GLY B O   1 
ATOM   4421  N  N   . GLU B  1 135 ? -12.633 126.478 27.632  1.00 36.95  ? 166  GLU B N   1 
ATOM   4422  C  CA  . GLU B  1 135 ? -14.044 126.758 27.371  1.00 35.73  ? 166  GLU B CA  1 
ATOM   4423  C  C   . GLU B  1 135 ? -14.342 128.232 27.608  1.00 34.11  ? 166  GLU B C   1 
ATOM   4424  O  O   . GLU B  1 135 ? -14.012 128.771 28.663  1.00 33.65  ? 166  GLU B O   1 
ATOM   4425  C  CB  . GLU B  1 135 ? -14.895 125.885 28.302  1.00 36.15  ? 166  GLU B CB  1 
ATOM   4426  C  CG  . GLU B  1 135 ? -16.386 125.994 28.044  1.00 37.89  ? 166  GLU B CG  1 
ATOM   4427  C  CD  . GLU B  1 135 ? -16.716 125.653 26.605  1.00 38.33  ? 166  GLU B CD  1 
ATOM   4428  O  OE1 . GLU B  1 135 ? -16.013 124.787 26.042  1.00 36.60  ? 166  GLU B OE1 1 
ATOM   4429  O  OE2 . GLU B  1 135 ? -17.660 126.243 26.054  1.00 39.61  ? 166  GLU B OE2 1 
ATOM   4430  N  N   . ALA B  1 136 ? -14.936 128.880 26.616  1.00 32.30  ? 167  ALA B N   1 
ATOM   4431  C  CA  . ALA B  1 136 ? -15.239 130.305 26.738  1.00 32.52  ? 167  ALA B CA  1 
ATOM   4432  C  C   . ALA B  1 136 ? -16.694 130.480 27.144  1.00 32.95  ? 167  ALA B C   1 
ATOM   4433  O  O   . ALA B  1 136 ? -17.450 129.513 27.057  1.00 34.75  ? 167  ALA B O   1 
ATOM   4434  C  CB  . ALA B  1 136 ? -15.029 130.990 25.393  1.00 32.33  ? 167  ALA B CB  1 
ATOM   4435  N  N   . ASP B  1 137 ? -17.063 131.698 27.553  1.00 30.99  ? 168  ASP B N   1 
ATOM   4436  C  CA  . ASP B  1 137 ? -18.496 131.870 27.857  1.00 27.25  ? 168  ASP B CA  1 
ATOM   4437  C  C   . ASP B  1 137 ? -19.208 131.740 26.535  1.00 24.67  ? 168  ASP B C   1 
ATOM   4438  O  O   . ASP B  1 137 ? -20.249 131.084 26.397  1.00 26.42  ? 168  ASP B O   1 
ATOM   4439  C  CB  . ASP B  1 137 ? -18.756 133.236 28.478  1.00 29.89  ? 168  ASP B CB  1 
ATOM   4440  C  CG  . ASP B  1 137 ? -18.206 133.300 29.887  1.00 31.88  ? 168  ASP B CG  1 
ATOM   4441  O  OD1 . ASP B  1 137 ? -18.469 132.351 30.664  1.00 32.39  ? 168  ASP B OD1 1 
ATOM   4442  O  OD2 . ASP B  1 137 ? -17.540 134.297 30.217  1.00 31.57  ? 168  ASP B OD2 1 
ATOM   4443  N  N   . ILE B  1 138 ? -18.776 132.416 25.505  1.00 22.08  ? 169  ILE B N   1 
ATOM   4444  C  CA  . ILE B  1 138 ? -19.331 132.335 24.178  1.00 21.19  ? 169  ILE B CA  1 
ATOM   4445  C  C   . ILE B  1 138 ? -18.365 131.657 23.209  1.00 22.04  ? 169  ILE B C   1 
ATOM   4446  O  O   . ILE B  1 138 ? -17.250 132.146 22.994  1.00 23.83  ? 169  ILE B O   1 
ATOM   4447  C  CB  . ILE B  1 138 ? -19.684 133.736 23.678  1.00 19.81  ? 169  ILE B CB  1 
ATOM   4448  C  CG1 . ILE B  1 138 ? -20.703 134.430 24.605  1.00 16.65  ? 169  ILE B CG1 1 
ATOM   4449  C  CG2 . ILE B  1 138 ? -20.302 133.668 22.292  1.00 18.67  ? 169  ILE B CG2 1 
ATOM   4450  C  CD1 . ILE B  1 138 ? -20.871 135.886 24.209  1.00 15.00  ? 169  ILE B CD1 1 
ATOM   4451  N  N   . MET B  1 139 ? -18.744 130.485 22.698  1.00 21.86  ? 170  MET B N   1 
ATOM   4452  C  CA  . MET B  1 139 ? -17.881 129.773 21.761  1.00 23.79  ? 170  MET B CA  1 
ATOM   4453  C  C   . MET B  1 139 ? -18.368 129.980 20.336  1.00 23.94  ? 170  MET B C   1 
ATOM   4454  O  O   . MET B  1 139 ? -19.418 129.504 19.923  1.00 27.96  ? 170  MET B O   1 
ATOM   4455  C  CB  . MET B  1 139 ? -17.816 128.283 22.018  1.00 24.63  ? 170  MET B CB  1 
ATOM   4456  C  CG  . MET B  1 139 ? -17.480 127.852 23.417  1.00 27.29  ? 170  MET B CG  1 
ATOM   4457  S  SD  . MET B  1 139 ? -15.700 127.689 23.682  1.00 31.94  ? 170  MET B SD  1 
ATOM   4458  C  CE  . MET B  1 139 ? -15.326 126.447 22.456  1.00 29.39  ? 170  MET B CE  1 
ATOM   4459  N  N   . ILE B  1 140 ? -17.653 130.778 19.561  1.00 22.53  ? 171  ILE B N   1 
ATOM   4460  C  CA  . ILE B  1 140 ? -18.089 131.120 18.201  1.00 21.86  ? 171  ILE B CA  1 
ATOM   4461  C  C   . ILE B  1 140 ? -17.656 130.046 17.216  1.00 21.35  ? 171  ILE B C   1 
ATOM   4462  O  O   . ILE B  1 140 ? -16.478 129.739 17.131  1.00 22.34  ? 171  ILE B O   1 
ATOM   4463  C  CB  . ILE B  1 140 ? -17.539 132.492 17.818  1.00 22.76  ? 171  ILE B CB  1 
ATOM   4464  C  CG1 . ILE B  1 140 ? -18.014 133.565 18.797  1.00 23.00  ? 171  ILE B CG1 1 
ATOM   4465  C  CG2 . ILE B  1 140 ? -17.856 132.940 16.410  1.00 22.57  ? 171  ILE B CG2 1 
ATOM   4466  C  CD1 . ILE B  1 140 ? -17.406 134.912 18.540  1.00 26.10  ? 171  ILE B CD1 1 
ATOM   4467  N  N   . ASN B  1 141 ? -18.558 129.647 16.324  1.00 21.60  ? 172  ASN B N   1 
ATOM   4468  C  CA  . ASN B  1 141 ? -18.211 128.649 15.324  1.00 23.09  ? 172  ASN B CA  1 
ATOM   4469  C  C   . ASN B  1 141 ? -19.120 128.634 14.104  1.00 23.41  ? 172  ASN B C   1 
ATOM   4470  O  O   . ASN B  1 141 ? -20.251 129.140 14.211  1.00 24.29  ? 172  ASN B O   1 
ATOM   4471  C  CB  . ASN B  1 141 ? -18.225 127.244 15.954  1.00 24.38  ? 172  ASN B CB  1 
ATOM   4472  C  CG  . ASN B  1 141 ? -17.545 126.228 15.064  1.00 25.37  ? 172  ASN B CG  1 
ATOM   4473  O  OD1 . ASN B  1 141 ? -17.634 125.027 15.282  1.00 27.75  ? 172  ASN B OD1 1 
ATOM   4474  N  ND2 . ASN B  1 141 ? -16.839 126.682 14.036  1.00 25.76  ? 172  ASN B ND2 1 
ATOM   4475  N  N   . PHE B  1 142 ? -18.686 128.043 13.020  1.00 23.21  ? 173  PHE B N   1 
ATOM   4476  C  CA  . PHE B  1 142 ? -19.465 127.951 11.799  1.00 26.62  ? 173  PHE B CA  1 
ATOM   4477  C  C   . PHE B  1 142 ? -19.797 126.499 11.482  1.00 29.37  ? 173  PHE B C   1 
ATOM   4478  O  O   . PHE B  1 142 ? -18.936 125.639 11.266  1.00 31.87  ? 173  PHE B O   1 
ATOM   4479  C  CB  . PHE B  1 142 ? -18.713 128.554 10.616  1.00 26.73  ? 173  PHE B CB  1 
ATOM   4480  C  CG  . PHE B  1 142 ? -18.436 130.025 10.679  1.00 27.38  ? 173  PHE B CG  1 
ATOM   4481  C  CD1 . PHE B  1 142 ? -17.482 130.508 11.545  1.00 27.77  ? 173  PHE B CD1 1 
ATOM   4482  C  CD2 . PHE B  1 142 ? -19.081 130.932 9.871   1.00 27.23  ? 173  PHE B CD2 1 
ATOM   4483  C  CE1 . PHE B  1 142 ? -17.189 131.852 11.611  1.00 29.08  ? 173  PHE B CE1 1 
ATOM   4484  C  CE2 . PHE B  1 142 ? -18.802 132.270 9.920   1.00 27.76  ? 173  PHE B CE2 1 
ATOM   4485  C  CZ  . PHE B  1 142 ? -17.848 132.741 10.794  1.00 29.16  ? 173  PHE B CZ  1 
ATOM   4486  N  N   . GLY B  1 143 ? -21.064 126.145 11.461  1.00 32.27  ? 174  GLY B N   1 
ATOM   4487  C  CA  . GLY B  1 143 ? -21.471 124.780 11.168  1.00 31.39  ? 174  GLY B CA  1 
ATOM   4488  C  C   . GLY B  1 143 ? -22.524 124.825 10.063  1.00 31.92  ? 174  GLY B C   1 
ATOM   4489  O  O   . GLY B  1 143 ? -23.040 125.898 9.785   1.00 31.18  ? 174  GLY B O   1 
ATOM   4490  N  N   . ARG B  1 144 ? -22.793 123.726 9.414   1.00 33.04  ? 175  ARG B N   1 
ATOM   4491  C  CA  . ARG B  1 144 ? -23.786 123.671 8.389   1.00 36.16  ? 175  ARG B CA  1 
ATOM   4492  C  C   . ARG B  1 144 ? -24.969 122.842 8.818   1.00 38.34  ? 175  ARG B C   1 
ATOM   4493  O  O   . ARG B  1 144 ? -25.456 122.966 9.958   1.00 42.30  ? 175  ARG B O   1 
ATOM   4494  C  CB  . ARG B  1 144 ? -23.270 123.317 7.031   1.00 33.82  ? 175  ARG B CB  1 
ATOM   4495  C  CG  . ARG B  1 144 ? -22.866 121.882 6.811   1.00 31.09  ? 175  ARG B CG  1 
ATOM   4496  C  CD  . ARG B  1 144 ? -21.785 121.828 5.730   1.00 29.23  ? 175  ARG B CD  1 
ATOM   4497  N  NE  . ARG B  1 144 ? -22.020 120.614 4.910   1.00 29.45  ? 175  ARG B NE  1 
ATOM   4498  C  CZ  . ARG B  1 144 ? -22.601 120.780 3.730   1.00 27.01  ? 175  ARG B CZ  1 
ATOM   4499  N  NH1 . ARG B  1 144 ? -22.903 122.040 3.435   1.00 23.69  ? 175  ARG B NH1 1 
ATOM   4500  N  NH2 . ARG B  1 144 ? -22.874 119.812 2.894   1.00 26.34  ? 175  ARG B NH2 1 
ATOM   4501  N  N   . TRP B  1 145 ? -25.553 122.038 7.937   1.00 38.16  ? 176  TRP B N   1 
ATOM   4502  C  CA  . TRP B  1 145 ? -26.726 121.282 8.458   1.00 38.33  ? 176  TRP B CA  1 
ATOM   4503  C  C   . TRP B  1 145 ? -26.300 120.617 9.766   1.00 38.17  ? 176  TRP B C   1 
ATOM   4504  O  O   . TRP B  1 145 ? -25.093 120.674 10.084  1.00 42.99  ? 176  TRP B O   1 
ATOM   4505  C  CB  . TRP B  1 145 ? -27.138 120.273 7.421   1.00 38.40  ? 176  TRP B CB  1 
ATOM   4506  C  CG  . TRP B  1 145 ? -27.471 120.771 6.055   1.00 39.67  ? 176  TRP B CG  1 
ATOM   4507  C  CD1 . TRP B  1 145 ? -26.590 120.980 5.037   1.00 38.00  ? 176  TRP B CD1 1 
ATOM   4508  C  CD2 . TRP B  1 145 ? -28.776 121.065 5.528   1.00 41.83  ? 176  TRP B CD2 1 
ATOM   4509  N  NE1 . TRP B  1 145 ? -27.250 121.422 3.923   1.00 41.53  ? 176  TRP B NE1 1 
ATOM   4510  C  CE2 . TRP B  1 145 ? -28.608 121.472 4.195   1.00 42.06  ? 176  TRP B CE2 1 
ATOM   4511  C  CE3 . TRP B  1 145 ? -30.060 121.040 6.071   1.00 43.24  ? 176  TRP B CE3 1 
ATOM   4512  C  CZ2 . TRP B  1 145 ? -29.675 121.838 3.388   1.00 42.32  ? 176  TRP B CZ2 1 
ATOM   4513  C  CZ3 . TRP B  1 145 ? -31.115 121.435 5.272   1.00 45.58  ? 176  TRP B CZ3 1 
ATOM   4514  C  CH2 . TRP B  1 145 ? -30.919 121.817 3.940   1.00 45.26  ? 176  TRP B CH2 1 
ATOM   4515  N  N   . GLU B  1 146 ? -27.172 119.937 10.480  1.00 33.88  ? 177  GLU B N   1 
ATOM   4516  C  CA  . GLU B  1 146 ? -26.839 119.231 11.689  1.00 30.27  ? 177  GLU B CA  1 
ATOM   4517  C  C   . GLU B  1 146 ? -25.352 119.141 11.919  1.00 29.59  ? 177  GLU B C   1 
ATOM   4518  O  O   . GLU B  1 146 ? -24.687 118.257 11.363  1.00 31.04  ? 177  GLU B O   1 
ATOM   4519  C  CB  . GLU B  1 146 ? -27.561 117.917 11.923  1.00 28.94  ? 177  GLU B CB  1 
ATOM   4520  C  CG  . GLU B  1 146 ? -27.504 117.441 13.365  1.00 28.13  ? 177  GLU B CG  1 
ATOM   4521  C  CD  . GLU B  1 146 ? -27.460 118.593 14.352  1.00 31.19  ? 177  GLU B CD  1 
ATOM   4522  O  OE1 . GLU B  1 146 ? -28.419 119.394 14.370  1.00 31.54  ? 177  GLU B OE1 1 
ATOM   4523  O  OE2 . GLU B  1 146 ? -26.469 118.696 15.106  1.00 32.67  ? 177  GLU B OE2 1 
ATOM   4524  N  N   . HIS B  1 147 ? -24.945 120.089 12.768  1.00 25.26  ? 178  HIS B N   1 
ATOM   4525  C  CA  . HIS B  1 147 ? -23.650 120.422 13.238  1.00 20.34  ? 178  HIS B CA  1 
ATOM   4526  C  C   . HIS B  1 147 ? -23.450 120.338 14.759  1.00 19.64  ? 178  HIS B C   1 
ATOM   4527  O  O   . HIS B  1 147 ? -22.676 121.103 15.335  1.00 18.12  ? 178  HIS B O   1 
ATOM   4528  C  CB  . HIS B  1 147 ? -23.224 121.814 12.766  1.00 19.37  ? 178  HIS B CB  1 
ATOM   4529  C  CG  . HIS B  1 147 ? -24.211 122.943 13.170  1.00 20.42  ? 178  HIS B CG  1 
ATOM   4530  N  ND1 . HIS B  1 147 ? -25.487 123.041 12.656  1.00 21.62  ? 178  HIS B ND1 1 
ATOM   4531  C  CD2 . HIS B  1 147 ? -24.073 123.985 14.026  1.00 20.99  ? 178  HIS B CD2 1 
ATOM   4532  C  CE1 . HIS B  1 147 ? -26.092 124.095 13.177  1.00 20.36  ? 178  HIS B CE1 1 
ATOM   4533  N  NE2 . HIS B  1 147 ? -25.256 124.685 14.010  1.00 19.59  ? 178  HIS B NE2 1 
ATOM   4534  N  N   . GLY B  1 148 ? -24.153 119.436 15.450  1.00 20.16  ? 179  GLY B N   1 
ATOM   4535  C  CA  . GLY B  1 148 ? -23.860 119.216 16.864  1.00 22.43  ? 179  GLY B CA  1 
ATOM   4536  C  C   . GLY B  1 148 ? -24.916 119.671 17.888  1.00 24.24  ? 179  GLY B C   1 
ATOM   4537  O  O   . GLY B  1 148 ? -24.690 119.607 19.096  1.00 25.85  ? 179  GLY B O   1 
ATOM   4538  N  N   . ASP B  1 149 ? -26.109 120.143 17.522  1.00 24.65  ? 180  ASP B N   1 
ATOM   4539  C  CA  . ASP B  1 149 ? -27.037 120.528 18.598  1.00 25.45  ? 180  ASP B CA  1 
ATOM   4540  C  C   . ASP B  1 149 ? -28.494 120.353 18.275  1.00 26.31  ? 180  ASP B C   1 
ATOM   4541  O  O   . ASP B  1 149 ? -29.344 121.077 18.789  1.00 27.37  ? 180  ASP B O   1 
ATOM   4542  C  CB  . ASP B  1 149 ? -26.785 121.959 19.091  1.00 25.56  ? 180  ASP B CB  1 
ATOM   4543  C  CG  . ASP B  1 149 ? -26.770 122.993 17.989  1.00 26.46  ? 180  ASP B CG  1 
ATOM   4544  O  OD1 . ASP B  1 149 ? -27.359 122.733 16.922  1.00 25.96  ? 180  ASP B OD1 1 
ATOM   4545  O  OD2 . ASP B  1 149 ? -26.167 124.068 18.198  1.00 26.82  ? 180  ASP B OD2 1 
ATOM   4546  N  N   . GLY B  1 150 ? -28.842 119.462 17.355  1.00 26.32  ? 181  GLY B N   1 
ATOM   4547  C  CA  . GLY B  1 150 ? -30.239 119.236 17.048  1.00 26.86  ? 181  GLY B CA  1 
ATOM   4548  C  C   . GLY B  1 150 ? -30.959 120.402 16.445  1.00 26.59  ? 181  GLY B C   1 
ATOM   4549  O  O   . GLY B  1 150 ? -32.112 120.270 16.012  1.00 29.54  ? 181  GLY B O   1 
ATOM   4550  N  N   . TYR B  1 151 ? -30.339 121.546 16.283  1.00 24.17  ? 182  TYR B N   1 
ATOM   4551  C  CA  . TYR B  1 151 ? -30.893 122.709 15.612  1.00 22.01  ? 182  TYR B CA  1 
ATOM   4552  C  C   . TYR B  1 151 ? -30.128 122.926 14.308  1.00 21.24  ? 182  TYR B C   1 
ATOM   4553  O  O   . TYR B  1 151 ? -29.121 123.609 14.252  1.00 24.41  ? 182  TYR B O   1 
ATOM   4554  C  CB  . TYR B  1 151 ? -30.860 123.895 16.569  1.00 22.02  ? 182  TYR B CB  1 
ATOM   4555  C  CG  . TYR B  1 151 ? -31.628 123.617 17.852  1.00 23.98  ? 182  TYR B CG  1 
ATOM   4556  C  CD1 . TYR B  1 151 ? -33.016 123.644 17.851  1.00 25.15  ? 182  TYR B CD1 1 
ATOM   4557  C  CD2 . TYR B  1 151 ? -30.984 123.325 19.037  1.00 25.15  ? 182  TYR B CD2 1 
ATOM   4558  C  CE1 . TYR B  1 151 ? -33.723 123.382 19.004  1.00 25.64  ? 182  TYR B CE1 1 
ATOM   4559  C  CE2 . TYR B  1 151 ? -31.683 123.065 20.191  1.00 24.83  ? 182  TYR B CE2 1 
ATOM   4560  C  CZ  . TYR B  1 151 ? -33.050 123.099 20.169  1.00 25.51  ? 182  TYR B CZ  1 
ATOM   4561  O  OH  . TYR B  1 151 ? -33.686 122.831 21.354  1.00 29.29  ? 182  TYR B OH  1 
ATOM   4562  N  N   . PRO B  1 152 ? -30.612 122.231 13.280  1.00 18.91  ? 183  PRO B N   1 
ATOM   4563  C  CA  . PRO B  1 152 ? -30.047 122.074 11.964  1.00 18.42  ? 183  PRO B CA  1 
ATOM   4564  C  C   . PRO B  1 152 ? -30.150 123.377 11.203  1.00 18.05  ? 183  PRO B C   1 
ATOM   4565  O  O   . PRO B  1 152 ? -31.051 124.172 11.476  1.00 21.38  ? 183  PRO B O   1 
ATOM   4566  C  CB  . PRO B  1 152 ? -30.828 120.972 11.252  1.00 20.10  ? 183  PRO B CB  1 
ATOM   4567  C  CG  . PRO B  1 152 ? -31.547 120.275 12.337  1.00 21.30  ? 183  PRO B CG  1 
ATOM   4568  C  CD  . PRO B  1 152 ? -31.797 121.325 13.376  1.00 19.58  ? 183  PRO B CD  1 
ATOM   4569  N  N   . PHE B  1 153 ? -29.219 123.598 10.315  1.00 17.72  ? 184  PHE B N   1 
ATOM   4570  C  CA  . PHE B  1 153 ? -29.297 124.760 9.445   1.00 16.69  ? 184  PHE B CA  1 
ATOM   4571  C  C   . PHE B  1 153 ? -29.957 124.270 8.187   1.00 16.20  ? 184  PHE B C   1 
ATOM   4572  O  O   . PHE B  1 153 ? -30.514 123.189 8.204   1.00 16.45  ? 184  PHE B O   1 
ATOM   4573  C  CB  . PHE B  1 153 ? -27.915 125.345 9.207   1.00 19.30  ? 184  PHE B CB  1 
ATOM   4574  C  CG  . PHE B  1 153 ? -27.318 126.138 10.320  1.00 21.01  ? 184  PHE B CG  1 
ATOM   4575  C  CD1 . PHE B  1 153 ? -28.109 126.732 11.287  1.00 21.18  ? 184  PHE B CD1 1 
ATOM   4576  C  CD2 . PHE B  1 153 ? -25.950 126.342 10.410  1.00 22.38  ? 184  PHE B CD2 1 
ATOM   4577  C  CE1 . PHE B  1 153 ? -27.572 127.471 12.322  1.00 21.44  ? 184  PHE B CE1 1 
ATOM   4578  C  CE2 . PHE B  1 153 ? -25.406 127.080 11.445  1.00 23.06  ? 184  PHE B CE2 1 
ATOM   4579  C  CZ  . PHE B  1 153 ? -26.208 127.674 12.413  1.00 21.39  ? 184  PHE B CZ  1 
ATOM   4580  N  N   . ASP B  1 154 ? -29.787 124.943 7.091   1.00 16.91  ? 185  ASP B N   1 
ATOM   4581  C  CA  . ASP B  1 154 ? -30.488 124.537 5.893   1.00 19.00  ? 185  ASP B CA  1 
ATOM   4582  C  C   . ASP B  1 154 ? -29.761 124.795 4.609   1.00 20.13  ? 185  ASP B C   1 
ATOM   4583  O  O   . ASP B  1 154 ? -30.287 124.521 3.518   1.00 19.97  ? 185  ASP B O   1 
ATOM   4584  C  CB  . ASP B  1 154 ? -31.832 125.299 5.870   1.00 21.31  ? 185  ASP B CB  1 
ATOM   4585  C  CG  . ASP B  1 154 ? -31.667 126.765 6.194   1.00 25.19  ? 185  ASP B CG  1 
ATOM   4586  O  OD1 . ASP B  1 154 ? -30.551 127.275 6.082   1.00 26.88  ? 185  ASP B OD1 1 
ATOM   4587  O  OD2 . ASP B  1 154 ? -32.673 127.399 6.564   1.00 29.04  ? 185  ASP B OD2 1 
ATOM   4588  N  N   . GLY B  1 155 ? -28.529 125.267 4.632   1.00 22.21  ? 186  GLY B N   1 
ATOM   4589  C  CA  . GLY B  1 155 ? -27.869 125.511 3.344   1.00 24.16  ? 186  GLY B CA  1 
ATOM   4590  C  C   . GLY B  1 155 ? -27.837 126.991 3.020   1.00 26.77  ? 186  GLY B C   1 
ATOM   4591  O  O   . GLY B  1 155 ? -27.557 127.796 3.893   1.00 27.80  ? 186  GLY B O   1 
ATOM   4592  N  N   . LYS B  1 156 ? -28.015 127.348 1.766   1.00 28.05  ? 187  LYS B N   1 
ATOM   4593  C  CA  . LYS B  1 156 ? -27.885 128.713 1.313   1.00 31.15  ? 187  LYS B CA  1 
ATOM   4594  C  C   . LYS B  1 156 ? -29.119 129.552 1.636   1.00 35.05  ? 187  LYS B C   1 
ATOM   4595  O  O   . LYS B  1 156 ? -30.249 129.134 1.379   1.00 38.97  ? 187  LYS B O   1 
ATOM   4596  C  CB  . LYS B  1 156 ? -27.569 128.776 -0.181  1.00 28.60  ? 187  LYS B CB  1 
ATOM   4597  C  CG  . LYS B  1 156 ? -26.215 129.386 -0.504  1.00 27.60  ? 187  LYS B CG  1 
ATOM   4598  C  CD  . LYS B  1 156 ? -26.319 130.390 -1.640  1.00 27.79  ? 187  LYS B CD  1 
ATOM   4599  C  CE  . LYS B  1 156 ? -25.111 131.312 -1.675  1.00 27.63  ? 187  LYS B CE  1 
ATOM   4600  N  NZ  . LYS B  1 156 ? -23.886 130.641 -1.159  1.00 29.56  ? 187  LYS B NZ  1 
ATOM   4601  N  N   . ASP B  1 157 ? -28.861 130.738 2.183   1.00 36.82  ? 188  ASP B N   1 
ATOM   4602  C  CA  . ASP B  1 157 ? -29.906 131.658 2.628   1.00 37.65  ? 188  ASP B CA  1 
ATOM   4603  C  C   . ASP B  1 157 ? -30.883 130.941 3.552   1.00 37.26  ? 188  ASP B C   1 
ATOM   4604  O  O   . ASP B  1 157 ? -30.633 129.819 3.989   1.00 37.77  ? 188  ASP B O   1 
ATOM   4605  C  CB  . ASP B  1 157 ? -30.615 132.353 1.453   1.00 41.05  ? 188  ASP B CB  1 
ATOM   4606  C  CG  . ASP B  1 157 ? -30.799 131.483 0.227   1.00 45.24  ? 188  ASP B CG  1 
ATOM   4607  O  OD1 . ASP B  1 157 ? -30.356 130.320 0.248   1.00 51.51  ? 188  ASP B OD1 1 
ATOM   4608  O  OD2 . ASP B  1 157 ? -31.391 131.975 -0.761  1.00 50.77  ? 188  ASP B OD2 1 
ATOM   4609  N  N   . GLY B  1 158 ? -32.005 131.577 3.862   1.00 36.32  ? 189  GLY B N   1 
ATOM   4610  C  CA  . GLY B  1 158 ? -32.958 130.990 4.786   1.00 35.70  ? 189  GLY B CA  1 
ATOM   4611  C  C   . GLY B  1 158 ? -32.465 131.201 6.226   1.00 33.33  ? 189  GLY B C   1 
ATOM   4612  O  O   . GLY B  1 158 ? -32.571 132.298 6.769   1.00 34.22  ? 189  GLY B O   1 
ATOM   4613  N  N   . LEU B  1 159 ? -31.911 130.147 6.849   1.00 29.54  ? 190  LEU B N   1 
ATOM   4614  C  CA  . LEU B  1 159 ? -31.364 130.252 8.221   1.00 28.37  ? 190  LEU B CA  1 
ATOM   4615  C  C   . LEU B  1 159 ? -29.908 130.731 8.175   1.00 28.23  ? 190  LEU B C   1 
ATOM   4616  O  O   . LEU B  1 159 ? -29.033 130.038 7.657   1.00 31.34  ? 190  LEU B O   1 
ATOM   4617  C  CB  . LEU B  1 159 ? -31.465 128.907 8.946   1.00 27.41  ? 190  LEU B CB  1 
ATOM   4618  C  CG  . LEU B  1 159 ? -32.874 128.423 9.296   1.00 23.02  ? 190  LEU B CG  1 
ATOM   4619  C  CD1 . LEU B  1 159 ? -32.817 127.289 10.310  1.00 19.83  ? 190  LEU B CD1 1 
ATOM   4620  C  CD2 . LEU B  1 159 ? -33.721 129.570 9.825   1.00 24.04  ? 190  LEU B CD2 1 
ATOM   4621  N  N   . LEU B  1 160 ? -29.639 131.919 8.724   1.00 25.58  ? 191  LEU B N   1 
ATOM   4622  C  CA  . LEU B  1 160 ? -28.290 132.496 8.659   1.00 22.22  ? 191  LEU B CA  1 
ATOM   4623  C  C   . LEU B  1 160 ? -27.398 132.106 9.842   1.00 21.36  ? 191  LEU B C   1 
ATOM   4624  O  O   . LEU B  1 160 ? -26.195 131.909 9.696   1.00 21.47  ? 191  LEU B O   1 
ATOM   4625  C  CB  . LEU B  1 160 ? -28.367 134.019 8.552   1.00 20.55  ? 191  LEU B CB  1 
ATOM   4626  C  CG  . LEU B  1 160 ? -29.102 134.569 7.328   1.00 20.09  ? 191  LEU B CG  1 
ATOM   4627  C  CD1 . LEU B  1 160 ? -28.871 136.065 7.187   1.00 22.01  ? 191  LEU B CD1 1 
ATOM   4628  C  CD2 . LEU B  1 160 ? -28.666 133.839 6.066   1.00 15.84  ? 191  LEU B CD2 1 
ATOM   4629  N  N   . ALA B  1 161 ? -27.958 131.999 11.023  1.00 18.52  ? 192  ALA B N   1 
ATOM   4630  C  CA  . ALA B  1 161 ? -27.180 131.623 12.194  1.00 19.14  ? 192  ALA B CA  1 
ATOM   4631  C  C   . ALA B  1 161 ? -28.113 131.206 13.324  1.00 19.56  ? 192  ALA B C   1 
ATOM   4632  O  O   . ALA B  1 161 ? -29.256 130.810 13.076  1.00 23.40  ? 192  ALA B O   1 
ATOM   4633  C  CB  . ALA B  1 161 ? -26.420 132.827 12.729  1.00 20.11  ? 192  ALA B CB  1 
ATOM   4634  N  N   . HIS B  1 162 ? -27.582 131.313 14.537  1.00 19.45  ? 193  HIS B N   1 
ATOM   4635  C  CA  . HIS B  1 162 ? -28.362 131.168 15.766  1.00 18.42  ? 193  HIS B CA  1 
ATOM   4636  C  C   . HIS B  1 162 ? -27.467 131.177 17.011  1.00 17.81  ? 193  HIS B C   1 
ATOM   4637  O  O   . HIS B  1 162 ? -26.262 130.939 16.933  1.00 18.22  ? 193  HIS B O   1 
ATOM   4638  C  CB  . HIS B  1 162 ? -29.288 129.971 15.747  1.00 20.61  ? 193  HIS B CB  1 
ATOM   4639  C  CG  . HIS B  1 162 ? -28.544 128.655 15.819  1.00 23.14  ? 193  HIS B CG  1 
ATOM   4640  N  ND1 . HIS B  1 162 ? -29.131 127.470 15.480  1.00 22.66  ? 193  HIS B ND1 1 
ATOM   4641  C  CD2 . HIS B  1 162 ? -27.278 128.401 16.181  1.00 26.55  ? 193  HIS B CD2 1 
ATOM   4642  C  CE1 . HIS B  1 162 ? -28.245 126.511 15.621  1.00 23.82  ? 193  HIS B CE1 1 
ATOM   4643  N  NE2 . HIS B  1 162 ? -27.109 127.048 16.044  1.00 25.48  ? 193  HIS B NE2 1 
ATOM   4644  N  N   . ALA B  1 163 ? -28.063 131.477 18.173  1.00 17.44  ? 194  ALA B N   1 
ATOM   4645  C  CA  . ALA B  1 163 ? -27.295 131.536 19.412  1.00 17.98  ? 194  ALA B CA  1 
ATOM   4646  C  C   . ALA B  1 163 ? -28.089 131.139 20.645  1.00 19.11  ? 194  ALA B C   1 
ATOM   4647  O  O   . ALA B  1 163 ? -29.287 131.400 20.745  1.00 22.41  ? 194  ALA B O   1 
ATOM   4648  C  CB  . ALA B  1 163 ? -26.699 132.919 19.621  1.00 17.86  ? 194  ALA B CB  1 
ATOM   4649  N  N   . PHE B  1 164 ? -27.456 130.506 21.632  1.00 18.54  ? 195  PHE B N   1 
ATOM   4650  C  CA  . PHE B  1 164 ? -28.166 130.085 22.818  1.00 19.54  ? 195  PHE B CA  1 
ATOM   4651  C  C   . PHE B  1 164 ? -28.058 131.181 23.877  1.00 20.96  ? 195  PHE B C   1 
ATOM   4652  O  O   . PHE B  1 164 ? -27.052 131.886 23.931  1.00 22.91  ? 195  PHE B O   1 
ATOM   4653  C  CB  . PHE B  1 164 ? -27.561 128.781 23.339  1.00 21.11  ? 195  PHE B CB  1 
ATOM   4654  C  CG  . PHE B  1 164 ? -27.645 127.660 22.361  1.00 22.70  ? 195  PHE B CG  1 
ATOM   4655  C  CD1 . PHE B  1 164 ? -26.763 127.617 21.299  1.00 23.44  ? 195  PHE B CD1 1 
ATOM   4656  C  CD2 . PHE B  1 164 ? -28.578 126.646 22.469  1.00 24.21  ? 195  PHE B CD2 1 
ATOM   4657  C  CE1 . PHE B  1 164 ? -26.805 126.595 20.376  1.00 25.17  ? 195  PHE B CE1 1 
ATOM   4658  C  CE2 . PHE B  1 164 ? -28.642 125.619 21.548  1.00 25.11  ? 195  PHE B CE2 1 
ATOM   4659  C  CZ  . PHE B  1 164 ? -27.741 125.598 20.503  1.00 27.34  ? 195  PHE B CZ  1 
ATOM   4660  N  N   . ALA B  1 165 ? -29.083 131.357 24.703  1.00 22.42  ? 196  ALA B N   1 
ATOM   4661  C  CA  . ALA B  1 165 ? -29.036 132.387 25.748  1.00 23.02  ? 196  ALA B CA  1 
ATOM   4662  C  C   . ALA B  1 165 ? -27.962 132.123 26.771  1.00 24.53  ? 196  ALA B C   1 
ATOM   4663  O  O   . ALA B  1 165 ? -27.411 131.020 26.837  1.00 24.75  ? 196  ALA B O   1 
ATOM   4664  C  CB  . ALA B  1 165 ? -30.383 132.468 26.420  1.00 21.33  ? 196  ALA B CB  1 
ATOM   4665  N  N   . PRO B  1 166 ? -27.681 133.091 27.625  1.00 26.49  ? 197  PRO B N   1 
ATOM   4666  C  CA  . PRO B  1 166 ? -26.661 132.949 28.651  1.00 28.55  ? 197  PRO B CA  1 
ATOM   4667  C  C   . PRO B  1 166 ? -26.919 131.682 29.443  1.00 31.59  ? 197  PRO B C   1 
ATOM   4668  O  O   . PRO B  1 166 ? -28.062 131.238 29.491  1.00 34.18  ? 197  PRO B O   1 
ATOM   4669  C  CB  . PRO B  1 166 ? -26.837 134.195 29.514  1.00 26.22  ? 197  PRO B CB  1 
ATOM   4670  C  CG  . PRO B  1 166 ? -27.256 135.212 28.500  1.00 27.61  ? 197  PRO B CG  1 
ATOM   4671  C  CD  . PRO B  1 166 ? -28.264 134.452 27.644  1.00 27.82  ? 197  PRO B CD  1 
ATOM   4672  N  N   . GLY B  1 167 ? -25.850 131.085 29.959  1.00 33.54  ? 198  GLY B N   1 
ATOM   4673  C  CA  . GLY B  1 167 ? -26.013 129.900 30.785  1.00 34.29  ? 198  GLY B CA  1 
ATOM   4674  C  C   . GLY B  1 167 ? -24.834 128.958 30.702  1.00 34.88  ? 198  GLY B C   1 
ATOM   4675  O  O   . GLY B  1 167 ? -23.956 129.057 29.845  1.00 35.53  ? 198  GLY B O   1 
ATOM   4676  N  N   . THR B  1 168 ? -24.824 127.984 31.610  1.00 35.19  ? 199  THR B N   1 
ATOM   4677  C  CA  . THR B  1 168 ? -23.749 126.992 31.604  1.00 34.61  ? 199  THR B CA  1 
ATOM   4678  C  C   . THR B  1 168 ? -23.976 126.088 30.393  1.00 34.29  ? 199  THR B C   1 
ATOM   4679  O  O   . THR B  1 168 ? -25.052 126.139 29.811  1.00 35.22  ? 199  THR B O   1 
ATOM   4680  C  CB  . THR B  1 168 ? -23.766 126.129 32.868  1.00 35.61  ? 199  THR B CB  1 
ATOM   4681  O  OG1 . THR B  1 168 ? -24.965 125.347 32.914  1.00 37.44  ? 199  THR B OG1 1 
ATOM   4682  C  CG2 . THR B  1 168 ? -23.648 126.970 34.125  1.00 34.17  ? 199  THR B CG2 1 
ATOM   4683  N  N   . GLY B  1 169 ? -22.988 125.274 30.075  1.00 33.39  ? 200  GLY B N   1 
ATOM   4684  C  CA  . GLY B  1 169 ? -23.044 124.338 28.980  1.00 31.30  ? 200  GLY B CA  1 
ATOM   4685  C  C   . GLY B  1 169 ? -22.872 125.078 27.672  1.00 29.50  ? 200  GLY B C   1 
ATOM   4686  O  O   . GLY B  1 169 ? -21.897 125.754 27.393  1.00 30.28  ? 200  GLY B O   1 
ATOM   4687  N  N   . VAL B  1 170 ? -23.791 124.860 26.746  1.00 27.97  ? 201  VAL B N   1 
ATOM   4688  C  CA  . VAL B  1 170 ? -23.742 125.479 25.424  1.00 26.58  ? 201  VAL B CA  1 
ATOM   4689  C  C   . VAL B  1 170 ? -24.270 126.897 25.458  1.00 25.88  ? 201  VAL B C   1 
ATOM   4690  O  O   . VAL B  1 170 ? -24.206 127.666 24.496  1.00 24.49  ? 201  VAL B O   1 
ATOM   4691  C  CB  . VAL B  1 170 ? -24.505 124.578 24.443  1.00 27.06  ? 201  VAL B CB  1 
ATOM   4692  C  CG1 . VAL B  1 170 ? -25.733 125.201 23.839  1.00 26.65  ? 201  VAL B CG1 1 
ATOM   4693  C  CG2 . VAL B  1 170 ? -23.529 124.044 23.406  1.00 25.51  ? 201  VAL B CG2 1 
ATOM   4694  N  N   . GLY B  1 171 ? -24.750 127.341 26.626  1.00 24.04  ? 202  GLY B N   1 
ATOM   4695  C  CA  . GLY B  1 171 ? -25.320 128.663 26.741  1.00 24.67  ? 202  GLY B CA  1 
ATOM   4696  C  C   . GLY B  1 171 ? -24.421 129.752 26.205  1.00 25.93  ? 202  GLY B C   1 
ATOM   4697  O  O   . GLY B  1 171 ? -23.225 129.835 26.494  1.00 28.92  ? 202  GLY B O   1 
ATOM   4698  N  N   . GLY B  1 172 ? -24.987 130.621 25.375  1.00 25.43  ? 203  GLY B N   1 
ATOM   4699  C  CA  . GLY B  1 172 ? -24.218 131.773 24.899  1.00 23.52  ? 203  GLY B CA  1 
ATOM   4700  C  C   . GLY B  1 172 ? -23.504 131.436 23.611  1.00 23.29  ? 203  GLY B C   1 
ATOM   4701  O  O   . GLY B  1 172 ? -22.951 132.318 22.962  1.00 24.06  ? 203  GLY B O   1 
ATOM   4702  N  N   . ASP B  1 173 ? -23.524 130.179 23.225  1.00 22.87  ? 204  ASP B N   1 
ATOM   4703  C  CA  . ASP B  1 173 ? -22.833 129.748 22.020  1.00 24.62  ? 204  ASP B CA  1 
ATOM   4704  C  C   . ASP B  1 173 ? -23.509 130.300 20.770  1.00 23.71  ? 204  ASP B C   1 
ATOM   4705  O  O   . ASP B  1 173 ? -24.721 130.140 20.608  1.00 23.49  ? 204  ASP B O   1 
ATOM   4706  C  CB  . ASP B  1 173 ? -22.759 128.228 21.960  1.00 28.48  ? 204  ASP B CB  1 
ATOM   4707  C  CG  . ASP B  1 173 ? -21.764 127.645 22.948  1.00 31.45  ? 204  ASP B CG  1 
ATOM   4708  O  OD1 . ASP B  1 173 ? -21.184 128.417 23.741  1.00 30.17  ? 204  ASP B OD1 1 
ATOM   4709  O  OD2 . ASP B  1 173 ? -21.590 126.405 22.922  1.00 35.58  ? 204  ASP B OD2 1 
ATOM   4710  N  N   . SER B  1 174 ? -22.704 130.902 19.898  1.00 23.30  ? 205  SER B N   1 
ATOM   4711  C  CA  . SER B  1 174 ? -23.176 131.487 18.651  1.00 23.09  ? 205  SER B CA  1 
ATOM   4712  C  C   . SER B  1 174 ? -22.625 130.765 17.438  1.00 23.49  ? 205  SER B C   1 
ATOM   4713  O  O   . SER B  1 174 ? -21.410 130.791 17.234  1.00 24.61  ? 205  SER B O   1 
ATOM   4714  C  CB  . SER B  1 174 ? -22.708 132.952 18.624  1.00 23.10  ? 205  SER B CB  1 
ATOM   4715  O  OG  . SER B  1 174 ? -22.907 133.443 19.950  1.00 23.73  ? 205  SER B OG  1 
ATOM   4716  N  N   . HIS B  1 175 ? -23.490 130.130 16.669  1.00 22.25  ? 206  HIS B N   1 
ATOM   4717  C  CA  . HIS B  1 175 ? -23.055 129.335 15.522  1.00 22.80  ? 206  HIS B CA  1 
ATOM   4718  C  C   . HIS B  1 175 ? -23.586 129.995 14.249  1.00 21.13  ? 206  HIS B C   1 
ATOM   4719  O  O   . HIS B  1 175 ? -24.710 130.487 14.242  1.00 21.14  ? 206  HIS B O   1 
ATOM   4720  C  CB  . HIS B  1 175 ? -23.574 127.899 15.582  1.00 24.58  ? 206  HIS B CB  1 
ATOM   4721  C  CG  . HIS B  1 175 ? -23.349 127.183 16.864  1.00 27.95  ? 206  HIS B CG  1 
ATOM   4722  N  ND1 . HIS B  1 175 ? -24.334 126.510 17.533  1.00 27.18  ? 206  HIS B ND1 1 
ATOM   4723  C  CD2 . HIS B  1 175 ? -22.235 127.053 17.620  1.00 31.77  ? 206  HIS B CD2 1 
ATOM   4724  C  CE1 . HIS B  1 175 ? -23.854 125.982 18.643  1.00 30.43  ? 206  HIS B CE1 1 
ATOM   4725  N  NE2 . HIS B  1 175 ? -22.569 126.297 18.720  1.00 34.74  ? 206  HIS B NE2 1 
ATOM   4726  N  N   . PHE B  1 176 ? -22.778 129.994 13.219  1.00 20.37  ? 207  PHE B N   1 
ATOM   4727  C  CA  . PHE B  1 176 ? -23.032 130.666 11.972  1.00 20.06  ? 207  PHE B CA  1 
ATOM   4728  C  C   . PHE B  1 176 ? -23.092 129.720 10.796  1.00 21.13  ? 207  PHE B C   1 
ATOM   4729  O  O   . PHE B  1 176 ? -22.220 128.885 10.692  1.00 21.06  ? 207  PHE B O   1 
ATOM   4730  C  CB  . PHE B  1 176 ? -22.062 131.798 11.666  1.00 19.18  ? 207  PHE B CB  1 
ATOM   4731  C  CG  . PHE B  1 176 ? -21.964 132.842 12.738  1.00 19.75  ? 207  PHE B CG  1 
ATOM   4732  C  CD1 . PHE B  1 176 ? -21.433 132.514 13.977  1.00 19.04  ? 207  PHE B CD1 1 
ATOM   4733  C  CD2 . PHE B  1 176 ? -22.396 134.139 12.548  1.00 17.71  ? 207  PHE B CD2 1 
ATOM   4734  C  CE1 . PHE B  1 176 ? -21.356 133.452 14.992  1.00 20.07  ? 207  PHE B CE1 1 
ATOM   4735  C  CE2 . PHE B  1 176 ? -22.312 135.063 13.543  1.00 17.66  ? 207  PHE B CE2 1 
ATOM   4736  C  CZ  . PHE B  1 176 ? -21.789 134.736 14.773  1.00 18.43  ? 207  PHE B CZ  1 
ATOM   4737  N  N   . ASP B  1 177 ? -24.179 129.715 10.034  1.00 23.85  ? 208  ASP B N   1 
ATOM   4738  C  CA  . ASP B  1 177 ? -24.327 128.774 8.932   1.00 24.16  ? 208  ASP B CA  1 
ATOM   4739  C  C   . ASP B  1 177 ? -23.143 128.880 7.985   1.00 24.09  ? 208  ASP B C   1 
ATOM   4740  O  O   . ASP B  1 177 ? -22.908 129.939 7.415   1.00 24.24  ? 208  ASP B O   1 
ATOM   4741  C  CB  . ASP B  1 177 ? -25.632 128.979 8.158   1.00 24.77  ? 208  ASP B CB  1 
ATOM   4742  C  CG  . ASP B  1 177 ? -25.956 127.740 7.329   1.00 26.38  ? 208  ASP B CG  1 
ATOM   4743  O  OD1 . ASP B  1 177 ? -24.978 127.089 6.906   1.00 23.22  ? 208  ASP B OD1 1 
ATOM   4744  O  OD2 . ASP B  1 177 ? -27.135 127.419 7.082   1.00 28.16  ? 208  ASP B OD2 1 
ATOM   4745  N  N   . ASP B  1 178 ? -22.466 127.763 7.816   1.00 23.89  ? 209  ASP B N   1 
ATOM   4746  C  CA  . ASP B  1 178 ? -21.236 127.695 7.049   1.00 23.97  ? 209  ASP B CA  1 
ATOM   4747  C  C   . ASP B  1 178 ? -21.585 127.533 5.587   1.00 23.54  ? 209  ASP B C   1 
ATOM   4748  O  O   . ASP B  1 178 ? -20.731 127.451 4.717   1.00 23.48  ? 209  ASP B O   1 
ATOM   4749  C  CB  . ASP B  1 178 ? -20.364 126.528 7.528   1.00 25.10  ? 209  ASP B CB  1 
ATOM   4750  C  CG  . ASP B  1 178 ? -19.057 126.435 6.791   1.00 27.89  ? 209  ASP B CG  1 
ATOM   4751  O  OD1 . ASP B  1 178 ? -18.266 127.408 6.780   1.00 28.97  ? 209  ASP B OD1 1 
ATOM   4752  O  OD2 . ASP B  1 178 ? -18.786 125.390 6.171   1.00 31.27  ? 209  ASP B OD2 1 
ATOM   4753  N  N   . ASP B  1 179 ? -22.867 127.494 5.236   1.00 23.24  ? 210  ASP B N   1 
ATOM   4754  C  CA  . ASP B  1 179 ? -23.266 127.361 3.844   1.00 23.05  ? 210  ASP B CA  1 
ATOM   4755  C  C   . ASP B  1 179 ? -23.521 128.709 3.175   1.00 23.36  ? 210  ASP B C   1 
ATOM   4756  O  O   . ASP B  1 179 ? -23.931 128.716 2.009   1.00 22.34  ? 210  ASP B O   1 
ATOM   4757  C  CB  . ASP B  1 179 ? -24.509 126.506 3.715   1.00 24.29  ? 210  ASP B CB  1 
ATOM   4758  C  CG  . ASP B  1 179 ? -24.205 125.023 3.669   1.00 28.97  ? 210  ASP B CG  1 
ATOM   4759  O  OD1 . ASP B  1 179 ? -23.355 124.623 2.851   1.00 27.32  ? 210  ASP B OD1 1 
ATOM   4760  O  OD2 . ASP B  1 179 ? -24.825 124.260 4.437   1.00 31.04  ? 210  ASP B OD2 1 
ATOM   4761  N  N   . GLU B  1 180 ? -23.241 129.782 3.898   1.00 22.00  ? 211  GLU B N   1 
ATOM   4762  C  CA  . GLU B  1 180 ? -23.504 131.127 3.445   1.00 20.36  ? 211  GLU B CA  1 
ATOM   4763  C  C   . GLU B  1 180 ? -22.306 131.870 2.879   1.00 21.94  ? 211  GLU B C   1 
ATOM   4764  O  O   . GLU B  1 180 ? -21.185 131.721 3.351   1.00 24.38  ? 211  GLU B O   1 
ATOM   4765  C  CB  . GLU B  1 180 ? -24.076 131.943 4.625   1.00 17.25  ? 211  GLU B CB  1 
ATOM   4766  C  CG  . GLU B  1 180 ? -25.507 132.385 4.412   1.00 16.49  ? 211  GLU B CG  1 
ATOM   4767  C  CD  . GLU B  1 180 ? -26.402 131.227 4.042   1.00 16.39  ? 211  GLU B CD  1 
ATOM   4768  O  OE1 . GLU B  1 180 ? -26.442 130.871 2.846   1.00 15.86  ? 211  GLU B OE1 1 
ATOM   4769  O  OE2 . GLU B  1 180 ? -27.054 130.679 4.953   1.00 15.00  ? 211  GLU B OE2 1 
ATOM   4770  N  N   . LEU B  1 181 ? -22.551 132.685 1.846   1.00 20.22  ? 212  LEU B N   1 
ATOM   4771  C  CA  . LEU B  1 181 ? -21.491 133.536 1.329   1.00 20.22  ? 212  LEU B CA  1 
ATOM   4772  C  C   . LEU B  1 181 ? -21.255 134.624 2.365   1.00 20.85  ? 212  LEU B C   1 
ATOM   4773  O  O   . LEU B  1 181 ? -22.018 135.585 2.450   1.00 21.29  ? 212  LEU B O   1 
ATOM   4774  C  CB  . LEU B  1 181 ? -21.861 134.099 -0.055  1.00 20.87  ? 212  LEU B CB  1 
ATOM   4775  C  CG  . LEU B  1 181 ? -20.959 135.213 -0.618  1.00 19.27  ? 212  LEU B CG  1 
ATOM   4776  C  CD1 . LEU B  1 181 ? -19.521 134.735 -0.759  1.00 18.64  ? 212  LEU B CD1 1 
ATOM   4777  C  CD2 . LEU B  1 181 ? -21.482 135.707 -1.962  1.00 19.02  ? 212  LEU B CD2 1 
ATOM   4778  N  N   . TRP B  1 182 ? -20.216 134.460 3.177   1.00 19.95  ? 213  TRP B N   1 
ATOM   4779  C  CA  . TRP B  1 182 ? -19.946 135.420 4.241   1.00 20.14  ? 213  TRP B CA  1 
ATOM   4780  C  C   . TRP B  1 182 ? -19.102 136.578 3.756   1.00 20.81  ? 213  TRP B C   1 
ATOM   4781  O  O   . TRP B  1 182 ? -17.949 136.402 3.374   1.00 22.43  ? 213  TRP B O   1 
ATOM   4782  C  CB  . TRP B  1 182 ? -19.318 134.722 5.433   1.00 19.77  ? 213  TRP B CB  1 
ATOM   4783  C  CG  . TRP B  1 182 ? -20.295 133.834 6.113   1.00 18.29  ? 213  TRP B CG  1 
ATOM   4784  C  CD1 . TRP B  1 182 ? -20.301 132.472 6.111   1.00 16.75  ? 213  TRP B CD1 1 
ATOM   4785  C  CD2 . TRP B  1 182 ? -21.423 134.252 6.881   1.00 19.63  ? 213  TRP B CD2 1 
ATOM   4786  N  NE1 . TRP B  1 182 ? -21.372 132.011 6.834   1.00 17.54  ? 213  TRP B NE1 1 
ATOM   4787  C  CE2 . TRP B  1 182 ? -22.077 133.084 7.317   1.00 19.07  ? 213  TRP B CE2 1 
ATOM   4788  C  CE3 . TRP B  1 182 ? -21.944 135.497 7.248   1.00 18.38  ? 213  TRP B CE3 1 
ATOM   4789  C  CZ2 . TRP B  1 182 ? -23.229 133.124 8.098   1.00 18.99  ? 213  TRP B CZ2 1 
ATOM   4790  C  CZ3 . TRP B  1 182 ? -23.084 135.534 8.027   1.00 18.67  ? 213  TRP B CZ3 1 
ATOM   4791  C  CH2 . TRP B  1 182 ? -23.714 134.355 8.443   1.00 18.57  ? 213  TRP B CH2 1 
ATOM   4792  N  N   . THR B  1 183 ? -19.706 137.746 3.791   1.00 20.00  ? 214  THR B N   1 
ATOM   4793  C  CA  . THR B  1 183 ? -19.065 138.960 3.335   1.00 19.77  ? 214  THR B CA  1 
ATOM   4794  C  C   . THR B  1 183 ? -19.315 140.082 4.332   1.00 19.80  ? 214  THR B C   1 
ATOM   4795  O  O   . THR B  1 183 ? -19.965 139.882 5.356   1.00 19.27  ? 214  THR B O   1 
ATOM   4796  C  CB  . THR B  1 183 ? -19.701 139.408 2.016   1.00 19.94  ? 214  THR B CB  1 
ATOM   4797  O  OG1 . THR B  1 183 ? -21.068 139.776 2.243   1.00 21.09  ? 214  THR B OG1 1 
ATOM   4798  C  CG2 . THR B  1 183 ? -19.638 138.290 0.987   1.00 18.44  ? 214  THR B CG2 1 
ATOM   4799  N  N   . LEU B  1 184 ? -18.827 141.278 4.037   1.00 19.46  ? 215  LEU B N   1 
ATOM   4800  C  CA  . LEU B  1 184 ? -19.067 142.403 4.931   1.00 20.21  ? 215  LEU B CA  1 
ATOM   4801  C  C   . LEU B  1 184 ? -20.344 143.170 4.559   1.00 20.21  ? 215  LEU B C   1 
ATOM   4802  O  O   . LEU B  1 184 ? -20.485 144.353 4.869   1.00 18.63  ? 215  LEU B O   1 
ATOM   4803  C  CB  . LEU B  1 184 ? -17.854 143.321 4.971   1.00 19.70  ? 215  LEU B CB  1 
ATOM   4804  C  CG  . LEU B  1 184 ? -16.644 142.774 5.730   1.00 18.60  ? 215  LEU B CG  1 
ATOM   4805  C  CD1 . LEU B  1 184 ? -15.536 143.810 5.802   1.00 17.54  ? 215  LEU B CD1 1 
ATOM   4806  C  CD2 . LEU B  1 184 ? -17.049 142.321 7.126   1.00 19.42  ? 215  LEU B CD2 1 
ATOM   4807  N  N   . GLY B  1 185 ? -21.287 142.498 3.894   1.00 20.76  ? 216  GLY B N   1 
ATOM   4808  C  CA  . GLY B  1 185 ? -22.554 143.121 3.528   1.00 23.42  ? 216  GLY B CA  1 
ATOM   4809  C  C   . GLY B  1 185 ? -22.650 143.397 2.031   1.00 26.26  ? 216  GLY B C   1 
ATOM   4810  O  O   . GLY B  1 185 ? -23.718 143.252 1.429   1.00 28.95  ? 216  GLY B O   1 
ATOM   4811  N  N   . GLU B  1 186 ? -21.536 143.796 1.439   1.00 26.45  ? 217  GLU B N   1 
ATOM   4812  C  CA  . GLU B  1 186 ? -21.497 144.097 0.021   1.00 27.02  ? 217  GLU B CA  1 
ATOM   4813  C  C   . GLU B  1 186 ? -20.472 143.233 -0.704  1.00 28.31  ? 217  GLU B C   1 
ATOM   4814  O  O   . GLU B  1 186 ? -19.274 143.330 -0.450  1.00 32.09  ? 217  GLU B O   1 
ATOM   4815  C  CB  . GLU B  1 186 ? -21.199 145.581 -0.203  1.00 26.30  ? 217  GLU B CB  1 
ATOM   4816  C  CG  . GLU B  1 186 ? -21.803 146.497 0.848   1.00 30.86  ? 217  GLU B CG  1 
ATOM   4817  C  CD  . GLU B  1 186 ? -21.381 147.943 0.680   1.00 33.99  ? 217  GLU B CD  1 
ATOM   4818  O  OE1 . GLU B  1 186 ? -21.713 148.541 -0.365  1.00 37.05  ? 217  GLU B OE1 1 
ATOM   4819  O  OE2 . GLU B  1 186 ? -20.720 148.479 1.594   1.00 35.26  ? 217  GLU B OE2 1 
ATOM   4820  N  N   . GLY B  1 187 ? -20.967 142.386 -1.592  1.00 28.62  ? 218  GLY B N   1 
ATOM   4821  C  CA  . GLY B  1 187 ? -20.127 141.541 -2.419  1.00 27.94  ? 218  GLY B CA  1 
ATOM   4822  C  C   . GLY B  1 187 ? -19.163 140.672 -1.651  1.00 26.84  ? 218  GLY B C   1 
ATOM   4823  O  O   . GLY B  1 187 ? -18.920 140.846 -0.450  1.00 24.81  ? 218  GLY B O   1 
ATOM   4824  N  N   . GLN B  1 188 ? -18.634 139.660 -2.361  1.00 26.48  ? 219  GLN B N   1 
ATOM   4825  C  CA  . GLN B  1 188 ? -17.685 138.769 -1.713  1.00 26.53  ? 219  GLN B CA  1 
ATOM   4826  C  C   . GLN B  1 188 ? -16.441 139.585 -1.375  1.00 27.29  ? 219  GLN B C   1 
ATOM   4827  O  O   . GLN B  1 188 ? -16.136 140.532 -2.107  1.00 28.40  ? 219  GLN B O   1 
ATOM   4828  C  CB  . GLN B  1 188 ? -17.315 137.595 -2.604  1.00 25.37  ? 219  GLN B CB  1 
ATOM   4829  C  CG  . GLN B  1 188 ? -16.411 138.033 -3.744  1.00 27.72  ? 219  GLN B CG  1 
ATOM   4830  C  CD  . GLN B  1 188 ? -16.190 136.896 -4.726  1.00 30.41  ? 219  GLN B CD  1 
ATOM   4831  O  OE1 . GLN B  1 188 ? -16.628 137.021 -5.865  1.00 32.37  ? 219  GLN B OE1 1 
ATOM   4832  N  NE2 . GLN B  1 188 ? -15.548 135.839 -4.243  1.00 29.17  ? 219  GLN B NE2 1 
ATOM   4833  N  N   . VAL B  1 189 ? -15.769 139.237 -0.291  1.00 27.07  ? 220  VAL B N   1 
ATOM   4834  C  CA  . VAL B  1 189 ? -14.580 139.962 0.146   1.00 25.20  ? 220  VAL B CA  1 
ATOM   4835  C  C   . VAL B  1 189 ? -13.344 139.076 0.013   1.00 26.12  ? 220  VAL B C   1 
ATOM   4836  O  O   . VAL B  1 189 ? -13.344 137.937 0.468   1.00 28.14  ? 220  VAL B O   1 
ATOM   4837  C  CB  . VAL B  1 189 ? -14.710 140.355 1.637   1.00 22.61  ? 220  VAL B CB  1 
ATOM   4838  C  CG1 . VAL B  1 189 ? -13.518 141.211 2.047   1.00 22.17  ? 220  VAL B CG1 1 
ATOM   4839  C  CG2 . VAL B  1 189 ? -15.997 141.046 1.963   1.00 22.35  ? 220  VAL B CG2 1 
ATOM   4840  N  N   . VAL B  1 190 ? -12.264 139.621 -0.553  1.00 25.22  ? 221  VAL B N   1 
ATOM   4841  C  CA  . VAL B  1 190 ? -11.043 138.840 -0.692  1.00 24.28  ? 221  VAL B CA  1 
ATOM   4842  C  C   . VAL B  1 190 ? -9.836  139.708 -0.318  1.00 24.86  ? 221  VAL B C   1 
ATOM   4843  O  O   . VAL B  1 190 ? -9.702  140.791 -0.879  1.00 24.77  ? 221  VAL B O   1 
ATOM   4844  C  CB  . VAL B  1 190 ? -10.771 138.302 -2.099  1.00 23.36  ? 221  VAL B CB  1 
ATOM   4845  C  CG1 . VAL B  1 190 ? -9.427  137.566 -2.059  1.00 23.35  ? 221  VAL B CG1 1 
ATOM   4846  C  CG2 . VAL B  1 190 ? -11.859 137.404 -2.631  1.00 26.13  ? 221  VAL B CG2 1 
ATOM   4847  N  N   . ARG B  1 191 ? -9.026  139.199 0.586   1.00 24.58  ? 222  ARG B N   1 
ATOM   4848  C  CA  . ARG B  1 191 ? -7.827  139.944 1.012   1.00 23.63  ? 222  ARG B CA  1 
ATOM   4849  C  C   . ARG B  1 191 ? -6.653  139.275 0.299   1.00 24.92  ? 222  ARG B C   1 
ATOM   4850  O  O   . ARG B  1 191 ? -6.471  138.077 0.482   1.00 24.71  ? 222  ARG B O   1 
ATOM   4851  C  CB  . ARG B  1 191 ? -7.770  139.972 2.528   1.00 20.64  ? 222  ARG B CB  1 
ATOM   4852  C  CG  . ARG B  1 191 ? -6.735  140.880 3.120   1.00 16.24  ? 222  ARG B CG  1 
ATOM   4853  C  CD  . ARG B  1 191 ? -6.603  140.760 4.619   1.00 15.00  ? 222  ARG B CD  1 
ATOM   4854  N  NE  . ARG B  1 191 ? -5.630  141.719 5.123   1.00 17.71  ? 222  ARG B NE  1 
ATOM   4855  C  CZ  . ARG B  1 191 ? -5.177  141.784 6.355   1.00 19.23  ? 222  ARG B CZ  1 
ATOM   4856  N  NH1 . ARG B  1 191 ? -5.565  140.954 7.295   1.00 18.12  ? 222  ARG B NH1 1 
ATOM   4857  N  NH2 . ARG B  1 191 ? -4.281  142.700 6.706   1.00 21.26  ? 222  ARG B NH2 1 
ATOM   4858  N  N   . VAL B  1 192 ? -5.981  140.012 -0.566  1.00 25.13  ? 223  VAL B N   1 
ATOM   4859  C  CA  . VAL B  1 192 ? -4.939  139.516 -1.426  1.00 26.71  ? 223  VAL B CA  1 
ATOM   4860  C  C   . VAL B  1 192 ? -3.586  139.262 -0.793  1.00 28.11  ? 223  VAL B C   1 
ATOM   4861  O  O   . VAL B  1 192 ? -3.332  139.596 0.342   1.00 28.69  ? 223  VAL B O   1 
ATOM   4862  C  CB  . VAL B  1 192 ? -4.687  140.460 -2.626  1.00 26.72  ? 223  VAL B CB  1 
ATOM   4863  C  CG1 . VAL B  1 192 ? -5.979  140.760 -3.346  1.00 26.64  ? 223  VAL B CG1 1 
ATOM   4864  C  CG2 . VAL B  1 192 ? -3.989  141.722 -2.142  1.00 27.20  ? 223  VAL B CG2 1 
ATOM   4865  N  N   . LYS B  1 193 ? -2.650  138.739 -1.585  1.00 28.38  ? 224  LYS B N   1 
ATOM   4866  C  CA  . LYS B  1 193 ? -1.333  138.368 -1.121  1.00 28.13  ? 224  LYS B CA  1 
ATOM   4867  C  C   . LYS B  1 193 ? -0.231  138.641 -2.142  1.00 31.43  ? 224  LYS B C   1 
ATOM   4868  O  O   . LYS B  1 193 ? -0.335  138.187 -3.283  1.00 32.79  ? 224  LYS B O   1 
ATOM   4869  C  CB  . LYS B  1 193 ? -1.295  136.870 -0.791  1.00 22.56  ? 224  LYS B CB  1 
ATOM   4870  C  CG  . LYS B  1 193 ? -1.990  136.397 0.460   1.00 17.94  ? 224  LYS B CG  1 
ATOM   4871  C  CD  . LYS B  1 193 ? -1.466  137.203 1.642   1.00 18.93  ? 224  LYS B CD  1 
ATOM   4872  C  CE  . LYS B  1 193 ? -1.119  136.181 2.729   1.00 20.30  ? 224  LYS B CE  1 
ATOM   4873  N  NZ  . LYS B  1 193 ? -0.138  136.761 3.690   1.00 27.03  ? 224  LYS B NZ  1 
ATOM   4874  N  N   . TYR B  1 194 ? 0.814   139.324 -1.724  1.00 31.27  ? 225  TYR B N   1 
ATOM   4875  C  CA  . TYR B  1 194 ? 2.048   139.434 -2.444  1.00 33.43  ? 225  TYR B CA  1 
ATOM   4876  C  C   . TYR B  1 194 ? 2.075   140.162 -3.771  1.00 35.33  ? 225  TYR B C   1 
ATOM   4877  O  O   . TYR B  1 194 ? 2.881   139.855 -4.646  1.00 39.03  ? 225  TYR B O   1 
ATOM   4878  C  CB  . TYR B  1 194 ? 2.629   138.027 -2.704  1.00 31.33  ? 225  TYR B CB  1 
ATOM   4879  C  CG  . TYR B  1 194 ? 2.903   137.255 -1.436  1.00 33.02  ? 225  TYR B CG  1 
ATOM   4880  C  CD1 . TYR B  1 194 ? 3.366   137.902 -0.300  1.00 36.97  ? 225  TYR B CD1 1 
ATOM   4881  C  CD2 . TYR B  1 194 ? 2.695   135.884 -1.375  1.00 31.76  ? 225  TYR B CD2 1 
ATOM   4882  C  CE1 . TYR B  1 194 ? 3.616   137.205 0.865   1.00 39.65  ? 225  TYR B CE1 1 
ATOM   4883  C  CE2 . TYR B  1 194 ? 2.942   135.178 -0.215  1.00 33.21  ? 225  TYR B CE2 1 
ATOM   4884  C  CZ  . TYR B  1 194 ? 3.402   135.844 0.901   1.00 38.48  ? 225  TYR B CZ  1 
ATOM   4885  O  OH  . TYR B  1 194 ? 3.649   135.140 2.056   1.00 40.83  ? 225  TYR B OH  1 
ATOM   4886  N  N   . GLY B  1 195 ? 1.243   141.132 -4.000  1.00 34.41  ? 226  GLY B N   1 
ATOM   4887  C  CA  . GLY B  1 195 ? 1.404   141.888 -5.217  1.00 35.70  ? 226  GLY B CA  1 
ATOM   4888  C  C   . GLY B  1 195 ? 2.204   143.114 -4.853  1.00 35.20  ? 226  GLY B C   1 
ATOM   4889  O  O   . GLY B  1 195 ? 3.286   143.009 -4.278  1.00 36.60  ? 226  GLY B O   1 
ATOM   4890  N  N   . ASN B  1 196 ? 1.658   144.245 -5.177  1.00 33.61  ? 227  ASN B N   1 
ATOM   4891  C  CA  . ASN B  1 196 ? 2.192   145.511 -4.741  1.00 31.98  ? 227  ASN B CA  1 
ATOM   4892  C  C   . ASN B  1 196 ? 1.145   146.070 -3.777  1.00 32.45  ? 227  ASN B C   1 
ATOM   4893  O  O   . ASN B  1 196 ? 1.025   147.258 -3.521  1.00 33.21  ? 227  ASN B O   1 
ATOM   4894  C  CB  . ASN B  1 196 ? 2.357   146.430 -5.940  1.00 32.05  ? 227  ASN B CB  1 
ATOM   4895  C  CG  . ASN B  1 196 ? 1.013   146.720 -6.579  1.00 33.57  ? 227  ASN B CG  1 
ATOM   4896  O  OD1 . ASN B  1 196 ? -0.017  146.205 -6.134  1.00 39.24  ? 227  ASN B OD1 1 
ATOM   4897  N  ND2 . ASN B  1 196 ? 1.016   147.540 -7.619  1.00 34.66  ? 227  ASN B ND2 1 
ATOM   4898  N  N   . ALA B  1 197 ? 0.220   145.167 -3.428  1.00 31.06  ? 228  ALA B N   1 
ATOM   4899  C  CA  . ALA B  1 197 ? -0.926  145.560 -2.620  1.00 28.05  ? 228  ALA B CA  1 
ATOM   4900  C  C   . ALA B  1 197 ? -1.247  144.594 -1.495  1.00 26.26  ? 228  ALA B C   1 
ATOM   4901  O  O   . ALA B  1 197 ? -2.360  144.490 -1.007  1.00 23.98  ? 228  ALA B O   1 
ATOM   4902  C  CB  . ALA B  1 197 ? -2.123  145.805 -3.514  1.00 27.65  ? 228  ALA B CB  1 
ATOM   4903  N  N   . ASP B  1 198 ? -0.288  143.688 -1.244  1.00 26.71  ? 229  ASP B N   1 
ATOM   4904  C  CA  . ASP B  1 198 ? -0.484  142.681 -0.209  1.00 27.48  ? 229  ASP B CA  1 
ATOM   4905  C  C   . ASP B  1 198 ? -1.141  143.286 1.017   1.00 27.76  ? 229  ASP B C   1 
ATOM   4906  O  O   . ASP B  1 198 ? -0.847  144.405 1.425   1.00 27.62  ? 229  ASP B O   1 
ATOM   4907  C  CB  . ASP B  1 198 ? 0.819   141.977 0.127   1.00 26.16  ? 229  ASP B CB  1 
ATOM   4908  C  CG  . ASP B  1 198 ? 0.764   141.139 1.387   1.00 27.29  ? 229  ASP B CG  1 
ATOM   4909  O  OD1 . ASP B  1 198 ? 0.799   141.715 2.493   1.00 26.30  ? 229  ASP B OD1 1 
ATOM   4910  O  OD2 . ASP B  1 198 ? 0.683   139.884 1.271   1.00 25.13  ? 229  ASP B OD2 1 
ATOM   4911  N  N   . GLY B  1 199 ? -2.091  142.549 1.597   1.00 28.61  ? 230  GLY B N   1 
ATOM   4912  C  CA  . GLY B  1 199 ? -2.870  142.947 2.735   1.00 28.19  ? 230  GLY B CA  1 
ATOM   4913  C  C   . GLY B  1 199 ? -4.181  143.632 2.397   1.00 28.23  ? 230  GLY B C   1 
ATOM   4914  O  O   . GLY B  1 199 ? -5.115  143.578 3.187   1.00 27.19  ? 230  GLY B O   1 
ATOM   4915  N  N   . GLU B  1 200 ? -4.228  144.263 1.233   1.00 28.21  ? 231  GLU B N   1 
ATOM   4916  C  CA  . GLU B  1 200 ? -5.405  144.988 0.789   1.00 28.14  ? 231  GLU B CA  1 
ATOM   4917  C  C   . GLU B  1 200 ? -6.514  144.034 0.399   1.00 27.90  ? 231  GLU B C   1 
ATOM   4918  O  O   . GLU B  1 200 ? -6.264  142.863 0.118   1.00 29.67  ? 231  GLU B O   1 
ATOM   4919  C  CB  . GLU B  1 200 ? -5.050  145.883 -0.406  1.00 30.83  ? 231  GLU B CB  1 
ATOM   4920  C  CG  . GLU B  1 200 ? -4.054  146.979 -0.069  1.00 34.92  ? 231  GLU B CG  1 
ATOM   4921  C  CD  . GLU B  1 200 ? -4.566  147.844 1.071   1.00 38.25  ? 231  GLU B CD  1 
ATOM   4922  O  OE1 . GLU B  1 200 ? -5.580  148.533 0.844   1.00 39.14  ? 231  GLU B OE1 1 
ATOM   4923  O  OE2 . GLU B  1 200 ? -3.969  147.823 2.165   1.00 39.02  ? 231  GLU B OE2 1 
ATOM   4924  N  N   . TYR B  1 201 ? -7.713  144.570 0.246   1.00 26.53  ? 232  TYR B N   1 
ATOM   4925  C  CA  . TYR B  1 201 ? -8.854  143.790 -0.222  1.00 24.29  ? 232  TYR B CA  1 
ATOM   4926  C  C   . TYR B  1 201 ? -9.007  143.987 -1.734  1.00 25.28  ? 232  TYR B C   1 
ATOM   4927  O  O   . TYR B  1 201 ? -8.573  144.997 -2.252  1.00 26.82  ? 232  TYR B O   1 
ATOM   4928  C  CB  . TYR B  1 201 ? -10.136 144.259 0.417   1.00 20.92  ? 232  TYR B CB  1 
ATOM   4929  C  CG  . TYR B  1 201 ? -10.377 143.850 1.834   1.00 19.88  ? 232  TYR B CG  1 
ATOM   4930  C  CD1 . TYR B  1 201 ? -10.277 142.516 2.206   1.00 21.51  ? 232  TYR B CD1 1 
ATOM   4931  C  CD2 . TYR B  1 201 ? -10.716 144.778 2.788   1.00 19.45  ? 232  TYR B CD2 1 
ATOM   4932  C  CE1 . TYR B  1 201 ? -10.507 142.133 3.517   1.00 24.35  ? 232  TYR B CE1 1 
ATOM   4933  C  CE2 . TYR B  1 201 ? -10.957 144.398 4.092   1.00 22.11  ? 232  TYR B CE2 1 
ATOM   4934  C  CZ  . TYR B  1 201 ? -10.840 143.084 4.457   1.00 24.21  ? 232  TYR B CZ  1 
ATOM   4935  O  OH  . TYR B  1 201 ? -11.062 142.727 5.758   1.00 28.38  ? 232  TYR B OH  1 
ATOM   4936  N  N   . CYS B  1 202 ? -9.549  142.994 -2.416  1.00 26.99  ? 233  CYS B N   1 
ATOM   4937  C  CA  . CYS B  1 202 ? -9.768  143.195 -3.857  1.00 27.39  ? 233  CYS B CA  1 
ATOM   4938  C  C   . CYS B  1 202 ? -10.802 144.306 -4.016  1.00 28.76  ? 233  CYS B C   1 
ATOM   4939  O  O   . CYS B  1 202 ? -11.450 144.693 -3.053  1.00 30.01  ? 233  CYS B O   1 
ATOM   4940  C  CB  . CYS B  1 202 ? -10.318 141.941 -4.527  1.00 25.56  ? 233  CYS B CB  1 
ATOM   4941  S  SG  . CYS B  1 202 ? -9.177  140.572 -4.505  1.00 23.57  ? 233  CYS B SG  1 
ATOM   4942  N  N   . LYS B  1 203 ? -10.959 144.786 -5.242  1.00 29.94  ? 234  LYS B N   1 
ATOM   4943  C  CA  . LYS B  1 203 ? -11.982 145.802 -5.486  1.00 31.95  ? 234  LYS B CA  1 
ATOM   4944  C  C   . LYS B  1 203 ? -12.937 145.264 -6.549  1.00 32.86  ? 234  LYS B C   1 
ATOM   4945  O  O   . LYS B  1 203 ? -12.568 145.247 -7.724  1.00 35.48  ? 234  LYS B O   1 
ATOM   4946  C  CB  . LYS B  1 203 ? -11.376 147.112 -5.977  1.00 33.02  ? 234  LYS B CB  1 
ATOM   4947  C  CG  . LYS B  1 203 ? -12.426 148.203 -6.179  1.00 35.94  ? 234  LYS B CG  1 
ATOM   4948  C  CD  . LYS B  1 203 ? -12.975 148.680 -4.844  1.00 39.68  ? 234  LYS B CD  1 
ATOM   4949  C  CE  . LYS B  1 203 ? -14.294 149.398 -4.998  1.00 42.33  ? 234  LYS B CE  1 
ATOM   4950  N  NZ  . LYS B  1 203 ? -15.478 148.485 -4.908  1.00 44.23  ? 234  LYS B NZ  1 
ATOM   4951  N  N   . PHE B  1 204 ? -14.089 144.757 -6.111  1.00 31.32  ? 235  PHE B N   1 
ATOM   4952  C  CA  . PHE B  1 204 ? -14.994 144.216 -7.133  1.00 31.03  ? 235  PHE B CA  1 
ATOM   4953  C  C   . PHE B  1 204 ? -16.118 145.223 -7.365  1.00 32.61  ? 235  PHE B C   1 
ATOM   4954  O  O   . PHE B  1 204 ? -16.729 145.673 -6.400  1.00 33.28  ? 235  PHE B O   1 
ATOM   4955  C  CB  . PHE B  1 204 ? -15.557 142.880 -6.673  1.00 28.78  ? 235  PHE B CB  1 
ATOM   4956  C  CG  . PHE B  1 204 ? -14.554 141.797 -6.468  1.00 23.56  ? 235  PHE B CG  1 
ATOM   4957  C  CD1 . PHE B  1 204 ? -13.572 141.559 -7.401  1.00 20.91  ? 235  PHE B CD1 1 
ATOM   4958  C  CD2 . PHE B  1 204 ? -14.598 141.001 -5.333  1.00 21.97  ? 235  PHE B CD2 1 
ATOM   4959  C  CE1 . PHE B  1 204 ? -12.621 140.585 -7.207  1.00 19.49  ? 235  PHE B CE1 1 
ATOM   4960  C  CE2 . PHE B  1 204 ? -13.664 140.008 -5.159  1.00 19.78  ? 235  PHE B CE2 1 
ATOM   4961  C  CZ  . PHE B  1 204 ? -12.672 139.778 -6.079  1.00 19.29  ? 235  PHE B CZ  1 
ATOM   4962  N  N   . PRO B  1 205 ? -16.385 145.541 -8.617  1.00 32.78  ? 236  PRO B N   1 
ATOM   4963  C  CA  . PRO B  1 205 ? -15.647 144.993 -9.749  1.00 31.88  ? 236  PRO B CA  1 
ATOM   4964  C  C   . PRO B  1 205 ? -14.401 145.829 -10.036 1.00 30.76  ? 236  PRO B C   1 
ATOM   4965  O  O   . PRO B  1 205 ? -14.294 146.960 -9.577  1.00 30.34  ? 236  PRO B O   1 
ATOM   4966  C  CB  . PRO B  1 205 ? -16.639 145.205 -10.911 1.00 31.21  ? 236  PRO B CB  1 
ATOM   4967  C  CG  . PRO B  1 205 ? -17.237 146.525 -10.570 1.00 30.28  ? 236  PRO B CG  1 
ATOM   4968  C  CD  . PRO B  1 205 ? -17.436 146.478 -9.071  1.00 31.58  ? 236  PRO B CD  1 
ATOM   4969  N  N   . PHE B  1 206 ? -13.478 145.215 -10.761 1.00 30.73  ? 237  PHE B N   1 
ATOM   4970  C  CA  . PHE B  1 206 ? -12.249 145.908 -11.149 1.00 31.06  ? 237  PHE B CA  1 
ATOM   4971  C  C   . PHE B  1 206 ? -12.097 145.851 -12.662 1.00 32.49  ? 237  PHE B C   1 
ATOM   4972  O  O   . PHE B  1 206 ? -12.576 144.903 -13.294 1.00 33.25  ? 237  PHE B O   1 
ATOM   4973  C  CB  . PHE B  1 206 ? -11.056 145.341 -10.405 1.00 28.49  ? 237  PHE B CB  1 
ATOM   4974  C  CG  . PHE B  1 206 ? -10.548 144.021 -10.901 1.00 25.64  ? 237  PHE B CG  1 
ATOM   4975  C  CD1 . PHE B  1 206 ? -9.579  143.966 -11.891 1.00 24.35  ? 237  PHE B CD1 1 
ATOM   4976  C  CD2 . PHE B  1 206 ? -11.045 142.833 -10.392 1.00 23.78  ? 237  PHE B CD2 1 
ATOM   4977  C  CE1 . PHE B  1 206 ? -9.110  142.759 -12.374 1.00 23.05  ? 237  PHE B CE1 1 
ATOM   4978  C  CE2 . PHE B  1 206 ? -10.564 141.620 -10.833 1.00 22.91  ? 237  PHE B CE2 1 
ATOM   4979  C  CZ  . PHE B  1 206 ? -9.608  141.587 -11.835 1.00 23.66  ? 237  PHE B CZ  1 
ATOM   4980  N  N   . LEU B  1 207 ? -11.512 146.885 -13.256 1.00 32.88  ? 238  LEU B N   1 
ATOM   4981  C  CA  . LEU B  1 207 ? -11.370 146.942 -14.695 1.00 33.04  ? 238  LEU B CA  1 
ATOM   4982  C  C   . LEU B  1 207 ? -10.010 146.490 -15.181 1.00 33.43  ? 238  LEU B C   1 
ATOM   4983  O  O   . LEU B  1 207 ? -9.003  147.147 -14.931 1.00 34.46  ? 238  LEU B O   1 
ATOM   4984  C  CB  . LEU B  1 207 ? -11.631 148.350 -15.228 1.00 31.90  ? 238  LEU B CB  1 
ATOM   4985  C  CG  . LEU B  1 207 ? -11.538 148.493 -16.748 1.00 33.02  ? 238  LEU B CG  1 
ATOM   4986  C  CD1 . LEU B  1 207 ? -12.713 147.826 -17.441 1.00 31.66  ? 238  LEU B CD1 1 
ATOM   4987  C  CD2 . LEU B  1 207 ? -11.418 149.956 -17.133 1.00 33.88  ? 238  LEU B CD2 1 
ATOM   4988  N  N   . PHE B  1 208 ? -9.984  145.410 -15.938 1.00 34.40  ? 239  PHE B N   1 
ATOM   4989  C  CA  . PHE B  1 208 ? -8.728  144.924 -16.485 1.00 36.52  ? 239  PHE B CA  1 
ATOM   4990  C  C   . PHE B  1 208 ? -8.890  144.659 -17.975 1.00 37.75  ? 239  PHE B C   1 
ATOM   4991  O  O   . PHE B  1 208 ? -9.781  143.915 -18.380 1.00 38.32  ? 239  PHE B O   1 
ATOM   4992  C  CB  . PHE B  1 208 ? -8.299  143.622 -15.779 1.00 37.31  ? 239  PHE B CB  1 
ATOM   4993  C  CG  . PHE B  1 208 ? -7.095  143.012 -16.452 1.00 35.29  ? 239  PHE B CG  1 
ATOM   4994  C  CD1 . PHE B  1 208 ? -5.860  143.623 -16.366 1.00 34.41  ? 239  PHE B CD1 1 
ATOM   4995  C  CD2 . PHE B  1 208 ? -7.218  141.851 -17.183 1.00 34.15  ? 239  PHE B CD2 1 
ATOM   4996  C  CE1 . PHE B  1 208 ? -4.761  143.077 -17.002 1.00 33.34  ? 239  PHE B CE1 1 
ATOM   4997  C  CE2 . PHE B  1 208 ? -6.121  141.302 -17.820 1.00 34.15  ? 239  PHE B CE2 1 
ATOM   4998  C  CZ  . PHE B  1 208 ? -4.896  141.920 -17.735 1.00 33.02  ? 239  PHE B CZ  1 
ATOM   4999  N  N   . ASN B  1 209 ? -8.067  145.301 -18.782 1.00 39.73  ? 240  ASN B N   1 
ATOM   5000  C  CA  . ASN B  1 209 ? -8.051  145.079 -20.212 1.00 43.49  ? 240  ASN B CA  1 
ATOM   5001  C  C   . ASN B  1 209 ? -9.399  145.215 -20.891 1.00 45.10  ? 240  ASN B C   1 
ATOM   5002  O  O   . ASN B  1 209 ? -9.709  144.448 -21.813 1.00 45.62  ? 240  ASN B O   1 
ATOM   5003  C  CB  . ASN B  1 209 ? -7.471  143.689 -20.523 1.00 45.76  ? 240  ASN B CB  1 
ATOM   5004  C  CG  . ASN B  1 209 ? -6.653  143.695 -21.799 1.00 48.75  ? 240  ASN B CG  1 
ATOM   5005  O  OD1 . ASN B  1 209 ? -7.135  143.314 -22.864 1.00 49.03  ? 240  ASN B OD1 1 
ATOM   5006  N  ND2 . ASN B  1 209 ? -5.403  144.134 -21.681 1.00 50.91  ? 240  ASN B ND2 1 
ATOM   5007  N  N   . GLY B  1 210 ? -10.207 146.187 -20.484 1.00 46.02  ? 241  GLY B N   1 
ATOM   5008  C  CA  . GLY B  1 210 ? -11.483 146.460 -21.114 1.00 44.72  ? 241  GLY B CA  1 
ATOM   5009  C  C   . GLY B  1 210 ? -12.643 145.615 -20.638 1.00 43.57  ? 241  GLY B C   1 
ATOM   5010  O  O   . GLY B  1 210 ? -13.773 145.747 -21.130 1.00 42.94  ? 241  GLY B O   1 
ATOM   5011  N  N   . LYS B  1 211 ? -12.382 144.724 -19.688 1.00 42.53  ? 242  LYS B N   1 
ATOM   5012  C  CA  . LYS B  1 211 ? -13.437 143.878 -19.140 1.00 41.92  ? 242  LYS B CA  1 
ATOM   5013  C  C   . LYS B  1 211 ? -13.490 144.049 -17.626 1.00 40.42  ? 242  LYS B C   1 
ATOM   5014  O  O   . LYS B  1 211 ? -12.463 144.277 -16.994 1.00 40.71  ? 242  LYS B O   1 
ATOM   5015  C  CB  . LYS B  1 211 ? -13.192 142.412 -19.497 1.00 43.53  ? 242  LYS B CB  1 
ATOM   5016  C  CG  . LYS B  1 211 ? -14.285 141.471 -19.031 1.00 44.95  ? 242  LYS B CG  1 
ATOM   5017  C  CD  . LYS B  1 211 ? -13.926 140.004 -19.161 1.00 46.73  ? 242  LYS B CD  1 
ATOM   5018  C  CE  . LYS B  1 211 ? -15.132 139.101 -18.937 1.00 49.05  ? 242  LYS B CE  1 
ATOM   5019  N  NZ  . LYS B  1 211 ? -15.383 138.778 -17.508 1.00 50.20  ? 242  LYS B NZ  1 
ATOM   5020  N  N   . GLU B  1 212 ? -14.688 143.990 -17.060 1.00 37.63  ? 243  GLU B N   1 
ATOM   5021  C  CA  . GLU B  1 212 ? -14.821 144.090 -15.612 1.00 35.73  ? 243  GLU B CA  1 
ATOM   5022  C  C   . GLU B  1 212 ? -14.743 142.675 -15.023 1.00 34.18  ? 243  GLU B C   1 
ATOM   5023  O  O   . GLU B  1 212 ? -14.953 141.676 -15.713 1.00 30.61  ? 243  GLU B O   1 
ATOM   5024  C  CB  . GLU B  1 212 ? -16.140 144.701 -15.179 1.00 37.85  ? 243  GLU B CB  1 
ATOM   5025  C  CG  . GLU B  1 212 ? -16.437 146.105 -15.644 1.00 40.18  ? 243  GLU B CG  1 
ATOM   5026  C  CD  . GLU B  1 212 ? -17.320 146.867 -14.673 1.00 41.00  ? 243  GLU B CD  1 
ATOM   5027  O  OE1 . GLU B  1 212 ? -18.355 146.314 -14.246 1.00 41.03  ? 243  GLU B OE1 1 
ATOM   5028  O  OE2 . GLU B  1 212 ? -16.962 148.017 -14.342 1.00 41.92  ? 243  GLU B OE2 1 
ATOM   5029  N  N   . TYR B  1 213 ? -14.339 142.629 -13.762 1.00 32.26  ? 244  TYR B N   1 
ATOM   5030  C  CA  . TYR B  1 213 ? -14.208 141.355 -13.071 1.00 30.88  ? 244  TYR B CA  1 
ATOM   5031  C  C   . TYR B  1 213 ? -14.794 141.526 -11.679 1.00 32.34  ? 244  TYR B C   1 
ATOM   5032  O  O   . TYR B  1 213 ? -14.514 142.520 -11.007 1.00 33.50  ? 244  TYR B O   1 
ATOM   5033  C  CB  . TYR B  1 213 ? -12.720 140.971 -13.001 1.00 29.87  ? 244  TYR B CB  1 
ATOM   5034  C  CG  . TYR B  1 213 ? -12.175 140.654 -14.376 1.00 28.80  ? 244  TYR B CG  1 
ATOM   5035  C  CD1 . TYR B  1 213 ? -12.259 139.365 -14.846 1.00 28.11  ? 244  TYR B CD1 1 
ATOM   5036  C  CD2 . TYR B  1 213 ? -11.609 141.615 -15.196 1.00 30.18  ? 244  TYR B CD2 1 
ATOM   5037  C  CE1 . TYR B  1 213 ? -11.790 139.027 -16.101 1.00 27.49  ? 244  TYR B CE1 1 
ATOM   5038  C  CE2 . TYR B  1 213 ? -11.156 141.283 -16.462 1.00 29.51  ? 244  TYR B CE2 1 
ATOM   5039  C  CZ  . TYR B  1 213 ? -11.240 139.993 -16.916 1.00 28.39  ? 244  TYR B CZ  1 
ATOM   5040  O  OH  . TYR B  1 213 ? -10.794 139.617 -18.157 1.00 27.53  ? 244  TYR B OH  1 
ATOM   5041  N  N   . ASN B  1 214 ? -15.734 140.669 -11.309 1.00 32.84  ? 245  ASN B N   1 
ATOM   5042  C  CA  . ASN B  1 214 ? -16.378 140.772 -10.002 1.00 33.24  ? 245  ASN B CA  1 
ATOM   5043  C  C   . ASN B  1 214 ? -15.879 139.647 -9.103  1.00 34.46  ? 245  ASN B C   1 
ATOM   5044  O  O   . ASN B  1 214 ? -16.568 139.200 -8.197  1.00 35.22  ? 245  ASN B O   1 
ATOM   5045  C  CB  . ASN B  1 214 ? -17.893 140.655 -10.137 1.00 34.07  ? 245  ASN B CB  1 
ATOM   5046  C  CG  . ASN B  1 214 ? -18.465 141.718 -11.049 1.00 35.16  ? 245  ASN B CG  1 
ATOM   5047  O  OD1 . ASN B  1 214 ? -18.515 142.903 -10.708 1.00 34.84  ? 245  ASN B OD1 1 
ATOM   5048  N  ND2 . ASN B  1 214 ? -18.905 141.287 -12.225 1.00 33.86  ? 245  ASN B ND2 1 
ATOM   5049  N  N   . SER B  1 215 ? -14.667 139.221 -9.379  1.00 35.06  ? 246  SER B N   1 
ATOM   5050  C  CA  . SER B  1 215 ? -14.049 138.132 -8.615  1.00 33.44  ? 246  SER B CA  1 
ATOM   5051  C  C   . SER B  1 215 ? -12.556 138.150 -9.043  1.00 33.53  ? 246  SER B C   1 
ATOM   5052  O  O   . SER B  1 215 ? -12.209 138.992 -9.848  1.00 33.11  ? 246  SER B O   1 
ATOM   5053  C  CB  . SER B  1 215 ? -14.561 136.824 -9.278  1.00 33.74  ? 246  SER B CB  1 
ATOM   5054  O  OG  . SER B  1 215 ? -14.114 136.844 -10.637 1.00 36.95  ? 246  SER B OG  1 
ATOM   5055  N  N   . CYS B  1 216 ? -11.792 137.270 -8.433  1.00 33.10  ? 247  CYS B N   1 
ATOM   5056  C  CA  . CYS B  1 216 ? -10.442 137.118 -8.993  1.00 30.99  ? 247  CYS B CA  1 
ATOM   5057  C  C   . CYS B  1 216 ? -10.450 136.364 -10.303 1.00 30.31  ? 247  CYS B C   1 
ATOM   5058  O  O   . CYS B  1 216 ? -11.384 135.644 -10.647 1.00 30.47  ? 247  CYS B O   1 
ATOM   5059  C  CB  . CYS B  1 216 ? -9.502  136.461 -7.990  1.00 30.67  ? 247  CYS B CB  1 
ATOM   5060  S  SG  . CYS B  1 216 ? -9.826  137.086 -6.315  1.00 31.46  ? 247  CYS B SG  1 
ATOM   5061  N  N   . THR B  1 217 ? -9.362  136.479 -11.063 1.00 31.24  ? 248  THR B N   1 
ATOM   5062  C  CA  . THR B  1 217 ? -9.212  135.834 -12.351 1.00 32.77  ? 248  THR B CA  1 
ATOM   5063  C  C   . THR B  1 217 ? -7.750  135.516 -12.641 1.00 33.05  ? 248  THR B C   1 
ATOM   5064  O  O   . THR B  1 217 ? -6.822  136.146 -12.153 1.00 33.95  ? 248  THR B O   1 
ATOM   5065  C  CB  . THR B  1 217 ? -9.740  136.728 -13.498 1.00 33.52  ? 248  THR B CB  1 
ATOM   5066  O  OG1 . THR B  1 217 ? -9.610  136.030 -14.738 1.00 34.84  ? 248  THR B OG1 1 
ATOM   5067  C  CG2 . THR B  1 217 ? -8.939  138.031 -13.563 1.00 32.48  ? 248  THR B CG2 1 
ATOM   5068  N  N   . ASP B  1 218 ? -7.538  134.522 -13.485 1.00 33.61  ? 249  ASP B N   1 
ATOM   5069  C  CA  . ASP B  1 218 ? -6.173  134.163 -13.871 1.00 34.15  ? 249  ASP B CA  1 
ATOM   5070  C  C   . ASP B  1 218 ? -5.937  134.754 -15.258 1.00 33.79  ? 249  ASP B C   1 
ATOM   5071  O  O   . ASP B  1 218 ? -4.934  134.470 -15.900 1.00 35.16  ? 249  ASP B O   1 
ATOM   5072  C  CB  . ASP B  1 218 ? -6.011  132.645 -13.933 1.00 36.09  ? 249  ASP B CB  1 
ATOM   5073  C  CG  . ASP B  1 218 ? -7.231  131.969 -14.546 1.00 38.95  ? 249  ASP B CG  1 
ATOM   5074  O  OD1 . ASP B  1 218 ? -8.061  132.682 -15.154 1.00 41.39  ? 249  ASP B OD1 1 
ATOM   5075  O  OD2 . ASP B  1 218 ? -7.356  130.736 -14.408 1.00 38.24  ? 249  ASP B OD2 1 
ATOM   5076  N  N   . THR B  1 219 ? -6.903  135.561 -15.691 1.00 32.67  ? 250  THR B N   1 
ATOM   5077  C  CA  . THR B  1 219 ? -6.769  136.197 -16.993 1.00 33.00  ? 250  THR B CA  1 
ATOM   5078  C  C   . THR B  1 219 ? -5.597  137.155 -17.061 1.00 33.49  ? 250  THR B C   1 
ATOM   5079  O  O   . THR B  1 219 ? -5.356  137.942 -16.154 1.00 33.16  ? 250  THR B O   1 
ATOM   5080  C  CB  . THR B  1 219 ? -8.041  136.920 -17.421 1.00 32.44  ? 250  THR B CB  1 
ATOM   5081  O  OG1 . THR B  1 219 ? -8.968  135.913 -17.878 1.00 35.45  ? 250  THR B OG1 1 
ATOM   5082  C  CG2 . THR B  1 219 ? -7.748  137.842 -18.591 1.00 31.78  ? 250  THR B CG2 1 
ATOM   5083  N  N   . GLY B  1 220 ? -4.829  137.035 -18.144 1.00 33.61  ? 251  GLY B N   1 
ATOM   5084  C  CA  . GLY B  1 220 ? -3.627  137.847 -18.281 1.00 34.14  ? 251  GLY B CA  1 
ATOM   5085  C  C   . GLY B  1 220 ? -2.355  137.116 -17.907 1.00 34.94  ? 251  GLY B C   1 
ATOM   5086  O  O   . GLY B  1 220 ? -1.305  137.365 -18.517 1.00 36.77  ? 251  GLY B O   1 
ATOM   5087  N  N   . ARG B  1 221 ? -2.402  136.226 -16.919 1.00 34.21  ? 252  ARG B N   1 
ATOM   5088  C  CA  . ARG B  1 221 ? -1.207  135.499 -16.499 1.00 33.42  ? 252  ARG B CA  1 
ATOM   5089  C  C   . ARG B  1 221 ? -1.064  134.175 -17.228 1.00 35.10  ? 252  ARG B C   1 
ATOM   5090  O  O   . ARG B  1 221 ? -2.010  133.653 -17.812 1.00 36.45  ? 252  ARG B O   1 
ATOM   5091  C  CB  . ARG B  1 221 ? -1.264  135.249 -14.987 1.00 31.04  ? 252  ARG B CB  1 
ATOM   5092  C  CG  . ARG B  1 221 ? -1.442  136.543 -14.203 1.00 31.53  ? 252  ARG B CG  1 
ATOM   5093  C  CD  . ARG B  1 221 ? -1.551  136.232 -12.708 1.00 31.35  ? 252  ARG B CD  1 
ATOM   5094  N  NE  . ARG B  1 221 ? -0.224  135.904 -12.181 1.00 30.64  ? 252  ARG B NE  1 
ATOM   5095  C  CZ  . ARG B  1 221 ? 0.753   136.801 -12.120 1.00 27.40  ? 252  ARG B CZ  1 
ATOM   5096  N  NH1 . ARG B  1 221 ? 0.555   138.040 -12.541 1.00 26.72  ? 252  ARG B NH1 1 
ATOM   5097  N  NH2 . ARG B  1 221 ? 1.926   136.420 -11.637 1.00 26.03  ? 252  ARG B NH2 1 
ATOM   5098  N  N   . SER B  1 222 ? 0.132   133.603 -17.176 1.00 36.54  ? 253  SER B N   1 
ATOM   5099  C  CA  . SER B  1 222 ? 0.355   132.283 -17.766 1.00 36.82  ? 253  SER B CA  1 
ATOM   5100  C  C   . SER B  1 222 ? 0.522   131.259 -16.636 1.00 35.64  ? 253  SER B C   1 
ATOM   5101  O  O   . SER B  1 222 ? 0.422   130.074 -16.893 1.00 35.42  ? 253  SER B O   1 
ATOM   5102  C  CB  . SER B  1 222 ? 1.612   132.280 -18.631 1.00 38.81  ? 253  SER B CB  1 
ATOM   5103  O  OG  . SER B  1 222 ? 1.355   132.800 -19.925 1.00 42.62  ? 253  SER B OG  1 
ATOM   5104  N  N   . ASP B  1 223 ? 0.756   131.770 -15.438 1.00 34.44  ? 254  ASP B N   1 
ATOM   5105  C  CA  . ASP B  1 223 ? 0.919   130.989 -14.243 1.00 33.64  ? 254  ASP B CA  1 
ATOM   5106  C  C   . ASP B  1 223 ? -0.292  130.108 -13.940 1.00 33.06  ? 254  ASP B C   1 
ATOM   5107  O  O   . ASP B  1 223 ? -0.145  128.934 -13.612 1.00 34.53  ? 254  ASP B O   1 
ATOM   5108  C  CB  . ASP B  1 223 ? 1.106   131.903 -13.024 1.00 35.77  ? 254  ASP B CB  1 
ATOM   5109  C  CG  . ASP B  1 223 ? 2.001   133.078 -13.324 1.00 38.81  ? 254  ASP B CG  1 
ATOM   5110  O  OD1 . ASP B  1 223 ? 3.114   132.857 -13.841 1.00 43.10  ? 254  ASP B OD1 1 
ATOM   5111  O  OD2 . ASP B  1 223 ? 1.588   134.226 -13.047 1.00 41.14  ? 254  ASP B OD2 1 
ATOM   5112  N  N   . GLY B  1 224 ? -1.459  130.728 -13.900 1.00 31.75  ? 255  GLY B N   1 
ATOM   5113  C  CA  . GLY B  1 224 ? -2.680  130.009 -13.532 1.00 30.16  ? 255  GLY B CA  1 
ATOM   5114  C  C   . GLY B  1 224 ? -3.055  130.430 -12.097 1.00 29.38  ? 255  GLY B C   1 
ATOM   5115  O  O   . GLY B  1 224 ? -3.929  129.840 -11.490 1.00 27.80  ? 255  GLY B O   1 
ATOM   5116  N  N   . PHE B  1 225 ? -2.314  131.435 -11.655 1.00 28.67  ? 256  PHE B N   1 
ATOM   5117  C  CA  . PHE B  1 225 ? -2.504  132.009 -10.343 1.00 29.06  ? 256  PHE B CA  1 
ATOM   5118  C  C   . PHE B  1 225 ? -3.659  132.998 -10.394 1.00 30.42  ? 256  PHE B C   1 
ATOM   5119  O  O   . PHE B  1 225 ? -3.974  133.562 -11.448 1.00 31.79  ? 256  PHE B O   1 
ATOM   5120  C  CB  . PHE B  1 225 ? -1.253  132.753 -9.884  1.00 27.87  ? 256  PHE B CB  1 
ATOM   5121  C  CG  . PHE B  1 225 ? -0.268  131.907 -9.124  1.00 27.80  ? 256  PHE B CG  1 
ATOM   5122  C  CD1 . PHE B  1 225 ? -0.573  131.433 -7.863  1.00 27.71  ? 256  PHE B CD1 1 
ATOM   5123  C  CD2 . PHE B  1 225 ? 0.964   131.604 -9.669  1.00 28.14  ? 256  PHE B CD2 1 
ATOM   5124  C  CE1 . PHE B  1 225 ? 0.323   130.660 -7.158  1.00 28.68  ? 256  PHE B CE1 1 
ATOM   5125  C  CE2 . PHE B  1 225 ? 1.867   130.826 -8.978  1.00 28.31  ? 256  PHE B CE2 1 
ATOM   5126  C  CZ  . PHE B  1 225 ? 1.547   130.357 -7.717  1.00 29.23  ? 256  PHE B CZ  1 
ATOM   5127  N  N   . LEU B  1 226 ? -4.341  133.175 -9.266  1.00 29.09  ? 257  LEU B N   1 
ATOM   5128  C  CA  . LEU B  1 226 ? -5.489  134.081 -9.322  1.00 27.91  ? 257  LEU B CA  1 
ATOM   5129  C  C   . LEU B  1 226 ? -5.061  135.425 -8.767  1.00 28.34  ? 257  LEU B C   1 
ATOM   5130  O  O   . LEU B  1 226 ? -4.317  135.434 -7.802  1.00 28.56  ? 257  LEU B O   1 
ATOM   5131  C  CB  . LEU B  1 226 ? -6.664  133.537 -8.511  1.00 26.14  ? 257  LEU B CB  1 
ATOM   5132  C  CG  . LEU B  1 226 ? -7.377  132.342 -9.146  1.00 23.03  ? 257  LEU B CG  1 
ATOM   5133  C  CD1 . LEU B  1 226 ? -8.596  131.932 -8.346  1.00 20.32  ? 257  LEU B CD1 1 
ATOM   5134  C  CD2 . LEU B  1 226 ? -7.744  132.629 -10.585 1.00 20.61  ? 257  LEU B CD2 1 
ATOM   5135  N  N   . TRP B  1 227 ? -5.465  136.463 -9.455  1.00 26.89  ? 258  TRP B N   1 
ATOM   5136  C  CA  . TRP B  1 227 ? -5.136  137.807 -9.063  1.00 27.08  ? 258  TRP B CA  1 
ATOM   5137  C  C   . TRP B  1 227 ? -6.330  138.734 -9.228  1.00 28.16  ? 258  TRP B C   1 
ATOM   5138  O  O   . TRP B  1 227 ? -7.204  138.422 -10.034 1.00 30.18  ? 258  TRP B O   1 
ATOM   5139  C  CB  . TRP B  1 227 ? -3.964  138.357 -9.879  1.00 24.86  ? 258  TRP B CB  1 
ATOM   5140  C  CG  . TRP B  1 227 ? -4.378  138.779 -11.259 1.00 22.51  ? 258  TRP B CG  1 
ATOM   5141  C  CD1 . TRP B  1 227 ? -4.508  138.001 -12.366 1.00 21.67  ? 258  TRP B CD1 1 
ATOM   5142  C  CD2 . TRP B  1 227 ? -4.714  140.109 -11.684 1.00 21.78  ? 258  TRP B CD2 1 
ATOM   5143  N  NE1 . TRP B  1 227 ? -4.903  138.743 -13.432 1.00 20.49  ? 258  TRP B NE1 1 
ATOM   5144  C  CE2 . TRP B  1 227 ? -5.049  140.043 -13.056 1.00 21.82  ? 258  TRP B CE2 1 
ATOM   5145  C  CE3 . TRP B  1 227 ? -4.755  141.352 -11.047 1.00 18.95  ? 258  TRP B CE3 1 
ATOM   5146  C  CZ2 . TRP B  1 227 ? -5.418  141.158 -13.792 1.00 21.21  ? 258  TRP B CZ2 1 
ATOM   5147  C  CZ3 . TRP B  1 227 ? -5.156  142.441 -11.771 1.00 18.85  ? 258  TRP B CZ3 1 
ATOM   5148  C  CH2 . TRP B  1 227 ? -5.471  142.344 -13.125 1.00 19.92  ? 258  TRP B CH2 1 
ATOM   5149  N  N   . CYS B  1 228 ? -6.316  139.845 -8.518  1.00 27.43  ? 259  CYS B N   1 
ATOM   5150  C  CA  . CYS B  1 228 ? -7.354  140.855 -8.624  1.00 25.76  ? 259  CYS B CA  1 
ATOM   5151  C  C   . CYS B  1 228 ? -6.691  142.226 -8.474  1.00 25.92  ? 259  CYS B C   1 
ATOM   5152  O  O   . CYS B  1 228 ? -5.530  142.327 -8.109  1.00 27.07  ? 259  CYS B O   1 
ATOM   5153  C  CB  . CYS B  1 228 ? -8.385  140.683 -7.488  1.00 24.35  ? 259  CYS B CB  1 
ATOM   5154  S  SG  . CYS B  1 228 ? -7.688  141.319 -5.951  1.00 26.95  ? 259  CYS B SG  1 
ATOM   5155  N  N   . SER B  1 229 ? -7.419  143.293 -8.692  1.00 25.11  ? 260  SER B N   1 
ATOM   5156  C  CA  . SER B  1 229 ? -6.939  144.642 -8.539  1.00 24.28  ? 260  SER B CA  1 
ATOM   5157  C  C   . SER B  1 229 ? -7.440  145.213 -7.220  1.00 24.74  ? 260  SER B C   1 
ATOM   5158  O  O   . SER B  1 229 ? -8.554  144.952 -6.779  1.00 25.86  ? 260  SER B O   1 
ATOM   5159  C  CB  . SER B  1 229 ? -7.345  145.495 -9.725  1.00 23.03  ? 260  SER B CB  1 
ATOM   5160  O  OG  . SER B  1 229 ? -6.654  146.708 -9.818  1.00 20.55  ? 260  SER B OG  1 
ATOM   5161  N  N   . THR B  1 230 ? -6.588  145.969 -6.543  1.00 24.80  ? 261  THR B N   1 
ATOM   5162  C  CA  . THR B  1 230 ? -6.963  146.576 -5.275  1.00 25.70  ? 261  THR B CA  1 
ATOM   5163  C  C   . THR B  1 230 ? -7.784  147.832 -5.460  1.00 26.90  ? 261  THR B C   1 
ATOM   5164  O  O   . THR B  1 230 ? -8.307  148.384 -4.484  1.00 26.28  ? 261  THR B O   1 
ATOM   5165  C  CB  . THR B  1 230 ? -5.707  146.846 -4.439  1.00 27.01  ? 261  THR B CB  1 
ATOM   5166  O  OG1 . THR B  1 230 ? -5.237  145.581 -3.963  1.00 27.66  ? 261  THR B OG1 1 
ATOM   5167  C  CG2 . THR B  1 230 ? -6.005  147.708 -3.228  1.00 28.52  ? 261  THR B CG2 1 
ATOM   5168  N  N   . THR B  1 231 ? -7.908  148.299 -6.694  1.00 28.59  ? 262  THR B N   1 
ATOM   5169  C  CA  . THR B  1 231 ? -8.678  149.478 -7.039  1.00 29.44  ? 262  THR B CA  1 
ATOM   5170  C  C   . THR B  1 231 ? -9.329  149.312 -8.415  1.00 29.43  ? 262  THR B C   1 
ATOM   5171  O  O   . THR B  1 231 ? -8.769  148.695 -9.296  1.00 29.60  ? 262  THR B O   1 
ATOM   5172  C  CB  . THR B  1 231 ? -7.817  150.747 -7.166  1.00 29.94  ? 262  THR B CB  1 
ATOM   5173  O  OG1 . THR B  1 231 ? -6.995  150.640 -8.329  1.00 30.00  ? 262  THR B OG1 1 
ATOM   5174  C  CG2 . THR B  1 231 ? -6.991  151.046 -5.942  1.00 28.68  ? 262  THR B CG2 1 
ATOM   5175  N  N   . TYR B  1 232 ? -10.482 149.945 -8.615  1.00 29.98  ? 263  TYR B N   1 
ATOM   5176  C  CA  . TYR B  1 232 ? -11.178 149.805 -9.873  1.00 31.45  ? 263  TYR B CA  1 
ATOM   5177  C  C   . TYR B  1 232 ? -10.296 149.868 -11.110 1.00 33.74  ? 263  TYR B C   1 
ATOM   5178  O  O   . TYR B  1 232 ? -10.234 148.932 -11.905 1.00 33.51  ? 263  TYR B O   1 
ATOM   5179  C  CB  . TYR B  1 232 ? -12.307 150.847 -10.039 1.00 29.08  ? 263  TYR B CB  1 
ATOM   5180  C  CG  . TYR B  1 232 ? -13.016 150.587 -11.368 1.00 26.94  ? 263  TYR B CG  1 
ATOM   5181  C  CD1 . TYR B  1 232 ? -14.080 149.696 -11.429 1.00 26.13  ? 263  TYR B CD1 1 
ATOM   5182  C  CD2 . TYR B  1 232 ? -12.601 151.204 -12.540 1.00 25.18  ? 263  TYR B CD2 1 
ATOM   5183  C  CE1 . TYR B  1 232 ? -14.711 149.434 -12.629 1.00 25.62  ? 263  TYR B CE1 1 
ATOM   5184  C  CE2 . TYR B  1 232 ? -13.241 150.960 -13.740 1.00 25.71  ? 263  TYR B CE2 1 
ATOM   5185  C  CZ  . TYR B  1 232 ? -14.300 150.065 -13.782 1.00 26.22  ? 263  TYR B CZ  1 
ATOM   5186  O  OH  . TYR B  1 232 ? -14.932 149.832 -14.978 1.00 26.37  ? 263  TYR B OH  1 
ATOM   5187  N  N   . ASN B  1 233 ? -9.765  151.059 -11.379 1.00 38.07  ? 264  ASN B N   1 
ATOM   5188  C  CA  . ASN B  1 233 ? -9.032  151.297 -12.619 1.00 42.17  ? 264  ASN B CA  1 
ATOM   5189  C  C   . ASN B  1 233 ? -7.601  150.789 -12.473 1.00 43.57  ? 264  ASN B C   1 
ATOM   5190  O  O   . ASN B  1 233 ? -6.767  151.347 -11.767 1.00 44.12  ? 264  ASN B O   1 
ATOM   5191  C  CB  . ASN B  1 233 ? -9.072  152.754 -13.026 1.00 45.13  ? 264  ASN B CB  1 
ATOM   5192  C  CG  . ASN B  1 233 ? -9.118  152.956 -14.527 1.00 48.65  ? 264  ASN B CG  1 
ATOM   5193  O  OD1 . ASN B  1 233 ? -8.308  152.397 -15.266 1.00 47.76  ? 264  ASN B OD1 1 
ATOM   5194  N  ND2 . ASN B  1 233 ? -10.068 153.771 -14.980 1.00 51.24  ? 264  ASN B ND2 1 
ATOM   5195  N  N   . PHE B  1 234 ? -7.396  149.624 -13.082 1.00 44.39  ? 265  PHE B N   1 
ATOM   5196  C  CA  . PHE B  1 234 ? -6.196  148.818 -12.905 1.00 45.84  ? 265  PHE B CA  1 
ATOM   5197  C  C   . PHE B  1 234 ? -5.167  149.356 -13.893 1.00 49.44  ? 265  PHE B C   1 
ATOM   5198  O  O   . PHE B  1 234 ? -3.994  149.511 -13.583 1.00 49.26  ? 265  PHE B O   1 
ATOM   5199  C  CB  . PHE B  1 234 ? -6.375  147.309 -13.112 1.00 41.44  ? 265  PHE B CB  1 
ATOM   5200  C  CG  . PHE B  1 234 ? -5.077  146.542 -12.971 1.00 37.01  ? 265  PHE B CG  1 
ATOM   5201  C  CD1 . PHE B  1 234 ? -4.413  146.478 -11.765 1.00 34.76  ? 265  PHE B CD1 1 
ATOM   5202  C  CD2 . PHE B  1 234 ? -4.520  145.895 -14.059 1.00 35.22  ? 265  PHE B CD2 1 
ATOM   5203  C  CE1 . PHE B  1 234 ? -3.226  145.792 -11.636 1.00 32.20  ? 265  PHE B CE1 1 
ATOM   5204  C  CE2 . PHE B  1 234 ? -3.336  145.201 -13.943 1.00 32.64  ? 265  PHE B CE2 1 
ATOM   5205  C  CZ  . PHE B  1 234 ? -2.686  145.147 -12.728 1.00 31.60  ? 265  PHE B CZ  1 
ATOM   5206  N  N   . GLU B  1 235 ? -5.680  149.699 -15.079 1.00 53.88  ? 266  GLU B N   1 
ATOM   5207  C  CA  . GLU B  1 235 ? -4.793  150.291 -16.092 1.00 57.51  ? 266  GLU B CA  1 
ATOM   5208  C  C   . GLU B  1 235 ? -4.074  151.463 -15.409 1.00 56.84  ? 266  GLU B C   1 
ATOM   5209  O  O   . GLU B  1 235 ? -2.875  151.432 -15.193 1.00 56.57  ? 266  GLU B O   1 
ATOM   5210  C  CB  . GLU B  1 235 ? -5.598  150.813 -17.280 1.00 61.67  ? 266  GLU B CB  1 
ATOM   5211  C  CG  . GLU B  1 235 ? -6.945  150.135 -17.473 1.00 68.87  ? 266  GLU B CG  1 
ATOM   5212  C  CD  . GLU B  1 235 ? -6.826  148.740 -18.051 1.00 73.01  ? 266  GLU B CD  1 
ATOM   5213  O  OE1 . GLU B  1 235 ? -6.217  147.857 -17.409 1.00 74.55  ? 266  GLU B OE1 1 
ATOM   5214  O  OE2 . GLU B  1 235 ? -7.352  148.519 -19.166 1.00 75.11  ? 266  GLU B OE2 1 
ATOM   5215  N  N   . LYS B  1 236 ? -4.886  152.413 -14.962 1.00 56.77  ? 267  LYS B N   1 
ATOM   5216  C  CA  . LYS B  1 236 ? -4.411  153.599 -14.291 1.00 56.52  ? 267  LYS B CA  1 
ATOM   5217  C  C   . LYS B  1 236 ? -3.546  153.302 -13.078 1.00 54.07  ? 267  LYS B C   1 
ATOM   5218  O  O   . LYS B  1 236 ? -2.375  153.676 -13.046 1.00 53.89  ? 267  LYS B O   1 
ATOM   5219  C  CB  . LYS B  1 236 ? -5.590  154.485 -13.869 1.00 59.45  ? 267  LYS B CB  1 
ATOM   5220  C  CG  . LYS B  1 236 ? -5.189  155.816 -13.260 1.00 62.65  ? 267  LYS B CG  1 
ATOM   5221  C  CD  . LYS B  1 236 ? -4.882  156.861 -14.316 1.00 64.42  ? 267  LYS B CD  1 
ATOM   5222  C  CE  . LYS B  1 236 ? -4.767  158.258 -13.721 1.00 64.68  ? 267  LYS B CE  1 
ATOM   5223  N  NZ  . LYS B  1 236 ? -3.644  158.405 -12.762 1.00 62.81  ? 267  LYS B NZ  1 
ATOM   5224  N  N   . ASP B  1 237 ? -4.132  152.696 -12.059 1.00 51.89  ? 268  ASP B N   1 
ATOM   5225  C  CA  . ASP B  1 237 ? -3.452  152.468 -10.800 1.00 50.39  ? 268  ASP B CA  1 
ATOM   5226  C  C   . ASP B  1 237 ? -2.403  151.376 -10.836 1.00 50.00  ? 268  ASP B C   1 
ATOM   5227  O  O   . ASP B  1 237 ? -1.302  151.534 -10.296 1.00 49.30  ? 268  ASP B O   1 
ATOM   5228  C  CB  . ASP B  1 237 ? -4.495  152.169 -9.713  1.00 51.21  ? 268  ASP B CB  1 
ATOM   5229  C  CG  . ASP B  1 237 ? -5.502  153.290 -9.558  1.00 49.66  ? 268  ASP B CG  1 
ATOM   5230  O  OD1 . ASP B  1 237 ? -5.181  154.399 -10.032 1.00 50.11  ? 268  ASP B OD1 1 
ATOM   5231  O  OD2 . ASP B  1 237 ? -6.577  153.082 -8.971  1.00 46.75  ? 268  ASP B OD2 1 
ATOM   5232  N  N   . GLY B  1 238 ? -2.737  150.201 -11.364 1.00 49.03  ? 269  GLY B N   1 
ATOM   5233  C  CA  . GLY B  1 238 ? -1.829  149.070 -11.388 1.00 45.93  ? 269  GLY B CA  1 
ATOM   5234  C  C   . GLY B  1 238 ? -1.475  148.545 -10.005 1.00 44.16  ? 269  GLY B C   1 
ATOM   5235  O  O   . GLY B  1 238 ? -0.393  147.986 -9.812  1.00 42.50  ? 269  GLY B O   1 
ATOM   5236  N  N   . LYS B  1 239 ? -2.379  148.644 -9.043  1.00 43.38  ? 270  LYS B N   1 
ATOM   5237  C  CA  . LYS B  1 239 ? -2.162  148.153 -7.683  1.00 40.64  ? 270  LYS B CA  1 
ATOM   5238  C  C   . LYS B  1 239 ? -2.997  146.890 -7.461  1.00 38.98  ? 270  LYS B C   1 
ATOM   5239  O  O   . LYS B  1 239 ? -4.199  146.940 -7.210  1.00 39.71  ? 270  LYS B O   1 
ATOM   5240  C  CB  . LYS B  1 239 ? -2.561  149.224 -6.667  1.00 41.21  ? 270  LYS B CB  1 
ATOM   5241  C  CG  . LYS B  1 239 ? -1.501  149.617 -5.668  1.00 39.30  ? 270  LYS B CG  1 
ATOM   5242  C  CD  . LYS B  1 239 ? -2.058  149.739 -4.252  1.00 40.55  ? 270  LYS B CD  1 
ATOM   5243  C  CE  . LYS B  1 239 ? -0.946  149.572 -3.226  1.00 40.77  ? 270  LYS B CE  1 
ATOM   5244  N  NZ  . LYS B  1 239 ? -1.457  149.426 -1.837  1.00 39.83  ? 270  LYS B NZ  1 
ATOM   5245  N  N   . TYR B  1 240 ? -2.347  145.745 -7.557  1.00 36.35  ? 271  TYR B N   1 
ATOM   5246  C  CA  . TYR B  1 240 ? -2.960  144.439 -7.438  1.00 32.76  ? 271  TYR B CA  1 
ATOM   5247  C  C   . TYR B  1 240 ? -2.302  143.553 -6.375  1.00 30.51  ? 271  TYR B C   1 
ATOM   5248  O  O   . TYR B  1 240 ? -1.252  143.853 -5.837  1.00 28.15  ? 271  TYR B O   1 
ATOM   5249  C  CB  . TYR B  1 240 ? -2.741  143.671 -8.774  1.00 32.29  ? 271  TYR B CB  1 
ATOM   5250  C  CG  . TYR B  1 240 ? -1.295  143.215 -8.834  1.00 33.90  ? 271  TYR B CG  1 
ATOM   5251  C  CD1 . TYR B  1 240 ? -0.280  144.150 -8.966  1.00 35.66  ? 271  TYR B CD1 1 
ATOM   5252  C  CD2 . TYR B  1 240 ? -0.945  141.884 -8.726  1.00 34.88  ? 271  TYR B CD2 1 
ATOM   5253  C  CE1 . TYR B  1 240 ? 1.044   143.771 -9.008  1.00 36.62  ? 271  TYR B CE1 1 
ATOM   5254  C  CE2 . TYR B  1 240 ? 0.382   141.488 -8.771  1.00 36.99  ? 271  TYR B CE2 1 
ATOM   5255  C  CZ  . TYR B  1 240 ? 1.365   142.439 -8.909  1.00 37.22  ? 271  TYR B CZ  1 
ATOM   5256  O  OH  . TYR B  1 240 ? 2.684   142.078 -8.951  1.00 38.78  ? 271  TYR B OH  1 
ATOM   5257  N  N   . GLY B  1 241 ? -2.928  142.407 -6.182  1.00 28.50  ? 272  GLY B N   1 
ATOM   5258  C  CA  . GLY B  1 241 ? -2.468  141.415 -5.228  1.00 26.90  ? 272  GLY B CA  1 
ATOM   5259  C  C   . GLY B  1 241 ? -2.880  140.036 -5.750  1.00 27.01  ? 272  GLY B C   1 
ATOM   5260  O  O   . GLY B  1 241 ? -3.608  139.941 -6.735  1.00 27.44  ? 272  GLY B O   1 
ATOM   5261  N  N   . PHE B  1 242 ? -2.444  138.986 -5.108  1.00 24.16  ? 273  PHE B N   1 
ATOM   5262  C  CA  . PHE B  1 242 ? -2.758  137.630 -5.449  1.00 22.06  ? 273  PHE B CA  1 
ATOM   5263  C  C   . PHE B  1 242 ? -3.899  137.088 -4.611  1.00 22.98  ? 273  PHE B C   1 
ATOM   5264  O  O   . PHE B  1 242 ? -3.989  137.346 -3.411  1.00 22.39  ? 273  PHE B O   1 
ATOM   5265  C  CB  . PHE B  1 242 ? -1.524  136.740 -5.366  1.00 21.39  ? 273  PHE B CB  1 
ATOM   5266  C  CG  . PHE B  1 242 ? -0.622  136.890 -6.553  1.00 19.34  ? 273  PHE B CG  1 
ATOM   5267  C  CD1 . PHE B  1 242 ? -0.971  136.345 -7.784  1.00 18.97  ? 273  PHE B CD1 1 
ATOM   5268  C  CD2 . PHE B  1 242 ? 0.565   137.601 -6.440  1.00 18.69  ? 273  PHE B CD2 1 
ATOM   5269  C  CE1 . PHE B  1 242 ? -0.138  136.493 -8.868  1.00 18.35  ? 273  PHE B CE1 1 
ATOM   5270  C  CE2 . PHE B  1 242 ? 1.385   137.745 -7.524  1.00 19.62  ? 273  PHE B CE2 1 
ATOM   5271  C  CZ  . PHE B  1 242 ? 1.037   137.204 -8.744  1.00 19.80  ? 273  PHE B CZ  1 
ATOM   5272  N  N   . CYS B  1 243 ? -4.757  136.223 -5.170  1.00 22.65  ? 274  CYS B N   1 
ATOM   5273  C  CA  . CYS B  1 243 ? -5.923  135.750 -4.438  1.00 22.80  ? 274  CYS B CA  1 
ATOM   5274  C  C   . CYS B  1 243 ? -5.704  134.345 -3.894  1.00 21.24  ? 274  CYS B C   1 
ATOM   5275  O  O   . CYS B  1 243 ? -5.280  133.424 -4.576  1.00 21.43  ? 274  CYS B O   1 
ATOM   5276  C  CB  . CYS B  1 243 ? -7.165  135.785 -5.330  1.00 24.54  ? 274  CYS B CB  1 
ATOM   5277  S  SG  . CYS B  1 243 ? -7.681  137.444 -5.830  1.00 27.90  ? 274  CYS B SG  1 
ATOM   5278  N  N   . PRO B  1 244 ? -6.030  134.183 -2.603  1.00 20.28  ? 275  PRO B N   1 
ATOM   5279  C  CA  . PRO B  1 244 ? -5.945  132.946 -1.855  1.00 21.22  ? 275  PRO B CA  1 
ATOM   5280  C  C   . PRO B  1 244 ? -6.623  131.749 -2.498  1.00 23.02  ? 275  PRO B C   1 
ATOM   5281  O  O   . PRO B  1 244 ? -7.707  131.857 -3.062  1.00 24.79  ? 275  PRO B O   1 
ATOM   5282  C  CB  . PRO B  1 244 ? -6.664  133.284 -0.537  1.00 19.49  ? 275  PRO B CB  1 
ATOM   5283  C  CG  . PRO B  1 244 ? -6.523  134.758 -0.384  1.00 19.46  ? 275  PRO B CG  1 
ATOM   5284  C  CD  . PRO B  1 244 ? -6.593  135.278 -1.773  1.00 20.25  ? 275  PRO B CD  1 
ATOM   5285  N  N   . HIS B  1 245 ? -6.044  130.558 -2.371  1.00 24.69  ? 276  HIS B N   1 
ATOM   5286  C  CA  . HIS B  1 245 ? -6.571  129.336 -2.934  1.00 24.72  ? 276  HIS B CA  1 
ATOM   5287  C  C   . HIS B  1 245 ? -5.686  128.113 -2.779  1.00 24.10  ? 276  HIS B C   1 
ATOM   5288  O  O   . HIS B  1 245 ? -4.786  127.863 -3.580  1.00 22.58  ? 276  HIS B O   1 
ATOM   5289  C  CB  . HIS B  1 245 ? -6.890  129.537 -4.435  1.00 25.61  ? 276  HIS B CB  1 
ATOM   5290  C  CG  . HIS B  1 245 ? -7.998  128.599 -4.839  1.00 29.36  ? 276  HIS B CG  1 
ATOM   5291  N  ND1 . HIS B  1 245 ? -7.914  127.234 -4.622  1.00 29.33  ? 276  HIS B ND1 1 
ATOM   5292  C  CD2 . HIS B  1 245 ? -9.201  128.817 -5.388  1.00 30.20  ? 276  HIS B CD2 1 
ATOM   5293  C  CE1 . HIS B  1 245 ? -9.016  126.657 -5.042  1.00 28.93  ? 276  HIS B CE1 1 
ATOM   5294  N  NE2 . HIS B  1 245 ? -9.811  127.600 -5.504  1.00 29.98  ? 276  HIS B NE2 1 
ATOM   5295  N  N   . GLU B  1 246 ? -6.040  127.247 -1.838  1.00 22.23  ? 277  GLU B N   1 
ATOM   5296  C  CA  . GLU B  1 246 ? -5.308  126.031 -1.505  1.00 19.30  ? 277  GLU B CA  1 
ATOM   5297  C  C   . GLU B  1 246 ? -4.944  125.235 -2.737  1.00 17.92  ? 277  GLU B C   1 
ATOM   5298  O  O   . GLU B  1 246 ? -4.022  124.411 -2.685  1.00 19.64  ? 277  GLU B O   1 
ATOM   5299  C  CB  . GLU B  1 246 ? -6.160  125.152 -0.599  1.00 18.42  ? 277  GLU B CB  1 
ATOM   5300  C  CG  . GLU B  1 246 ? -7.590  125.065 -1.160  1.00 20.73  ? 277  GLU B CG  1 
ATOM   5301  C  CD  . GLU B  1 246 ? -8.459  126.156 -0.604  1.00 19.69  ? 277  GLU B CD  1 
ATOM   5302  O  OE1 . GLU B  1 246 ? -8.034  127.338 -0.611  1.00 21.96  ? 277  GLU B OE1 1 
ATOM   5303  O  OE2 . GLU B  1 246 ? -9.562  125.885 -0.111  1.00 20.34  ? 277  GLU B OE2 1 
ATOM   5304  N  N   . ALA B  1 247 ? -5.601  125.432 -3.860  1.00 15.17  ? 278  ALA B N   1 
ATOM   5305  C  CA  . ALA B  1 247 ? -5.232  124.747 -5.096  1.00 15.00  ? 278  ALA B CA  1 
ATOM   5306  C  C   . ALA B  1 247 ? -4.002  125.413 -5.716  1.00 15.00  ? 278  ALA B C   1 
ATOM   5307  O  O   . ALA B  1 247 ? -3.335  124.764 -6.525  1.00 15.23  ? 278  ALA B O   1 
ATOM   5308  C  CB  . ALA B  1 247 ? -6.418  124.775 -6.040  1.00 15.00  ? 278  ALA B CB  1 
ATOM   5309  N  N   . LEU B  1 248 ? -3.773  126.689 -5.409  1.00 17.14  ? 279  LEU B N   1 
ATOM   5310  C  CA  . LEU B  1 248 ? -2.716  127.502 -5.983  1.00 15.75  ? 279  LEU B CA  1 
ATOM   5311  C  C   . LEU B  1 248 ? -1.557  127.753 -5.047  1.00 15.13  ? 279  LEU B C   1 
ATOM   5312  O  O   . LEU B  1 248 ? -0.423  127.750 -5.439  1.00 15.37  ? 279  LEU B O   1 
ATOM   5313  C  CB  . LEU B  1 248 ? -3.281  128.843 -6.477  1.00 16.20  ? 279  LEU B CB  1 
ATOM   5314  C  CG  . LEU B  1 248 ? -4.581  128.699 -7.282  1.00 15.00  ? 279  LEU B CG  1 
ATOM   5315  C  CD1 . LEU B  1 248 ? -5.001  130.027 -7.902  1.00 15.00  ? 279  LEU B CD1 1 
ATOM   5316  C  CD2 . LEU B  1 248 ? -4.437  127.708 -8.413  1.00 15.58  ? 279  LEU B CD2 1 
ATOM   5317  N  N   . PHE B  1 249 ? -1.861  127.927 -3.780  1.00 15.06  ? 280  PHE B N   1 
ATOM   5318  C  CA  . PHE B  1 249 ? -0.799  128.145 -2.779  1.00 16.02  ? 280  PHE B CA  1 
ATOM   5319  C  C   . PHE B  1 249 ? -1.330  127.948 -1.369  1.00 15.00  ? 280  PHE B C   1 
ATOM   5320  O  O   . PHE B  1 249 ? -2.511  128.218 -1.133  1.00 15.42  ? 280  PHE B O   1 
ATOM   5321  C  CB  . PHE B  1 249 ? -0.076  129.457 -2.946  1.00 15.00  ? 280  PHE B CB  1 
ATOM   5322  C  CG  . PHE B  1 249 ? -0.737  130.747 -2.638  1.00 16.28  ? 280  PHE B CG  1 
ATOM   5323  C  CD1 . PHE B  1 249 ? -1.540  131.403 -3.562  1.00 15.68  ? 280  PHE B CD1 1 
ATOM   5324  C  CD2 . PHE B  1 249 ? -0.581  131.359 -1.400  1.00 17.38  ? 280  PHE B CD2 1 
ATOM   5325  C  CE1 . PHE B  1 249 ? -2.150  132.576 -3.275  1.00 15.00  ? 280  PHE B CE1 1 
ATOM   5326  C  CE2 . PHE B  1 249 ? -1.203  132.550 -1.088  1.00 19.28  ? 280  PHE B CE2 1 
ATOM   5327  C  CZ  . PHE B  1 249 ? -2.003  133.175 -2.035  1.00 17.72  ? 280  PHE B CZ  1 
ATOM   5328  N  N   . THR B  1 250 ? -0.470  127.662 -0.432  1.00 15.00  ? 281  THR B N   1 
ATOM   5329  C  CA  . THR B  1 250 ? -0.803  127.581 0.961   1.00 16.04  ? 281  THR B CA  1 
ATOM   5330  C  C   . THR B  1 250 ? -0.118  128.741 1.680   1.00 16.77  ? 281  THR B C   1 
ATOM   5331  O  O   . THR B  1 250 ? 0.541   129.578 1.089   1.00 15.68  ? 281  THR B O   1 
ATOM   5332  C  CB  . THR B  1 250 ? -0.427  126.271 1.640   1.00 15.08  ? 281  THR B CB  1 
ATOM   5333  O  OG1 . THR B  1 250 ? 0.931   125.945 1.348   1.00 16.29  ? 281  THR B OG1 1 
ATOM   5334  C  CG2 . THR B  1 250 ? -1.302  125.135 1.169   1.00 17.47  ? 281  THR B CG2 1 
ATOM   5335  N  N   . MET B  1 251 ? -0.363  128.828 2.968   1.00 19.57  ? 282  MET B N   1 
ATOM   5336  C  CA  . MET B  1 251 ? 0.151   129.883 3.797   1.00 23.47  ? 282  MET B CA  1 
ATOM   5337  C  C   . MET B  1 251 ? 0.778   129.377 5.070   1.00 24.69  ? 282  MET B C   1 
ATOM   5338  O  O   . MET B  1 251 ? 0.126   128.682 5.835   1.00 26.60  ? 282  MET B O   1 
ATOM   5339  C  CB  . MET B  1 251 ? -0.904  130.934 4.068   1.00 27.51  ? 282  MET B CB  1 
ATOM   5340  C  CG  . MET B  1 251 ? -0.449  132.373 4.061   1.00 32.20  ? 282  MET B CG  1 
ATOM   5341  S  SD  . MET B  1 251 ? -0.068  133.028 2.427   1.00 38.13  ? 282  MET B SD  1 
ATOM   5342  C  CE  . MET B  1 251 ? 1.593   133.665 2.755   1.00 38.94  ? 282  MET B CE  1 
ATOM   5343  N  N   . GLY B  1 252 ? 2.036   129.702 5.331   1.00 24.03  ? 283  GLY B N   1 
ATOM   5344  C  CA  . GLY B  1 252 ? 2.665   129.312 6.589   1.00 23.82  ? 283  GLY B CA  1 
ATOM   5345  C  C   . GLY B  1 252 ? 3.151   127.869 6.512   1.00 25.00  ? 283  GLY B C   1 
ATOM   5346  O  O   . GLY B  1 252 ? 3.511   127.413 5.427   1.00 26.14  ? 283  GLY B O   1 
ATOM   5347  N  N   . GLY B  1 253 ? 3.188   127.208 7.667   1.00 25.77  ? 284  GLY B N   1 
ATOM   5348  C  CA  . GLY B  1 253 ? 3.579   125.803 7.726   1.00 24.37  ? 284  GLY B CA  1 
ATOM   5349  C  C   . GLY B  1 253 ? 5.020   125.644 7.254   1.00 23.71  ? 284  GLY B C   1 
ATOM   5350  O  O   . GLY B  1 253 ? 5.802   126.551 7.525   1.00 24.17  ? 284  GLY B O   1 
ATOM   5351  N  N   . ASN B  1 254 ? 5.330   124.573 6.547   1.00 23.03  ? 285  ASN B N   1 
ATOM   5352  C  CA  . ASN B  1 254 ? 6.665   124.303 6.052   1.00 20.82  ? 285  ASN B CA  1 
ATOM   5353  C  C   . ASN B  1 254 ? 6.698   124.033 4.557   1.00 19.95  ? 285  ASN B C   1 
ATOM   5354  O  O   . ASN B  1 254 ? 7.750   123.690 4.003   1.00 21.53  ? 285  ASN B O   1 
ATOM   5355  C  CB  . ASN B  1 254 ? 7.200   123.032 6.721   1.00 21.98  ? 285  ASN B CB  1 
ATOM   5356  C  CG  . ASN B  1 254 ? 6.469   121.793 6.270   1.00 25.01  ? 285  ASN B CG  1 
ATOM   5357  O  OD1 . ASN B  1 254 ? 6.065   121.645 5.124   1.00 31.11  ? 285  ASN B OD1 1 
ATOM   5358  N  ND2 . ASN B  1 254 ? 6.336   120.899 7.247   1.00 22.58  ? 285  ASN B ND2 1 
ATOM   5359  N  N   . ALA B  1 255 ? 5.556   124.069 3.915   1.00 18.96  ? 286  ALA B N   1 
ATOM   5360  C  CA  . ALA B  1 255 ? 5.419   123.802 2.527   1.00 18.74  ? 286  ALA B CA  1 
ATOM   5361  C  C   . ALA B  1 255 ? 5.868   124.884 1.575   1.00 19.06  ? 286  ALA B C   1 
ATOM   5362  O  O   . ALA B  1 255 ? 5.734   124.752 0.365   1.00 20.24  ? 286  ALA B O   1 
ATOM   5363  C  CB  . ALA B  1 255 ? 4.030   123.340 2.190   1.00 19.83  ? 286  ALA B CB  1 
ATOM   5364  N  N   . GLU B  1 256 ? 6.394   125.971 2.128   1.00 18.77  ? 287  GLU B N   1 
ATOM   5365  C  CA  . GLU B  1 256 ? 6.889   127.084 1.348   1.00 20.52  ? 287  GLU B CA  1 
ATOM   5366  C  C   . GLU B  1 256 ? 5.873   127.589 0.329   1.00 21.40  ? 287  GLU B C   1 
ATOM   5367  O  O   . GLU B  1 256 ? 6.321   127.950 -0.752  1.00 18.55  ? 287  GLU B O   1 
ATOM   5368  C  CB  . GLU B  1 256 ? 8.151   126.658 0.579   1.00 22.79  ? 287  GLU B CB  1 
ATOM   5369  C  CG  . GLU B  1 256 ? 9.326   126.378 1.473   1.00 28.69  ? 287  GLU B CG  1 
ATOM   5370  C  CD  . GLU B  1 256 ? 10.404  125.558 0.792   1.00 32.11  ? 287  GLU B CD  1 
ATOM   5371  O  OE1 . GLU B  1 256 ? 11.164  126.141 -0.009  1.00 32.87  ? 287  GLU B OE1 1 
ATOM   5372  O  OE2 . GLU B  1 256 ? 10.470  124.338 1.056   1.00 34.65  ? 287  GLU B OE2 1 
ATOM   5373  N  N   . GLY B  1 257 ? 4.607   127.626 0.698   1.00 23.91  ? 288  GLY B N   1 
ATOM   5374  C  CA  . GLY B  1 257 ? 3.581   128.109 -0.245  1.00 24.71  ? 288  GLY B CA  1 
ATOM   5375  C  C   . GLY B  1 257 ? 3.196   127.147 -1.353  1.00 24.85  ? 288  GLY B C   1 
ATOM   5376  O  O   . GLY B  1 257 ? 2.623   127.577 -2.364  1.00 22.75  ? 288  GLY B O   1 
ATOM   5377  N  N   . GLN B  1 258 ? 3.572   125.872 -1.191  1.00 24.63  ? 289  GLN B N   1 
ATOM   5378  C  CA  . GLN B  1 258 ? 3.202   124.894 -2.215  1.00 22.88  ? 289  GLN B CA  1 
ATOM   5379  C  C   . GLN B  1 258 ? 1.695   124.678 -2.172  1.00 23.10  ? 289  GLN B C   1 
ATOM   5380  O  O   . GLN B  1 258 ? 1.041   124.875 -1.154  1.00 20.77  ? 289  GLN B O   1 
ATOM   5381  C  CB  . GLN B  1 258 ? 4.004   123.630 -2.012  1.00 23.10  ? 289  GLN B CB  1 
ATOM   5382  C  CG  . GLN B  1 258 ? 5.422   123.694 -2.567  1.00 24.99  ? 289  GLN B CG  1 
ATOM   5383  C  CD  . GLN B  1 258 ? 5.424   124.068 -4.035  1.00 25.89  ? 289  GLN B CD  1 
ATOM   5384  O  OE1 . GLN B  1 258 ? 5.248   123.214 -4.895  1.00 25.12  ? 289  GLN B OE1 1 
ATOM   5385  N  NE2 . GLN B  1 258 ? 5.620   125.357 -4.286  1.00 27.42  ? 289  GLN B NE2 1 
ATOM   5386  N  N   . PRO B  1 259 ? 1.076   124.353 -3.295  1.00 22.77  ? 290  PRO B N   1 
ATOM   5387  C  CA  . PRO B  1 259 ? -0.337  124.022 -3.331  1.00 22.44  ? 290  PRO B CA  1 
ATOM   5388  C  C   . PRO B  1 259 ? -0.633  122.789 -2.477  1.00 21.50  ? 290  PRO B C   1 
ATOM   5389  O  O   . PRO B  1 259 ? 0.278   122.054 -2.091  1.00 20.68  ? 290  PRO B O   1 
ATOM   5390  C  CB  . PRO B  1 259 ? -0.634  123.759 -4.796  1.00 22.18  ? 290  PRO B CB  1 
ATOM   5391  C  CG  . PRO B  1 259 ? 0.544   124.238 -5.551  1.00 21.24  ? 290  PRO B CG  1 
ATOM   5392  C  CD  . PRO B  1 259 ? 1.713   124.144 -4.616  1.00 23.08  ? 290  PRO B CD  1 
ATOM   5393  N  N   . CYS B  1 260 ? -1.920  122.578 -2.204  1.00 20.17  ? 291  CYS B N   1 
ATOM   5394  C  CA  . CYS B  1 260 ? -2.362  121.411 -1.436  1.00 18.70  ? 291  CYS B CA  1 
ATOM   5395  C  C   . CYS B  1 260 ? -2.434  120.208 -2.376  1.00 19.09  ? 291  CYS B C   1 
ATOM   5396  O  O   . CYS B  1 260 ? -2.606  120.411 -3.558  1.00 19.41  ? 291  CYS B O   1 
ATOM   5397  C  CB  . CYS B  1 260 ? -3.755  121.634 -0.861  1.00 17.58  ? 291  CYS B CB  1 
ATOM   5398  S  SG  . CYS B  1 260 ? -3.891  123.114 0.114   1.00 19.67  ? 291  CYS B SG  1 
ATOM   5399  N  N   . LYS B  1 261 ? -2.265  119.034 -1.812  1.00 19.15  ? 292  LYS B N   1 
ATOM   5400  C  CA  . LYS B  1 261 ? -2.409  117.841 -2.637  1.00 20.25  ? 292  LYS B CA  1 
ATOM   5401  C  C   . LYS B  1 261 ? -3.657  117.095 -2.197  1.00 22.67  ? 292  LYS B C   1 
ATOM   5402  O  O   . LYS B  1 261 ? -3.745  116.692 -1.043  1.00 26.27  ? 292  LYS B O   1 
ATOM   5403  C  CB  . LYS B  1 261 ? -1.168  116.967 -2.484  1.00 19.82  ? 292  LYS B CB  1 
ATOM   5404  C  CG  . LYS B  1 261 ? -1.165  115.692 -3.310  1.00 18.38  ? 292  LYS B CG  1 
ATOM   5405  C  CD  . LYS B  1 261 ? -1.758  115.911 -4.687  1.00 17.23  ? 292  LYS B CD  1 
ATOM   5406  C  CE  . LYS B  1 261 ? -0.792  115.585 -5.811  1.00 17.29  ? 292  LYS B CE  1 
ATOM   5407  N  NZ  . LYS B  1 261 ? -0.408  114.160 -5.846  1.00 17.83  ? 292  LYS B NZ  1 
ATOM   5408  N  N   . PHE B  1 262 ? -4.621  116.985 -3.118  1.00 20.19  ? 293  PHE B N   1 
ATOM   5409  C  CA  . PHE B  1 262 ? -5.843  116.284 -2.700  1.00 19.48  ? 293  PHE B CA  1 
ATOM   5410  C  C   . PHE B  1 262 ? -5.977  115.016 -3.529  1.00 18.80  ? 293  PHE B C   1 
ATOM   5411  O  O   . PHE B  1 262 ? -5.860  115.072 -4.769  1.00 20.37  ? 293  PHE B O   1 
ATOM   5412  C  CB  . PHE B  1 262 ? -7.089  117.157 -2.784  1.00 19.19  ? 293  PHE B CB  1 
ATOM   5413  C  CG  . PHE B  1 262 ? -7.060  118.456 -2.044  1.00 16.72  ? 293  PHE B CG  1 
ATOM   5414  C  CD1 . PHE B  1 262 ? -6.864  118.481 -0.678  1.00 15.54  ? 293  PHE B CD1 1 
ATOM   5415  C  CD2 . PHE B  1 262 ? -7.209  119.670 -2.701  1.00 15.91  ? 293  PHE B CD2 1 
ATOM   5416  C  CE1 . PHE B  1 262 ? -6.817  119.672 0.007   1.00 15.53  ? 293  PHE B CE1 1 
ATOM   5417  C  CE2 . PHE B  1 262 ? -7.167  120.874 -2.014  1.00 15.97  ? 293  PHE B CE2 1 
ATOM   5418  C  CZ  . PHE B  1 262 ? -7.001  120.856 -0.647  1.00 15.00  ? 293  PHE B CZ  1 
ATOM   5419  N  N   . PRO B  1 263 ? -6.332  113.904 -2.930  1.00 18.06  ? 294  PRO B N   1 
ATOM   5420  C  CA  . PRO B  1 263 ? -6.472  113.775 -1.489  1.00 17.79  ? 294  PRO B CA  1 
ATOM   5421  C  C   . PRO B  1 263 ? -5.122  113.564 -0.833  1.00 17.90  ? 294  PRO B C   1 
ATOM   5422  O  O   . PRO B  1 263 ? -4.197  113.006 -1.460  1.00 20.03  ? 294  PRO B O   1 
ATOM   5423  C  CB  . PRO B  1 263 ? -7.310  112.525 -1.340  1.00 17.50  ? 294  PRO B CB  1 
ATOM   5424  C  CG  . PRO B  1 263 ? -7.040  111.705 -2.546  1.00 16.01  ? 294  PRO B CG  1 
ATOM   5425  C  CD  . PRO B  1 263 ? -6.589  112.632 -3.625  1.00 16.70  ? 294  PRO B CD  1 
ATOM   5426  N  N   . PHE B  1 264 ? -4.956  114.056 0.367   1.00 17.79  ? 295  PHE B N   1 
ATOM   5427  C  CA  . PHE B  1 264 ? -3.705  113.811 1.075   1.00 17.49  ? 295  PHE B CA  1 
ATOM   5428  C  C   . PHE B  1 264 ? -4.021  112.980 2.303   1.00 18.08  ? 295  PHE B C   1 
ATOM   5429  O  O   . PHE B  1 264 ? -5.050  113.224 2.940   1.00 20.52  ? 295  PHE B O   1 
ATOM   5430  C  CB  . PHE B  1 264 ? -3.045  115.122 1.418   1.00 16.75  ? 295  PHE B CB  1 
ATOM   5431  C  CG  . PHE B  1 264 ? -3.772  115.887 2.491   1.00 17.90  ? 295  PHE B CG  1 
ATOM   5432  C  CD1 . PHE B  1 264 ? -3.522  115.631 3.825   1.00 17.22  ? 295  PHE B CD1 1 
ATOM   5433  C  CD2 . PHE B  1 264 ? -4.708  116.854 2.146   1.00 19.68  ? 295  PHE B CD2 1 
ATOM   5434  C  CE1 . PHE B  1 264 ? -4.174  116.316 4.787   1.00 16.92  ? 295  PHE B CE1 1 
ATOM   5435  C  CE2 . PHE B  1 264 ? -5.359  117.541 3.142   1.00 19.85  ? 295  PHE B CE2 1 
ATOM   5436  C  CZ  . PHE B  1 264 ? -5.115  117.296 4.467   1.00 19.41  ? 295  PHE B CZ  1 
ATOM   5437  N  N   . ARG B  1 265 ? -3.210  112.006 2.620   1.00 19.56  ? 296  ARG B N   1 
ATOM   5438  C  CA  . ARG B  1 265 ? -3.418  111.108 3.729   1.00 21.39  ? 296  ARG B CA  1 
ATOM   5439  C  C   . ARG B  1 265 ? -2.873  111.632 5.032   1.00 21.37  ? 296  ARG B C   1 
ATOM   5440  O  O   . ARG B  1 265 ? -1.711  111.879 5.191   1.00 22.69  ? 296  ARG B O   1 
ATOM   5441  C  CB  . ARG B  1 265 ? -2.870  109.717 3.427   1.00 24.07  ? 296  ARG B CB  1 
ATOM   5442  C  CG  . ARG B  1 265 ? -2.549  108.861 4.633   1.00 27.82  ? 296  ARG B CG  1 
ATOM   5443  C  CD  . ARG B  1 265 ? -2.503  107.382 4.292   1.00 33.02  ? 296  ARG B CD  1 
ATOM   5444  N  NE  . ARG B  1 265 ? -2.775  106.525 5.456   1.00 37.00  ? 296  ARG B NE  1 
ATOM   5445  C  CZ  . ARG B  1 265 ? -2.828  105.194 5.379   1.00 37.07  ? 296  ARG B CZ  1 
ATOM   5446  N  NH1 . ARG B  1 265 ? -2.623  104.623 4.197   1.00 38.96  ? 296  ARG B NH1 1 
ATOM   5447  N  NH2 . ARG B  1 265 ? -3.077  104.472 6.459   1.00 35.30  ? 296  ARG B NH2 1 
ATOM   5448  N  N   . PHE B  1 266 ? -3.754  111.751 6.021   1.00 20.21  ? 297  PHE B N   1 
ATOM   5449  C  CA  . PHE B  1 266 ? -3.325  112.068 7.374   1.00 20.30  ? 297  PHE B CA  1 
ATOM   5450  C  C   . PHE B  1 266 ? -3.819  110.920 8.267   1.00 20.69  ? 297  PHE B C   1 
ATOM   5451  O  O   . PHE B  1 266 ? -5.010  110.750 8.441   1.00 22.28  ? 297  PHE B O   1 
ATOM   5452  C  CB  . PHE B  1 266 ? -3.895  113.371 7.887   1.00 19.73  ? 297  PHE B CB  1 
ATOM   5453  C  CG  . PHE B  1 266 ? -3.486  113.664 9.307   1.00 18.00  ? 297  PHE B CG  1 
ATOM   5454  C  CD1 . PHE B  1 266 ? -2.221  113.419 9.767   1.00 17.72  ? 297  PHE B CD1 1 
ATOM   5455  C  CD2 . PHE B  1 266 ? -4.421  114.224 10.176  1.00 19.66  ? 297  PHE B CD2 1 
ATOM   5456  C  CE1 . PHE B  1 266 ? -1.873  113.681 11.071  1.00 16.44  ? 297  PHE B CE1 1 
ATOM   5457  C  CE2 . PHE B  1 266 ? -4.065  114.502 11.478  1.00 18.88  ? 297  PHE B CE2 1 
ATOM   5458  C  CZ  . PHE B  1 266 ? -2.794  114.236 11.926  1.00 16.31  ? 297  PHE B CZ  1 
ATOM   5459  N  N   . GLN B  1 267 ? -2.880  110.116 8.736   1.00 22.18  ? 298  GLN B N   1 
ATOM   5460  C  CA  . GLN B  1 267 ? -3.279  108.960 9.534   1.00 23.24  ? 298  GLN B CA  1 
ATOM   5461  C  C   . GLN B  1 267 ? -4.288  108.113 8.779   1.00 25.28  ? 298  GLN B C   1 
ATOM   5462  O  O   . GLN B  1 267 ? -4.235  108.013 7.554   1.00 27.13  ? 298  GLN B O   1 
ATOM   5463  C  CB  . GLN B  1 267 ? -3.830  109.406 10.880  1.00 22.15  ? 298  GLN B CB  1 
ATOM   5464  C  CG  . GLN B  1 267 ? -2.819  110.085 11.793  1.00 23.20  ? 298  GLN B CG  1 
ATOM   5465  C  CD  . GLN B  1 267 ? -1.570  109.274 12.001  1.00 23.82  ? 298  GLN B CD  1 
ATOM   5466  O  OE1 . GLN B  1 267 ? -1.580  108.207 12.600  1.00 24.24  ? 298  GLN B OE1 1 
ATOM   5467  N  NE2 . GLN B  1 267 ? -0.422  109.775 11.522  1.00 25.53  ? 298  GLN B NE2 1 
ATOM   5468  N  N   . GLY B  1 268 ? -5.258  107.525 9.454   1.00 26.21  ? 299  GLY B N   1 
ATOM   5469  C  CA  . GLY B  1 268 ? -6.267  106.694 8.861   1.00 28.81  ? 299  GLY B CA  1 
ATOM   5470  C  C   . GLY B  1 268 ? -7.304  107.366 8.012   1.00 31.43  ? 299  GLY B C   1 
ATOM   5471  O  O   . GLY B  1 268 ? -8.416  106.830 7.858   1.00 33.79  ? 299  GLY B O   1 
ATOM   5472  N  N   . THR B  1 269 ? -7.093  108.572 7.483   1.00 33.09  ? 300  THR B N   1 
ATOM   5473  C  CA  . THR B  1 269 ? -8.113  109.183 6.632   1.00 34.43  ? 300  THR B CA  1 
ATOM   5474  C  C   . THR B  1 269 ? -7.487  109.847 5.401   1.00 32.44  ? 300  THR B C   1 
ATOM   5475  O  O   . THR B  1 269 ? -6.375  110.377 5.533   1.00 32.77  ? 300  THR B O   1 
ATOM   5476  C  CB  . THR B  1 269 ? -8.899  110.264 7.391   1.00 39.36  ? 300  THR B CB  1 
ATOM   5477  O  OG1 . THR B  1 269 ? -9.203  109.844 8.716   1.00 46.74  ? 300  THR B OG1 1 
ATOM   5478  C  CG2 . THR B  1 269 ? -10.207 110.596 6.677   1.00 38.55  ? 300  THR B CG2 1 
ATOM   5479  N  N   . SER B  1 270 ? -8.231  109.855 4.318   1.00 29.14  ? 301  SER B N   1 
ATOM   5480  C  CA  . SER B  1 270 ? -7.855  110.532 3.091   1.00 25.29  ? 301  SER B CA  1 
ATOM   5481  C  C   . SER B  1 270 ? -8.652  111.839 2.965   1.00 25.69  ? 301  SER B C   1 
ATOM   5482  O  O   . SER B  1 270 ? -9.862  111.819 2.735   1.00 24.49  ? 301  SER B O   1 
ATOM   5483  C  CB  . SER B  1 270 ? -8.035  109.610 1.918   1.00 24.57  ? 301  SER B CB  1 
ATOM   5484  O  OG  . SER B  1 270 ? -7.639  110.104 0.683   1.00 21.57  ? 301  SER B OG  1 
ATOM   5485  N  N   . TYR B  1 271 ? -7.996  112.969 3.161   1.00 24.21  ? 302  TYR B N   1 
ATOM   5486  C  CA  . TYR B  1 271 ? -8.555  114.297 3.101   1.00 22.93  ? 302  TYR B CA  1 
ATOM   5487  C  C   . TYR B  1 271 ? -8.513  114.863 1.682   1.00 23.72  ? 302  TYR B C   1 
ATOM   5488  O  O   . TYR B  1 271 ? -7.432  114.904 1.103   1.00 25.15  ? 302  TYR B O   1 
ATOM   5489  C  CB  . TYR B  1 271 ? -7.814  115.291 4.022   1.00 21.48  ? 302  TYR B CB  1 
ATOM   5490  C  CG  . TYR B  1 271 ? -7.900  114.818 5.466   1.00 22.16  ? 302  TYR B CG  1 
ATOM   5491  C  CD1 . TYR B  1 271 ? -9.096  115.011 6.152   1.00 22.54  ? 302  TYR B CD1 1 
ATOM   5492  C  CD2 . TYR B  1 271 ? -6.868  114.192 6.134   1.00 22.50  ? 302  TYR B CD2 1 
ATOM   5493  C  CE1 . TYR B  1 271 ? -9.253  114.586 7.450   1.00 23.25  ? 302  TYR B CE1 1 
ATOM   5494  C  CE2 . TYR B  1 271 ? -7.025  113.774 7.441   1.00 23.81  ? 302  TYR B CE2 1 
ATOM   5495  C  CZ  . TYR B  1 271 ? -8.212  113.983 8.103   1.00 23.80  ? 302  TYR B CZ  1 
ATOM   5496  O  OH  . TYR B  1 271 ? -8.358  113.576 9.408   1.00 23.92  ? 302  TYR B OH  1 
ATOM   5497  N  N   . ASP B  1 272 ? -9.668  115.302 1.197   1.00 23.24  ? 303  ASP B N   1 
ATOM   5498  C  CA  . ASP B  1 272 ? -9.810  115.846 -0.132  1.00 21.14  ? 303  ASP B CA  1 
ATOM   5499  C  C   . ASP B  1 272 ? -9.943  117.364 -0.137  1.00 21.39  ? 303  ASP B C   1 
ATOM   5500  O  O   . ASP B  1 272 ? -10.342 117.946 -1.155  1.00 20.25  ? 303  ASP B O   1 
ATOM   5501  C  CB  . ASP B  1 272 ? -11.023 115.241 -0.841  1.00 22.43  ? 303  ASP B CB  1 
ATOM   5502  C  CG  . ASP B  1 272 ? -10.935 115.393 -2.351  1.00 24.97  ? 303  ASP B CG  1 
ATOM   5503  O  OD1 . ASP B  1 272 ? -9.856  115.097 -2.904  1.00 23.01  ? 303  ASP B OD1 1 
ATOM   5504  O  OD2 . ASP B  1 272 ? -11.943 115.805 -2.952  1.00 28.47  ? 303  ASP B OD2 1 
ATOM   5505  N  N   . SER B  1 273 ? -9.630  118.004 0.964   1.00 21.18  ? 304  SER B N   1 
ATOM   5506  C  CA  . SER B  1 273 ? -9.706  119.439 1.107   1.00 20.74  ? 304  SER B CA  1 
ATOM   5507  C  C   . SER B  1 273 ? -8.955  119.916 2.336   1.00 22.51  ? 304  SER B C   1 
ATOM   5508  O  O   . SER B  1 273 ? -8.686  119.098 3.198   1.00 23.79  ? 304  SER B O   1 
ATOM   5509  C  CB  . SER B  1 273 ? -11.162 119.882 1.374   1.00 18.08  ? 304  SER B CB  1 
ATOM   5510  O  OG  . SER B  1 273 ? -11.423 119.530 2.743   1.00 19.81  ? 304  SER B OG  1 
ATOM   5511  N  N   . CYS B  1 274 ? -8.642  121.210 2.445   1.00 23.44  ? 305  CYS B N   1 
ATOM   5512  C  CA  . CYS B  1 274 ? -8.137  121.619 3.748   1.00 23.12  ? 305  CYS B CA  1 
ATOM   5513  C  C   . CYS B  1 274 ? -9.134  121.301 4.854   1.00 21.87  ? 305  CYS B C   1 
ATOM   5514  O  O   . CYS B  1 274 ? -10.330 121.132 4.623   1.00 22.37  ? 305  CYS B O   1 
ATOM   5515  C  CB  . CYS B  1 274 ? -7.805  123.112 3.748   1.00 22.20  ? 305  CYS B CB  1 
ATOM   5516  S  SG  . CYS B  1 274 ? -6.443  123.575 2.654   1.00 29.97  ? 305  CYS B SG  1 
ATOM   5517  N  N   . THR B  1 275 ? -8.614  121.027 6.040   1.00 20.79  ? 306  THR B N   1 
ATOM   5518  C  CA  . THR B  1 275 ? -9.308  120.647 7.245   1.00 21.65  ? 306  THR B CA  1 
ATOM   5519  C  C   . THR B  1 275 ? -8.752  121.277 8.507   1.00 23.15  ? 306  THR B C   1 
ATOM   5520  O  O   . THR B  1 275 ? -7.690  121.879 8.420   1.00 23.66  ? 306  THR B O   1 
ATOM   5521  C  CB  . THR B  1 275 ? -9.266  119.101 7.420   1.00 21.98  ? 306  THR B CB  1 
ATOM   5522  O  OG1 . THR B  1 275 ? -10.046 118.714 8.561   1.00 20.55  ? 306  THR B OG1 1 
ATOM   5523  C  CG2 . THR B  1 275 ? -7.840  118.653 7.708   1.00 21.18  ? 306  THR B CG2 1 
ATOM   5524  N  N   . THR B  1 276 ? -9.399  121.057 9.640   1.00 24.25  ? 307  THR B N   1 
ATOM   5525  C  CA  . THR B  1 276 ? -8.832  121.461 10.911  1.00 24.56  ? 307  THR B CA  1 
ATOM   5526  C  C   . THR B  1 276 ? -8.471  120.287 11.823  1.00 25.08  ? 307  THR B C   1 
ATOM   5527  O  O   . THR B  1 276 ? -8.002  120.444 12.958  1.00 25.11  ? 307  THR B O   1 
ATOM   5528  C  CB  . THR B  1 276 ? -9.814  122.358 11.681  1.00 23.68  ? 307  THR B CB  1 
ATOM   5529  O  OG1 . THR B  1 276 ? -10.763 121.463 12.267  1.00 27.84  ? 307  THR B OG1 1 
ATOM   5530  C  CG2 . THR B  1 276 ? -10.485 123.357 10.768  1.00 20.75  ? 307  THR B CG2 1 
ATOM   5531  N  N   . GLU B  1 277 ? -8.628  119.078 11.281  1.00 25.50  ? 308  GLU B N   1 
ATOM   5532  C  CA  . GLU B  1 277 ? -8.303  117.877 12.018  1.00 27.34  ? 308  GLU B CA  1 
ATOM   5533  C  C   . GLU B  1 277 ? -6.910  118.033 12.614  1.00 27.37  ? 308  GLU B C   1 
ATOM   5534  O  O   . GLU B  1 277 ? -5.993  118.469 11.923  1.00 30.60  ? 308  GLU B O   1 
ATOM   5535  C  CB  . GLU B  1 277 ? -8.387  116.635 11.156  1.00 31.92  ? 308  GLU B CB  1 
ATOM   5536  C  CG  . GLU B  1 277 ? -7.990  115.362 11.904  1.00 37.07  ? 308  GLU B CG  1 
ATOM   5537  C  CD  . GLU B  1 277 ? -8.774  115.155 13.192  1.00 40.36  ? 308  GLU B CD  1 
ATOM   5538  O  OE1 . GLU B  1 277 ? -10.018 115.047 13.182  1.00 41.31  ? 308  GLU B OE1 1 
ATOM   5539  O  OE2 . GLU B  1 277 ? -8.098  115.102 14.244  1.00 43.18  ? 308  GLU B OE2 1 
ATOM   5540  N  N   . GLY B  1 278 ? -6.824  117.668 13.864  1.00 27.07  ? 309  GLY B N   1 
ATOM   5541  C  CA  . GLY B  1 278 ? -5.786  117.968 14.816  1.00 27.21  ? 309  GLY B CA  1 
ATOM   5542  C  C   . GLY B  1 278 ? -5.660  119.345 15.433  1.00 28.65  ? 309  GLY B C   1 
ATOM   5543  O  O   . GLY B  1 278 ? -5.014  119.526 16.467  1.00 29.99  ? 309  GLY B O   1 
ATOM   5544  N  N   . ARG B  1 279 ? -6.235  120.341 14.767  1.00 29.98  ? 310  ARG B N   1 
ATOM   5545  C  CA  . ARG B  1 279 ? -6.116  121.729 15.199  1.00 29.11  ? 310  ARG B CA  1 
ATOM   5546  C  C   . ARG B  1 279 ? -7.182  122.055 16.246  1.00 31.08  ? 310  ARG B C   1 
ATOM   5547  O  O   . ARG B  1 279 ? -8.321  121.616 16.148  1.00 32.10  ? 310  ARG B O   1 
ATOM   5548  C  CB  . ARG B  1 279 ? -6.265  122.703 14.042  1.00 27.10  ? 310  ARG B CB  1 
ATOM   5549  C  CG  . ARG B  1 279 ? -5.552  122.334 12.757  1.00 24.74  ? 310  ARG B CG  1 
ATOM   5550  C  CD  . ARG B  1 279 ? -4.099  122.769 12.894  1.00 24.35  ? 310  ARG B CD  1 
ATOM   5551  N  NE  . ARG B  1 279 ? -4.053  124.006 13.677  1.00 21.52  ? 310  ARG B NE  1 
ATOM   5552  C  CZ  . ARG B  1 279 ? -2.960  124.744 13.806  1.00 18.97  ? 310  ARG B CZ  1 
ATOM   5553  N  NH1 . ARG B  1 279 ? -1.843  124.381 13.218  1.00 15.70  ? 310  ARG B NH1 1 
ATOM   5554  N  NH2 . ARG B  1 279 ? -3.010  125.853 14.525  1.00 20.15  ? 310  ARG B NH2 1 
ATOM   5555  N  N   . THR B  1 280 ? -6.788  122.872 17.205  1.00 32.89  ? 311  THR B N   1 
ATOM   5556  C  CA  . THR B  1 280 ? -7.708  123.306 18.256  1.00 33.85  ? 311  THR B CA  1 
ATOM   5557  C  C   . THR B  1 280 ? -7.928  124.810 18.137  1.00 33.21  ? 311  THR B C   1 
ATOM   5558  O  O   . THR B  1 280 ? -8.685  125.401 18.898  1.00 34.85  ? 311  THR B O   1 
ATOM   5559  C  CB  . THR B  1 280 ? -7.141  122.934 19.631  1.00 35.16  ? 311  THR B CB  1 
ATOM   5560  O  OG1 . THR B  1 280 ? -8.147  122.956 20.636  1.00 37.52  ? 311  THR B OG1 1 
ATOM   5561  C  CG2 . THR B  1 280 ? -5.997  123.863 20.002  1.00 35.80  ? 311  THR B CG2 1 
ATOM   5562  N  N   . ASP B  1 281 ? -7.337  125.429 17.122  1.00 31.86  ? 312  ASP B N   1 
ATOM   5563  C  CA  . ASP B  1 281 ? -7.499  126.846 16.851  1.00 30.38  ? 312  ASP B CA  1 
ATOM   5564  C  C   . ASP B  1 281 ? -8.327  127.144 15.613  1.00 29.98  ? 312  ASP B C   1 
ATOM   5565  O  O   . ASP B  1 281 ? -8.431  128.266 15.130  1.00 28.74  ? 312  ASP B O   1 
ATOM   5566  C  CB  . ASP B  1 281 ? -6.136  127.503 16.720  1.00 31.09  ? 312  ASP B CB  1 
ATOM   5567  C  CG  . ASP B  1 281 ? -5.386  127.051 15.487  1.00 31.47  ? 312  ASP B CG  1 
ATOM   5568  O  OD1 . ASP B  1 281 ? -5.822  126.093 14.821  1.00 29.40  ? 312  ASP B OD1 1 
ATOM   5569  O  OD2 . ASP B  1 281 ? -4.344  127.695 15.202  1.00 30.91  ? 312  ASP B OD2 1 
ATOM   5570  N  N   . GLY B  1 282 ? -8.933  126.121 15.015  1.00 30.43  ? 313  GLY B N   1 
ATOM   5571  C  CA  . GLY B  1 282 ? -9.795  126.320 13.879  1.00 29.60  ? 313  GLY B CA  1 
ATOM   5572  C  C   . GLY B  1 282 ? -9.156  126.893 12.640  1.00 28.74  ? 313  GLY B C   1 
ATOM   5573  O  O   . GLY B  1 282 ? -9.871  127.543 11.859  1.00 30.12  ? 313  GLY B O   1 
ATOM   5574  N  N   . TYR B  1 283 ? -7.874  126.662 12.386  1.00 27.85  ? 314  TYR B N   1 
ATOM   5575  C  CA  . TYR B  1 283 ? -7.257  127.180 11.160  1.00 26.79  ? 314  TYR B CA  1 
ATOM   5576  C  C   . TYR B  1 283 ? -7.160  126.030 10.133  1.00 24.75  ? 314  TYR B C   1 
ATOM   5577  O  O   . TYR B  1 283 ? -6.545  125.050 10.508  1.00 24.74  ? 314  TYR B O   1 
ATOM   5578  C  CB  . TYR B  1 283 ? -5.851  127.724 11.465  1.00 29.26  ? 314  TYR B CB  1 
ATOM   5579  C  CG  . TYR B  1 283 ? -5.871  129.108 12.080  1.00 31.68  ? 314  TYR B CG  1 
ATOM   5580  C  CD1 . TYR B  1 283 ? -6.163  130.215 11.302  1.00 34.63  ? 314  TYR B CD1 1 
ATOM   5581  C  CD2 . TYR B  1 283 ? -5.614  129.341 13.414  1.00 33.32  ? 314  TYR B CD2 1 
ATOM   5582  C  CE1 . TYR B  1 283 ? -6.200  131.489 11.842  1.00 36.40  ? 314  TYR B CE1 1 
ATOM   5583  C  CE2 . TYR B  1 283 ? -5.647  130.604 13.974  1.00 34.29  ? 314  TYR B CE2 1 
ATOM   5584  C  CZ  . TYR B  1 283 ? -5.940  131.689 13.179  1.00 34.93  ? 314  TYR B CZ  1 
ATOM   5585  O  OH  . TYR B  1 283 ? -5.975  132.955 13.712  1.00 33.15  ? 314  TYR B OH  1 
ATOM   5586  N  N   . ARG B  1 284 ? -7.737  126.207 8.975   1.00 23.52  ? 315  ARG B N   1 
ATOM   5587  C  CA  . ARG B  1 284 ? -7.633  125.175 7.959   1.00 23.10  ? 315  ARG B CA  1 
ATOM   5588  C  C   . ARG B  1 284 ? -6.190  125.038 7.465   1.00 23.65  ? 315  ARG B C   1 
ATOM   5589  O  O   . ARG B  1 284 ? -5.536  126.030 7.198   1.00 25.86  ? 315  ARG B O   1 
ATOM   5590  C  CB  . ARG B  1 284 ? -8.496  125.476 6.749   1.00 21.22  ? 315  ARG B CB  1 
ATOM   5591  C  CG  . ARG B  1 284 ? -9.934  125.815 7.103   1.00 16.86  ? 315  ARG B CG  1 
ATOM   5592  C  CD  . ARG B  1 284 ? -10.780 125.280 5.945   1.00 19.15  ? 315  ARG B CD  1 
ATOM   5593  N  NE  . ARG B  1 284 ? -10.424 125.809 4.652   1.00 18.23  ? 315  ARG B NE  1 
ATOM   5594  C  CZ  . ARG B  1 284 ? -10.337 127.088 4.289   1.00 19.74  ? 315  ARG B CZ  1 
ATOM   5595  N  NH1 . ARG B  1 284 ? -10.559 128.069 5.152   1.00 19.85  ? 315  ARG B NH1 1 
ATOM   5596  N  NH2 . ARG B  1 284 ? -9.981  127.384 3.059   1.00 17.84  ? 315  ARG B NH2 1 
ATOM   5597  N  N   . TRP B  1 285 ? -5.747  123.796 7.365   1.00 22.31  ? 316  TRP B N   1 
ATOM   5598  C  CA  . TRP B  1 285 ? -4.433  123.421 6.891   1.00 18.98  ? 316  TRP B CA  1 
ATOM   5599  C  C   . TRP B  1 285 ? -4.555  122.173 5.998   1.00 16.90  ? 316  TRP B C   1 
ATOM   5600  O  O   . TRP B  1 285 ? -5.547  121.492 6.081   1.00 18.62  ? 316  TRP B O   1 
ATOM   5601  C  CB  . TRP B  1 285 ? -3.568  123.012 8.096   1.00 19.65  ? 316  TRP B CB  1 
ATOM   5602  C  CG  . TRP B  1 285 ? -3.987  121.695 8.689   1.00 19.47  ? 316  TRP B CG  1 
ATOM   5603  C  CD1 . TRP B  1 285 ? -4.957  121.504 9.632   1.00 19.55  ? 316  TRP B CD1 1 
ATOM   5604  C  CD2 . TRP B  1 285 ? -3.462  120.391 8.396   1.00 18.85  ? 316  TRP B CD2 1 
ATOM   5605  N  NE1 . TRP B  1 285 ? -5.078  120.177 9.936   1.00 19.56  ? 316  TRP B NE1 1 
ATOM   5606  C  CE2 . TRP B  1 285 ? -4.168  119.471 9.184   1.00 18.34  ? 316  TRP B CE2 1 
ATOM   5607  C  CE3 . TRP B  1 285 ? -2.488  119.923 7.516   1.00 16.34  ? 316  TRP B CE3 1 
ATOM   5608  C  CZ2 . TRP B  1 285 ? -3.908  118.100 9.138   1.00 16.74  ? 316  TRP B CZ2 1 
ATOM   5609  C  CZ3 . TRP B  1 285 ? -2.225  118.572 7.477   1.00 15.10  ? 316  TRP B CZ3 1 
ATOM   5610  C  CH2 . TRP B  1 285 ? -2.935  117.674 8.285   1.00 17.61  ? 316  TRP B CH2 1 
ATOM   5611  N  N   . CYS B  1 286 ? -3.585  121.970 5.133   1.00 15.78  ? 317  CYS B N   1 
ATOM   5612  C  CA  . CYS B  1 286 ? -3.666  120.808 4.259   1.00 16.14  ? 317  CYS B CA  1 
ATOM   5613  C  C   . CYS B  1 286 ? -2.299  120.163 4.071   1.00 15.50  ? 317  CYS B C   1 
ATOM   5614  O  O   . CYS B  1 286 ? -1.271  120.768 4.402   1.00 16.02  ? 317  CYS B O   1 
ATOM   5615  C  CB  . CYS B  1 286 ? -4.265  121.197 2.905   1.00 15.00  ? 317  CYS B CB  1 
ATOM   5616  S  SG  . CYS B  1 286 ? -3.269  122.372 1.959   1.00 15.00  ? 317  CYS B SG  1 
ATOM   5617  N  N   . GLY B  1 287 ? -2.307  118.967 3.563   1.00 16.43  ? 318  GLY B N   1 
ATOM   5618  C  CA  . GLY B  1 287 ? -1.115  118.226 3.232   1.00 16.77  ? 318  GLY B CA  1 
ATOM   5619  C  C   . GLY B  1 287 ? -0.661  118.721 1.843   1.00 18.69  ? 318  GLY B C   1 
ATOM   5620  O  O   . GLY B  1 287 ? -1.486  118.769 0.931   1.00 18.62  ? 318  GLY B O   1 
ATOM   5621  N  N   . THR B  1 288 ? 0.596   119.127 1.688   1.00 19.20  ? 319  THR B N   1 
ATOM   5622  C  CA  . THR B  1 288 ? 1.025   119.609 0.386   1.00 18.98  ? 319  THR B CA  1 
ATOM   5623  C  C   . THR B  1 288 ? 1.634   118.502 -0.446  1.00 20.35  ? 319  THR B C   1 
ATOM   5624  O  O   . THR B  1 288 ? 2.047   118.730 -1.562  1.00 20.19  ? 319  THR B O   1 
ATOM   5625  C  CB  . THR B  1 288 ? 2.048   120.751 0.559   1.00 15.62  ? 319  THR B CB  1 
ATOM   5626  O  OG1 . THR B  1 288 ? 3.016   120.289 1.507   1.00 15.08  ? 319  THR B OG1 1 
ATOM   5627  C  CG2 . THR B  1 288 ? 1.300   121.968 1.096   1.00 15.00  ? 319  THR B CG2 1 
ATOM   5628  N  N   . THR B  1 289 ? 1.603   117.326 0.137   1.00 22.04  ? 320  THR B N   1 
ATOM   5629  C  CA  . THR B  1 289 ? 2.167   116.113 -0.463  1.00 23.69  ? 320  THR B CA  1 
ATOM   5630  C  C   . THR B  1 289 ? 1.064   115.067 -0.472  1.00 23.03  ? 320  THR B C   1 
ATOM   5631  O  O   . THR B  1 289 ? -0.013  115.325 0.070   1.00 24.77  ? 320  THR B O   1 
ATOM   5632  C  CB  . THR B  1 289 ? 3.379   115.663 0.368   1.00 24.14  ? 320  THR B CB  1 
ATOM   5633  O  OG1 . THR B  1 289 ? 3.983   114.506 -0.189  1.00 30.96  ? 320  THR B OG1 1 
ATOM   5634  C  CG2 . THR B  1 289 ? 2.989   115.451 1.815   1.00 22.18  ? 320  THR B CG2 1 
ATOM   5635  N  N   . GLU B  1 290 ? 1.224   113.933 -1.122  1.00 20.95  ? 321  GLU B N   1 
ATOM   5636  C  CA  . GLU B  1 290 ? 0.140   112.932 -1.148  1.00 16.90  ? 321  GLU B CA  1 
ATOM   5637  C  C   . GLU B  1 290 ? -0.024  112.261 0.201   1.00 15.50  ? 321  GLU B C   1 
ATOM   5638  O  O   . GLU B  1 290 ? -1.059  111.663 0.561   1.00 15.59  ? 321  GLU B O   1 
ATOM   5639  C  CB  . GLU B  1 290 ? 0.543   111.820 -2.145  1.00 15.00  ? 321  GLU B CB  1 
ATOM   5640  C  CG  . GLU B  1 290 ? 0.096   112.153 -3.561  1.00 16.68  ? 321  GLU B CG  1 
ATOM   5641  C  CD  . GLU B  1 290 ? 0.351   111.002 -4.532  1.00 21.97  ? 321  GLU B CD  1 
ATOM   5642  O  OE1 . GLU B  1 290 ? 0.713   109.908 -4.037  1.00 23.52  ? 321  GLU B OE1 1 
ATOM   5643  O  OE2 . GLU B  1 290 ? 0.181   111.159 -5.763  1.00 19.76  ? 321  GLU B OE2 1 
ATOM   5644  N  N   . ASP B  1 291 ? 0.984   112.314 1.068   1.00 16.39  ? 322  ASP B N   1 
ATOM   5645  C  CA  . ASP B  1 291 ? 0.975   111.650 2.359   1.00 17.79  ? 322  ASP B CA  1 
ATOM   5646  C  C   . ASP B  1 291 ? 1.561   112.531 3.436   1.00 17.72  ? 322  ASP B C   1 
ATOM   5647  O  O   . ASP B  1 291 ? 2.753   112.738 3.577   1.00 16.71  ? 322  ASP B O   1 
ATOM   5648  C  CB  . ASP B  1 291 ? 1.758   110.343 2.268   1.00 18.81  ? 322  ASP B CB  1 
ATOM   5649  C  CG  . ASP B  1 291 ? 1.818   109.604 3.583   1.00 19.43  ? 322  ASP B CG  1 
ATOM   5650  O  OD1 . ASP B  1 291 ? 1.709   110.225 4.654   1.00 18.78  ? 322  ASP B OD1 1 
ATOM   5651  O  OD2 . ASP B  1 291 ? 1.967   108.370 3.530   1.00 16.75  ? 322  ASP B OD2 1 
ATOM   5652  N  N   . TYR B  1 292 ? 0.675   113.094 4.256   1.00 18.80  ? 323  TYR B N   1 
ATOM   5653  C  CA  . TYR B  1 292 ? 1.262   114.059 5.231   1.00 19.42  ? 323  TYR B CA  1 
ATOM   5654  C  C   . TYR B  1 292 ? 2.180   113.343 6.188   1.00 21.30  ? 323  TYR B C   1 
ATOM   5655  O  O   . TYR B  1 292 ? 3.282   113.776 6.503   1.00 22.94  ? 323  TYR B O   1 
ATOM   5656  C  CB  . TYR B  1 292 ? 0.117   114.764 5.988   1.00 17.49  ? 323  TYR B CB  1 
ATOM   5657  C  CG  . TYR B  1 292 ? 0.693   115.532 7.171   1.00 19.68  ? 323  TYR B CG  1 
ATOM   5658  C  CD1 . TYR B  1 292 ? 1.360   116.733 6.988   1.00 19.93  ? 323  TYR B CD1 1 
ATOM   5659  C  CD2 . TYR B  1 292 ? 0.595   115.029 8.455   1.00 21.09  ? 323  TYR B CD2 1 
ATOM   5660  C  CE1 . TYR B  1 292 ? 1.895   117.420 8.052   1.00 20.91  ? 323  TYR B CE1 1 
ATOM   5661  C  CE2 . TYR B  1 292 ? 1.134   115.707 9.528   1.00 22.80  ? 323  TYR B CE2 1 
ATOM   5662  C  CZ  . TYR B  1 292 ? 1.772   116.909 9.326   1.00 23.02  ? 323  TYR B CZ  1 
ATOM   5663  O  OH  . TYR B  1 292 ? 2.323   117.560 10.417  1.00 24.30  ? 323  TYR B OH  1 
ATOM   5664  N  N   . ASP B  1 293 ? 1.757   112.231 6.740   1.00 23.27  ? 324  ASP B N   1 
ATOM   5665  C  CA  . ASP B  1 293 ? 2.507   111.514 7.759   1.00 24.24  ? 324  ASP B CA  1 
ATOM   5666  C  C   . ASP B  1 293 ? 3.918   111.182 7.299   1.00 24.62  ? 324  ASP B C   1 
ATOM   5667  O  O   . ASP B  1 293 ? 4.865   111.374 8.054   1.00 24.83  ? 324  ASP B O   1 
ATOM   5668  C  CB  . ASP B  1 293 ? 1.774   110.197 8.066   1.00 24.65  ? 324  ASP B CB  1 
ATOM   5669  C  CG  . ASP B  1 293 ? 0.487   110.451 8.792   1.00 24.79  ? 324  ASP B CG  1 
ATOM   5670  O  OD1 . ASP B  1 293 ? 0.536   111.242 9.779   1.00 23.68  ? 324  ASP B OD1 1 
ATOM   5671  O  OD2 . ASP B  1 293 ? -0.578  109.915 8.443   1.00 26.16  ? 324  ASP B OD2 1 
ATOM   5672  N  N   . ARG B  1 294 ? 4.066   110.778 6.055   1.00 25.31  ? 325  ARG B N   1 
ATOM   5673  C  CA  . ARG B  1 294 ? 5.321   110.414 5.464   1.00 27.17  ? 325  ARG B CA  1 
ATOM   5674  C  C   . ARG B  1 294 ? 6.231   111.599 5.163   1.00 27.06  ? 325  ARG B C   1 
ATOM   5675  O  O   . ARG B  1 294 ? 7.410   111.548 5.474   1.00 27.95  ? 325  ARG B O   1 
ATOM   5676  C  CB  . ARG B  1 294 ? 5.091   109.612 4.180   1.00 29.74  ? 325  ARG B CB  1 
ATOM   5677  C  CG  . ARG B  1 294 ? 6.389   109.170 3.518   1.00 35.05  ? 325  ARG B CG  1 
ATOM   5678  C  CD  . ARG B  1 294 ? 6.122   107.977 2.606   1.00 40.63  ? 325  ARG B CD  1 
ATOM   5679  N  NE  . ARG B  1 294 ? 5.194   108.334 1.539   1.00 46.25  ? 325  ARG B NE  1 
ATOM   5680  C  CZ  . ARG B  1 294 ? 5.440   109.250 0.612   1.00 50.44  ? 325  ARG B CZ  1 
ATOM   5681  N  NH1 . ARG B  1 294 ? 6.598   109.914 0.603   1.00 52.50  ? 325  ARG B NH1 1 
ATOM   5682  N  NH2 . ARG B  1 294 ? 4.542   109.521 -0.322  1.00 52.41  ? 325  ARG B NH2 1 
ATOM   5683  N  N   . ASP B  1 295 ? 5.725   112.571 4.421   1.00 26.88  ? 326  ASP B N   1 
ATOM   5684  C  CA  . ASP B  1 295 ? 6.471   113.721 3.967   1.00 26.82  ? 326  ASP B CA  1 
ATOM   5685  C  C   . ASP B  1 295 ? 6.496   114.866 4.968   1.00 28.88  ? 326  ASP B C   1 
ATOM   5686  O  O   . ASP B  1 295 ? 7.327   115.785 4.858   1.00 29.71  ? 326  ASP B O   1 
ATOM   5687  C  CB  . ASP B  1 295 ? 5.894   114.225 2.637   1.00 26.15  ? 326  ASP B CB  1 
ATOM   5688  C  CG  . ASP B  1 295 ? 5.899   113.139 1.570   1.00 26.64  ? 326  ASP B CG  1 
ATOM   5689  O  OD1 . ASP B  1 295 ? 6.999   112.778 1.125   1.00 30.80  ? 326  ASP B OD1 1 
ATOM   5690  O  OD2 . ASP B  1 295 ? 4.810   112.673 1.201   1.00 28.25  ? 326  ASP B OD2 1 
ATOM   5691  N  N   . LYS B  1 296 ? 5.550   114.909 5.873   1.00 30.52  ? 327  LYS B N   1 
ATOM   5692  C  CA  . LYS B  1 296 ? 5.398   115.918 6.885   1.00 30.33  ? 327  LYS B CA  1 
ATOM   5693  C  C   . LYS B  1 296 ? 5.406   117.357 6.405   1.00 30.97  ? 327  LYS B C   1 
ATOM   5694  O  O   . LYS B  1 296 ? 5.507   118.269 7.243   1.00 31.17  ? 327  LYS B O   1 
ATOM   5695  C  CB  . LYS B  1 296 ? 6.413   115.721 8.007   1.00 29.09  ? 327  LYS B CB  1 
ATOM   5696  C  CG  . LYS B  1 296 ? 6.268   114.424 8.760   1.00 30.34  ? 327  LYS B CG  1 
ATOM   5697  C  CD  . LYS B  1 296 ? 7.490   114.080 9.588   1.00 34.40  ? 327  LYS B CD  1 
ATOM   5698  C  CE  . LYS B  1 296 ? 8.477   113.214 8.825   1.00 34.79  ? 327  LYS B CE  1 
ATOM   5699  N  NZ  . LYS B  1 296 ? 8.078   111.767 8.777   1.00 31.35  ? 327  LYS B NZ  1 
ATOM   5700  N  N   . LYS B  1 297 ? 5.156   117.603 5.120   1.00 30.46  ? 328  LYS B N   1 
ATOM   5701  C  CA  . LYS B  1 297 ? 5.045   118.937 4.576   1.00 30.32  ? 328  LYS B CA  1 
ATOM   5702  C  C   . LYS B  1 297 ? 3.572   119.367 4.552   1.00 30.39  ? 328  LYS B C   1 
ATOM   5703  O  O   . LYS B  1 297 ? 2.692   118.594 4.156   1.00 30.10  ? 328  LYS B O   1 
ATOM   5704  C  CB  . LYS B  1 297 ? 5.621   119.050 3.174   1.00 31.90  ? 328  LYS B CB  1 
ATOM   5705  C  CG  . LYS B  1 297 ? 7.085   118.705 3.022   1.00 33.42  ? 328  LYS B CG  1 
ATOM   5706  C  CD  . LYS B  1 297 ? 8.001   119.613 3.817   1.00 33.53  ? 328  LYS B CD  1 
ATOM   5707  C  CE  . LYS B  1 297 ? 9.280   119.923 3.082   1.00 32.54  ? 328  LYS B CE  1 
ATOM   5708  N  NZ  . LYS B  1 297 ? 9.242   121.223 2.372   1.00 32.52  ? 328  LYS B NZ  1 
ATOM   5709  N  N   . TYR B  1 298 ? 3.303   120.609 4.922   1.00 30.36  ? 329  TYR B N   1 
ATOM   5710  C  CA  . TYR B  1 298 ? 1.929   121.097 4.982   1.00 29.24  ? 329  TYR B CA  1 
ATOM   5711  C  C   . TYR B  1 298 ? 1.961   122.635 4.950   1.00 29.49  ? 329  TYR B C   1 
ATOM   5712  O  O   . TYR B  1 298 ? 3.033   123.220 5.126   1.00 29.34  ? 329  TYR B O   1 
ATOM   5713  C  CB  . TYR B  1 298 ? 1.266   120.694 6.311   1.00 28.66  ? 329  TYR B CB  1 
ATOM   5714  C  CG  . TYR B  1 298 ? 1.921   121.468 7.450   1.00 27.11  ? 329  TYR B CG  1 
ATOM   5715  C  CD1 . TYR B  1 298 ? 3.230   121.178 7.802   1.00 28.27  ? 329  TYR B CD1 1 
ATOM   5716  C  CD2 . TYR B  1 298 ? 1.273   122.479 8.128   1.00 27.47  ? 329  TYR B CD2 1 
ATOM   5717  C  CE1 . TYR B  1 298 ? 3.859   121.858 8.826   1.00 29.19  ? 329  TYR B CE1 1 
ATOM   5718  C  CE2 . TYR B  1 298 ? 1.904   123.187 9.143   1.00 27.93  ? 329  TYR B CE2 1 
ATOM   5719  C  CZ  . TYR B  1 298 ? 3.198   122.863 9.480   1.00 28.54  ? 329  TYR B CZ  1 
ATOM   5720  O  OH  . TYR B  1 298 ? 3.842   123.550 10.493  1.00 29.33  ? 329  TYR B OH  1 
ATOM   5721  N  N   . GLY B  1 299 ? 0.775   123.197 4.852   1.00 28.73  ? 330  GLY B N   1 
ATOM   5722  C  CA  . GLY B  1 299 ? 0.617   124.657 4.788   1.00 28.57  ? 330  GLY B CA  1 
ATOM   5723  C  C   . GLY B  1 299 ? -0.803  125.039 5.187   1.00 26.54  ? 330  GLY B C   1 
ATOM   5724  O  O   . GLY B  1 299 ? -1.621  124.123 5.297   1.00 29.06  ? 330  GLY B O   1 
ATOM   5725  N  N   . PHE B  1 300 ? -1.161  126.290 5.300   1.00 23.85  ? 331  PHE B N   1 
ATOM   5726  C  CA  . PHE B  1 300 ? -2.477  126.706 5.686   1.00 23.40  ? 331  PHE B CA  1 
ATOM   5727  C  C   . PHE B  1 300 ? -3.305  127.254 4.530   1.00 24.03  ? 331  PHE B C   1 
ATOM   5728  O  O   . PHE B  1 300 ? -2.857  127.532 3.435   1.00 25.99  ? 331  PHE B O   1 
ATOM   5729  C  CB  . PHE B  1 300 ? -2.426  127.781 6.774   1.00 20.01  ? 331  PHE B CB  1 
ATOM   5730  C  CG  . PHE B  1 300 ? -1.832  127.244 8.046   1.00 18.29  ? 331  PHE B CG  1 
ATOM   5731  C  CD1 . PHE B  1 300 ? -0.466  127.197 8.246   1.00 16.95  ? 331  PHE B CD1 1 
ATOM   5732  C  CD2 . PHE B  1 300 ? -2.641  126.771 9.067   1.00 19.55  ? 331  PHE B CD2 1 
ATOM   5733  C  CE1 . PHE B  1 300 ? 0.050   126.685 9.415   1.00 17.45  ? 331  PHE B CE1 1 
ATOM   5734  C  CE2 . PHE B  1 300 ? -2.113  126.299 10.235  1.00 15.91  ? 331  PHE B CE2 1 
ATOM   5735  C  CZ  . PHE B  1 300 ? -0.762  126.256 10.442  1.00 15.00  ? 331  PHE B CZ  1 
ATOM   5736  N  N   . CYS B  1 301 ? -4.588  127.456 4.814   1.00 24.25  ? 332  CYS B N   1 
ATOM   5737  C  CA  . CYS B  1 301 ? -5.573  127.894 3.826   1.00 23.83  ? 332  CYS B CA  1 
ATOM   5738  C  C   . CYS B  1 301 ? -6.425  128.978 4.483   1.00 23.20  ? 332  CYS B C   1 
ATOM   5739  O  O   . CYS B  1 301 ? -7.541  128.690 4.856   1.00 23.72  ? 332  CYS B O   1 
ATOM   5740  C  CB  . CYS B  1 301 ? -6.493  126.725 3.453   1.00 25.80  ? 332  CYS B CB  1 
ATOM   5741  S  SG  . CYS B  1 301 ? -5.594  125.191 3.389   1.00 24.61  ? 332  CYS B SG  1 
ATOM   5742  N  N   . PRO B  1 302 ? -5.866  130.167 4.588   1.00 21.95  ? 333  PRO B N   1 
ATOM   5743  C  CA  . PRO B  1 302 ? -6.503  131.266 5.286   1.00 20.20  ? 333  PRO B CA  1 
ATOM   5744  C  C   . PRO B  1 302 ? -7.802  131.729 4.673   1.00 19.76  ? 333  PRO B C   1 
ATOM   5745  O  O   . PRO B  1 302 ? -8.662  132.367 5.302   1.00 18.37  ? 333  PRO B O   1 
ATOM   5746  C  CB  . PRO B  1 302 ? -5.456  132.365 5.273   1.00 21.32  ? 333  PRO B CB  1 
ATOM   5747  C  CG  . PRO B  1 302 ? -4.153  131.721 4.975   1.00 20.04  ? 333  PRO B CG  1 
ATOM   5748  C  CD  . PRO B  1 302 ? -4.498  130.535 4.130   1.00 21.68  ? 333  PRO B CD  1 
ATOM   5749  N  N   . GLU B  1 303 ? -7.970  131.472 3.371   1.00 20.51  ? 334  GLU B N   1 
ATOM   5750  C  CA  . GLU B  1 303 ? -9.210  131.958 2.738   1.00 24.46  ? 334  GLU B CA  1 
ATOM   5751  C  C   . GLU B  1 303 ? -9.388  131.290 1.397   1.00 25.13  ? 334  GLU B C   1 
ATOM   5752  O  O   . GLU B  1 303 ? -8.381  130.931 0.780   1.00 26.17  ? 334  GLU B O   1 
ATOM   5753  C  CB  . GLU B  1 303 ? -9.113  133.476 2.517   1.00 28.46  ? 334  GLU B CB  1 
ATOM   5754  C  CG  . GLU B  1 303 ? -10.109 134.102 1.562   1.00 35.50  ? 334  GLU B CG  1 
ATOM   5755  C  CD  . GLU B  1 303 ? -9.777  135.553 1.251   1.00 39.94  ? 334  GLU B CD  1 
ATOM   5756  O  OE1 . GLU B  1 303 ? -8.592  135.922 1.414   1.00 44.47  ? 334  GLU B OE1 1 
ATOM   5757  O  OE2 . GLU B  1 303 ? -10.671 136.319 0.857   1.00 38.71  ? 334  GLU B OE2 1 
ATOM   5758  N  N   . THR B  1 304 ? -10.596 131.246 0.872   1.00 24.74  ? 335  THR B N   1 
ATOM   5759  C  CA  . THR B  1 304 ? -10.673 130.770 -0.502  1.00 25.04  ? 335  THR B CA  1 
ATOM   5760  C  C   . THR B  1 304 ? -11.328 131.766 -1.415  1.00 26.28  ? 335  THR B C   1 
ATOM   5761  O  O   . THR B  1 304 ? -12.410 132.304 -1.142  1.00 25.54  ? 335  THR B O   1 
ATOM   5762  C  CB  . THR B  1 304 ? -11.291 129.377 -0.554  1.00 23.19  ? 335  THR B CB  1 
ATOM   5763  O  OG1 . THR B  1 304 ? -10.501 128.497 0.229   1.00 21.19  ? 335  THR B OG1 1 
ATOM   5764  C  CG2 . THR B  1 304 ? -11.379 128.864 -1.959  1.00 22.93  ? 335  THR B CG2 1 
ATOM   5765  N  N   . ALA B  1 305 ? -10.764 131.962 -2.601  1.00 27.51  ? 336  ALA B N   1 
ATOM   5766  C  CA  . ALA B  1 305 ? -11.292 132.881 -3.586  1.00 28.97  ? 336  ALA B CA  1 
ATOM   5767  C  C   . ALA B  1 305 ? -12.401 132.113 -4.330  1.00 32.61  ? 336  ALA B C   1 
ATOM   5768  O  O   . ALA B  1 305 ? -12.101 131.018 -4.806  1.00 34.78  ? 336  ALA B O   1 
ATOM   5769  C  CB  . ALA B  1 305 ? -10.292 133.150 -4.685  1.00 25.86  ? 336  ALA B CB  1 
ATOM   5770  N  N   . MET B  1 306 ? -13.560 132.701 -4.416  1.00 35.34  ? 337  MET B N   1 
ATOM   5771  C  CA  . MET B  1 306 ? -14.661 132.060 -5.145  1.00 36.47  ? 337  MET B CA  1 
ATOM   5772  C  C   . MET B  1 306 ? -14.973 132.950 -6.340  1.00 35.74  ? 337  MET B C   1 
ATOM   5773  O  O   . MET B  1 306 ? -14.810 134.173 -6.279  1.00 37.36  ? 337  MET B O   1 
ATOM   5774  C  CB  . MET B  1 306 ? -15.819 131.892 -4.175  1.00 39.47  ? 337  MET B CB  1 
ATOM   5775  C  CG  . MET B  1 306 ? -16.386 130.492 -4.136  1.00 46.90  ? 337  MET B CG  1 
ATOM   5776  S  SD  . MET B  1 306 ? -15.646 129.343 -2.980  1.00 54.44  ? 337  MET B SD  1 
ATOM   5777  C  CE  . MET B  1 306 ? -14.118 128.905 -3.802  1.00 51.57  ? 337  MET B CE  1 
ATOM   5778  N  N   . SER B  1 307 ? -15.257 132.359 -7.483  1.00 33.95  ? 338  SER B N   1 
ATOM   5779  C  CA  . SER B  1 307 ? -15.606 133.148 -8.669  1.00 32.85  ? 338  SER B CA  1 
ATOM   5780  C  C   . SER B  1 307 ? -17.086 132.857 -8.984  1.00 33.02  ? 338  SER B C   1 
ATOM   5781  O  O   . SER B  1 307 ? -17.721 133.538 -9.769  1.00 34.07  ? 338  SER B O   1 
ATOM   5782  C  CB  . SER B  1 307 ? -14.772 132.691 -9.857  1.00 32.64  ? 338  SER B CB  1 
ATOM   5783  O  OG  . SER B  1 307 ? -14.298 133.802 -10.603 1.00 33.20  ? 338  SER B OG  1 
ATOM   5784  N  N   . THR B  1 308 ? -17.545 131.787 -8.368  1.00 31.66  ? 339  THR B N   1 
ATOM   5785  C  CA  . THR B  1 308 ? -18.900 131.268 -8.494  1.00 29.81  ? 339  THR B CA  1 
ATOM   5786  C  C   . THR B  1 308 ? -19.180 130.521 -7.192  1.00 30.11  ? 339  THR B C   1 
ATOM   5787  O  O   . THR B  1 308 ? -18.220 130.077 -6.554  1.00 32.03  ? 339  THR B O   1 
ATOM   5788  C  CB  . THR B  1 308 ? -18.992 130.294 -9.665  1.00 29.60  ? 339  THR B CB  1 
ATOM   5789  O  OG1 . THR B  1 308 ? -20.210 130.501 -10.374 1.00 30.38  ? 339  THR B OG1 1 
ATOM   5790  C  CG2 . THR B  1 308 ? -18.910 128.848 -9.218  1.00 28.17  ? 339  THR B CG2 1 
ATOM   5791  N  N   . VAL B  1 309 ? -20.423 130.417 -6.773  1.00 29.10  ? 340  VAL B N   1 
ATOM   5792  C  CA  . VAL B  1 309 ? -20.692 129.759 -5.499  1.00 29.25  ? 340  VAL B CA  1 
ATOM   5793  C  C   . VAL B  1 309 ? -21.597 128.563 -5.645  1.00 31.03  ? 340  VAL B C   1 
ATOM   5794  O  O   . VAL B  1 309 ? -22.518 128.545 -6.458  1.00 31.79  ? 340  VAL B O   1 
ATOM   5795  C  CB  . VAL B  1 309 ? -21.325 130.744 -4.501  1.00 27.93  ? 340  VAL B CB  1 
ATOM   5796  C  CG1 . VAL B  1 309 ? -21.893 129.999 -3.303  1.00 28.94  ? 340  VAL B CG1 1 
ATOM   5797  C  CG2 . VAL B  1 309 ? -20.264 131.721 -4.022  1.00 29.03  ? 340  VAL B CG2 1 
ATOM   5798  N  N   . GLY B  1 310 ? -21.407 127.576 -4.758  1.00 32.00  ? 341  GLY B N   1 
ATOM   5799  C  CA  . GLY B  1 310 ? -22.373 126.472 -4.849  1.00 33.98  ? 341  GLY B CA  1 
ATOM   5800  C  C   . GLY B  1 310 ? -22.371 125.966 -6.312  1.00 35.09  ? 341  GLY B C   1 
ATOM   5801  O  O   . GLY B  1 310 ? -21.355 126.168 -7.007  1.00 37.32  ? 341  GLY B O   1 
ATOM   5802  N  N   . GLY B  1 311 ? -23.143 124.906 -6.477  1.00 33.81  ? 342  GLY B N   1 
ATOM   5803  C  CA  . GLY B  1 311 ? -23.208 124.239 -7.759  1.00 33.69  ? 342  GLY B CA  1 
ATOM   5804  C  C   . GLY B  1 311 ? -22.280 123.030 -7.771  1.00 33.71  ? 342  GLY B C   1 
ATOM   5805  O  O   . GLY B  1 311 ? -21.851 122.585 -6.713  1.00 32.96  ? 342  GLY B O   1 
ATOM   5806  N  N   . ASN B  1 312 ? -22.026 122.537 -8.969  1.00 34.11  ? 343  ASN B N   1 
ATOM   5807  C  CA  . ASN B  1 312 ? -21.148 121.402 -9.169  1.00 35.13  ? 343  ASN B CA  1 
ATOM   5808  C  C   . ASN B  1 312 ? -19.824 121.909 -9.734  1.00 36.46  ? 343  ASN B C   1 
ATOM   5809  O  O   . ASN B  1 312 ? -18.834 121.199 -9.783  1.00 36.96  ? 343  ASN B O   1 
ATOM   5810  C  CB  . ASN B  1 312 ? -21.762 120.408 -10.150 1.00 36.21  ? 343  ASN B CB  1 
ATOM   5811  C  CG  . ASN B  1 312 ? -22.230 121.064 -11.428 1.00 37.11  ? 343  ASN B CG  1 
ATOM   5812  O  OD1 . ASN B  1 312 ? -21.726 122.107 -11.830 1.00 39.39  ? 343  ASN B OD1 1 
ATOM   5813  N  ND2 . ASN B  1 312 ? -23.214 120.440 -12.059 1.00 38.22  ? 343  ASN B ND2 1 
ATOM   5814  N  N   . SER B  1 313 ? -19.825 123.178 -10.143 1.00 38.32  ? 344  SER B N   1 
ATOM   5815  C  CA  . SER B  1 313 ? -18.584 123.749 -10.678 1.00 39.39  ? 344  SER B CA  1 
ATOM   5816  C  C   . SER B  1 313 ? -17.671 124.156 -9.525  1.00 41.06  ? 344  SER B C   1 
ATOM   5817  O  O   . SER B  1 313 ? -16.606 124.718 -9.742  1.00 37.78  ? 344  SER B O   1 
ATOM   5818  C  CB  . SER B  1 313 ? -18.882 124.947 -11.565 1.00 39.32  ? 344  SER B CB  1 
ATOM   5819  O  OG  . SER B  1 313 ? -19.774 124.554 -12.595 1.00 38.79  ? 344  SER B OG  1 
ATOM   5820  N  N   . GLU B  1 314 ? -18.147 123.903 -8.313  1.00 44.20  ? 345  GLU B N   1 
ATOM   5821  C  CA  . GLU B  1 314 ? -17.482 124.225 -7.074  1.00 46.02  ? 345  GLU B CA  1 
ATOM   5822  C  C   . GLU B  1 314 ? -16.044 124.615 -7.327  1.00 42.52  ? 345  GLU B C   1 
ATOM   5823  O  O   . GLU B  1 314 ? -15.158 123.749 -7.378  1.00 43.76  ? 345  GLU B O   1 
ATOM   5824  C  CB  . GLU B  1 314 ? -17.803 123.235 -5.979  1.00 51.06  ? 345  GLU B CB  1 
ATOM   5825  C  CG  . GLU B  1 314 ? -19.189 123.406 -5.396  1.00 60.35  ? 345  GLU B CG  1 
ATOM   5826  C  CD  . GLU B  1 314 ? -19.431 124.828 -4.952  1.00 68.22  ? 345  GLU B CD  1 
ATOM   5827  O  OE1 . GLU B  1 314 ? -18.603 125.348 -4.176  1.00 71.74  ? 345  GLU B OE1 1 
ATOM   5828  O  OE2 . GLU B  1 314 ? -20.437 125.423 -5.381  1.00 72.90  ? 345  GLU B OE2 1 
ATOM   5829  N  N   . GLY B  1 315 ? -15.971 125.943 -7.469  1.00 39.33  ? 346  GLY B N   1 
ATOM   5830  C  CA  . GLY B  1 315 ? -14.923 126.857 -7.721  1.00 38.59  ? 346  GLY B CA  1 
ATOM   5831  C  C   . GLY B  1 315 ? -15.190 127.724 -8.966  1.00 37.98  ? 346  GLY B C   1 
ATOM   5832  O  O   . GLY B  1 315 ? -15.595 128.884 -8.857  1.00 36.07  ? 346  GLY B O   1 
ATOM   5833  N  N   . ALA B  1 316 ? -14.969 127.091 -10.096 1.00 38.60  ? 347  ALA B N   1 
ATOM   5834  C  CA  . ALA B  1 316 ? -15.038 127.661 -11.439 1.00 38.25  ? 347  ALA B CA  1 
ATOM   5835  C  C   . ALA B  1 316 ? -15.897 128.879 -11.674 1.00 38.96  ? 347  ALA B C   1 
ATOM   5836  O  O   . ALA B  1 316 ? -17.041 128.999 -11.252 1.00 38.88  ? 347  ALA B O   1 
ATOM   5837  C  CB  . ALA B  1 316 ? -15.483 126.607 -12.441 1.00 39.92  ? 347  ALA B CB  1 
ATOM   5838  N  N   . PRO B  1 317 ? -15.363 129.810 -12.465 1.00 39.01  ? 348  PRO B N   1 
ATOM   5839  C  CA  . PRO B  1 317 ? -16.018 131.035 -12.874 1.00 39.49  ? 348  PRO B CA  1 
ATOM   5840  C  C   . PRO B  1 317 ? -17.073 130.749 -13.944 1.00 41.08  ? 348  PRO B C   1 
ATOM   5841  O  O   . PRO B  1 317 ? -17.194 129.619 -14.410 1.00 42.41  ? 348  PRO B O   1 
ATOM   5842  C  CB  . PRO B  1 317 ? -14.912 131.877 -13.490 1.00 38.92  ? 348  PRO B CB  1 
ATOM   5843  C  CG  . PRO B  1 317 ? -13.816 130.952 -13.834 1.00 39.62  ? 348  PRO B CG  1 
ATOM   5844  C  CD  . PRO B  1 317 ? -14.017 129.694 -13.062 1.00 39.09  ? 348  PRO B CD  1 
ATOM   5845  N  N   . CYS B  1 318 ? -17.776 131.784 -14.400 1.00 40.65  ? 349  CYS B N   1 
ATOM   5846  C  CA  . CYS B  1 318 ? -18.737 131.575 -15.477 1.00 41.52  ? 349  CYS B CA  1 
ATOM   5847  C  C   . CYS B  1 318 ? -18.051 131.644 -16.843 1.00 43.96  ? 349  CYS B C   1 
ATOM   5848  O  O   . CYS B  1 318 ? -16.877 131.988 -16.956 1.00 44.90  ? 349  CYS B O   1 
ATOM   5849  C  CB  . CYS B  1 318 ? -19.888 132.554 -15.457 1.00 38.55  ? 349  CYS B CB  1 
ATOM   5850  S  SG  . CYS B  1 318 ? -20.538 132.961 -13.837 1.00 39.12  ? 349  CYS B SG  1 
ATOM   5851  N  N   . VAL B  1 319 ? -18.811 131.294 -17.869 1.00 45.87  ? 350  VAL B N   1 
ATOM   5852  C  CA  . VAL B  1 319 ? -18.350 131.315 -19.249 1.00 46.75  ? 350  VAL B CA  1 
ATOM   5853  C  C   . VAL B  1 319 ? -19.473 131.873 -20.125 1.00 47.97  ? 350  VAL B C   1 
ATOM   5854  O  O   . VAL B  1 319 ? -20.589 131.355 -20.143 1.00 47.71  ? 350  VAL B O   1 
ATOM   5855  C  CB  . VAL B  1 319 ? -17.993 129.916 -19.778 1.00 46.38  ? 350  VAL B CB  1 
ATOM   5856  C  CG1 . VAL B  1 319 ? -16.781 129.336 -19.088 1.00 46.81  ? 350  VAL B CG1 1 
ATOM   5857  C  CG2 . VAL B  1 319 ? -19.208 129.017 -19.639 1.00 46.88  ? 350  VAL B CG2 1 
ATOM   5858  N  N   . PHE B  1 320 ? -19.195 132.998 -20.774 1.00 49.79  ? 351  PHE B N   1 
ATOM   5859  C  CA  . PHE B  1 320 ? -20.232 133.615 -21.598 1.00 51.92  ? 351  PHE B CA  1 
ATOM   5860  C  C   . PHE B  1 320 ? -19.765 133.756 -23.039 1.00 52.58  ? 351  PHE B C   1 
ATOM   5861  O  O   . PHE B  1 320 ? -18.639 134.181 -23.285 1.00 53.31  ? 351  PHE B O   1 
ATOM   5862  C  CB  . PHE B  1 320 ? -20.632 134.983 -21.051 1.00 52.85  ? 351  PHE B CB  1 
ATOM   5863  C  CG  . PHE B  1 320 ? -21.092 134.971 -19.622 1.00 53.32  ? 351  PHE B CG  1 
ATOM   5864  C  CD1 . PHE B  1 320 ? -22.171 134.188 -19.252 1.00 52.89  ? 351  PHE B CD1 1 
ATOM   5865  C  CD2 . PHE B  1 320 ? -20.457 135.728 -18.655 1.00 53.50  ? 351  PHE B CD2 1 
ATOM   5866  C  CE1 . PHE B  1 320 ? -22.600 134.164 -17.943 1.00 53.76  ? 351  PHE B CE1 1 
ATOM   5867  C  CE2 . PHE B  1 320 ? -20.886 135.709 -17.342 1.00 52.94  ? 351  PHE B CE2 1 
ATOM   5868  C  CZ  . PHE B  1 320 ? -21.964 134.926 -16.985 1.00 53.90  ? 351  PHE B CZ  1 
ATOM   5869  N  N   . PRO B  1 321 ? -20.636 133.409 -23.970 1.00 52.60  ? 352  PRO B N   1 
ATOM   5870  C  CA  . PRO B  1 321 ? -21.958 132.904 -23.665 1.00 52.81  ? 352  PRO B CA  1 
ATOM   5871  C  C   . PRO B  1 321 ? -21.940 131.420 -23.317 1.00 52.35  ? 352  PRO B C   1 
ATOM   5872  O  O   . PRO B  1 321 ? -20.995 130.720 -23.670 1.00 52.41  ? 352  PRO B O   1 
ATOM   5873  C  CB  . PRO B  1 321 ? -22.704 133.092 -24.993 1.00 52.78  ? 352  PRO B CB  1 
ATOM   5874  C  CG  . PRO B  1 321 ? -21.642 132.907 -26.017 1.00 53.16  ? 352  PRO B CG  1 
ATOM   5875  C  CD  . PRO B  1 321 ? -20.392 133.492 -25.429 1.00 53.17  ? 352  PRO B CD  1 
ATOM   5876  N  N   . PHE B  1 322 ? -22.980 130.963 -22.638 1.00 51.61  ? 353  PHE B N   1 
ATOM   5877  C  CA  . PHE B  1 322 ? -23.176 129.560 -22.320 1.00 51.10  ? 353  PHE B CA  1 
ATOM   5878  C  C   . PHE B  1 322 ? -24.586 129.157 -22.743 1.00 51.16  ? 353  PHE B C   1 
ATOM   5879  O  O   . PHE B  1 322 ? -25.527 129.918 -22.509 1.00 51.94  ? 353  PHE B O   1 
ATOM   5880  C  CB  . PHE B  1 322 ? -22.948 129.256 -20.848 1.00 50.93  ? 353  PHE B CB  1 
ATOM   5881  C  CG  . PHE B  1 322 ? -24.007 129.796 -19.932 1.00 49.44  ? 353  PHE B CG  1 
ATOM   5882  C  CD1 . PHE B  1 322 ? -25.239 129.181 -19.850 1.00 48.87  ? 353  PHE B CD1 1 
ATOM   5883  C  CD2 . PHE B  1 322 ? -23.781 130.910 -19.143 1.00 49.22  ? 353  PHE B CD2 1 
ATOM   5884  C  CE1 . PHE B  1 322 ? -26.231 129.667 -19.028 1.00 49.14  ? 353  PHE B CE1 1 
ATOM   5885  C  CE2 . PHE B  1 322 ? -24.761 131.397 -18.306 1.00 48.36  ? 353  PHE B CE2 1 
ATOM   5886  C  CZ  . PHE B  1 322 ? -25.992 130.777 -18.249 1.00 48.51  ? 353  PHE B CZ  1 
ATOM   5887  N  N   . THR B  1 323 ? -24.727 128.010 -23.393 1.00 51.35  ? 354  THR B N   1 
ATOM   5888  C  CA  . THR B  1 323 ? -26.050 127.615 -23.865 1.00 51.85  ? 354  THR B CA  1 
ATOM   5889  C  C   . THR B  1 323 ? -26.761 126.699 -22.879 1.00 52.27  ? 354  THR B C   1 
ATOM   5890  O  O   . THR B  1 323 ? -26.189 125.733 -22.383 1.00 51.99  ? 354  THR B O   1 
ATOM   5891  C  CB  . THR B  1 323 ? -25.976 126.953 -25.248 1.00 51.93  ? 354  THR B CB  1 
ATOM   5892  O  OG1 . THR B  1 323 ? -26.272 125.559 -25.119 1.00 53.15  ? 354  THR B OG1 1 
ATOM   5893  C  CG2 . THR B  1 323 ? -24.591 127.130 -25.858 1.00 50.76  ? 354  THR B CG2 1 
ATOM   5894  N  N   . PHE B  1 324 ? -28.017 127.013 -22.609 1.00 53.05  ? 355  PHE B N   1 
ATOM   5895  C  CA  . PHE B  1 324 ? -28.897 126.246 -21.732 1.00 52.57  ? 355  PHE B CA  1 
ATOM   5896  C  C   . PHE B  1 324 ? -30.211 125.975 -22.467 1.00 52.90  ? 355  PHE B C   1 
ATOM   5897  O  O   . PHE B  1 324 ? -30.736 126.869 -23.135 1.00 52.42  ? 355  PHE B O   1 
ATOM   5898  C  CB  . PHE B  1 324 ? -29.191 127.039 -20.463 1.00 51.12  ? 355  PHE B CB  1 
ATOM   5899  C  CG  . PHE B  1 324 ? -30.077 126.375 -19.457 1.00 49.55  ? 355  PHE B CG  1 
ATOM   5900  C  CD1 . PHE B  1 324 ? -29.774 125.126 -18.952 1.00 49.12  ? 355  PHE B CD1 1 
ATOM   5901  C  CD2 . PHE B  1 324 ? -31.215 127.015 -18.990 1.00 48.67  ? 355  PHE B CD2 1 
ATOM   5902  C  CE1 . PHE B  1 324 ? -30.579 124.522 -18.010 1.00 48.78  ? 355  PHE B CE1 1 
ATOM   5903  C  CE2 . PHE B  1 324 ? -32.025 126.414 -18.052 1.00 48.72  ? 355  PHE B CE2 1 
ATOM   5904  C  CZ  . PHE B  1 324 ? -31.709 125.168 -17.559 1.00 48.92  ? 355  PHE B CZ  1 
ATOM   5905  N  N   . LEU B  1 325 ? -30.689 124.738 -22.433 1.00 52.92  ? 356  LEU B N   1 
ATOM   5906  C  CA  . LEU B  1 325 ? -31.919 124.376 -23.128 1.00 52.61  ? 356  LEU B CA  1 
ATOM   5907  C  C   . LEU B  1 325 ? -31.912 124.821 -24.582 1.00 52.38  ? 356  LEU B C   1 
ATOM   5908  O  O   . LEU B  1 325 ? -32.968 125.114 -25.150 1.00 52.20  ? 356  LEU B O   1 
ATOM   5909  C  CB  . LEU B  1 325 ? -33.124 125.020 -22.426 1.00 52.01  ? 356  LEU B CB  1 
ATOM   5910  C  CG  . LEU B  1 325 ? -33.334 124.650 -20.960 1.00 52.00  ? 356  LEU B CG  1 
ATOM   5911  C  CD1 . LEU B  1 325 ? -34.636 125.226 -20.436 1.00 50.99  ? 356  LEU B CD1 1 
ATOM   5912  C  CD2 . LEU B  1 325 ? -33.291 123.139 -20.788 1.00 51.72  ? 356  LEU B CD2 1 
ATOM   5913  N  N   . GLY B  1 326 ? -30.754 124.923 -25.220 1.00 52.15  ? 357  GLY B N   1 
ATOM   5914  C  CA  . GLY B  1 326 ? -30.672 125.338 -26.598 1.00 52.49  ? 357  GLY B CA  1 
ATOM   5915  C  C   . GLY B  1 326 ? -30.504 126.816 -26.836 1.00 53.43  ? 357  GLY B C   1 
ATOM   5916  O  O   . GLY B  1 326 ? -30.420 127.230 -28.005 1.00 53.07  ? 357  GLY B O   1 
ATOM   5917  N  N   . ASN B  1 327 ? -30.448 127.674 -25.822 1.00 54.53  ? 358  ASN B N   1 
ATOM   5918  C  CA  . ASN B  1 327 ? -30.286 129.105 -26.078 1.00 55.71  ? 358  ASN B CA  1 
ATOM   5919  C  C   . ASN B  1 327 ? -29.044 129.668 -25.403 1.00 56.57  ? 358  ASN B C   1 
ATOM   5920  O  O   . ASN B  1 327 ? -28.703 129.263 -24.292 1.00 57.64  ? 358  ASN B O   1 
ATOM   5921  C  CB  . ASN B  1 327 ? -31.516 129.907 -25.667 1.00 55.00  ? 358  ASN B CB  1 
ATOM   5922  C  CG  . ASN B  1 327 ? -32.583 129.069 -25.000 1.00 54.78  ? 358  ASN B CG  1 
ATOM   5923  O  OD1 . ASN B  1 327 ? -32.360 128.451 -23.961 1.00 54.37  ? 358  ASN B OD1 1 
ATOM   5924  N  ND2 . ASN B  1 327 ? -33.755 129.039 -25.617 1.00 54.63  ? 358  ASN B ND2 1 
ATOM   5925  N  N   . LYS B  1 328 ? -28.395 130.632 -26.046 1.00 56.36  ? 359  LYS B N   1 
ATOM   5926  C  CA  . LYS B  1 328 ? -27.185 131.244 -25.534 1.00 56.00  ? 359  LYS B CA  1 
ATOM   5927  C  C   . LYS B  1 328 ? -27.450 132.390 -24.570 1.00 55.03  ? 359  LYS B C   1 
ATOM   5928  O  O   . LYS B  1 328 ? -27.961 133.436 -24.963 1.00 54.35  ? 359  LYS B O   1 
ATOM   5929  C  CB  . LYS B  1 328 ? -26.299 131.708 -26.696 1.00 57.48  ? 359  LYS B CB  1 
ATOM   5930  C  CG  . LYS B  1 328 ? -25.276 130.672 -27.133 1.00 58.48  ? 359  LYS B CG  1 
ATOM   5931  C  CD  . LYS B  1 328 ? -24.426 131.191 -28.284 1.00 59.30  ? 359  LYS B CD  1 
ATOM   5932  C  CE  . LYS B  1 328 ? -24.948 130.650 -29.609 1.00 58.73  ? 359  LYS B CE  1 
ATOM   5933  N  NZ  . LYS B  1 328 ? -23.958 130.857 -30.704 1.00 58.03  ? 359  LYS B NZ  1 
ATOM   5934  N  N   . TYR B  1 329 ? -27.078 132.192 -23.310 1.00 54.26  ? 360  TYR B N   1 
ATOM   5935  C  CA  . TYR B  1 329 ? -27.198 133.222 -22.280 1.00 53.03  ? 360  TYR B CA  1 
ATOM   5936  C  C   . TYR B  1 329 ? -25.870 133.978 -22.191 1.00 52.90  ? 360  TYR B C   1 
ATOM   5937  O  O   . TYR B  1 329 ? -24.809 133.373 -22.313 1.00 52.13  ? 360  TYR B O   1 
ATOM   5938  C  CB  . TYR B  1 329 ? -27.528 132.602 -20.926 1.00 52.16  ? 360  TYR B CB  1 
ATOM   5939  C  CG  . TYR B  1 329 ? -28.843 131.869 -20.846 1.00 51.04  ? 360  TYR B CG  1 
ATOM   5940  C  CD1 . TYR B  1 329 ? -29.056 130.699 -21.559 1.00 51.11  ? 360  TYR B CD1 1 
ATOM   5941  C  CD2 . TYR B  1 329 ? -29.877 132.338 -20.049 1.00 50.94  ? 360  TYR B CD2 1 
ATOM   5942  C  CE1 . TYR B  1 329 ? -30.260 130.028 -21.483 1.00 52.46  ? 360  TYR B CE1 1 
ATOM   5943  C  CE2 . TYR B  1 329 ? -31.082 131.673 -19.967 1.00 51.78  ? 360  TYR B CE2 1 
ATOM   5944  C  CZ  . TYR B  1 329 ? -31.272 130.514 -20.688 1.00 52.10  ? 360  TYR B CZ  1 
ATOM   5945  O  OH  . TYR B  1 329 ? -32.469 129.847 -20.613 1.00 51.32  ? 360  TYR B OH  1 
ATOM   5946  N  N   . GLU B  1 330 ? -25.923 135.293 -22.046 1.00 54.12  ? 361  GLU B N   1 
ATOM   5947  C  CA  . GLU B  1 330 ? -24.694 136.080 -21.979 1.00 55.32  ? 361  GLU B CA  1 
ATOM   5948  C  C   . GLU B  1 330 ? -24.556 136.760 -20.622 1.00 54.45  ? 361  GLU B C   1 
ATOM   5949  O  O   . GLU B  1 330 ? -23.943 137.815 -20.517 1.00 54.64  ? 361  GLU B O   1 
ATOM   5950  C  CB  . GLU B  1 330 ? -24.639 137.128 -23.082 1.00 57.47  ? 361  GLU B CB  1 
ATOM   5951  C  CG  . GLU B  1 330 ? -23.624 136.842 -24.173 1.00 62.48  ? 361  GLU B CG  1 
ATOM   5952  C  CD  . GLU B  1 330 ? -24.268 136.594 -25.522 1.00 65.59  ? 361  GLU B CD  1 
ATOM   5953  O  OE1 . GLU B  1 330 ? -25.177 137.359 -25.909 1.00 65.40  ? 361  GLU B OE1 1 
ATOM   5954  O  OE2 . GLU B  1 330 ? -23.867 135.632 -26.211 1.00 68.41  ? 361  GLU B OE2 1 
ATOM   5955  N  N   . SER B  1 331 ? -25.118 136.127 -19.606 1.00 52.94  ? 362  SER B N   1 
ATOM   5956  C  CA  . SER B  1 331 ? -25.065 136.667 -18.250 1.00 51.06  ? 362  SER B CA  1 
ATOM   5957  C  C   . SER B  1 331 ? -25.526 135.573 -17.280 1.00 49.96  ? 362  SER B C   1 
ATOM   5958  O  O   . SER B  1 331 ? -26.005 134.548 -17.740 1.00 50.50  ? 362  SER B O   1 
ATOM   5959  C  CB  . SER B  1 331 ? -26.120 137.792 -18.137 1.00 50.84  ? 362  SER B CB  1 
ATOM   5960  O  OG  . SER B  1 331 ? -27.403 137.313 -18.496 1.00 50.92  ? 362  SER B OG  1 
ATOM   5961  N  N   . CYS B  1 332 ? -25.469 135.887 -15.999 1.00 47.52  ? 363  CYS B N   1 
ATOM   5962  C  CA  . CYS B  1 332 ? -26.257 135.003 -15.078 1.00 44.69  ? 363  CYS B CA  1 
ATOM   5963  C  C   . CYS B  1 332 ? -27.757 134.990 -15.342 1.00 43.59  ? 363  CYS B C   1 
ATOM   5964  O  O   . CYS B  1 332 ? -28.386 136.011 -15.646 1.00 42.50  ? 363  CYS B O   1 
ATOM   5965  C  CB  . CYS B  1 332 ? -25.951 135.522 -13.665 1.00 44.00  ? 363  CYS B CB  1 
ATOM   5966  S  SG  . CYS B  1 332 ? -24.149 135.734 -13.526 1.00 42.98  ? 363  CYS B SG  1 
ATOM   5967  N  N   . THR B  1 333 ? -28.397 133.833 -15.186 1.00 43.68  ? 364  THR B N   1 
ATOM   5968  C  CA  . THR B  1 333 ? -29.823 133.659 -15.390 1.00 42.46  ? 364  THR B CA  1 
ATOM   5969  C  C   . THR B  1 333 ? -30.474 132.899 -14.233 1.00 42.01  ? 364  THR B C   1 
ATOM   5970  O  O   . THR B  1 333 ? -29.804 132.184 -13.506 1.00 41.79  ? 364  THR B O   1 
ATOM   5971  C  CB  . THR B  1 333 ? -30.125 132.824 -16.661 1.00 42.79  ? 364  THR B CB  1 
ATOM   5972  O  OG1 . THR B  1 333 ? -31.535 132.868 -16.927 1.00 43.75  ? 364  THR B OG1 1 
ATOM   5973  C  CG2 . THR B  1 333 ? -29.749 131.369 -16.426 1.00 41.07  ? 364  THR B CG2 1 
ATOM   5974  N  N   . SER B  1 334 ? -31.791 133.008 -14.146 1.00 41.62  ? 365  SER B N   1 
ATOM   5975  C  CA  . SER B  1 334 ? -32.574 132.261 -13.164 1.00 41.27  ? 365  SER B CA  1 
ATOM   5976  C  C   . SER B  1 334 ? -33.328 131.141 -13.888 1.00 41.10  ? 365  SER B C   1 
ATOM   5977  O  O   . SER B  1 334 ? -33.981 130.290 -13.306 1.00 39.79  ? 365  SER B O   1 
ATOM   5978  C  CB  . SER B  1 334 ? -33.572 133.160 -12.450 1.00 40.70  ? 365  SER B CB  1 
ATOM   5979  O  OG  . SER B  1 334 ? -34.142 134.114 -13.324 1.00 43.21  ? 365  SER B OG  1 
ATOM   5980  N  N   . ALA B  1 335 ? -33.190 131.158 -15.208 1.00 41.80  ? 366  ALA B N   1 
ATOM   5981  C  CA  . ALA B  1 335 ? -33.809 130.187 -16.085 1.00 42.51  ? 366  ALA B CA  1 
ATOM   5982  C  C   . ALA B  1 335 ? -33.511 128.764 -15.627 1.00 43.04  ? 366  ALA B C   1 
ATOM   5983  O  O   . ALA B  1 335 ? -32.345 128.343 -15.616 1.00 44.98  ? 366  ALA B O   1 
ATOM   5984  C  CB  . ALA B  1 335 ? -33.375 130.433 -17.522 1.00 41.86  ? 366  ALA B CB  1 
ATOM   5985  N  N   . GLY B  1 336 ? -34.590 128.072 -15.253 1.00 43.80  ? 367  GLY B N   1 
ATOM   5986  C  CA  . GLY B  1 336 ? -34.536 126.700 -14.791 1.00 44.19  ? 367  GLY B CA  1 
ATOM   5987  C  C   . GLY B  1 336 ? -35.021 126.539 -13.336 1.00 45.28  ? 367  GLY B C   1 
ATOM   5988  O  O   . GLY B  1 336 ? -35.478 125.468 -12.934 1.00 44.79  ? 367  GLY B O   1 
ATOM   5989  N  N   . ARG B  1 337 ? -34.936 127.590 -12.508 1.00 45.89  ? 368  ARG B N   1 
ATOM   5990  C  CA  . ARG B  1 337 ? -35.313 127.456 -11.089 1.00 46.38  ? 368  ARG B CA  1 
ATOM   5991  C  C   . ARG B  1 337 ? -36.454 128.364 -10.668 1.00 48.34  ? 368  ARG B C   1 
ATOM   5992  O  O   . ARG B  1 337 ? -36.671 129.430 -11.242 1.00 48.96  ? 368  ARG B O   1 
ATOM   5993  C  CB  . ARG B  1 337 ? -34.108 127.703 -10.181 1.00 44.35  ? 368  ARG B CB  1 
ATOM   5994  C  CG  . ARG B  1 337 ? -33.119 128.723 -10.718 1.00 41.97  ? 368  ARG B CG  1 
ATOM   5995  C  CD  . ARG B  1 337 ? -31.904 128.833 -9.812  1.00 38.99  ? 368  ARG B CD  1 
ATOM   5996  N  NE  . ARG B  1 337 ? -31.308 127.528 -9.542  1.00 38.28  ? 368  ARG B NE  1 
ATOM   5997  C  CZ  . ARG B  1 337 ? -31.331 126.917 -8.360  1.00 37.56  ? 368  ARG B CZ  1 
ATOM   5998  N  NH1 . ARG B  1 337 ? -31.921 127.493 -7.322  1.00 35.30  ? 368  ARG B NH1 1 
ATOM   5999  N  NH2 . ARG B  1 337 ? -30.763 125.726 -8.219  1.00 35.85  ? 368  ARG B NH2 1 
ATOM   6000  N  N   . SER B  1 338 ? -37.184 127.956 -9.635  1.00 49.93  ? 369  SER B N   1 
ATOM   6001  C  CA  . SER B  1 338 ? -38.321 128.702 -9.135  1.00 51.67  ? 369  SER B CA  1 
ATOM   6002  C  C   . SER B  1 338 ? -37.969 129.708 -8.049  1.00 52.38  ? 369  SER B C   1 
ATOM   6003  O  O   . SER B  1 338 ? -38.795 130.570 -7.727  1.00 53.71  ? 369  SER B O   1 
ATOM   6004  C  CB  . SER B  1 338 ? -39.370 127.723 -8.581  1.00 52.06  ? 369  SER B CB  1 
ATOM   6005  O  OG  . SER B  1 338 ? -38.824 127.030 -7.466  1.00 53.05  ? 369  SER B OG  1 
ATOM   6006  N  N   . ASP B  1 339 ? -36.783 129.621 -7.466  1.00 51.74  ? 370  ASP B N   1 
ATOM   6007  C  CA  . ASP B  1 339 ? -36.375 130.517 -6.397  1.00 50.50  ? 370  ASP B CA  1 
ATOM   6008  C  C   . ASP B  1 339 ? -35.805 131.823 -6.912  1.00 49.58  ? 370  ASP B C   1 
ATOM   6009  O  O   . ASP B  1 339 ? -35.306 132.645 -6.139  1.00 48.38  ? 370  ASP B O   1 
ATOM   6010  C  CB  . ASP B  1 339 ? -35.419 129.830 -5.426  1.00 50.84  ? 370  ASP B CB  1 
ATOM   6011  C  CG  . ASP B  1 339 ? -34.204 129.215 -6.077  1.00 51.82  ? 370  ASP B CG  1 
ATOM   6012  O  OD1 . ASP B  1 339 ? -34.280 128.784 -7.242  1.00 53.64  ? 370  ASP B OD1 1 
ATOM   6013  O  OD2 . ASP B  1 339 ? -33.145 129.143 -5.421  1.00 52.58  ? 370  ASP B OD2 1 
ATOM   6014  N  N   . GLY B  1 340 ? -35.813 132.027 -8.223  1.00 48.84  ? 371  GLY B N   1 
ATOM   6015  C  CA  . GLY B  1 340 ? -35.315 133.230 -8.846  1.00 48.37  ? 371  GLY B CA  1 
ATOM   6016  C  C   . GLY B  1 340 ? -33.840 133.496 -8.630  1.00 48.85  ? 371  GLY B C   1 
ATOM   6017  O  O   . GLY B  1 340 ? -33.388 134.608 -8.939  1.00 48.36  ? 371  GLY B O   1 
ATOM   6018  N  N   . LYS B  1 341 ? -33.084 132.522 -8.139  1.00 49.21  ? 372  LYS B N   1 
ATOM   6019  C  CA  . LYS B  1 341 ? -31.655 132.679 -7.894  1.00 47.76  ? 372  LYS B CA  1 
ATOM   6020  C  C   . LYS B  1 341 ? -30.907 132.720 -9.222  1.00 46.52  ? 372  LYS B C   1 
ATOM   6021  O  O   . LYS B  1 341 ? -31.358 132.137 -10.203 1.00 46.46  ? 372  LYS B O   1 
ATOM   6022  C  CB  . LYS B  1 341 ? -31.111 131.544 -7.038  1.00 48.71  ? 372  LYS B CB  1 
ATOM   6023  C  CG  . LYS B  1 341 ? -31.713 131.464 -5.655  1.00 51.30  ? 372  LYS B CG  1 
ATOM   6024  C  CD  . LYS B  1 341 ? -31.255 132.594 -4.755  1.00 52.75  ? 372  LYS B CD  1 
ATOM   6025  C  CE  . LYS B  1 341 ? -31.727 132.356 -3.326  1.00 54.06  ? 372  LYS B CE  1 
ATOM   6026  N  NZ  . LYS B  1 341 ? -31.586 130.918 -2.943  1.00 54.25  ? 372  LYS B NZ  1 
ATOM   6027  N  N   . MET B  1 342 ? -29.784 133.423 -9.253  1.00 44.27  ? 373  MET B N   1 
ATOM   6028  C  CA  . MET B  1 342 ? -29.013 133.542 -10.482 1.00 42.66  ? 373  MET B CA  1 
ATOM   6029  C  C   . MET B  1 342 ? -27.854 132.551 -10.508 1.00 40.58  ? 373  MET B C   1 
ATOM   6030  O  O   . MET B  1 342 ? -27.108 132.448 -9.544  1.00 40.11  ? 373  MET B O   1 
ATOM   6031  C  CB  . MET B  1 342 ? -28.471 134.962 -10.640 1.00 44.41  ? 373  MET B CB  1 
ATOM   6032  C  CG  . MET B  1 342 ? -29.497 136.046 -10.389 1.00 47.21  ? 373  MET B CG  1 
ATOM   6033  S  SD  . MET B  1 342 ? -30.781 136.084 -11.656 1.00 50.60  ? 373  MET B SD  1 
ATOM   6034  C  CE  . MET B  1 342 ? -29.836 136.740 -13.030 1.00 49.28  ? 373  MET B CE  1 
ATOM   6035  N  N   . TRP B  1 343 ? -27.713 131.855 -11.620 1.00 38.91  ? 374  TRP B N   1 
ATOM   6036  C  CA  . TRP B  1 343 ? -26.657 130.893 -11.840 1.00 37.77  ? 374  TRP B CA  1 
ATOM   6037  C  C   . TRP B  1 343 ? -26.051 131.083 -13.226 1.00 36.73  ? 374  TRP B C   1 
ATOM   6038  O  O   . TRP B  1 343 ? -26.475 131.925 -14.010 1.00 35.79  ? 374  TRP B O   1 
ATOM   6039  C  CB  . TRP B  1 343 ? -27.166 129.446 -11.697 1.00 40.02  ? 374  TRP B CB  1 
ATOM   6040  C  CG  . TRP B  1 343 ? -28.146 129.087 -12.772 1.00 42.57  ? 374  TRP B CG  1 
ATOM   6041  C  CD1 . TRP B  1 343 ? -29.487 129.354 -12.762 1.00 44.77  ? 374  TRP B CD1 1 
ATOM   6042  C  CD2 . TRP B  1 343 ? -27.885 128.424 -14.010 1.00 42.71  ? 374  TRP B CD2 1 
ATOM   6043  N  NE1 . TRP B  1 343 ? -30.073 128.899 -13.919 1.00 45.32  ? 374  TRP B NE1 1 
ATOM   6044  C  CE2 . TRP B  1 343 ? -29.108 128.323 -14.704 1.00 43.43  ? 374  TRP B CE2 1 
ATOM   6045  C  CE3 . TRP B  1 343 ? -26.747 127.895 -14.609 1.00 43.04  ? 374  TRP B CE3 1 
ATOM   6046  C  CZ2 . TRP B  1 343 ? -29.213 127.726 -15.957 1.00 42.06  ? 374  TRP B CZ2 1 
ATOM   6047  C  CZ3 . TRP B  1 343 ? -26.846 127.304 -15.849 1.00 42.35  ? 374  TRP B CZ3 1 
ATOM   6048  C  CH2 . TRP B  1 343 ? -28.079 127.226 -16.510 1.00 41.17  ? 374  TRP B CH2 1 
ATOM   6049  N  N   . CYS B  1 344 ? -25.028 130.328 -13.514 1.00 36.01  ? 375  CYS B N   1 
ATOM   6050  C  CA  . CYS B  1 344 ? -24.391 130.348 -14.824 1.00 33.69  ? 375  CYS B CA  1 
ATOM   6051  C  C   . CYS B  1 344 ? -23.653 129.043 -15.098 1.00 32.90  ? 375  CYS B C   1 
ATOM   6052  O  O   . CYS B  1 344 ? -23.477 128.268 -14.147 1.00 29.58  ? 375  CYS B O   1 
ATOM   6053  C  CB  . CYS B  1 344 ? -23.435 131.537 -14.936 1.00 35.04  ? 375  CYS B CB  1 
ATOM   6054  S  SG  . CYS B  1 344 ? -22.041 131.486 -13.787 1.00 37.03  ? 375  CYS B SG  1 
ATOM   6055  N  N   . ALA B  1 345 ? -23.379 128.813 -16.346 1.00 33.23  ? 376  ALA B N   1 
ATOM   6056  C  CA  . ALA B  1 345 ? -22.658 127.598 -16.731 1.00 32.96  ? 376  ALA B CA  1 
ATOM   6057  C  C   . ALA B  1 345 ? -21.169 127.922 -16.661 1.00 33.06  ? 376  ALA B C   1 
ATOM   6058  O  O   . ALA B  1 345 ? -20.762 128.988 -17.112 1.00 31.68  ? 376  ALA B O   1 
ATOM   6059  C  CB  . ALA B  1 345 ? -23.054 127.169 -18.130 1.00 30.41  ? 376  ALA B CB  1 
ATOM   6060  N  N   . THR B  1 346 ? -20.413 127.018 -16.070 1.00 33.01  ? 377  THR B N   1 
ATOM   6061  C  CA  . THR B  1 346 ? -18.972 127.246 -15.949 1.00 33.40  ? 377  THR B CA  1 
ATOM   6062  C  C   . THR B  1 346 ? -18.279 126.635 -17.159 1.00 36.88  ? 377  THR B C   1 
ATOM   6063  O  O   . THR B  1 346 ? -17.050 126.519 -17.195 1.00 39.69  ? 377  THR B O   1 
ATOM   6064  C  CB  . THR B  1 346 ? -18.489 126.626 -14.634 1.00 31.04  ? 377  THR B CB  1 
ATOM   6065  O  OG1 . THR B  1 346 ? -19.034 125.303 -14.529 1.00 28.76  ? 377  THR B OG1 1 
ATOM   6066  C  CG2 . THR B  1 346 ? -18.972 127.396 -13.417 1.00 27.30  ? 377  THR B CG2 1 
ATOM   6067  N  N   . THR B  1 347 ? -19.087 126.228 -18.139 1.00 37.61  ? 378  THR B N   1 
ATOM   6068  C  CA  . THR B  1 347 ? -18.631 125.672 -19.394 1.00 38.89  ? 378  THR B CA  1 
ATOM   6069  C  C   . THR B  1 347 ? -19.577 125.966 -20.552 1.00 40.92  ? 378  THR B C   1 
ATOM   6070  O  O   . THR B  1 347 ? -20.761 125.642 -20.457 1.00 43.82  ? 378  THR B O   1 
ATOM   6071  C  CB  . THR B  1 347 ? -18.423 124.156 -19.323 1.00 37.60  ? 378  THR B CB  1 
ATOM   6072  O  OG1 . THR B  1 347 ? -19.181 123.533 -20.374 1.00 38.00  ? 378  THR B OG1 1 
ATOM   6073  C  CG2 . THR B  1 347 ? -18.827 123.541 -18.004 1.00 37.11  ? 378  THR B CG2 1 
ATOM   6074  N  N   . ALA B  1 348 ? -19.103 126.569 -21.623 1.00 43.20  ? 379  ALA B N   1 
ATOM   6075  C  CA  . ALA B  1 348 ? -19.873 126.955 -22.781 1.00 45.70  ? 379  ALA B CA  1 
ATOM   6076  C  C   . ALA B  1 348 ? -21.105 126.098 -23.109 1.00 47.60  ? 379  ALA B C   1 
ATOM   6077  O  O   . ALA B  1 348 ? -22.039 126.556 -23.762 1.00 49.21  ? 379  ALA B O   1 
ATOM   6078  C  CB  . ALA B  1 348 ? -18.969 127.304 -23.954 1.00 45.27  ? 379  ALA B CB  1 
ATOM   6079  N  N   . ASN B  1 349 ? -21.225 124.848 -22.702 1.00 48.55  ? 380  ASN B N   1 
ATOM   6080  C  CA  . ASN B  1 349 ? -22.508 124.171 -22.951 1.00 49.73  ? 380  ASN B CA  1 
ATOM   6081  C  C   . ASN B  1 349 ? -22.973 123.409 -21.719 1.00 50.93  ? 380  ASN B C   1 
ATOM   6082  O  O   . ASN B  1 349 ? -22.331 122.454 -21.292 1.00 51.62  ? 380  ASN B O   1 
ATOM   6083  C  CB  . ASN B  1 349 ? -22.488 123.262 -24.180 1.00 50.43  ? 380  ASN B CB  1 
ATOM   6084  C  CG  . ASN B  1 349 ? -23.890 123.090 -24.759 1.00 50.68  ? 380  ASN B CG  1 
ATOM   6085  O  OD1 . ASN B  1 349 ? -24.817 122.673 -24.059 1.00 49.73  ? 380  ASN B OD1 1 
ATOM   6086  N  ND2 . ASN B  1 349 ? -24.054 123.420 -26.035 1.00 51.47  ? 380  ASN B ND2 1 
ATOM   6087  N  N   . TYR B  1 350 ? -24.099 123.843 -21.144 1.00 50.95  ? 381  TYR B N   1 
ATOM   6088  C  CA  . TYR B  1 350 ? -24.624 123.197 -19.942 1.00 51.72  ? 381  TYR B CA  1 
ATOM   6089  C  C   . TYR B  1 350 ? -25.338 121.889 -20.248 1.00 54.63  ? 381  TYR B C   1 
ATOM   6090  O  O   . TYR B  1 350 ? -25.217 120.918 -19.504 1.00 55.25  ? 381  TYR B O   1 
ATOM   6091  C  CB  . TYR B  1 350 ? -25.596 124.102 -19.179 1.00 47.65  ? 381  TYR B CB  1 
ATOM   6092  C  CG  . TYR B  1 350 ? -26.283 123.394 -18.026 1.00 44.79  ? 381  TYR B CG  1 
ATOM   6093  C  CD1 . TYR B  1 350 ? -25.673 123.295 -16.782 1.00 43.21  ? 381  TYR B CD1 1 
ATOM   6094  C  CD2 . TYR B  1 350 ? -27.539 122.815 -18.182 1.00 43.99  ? 381  TYR B CD2 1 
ATOM   6095  C  CE1 . TYR B  1 350 ? -26.290 122.642 -15.730 1.00 41.55  ? 381  TYR B CE1 1 
ATOM   6096  C  CE2 . TYR B  1 350 ? -28.162 122.159 -17.136 1.00 42.84  ? 381  TYR B CE2 1 
ATOM   6097  C  CZ  . TYR B  1 350 ? -27.532 122.075 -15.913 1.00 42.16  ? 381  TYR B CZ  1 
ATOM   6098  O  OH  . TYR B  1 350 ? -28.148 121.420 -14.870 1.00 40.33  ? 381  TYR B OH  1 
ATOM   6099  N  N   . ASP B  1 351 ? -26.086 121.864 -21.340 1.00 57.38  ? 382  ASP B N   1 
ATOM   6100  C  CA  . ASP B  1 351 ? -26.834 120.674 -21.716 1.00 59.81  ? 382  ASP B CA  1 
ATOM   6101  C  C   . ASP B  1 351 ? -25.954 119.438 -21.718 1.00 60.81  ? 382  ASP B C   1 
ATOM   6102  O  O   . ASP B  1 351 ? -26.294 118.422 -21.102 1.00 62.13  ? 382  ASP B O   1 
ATOM   6103  C  CB  . ASP B  1 351 ? -27.508 120.877 -23.072 1.00 60.24  ? 382  ASP B CB  1 
ATOM   6104  C  CG  . ASP B  1 351 ? -28.672 121.845 -22.992 1.00 61.17  ? 382  ASP B CG  1 
ATOM   6105  O  OD1 . ASP B  1 351 ? -29.554 121.644 -22.129 1.00 60.51  ? 382  ASP B OD1 1 
ATOM   6106  O  OD2 . ASP B  1 351 ? -28.702 122.806 -23.788 1.00 61.34  ? 382  ASP B OD2 1 
ATOM   6107  N  N   . ASP B  1 352 ? -24.827 119.503 -22.416 1.00 59.84  ? 383  ASP B N   1 
ATOM   6108  C  CA  . ASP B  1 352 ? -23.922 118.372 -22.521 1.00 59.00  ? 383  ASP B CA  1 
ATOM   6109  C  C   . ASP B  1 352 ? -22.971 118.261 -21.344 1.00 57.99  ? 383  ASP B C   1 
ATOM   6110  O  O   . ASP B  1 352 ? -22.659 117.148 -20.903 1.00 58.35  ? 383  ASP B O   1 
ATOM   6111  C  CB  . ASP B  1 352 ? -23.153 118.389 -23.841 1.00 59.87  ? 383  ASP B CB  1 
ATOM   6112  C  CG  . ASP B  1 352 ? -23.072 119.783 -24.435 1.00 60.84  ? 383  ASP B CG  1 
ATOM   6113  O  OD1 . ASP B  1 352 ? -22.997 120.741 -23.640 1.00 62.73  ? 383  ASP B OD1 1 
ATOM   6114  O  OD2 . ASP B  1 352 ? -23.088 119.903 -25.673 1.00 61.09  ? 383  ASP B OD2 1 
ATOM   6115  N  N   . ASP B  1 353 ? -22.496 119.389 -20.823 1.00 56.01  ? 384  ASP B N   1 
ATOM   6116  C  CA  . ASP B  1 353 ? -21.584 119.359 -19.683 1.00 54.60  ? 384  ASP B CA  1 
ATOM   6117  C  C   . ASP B  1 353 ? -22.346 119.243 -18.365 1.00 53.75  ? 384  ASP B C   1 
ATOM   6118  O  O   . ASP B  1 353 ? -21.985 118.455 -17.492 1.00 51.84  ? 384  ASP B O   1 
ATOM   6119  C  CB  . ASP B  1 353 ? -20.700 120.601 -19.663 1.00 56.03  ? 384  ASP B CB  1 
ATOM   6120  C  CG  . ASP B  1 353 ? -19.832 120.758 -20.890 1.00 57.17  ? 384  ASP B CG  1 
ATOM   6121  O  OD1 . ASP B  1 353 ? -18.920 119.931 -21.102 1.00 57.96  ? 384  ASP B OD1 1 
ATOM   6122  O  OD2 . ASP B  1 353 ? -20.051 121.724 -21.654 1.00 57.16  ? 384  ASP B OD2 1 
ATOM   6123  N  N   . ARG B  1 354 ? -23.385 120.053 -18.210 1.00 53.74  ? 385  ARG B N   1 
ATOM   6124  C  CA  . ARG B  1 354 ? -24.223 120.087 -17.027 1.00 52.42  ? 385  ARG B CA  1 
ATOM   6125  C  C   . ARG B  1 354 ? -23.447 120.459 -15.771 1.00 49.24  ? 385  ARG B C   1 
ATOM   6126  O  O   . ARG B  1 354 ? -23.710 119.961 -14.683 1.00 46.88  ? 385  ARG B O   1 
ATOM   6127  C  CB  . ARG B  1 354 ? -24.986 118.779 -16.847 1.00 56.59  ? 385  ARG B CB  1 
ATOM   6128  C  CG  . ARG B  1 354 ? -25.867 118.412 -18.035 1.00 62.43  ? 385  ARG B CG  1 
ATOM   6129  C  CD  . ARG B  1 354 ? -26.814 117.270 -17.690 1.00 65.14  ? 385  ARG B CD  1 
ATOM   6130  N  NE  . ARG B  1 354 ? -27.772 117.683 -16.675 1.00 69.24  ? 385  ARG B NE  1 
ATOM   6131  C  CZ  . ARG B  1 354 ? -28.547 116.867 -15.978 1.00 71.49  ? 385  ARG B CZ  1 
ATOM   6132  N  NH1 . ARG B  1 354 ? -28.489 115.556 -16.181 1.00 72.05  ? 385  ARG B NH1 1 
ATOM   6133  N  NH2 . ARG B  1 354 ? -29.385 117.360 -15.072 1.00 71.96  ? 385  ARG B NH2 1 
ATOM   6134  N  N   . LYS B  1 355 ? -22.510 121.373 -15.932 1.00 47.01  ? 386  LYS B N   1 
ATOM   6135  C  CA  . LYS B  1 355 ? -21.649 121.891 -14.879 1.00 43.75  ? 386  LYS B CA  1 
ATOM   6136  C  C   . LYS B  1 355 ? -22.010 123.360 -14.631 1.00 41.90  ? 386  LYS B C   1 
ATOM   6137  O  O   . LYS B  1 355 ? -21.682 124.228 -15.430 1.00 41.15  ? 386  LYS B O   1 
ATOM   6138  C  CB  . LYS B  1 355 ? -20.184 121.799 -15.311 1.00 43.18  ? 386  LYS B CB  1 
ATOM   6139  C  CG  . LYS B  1 355 ? -19.550 120.439 -15.077 1.00 41.79  ? 386  LYS B CG  1 
ATOM   6140  C  CD  . LYS B  1 355 ? -18.931 120.370 -13.687 1.00 42.60  ? 386  LYS B CD  1 
ATOM   6141  C  CE  . LYS B  1 355 ? -18.342 119.001 -13.415 1.00 45.74  ? 386  LYS B CE  1 
ATOM   6142  N  NZ  . LYS B  1 355 ? -17.931 118.828 -11.994 1.00 47.37  ? 386  LYS B NZ  1 
ATOM   6143  N  N   . TRP B  1 356 ? -22.740 123.588 -13.549 1.00 40.51  ? 387  TRP B N   1 
ATOM   6144  C  CA  . TRP B  1 356 ? -23.276 124.904 -13.247 1.00 39.36  ? 387  TRP B CA  1 
ATOM   6145  C  C   . TRP B  1 356 ? -22.718 125.475 -11.950 1.00 38.95  ? 387  TRP B C   1 
ATOM   6146  O  O   . TRP B  1 356 ? -22.066 124.768 -11.190 1.00 39.25  ? 387  TRP B O   1 
ATOM   6147  C  CB  . TRP B  1 356 ? -24.808 124.814 -13.115 1.00 38.83  ? 387  TRP B CB  1 
ATOM   6148  C  CG  . TRP B  1 356 ? -25.225 124.118 -11.853 1.00 37.90  ? 387  TRP B CG  1 
ATOM   6149  C  CD1 . TRP B  1 356 ? -25.121 122.788 -11.589 1.00 37.98  ? 387  TRP B CD1 1 
ATOM   6150  C  CD2 . TRP B  1 356 ? -25.812 124.716 -10.693 1.00 38.16  ? 387  TRP B CD2 1 
ATOM   6151  N  NE1 . TRP B  1 356 ? -25.604 122.513 -10.337 1.00 37.32  ? 387  TRP B NE1 1 
ATOM   6152  C  CE2 . TRP B  1 356 ? -26.041 123.681 -9.765  1.00 38.06  ? 387  TRP B CE2 1 
ATOM   6153  C  CE3 . TRP B  1 356 ? -26.173 126.018 -10.345 1.00 38.15  ? 387  TRP B CE3 1 
ATOM   6154  C  CZ2 . TRP B  1 356 ? -26.608 123.912 -8.515  1.00 37.38  ? 387  TRP B CZ2 1 
ATOM   6155  C  CZ3 . TRP B  1 356 ? -26.738 126.241 -9.106  1.00 37.09  ? 387  TRP B CZ3 1 
ATOM   6156  C  CH2 . TRP B  1 356 ? -26.946 125.197 -8.203  1.00 36.09  ? 387  TRP B CH2 1 
ATOM   6157  N  N   . GLY B  1 357 ? -22.987 126.755 -11.711 1.00 37.19  ? 388  GLY B N   1 
ATOM   6158  C  CA  . GLY B  1 357 ? -22.585 127.452 -10.504 1.00 34.14  ? 388  GLY B CA  1 
ATOM   6159  C  C   . GLY B  1 357 ? -23.483 128.659 -10.233 1.00 33.55  ? 388  GLY B C   1 
ATOM   6160  O  O   . GLY B  1 357 ? -24.063 129.238 -11.159 1.00 33.77  ? 388  GLY B O   1 
ATOM   6161  N  N   . PHE B  1 358 ? -23.598 129.048 -8.965  1.00 31.46  ? 389  PHE B N   1 
ATOM   6162  C  CA  . PHE B  1 358 ? -24.380 130.214 -8.602  1.00 30.50  ? 389  PHE B CA  1 
ATOM   6163  C  C   . PHE B  1 358 ? -23.564 131.489 -8.747  1.00 31.53  ? 389  PHE B C   1 
ATOM   6164  O  O   . PHE B  1 358 ? -22.379 131.517 -8.472  1.00 33.59  ? 389  PHE B O   1 
ATOM   6165  C  CB  . PHE B  1 358 ? -24.855 130.133 -7.152  1.00 29.68  ? 389  PHE B CB  1 
ATOM   6166  C  CG  . PHE B  1 358 ? -26.127 129.376 -6.958  1.00 29.99  ? 389  PHE B CG  1 
ATOM   6167  C  CD1 . PHE B  1 358 ? -27.177 129.567 -7.850  1.00 29.59  ? 389  PHE B CD1 1 
ATOM   6168  C  CD2 . PHE B  1 358 ? -26.282 128.481 -5.916  1.00 31.85  ? 389  PHE B CD2 1 
ATOM   6169  C  CE1 . PHE B  1 358 ? -28.349 128.872 -7.689  1.00 30.51  ? 389  PHE B CE1 1 
ATOM   6170  C  CE2 . PHE B  1 358 ? -27.464 127.777 -5.756  1.00 32.40  ? 389  PHE B CE2 1 
ATOM   6171  C  CZ  . PHE B  1 358 ? -28.489 127.982 -6.646  1.00 31.52  ? 389  PHE B CZ  1 
ATOM   6172  N  N   . CYS B  1 359 ? -24.218 132.537 -9.207  1.00 32.68  ? 390  CYS B N   1 
ATOM   6173  C  CA  . CYS B  1 359 ? -23.546 133.827 -9.261  1.00 32.95  ? 390  CYS B CA  1 
ATOM   6174  C  C   . CYS B  1 359 ? -23.506 134.490 -7.890  1.00 32.51  ? 390  CYS B C   1 
ATOM   6175  O  O   . CYS B  1 359 ? -24.573 134.605 -7.274  1.00 33.18  ? 390  CYS B O   1 
ATOM   6176  C  CB  . CYS B  1 359 ? -24.232 134.746 -10.273 1.00 33.37  ? 390  CYS B CB  1 
ATOM   6177  S  SG  . CYS B  1 359 ? -24.115 134.189 -11.989 1.00 38.30  ? 390  CYS B SG  1 
ATOM   6178  N  N   . PRO B  1 360 ? -22.320 134.680 -7.368  1.00 30.77  ? 391  PRO B N   1 
ATOM   6179  C  CA  . PRO B  1 360 ? -22.186 135.172 -6.000  1.00 30.02  ? 391  PRO B CA  1 
ATOM   6180  C  C   . PRO B  1 360 ? -23.036 136.437 -5.924  1.00 30.75  ? 391  PRO B C   1 
ATOM   6181  O  O   . PRO B  1 360 ? -23.138 137.126 -6.939  1.00 31.78  ? 391  PRO B O   1 
ATOM   6182  C  CB  . PRO B  1 360 ? -20.725 135.526 -5.871  1.00 30.50  ? 391  PRO B CB  1 
ATOM   6183  C  CG  . PRO B  1 360 ? -20.022 134.796 -6.940  1.00 32.40  ? 391  PRO B CG  1 
ATOM   6184  C  CD  . PRO B  1 360 ? -21.017 134.537 -8.031  1.00 31.66  ? 391  PRO B CD  1 
ATOM   6185  N  N   . ASP B  1 361 ? -23.689 136.634 -4.795  1.00 30.30  ? 392  ASP B N   1 
ATOM   6186  C  CA  . ASP B  1 361 ? -24.540 137.815 -4.639  1.00 28.04  ? 392  ASP B CA  1 
ATOM   6187  C  C   . ASP B  1 361 ? -23.903 138.712 -3.587  1.00 25.84  ? 392  ASP B C   1 
ATOM   6188  O  O   . ASP B  1 361 ? -22.676 138.821 -3.566  1.00 27.42  ? 392  ASP B O   1 
ATOM   6189  C  CB  . ASP B  1 361 ? -25.955 137.441 -4.231  1.00 32.57  ? 392  ASP B CB  1 
ATOM   6190  C  CG  . ASP B  1 361 ? -26.041 136.680 -2.922  1.00 36.62  ? 392  ASP B CG  1 
ATOM   6191  O  OD1 . ASP B  1 361 ? -25.221 135.745 -2.737  1.00 42.47  ? 392  ASP B OD1 1 
ATOM   6192  O  OD2 . ASP B  1 361 ? -26.891 136.970 -2.058  1.00 35.10  ? 392  ASP B OD2 1 
ATOM   6193  N  N   . GLN B  1 362 ? -24.710 139.242 -2.696  1.00 24.49  ? 393  GLN B N   1 
ATOM   6194  C  CA  . GLN B  1 362 ? -24.165 140.158 -1.691  1.00 22.64  ? 393  GLN B CA  1 
ATOM   6195  C  C   . GLN B  1 362 ? -23.692 139.382 -0.498  1.00 21.42  ? 393  GLN B C   1 
ATOM   6196  O  O   . GLN B  1 362 ? -22.951 139.861 0.344   1.00 23.83  ? 393  GLN B O   1 
ATOM   6197  C  CB  . GLN B  1 362 ? -25.187 141.220 -1.297  1.00 23.42  ? 393  GLN B CB  1 
ATOM   6198  C  CG  . GLN B  1 362 ? -25.531 142.156 -2.441  1.00 25.10  ? 393  GLN B CG  1 
ATOM   6199  C  CD  . GLN B  1 362 ? -24.567 143.322 -2.486  1.00 28.81  ? 393  GLN B CD  1 
ATOM   6200  O  OE1 . GLN B  1 362 ? -24.510 144.113 -1.543  1.00 30.33  ? 393  GLN B OE1 1 
ATOM   6201  N  NE2 . GLN B  1 362 ? -23.815 143.438 -3.569  1.00 31.71  ? 393  GLN B NE2 1 
ATOM   6202  N  N   . GLY B  1 363 ? -24.234 138.177 -0.320  1.00 18.41  ? 394  GLY B N   1 
ATOM   6203  C  CA  . GLY B  1 363 ? -23.875 137.398 0.861   1.00 17.71  ? 394  GLY B CA  1 
ATOM   6204  C  C   . GLY B  1 363 ? -24.266 138.220 2.081   1.00 16.80  ? 394  GLY B C   1 
ATOM   6205  O  O   . GLY B  1 363 ? -25.038 139.171 1.979   1.00 16.85  ? 394  GLY B O   1 
ATOM   6206  N  N   . TYR B  1 364 ? -23.989 137.702 3.276   1.00 16.47  ? 395  TYR B N   1 
ATOM   6207  C  CA  . TYR B  1 364 ? -24.346 138.360 4.513   1.00 18.00  ? 395  TYR B CA  1 
ATOM   6208  C  C   . TYR B  1 364 ? -23.228 138.948 5.306   1.00 19.18  ? 395  TYR B C   1 
ATOM   6209  O  O   . TYR B  1 364 ? -22.096 138.479 5.249   1.00 21.82  ? 395  TYR B O   1 
ATOM   6210  C  CB  . TYR B  1 364 ? -25.216 137.447 5.365   1.00 17.28  ? 395  TYR B CB  1 
ATOM   6211  C  CG  . TYR B  1 364 ? -26.259 136.769 4.527   1.00 16.11  ? 395  TYR B CG  1 
ATOM   6212  C  CD1 . TYR B  1 364 ? -26.020 135.584 3.852   1.00 15.85  ? 395  TYR B CD1 1 
ATOM   6213  C  CD2 . TYR B  1 364 ? -27.511 137.331 4.384   1.00 19.50  ? 395  TYR B CD2 1 
ATOM   6214  C  CE1 . TYR B  1 364 ? -26.963 134.973 3.062   1.00 17.63  ? 395  TYR B CE1 1 
ATOM   6215  C  CE2 . TYR B  1 364 ? -28.479 136.743 3.610   1.00 21.02  ? 395  TYR B CE2 1 
ATOM   6216  C  CZ  . TYR B  1 364 ? -28.203 135.561 2.957   1.00 21.54  ? 395  TYR B CZ  1 
ATOM   6217  O  OH  . TYR B  1 364 ? -29.204 135.001 2.198   1.00 24.41  ? 395  TYR B OH  1 
ATOM   6218  N  N   . SER B  1 365 ? -23.497 140.039 6.034   1.00 18.54  ? 396  SER B N   1 
ATOM   6219  C  CA  . SER B  1 365 ? -22.436 140.654 6.816   1.00 18.18  ? 396  SER B CA  1 
ATOM   6220  C  C   . SER B  1 365 ? -22.179 139.910 8.108   1.00 17.77  ? 396  SER B C   1 
ATOM   6221  O  O   . SER B  1 365 ? -22.993 139.991 9.025   1.00 17.25  ? 396  SER B O   1 
ATOM   6222  C  CB  . SER B  1 365 ? -22.745 142.112 7.141   1.00 19.05  ? 396  SER B CB  1 
ATOM   6223  O  OG  . SER B  1 365 ? -21.915 142.540 8.202   1.00 20.81  ? 396  SER B OG  1 
ATOM   6224  N  N   . LEU B  1 366 ? -20.996 139.285 8.200   1.00 16.61  ? 397  LEU B N   1 
ATOM   6225  C  CA  . LEU B  1 366 ? -20.628 138.603 9.438   1.00 16.03  ? 397  LEU B CA  1 
ATOM   6226  C  C   . LEU B  1 366 ? -20.787 139.544 10.633  1.00 17.05  ? 397  LEU B C   1 
ATOM   6227  O  O   . LEU B  1 366 ? -21.228 139.152 11.719  1.00 17.79  ? 397  LEU B O   1 
ATOM   6228  C  CB  . LEU B  1 366 ? -19.209 138.065 9.393   1.00 15.00  ? 397  LEU B CB  1 
ATOM   6229  C  CG  . LEU B  1 366 ? -18.819 137.101 10.535  1.00 15.00  ? 397  LEU B CG  1 
ATOM   6230  C  CD1 . LEU B  1 366 ? -19.885 136.062 10.758  1.00 16.71  ? 397  LEU B CD1 1 
ATOM   6231  C  CD2 . LEU B  1 366 ? -17.515 136.400 10.146  1.00 15.45  ? 397  LEU B CD2 1 
ATOM   6232  N  N   . PHE B  1 367 ? -20.418 140.812 10.451  1.00 17.60  ? 398  PHE B N   1 
ATOM   6233  C  CA  . PHE B  1 367 ? -20.582 141.819 11.451  1.00 19.97  ? 398  PHE B CA  1 
ATOM   6234  C  C   . PHE B  1 367 ? -22.012 141.991 11.959  1.00 20.06  ? 398  PHE B C   1 
ATOM   6235  O  O   . PHE B  1 367 ? -22.270 141.937 13.161  1.00 19.74  ? 398  PHE B O   1 
ATOM   6236  C  CB  . PHE B  1 367 ? -20.039 143.179 11.004  1.00 22.09  ? 398  PHE B CB  1 
ATOM   6237  C  CG  . PHE B  1 367 ? -20.358 144.253 12.018  1.00 23.92  ? 398  PHE B CG  1 
ATOM   6238  C  CD1 . PHE B  1 367 ? -19.789 144.203 13.278  1.00 24.89  ? 398  PHE B CD1 1 
ATOM   6239  C  CD2 . PHE B  1 367 ? -21.236 145.278 11.737  1.00 23.48  ? 398  PHE B CD2 1 
ATOM   6240  C  CE1 . PHE B  1 367 ? -20.077 145.158 14.224  1.00 23.40  ? 398  PHE B CE1 1 
ATOM   6241  C  CE2 . PHE B  1 367 ? -21.534 146.224 12.683  1.00 22.18  ? 398  PHE B CE2 1 
ATOM   6242  C  CZ  . PHE B  1 367 ? -20.945 146.177 13.933  1.00 22.73  ? 398  PHE B CZ  1 
ATOM   6243  N  N   . LEU B  1 368 ? -22.944 142.200 11.053  1.00 19.30  ? 399  LEU B N   1 
ATOM   6244  C  CA  . LEU B  1 368 ? -24.336 142.356 11.402  1.00 18.13  ? 399  LEU B CA  1 
ATOM   6245  C  C   . LEU B  1 368 ? -24.947 141.121 11.995  1.00 18.53  ? 399  LEU B C   1 
ATOM   6246  O  O   . LEU B  1 368 ? -25.494 141.060 13.112  1.00 19.30  ? 399  LEU B O   1 
ATOM   6247  C  CB  . LEU B  1 368 ? -25.057 142.859 10.149  1.00 16.66  ? 399  LEU B CB  1 
ATOM   6248  C  CG  . LEU B  1 368 ? -24.702 144.266 9.731   1.00 15.07  ? 399  LEU B CG  1 
ATOM   6249  C  CD1 . LEU B  1 368 ? -25.470 144.710 8.504   1.00 15.00  ? 399  LEU B CD1 1 
ATOM   6250  C  CD2 . LEU B  1 368 ? -24.859 145.318 10.803  1.00 15.00  ? 399  LEU B CD2 1 
ATOM   6251  N  N   . VAL B  1 369 ? -24.843 140.003 11.259  1.00 17.68  ? 400  VAL B N   1 
ATOM   6252  C  CA  . VAL B  1 369 ? -25.430 138.757 11.759  1.00 16.13  ? 400  VAL B CA  1 
ATOM   6253  C  C   . VAL B  1 369 ? -24.800 138.347 13.087  1.00 17.55  ? 400  VAL B C   1 
ATOM   6254  O  O   . VAL B  1 369 ? -25.452 137.906 14.002  1.00 17.74  ? 400  VAL B O   1 
ATOM   6255  C  CB  . VAL B  1 369 ? -25.236 137.617 10.733  1.00 15.00  ? 400  VAL B CB  1 
ATOM   6256  C  CG1 . VAL B  1 369 ? -25.893 136.344 11.219  1.00 15.00  ? 400  VAL B CG1 1 
ATOM   6257  C  CG2 . VAL B  1 369 ? -25.641 138.028 9.353   1.00 15.00  ? 400  VAL B CG2 1 
ATOM   6258  N  N   . ALA B  1 370 ? -23.491 138.602 13.213  1.00 17.34  ? 401  ALA B N   1 
ATOM   6259  C  CA  . ALA B  1 370 ? -22.858 138.266 14.487  1.00 16.92  ? 401  ALA B CA  1 
ATOM   6260  C  C   . ALA B  1 370 ? -23.288 139.227 15.584  1.00 17.05  ? 401  ALA B C   1 
ATOM   6261  O  O   . ALA B  1 370 ? -23.636 138.803 16.694  1.00 16.63  ? 401  ALA B O   1 
ATOM   6262  C  CB  . ALA B  1 370 ? -21.357 138.244 14.304  1.00 17.21  ? 401  ALA B CB  1 
ATOM   6263  N  N   . ALA B  1 371 ? -23.345 140.508 15.245  1.00 17.85  ? 402  ALA B N   1 
ATOM   6264  C  CA  . ALA B  1 371 ? -23.723 141.517 16.215  1.00 20.07  ? 402  ALA B CA  1 
ATOM   6265  C  C   . ALA B  1 371 ? -25.098 141.087 16.740  1.00 21.87  ? 402  ALA B C   1 
ATOM   6266  O  O   . ALA B  1 371 ? -25.454 141.292 17.886  1.00 22.18  ? 402  ALA B O   1 
ATOM   6267  C  CB  . ALA B  1 371 ? -23.808 142.895 15.605  1.00 19.23  ? 402  ALA B CB  1 
ATOM   6268  N  N   . HIS B  1 372 ? -25.869 140.506 15.835  1.00 23.45  ? 403  HIS B N   1 
ATOM   6269  C  CA  . HIS B  1 372 ? -27.195 140.020 16.137  1.00 24.57  ? 403  HIS B CA  1 
ATOM   6270  C  C   . HIS B  1 372 ? -27.198 138.833 17.095  1.00 24.98  ? 403  HIS B C   1 
ATOM   6271  O  O   . HIS B  1 372 ? -27.766 138.871 18.172  1.00 24.33  ? 403  HIS B O   1 
ATOM   6272  C  CB  . HIS B  1 372 ? -27.910 139.617 14.841  1.00 25.09  ? 403  HIS B CB  1 
ATOM   6273  C  CG  . HIS B  1 372 ? -29.339 139.271 15.106  1.00 25.52  ? 403  HIS B CG  1 
ATOM   6274  N  ND1 . HIS B  1 372 ? -30.349 140.191 14.942  1.00 27.43  ? 403  HIS B ND1 1 
ATOM   6275  C  CD2 . HIS B  1 372 ? -29.933 138.139 15.499  1.00 25.89  ? 403  HIS B CD2 1 
ATOM   6276  C  CE1 . HIS B  1 372 ? -31.505 139.626 15.233  1.00 27.69  ? 403  HIS B CE1 1 
ATOM   6277  N  NE2 . HIS B  1 372 ? -31.275 138.380 15.585  1.00 25.98  ? 403  HIS B NE2 1 
ATOM   6278  N  N   . GLN B  1 373 ? -26.518 137.752 16.692  1.00 25.73  ? 404  GLN B N   1 
ATOM   6279  C  CA  . GLN B  1 373 ? -26.417 136.552 17.511  1.00 26.44  ? 404  GLN B CA  1 
ATOM   6280  C  C   . GLN B  1 373 ? -25.913 136.893 18.902  1.00 28.04  ? 404  GLN B C   1 
ATOM   6281  O  O   . GLN B  1 373 ? -26.466 136.515 19.924  1.00 29.84  ? 404  GLN B O   1 
ATOM   6282  C  CB  . GLN B  1 373 ? -25.447 135.551 16.890  1.00 27.98  ? 404  GLN B CB  1 
ATOM   6283  C  CG  . GLN B  1 373 ? -25.805 135.179 15.456  1.00 30.64  ? 404  GLN B CG  1 
ATOM   6284  C  CD  . GLN B  1 373 ? -27.259 134.737 15.397  1.00 32.48  ? 404  GLN B CD  1 
ATOM   6285  O  OE1 . GLN B  1 373 ? -27.670 133.948 16.240  1.00 33.63  ? 404  GLN B OE1 1 
ATOM   6286  N  NE2 . GLN B  1 373 ? -27.958 135.272 14.410  1.00 33.08  ? 404  GLN B NE2 1 
ATOM   6287  N  N   . PHE B  1 374 ? -24.806 137.625 18.990  1.00 28.80  ? 405  PHE B N   1 
ATOM   6288  C  CA  . PHE B  1 374 ? -24.281 138.021 20.290  1.00 29.37  ? 405  PHE B CA  1 
ATOM   6289  C  C   . PHE B  1 374 ? -25.367 138.581 21.185  1.00 28.78  ? 405  PHE B C   1 
ATOM   6290  O  O   . PHE B  1 374 ? -25.486 138.241 22.362  1.00 27.36  ? 405  PHE B O   1 
ATOM   6291  C  CB  . PHE B  1 374 ? -23.117 138.982 20.104  1.00 30.72  ? 405  PHE B CB  1 
ATOM   6292  C  CG  . PHE B  1 374 ? -21.941 138.368 19.407  1.00 31.95  ? 405  PHE B CG  1 
ATOM   6293  C  CD1 . PHE B  1 374 ? -21.758 137.002 19.383  1.00 32.36  ? 405  PHE B CD1 1 
ATOM   6294  C  CD2 . PHE B  1 374 ? -20.994 139.161 18.784  1.00 32.48  ? 405  PHE B CD2 1 
ATOM   6295  C  CE1 . PHE B  1 374 ? -20.678 136.427 18.736  1.00 33.11  ? 405  PHE B CE1 1 
ATOM   6296  C  CE2 . PHE B  1 374 ? -19.912 138.601 18.147  1.00 33.34  ? 405  PHE B CE2 1 
ATOM   6297  C  CZ  . PHE B  1 374 ? -19.738 137.229 18.113  1.00 33.76  ? 405  PHE B CZ  1 
ATOM   6298  N  N   . GLY B  1 375 ? -26.203 139.450 20.610  1.00 27.43  ? 406  GLY B N   1 
ATOM   6299  C  CA  . GLY B  1 375 ? -27.267 140.030 21.436  1.00 27.06  ? 406  GLY B CA  1 
ATOM   6300  C  C   . GLY B  1 375 ? -28.068 138.907 22.078  1.00 26.09  ? 406  GLY B C   1 
ATOM   6301  O  O   . GLY B  1 375 ? -28.412 138.969 23.253  1.00 26.83  ? 406  GLY B O   1 
ATOM   6302  N  N   . HIS B  1 376 ? -28.406 137.892 21.282  1.00 25.13  ? 407  HIS B N   1 
ATOM   6303  C  CA  . HIS B  1 376 ? -29.092 136.735 21.849  1.00 23.96  ? 407  HIS B CA  1 
ATOM   6304  C  C   . HIS B  1 376 ? -28.291 136.192 23.035  1.00 24.18  ? 407  HIS B C   1 
ATOM   6305  O  O   . HIS B  1 376 ? -28.828 136.095 24.126  1.00 25.48  ? 407  HIS B O   1 
ATOM   6306  C  CB  . HIS B  1 376 ? -29.223 135.628 20.800  1.00 22.34  ? 407  HIS B CB  1 
ATOM   6307  C  CG  . HIS B  1 376 ? -30.446 135.753 19.970  1.00 24.47  ? 407  HIS B CG  1 
ATOM   6308  N  ND1 . HIS B  1 376 ? -31.382 136.748 20.171  1.00 26.48  ? 407  HIS B ND1 1 
ATOM   6309  C  CD2 . HIS B  1 376 ? -30.906 135.011 18.947  1.00 24.89  ? 407  HIS B CD2 1 
ATOM   6310  C  CE1 . HIS B  1 376 ? -32.355 136.615 19.302  1.00 24.72  ? 407  HIS B CE1 1 
ATOM   6311  N  NE2 . HIS B  1 376 ? -32.101 135.558 18.558  1.00 22.54  ? 407  HIS B NE2 1 
ATOM   6312  N  N   . ALA B  1 377 ? -27.043 135.853 22.778  1.00 24.23  ? 408  ALA B N   1 
ATOM   6313  C  CA  . ALA B  1 377 ? -26.144 135.326 23.785  1.00 25.46  ? 408  ALA B CA  1 
ATOM   6314  C  C   . ALA B  1 377 ? -26.056 136.179 25.031  1.00 26.19  ? 408  ALA B C   1 
ATOM   6315  O  O   . ALA B  1 377 ? -25.556 135.746 26.080  1.00 26.26  ? 408  ALA B O   1 
ATOM   6316  C  CB  . ALA B  1 377 ? -24.758 135.143 23.164  1.00 24.48  ? 408  ALA B CB  1 
ATOM   6317  N  N   . MET B  1 378 ? -26.538 137.423 24.986  1.00 26.14  ? 409  MET B N   1 
ATOM   6318  C  CA  . MET B  1 378 ? -26.548 138.283 26.144  1.00 27.13  ? 409  MET B CA  1 
ATOM   6319  C  C   . MET B  1 378 ? -27.920 138.262 26.808  1.00 26.88  ? 409  MET B C   1 
ATOM   6320  O  O   . MET B  1 378 ? -28.166 139.011 27.755  1.00 26.98  ? 409  MET B O   1 
ATOM   6321  C  CB  . MET B  1 378 ? -26.121 139.710 25.827  1.00 27.37  ? 409  MET B CB  1 
ATOM   6322  C  CG  . MET B  1 378 ? -24.759 139.856 25.175  1.00 29.01  ? 409  MET B CG  1 
ATOM   6323  S  SD  . MET B  1 378 ? -23.483 138.874 26.037  1.00 29.24  ? 409  MET B SD  1 
ATOM   6324  C  CE  . MET B  1 378 ? -23.528 139.730 27.607  1.00 31.54  ? 409  MET B CE  1 
ATOM   6325  N  N   . GLY B  1 379 ? -28.792 137.398 26.332  1.00 26.87  ? 410  GLY B N   1 
ATOM   6326  C  CA  . GLY B  1 379 ? -30.115 137.190 26.843  1.00 26.53  ? 410  GLY B CA  1 
ATOM   6327  C  C   . GLY B  1 379 ? -31.196 137.929 26.076  1.00 27.10  ? 410  GLY B C   1 
ATOM   6328  O  O   . GLY B  1 379 ? -32.355 137.961 26.496  1.00 28.28  ? 410  GLY B O   1 
ATOM   6329  N  N   . LEU B  1 380 ? -30.842 138.532 24.950  1.00 26.76  ? 411  LEU B N   1 
ATOM   6330  C  CA  . LEU B  1 380 ? -31.852 139.267 24.186  1.00 25.92  ? 411  LEU B CA  1 
ATOM   6331  C  C   . LEU B  1 380 ? -32.708 138.341 23.341  1.00 28.24  ? 411  LEU B C   1 
ATOM   6332  O  O   . LEU B  1 380 ? -32.317 137.220 23.016  1.00 29.19  ? 411  LEU B O   1 
ATOM   6333  C  CB  . LEU B  1 380 ? -31.198 140.267 23.262  1.00 22.72  ? 411  LEU B CB  1 
ATOM   6334  C  CG  . LEU B  1 380 ? -30.603 141.534 23.885  1.00 19.78  ? 411  LEU B CG  1 
ATOM   6335  C  CD1 . LEU B  1 380 ? -30.117 142.384 22.718  1.00 18.13  ? 411  LEU B CD1 1 
ATOM   6336  C  CD2 . LEU B  1 380 ? -31.627 142.245 24.746  1.00 16.12  ? 411  LEU B CD2 1 
ATOM   6337  N  N   . GLU B  1 381 ? -33.861 138.849 22.916  1.00 30.29  ? 412  GLU B N   1 
ATOM   6338  C  CA  . GLU B  1 381 ? -34.771 138.033 22.105  1.00 32.64  ? 412  GLU B CA  1 
ATOM   6339  C  C   . GLU B  1 381 ? -35.243 138.915 20.945  1.00 31.84  ? 412  GLU B C   1 
ATOM   6340  O  O   . GLU B  1 381 ? -35.079 140.130 21.061  1.00 31.79  ? 412  GLU B O   1 
ATOM   6341  C  CB  . GLU B  1 381 ? -35.976 137.620 22.951  1.00 36.20  ? 412  GLU B CB  1 
ATOM   6342  C  CG  . GLU B  1 381 ? -36.251 136.131 22.959  1.00 42.60  ? 412  GLU B CG  1 
ATOM   6343  C  CD  . GLU B  1 381 ? -35.582 135.432 24.128  1.00 47.18  ? 412  GLU B CD  1 
ATOM   6344  O  OE1 . GLU B  1 381 ? -34.340 135.497 24.230  1.00 47.91  ? 412  GLU B OE1 1 
ATOM   6345  O  OE2 . GLU B  1 381 ? -36.298 134.813 24.945  1.00 50.60  ? 412  GLU B OE2 1 
ATOM   6346  N  N   . HIS B  1 382 ? -35.833 138.311 19.938  1.00 31.05  ? 413  HIS B N   1 
ATOM   6347  C  CA  . HIS B  1 382 ? -36.284 139.002 18.752  1.00 32.37  ? 413  HIS B CA  1 
ATOM   6348  C  C   . HIS B  1 382 ? -37.203 140.180 19.031  1.00 32.91  ? 413  HIS B C   1 
ATOM   6349  O  O   . HIS B  1 382 ? -38.029 140.165 19.935  1.00 34.73  ? 413  HIS B O   1 
ATOM   6350  C  CB  . HIS B  1 382 ? -36.967 138.020 17.810  1.00 35.09  ? 413  HIS B CB  1 
ATOM   6351  C  CG  . HIS B  1 382 ? -35.997 137.182 17.049  1.00 38.21  ? 413  HIS B CG  1 
ATOM   6352  N  ND1 . HIS B  1 382 ? -36.306 135.933 16.574  1.00 40.12  ? 413  HIS B ND1 1 
ATOM   6353  C  CD2 . HIS B  1 382 ? -34.718 137.439 16.683  1.00 40.17  ? 413  HIS B CD2 1 
ATOM   6354  C  CE1 . HIS B  1 382 ? -35.251 135.447 15.937  1.00 41.80  ? 413  HIS B CE1 1 
ATOM   6355  N  NE2 . HIS B  1 382 ? -34.291 136.344 15.988  1.00 40.71  ? 413  HIS B NE2 1 
ATOM   6356  N  N   . SER B  1 383 ? -37.051 141.198 18.203  1.00 31.57  ? 414  SER B N   1 
ATOM   6357  C  CA  . SER B  1 383 ? -37.777 142.443 18.247  1.00 30.96  ? 414  SER B CA  1 
ATOM   6358  C  C   . SER B  1 383 ? -38.738 142.498 17.062  1.00 32.66  ? 414  SER B C   1 
ATOM   6359  O  O   . SER B  1 383 ? -38.418 141.972 16.006  1.00 31.18  ? 414  SER B O   1 
ATOM   6360  C  CB  . SER B  1 383 ? -36.813 143.634 18.157  1.00 31.15  ? 414  SER B CB  1 
ATOM   6361  O  OG  . SER B  1 383 ? -37.482 144.837 17.817  1.00 28.27  ? 414  SER B OG  1 
ATOM   6362  N  N   . GLN B  1 384 ? -39.864 143.169 17.279  1.00 34.82  ? 415  GLN B N   1 
ATOM   6363  C  CA  . GLN B  1 384 ? -40.852 143.292 16.215  1.00 36.24  ? 415  GLN B CA  1 
ATOM   6364  C  C   . GLN B  1 384 ? -40.567 144.524 15.371  1.00 36.26  ? 415  GLN B C   1 
ATOM   6365  O  O   . GLN B  1 384 ? -41.192 144.699 14.330  1.00 36.17  ? 415  GLN B O   1 
ATOM   6366  C  CB  . GLN B  1 384 ? -42.261 143.328 16.779  1.00 37.67  ? 415  GLN B CB  1 
ATOM   6367  C  CG  . GLN B  1 384 ? -42.730 142.020 17.386  1.00 40.28  ? 415  GLN B CG  1 
ATOM   6368  C  CD  . GLN B  1 384 ? -44.126 142.104 17.963  1.00 42.58  ? 415  GLN B CD  1 
ATOM   6369  O  OE1 . GLN B  1 384 ? -44.498 141.230 18.748  1.00 45.41  ? 415  GLN B OE1 1 
ATOM   6370  N  NE2 . GLN B  1 384 ? -44.893 143.122 17.598  1.00 42.92  ? 415  GLN B NE2 1 
ATOM   6371  N  N   . ASP B  1 385 ? -39.661 145.359 15.851  1.00 36.72  ? 416  ASP B N   1 
ATOM   6372  C  CA  . ASP B  1 385 ? -39.260 146.555 15.106  1.00 37.07  ? 416  ASP B CA  1 
ATOM   6373  C  C   . ASP B  1 385 ? -38.448 146.098 13.902  1.00 37.54  ? 416  ASP B C   1 
ATOM   6374  O  O   . ASP B  1 385 ? -37.322 145.631 14.069  1.00 38.22  ? 416  ASP B O   1 
ATOM   6375  C  CB  . ASP B  1 385 ? -38.385 147.447 15.992  1.00 38.14  ? 416  ASP B CB  1 
ATOM   6376  C  CG  . ASP B  1 385 ? -37.913 148.694 15.278  1.00 40.09  ? 416  ASP B CG  1 
ATOM   6377  O  OD1 . ASP B  1 385 ? -37.666 148.651 14.057  1.00 40.13  ? 416  ASP B OD1 1 
ATOM   6378  O  OD2 . ASP B  1 385 ? -37.783 149.738 15.944  1.00 42.08  ? 416  ASP B OD2 1 
ATOM   6379  N  N   . PRO B  1 386 ? -38.961 146.264 12.700  1.00 36.98  ? 417  PRO B N   1 
ATOM   6380  C  CA  . PRO B  1 386 ? -38.249 145.816 11.516  1.00 35.63  ? 417  PRO B CA  1 
ATOM   6381  C  C   . PRO B  1 386 ? -36.860 146.396 11.389  1.00 34.74  ? 417  PRO B C   1 
ATOM   6382  O  O   . PRO B  1 386 ? -35.998 145.787 10.742  1.00 34.82  ? 417  PRO B O   1 
ATOM   6383  C  CB  . PRO B  1 386 ? -39.160 146.186 10.367  1.00 36.46  ? 417  PRO B CB  1 
ATOM   6384  C  CG  . PRO B  1 386 ? -40.513 146.332 10.971  1.00 36.87  ? 417  PRO B CG  1 
ATOM   6385  C  CD  . PRO B  1 386 ? -40.294 146.821 12.375  1.00 36.88  ? 417  PRO B CD  1 
ATOM   6386  N  N   . GLY B  1 387 ? -36.573 147.541 11.992  1.00 32.44  ? 418  GLY B N   1 
ATOM   6387  C  CA  . GLY B  1 387 ? -35.272 148.149 11.913  1.00 32.51  ? 418  GLY B CA  1 
ATOM   6388  C  C   . GLY B  1 387 ? -34.352 147.842 13.079  1.00 33.75  ? 418  GLY B C   1 
ATOM   6389  O  O   . GLY B  1 387 ? -33.159 148.173 13.034  1.00 34.48  ? 418  GLY B O   1 
ATOM   6390  N  N   . ALA B  1 388 ? -34.862 147.223 14.140  1.00 33.49  ? 419  ALA B N   1 
ATOM   6391  C  CA  . ALA B  1 388 ? -34.021 146.892 15.284  1.00 31.90  ? 419  ALA B CA  1 
ATOM   6392  C  C   . ALA B  1 388 ? -32.993 145.837 14.925  1.00 31.04  ? 419  ALA B C   1 
ATOM   6393  O  O   . ALA B  1 388 ? -33.171 144.965 14.083  1.00 30.36  ? 419  ALA B O   1 
ATOM   6394  C  CB  . ALA B  1 388 ? -34.827 146.466 16.493  1.00 32.31  ? 419  ALA B CB  1 
ATOM   6395  N  N   . LEU B  1 389 ? -31.860 145.902 15.622  1.00 31.14  ? 420  LEU B N   1 
ATOM   6396  C  CA  . LEU B  1 389 ? -30.786 144.954 15.334  1.00 28.90  ? 420  LEU B CA  1 
ATOM   6397  C  C   . LEU B  1 389 ? -31.259 143.561 15.698  1.00 27.27  ? 420  LEU B C   1 
ATOM   6398  O  O   . LEU B  1 389 ? -30.806 142.588 15.110  1.00 28.46  ? 420  LEU B O   1 
ATOM   6399  C  CB  . LEU B  1 389 ? -29.525 145.306 16.133  1.00 28.86  ? 420  LEU B CB  1 
ATOM   6400  C  CG  . LEU B  1 389 ? -28.458 144.199 16.008  1.00 28.51  ? 420  LEU B CG  1 
ATOM   6401  C  CD1 . LEU B  1 389 ? -28.054 144.078 14.543  1.00 27.50  ? 420  LEU B CD1 1 
ATOM   6402  C  CD2 . LEU B  1 389 ? -27.253 144.512 16.865  1.00 31.69  ? 420  LEU B CD2 1 
ATOM   6403  N  N   . MET B  1 390 ? -32.191 143.495 16.647  1.00 24.64  ? 421  MET B N   1 
ATOM   6404  C  CA  . MET B  1 390 ? -32.713 142.215 17.101  1.00 22.96  ? 421  MET B CA  1 
ATOM   6405  C  C   . MET B  1 390 ? -33.905 141.722 16.311  1.00 22.37  ? 421  MET B C   1 
ATOM   6406  O  O   . MET B  1 390 ? -34.588 140.805 16.750  1.00 22.20  ? 421  MET B O   1 
ATOM   6407  C  CB  . MET B  1 390 ? -33.101 142.336 18.588  1.00 21.56  ? 421  MET B CB  1 
ATOM   6408  C  CG  . MET B  1 390 ? -31.812 142.370 19.421  1.00 21.05  ? 421  MET B CG  1 
ATOM   6409  S  SD  . MET B  1 390 ? -30.643 141.229 18.672  1.00 21.01  ? 421  MET B SD  1 
ATOM   6410  C  CE  . MET B  1 390 ? -30.637 139.981 19.981  1.00 22.49  ? 421  MET B CE  1 
ATOM   6411  N  N   . ALA B  1 391 ? -34.079 142.265 15.150  1.00 22.22  ? 422  ALA B N   1 
ATOM   6412  C  CA  . ALA B  1 391 ? -35.191 141.906 14.264  1.00 23.47  ? 422  ALA B CA  1 
ATOM   6413  C  C   . ALA B  1 391 ? -34.779 140.590 13.602  1.00 24.77  ? 422  ALA B C   1 
ATOM   6414  O  O   . ALA B  1 391 ? -33.642 140.518 13.145  1.00 25.59  ? 422  ALA B O   1 
ATOM   6415  C  CB  . ALA B  1 391 ? -35.287 142.989 13.180  1.00 23.46  ? 422  ALA B CB  1 
ATOM   6416  N  N   . PRO B  1 392 ? -35.673 139.635 13.459  1.00 24.94  ? 423  PRO B N   1 
ATOM   6417  C  CA  . PRO B  1 392 ? -35.350 138.370 12.827  1.00 24.55  ? 423  PRO B CA  1 
ATOM   6418  C  C   . PRO B  1 392 ? -34.865 138.490 11.404  1.00 25.20  ? 423  PRO B C   1 
ATOM   6419  O  O   . PRO B  1 392 ? -33.738 138.084 11.113  1.00 24.74  ? 423  PRO B O   1 
ATOM   6420  C  CB  . PRO B  1 392 ? -36.625 137.554 12.968  1.00 24.54  ? 423  PRO B CB  1 
ATOM   6421  C  CG  . PRO B  1 392 ? -37.281 138.119 14.186  1.00 24.33  ? 423  PRO B CG  1 
ATOM   6422  C  CD  . PRO B  1 392 ? -37.014 139.613 14.082  1.00 25.59  ? 423  PRO B CD  1 
ATOM   6423  N  N   . ILE B  1 393 ? -35.667 139.016 10.484  1.00 26.74  ? 424  ILE B N   1 
ATOM   6424  C  CA  . ILE B  1 393 ? -35.222 139.121 9.096   1.00 28.83  ? 424  ILE B CA  1 
ATOM   6425  C  C   . ILE B  1 393 ? -33.922 139.902 8.969   1.00 30.72  ? 424  ILE B C   1 
ATOM   6426  O  O   . ILE B  1 393 ? -33.630 140.784 9.775   1.00 31.75  ? 424  ILE B O   1 
ATOM   6427  C  CB  . ILE B  1 393 ? -36.284 139.713 8.171   1.00 27.78  ? 424  ILE B CB  1 
ATOM   6428  C  CG1 . ILE B  1 393 ? -37.661 139.128 8.434   1.00 28.31  ? 424  ILE B CG1 1 
ATOM   6429  C  CG2 . ILE B  1 393 ? -35.861 139.531 6.723   1.00 25.96  ? 424  ILE B CG2 1 
ATOM   6430  C  CD1 . ILE B  1 393 ? -38.004 137.854 7.728   1.00 28.27  ? 424  ILE B CD1 1 
ATOM   6431  N  N   . TYR B  1 394 ? -33.095 139.570 7.972   1.00 31.96  ? 425  TYR B N   1 
ATOM   6432  C  CA  . TYR B  1 394 ? -31.809 140.228 7.783   1.00 31.83  ? 425  TYR B CA  1 
ATOM   6433  C  C   . TYR B  1 394 ? -31.886 141.326 6.724   1.00 32.27  ? 425  TYR B C   1 
ATOM   6434  O  O   . TYR B  1 394 ? -32.314 141.053 5.604   1.00 34.05  ? 425  TYR B O   1 
ATOM   6435  C  CB  . TYR B  1 394 ? -30.708 139.239 7.391   1.00 29.04  ? 425  TYR B CB  1 
ATOM   6436  C  CG  . TYR B  1 394 ? -29.480 139.859 6.769   1.00 26.46  ? 425  TYR B CG  1 
ATOM   6437  C  CD1 . TYR B  1 394 ? -29.411 140.161 5.418   1.00 23.97  ? 425  TYR B CD1 1 
ATOM   6438  C  CD2 . TYR B  1 394 ? -28.366 140.167 7.539   1.00 26.64  ? 425  TYR B CD2 1 
ATOM   6439  C  CE1 . TYR B  1 394 ? -28.286 140.745 4.850   1.00 24.21  ? 425  TYR B CE1 1 
ATOM   6440  C  CE2 . TYR B  1 394 ? -27.249 140.747 6.989   1.00 25.87  ? 425  TYR B CE2 1 
ATOM   6441  C  CZ  . TYR B  1 394 ? -27.207 141.025 5.646   1.00 25.89  ? 425  TYR B CZ  1 
ATOM   6442  O  OH  . TYR B  1 394 ? -26.055 141.602 5.153   1.00 22.42  ? 425  TYR B OH  1 
ATOM   6443  N  N   . THR B  1 395 ? -31.382 142.497 7.081   1.00 30.81  ? 426  THR B N   1 
ATOM   6444  C  CA  . THR B  1 395 ? -31.302 143.625 6.166   1.00 29.48  ? 426  THR B CA  1 
ATOM   6445  C  C   . THR B  1 395 ? -29.973 144.346 6.368   1.00 27.69  ? 426  THR B C   1 
ATOM   6446  O  O   . THR B  1 395 ? -29.598 144.667 7.496   1.00 25.96  ? 426  THR B O   1 
ATOM   6447  C  CB  . THR B  1 395 ? -32.450 144.626 6.374   1.00 31.26  ? 426  THR B CB  1 
ATOM   6448  O  OG1 . THR B  1 395 ? -32.665 144.865 7.769   1.00 33.34  ? 426  THR B OG1 1 
ATOM   6449  C  CG2 . THR B  1 395 ? -33.727 144.138 5.716   1.00 30.83  ? 426  THR B CG2 1 
ATOM   6450  N  N   . TYR B  1 396 ? -29.259 144.595 5.288   1.00 26.80  ? 427  TYR B N   1 
ATOM   6451  C  CA  . TYR B  1 396 ? -27.971 145.255 5.357   1.00 27.26  ? 427  TYR B CA  1 
ATOM   6452  C  C   . TYR B  1 396 ? -28.079 146.749 5.583   1.00 29.24  ? 427  TYR B C   1 
ATOM   6453  O  O   . TYR B  1 396 ? -28.978 147.423 5.086   1.00 29.81  ? 427  TYR B O   1 
ATOM   6454  C  CB  . TYR B  1 396 ? -27.152 144.963 4.096   1.00 26.83  ? 427  TYR B CB  1 
ATOM   6455  C  CG  . TYR B  1 396 ? -25.847 145.724 4.048   1.00 26.48  ? 427  TYR B CG  1 
ATOM   6456  C  CD1 . TYR B  1 396 ? -24.954 145.696 5.113   1.00 27.69  ? 427  TYR B CD1 1 
ATOM   6457  C  CD2 . TYR B  1 396 ? -25.498 146.474 2.941   1.00 26.78  ? 427  TYR B CD2 1 
ATOM   6458  C  CE1 . TYR B  1 396 ? -23.771 146.394 5.076   1.00 29.21  ? 427  TYR B CE1 1 
ATOM   6459  C  CE2 . TYR B  1 396 ? -24.312 147.179 2.887   1.00 28.14  ? 427  TYR B CE2 1 
ATOM   6460  C  CZ  . TYR B  1 396 ? -23.452 147.133 3.960   1.00 28.86  ? 427  TYR B CZ  1 
ATOM   6461  O  OH  . TYR B  1 396 ? -22.264 147.833 3.907   1.00 27.40  ? 427  TYR B OH  1 
ATOM   6462  N  N   . THR B  1 397 ? -27.123 147.278 6.345   1.00 31.72  ? 428  THR B N   1 
ATOM   6463  C  CA  . THR B  1 397 ? -27.051 148.708 6.610   1.00 34.42  ? 428  THR B CA  1 
ATOM   6464  C  C   . THR B  1 397 ? -25.607 149.177 6.446   1.00 37.77  ? 428  THR B C   1 
ATOM   6465  O  O   . THR B  1 397 ? -24.742 148.732 7.194   1.00 39.19  ? 428  THR B O   1 
ATOM   6466  C  CB  . THR B  1 397 ? -27.482 149.045 8.050   1.00 33.75  ? 428  THR B CB  1 
ATOM   6467  O  OG1 . THR B  1 397 ? -28.002 147.875 8.688   1.00 33.64  ? 428  THR B OG1 1 
ATOM   6468  C  CG2 . THR B  1 397 ? -28.528 150.142 8.029   1.00 32.51  ? 428  THR B CG2 1 
ATOM   6469  N  N   . LYS B  1 398 ? -25.349 150.011 5.463   1.00 41.61  ? 429  LYS B N   1 
ATOM   6470  C  CA  . LYS B  1 398 ? -24.016 150.549 5.206   1.00 42.76  ? 429  LYS B CA  1 
ATOM   6471  C  C   . LYS B  1 398 ? -23.437 151.161 6.474   1.00 43.09  ? 429  LYS B C   1 
ATOM   6472  O  O   . LYS B  1 398 ? -22.331 150.837 6.896   1.00 43.24  ? 429  LYS B O   1 
ATOM   6473  C  CB  . LYS B  1 398 ? -24.091 151.589 4.091   1.00 44.11  ? 429  LYS B CB  1 
ATOM   6474  C  CG  . LYS B  1 398 ? -23.077 151.407 2.977   1.00 46.39  ? 429  LYS B CG  1 
ATOM   6475  C  CD  . LYS B  1 398 ? -21.678 151.764 3.449   1.00 48.72  ? 429  LYS B CD  1 
ATOM   6476  C  CE  . LYS B  1 398 ? -20.896 152.540 2.408   1.00 50.31  ? 429  LYS B CE  1 
ATOM   6477  N  NZ  . LYS B  1 398 ? -21.517 153.859 2.091   1.00 50.13  ? 429  LYS B NZ  1 
ATOM   6478  N  N   . ASN B  1 399 ? -24.182 152.055 7.109   1.00 44.02  ? 430  ASN B N   1 
ATOM   6479  C  CA  . ASN B  1 399 ? -23.718 152.676 8.349   1.00 45.61  ? 430  ASN B CA  1 
ATOM   6480  C  C   . ASN B  1 399 ? -24.622 152.235 9.496   1.00 44.16  ? 430  ASN B C   1 
ATOM   6481  O  O   . ASN B  1 399 ? -25.730 152.742 9.650   1.00 44.40  ? 430  ASN B O   1 
ATOM   6482  C  CB  . ASN B  1 399 ? -23.734 154.201 8.244   1.00 49.10  ? 430  ASN B CB  1 
ATOM   6483  C  CG  . ASN B  1 399 ? -22.787 154.836 9.246   1.00 52.48  ? 430  ASN B CG  1 
ATOM   6484  O  OD1 . ASN B  1 399 ? -21.567 154.692 9.141   1.00 54.05  ? 430  ASN B OD1 1 
ATOM   6485  N  ND2 . ASN B  1 399 ? -23.337 155.532 10.233  1.00 53.28  ? 430  ASN B ND2 1 
ATOM   6486  N  N   . PHE B  1 400 ? -24.148 151.268 10.263  1.00 42.59  ? 431  PHE B N   1 
ATOM   6487  C  CA  . PHE B  1 400 ? -24.966 150.679 11.300  1.00 42.33  ? 431  PHE B CA  1 
ATOM   6488  C  C   . PHE B  1 400 ? -25.053 151.521 12.551  1.00 44.17  ? 431  PHE B C   1 
ATOM   6489  O  O   . PHE B  1 400 ? -24.087 152.114 12.996  1.00 44.63  ? 431  PHE B O   1 
ATOM   6490  C  CB  . PHE B  1 400 ? -24.464 149.284 11.655  1.00 39.35  ? 431  PHE B CB  1 
ATOM   6491  C  CG  . PHE B  1 400 ? -25.161 148.648 12.817  1.00 36.40  ? 431  PHE B CG  1 
ATOM   6492  C  CD1 . PHE B  1 400 ? -26.390 148.055 12.664  1.00 34.97  ? 431  PHE B CD1 1 
ATOM   6493  C  CD2 . PHE B  1 400 ? -24.591 148.629 14.070  1.00 36.26  ? 431  PHE B CD2 1 
ATOM   6494  C  CE1 . PHE B  1 400 ? -27.032 147.478 13.742  1.00 35.56  ? 431  PHE B CE1 1 
ATOM   6495  C  CE2 . PHE B  1 400 ? -25.213 148.044 15.154  1.00 35.99  ? 431  PHE B CE2 1 
ATOM   6496  C  CZ  . PHE B  1 400 ? -26.445 147.461 14.983  1.00 36.06  ? 431  PHE B CZ  1 
ATOM   6497  N  N   . ARG B  1 401 ? -26.229 151.505 13.155  1.00 46.42  ? 432  ARG B N   1 
ATOM   6498  C  CA  . ARG B  1 401 ? -26.412 152.203 14.432  1.00 47.22  ? 432  ARG B CA  1 
ATOM   6499  C  C   . ARG B  1 401 ? -27.377 151.339 15.246  1.00 44.63  ? 432  ARG B C   1 
ATOM   6500  O  O   . ARG B  1 401 ? -28.314 150.793 14.667  1.00 44.40  ? 432  ARG B O   1 
ATOM   6501  C  CB  . ARG B  1 401 ? -27.008 153.584 14.197  1.00 52.64  ? 432  ARG B CB  1 
ATOM   6502  C  CG  . ARG B  1 401 ? -28.471 153.573 13.773  1.00 60.05  ? 432  ARG B CG  1 
ATOM   6503  C  CD  . ARG B  1 401 ? -28.901 154.932 13.247  1.00 68.20  ? 432  ARG B CD  1 
ATOM   6504  N  NE  . ARG B  1 401 ? -30.276 154.916 12.739  1.00 74.83  ? 432  ARG B NE  1 
ATOM   6505  C  CZ  . ARG B  1 401 ? -30.905 156.006 12.297  1.00 77.14  ? 432  ARG B CZ  1 
ATOM   6506  N  NH1 . ARG B  1 401 ? -30.277 157.178 12.305  1.00 76.53  ? 432  ARG B NH1 1 
ATOM   6507  N  NH2 . ARG B  1 401 ? -32.155 155.928 11.853  1.00 78.98  ? 432  ARG B NH2 1 
ATOM   6508  N  N   . LEU B  1 402 ? -27.063 151.140 16.515  1.00 42.10  ? 433  LEU B N   1 
ATOM   6509  C  CA  . LEU B  1 402 ? -27.985 150.330 17.320  1.00 40.28  ? 433  LEU B CA  1 
ATOM   6510  C  C   . LEU B  1 402 ? -29.326 151.068 17.368  1.00 42.10  ? 433  LEU B C   1 
ATOM   6511  O  O   . LEU B  1 402 ? -29.363 152.267 17.109  1.00 42.41  ? 433  LEU B O   1 
ATOM   6512  C  CB  . LEU B  1 402 ? -27.464 150.114 18.724  1.00 36.15  ? 433  LEU B CB  1 
ATOM   6513  C  CG  . LEU B  1 402 ? -27.049 148.699 19.108  1.00 31.34  ? 433  LEU B CG  1 
ATOM   6514  C  CD1 . LEU B  1 402 ? -27.095 148.543 20.619  1.00 28.60  ? 433  LEU B CD1 1 
ATOM   6515  C  CD2 . LEU B  1 402 ? -27.967 147.683 18.457  1.00 31.02  ? 433  LEU B CD2 1 
ATOM   6516  N  N   . SER B  1 403 ? -30.379 150.324 17.648  1.00 43.47  ? 434  SER B N   1 
ATOM   6517  C  CA  . SER B  1 403 ? -31.719 150.886 17.711  1.00 45.81  ? 434  SER B CA  1 
ATOM   6518  C  C   . SER B  1 403 ? -32.145 151.094 19.156  1.00 46.99  ? 434  SER B C   1 
ATOM   6519  O  O   . SER B  1 403 ? -31.907 150.238 20.017  1.00 48.67  ? 434  SER B O   1 
ATOM   6520  C  CB  . SER B  1 403 ? -32.716 149.972 16.997  1.00 46.38  ? 434  SER B CB  1 
ATOM   6521  O  OG  . SER B  1 403 ? -34.018 150.159 17.541  1.00 49.71  ? 434  SER B OG  1 
ATOM   6522  N  N   . GLN B  1 404 ? -32.811 152.216 19.412  1.00 46.54  ? 435  GLN B N   1 
ATOM   6523  C  CA  . GLN B  1 404 ? -33.321 152.524 20.741  1.00 46.91  ? 435  GLN B CA  1 
ATOM   6524  C  C   . GLN B  1 404 ? -34.024 151.318 21.352  1.00 43.93  ? 435  GLN B C   1 
ATOM   6525  O  O   . GLN B  1 404 ? -33.963 151.023 22.533  1.00 41.09  ? 435  GLN B O   1 
ATOM   6526  C  CB  . GLN B  1 404 ? -34.268 153.724 20.687  1.00 53.16  ? 435  GLN B CB  1 
ATOM   6527  C  CG  . GLN B  1 404 ? -34.665 154.263 22.052  1.00 60.98  ? 435  GLN B CG  1 
ATOM   6528  C  CD  . GLN B  1 404 ? -33.521 154.966 22.755  1.00 65.07  ? 435  GLN B CD  1 
ATOM   6529  O  OE1 . GLN B  1 404 ? -32.417 155.063 22.220  1.00 65.80  ? 435  GLN B OE1 1 
ATOM   6530  N  NE2 . GLN B  1 404 ? -33.561 155.530 23.957  1.00 66.63  ? 435  GLN B NE2 1 
ATOM   6531  N  N   . ASP B  1 405 ? -34.694 150.567 20.476  1.00 42.52  ? 436  ASP B N   1 
ATOM   6532  C  CA  . ASP B  1 405 ? -35.320 149.335 20.941  1.00 44.23  ? 436  ASP B CA  1 
ATOM   6533  C  C   . ASP B  1 405 ? -34.242 148.429 21.531  1.00 44.08  ? 436  ASP B C   1 
ATOM   6534  O  O   . ASP B  1 405 ? -34.404 147.897 22.625  1.00 46.10  ? 436  ASP B O   1 
ATOM   6535  C  CB  . ASP B  1 405 ? -36.012 148.632 19.771  1.00 44.98  ? 436  ASP B CB  1 
ATOM   6536  C  CG  . ASP B  1 405 ? -36.810 147.428 20.233  1.00 45.20  ? 436  ASP B CG  1 
ATOM   6537  O  OD1 . ASP B  1 405 ? -37.707 147.587 21.079  1.00 43.89  ? 436  ASP B OD1 1 
ATOM   6538  O  OD2 . ASP B  1 405 ? -36.518 146.325 19.730  1.00 46.10  ? 436  ASP B OD2 1 
ATOM   6539  N  N   . ASP B  1 406 ? -33.149 148.282 20.781  1.00 42.03  ? 437  ASP B N   1 
ATOM   6540  C  CA  . ASP B  1 406 ? -32.043 147.436 21.195  1.00 37.64  ? 437  ASP B CA  1 
ATOM   6541  C  C   . ASP B  1 406 ? -31.353 147.992 22.432  1.00 36.06  ? 437  ASP B C   1 
ATOM   6542  O  O   . ASP B  1 406 ? -31.167 147.264 23.404  1.00 36.16  ? 437  ASP B O   1 
ATOM   6543  C  CB  . ASP B  1 406 ? -30.997 147.311 20.099  1.00 36.36  ? 437  ASP B CB  1 
ATOM   6544  C  CG  . ASP B  1 406 ? -31.556 146.739 18.819  1.00 36.37  ? 437  ASP B CG  1 
ATOM   6545  O  OD1 . ASP B  1 406 ? -32.043 145.588 18.837  1.00 35.17  ? 437  ASP B OD1 1 
ATOM   6546  O  OD2 . ASP B  1 406 ? -31.500 147.470 17.811  1.00 36.64  ? 437  ASP B OD2 1 
ATOM   6547  N  N   . ILE B  1 407 ? -30.975 149.275 22.374  1.00 33.59  ? 438  ILE B N   1 
ATOM   6548  C  CA  . ILE B  1 407 ? -30.306 149.846 23.553  1.00 32.50  ? 438  ILE B CA  1 
ATOM   6549  C  C   . ILE B  1 407 ? -31.180 149.560 24.771  1.00 34.08  ? 438  ILE B C   1 
ATOM   6550  O  O   . ILE B  1 407 ? -30.743 149.040 25.793  1.00 35.30  ? 438  ILE B O   1 
ATOM   6551  C  CB  . ILE B  1 407 ? -30.053 151.344 23.424  1.00 29.36  ? 438  ILE B CB  1 
ATOM   6552  C  CG1 . ILE B  1 407 ? -28.974 151.646 22.378  1.00 28.46  ? 438  ILE B CG1 1 
ATOM   6553  C  CG2 . ILE B  1 407 ? -29.586 151.933 24.752  1.00 27.94  ? 438  ILE B CG2 1 
ATOM   6554  C  CD1 . ILE B  1 407 ? -29.503 152.152 21.064  1.00 29.65  ? 438  ILE B CD1 1 
ATOM   6555  N  N   . LYS B  1 408 ? -32.473 149.830 24.601  1.00 34.85  ? 439  LYS B N   1 
ATOM   6556  C  CA  . LYS B  1 408 ? -33.430 149.594 25.677  1.00 36.27  ? 439  LYS B CA  1 
ATOM   6557  C  C   . LYS B  1 408 ? -33.393 148.150 26.150  1.00 35.77  ? 439  LYS B C   1 
ATOM   6558  O  O   . LYS B  1 408 ? -33.245 147.867 27.338  1.00 34.87  ? 439  LYS B O   1 
ATOM   6559  C  CB  . LYS B  1 408 ? -34.836 149.983 25.228  1.00 38.47  ? 439  LYS B CB  1 
ATOM   6560  C  CG  . LYS B  1 408 ? -35.931 149.572 26.197  1.00 41.03  ? 439  LYS B CG  1 
ATOM   6561  C  CD  . LYS B  1 408 ? -37.318 149.973 25.722  1.00 43.21  ? 439  LYS B CD  1 
ATOM   6562  C  CE  . LYS B  1 408 ? -38.343 148.887 26.015  1.00 43.34  ? 439  LYS B CE  1 
ATOM   6563  N  NZ  . LYS B  1 408 ? -39.661 149.157 25.374  1.00 40.77  ? 439  LYS B NZ  1 
ATOM   6564  N  N   . GLY B  1 409 ? -33.528 147.213 25.213  1.00 35.59  ? 440  GLY B N   1 
ATOM   6565  C  CA  . GLY B  1 409 ? -33.544 145.807 25.564  1.00 37.14  ? 440  GLY B CA  1 
ATOM   6566  C  C   . GLY B  1 409 ? -32.283 145.379 26.291  1.00 38.31  ? 440  GLY B C   1 
ATOM   6567  O  O   . GLY B  1 409 ? -32.346 144.670 27.298  1.00 38.85  ? 440  GLY B O   1 
ATOM   6568  N  N   . ILE B  1 410 ? -31.122 145.738 25.749  1.00 38.45  ? 441  ILE B N   1 
ATOM   6569  C  CA  . ILE B  1 410 ? -29.866 145.298 26.343  1.00 38.68  ? 441  ILE B CA  1 
ATOM   6570  C  C   . ILE B  1 410 ? -29.658 145.934 27.705  1.00 38.74  ? 441  ILE B C   1 
ATOM   6571  O  O   . ILE B  1 410 ? -29.291 145.265 28.665  1.00 38.93  ? 441  ILE B O   1 
ATOM   6572  C  CB  . ILE B  1 410 ? -28.660 145.554 25.440  1.00 37.79  ? 441  ILE B CB  1 
ATOM   6573  C  CG1 . ILE B  1 410 ? -27.433 144.785 25.954  1.00 36.09  ? 441  ILE B CG1 1 
ATOM   6574  C  CG2 . ILE B  1 410 ? -28.327 147.020 25.285  1.00 38.04  ? 441  ILE B CG2 1 
ATOM   6575  C  CD1 . ILE B  1 410 ? -27.448 143.333 25.514  1.00 35.81  ? 441  ILE B CD1 1 
ATOM   6576  N  N   . GLN B  1 411 ? -29.952 147.228 27.794  1.00 38.71  ? 442  GLN B N   1 
ATOM   6577  C  CA  . GLN B  1 411 ? -29.709 147.964 29.015  1.00 39.42  ? 442  GLN B CA  1 
ATOM   6578  C  C   . GLN B  1 411 ? -30.540 147.537 30.195  1.00 41.12  ? 442  GLN B C   1 
ATOM   6579  O  O   . GLN B  1 411 ? -30.073 147.517 31.333  1.00 41.90  ? 442  GLN B O   1 
ATOM   6580  C  CB  . GLN B  1 411 ? -29.882 149.463 28.791  1.00 36.61  ? 442  GLN B CB  1 
ATOM   6581  C  CG  . GLN B  1 411 ? -28.570 150.146 28.453  1.00 36.36  ? 442  GLN B CG  1 
ATOM   6582  C  CD  . GLN B  1 411 ? -28.809 151.565 27.984  1.00 37.60  ? 442  GLN B CD  1 
ATOM   6583  O  OE1 . GLN B  1 411 ? -29.892 152.102 28.217  1.00 37.74  ? 442  GLN B OE1 1 
ATOM   6584  N  NE2 . GLN B  1 411 ? -27.822 152.165 27.334  1.00 39.48  ? 442  GLN B NE2 1 
ATOM   6585  N  N   . GLU B  1 412 ? -31.801 147.167 29.976  1.00 42.57  ? 443  GLU B N   1 
ATOM   6586  C  CA  . GLU B  1 412 ? -32.607 146.738 31.115  1.00 44.53  ? 443  GLU B CA  1 
ATOM   6587  C  C   . GLU B  1 412 ? -32.111 145.402 31.643  1.00 44.32  ? 443  GLU B C   1 
ATOM   6588  O  O   . GLU B  1 412 ? -32.565 144.936 32.691  1.00 44.15  ? 443  GLU B O   1 
ATOM   6589  C  CB  . GLU B  1 412 ? -34.077 146.661 30.731  1.00 48.62  ? 443  GLU B CB  1 
ATOM   6590  C  CG  . GLU B  1 412 ? -34.345 145.785 29.516  1.00 53.21  ? 443  GLU B CG  1 
ATOM   6591  C  CD  . GLU B  1 412 ? -35.835 145.641 29.251  1.00 56.48  ? 443  GLU B CD  1 
ATOM   6592  O  OE1 . GLU B  1 412 ? -36.514 146.680 29.096  1.00 57.45  ? 443  GLU B OE1 1 
ATOM   6593  O  OE2 . GLU B  1 412 ? -36.306 144.487 29.203  1.00 56.04  ? 443  GLU B OE2 1 
ATOM   6594  N  N   . LEU B  1 413 ? -31.202 144.765 30.916  1.00 44.39  ? 444  LEU B N   1 
ATOM   6595  C  CA  . LEU B  1 413 ? -30.615 143.503 31.338  1.00 44.26  ? 444  LEU B CA  1 
ATOM   6596  C  C   . LEU B  1 413 ? -29.266 143.730 32.022  1.00 44.89  ? 444  LEU B C   1 
ATOM   6597  O  O   . LEU B  1 413 ? -28.929 143.025 32.966  1.00 44.57  ? 444  LEU B O   1 
ATOM   6598  C  CB  . LEU B  1 413 ? -30.420 142.548 30.167  1.00 43.11  ? 444  LEU B CB  1 
ATOM   6599  C  CG  . LEU B  1 413 ? -31.529 141.585 29.774  1.00 40.64  ? 444  LEU B CG  1 
ATOM   6600  C  CD1 . LEU B  1 413 ? -31.063 140.639 28.678  1.00 39.07  ? 444  LEU B CD1 1 
ATOM   6601  C  CD2 . LEU B  1 413 ? -32.040 140.799 30.966  1.00 39.66  ? 444  LEU B CD2 1 
ATOM   6602  N  N   . TYR B  1 414 ? -28.482 144.669 31.504  1.00 45.81  ? 445  TYR B N   1 
ATOM   6603  C  CA  . TYR B  1 414 ? -27.139 144.909 32.012  1.00 45.83  ? 445  TYR B CA  1 
ATOM   6604  C  C   . TYR B  1 414 ? -26.960 146.332 32.513  1.00 45.89  ? 445  TYR B C   1 
ATOM   6605  O  O   . TYR B  1 414 ? -25.908 146.688 33.039  1.00 46.58  ? 445  TYR B O   1 
ATOM   6606  C  CB  . TYR B  1 414 ? -26.110 144.654 30.901  1.00 46.08  ? 445  TYR B CB  1 
ATOM   6607  C  CG  . TYR B  1 414 ? -26.127 143.239 30.371  1.00 47.64  ? 445  TYR B CG  1 
ATOM   6608  C  CD1 . TYR B  1 414 ? -25.350 142.251 30.958  1.00 48.68  ? 445  TYR B CD1 1 
ATOM   6609  C  CD2 . TYR B  1 414 ? -26.921 142.891 29.285  1.00 47.78  ? 445  TYR B CD2 1 
ATOM   6610  C  CE1 . TYR B  1 414 ? -25.360 140.956 30.480  1.00 48.95  ? 445  TYR B CE1 1 
ATOM   6611  C  CE2 . TYR B  1 414 ? -26.938 141.596 28.800  1.00 48.42  ? 445  TYR B CE2 1 
ATOM   6612  C  CZ  . TYR B  1 414 ? -26.155 140.634 29.402  1.00 49.37  ? 445  TYR B CZ  1 
ATOM   6613  O  OH  . TYR B  1 414 ? -26.164 139.343 28.926  1.00 52.11  ? 445  TYR B OH  1 
ATOM   6614  N  N   . GLY B  1 415 ? -27.980 147.161 32.364  1.00 45.69  ? 446  GLY B N   1 
ATOM   6615  C  CA  . GLY B  1 415 ? -27.888 148.522 32.836  1.00 44.81  ? 446  GLY B CA  1 
ATOM   6616  C  C   . GLY B  1 415 ? -27.201 149.269 31.708  1.00 44.34  ? 446  GLY B C   1 
ATOM   6617  O  O   . GLY B  1 415 ? -26.845 148.668 30.696  1.00 45.00  ? 446  GLY B O   1 
ATOM   6618  N  N   . ALA B  1 416 ? -26.998 150.569 31.853  1.00 44.10  ? 447  ALA B N   1 
ATOM   6619  C  CA  . ALA B  1 416 ? -26.372 151.352 30.785  1.00 43.85  ? 447  ALA B CA  1 
ATOM   6620  C  C   . ALA B  1 416 ? -24.906 151.660 31.082  1.00 44.17  ? 447  ALA B C   1 
ATOM   6621  O  O   . ALA B  1 416 ? -24.464 151.572 32.227  1.00 43.91  ? 447  ALA B O   1 
ATOM   6622  C  CB  . ALA B  1 416 ? -27.140 152.644 30.561  1.00 43.90  ? 447  ALA B CB  1 
ATOM   6623  N  N   . SER B  1 417 ? -24.143 152.029 30.043  1.00 44.39  ? 448  SER B N   1 
ATOM   6624  C  CA  . SER B  1 417 ? -22.728 152.349 30.227  1.00 43.59  ? 448  SER B CA  1 
ATOM   6625  C  C   . SER B  1 417 ? -22.548 153.253 31.437  1.00 43.48  ? 448  SER B C   1 
ATOM   6626  O  O   . SER B  1 417 ? -23.295 154.204 31.653  1.00 42.60  ? 448  SER B O   1 
ATOM   6627  C  CB  . SER B  1 417 ? -22.113 152.967 28.970  1.00 43.95  ? 448  SER B CB  1 
ATOM   6628  O  OG  . SER B  1 417 ? -23.079 153.655 28.206  1.00 46.58  ? 448  SER B OG  1 
ATOM   6629  N  N   . PRO B  1 418 ? -21.594 152.876 32.278  1.00 43.91  ? 449  PRO B N   1 
ATOM   6630  C  CA  . PRO B  1 418 ? -21.295 153.516 33.529  1.00 44.33  ? 449  PRO B CA  1 
ATOM   6631  C  C   . PRO B  1 418 ? -20.995 154.998 33.431  1.00 44.51  ? 449  PRO B C   1 
ATOM   6632  O  O   . PRO B  1 418 ? -20.428 155.496 32.471  1.00 44.59  ? 449  PRO B O   1 
ATOM   6633  C  CB  . PRO B  1 418 ? -20.088 152.770 34.087  1.00 41.87  ? 449  PRO B CB  1 
ATOM   6634  C  CG  . PRO B  1 418 ? -20.116 151.460 33.397  1.00 41.40  ? 449  PRO B CG  1 
ATOM   6635  C  CD  . PRO B  1 418 ? -20.711 151.701 32.043  1.00 42.98  ? 449  PRO B CD  1 
ATOM   6636  N  N   . ASP B  1 419 ? -21.382 155.692 34.496  1.00 70.40  ? 450  ASP B N   1 
ATOM   6637  C  CA  . ASP B  1 419 ? -21.170 157.129 34.584  1.00 71.06  ? 450  ASP B CA  1 
ATOM   6638  C  C   . ASP B  1 419 ? -19.704 157.479 34.372  1.00 69.97  ? 450  ASP B C   1 
ATOM   6639  O  O   . ASP B  1 419 ? -19.377 158.206 33.413  1.00 76.54  ? 450  ASP B O   1 
ATOM   6640  C  CB  . ASP B  1 419 ? -21.650 157.626 35.950  1.00 73.75  ? 450  ASP B CB  1 
ATOM   6641  C  CG  . ASP B  1 419 ? -23.158 157.588 36.094  1.00 74.31  ? 450  ASP B CG  1 
ATOM   6642  O  OD1 . ASP B  1 419 ? -23.846 157.223 35.120  1.00 75.38  ? 450  ASP B OD1 1 
ATOM   6643  O  OD2 . ASP B  1 419 ? -23.661 157.930 37.186  1.00 75.23  ? 450  ASP B OD2 1 
ATOM   6644  N  N   . SER C  1 1   ? 68.291  44.570  -20.085 1.00 88.24  ? 32   SER C N   1 
ATOM   6645  C  CA  . SER C  1 1   ? 68.001  45.800  -19.383 1.00 87.60  ? 32   SER C CA  1 
ATOM   6646  C  C   . SER C  1 1   ? 68.468  45.719  -17.935 1.00 85.58  ? 32   SER C C   1 
ATOM   6647  O  O   . SER C  1 1   ? 68.656  44.629  -17.393 1.00 85.55  ? 32   SER C O   1 
ATOM   6648  C  CB  . SER C  1 1   ? 66.495  46.080  -19.424 1.00 89.05  ? 32   SER C CB  1 
ATOM   6649  O  OG  . SER C  1 1   ? 65.761  45.009  -18.846 1.00 89.32  ? 32   SER C OG  1 
ATOM   6650  N  N   . PRO C  1 2   ? 68.653  46.884  -17.318 1.00 82.98  ? 33   PRO C N   1 
ATOM   6651  C  CA  . PRO C  1 2   ? 69.126  47.002  -15.932 1.00 79.96  ? 33   PRO C CA  1 
ATOM   6652  C  C   . PRO C  1 2   ? 68.090  46.491  -14.973 1.00 75.95  ? 33   PRO C C   1 
ATOM   6653  O  O   . PRO C  1 2   ? 67.104  45.870  -15.378 1.00 73.88  ? 33   PRO C O   1 
ATOM   6654  C  CB  . PRO C  1 2   ? 69.188  48.517  -15.706 1.00 81.75  ? 33   PRO C CB  1 
ATOM   6655  C  CG  . PRO C  1 2   ? 69.259  49.097  -17.069 1.00 83.49  ? 33   PRO C CG  1 
ATOM   6656  C  CD  . PRO C  1 2   ? 68.424  48.199  -17.924 1.00 83.20  ? 33   PRO C CD  1 
ATOM   6657  N  N   . ILE C  1 3   ? 68.301  46.763  -13.709 1.00 72.63  ? 34   ILE C N   1 
ATOM   6658  C  CA  . ILE C  1 3   ? 67.346  46.361  -12.725 1.00 70.04  ? 34   ILE C CA  1 
ATOM   6659  C  C   . ILE C  1 3   ? 66.553  47.555  -12.275 1.00 69.43  ? 34   ILE C C   1 
ATOM   6660  O  O   . ILE C  1 3   ? 67.106  48.505  -11.725 1.00 70.13  ? 34   ILE C O   1 
ATOM   6661  C  CB  . ILE C  1 3   ? 67.963  45.710  -11.515 1.00 69.15  ? 34   ILE C CB  1 
ATOM   6662  C  CG1 . ILE C  1 3   ? 68.383  44.276  -11.845 1.00 68.68  ? 34   ILE C CG1 1 
ATOM   6663  C  CG2 . ILE C  1 3   ? 66.994  45.738  -10.343 1.00 69.67  ? 34   ILE C CG2 1 
ATOM   6664  C  CD1 . ILE C  1 3   ? 69.346  43.675  -10.846 1.00 67.52  ? 34   ILE C CD1 1 
ATOM   6665  N  N   . ILE C  1 4   ? 65.266  47.500  -12.508 1.00 68.11  ? 35   ILE C N   1 
ATOM   6666  C  CA  . ILE C  1 4   ? 64.411  48.611  -12.188 1.00 64.60  ? 35   ILE C CA  1 
ATOM   6667  C  C   . ILE C  1 4   ? 63.630  48.385  -10.903 1.00 63.38  ? 35   ILE C C   1 
ATOM   6668  O  O   . ILE C  1 4   ? 63.299  47.248  -10.557 1.00 63.40  ? 35   ILE C O   1 
ATOM   6669  C  CB  . ILE C  1 4   ? 63.450  48.883  -13.349 1.00 64.68  ? 35   ILE C CB  1 
ATOM   6670  C  CG1 . ILE C  1 4   ? 62.268  47.917  -13.298 1.00 66.68  ? 35   ILE C CG1 1 
ATOM   6671  C  CG2 . ILE C  1 4   ? 64.185  48.766  -14.679 1.00 64.97  ? 35   ILE C CG2 1 
ATOM   6672  C  CD1 . ILE C  1 4   ? 61.021  48.452  -13.962 1.00 68.63  ? 35   ILE C CD1 1 
ATOM   6673  N  N   . LYS C  1 5   ? 63.353  49.491  -10.215 1.00 62.63  ? 36   LYS C N   1 
ATOM   6674  C  CA  . LYS C  1 5   ? 62.584  49.453  -8.981  1.00 62.94  ? 36   LYS C CA  1 
ATOM   6675  C  C   . LYS C  1 5   ? 61.109  49.693  -9.267  1.00 62.46  ? 36   LYS C C   1 
ATOM   6676  O  O   . LYS C  1 5   ? 60.720  50.778  -9.706  1.00 61.39  ? 36   LYS C O   1 
ATOM   6677  C  CB  . LYS C  1 5   ? 63.111  50.475  -7.973  1.00 64.50  ? 36   LYS C CB  1 
ATOM   6678  C  CG  . LYS C  1 5   ? 62.607  50.249  -6.556  1.00 68.18  ? 36   LYS C CG  1 
ATOM   6679  C  CD  . LYS C  1 5   ? 63.218  51.241  -5.581  1.00 70.65  ? 36   LYS C CD  1 
ATOM   6680  C  CE  . LYS C  1 5   ? 63.249  50.678  -4.169  1.00 73.73  ? 36   LYS C CE  1 
ATOM   6681  N  NZ  . LYS C  1 5   ? 63.941  51.595  -3.221  1.00 75.68  ? 36   LYS C NZ  1 
ATOM   6682  N  N   . PHE C  1 6   ? 60.310  48.671  -9.011  1.00 61.93  ? 37   PHE C N   1 
ATOM   6683  C  CA  . PHE C  1 6   ? 58.881  48.734  -9.265  1.00 59.81  ? 37   PHE C CA  1 
ATOM   6684  C  C   . PHE C  1 6   ? 58.122  49.444  -8.152  1.00 59.17  ? 37   PHE C C   1 
ATOM   6685  O  O   . PHE C  1 6   ? 58.547  49.436  -6.995  1.00 59.82  ? 37   PHE C O   1 
ATOM   6686  C  CB  . PHE C  1 6   ? 58.311  47.325  -9.434  1.00 57.97  ? 37   PHE C CB  1 
ATOM   6687  C  CG  . PHE C  1 6   ? 58.796  46.617  -10.663 1.00 57.47  ? 37   PHE C CG  1 
ATOM   6688  C  CD1 . PHE C  1 6   ? 58.170  46.821  -11.877 1.00 57.49  ? 37   PHE C CD1 1 
ATOM   6689  C  CD2 . PHE C  1 6   ? 59.875  45.750  -10.602 1.00 57.16  ? 37   PHE C CD2 1 
ATOM   6690  C  CE1 . PHE C  1 6   ? 58.609  46.172  -13.016 1.00 57.37  ? 37   PHE C CE1 1 
ATOM   6691  C  CE2 . PHE C  1 6   ? 60.320  45.097  -11.737 1.00 57.66  ? 37   PHE C CE2 1 
ATOM   6692  C  CZ  . PHE C  1 6   ? 59.685  45.308  -12.945 1.00 57.63  ? 37   PHE C CZ  1 
ATOM   6693  N  N   . PRO C  1 7   ? 56.982  50.048  -8.516  1.00 57.86  ? 38   PRO C N   1 
ATOM   6694  C  CA  . PRO C  1 7   ? 56.137  50.809  -7.591  1.00 57.34  ? 38   PRO C CA  1 
ATOM   6695  C  C   . PRO C  1 7   ? 55.557  49.951  -6.476  1.00 57.77  ? 38   PRO C C   1 
ATOM   6696  O  O   . PRO C  1 7   ? 55.035  48.867  -6.723  1.00 57.81  ? 38   PRO C O   1 
ATOM   6697  C  CB  . PRO C  1 7   ? 54.968  51.278  -8.464  1.00 57.44  ? 38   PRO C CB  1 
ATOM   6698  C  CG  . PRO C  1 7   ? 55.494  51.216  -9.852  1.00 57.29  ? 38   PRO C CG  1 
ATOM   6699  C  CD  . PRO C  1 7   ? 56.423  50.041  -9.873  1.00 57.52  ? 38   PRO C CD  1 
ATOM   6700  N  N   . GLY C  1 8   ? 55.653  50.447  -5.250  1.00 59.38  ? 39   GLY C N   1 
ATOM   6701  C  CA  . GLY C  1 8   ? 55.097  49.753  -4.104  1.00 62.86  ? 39   GLY C CA  1 
ATOM   6702  C  C   . GLY C  1 8   ? 55.936  48.548  -3.684  1.00 65.77  ? 39   GLY C C   1 
ATOM   6703  O  O   . GLY C  1 8   ? 55.831  48.055  -2.574  1.00 65.65  ? 39   GLY C O   1 
ATOM   6704  N  N   . ASP C  1 9   ? 56.764  48.050  -4.563  1.00 67.96  ? 40   ASP C N   1 
ATOM   6705  C  CA  . ASP C  1 9   ? 57.630  46.922  -4.246  1.00 69.03  ? 40   ASP C CA  1 
ATOM   6706  C  C   . ASP C  1 9   ? 58.482  47.154  -3.008  1.00 68.85  ? 40   ASP C C   1 
ATOM   6707  O  O   . ASP C  1 9   ? 58.667  48.290  -2.574  1.00 69.06  ? 40   ASP C O   1 
ATOM   6708  C  CB  . ASP C  1 9   ? 58.669  46.788  -5.393  1.00 70.45  ? 40   ASP C CB  1 
ATOM   6709  C  CG  . ASP C  1 9   ? 58.913  45.397  -5.962  1.00 71.61  ? 40   ASP C CG  1 
ATOM   6710  O  OD1 . ASP C  1 9   ? 58.201  44.452  -5.586  1.00 71.86  ? 40   ASP C OD1 1 
ATOM   6711  O  OD2 . ASP C  1 9   ? 59.830  45.266  -6.814  1.00 72.16  ? 40   ASP C OD2 1 
ATOM   6712  N  N   . VAL C  1 10  ? 59.037  46.103  -2.436  1.00 67.57  ? 41   VAL C N   1 
ATOM   6713  C  CA  . VAL C  1 10  ? 59.945  46.292  -1.316  1.00 66.31  ? 41   VAL C CA  1 
ATOM   6714  C  C   . VAL C  1 10  ? 61.329  46.658  -1.847  1.00 65.68  ? 41   VAL C C   1 
ATOM   6715  O  O   . VAL C  1 10  ? 61.613  46.488  -3.032  1.00 65.43  ? 41   VAL C O   1 
ATOM   6716  C  CB  . VAL C  1 10  ? 60.036  45.033  -0.434  1.00 65.66  ? 41   VAL C CB  1 
ATOM   6717  C  CG1 . VAL C  1 10  ? 60.527  45.393  0.960   1.00 64.57  ? 41   VAL C CG1 1 
ATOM   6718  C  CG2 . VAL C  1 10  ? 58.693  44.326  -0.370  1.00 64.98  ? 41   VAL C CG2 1 
ATOM   6719  N  N   . ALA C  1 11  ? 62.201  47.174  -0.990  1.00 65.00  ? 42   ALA C N   1 
ATOM   6720  C  CA  . ALA C  1 11  ? 63.566  47.490  -1.409  1.00 64.64  ? 42   ALA C CA  1 
ATOM   6721  C  C   . ALA C  1 11  ? 64.411  46.220  -1.341  1.00 63.17  ? 42   ALA C C   1 
ATOM   6722  O  O   . ALA C  1 11  ? 64.462  45.584  -0.285  1.00 63.52  ? 42   ALA C O   1 
ATOM   6723  C  CB  . ALA C  1 11  ? 64.143  48.598  -0.541  1.00 65.35  ? 42   ALA C CB  1 
ATOM   6724  N  N   . PRO C  1 12  ? 65.070  45.857  -2.425  1.00 60.89  ? 43   PRO C N   1 
ATOM   6725  C  CA  . PRO C  1 12  ? 65.922  44.675  -2.436  1.00 58.58  ? 43   PRO C CA  1 
ATOM   6726  C  C   . PRO C  1 12  ? 66.954  44.700  -1.317  1.00 55.92  ? 43   PRO C C   1 
ATOM   6727  O  O   . PRO C  1 12  ? 67.261  45.752  -0.760  1.00 55.68  ? 43   PRO C O   1 
ATOM   6728  C  CB  . PRO C  1 12  ? 66.617  44.744  -3.795  1.00 58.31  ? 43   PRO C CB  1 
ATOM   6729  C  CG  . PRO C  1 12  ? 65.713  45.549  -4.656  1.00 58.77  ? 43   PRO C CG  1 
ATOM   6730  C  CD  . PRO C  1 12  ? 65.066  46.546  -3.735  1.00 60.09  ? 43   PRO C CD  1 
ATOM   6731  N  N   . LYS C  1 13  ? 67.448  43.522  -0.958  1.00 52.21  ? 44   LYS C N   1 
ATOM   6732  C  CA  . LYS C  1 13  ? 68.541  43.412  0.011   1.00 49.29  ? 44   LYS C CA  1 
ATOM   6733  C  C   . LYS C  1 13  ? 69.769  42.910  -0.753  1.00 46.28  ? 44   LYS C C   1 
ATOM   6734  O  O   . LYS C  1 13  ? 69.599  42.285  -1.805  1.00 47.02  ? 44   LYS C O   1 
ATOM   6735  C  CB  . LYS C  1 13  ? 68.198  42.477  1.156   1.00 49.55  ? 44   LYS C CB  1 
ATOM   6736  C  CG  . LYS C  1 13  ? 66.893  42.768  1.865   1.00 51.04  ? 44   LYS C CG  1 
ATOM   6737  C  CD  . LYS C  1 13  ? 66.987  43.956  2.799   1.00 53.20  ? 44   LYS C CD  1 
ATOM   6738  C  CE  . LYS C  1 13  ? 66.529  45.257  2.171   1.00 53.45  ? 44   LYS C CE  1 
ATOM   6739  N  NZ  . LYS C  1 13  ? 67.056  46.451  2.898   1.00 52.20  ? 44   LYS C NZ  1 
ATOM   6740  N  N   . THR C  1 14  ? 70.971  43.220  -0.302  1.00 42.05  ? 45   THR C N   1 
ATOM   6741  C  CA  . THR C  1 14  ? 72.151  42.719  -1.018  1.00 38.54  ? 45   THR C CA  1 
ATOM   6742  C  C   . THR C  1 14  ? 72.471  41.313  -0.518  1.00 37.69  ? 45   THR C C   1 
ATOM   6743  O  O   . THR C  1 14  ? 71.997  40.915  0.544   1.00 38.28  ? 45   THR C O   1 
ATOM   6744  C  CB  . THR C  1 14  ? 73.384  43.609  -0.814  1.00 37.02  ? 45   THR C CB  1 
ATOM   6745  O  OG1 . THR C  1 14  ? 73.444  44.060  0.546   1.00 35.09  ? 45   THR C OG1 1 
ATOM   6746  C  CG2 . THR C  1 14  ? 73.416  44.783  -1.761  1.00 33.83  ? 45   THR C CG2 1 
ATOM   6747  N  N   . ASP C  1 15  ? 73.325  40.604  -1.245  1.00 35.58  ? 46   ASP C N   1 
ATOM   6748  C  CA  . ASP C  1 15  ? 73.760  39.286  -0.793  1.00 34.92  ? 46   ASP C CA  1 
ATOM   6749  C  C   . ASP C  1 15  ? 74.273  39.358  0.638   1.00 33.87  ? 46   ASP C C   1 
ATOM   6750  O  O   . ASP C  1 15  ? 73.925  38.519  1.464   1.00 32.85  ? 46   ASP C O   1 
ATOM   6751  C  CB  . ASP C  1 15  ? 74.827  38.726  -1.724  1.00 36.12  ? 46   ASP C CB  1 
ATOM   6752  C  CG  . ASP C  1 15  ? 74.262  37.910  -2.865  1.00 39.90  ? 46   ASP C CG  1 
ATOM   6753  O  OD1 . ASP C  1 15  ? 73.117  37.420  -2.754  1.00 44.30  ? 46   ASP C OD1 1 
ATOM   6754  O  OD2 . ASP C  1 15  ? 74.956  37.750  -3.888  1.00 39.74  ? 46   ASP C OD2 1 
ATOM   6755  N  N   . LYS C  1 16  ? 75.082  40.370  0.941   1.00 33.76  ? 47   LYS C N   1 
ATOM   6756  C  CA  . LYS C  1 16  ? 75.635  40.519  2.283   1.00 34.80  ? 47   LYS C CA  1 
ATOM   6757  C  C   . LYS C  1 16  ? 74.591  41.015  3.267   1.00 36.07  ? 47   LYS C C   1 
ATOM   6758  O  O   . LYS C  1 16  ? 74.414  40.464  4.354   1.00 37.41  ? 47   LYS C O   1 
ATOM   6759  C  CB  . LYS C  1 16  ? 76.854  41.430  2.311   1.00 33.01  ? 47   LYS C CB  1 
ATOM   6760  C  CG  . LYS C  1 16  ? 77.686  41.329  3.584   1.00 32.54  ? 47   LYS C CG  1 
ATOM   6761  C  CD  . LYS C  1 16  ? 78.628  42.516  3.707   1.00 32.90  ? 47   LYS C CD  1 
ATOM   6762  C  CE  . LYS C  1 16  ? 79.248  42.596  5.092   1.00 34.00  ? 47   LYS C CE  1 
ATOM   6763  N  NZ  . LYS C  1 16  ? 80.487  43.429  5.091   1.00 33.23  ? 47   LYS C NZ  1 
ATOM   6764  N  N   . GLU C  1 17  ? 73.876  42.070  2.883   1.00 37.20  ? 48   GLU C N   1 
ATOM   6765  C  CA  . GLU C  1 17  ? 72.799  42.546  3.760   1.00 38.31  ? 48   GLU C CA  1 
ATOM   6766  C  C   . GLU C  1 17  ? 71.977  41.354  4.251   1.00 37.02  ? 48   GLU C C   1 
ATOM   6767  O  O   . GLU C  1 17  ? 71.724  41.192  5.434   1.00 36.12  ? 48   GLU C O   1 
ATOM   6768  C  CB  . GLU C  1 17  ? 71.890  43.505  2.997   1.00 40.05  ? 48   GLU C CB  1 
ATOM   6769  C  CG  . GLU C  1 17  ? 72.283  44.965  3.149   1.00 41.98  ? 48   GLU C CG  1 
ATOM   6770  C  CD  . GLU C  1 17  ? 71.649  45.841  2.089   1.00 43.49  ? 48   GLU C CD  1 
ATOM   6771  O  OE1 . GLU C  1 17  ? 70.485  45.577  1.731   1.00 43.71  ? 48   GLU C OE1 1 
ATOM   6772  O  OE2 . GLU C  1 17  ? 72.317  46.784  1.619   1.00 45.34  ? 48   GLU C OE2 1 
ATOM   6773  N  N   . LEU C  1 18  ? 71.555  40.519  3.316   1.00 36.62  ? 49   LEU C N   1 
ATOM   6774  C  CA  . LEU C  1 18  ? 70.816  39.307  3.632   1.00 35.91  ? 49   LEU C CA  1 
ATOM   6775  C  C   . LEU C  1 18  ? 71.557  38.467  4.664   1.00 34.74  ? 49   LEU C C   1 
ATOM   6776  O  O   . LEU C  1 18  ? 71.102  38.293  5.791   1.00 34.19  ? 49   LEU C O   1 
ATOM   6777  C  CB  . LEU C  1 18  ? 70.632  38.482  2.348   1.00 37.81  ? 49   LEU C CB  1 
ATOM   6778  C  CG  . LEU C  1 18  ? 69.974  37.115  2.525   1.00 40.53  ? 49   LEU C CG  1 
ATOM   6779  C  CD1 . LEU C  1 18  ? 68.577  37.274  3.098   1.00 41.06  ? 49   LEU C CD1 1 
ATOM   6780  C  CD2 . LEU C  1 18  ? 69.974  36.316  1.230   1.00 41.29  ? 49   LEU C CD2 1 
ATOM   6781  N  N   . ALA C  1 19  ? 72.697  37.911  4.274   1.00 33.77  ? 50   ALA C N   1 
ATOM   6782  C  CA  . ALA C  1 19  ? 73.465  37.035  5.146   1.00 32.50  ? 50   ALA C CA  1 
ATOM   6783  C  C   . ALA C  1 19  ? 73.475  37.558  6.572   1.00 33.40  ? 50   ALA C C   1 
ATOM   6784  O  O   . ALA C  1 19  ? 73.190  36.815  7.499   1.00 33.98  ? 50   ALA C O   1 
ATOM   6785  C  CB  . ALA C  1 19  ? 74.898  36.953  4.625   1.00 30.38  ? 50   ALA C CB  1 
ATOM   6786  N  N   . VAL C  1 20  ? 73.870  38.809  6.748   1.00 35.38  ? 51   VAL C N   1 
ATOM   6787  C  CA  . VAL C  1 20  ? 73.983  39.433  8.057   1.00 36.48  ? 51   VAL C CA  1 
ATOM   6788  C  C   . VAL C  1 20  ? 72.686  39.402  8.841   1.00 38.57  ? 51   VAL C C   1 
ATOM   6789  O  O   . VAL C  1 20  ? 72.658  39.197  10.055  1.00 39.36  ? 51   VAL C O   1 
ATOM   6790  C  CB  . VAL C  1 20  ? 74.502  40.881  7.947   1.00 35.22  ? 51   VAL C CB  1 
ATOM   6791  C  CG1 . VAL C  1 20  ? 74.848  41.429  9.328   1.00 34.44  ? 51   VAL C CG1 1 
ATOM   6792  C  CG2 . VAL C  1 20  ? 75.717  40.939  7.033   1.00 31.25  ? 51   VAL C CG2 1 
ATOM   6793  N  N   . GLN C  1 21  ? 71.568  39.627  8.160   1.00 39.94  ? 52   GLN C N   1 
ATOM   6794  C  CA  . GLN C  1 21  ? 70.265  39.573  8.819   1.00 40.24  ? 52   GLN C CA  1 
ATOM   6795  C  C   . GLN C  1 21  ? 69.949  38.120  9.172   1.00 39.20  ? 52   GLN C C   1 
ATOM   6796  O  O   . GLN C  1 21  ? 69.576  37.777  10.287  1.00 39.04  ? 52   GLN C O   1 
ATOM   6797  C  CB  . GLN C  1 21  ? 69.195  40.117  7.872   1.00 41.88  ? 52   GLN C CB  1 
ATOM   6798  C  CG  . GLN C  1 21  ? 67.851  40.358  8.532   1.00 47.74  ? 52   GLN C CG  1 
ATOM   6799  C  CD  . GLN C  1 21  ? 67.043  41.417  7.803   1.00 53.21  ? 52   GLN C CD  1 
ATOM   6800  O  OE1 . GLN C  1 21  ? 66.811  41.305  6.597   1.00 57.31  ? 52   GLN C OE1 1 
ATOM   6801  N  NE2 . GLN C  1 21  ? 66.619  42.444  8.533   1.00 53.22  ? 52   GLN C NE2 1 
ATOM   6802  N  N   . TYR C  1 22  ? 70.164  37.232  8.204   1.00 37.76  ? 53   TYR C N   1 
ATOM   6803  C  CA  . TYR C  1 22  ? 69.908  35.812  8.395   1.00 36.21  ? 53   TYR C CA  1 
ATOM   6804  C  C   . TYR C  1 22  ? 70.683  35.279  9.591   1.00 36.74  ? 53   TYR C C   1 
ATOM   6805  O  O   . TYR C  1 22  ? 70.119  34.572  10.429  1.00 39.34  ? 53   TYR C O   1 
ATOM   6806  C  CB  . TYR C  1 22  ? 70.269  35.043  7.151   1.00 34.85  ? 53   TYR C CB  1 
ATOM   6807  C  CG  . TYR C  1 22  ? 69.728  33.655  6.959   1.00 35.31  ? 53   TYR C CG  1 
ATOM   6808  C  CD1 . TYR C  1 22  ? 70.248  32.550  7.610   1.00 34.72  ? 53   TYR C CD1 1 
ATOM   6809  C  CD2 . TYR C  1 22  ? 68.689  33.425  6.060   1.00 35.46  ? 53   TYR C CD2 1 
ATOM   6810  C  CE1 . TYR C  1 22  ? 69.759  31.276  7.390   1.00 33.95  ? 53   TYR C CE1 1 
ATOM   6811  C  CE2 . TYR C  1 22  ? 68.182  32.176  5.843   1.00 34.41  ? 53   TYR C CE2 1 
ATOM   6812  C  CZ  . TYR C  1 22  ? 68.726  31.093  6.501   1.00 34.70  ? 53   TYR C CZ  1 
ATOM   6813  O  OH  . TYR C  1 22  ? 68.222  29.826  6.272   1.00 33.26  ? 53   TYR C OH  1 
ATOM   6814  N  N   . LEU C  1 23  ? 71.963  35.616  9.681   1.00 35.36  ? 54   LEU C N   1 
ATOM   6815  C  CA  . LEU C  1 23  ? 72.785  35.149  10.794  1.00 35.15  ? 54   LEU C CA  1 
ATOM   6816  C  C   . LEU C  1 23  ? 72.411  35.888  12.069  1.00 36.01  ? 54   LEU C C   1 
ATOM   6817  O  O   . LEU C  1 23  ? 72.788  35.486  13.165  1.00 36.91  ? 54   LEU C O   1 
ATOM   6818  C  CB  . LEU C  1 23  ? 74.272  35.356  10.503  1.00 33.97  ? 54   LEU C CB  1 
ATOM   6819  C  CG  . LEU C  1 23  ? 74.799  34.691  9.228   1.00 33.47  ? 54   LEU C CG  1 
ATOM   6820  C  CD1 . LEU C  1 23  ? 76.277  34.978  9.065   1.00 33.06  ? 54   LEU C CD1 1 
ATOM   6821  C  CD2 . LEU C  1 23  ? 74.508  33.202  9.223   1.00 31.79  ? 54   LEU C CD2 1 
ATOM   6822  N  N   . ASN C  1 24  ? 71.667  36.979  11.927  1.00 36.98  ? 55   ASN C N   1 
ATOM   6823  C  CA  . ASN C  1 24  ? 71.263  37.747  13.094  1.00 38.27  ? 55   ASN C CA  1 
ATOM   6824  C  C   . ASN C  1 24  ? 69.982  37.218  13.721  1.00 38.20  ? 55   ASN C C   1 
ATOM   6825  O  O   . ASN C  1 24  ? 69.833  37.073  14.932  1.00 38.13  ? 55   ASN C O   1 
ATOM   6826  C  CB  . ASN C  1 24  ? 71.061  39.211  12.689  1.00 38.60  ? 55   ASN C CB  1 
ATOM   6827  C  CG  . ASN C  1 24  ? 70.766  40.058  13.912  1.00 41.58  ? 55   ASN C CG  1 
ATOM   6828  O  OD1 . ASN C  1 24  ? 70.400  41.224  13.768  1.00 46.85  ? 55   ASN C OD1 1 
ATOM   6829  N  ND2 . ASN C  1 24  ? 70.929  39.491  15.099  1.00 41.29  ? 55   ASN C ND2 1 
ATOM   6830  N  N   . THR C  1 25  ? 68.992  36.981  12.868  1.00 37.98  ? 56   THR C N   1 
ATOM   6831  C  CA  . THR C  1 25  ? 67.712  36.455  13.316  1.00 35.85  ? 56   THR C CA  1 
ATOM   6832  C  C   . THR C  1 25  ? 67.896  35.013  13.791  1.00 36.95  ? 56   THR C C   1 
ATOM   6833  O  O   . THR C  1 25  ? 67.476  34.652  14.880  1.00 37.43  ? 56   THR C O   1 
ATOM   6834  C  CB  . THR C  1 25  ? 66.702  36.409  12.145  1.00 34.49  ? 56   THR C CB  1 
ATOM   6835  O  OG1 . THR C  1 25  ? 66.691  37.653  11.443  1.00 32.68  ? 56   THR C OG1 1 
ATOM   6836  C  CG2 . THR C  1 25  ? 65.318  36.131  12.703  1.00 34.06  ? 56   THR C CG2 1 
ATOM   6837  N  N   . PHE C  1 26  ? 68.540  34.224  12.935  1.00 38.05  ? 57   PHE C N   1 
ATOM   6838  C  CA  . PHE C  1 26  ? 68.669  32.806  13.123  1.00 39.11  ? 57   PHE C CA  1 
ATOM   6839  C  C   . PHE C  1 26  ? 69.886  32.332  13.866  1.00 42.01  ? 57   PHE C C   1 
ATOM   6840  O  O   . PHE C  1 26  ? 69.859  31.202  14.392  1.00 42.56  ? 57   PHE C O   1 
ATOM   6841  C  CB  . PHE C  1 26  ? 68.548  32.107  11.760  1.00 36.96  ? 57   PHE C CB  1 
ATOM   6842  C  CG  . PHE C  1 26  ? 67.321  32.532  10.994  1.00 35.19  ? 57   PHE C CG  1 
ATOM   6843  C  CD1 . PHE C  1 26  ? 66.045  32.318  11.470  1.00 33.21  ? 57   PHE C CD1 1 
ATOM   6844  C  CD2 . PHE C  1 26  ? 67.454  33.167  9.771   1.00 34.16  ? 57   PHE C CD2 1 
ATOM   6845  C  CE1 . PHE C  1 26  ? 64.917  32.696  10.779  1.00 33.66  ? 57   PHE C CE1 1 
ATOM   6846  C  CE2 . PHE C  1 26  ? 66.324  33.559  9.072   1.00 36.04  ? 57   PHE C CE2 1 
ATOM   6847  C  CZ  . PHE C  1 26  ? 65.065  33.326  9.568   1.00 34.28  ? 57   PHE C CZ  1 
ATOM   6848  N  N   . TYR C  1 27  ? 70.982  33.089  13.908  1.00 45.29  ? 58   TYR C N   1 
ATOM   6849  C  CA  . TYR C  1 27  ? 72.195  32.609  14.554  1.00 47.70  ? 58   TYR C CA  1 
ATOM   6850  C  C   . TYR C  1 27  ? 72.618  33.382  15.803  1.00 46.64  ? 58   TYR C C   1 
ATOM   6851  O  O   . TYR C  1 27  ? 73.559  32.988  16.493  1.00 46.52  ? 58   TYR C O   1 
ATOM   6852  C  CB  . TYR C  1 27  ? 73.388  32.749  13.573  1.00 54.19  ? 58   TYR C CB  1 
ATOM   6853  C  CG  . TYR C  1 27  ? 73.237  31.743  12.453  1.00 60.94  ? 58   TYR C CG  1 
ATOM   6854  C  CD1 . TYR C  1 27  ? 73.692  30.444  12.605  1.00 63.99  ? 58   TYR C CD1 1 
ATOM   6855  C  CD2 . TYR C  1 27  ? 72.607  32.081  11.260  1.00 64.74  ? 58   TYR C CD2 1 
ATOM   6856  C  CE1 . TYR C  1 27  ? 73.533  29.508  11.604  1.00 68.46  ? 58   TYR C CE1 1 
ATOM   6857  C  CE2 . TYR C  1 27  ? 72.443  31.151  10.251  1.00 69.29  ? 58   TYR C CE2 1 
ATOM   6858  C  CZ  . TYR C  1 27  ? 72.907  29.865  10.430  1.00 70.65  ? 58   TYR C CZ  1 
ATOM   6859  O  OH  . TYR C  1 27  ? 72.746  28.930  9.433   1.00 74.89  ? 58   TYR C OH  1 
ATOM   6860  N  N   . GLY C  1 28  ? 71.957  34.489  16.097  1.00 45.23  ? 59   GLY C N   1 
ATOM   6861  C  CA  . GLY C  1 28  ? 72.345  35.319  17.232  1.00 44.00  ? 59   GLY C CA  1 
ATOM   6862  C  C   . GLY C  1 28  ? 73.559  36.235  16.909  1.00 44.11  ? 59   GLY C C   1 
ATOM   6863  O  O   . GLY C  1 28  ? 74.207  36.778  17.802  1.00 43.64  ? 59   GLY C O   1 
ATOM   6864  N  N   . CYS C  1 29  ? 73.902  36.441  15.631  1.00 45.22  ? 60   CYS C N   1 
ATOM   6865  C  CA  . CYS C  1 29  ? 75.035  37.320  15.278  1.00 47.29  ? 60   CYS C CA  1 
ATOM   6866  C  C   . CYS C  1 29  ? 74.693  38.781  15.576  1.00 49.67  ? 60   CYS C C   1 
ATOM   6867  O  O   . CYS C  1 29  ? 73.759  39.339  15.004  1.00 49.88  ? 60   CYS C O   1 
ATOM   6868  C  CB  . CYS C  1 29  ? 75.396  37.143  13.795  1.00 46.35  ? 60   CYS C CB  1 
ATOM   6869  S  SG  . CYS C  1 29  ? 77.123  37.537  13.368  1.00 45.23  ? 60   CYS C SG  1 
ATOM   6870  N  N   . PRO C  1 30  ? 75.433  39.475  16.471  1.00 51.73  ? 61   PRO C N   1 
ATOM   6871  C  CA  . PRO C  1 30  ? 75.117  40.863  16.804  1.00 52.93  ? 61   PRO C CA  1 
ATOM   6872  C  C   . PRO C  1 30  ? 75.069  41.714  15.548  1.00 54.75  ? 61   PRO C C   1 
ATOM   6873  O  O   . PRO C  1 30  ? 76.007  41.714  14.752  1.00 55.16  ? 61   PRO C O   1 
ATOM   6874  C  CB  . PRO C  1 30  ? 76.250  41.278  17.745  1.00 52.00  ? 61   PRO C CB  1 
ATOM   6875  C  CG  . PRO C  1 30  ? 76.739  39.994  18.324  1.00 51.42  ? 61   PRO C CG  1 
ATOM   6876  C  CD  . PRO C  1 30  ? 76.595  38.977  17.224  1.00 52.48  ? 61   PRO C CD  1 
ATOM   6877  N  N   . LYS C  1 31  ? 73.957  42.416  15.403  1.00 56.61  ? 62   LYS C N   1 
ATOM   6878  C  CA  . LYS C  1 31  ? 73.712  43.257  14.245  1.00 59.00  ? 62   LYS C CA  1 
ATOM   6879  C  C   . LYS C  1 31  ? 74.919  44.092  13.841  1.00 60.45  ? 62   LYS C C   1 
ATOM   6880  O  O   . LYS C  1 31  ? 75.501  43.921  12.775  1.00 60.88  ? 62   LYS C O   1 
ATOM   6881  C  CB  . LYS C  1 31  ? 72.533  44.198  14.504  1.00 58.76  ? 62   LYS C CB  1 
ATOM   6882  C  CG  . LYS C  1 31  ? 71.444  43.607  15.383  1.00 60.96  ? 62   LYS C CG  1 
ATOM   6883  C  CD  . LYS C  1 31  ? 71.885  43.517  16.835  1.00 62.41  ? 62   LYS C CD  1 
ATOM   6884  C  CE  . LYS C  1 31  ? 71.141  42.411  17.566  1.00 62.85  ? 62   LYS C CE  1 
ATOM   6885  N  NZ  . LYS C  1 31  ? 71.660  42.209  18.946  1.00 62.32  ? 62   LYS C NZ  1 
ATOM   6886  N  N   . GLU C  1 32  ? 75.254  45.054  14.686  1.00 61.47  ? 63   GLU C N   1 
ATOM   6887  C  CA  . GLU C  1 32  ? 76.320  46.003  14.409  1.00 61.95  ? 63   GLU C CA  1 
ATOM   6888  C  C   . GLU C  1 32  ? 77.687  45.353  14.576  1.00 60.34  ? 63   GLU C C   1 
ATOM   6889  O  O   . GLU C  1 32  ? 78.691  45.868  14.085  1.00 61.15  ? 63   GLU C O   1 
ATOM   6890  C  CB  . GLU C  1 32  ? 76.179  47.206  15.351  1.00 64.40  ? 63   GLU C CB  1 
ATOM   6891  C  CG  . GLU C  1 32  ? 76.558  46.875  16.787  1.00 68.51  ? 63   GLU C CG  1 
ATOM   6892  C  CD  . GLU C  1 32  ? 75.931  45.597  17.303  1.00 69.54  ? 63   GLU C CD  1 
ATOM   6893  O  OE1 . GLU C  1 32  ? 74.714  45.398  17.107  1.00 69.64  ? 63   GLU C OE1 1 
ATOM   6894  O  OE2 . GLU C  1 32  ? 76.655  44.775  17.903  1.00 69.65  ? 63   GLU C OE2 1 
ATOM   6895  N  N   . SER C  1 33  ? 77.717  44.209  15.252  1.00 57.43  ? 64   SER C N   1 
ATOM   6896  C  CA  . SER C  1 33  ? 78.958  43.498  15.513  1.00 54.42  ? 64   SER C CA  1 
ATOM   6897  C  C   . SER C  1 33  ? 79.138  42.247  14.678  1.00 53.06  ? 64   SER C C   1 
ATOM   6898  O  O   . SER C  1 33  ? 80.047  41.449  14.917  1.00 52.69  ? 64   SER C O   1 
ATOM   6899  C  CB  . SER C  1 33  ? 79.089  43.202  17.008  1.00 53.06  ? 64   SER C CB  1 
ATOM   6900  O  OG  . SER C  1 33  ? 79.726  41.971  17.270  1.00 51.35  ? 64   SER C OG  1 
ATOM   6901  N  N   . CYS C  1 34  ? 78.303  42.041  13.664  1.00 51.66  ? 65   CYS C N   1 
ATOM   6902  C  CA  . CYS C  1 34  ? 78.383  40.849  12.825  1.00 49.57  ? 65   CYS C CA  1 
ATOM   6903  C  C   . CYS C  1 34  ? 79.240  41.093  11.593  1.00 48.94  ? 65   CYS C C   1 
ATOM   6904  O  O   . CYS C  1 34  ? 78.732  41.288  10.492  1.00 47.95  ? 65   CYS C O   1 
ATOM   6905  C  CB  . CYS C  1 34  ? 76.976  40.402  12.398  1.00 48.97  ? 65   CYS C CB  1 
ATOM   6906  S  SG  . CYS C  1 34  ? 76.906  38.741  11.687  1.00 46.85  ? 65   CYS C SG  1 
ATOM   6907  N  N   . ASN C  1 35  ? 80.558  41.107  11.763  1.00 49.08  ? 66   ASN C N   1 
ATOM   6908  C  CA  . ASN C  1 35  ? 81.488  41.321  10.661  1.00 48.57  ? 66   ASN C CA  1 
ATOM   6909  C  C   . ASN C  1 35  ? 82.884  40.794  10.964  1.00 47.39  ? 66   ASN C C   1 
ATOM   6910  O  O   . ASN C  1 35  ? 83.230  40.593  12.129  1.00 47.69  ? 66   ASN C O   1 
ATOM   6911  C  CB  . ASN C  1 35  ? 81.554  42.797  10.267  1.00 48.78  ? 66   ASN C CB  1 
ATOM   6912  C  CG  . ASN C  1 35  ? 81.692  42.967  8.763   1.00 50.68  ? 66   ASN C CG  1 
ATOM   6913  O  OD1 . ASN C  1 35  ? 82.601  42.400  8.158   1.00 50.81  ? 66   ASN C OD1 1 
ATOM   6914  N  ND2 . ASN C  1 35  ? 80.791  43.726  8.158   1.00 51.98  ? 66   ASN C ND2 1 
ATOM   6915  N  N   . LEU C  1 36  ? 83.714  40.596  9.948   1.00 45.61  ? 67   LEU C N   1 
ATOM   6916  C  CA  . LEU C  1 36  ? 85.050  40.041  10.099  1.00 43.63  ? 67   LEU C CA  1 
ATOM   6917  C  C   . LEU C  1 36  ? 84.997  38.678  10.755  1.00 43.19  ? 67   LEU C C   1 
ATOM   6918  O  O   . LEU C  1 36  ? 84.047  37.933  10.464  1.00 42.21  ? 67   LEU C O   1 
ATOM   6919  C  CB  . LEU C  1 36  ? 86.056  40.984  10.709  1.00 42.27  ? 67   LEU C CB  1 
ATOM   6920  C  CG  . LEU C  1 36  ? 87.540  40.735  10.431  1.00 40.94  ? 67   LEU C CG  1 
ATOM   6921  C  CD1 . LEU C  1 36  ? 87.745  39.582  9.460   1.00 38.85  ? 67   LEU C CD1 1 
ATOM   6922  C  CD2 . LEU C  1 36  ? 88.209  41.991  9.896   1.00 41.12  ? 67   LEU C CD2 1 
ATOM   6923  N  N   . PHE C  1 37  ? 85.887  38.275  11.637  1.00 43.02  ? 68   PHE C N   1 
ATOM   6924  C  CA  . PHE C  1 37  ? 85.833  36.945  12.219  1.00 42.40  ? 68   PHE C CA  1 
ATOM   6925  C  C   . PHE C  1 37  ? 84.539  36.490  12.832  1.00 41.42  ? 68   PHE C C   1 
ATOM   6926  O  O   . PHE C  1 37  ? 84.304  35.273  12.945  1.00 41.73  ? 68   PHE C O   1 
ATOM   6927  C  CB  . PHE C  1 37  ? 87.003  36.807  13.210  1.00 42.93  ? 68   PHE C CB  1 
ATOM   6928  C  CG  . PHE C  1 37  ? 88.263  37.391  12.620  1.00 42.99  ? 68   PHE C CG  1 
ATOM   6929  C  CD1 . PHE C  1 37  ? 88.833  36.827  11.496  1.00 41.43  ? 68   PHE C CD1 1 
ATOM   6930  C  CD2 . PHE C  1 37  ? 88.851  38.504  13.186  1.00 42.79  ? 68   PHE C CD2 1 
ATOM   6931  C  CE1 . PHE C  1 37  ? 89.980  37.365  10.954  1.00 41.21  ? 68   PHE C CE1 1 
ATOM   6932  C  CE2 . PHE C  1 37  ? 89.997  39.044  12.646  1.00 41.12  ? 68   PHE C CE2 1 
ATOM   6933  C  CZ  . PHE C  1 37  ? 90.561  38.471  11.528  1.00 41.21  ? 68   PHE C CZ  1 
ATOM   6934  N  N   . VAL C  1 38  ? 83.663  37.374  13.292  1.00 40.17  ? 69   VAL C N   1 
ATOM   6935  C  CA  . VAL C  1 38  ? 82.386  36.980  13.876  1.00 36.28  ? 69   VAL C CA  1 
ATOM   6936  C  C   . VAL C  1 38  ? 81.439  36.514  12.771  1.00 35.50  ? 69   VAL C C   1 
ATOM   6937  O  O   . VAL C  1 38  ? 80.729  35.537  12.921  1.00 34.65  ? 69   VAL C O   1 
ATOM   6938  C  CB  . VAL C  1 38  ? 81.706  38.121  14.642  1.00 35.02  ? 69   VAL C CB  1 
ATOM   6939  C  CG1 . VAL C  1 38  ? 80.495  37.582  15.396  1.00 34.88  ? 69   VAL C CG1 1 
ATOM   6940  C  CG2 . VAL C  1 38  ? 82.647  38.820  15.593  1.00 32.94  ? 69   VAL C CG2 1 
ATOM   6941  N  N   . LEU C  1 39  ? 81.476  37.232  11.652  1.00 35.35  ? 70   LEU C N   1 
ATOM   6942  C  CA  . LEU C  1 39  ? 80.664  36.866  10.503  1.00 36.76  ? 70   LEU C CA  1 
ATOM   6943  C  C   . LEU C  1 39  ? 81.166  35.539  9.936   1.00 38.66  ? 70   LEU C C   1 
ATOM   6944  O  O   . LEU C  1 39  ? 80.416  34.746  9.385   1.00 40.68  ? 70   LEU C O   1 
ATOM   6945  C  CB  . LEU C  1 39  ? 80.743  37.929  9.410   1.00 35.53  ? 70   LEU C CB  1 
ATOM   6946  C  CG  . LEU C  1 39  ? 80.161  37.521  8.055   1.00 35.61  ? 70   LEU C CG  1 
ATOM   6947  C  CD1 . LEU C  1 39  ? 78.744  36.997  8.202   1.00 36.04  ? 70   LEU C CD1 1 
ATOM   6948  C  CD2 . LEU C  1 39  ? 80.188  38.691  7.083   1.00 35.95  ? 70   LEU C CD2 1 
ATOM   6949  N  N   . LYS C  1 40  ? 82.458  35.322  10.108  1.00 39.94  ? 71   LYS C N   1 
ATOM   6950  C  CA  . LYS C  1 40  ? 83.109  34.121  9.601   1.00 40.54  ? 71   LYS C CA  1 
ATOM   6951  C  C   . LYS C  1 40  ? 82.824  32.937  10.502  1.00 40.78  ? 71   LYS C C   1 
ATOM   6952  O  O   . LYS C  1 40  ? 82.369  31.895  10.036  1.00 40.40  ? 71   LYS C O   1 
ATOM   6953  C  CB  . LYS C  1 40  ? 84.608  34.374  9.489   1.00 42.51  ? 71   LYS C CB  1 
ATOM   6954  C  CG  . LYS C  1 40  ? 85.422  33.226  8.939   1.00 43.56  ? 71   LYS C CG  1 
ATOM   6955  C  CD  . LYS C  1 40  ? 86.706  33.052  9.747   1.00 46.88  ? 71   LYS C CD  1 
ATOM   6956  C  CE  . LYS C  1 40  ? 86.382  32.757  11.203  1.00 49.30  ? 71   LYS C CE  1 
ATOM   6957  N  NZ  . LYS C  1 40  ? 87.580  32.750  12.080  1.00 51.33  ? 71   LYS C NZ  1 
ATOM   6958  N  N   . ASP C  1 41  ? 83.049  33.119  11.801  1.00 42.04  ? 72   ASP C N   1 
ATOM   6959  C  CA  . ASP C  1 41  ? 82.798  32.040  12.750  1.00 43.72  ? 72   ASP C CA  1 
ATOM   6960  C  C   . ASP C  1 41  ? 81.319  31.668  12.740  1.00 42.78  ? 72   ASP C C   1 
ATOM   6961  O  O   . ASP C  1 41  ? 80.980  30.488  12.730  1.00 42.39  ? 72   ASP C O   1 
ATOM   6962  C  CB  . ASP C  1 41  ? 83.265  32.402  14.151  1.00 47.25  ? 72   ASP C CB  1 
ATOM   6963  C  CG  . ASP C  1 41  ? 84.777  32.471  14.266  1.00 51.65  ? 72   ASP C CG  1 
ATOM   6964  O  OD1 . ASP C  1 41  ? 85.459  31.554  13.755  1.00 52.88  ? 72   ASP C OD1 1 
ATOM   6965  O  OD2 . ASP C  1 41  ? 85.289  33.442  14.862  1.00 55.00  ? 72   ASP C OD2 1 
ATOM   6966  N  N   . THR C  1 42  ? 80.467  32.684  12.712  1.00 41.45  ? 73   THR C N   1 
ATOM   6967  C  CA  . THR C  1 42  ? 79.032  32.498  12.647  1.00 39.69  ? 73   THR C CA  1 
ATOM   6968  C  C   . THR C  1 42  ? 78.598  31.882  11.330  1.00 38.74  ? 73   THR C C   1 
ATOM   6969  O  O   . THR C  1 42  ? 77.952  30.826  11.341  1.00 38.72  ? 73   THR C O   1 
ATOM   6970  C  CB  . THR C  1 42  ? 78.271  33.809  12.884  1.00 39.94  ? 73   THR C CB  1 
ATOM   6971  O  OG1 . THR C  1 42  ? 78.505  34.184  14.251  1.00 41.57  ? 73   THR C OG1 1 
ATOM   6972  C  CG2 . THR C  1 42  ? 76.777  33.598  12.679  1.00 40.01  ? 73   THR C CG2 1 
ATOM   6973  N  N   . LEU C  1 43  ? 79.034  32.454  10.204  1.00 34.91  ? 74   LEU C N   1 
ATOM   6974  C  CA  . LEU C  1 43  ? 78.699  31.865  8.909   1.00 31.28  ? 74   LEU C CA  1 
ATOM   6975  C  C   . LEU C  1 43  ? 78.867  30.351  8.976   1.00 31.87  ? 74   LEU C C   1 
ATOM   6976  O  O   . LEU C  1 43  ? 78.061  29.594  8.447   1.00 31.37  ? 74   LEU C O   1 
ATOM   6977  C  CB  . LEU C  1 43  ? 79.563  32.448  7.800   1.00 27.31  ? 74   LEU C CB  1 
ATOM   6978  C  CG  . LEU C  1 43  ? 79.082  33.728  7.122   1.00 26.37  ? 74   LEU C CG  1 
ATOM   6979  C  CD1 . LEU C  1 43  ? 80.259  34.383  6.391   1.00 25.67  ? 74   LEU C CD1 1 
ATOM   6980  C  CD2 . LEU C  1 43  ? 77.950  33.527  6.109   1.00 24.73  ? 74   LEU C CD2 1 
ATOM   6981  N  N   . LYS C  1 44  ? 79.930  29.878  9.618   1.00 33.13  ? 75   LYS C N   1 
ATOM   6982  C  CA  . LYS C  1 44  ? 80.234  28.470  9.731   1.00 33.08  ? 75   LYS C CA  1 
ATOM   6983  C  C   . LYS C  1 44  ? 79.291  27.665  10.597  1.00 31.77  ? 75   LYS C C   1 
ATOM   6984  O  O   . LYS C  1 44  ? 79.085  26.476  10.316  1.00 31.10  ? 75   LYS C O   1 
ATOM   6985  C  CB  . LYS C  1 44  ? 81.682  28.295  10.218  1.00 35.43  ? 75   LYS C CB  1 
ATOM   6986  C  CG  . LYS C  1 44  ? 82.709  28.660  9.163   1.00 37.91  ? 75   LYS C CG  1 
ATOM   6987  C  CD  . LYS C  1 44  ? 84.061  28.061  9.499   1.00 41.44  ? 75   LYS C CD  1 
ATOM   6988  C  CE  . LYS C  1 44  ? 84.765  28.872  10.574  1.00 44.19  ? 75   LYS C CE  1 
ATOM   6989  N  NZ  . LYS C  1 44  ? 86.247  28.822  10.387  1.00 46.88  ? 75   LYS C NZ  1 
ATOM   6990  N  N   . LYS C  1 45  ? 78.750  28.260  11.665  1.00 29.60  ? 76   LYS C N   1 
ATOM   6991  C  CA  . LYS C  1 45  ? 77.822  27.514  12.524  1.00 28.49  ? 76   LYS C CA  1 
ATOM   6992  C  C   . LYS C  1 45  ? 76.570  27.191  11.682  1.00 27.37  ? 76   LYS C C   1 
ATOM   6993  O  O   . LYS C  1 45  ? 75.969  26.129  11.820  1.00 25.35  ? 76   LYS C O   1 
ATOM   6994  C  CB  . LYS C  1 45  ? 77.381  28.299  13.743  1.00 30.29  ? 76   LYS C CB  1 
ATOM   6995  C  CG  . LYS C  1 45  ? 78.407  29.063  14.530  1.00 34.25  ? 76   LYS C CG  1 
ATOM   6996  C  CD  . LYS C  1 45  ? 78.058  29.204  16.008  1.00 36.15  ? 76   LYS C CD  1 
ATOM   6997  C  CE  . LYS C  1 45  ? 76.657  29.746  16.219  1.00 38.39  ? 76   LYS C CE  1 
ATOM   6998  N  NZ  . LYS C  1 45  ? 76.112  29.444  17.576  1.00 38.03  ? 76   LYS C NZ  1 
ATOM   6999  N  N   . MET C  1 46  ? 76.286  28.110  10.779  1.00 26.64  ? 77   MET C N   1 
ATOM   7000  C  CA  . MET C  1 46  ? 75.150  28.063  9.883   1.00 26.39  ? 77   MET C CA  1 
ATOM   7001  C  C   . MET C  1 46  ? 75.382  27.083  8.751   1.00 27.58  ? 77   MET C C   1 
ATOM   7002  O  O   . MET C  1 46  ? 74.573  26.217  8.451   1.00 30.04  ? 77   MET C O   1 
ATOM   7003  C  CB  . MET C  1 46  ? 74.883  29.455  9.311   1.00 23.66  ? 77   MET C CB  1 
ATOM   7004  C  CG  . MET C  1 46  ? 73.832  29.553  8.252   1.00 22.25  ? 77   MET C CG  1 
ATOM   7005  S  SD  . MET C  1 46  ? 74.337  28.998  6.658   1.00 18.25  ? 77   MET C SD  1 
ATOM   7006  C  CE  . MET C  1 46  ? 73.228  29.850  5.576   1.00 18.08  ? 77   MET C CE  1 
ATOM   7007  N  N   . GLN C  1 47  ? 76.572  27.154  8.152   1.00 29.05  ? 78   GLN C N   1 
ATOM   7008  C  CA  . GLN C  1 47  ? 76.887  26.229  7.065   1.00 28.75  ? 78   GLN C CA  1 
ATOM   7009  C  C   . GLN C  1 47  ? 76.925  24.801  7.576   1.00 27.67  ? 78   GLN C C   1 
ATOM   7010  O  O   . GLN C  1 47  ? 76.542  23.852  6.894   1.00 26.33  ? 78   GLN C O   1 
ATOM   7011  C  CB  . GLN C  1 47  ? 78.235  26.607  6.460   1.00 29.07  ? 78   GLN C CB  1 
ATOM   7012  C  CG  . GLN C  1 47  ? 78.198  27.921  5.709   1.00 33.61  ? 78   GLN C CG  1 
ATOM   7013  C  CD  . GLN C  1 47  ? 79.530  28.630  5.708   1.00 35.98  ? 78   GLN C CD  1 
ATOM   7014  O  OE1 . GLN C  1 47  ? 80.204  28.756  6.726   1.00 36.89  ? 78   GLN C OE1 1 
ATOM   7015  N  NE2 . GLN C  1 47  ? 79.940  29.117  4.540   1.00 37.30  ? 78   GLN C NE2 1 
ATOM   7016  N  N   . LYS C  1 48  ? 77.395  24.633  8.804   1.00 27.01  ? 79   LYS C N   1 
ATOM   7017  C  CA  . LYS C  1 48  ? 77.423  23.293  9.383   1.00 28.73  ? 79   LYS C CA  1 
ATOM   7018  C  C   . LYS C  1 48  ? 75.990  22.781  9.530   1.00 30.35  ? 79   LYS C C   1 
ATOM   7019  O  O   . LYS C  1 48  ? 75.605  21.708  9.089   1.00 30.01  ? 79   LYS C O   1 
ATOM   7020  C  CB  . LYS C  1 48  ? 78.085  23.298  10.766  1.00 28.97  ? 79   LYS C CB  1 
ATOM   7021  C  CG  . LYS C  1 48  ? 78.207  21.901  11.355  1.00 30.69  ? 79   LYS C CG  1 
ATOM   7022  C  CD  . LYS C  1 48  ? 79.383  21.786  12.307  1.00 31.44  ? 79   LYS C CD  1 
ATOM   7023  C  CE  . LYS C  1 48  ? 78.938  22.023  13.744  1.00 34.04  ? 79   LYS C CE  1 
ATOM   7024  N  NZ  . LYS C  1 48  ? 80.004  21.718  14.732  1.00 38.74  ? 79   LYS C NZ  1 
ATOM   7025  N  N   . PHE C  1 49  ? 75.164  23.634  10.131  1.00 31.47  ? 80   PHE C N   1 
ATOM   7026  C  CA  . PHE C  1 49  ? 73.766  23.300  10.360  1.00 29.98  ? 80   PHE C CA  1 
ATOM   7027  C  C   . PHE C  1 49  ? 73.074  22.778  9.113   1.00 28.91  ? 80   PHE C C   1 
ATOM   7028  O  O   . PHE C  1 49  ? 72.322  21.799  9.137   1.00 30.42  ? 80   PHE C O   1 
ATOM   7029  C  CB  . PHE C  1 49  ? 73.023  24.543  10.886  1.00 29.52  ? 80   PHE C CB  1 
ATOM   7030  C  CG  . PHE C  1 49  ? 71.631  24.170  11.313  1.00 30.49  ? 80   PHE C CG  1 
ATOM   7031  C  CD1 . PHE C  1 49  ? 70.634  24.043  10.366  1.00 30.22  ? 80   PHE C CD1 1 
ATOM   7032  C  CD2 . PHE C  1 49  ? 71.330  23.937  12.641  1.00 31.47  ? 80   PHE C CD2 1 
ATOM   7033  C  CE1 . PHE C  1 49  ? 69.357  23.695  10.737  1.00 31.01  ? 80   PHE C CE1 1 
ATOM   7034  C  CE2 . PHE C  1 49  ? 70.053  23.577  13.034  1.00 30.14  ? 80   PHE C CE2 1 
ATOM   7035  C  CZ  . PHE C  1 49  ? 69.080  23.463  12.071  1.00 32.44  ? 80   PHE C CZ  1 
ATOM   7036  N  N   . PHE C  1 50  ? 73.267  23.453  7.986   1.00 26.07  ? 81   PHE C N   1 
ATOM   7037  C  CA  . PHE C  1 50  ? 72.640  23.055  6.730   1.00 24.90  ? 81   PHE C CA  1 
ATOM   7038  C  C   . PHE C  1 50  ? 73.562  22.176  5.901   1.00 23.16  ? 81   PHE C C   1 
ATOM   7039  O  O   . PHE C  1 50  ? 73.379  21.976  4.697   1.00 21.52  ? 81   PHE C O   1 
ATOM   7040  C  CB  . PHE C  1 50  ? 72.202  24.299  5.965   1.00 27.89  ? 81   PHE C CB  1 
ATOM   7041  C  CG  . PHE C  1 50  ? 71.148  25.118  6.669   1.00 28.69  ? 81   PHE C CG  1 
ATOM   7042  C  CD1 . PHE C  1 50  ? 69.826  24.693  6.661   1.00 26.42  ? 81   PHE C CD1 1 
ATOM   7043  C  CD2 . PHE C  1 50  ? 71.454  26.292  7.325   1.00 30.07  ? 81   PHE C CD2 1 
ATOM   7044  C  CE1 . PHE C  1 50  ? 68.842  25.420  7.298   1.00 27.43  ? 81   PHE C CE1 1 
ATOM   7045  C  CE2 . PHE C  1 50  ? 70.490  27.032  7.969   1.00 32.03  ? 81   PHE C CE2 1 
ATOM   7046  C  CZ  . PHE C  1 50  ? 69.175  26.592  7.952   1.00 30.39  ? 81   PHE C CZ  1 
ATOM   7047  N  N   . GLY C  1 51  ? 74.577  21.607  6.545   1.00 21.44  ? 82   GLY C N   1 
ATOM   7048  C  CA  . GLY C  1 51  ? 75.483  20.694  5.868   1.00 20.86  ? 82   GLY C CA  1 
ATOM   7049  C  C   . GLY C  1 51  ? 76.023  21.295  4.577   1.00 22.20  ? 82   GLY C C   1 
ATOM   7050  O  O   . GLY C  1 51  ? 75.959  20.697  3.508   1.00 20.81  ? 82   GLY C O   1 
ATOM   7051  N  N   . LEU C  1 52  ? 76.575  22.495  4.692   1.00 22.95  ? 83   LEU C N   1 
ATOM   7052  C  CA  . LEU C  1 52  ? 77.197  23.174  3.547   1.00 23.79  ? 83   LEU C CA  1 
ATOM   7053  C  C   . LEU C  1 52  ? 78.713  23.108  3.764   1.00 25.17  ? 83   LEU C C   1 
ATOM   7054  O  O   . LEU C  1 52  ? 79.139  22.874  4.895   1.00 26.19  ? 83   LEU C O   1 
ATOM   7055  C  CB  . LEU C  1 52  ? 76.804  24.650  3.563   1.00 24.63  ? 83   LEU C CB  1 
ATOM   7056  C  CG  . LEU C  1 52  ? 75.425  25.068  3.095   1.00 26.51  ? 83   LEU C CG  1 
ATOM   7057  C  CD1 . LEU C  1 52  ? 75.306  26.587  3.106   1.00 26.36  ? 83   LEU C CD1 1 
ATOM   7058  C  CD2 . LEU C  1 52  ? 75.142  24.538  1.697   1.00 28.78  ? 83   LEU C CD2 1 
ATOM   7059  N  N   . PRO C  1 53  ? 79.506  23.314  2.735   1.00 25.25  ? 84   PRO C N   1 
ATOM   7060  C  CA  . PRO C  1 53  ? 80.956  23.374  2.935   1.00 25.83  ? 84   PRO C CA  1 
ATOM   7061  C  C   . PRO C  1 53  ? 81.237  24.483  3.951   1.00 28.15  ? 84   PRO C C   1 
ATOM   7062  O  O   . PRO C  1 53  ? 80.988  25.646  3.637   1.00 28.66  ? 84   PRO C O   1 
ATOM   7063  C  CB  . PRO C  1 53  ? 81.464  23.751  1.552   1.00 24.82  ? 84   PRO C CB  1 
ATOM   7064  C  CG  . PRO C  1 53  ? 80.422  23.206  0.621   1.00 22.34  ? 84   PRO C CG  1 
ATOM   7065  C  CD  . PRO C  1 53  ? 79.124  23.552  1.327   1.00 25.84  ? 84   PRO C CD  1 
ATOM   7066  N  N   . GLN C  1 54  ? 81.706  24.120  5.135   1.00 29.17  ? 85   GLN C N   1 
ATOM   7067  C  CA  . GLN C  1 54  ? 82.002  25.048  6.212   1.00 30.18  ? 85   GLN C CA  1 
ATOM   7068  C  C   . GLN C  1 54  ? 83.130  26.012  5.855   1.00 31.08  ? 85   GLN C C   1 
ATOM   7069  O  O   . GLN C  1 54  ? 84.122  26.139  6.572   1.00 31.72  ? 85   GLN C O   1 
ATOM   7070  C  CB  . GLN C  1 54  ? 82.365  24.268  7.478   1.00 29.51  ? 85   GLN C CB  1 
ATOM   7071  C  CG  . GLN C  1 54  ? 81.211  23.607  8.194   1.00 29.35  ? 85   GLN C CG  1 
ATOM   7072  C  CD  . GLN C  1 54  ? 81.587  23.108  9.574   1.00 30.08  ? 85   GLN C CD  1 
ATOM   7073  O  OE1 . GLN C  1 54  ? 82.116  23.833  10.408  1.00 28.14  ? 85   GLN C OE1 1 
ATOM   7074  N  NE2 . GLN C  1 54  ? 81.310  21.839  9.831   1.00 33.44  ? 85   GLN C NE2 1 
ATOM   7075  N  N   . THR C  1 55  ? 82.957  26.753  4.779   1.00 31.02  ? 86   THR C N   1 
ATOM   7076  C  CA  . THR C  1 55  ? 83.856  27.746  4.258   1.00 30.20  ? 86   THR C CA  1 
ATOM   7077  C  C   . THR C  1 55  ? 84.101  28.875  5.236   1.00 29.80  ? 86   THR C C   1 
ATOM   7078  O  O   . THR C  1 55  ? 85.228  29.239  5.544   1.00 30.42  ? 86   THR C O   1 
ATOM   7079  C  CB  . THR C  1 55  ? 83.275  28.351  2.953   1.00 30.34  ? 86   THR C CB  1 
ATOM   7080  O  OG1 . THR C  1 55  ? 83.518  27.375  1.931   1.00 32.07  ? 86   THR C OG1 1 
ATOM   7081  C  CG2 . THR C  1 55  ? 84.016  29.608  2.558   1.00 31.10  ? 86   THR C CG2 1 
ATOM   7082  N  N   . GLY C  1 56  ? 83.035  29.513  5.691   1.00 30.64  ? 87   GLY C N   1 
ATOM   7083  C  CA  . GLY C  1 56  ? 83.209  30.636  6.619   1.00 31.15  ? 87   GLY C CA  1 
ATOM   7084  C  C   . GLY C  1 56  ? 83.017  31.955  5.875   1.00 30.82  ? 87   GLY C C   1 
ATOM   7085  O  O   . GLY C  1 56  ? 83.176  33.028  6.454   1.00 30.06  ? 87   GLY C O   1 
ATOM   7086  N  N   . ASP C  1 57  ? 82.737  31.850  4.582   1.00 29.75  ? 88   ASP C N   1 
ATOM   7087  C  CA  . ASP C  1 57  ? 82.562  33.003  3.723   1.00 29.36  ? 88   ASP C CA  1 
ATOM   7088  C  C   . ASP C  1 57  ? 81.194  32.969  3.046   1.00 28.61  ? 88   ASP C C   1 
ATOM   7089  O  O   . ASP C  1 57  ? 80.536  31.937  3.036   1.00 30.41  ? 88   ASP C O   1 
ATOM   7090  C  CB  . ASP C  1 57  ? 83.649  33.067  2.647   1.00 31.29  ? 88   ASP C CB  1 
ATOM   7091  C  CG  . ASP C  1 57  ? 85.011  32.621  3.127   1.00 32.22  ? 88   ASP C CG  1 
ATOM   7092  O  OD1 . ASP C  1 57  ? 85.468  33.087  4.189   1.00 35.18  ? 88   ASP C OD1 1 
ATOM   7093  O  OD2 . ASP C  1 57  ? 85.616  31.780  2.426   1.00 30.36  ? 88   ASP C OD2 1 
ATOM   7094  N  N   . LEU C  1 58  ? 80.789  34.081  2.457   1.00 27.59  ? 89   LEU C N   1 
ATOM   7095  C  CA  . LEU C  1 58  ? 79.550  34.145  1.718   1.00 28.31  ? 89   LEU C CA  1 
ATOM   7096  C  C   . LEU C  1 58  ? 79.760  33.794  0.243   1.00 28.78  ? 89   LEU C C   1 
ATOM   7097  O  O   . LEU C  1 58  ? 80.232  34.598  -0.550  1.00 28.40  ? 89   LEU C O   1 
ATOM   7098  C  CB  . LEU C  1 58  ? 78.871  35.498  1.867   1.00 29.24  ? 89   LEU C CB  1 
ATOM   7099  C  CG  . LEU C  1 58  ? 77.691  35.520  2.852   1.00 31.64  ? 89   LEU C CG  1 
ATOM   7100  C  CD1 . LEU C  1 58  ? 77.638  36.916  3.443   1.00 31.62  ? 89   LEU C CD1 1 
ATOM   7101  C  CD2 . LEU C  1 58  ? 76.411  35.179  2.120   1.00 31.75  ? 89   LEU C CD2 1 
ATOM   7102  N  N   . ASP C  1 59  ? 79.412  32.563  -0.049  1.00 30.54  ? 90   ASP C N   1 
ATOM   7103  C  CA  . ASP C  1 59  ? 79.692  31.801  -1.244  1.00 34.94  ? 90   ASP C CA  1 
ATOM   7104  C  C   . ASP C  1 59  ? 78.362  31.261  -1.752  1.00 36.56  ? 90   ASP C C   1 
ATOM   7105  O  O   . ASP C  1 59  ? 77.533  30.808  -0.962  1.00 35.56  ? 90   ASP C O   1 
ATOM   7106  C  CB  . ASP C  1 59  ? 80.706  30.657  -1.113  1.00 38.15  ? 90   ASP C CB  1 
ATOM   7107  C  CG  . ASP C  1 59  ? 80.313  29.562  -0.155  1.00 41.50  ? 90   ASP C CG  1 
ATOM   7108  O  OD1 . ASP C  1 59  ? 80.430  29.776  1.074   1.00 42.45  ? 90   ASP C OD1 1 
ATOM   7109  O  OD2 . ASP C  1 59  ? 79.902  28.469  -0.615  1.00 42.90  ? 90   ASP C OD2 1 
ATOM   7110  N  N   . GLN C  1 60  ? 78.210  31.222  -3.069  1.00 39.31  ? 91   GLN C N   1 
ATOM   7111  C  CA  . GLN C  1 60  ? 77.024  30.757  -3.736  1.00 43.35  ? 91   GLN C CA  1 
ATOM   7112  C  C   . GLN C  1 60  ? 76.417  29.504  -3.129  1.00 43.79  ? 91   GLN C C   1 
ATOM   7113  O  O   . GLN C  1 60  ? 75.220  29.256  -3.258  1.00 43.15  ? 91   GLN C O   1 
ATOM   7114  C  CB  . GLN C  1 60  ? 77.112  30.765  -5.250  1.00 46.56  ? 91   GLN C CB  1 
ATOM   7115  C  CG  . GLN C  1 60  ? 75.771  30.900  -5.950  1.00 53.74  ? 91   GLN C CG  1 
ATOM   7116  C  CD  . GLN C  1 60  ? 75.056  32.189  -5.597  1.00 59.78  ? 91   GLN C CD  1 
ATOM   7117  O  OE1 . GLN C  1 60  ? 75.614  33.277  -5.735  1.00 62.07  ? 91   GLN C OE1 1 
ATOM   7118  N  NE2 . GLN C  1 60  ? 73.820  32.300  -5.124  1.00 63.91  ? 91   GLN C NE2 1 
ATOM   7119  N  N   . ASN C  1 61  ? 77.172  28.687  -2.435  1.00 45.87  ? 92   ASN C N   1 
ATOM   7120  C  CA  . ASN C  1 61  ? 76.493  27.630  -1.670  1.00 45.64  ? 92   ASN C CA  1 
ATOM   7121  C  C   . ASN C  1 61  ? 75.608  28.143  -0.515  1.00 44.71  ? 92   ASN C C   1 
ATOM   7122  O  O   . ASN C  1 61  ? 74.407  27.869  -0.463  1.00 45.99  ? 92   ASN C O   1 
ATOM   7123  C  CB  . ASN C  1 61  ? 77.518  26.627  -1.172  1.00 46.64  ? 92   ASN C CB  1 
ATOM   7124  C  CG  . ASN C  1 61  ? 77.653  25.449  -2.107  1.00 46.21  ? 92   ASN C CG  1 
ATOM   7125  O  OD1 . ASN C  1 61  ? 78.691  24.793  -2.142  1.00 45.38  ? 92   ASN C OD1 1 
ATOM   7126  N  ND2 . ASN C  1 61  ? 76.601  25.183  -2.873  1.00 47.24  ? 92   ASN C ND2 1 
ATOM   7127  N  N   . THR C  1 62  ? 76.210  28.902  0.410   1.00 43.93  ? 93   THR C N   1 
ATOM   7128  C  CA  . THR C  1 62  ? 75.485  29.430  1.573   1.00 42.98  ? 93   THR C CA  1 
ATOM   7129  C  C   . THR C  1 62  ? 74.368  30.396  1.173   1.00 43.64  ? 93   THR C C   1 
ATOM   7130  O  O   . THR C  1 62  ? 73.217  30.234  1.576   1.00 44.23  ? 93   THR C O   1 
ATOM   7131  C  CB  . THR C  1 62  ? 76.421  30.150  2.550   1.00 40.94  ? 93   THR C CB  1 
ATOM   7132  O  OG1 . THR C  1 62  ? 76.067  31.537  2.627   1.00 40.89  ? 93   THR C OG1 1 
ATOM   7133  C  CG2 . THR C  1 62  ? 77.867  30.014  2.100   1.00 38.34  ? 93   THR C CG2 1 
ATOM   7134  N  N   . ILE C  1 63  ? 74.700  31.411  0.380   1.00 43.67  ? 94   ILE C N   1 
ATOM   7135  C  CA  . ILE C  1 63  ? 73.703  32.387  -0.052  1.00 42.27  ? 94   ILE C CA  1 
ATOM   7136  C  C   . ILE C  1 63  ? 72.448  31.701  -0.585  1.00 42.28  ? 94   ILE C C   1 
ATOM   7137  O  O   . ILE C  1 63  ? 71.347  31.922  -0.082  1.00 43.27  ? 94   ILE C O   1 
ATOM   7138  C  CB  . ILE C  1 63  ? 74.247  33.327  -1.146  1.00 40.02  ? 94   ILE C CB  1 
ATOM   7139  C  CG1 . ILE C  1 63  ? 75.585  33.934  -0.720  1.00 41.17  ? 94   ILE C CG1 1 
ATOM   7140  C  CG2 . ILE C  1 63  ? 73.235  34.421  -1.458  1.00 35.50  ? 94   ILE C CG2 1 
ATOM   7141  C  CD1 . ILE C  1 63  ? 76.237  34.783  -1.790  1.00 43.22  ? 94   ILE C CD1 1 
ATOM   7142  N  N   . GLU C  1 64  ? 72.625  30.867  -1.603  1.00 40.13  ? 95   GLU C N   1 
ATOM   7143  C  CA  . GLU C  1 64  ? 71.511  30.160  -2.227  1.00 37.54  ? 95   GLU C CA  1 
ATOM   7144  C  C   . GLU C  1 64  ? 70.525  29.614  -1.194  1.00 35.48  ? 95   GLU C C   1 
ATOM   7145  O  O   . GLU C  1 64  ? 69.313  29.769  -1.335  1.00 33.76  ? 95   GLU C O   1 
ATOM   7146  C  CB  . GLU C  1 64  ? 72.026  29.031  -3.121  1.00 39.06  ? 95   GLU C CB  1 
ATOM   7147  C  CG  . GLU C  1 64  ? 72.338  29.466  -4.544  1.00 42.74  ? 95   GLU C CG  1 
ATOM   7148  C  CD  . GLU C  1 64  ? 72.422  28.300  -5.508  1.00 46.42  ? 95   GLU C CD  1 
ATOM   7149  O  OE1 . GLU C  1 64  ? 72.234  27.147  -5.065  1.00 46.76  ? 95   GLU C OE1 1 
ATOM   7150  O  OE2 . GLU C  1 64  ? 72.677  28.538  -6.708  1.00 48.46  ? 95   GLU C OE2 1 
ATOM   7151  N  N   . THR C  1 65  ? 71.029  28.969  -0.145  1.00 35.57  ? 96   THR C N   1 
ATOM   7152  C  CA  . THR C  1 65  ? 70.138  28.409  0.869   1.00 36.63  ? 96   THR C CA  1 
ATOM   7153  C  C   . THR C  1 65  ? 69.589  29.486  1.785   1.00 39.73  ? 96   THR C C   1 
ATOM   7154  O  O   . THR C  1 65  ? 68.485  29.348  2.329   1.00 42.27  ? 96   THR C O   1 
ATOM   7155  C  CB  . THR C  1 65  ? 70.825  27.329  1.708   1.00 34.94  ? 96   THR C CB  1 
ATOM   7156  O  OG1 . THR C  1 65  ? 71.408  27.920  2.874   1.00 33.28  ? 96   THR C OG1 1 
ATOM   7157  C  CG2 . THR C  1 65  ? 71.896  26.621  0.895   1.00 33.53  ? 96   THR C CG2 1 
ATOM   7158  N  N   . MET C  1 66  ? 70.321  30.588  1.926   1.00 39.75  ? 97   MET C N   1 
ATOM   7159  C  CA  . MET C  1 66  ? 69.896  31.688  2.778   1.00 39.19  ? 97   MET C CA  1 
ATOM   7160  C  C   . MET C  1 66  ? 68.669  32.390  2.230   1.00 38.42  ? 97   MET C C   1 
ATOM   7161  O  O   . MET C  1 66  ? 67.967  33.099  2.941   1.00 38.44  ? 97   MET C O   1 
ATOM   7162  C  CB  . MET C  1 66  ? 71.015  32.725  2.994   1.00 37.99  ? 97   MET C CB  1 
ATOM   7163  C  CG  . MET C  1 66  ? 71.747  32.526  4.306   1.00 37.76  ? 97   MET C CG  1 
ATOM   7164  S  SD  . MET C  1 66  ? 73.048  33.702  4.639   1.00 37.97  ? 97   MET C SD  1 
ATOM   7165  C  CE  . MET C  1 66  ? 74.067  33.508  3.184   1.00 39.27  ? 97   MET C CE  1 
ATOM   7166  N  N   . ARG C  1 67  ? 68.419  32.242  0.931   1.00 37.36  ? 98   ARG C N   1 
ATOM   7167  C  CA  . ARG C  1 67  ? 67.287  32.942  0.343   1.00 37.75  ? 98   ARG C CA  1 
ATOM   7168  C  C   . ARG C  1 67  ? 66.164  31.987  0.000   1.00 38.28  ? 98   ARG C C   1 
ATOM   7169  O  O   . ARG C  1 67  ? 65.316  32.269  -0.845  1.00 39.59  ? 98   ARG C O   1 
ATOM   7170  C  CB  . ARG C  1 67  ? 67.726  33.774  -0.839  1.00 37.61  ? 98   ARG C CB  1 
ATOM   7171  C  CG  . ARG C  1 67  ? 68.186  33.000  -2.054  1.00 39.28  ? 98   ARG C CG  1 
ATOM   7172  C  CD  . ARG C  1 67  ? 69.156  33.847  -2.876  1.00 41.74  ? 98   ARG C CD  1 
ATOM   7173  N  NE  . ARG C  1 67  ? 68.943  35.261  -2.612  1.00 46.47  ? 98   ARG C NE  1 
ATOM   7174  C  CZ  . ARG C  1 67  ? 69.708  36.260  -3.018  1.00 49.19  ? 98   ARG C CZ  1 
ATOM   7175  N  NH1 . ARG C  1 67  ? 70.799  36.045  -3.744  1.00 50.26  ? 98   ARG C NH1 1 
ATOM   7176  N  NH2 . ARG C  1 67  ? 69.381  37.506  -2.695  1.00 48.36  ? 98   ARG C NH2 1 
ATOM   7177  N  N   . LYS C  1 68  ? 66.146  30.829  0.657   1.00 37.45  ? 99   LYS C N   1 
ATOM   7178  C  CA  . LYS C  1 68  ? 65.068  29.853  0.471   1.00 34.63  ? 99   LYS C CA  1 
ATOM   7179  C  C   . LYS C  1 68  ? 64.036  30.104  1.581   1.00 32.56  ? 99   LYS C C   1 
ATOM   7180  O  O   . LYS C  1 68  ? 64.441  30.297  2.727   1.00 31.72  ? 99   LYS C O   1 
ATOM   7181  C  CB  . LYS C  1 68  ? 65.611  28.436  0.656   1.00 35.33  ? 99   LYS C CB  1 
ATOM   7182  C  CG  . LYS C  1 68  ? 66.637  27.917  -0.315  1.00 36.36  ? 99   LYS C CG  1 
ATOM   7183  C  CD  . LYS C  1 68  ? 66.592  26.397  -0.410  1.00 38.70  ? 99   LYS C CD  1 
ATOM   7184  C  CE  . LYS C  1 68  ? 67.433  25.901  -1.577  1.00 41.22  ? 99   LYS C CE  1 
ATOM   7185  N  NZ  . LYS C  1 68  ? 68.821  25.562  -1.146  1.00 44.27  ? 99   LYS C NZ  1 
ATOM   7186  N  N   . PRO C  1 69  ? 62.770  30.174  1.235   1.00 30.82  ? 100  PRO C N   1 
ATOM   7187  C  CA  . PRO C  1 69  ? 61.699  30.393  2.217   1.00 29.09  ? 100  PRO C CA  1 
ATOM   7188  C  C   . PRO C  1 69  ? 61.946  29.439  3.386   1.00 29.14  ? 100  PRO C C   1 
ATOM   7189  O  O   . PRO C  1 69  ? 62.214  28.255  3.206   1.00 28.51  ? 100  PRO C O   1 
ATOM   7190  C  CB  . PRO C  1 69  ? 60.457  29.983  1.455   1.00 29.07  ? 100  PRO C CB  1 
ATOM   7191  C  CG  . PRO C  1 69  ? 60.766  30.292  0.034   1.00 29.17  ? 100  PRO C CG  1 
ATOM   7192  C  CD  . PRO C  1 69  ? 62.219  29.993  -0.127  1.00 30.36  ? 100  PRO C CD  1 
ATOM   7193  N  N   . ARG C  1 70  ? 61.946  29.979  4.601   1.00 28.97  ? 101  ARG C N   1 
ATOM   7194  C  CA  . ARG C  1 70  ? 62.249  29.150  5.775   1.00 27.90  ? 101  ARG C CA  1 
ATOM   7195  C  C   . ARG C  1 70  ? 61.445  29.636  6.951   1.00 28.22  ? 101  ARG C C   1 
ATOM   7196  O  O   . ARG C  1 70  ? 60.875  30.713  6.958   1.00 27.70  ? 101  ARG C O   1 
ATOM   7197  C  CB  . ARG C  1 70  ? 63.743  29.239  6.102   1.00 28.33  ? 101  ARG C CB  1 
ATOM   7198  C  CG  . ARG C  1 70  ? 64.216  30.655  6.434   1.00 26.51  ? 101  ARG C CG  1 
ATOM   7199  C  CD  . ARG C  1 70  ? 64.653  30.716  7.892   1.00 25.59  ? 101  ARG C CD  1 
ATOM   7200  N  NE  . ARG C  1 70  ? 65.770  29.822  8.141   1.00 26.37  ? 101  ARG C NE  1 
ATOM   7201  C  CZ  . ARG C  1 70  ? 66.103  29.367  9.348   1.00 28.37  ? 101  ARG C CZ  1 
ATOM   7202  N  NH1 . ARG C  1 70  ? 65.421  29.680  10.440  1.00 27.08  ? 101  ARG C NH1 1 
ATOM   7203  N  NH2 . ARG C  1 70  ? 67.145  28.545  9.449   1.00 27.28  ? 101  ARG C NH2 1 
ATOM   7204  N  N   . CYS C  1 71  ? 61.445  28.818  7.992   1.00 27.75  ? 102  CYS C N   1 
ATOM   7205  C  CA  . CYS C  1 71  ? 60.687  29.198  9.180   1.00 29.35  ? 102  CYS C CA  1 
ATOM   7206  C  C   . CYS C  1 71  ? 61.362  30.365  9.886   1.00 28.97  ? 102  CYS C C   1 
ATOM   7207  O  O   . CYS C  1 71  ? 62.589  30.437  9.915   1.00 32.34  ? 102  CYS C O   1 
ATOM   7208  C  CB  . CYS C  1 71  ? 60.586  27.996  10.130  1.00 29.05  ? 102  CYS C CB  1 
ATOM   7209  S  SG  . CYS C  1 71  ? 60.342  28.588  11.805  1.00 31.67  ? 102  CYS C SG  1 
ATOM   7210  N  N   . GLY C  1 72  ? 60.584  31.228  10.524  1.00 28.24  ? 103  GLY C N   1 
ATOM   7211  C  CA  . GLY C  1 72  ? 61.085  32.373  11.244  1.00 27.08  ? 103  GLY C CA  1 
ATOM   7212  C  C   . GLY C  1 72  ? 61.651  32.096  12.615  1.00 26.98  ? 103  GLY C C   1 
ATOM   7213  O  O   . GLY C  1 72  ? 61.985  33.065  13.321  1.00 27.52  ? 103  GLY C O   1 
ATOM   7214  N  N   . ASN C  1 73  ? 61.878  30.868  13.026  1.00 26.90  ? 104  ASN C N   1 
ATOM   7215  C  CA  . ASN C  1 73  ? 62.455  30.606  14.340  1.00 30.71  ? 104  ASN C CA  1 
ATOM   7216  C  C   . ASN C  1 73  ? 63.963  30.399  14.213  1.00 34.15  ? 104  ASN C C   1 
ATOM   7217  O  O   . ASN C  1 73  ? 64.508  30.066  13.150  1.00 35.02  ? 104  ASN C O   1 
ATOM   7218  C  CB  . ASN C  1 73  ? 61.827  29.362  14.961  1.00 33.94  ? 104  ASN C CB  1 
ATOM   7219  C  CG  . ASN C  1 73  ? 60.488  29.565  15.620  1.00 35.54  ? 104  ASN C CG  1 
ATOM   7220  O  OD1 . ASN C  1 73  ? 60.153  28.991  16.662  1.00 35.98  ? 104  ASN C OD1 1 
ATOM   7221  N  ND2 . ASN C  1 73  ? 59.646  30.398  15.028  1.00 38.05  ? 104  ASN C ND2 1 
ATOM   7222  N  N   . PRO C  1 74  ? 64.691  30.536  15.310  1.00 36.35  ? 105  PRO C N   1 
ATOM   7223  C  CA  . PRO C  1 74  ? 66.139  30.392  15.312  1.00 37.59  ? 105  PRO C CA  1 
ATOM   7224  C  C   . PRO C  1 74  ? 66.570  28.958  15.042  1.00 39.74  ? 105  PRO C C   1 
ATOM   7225  O  O   . PRO C  1 74  ? 65.746  28.043  15.072  1.00 39.22  ? 105  PRO C O   1 
ATOM   7226  C  CB  . PRO C  1 74  ? 66.557  30.822  16.712  1.00 35.82  ? 105  PRO C CB  1 
ATOM   7227  C  CG  . PRO C  1 74  ? 65.438  31.693  17.177  1.00 35.40  ? 105  PRO C CG  1 
ATOM   7228  C  CD  . PRO C  1 74  ? 64.198  31.007  16.631  1.00 35.73  ? 105  PRO C CD  1 
ATOM   7229  N  N   . ASP C  1 75  ? 67.866  28.805  14.728  1.00 41.14  ? 106  ASP C N   1 
ATOM   7230  C  CA  . ASP C  1 75  ? 68.408  27.473  14.467  1.00 42.55  ? 106  ASP C CA  1 
ATOM   7231  C  C   . ASP C  1 75  ? 69.299  27.078  15.646  1.00 45.84  ? 106  ASP C C   1 
ATOM   7232  O  O   . ASP C  1 75  ? 69.479  25.907  15.938  1.00 45.13  ? 106  ASP C O   1 
ATOM   7233  C  CB  . ASP C  1 75  ? 69.188  27.441  13.185  1.00 41.68  ? 106  ASP C CB  1 
ATOM   7234  C  CG  . ASP C  1 75  ? 68.337  27.590  11.950  1.00 41.70  ? 106  ASP C CG  1 
ATOM   7235  O  OD1 . ASP C  1 75  ? 67.102  27.449  12.040  1.00 40.97  ? 106  ASP C OD1 1 
ATOM   7236  O  OD2 . ASP C  1 75  ? 68.877  27.838  10.853  1.00 43.76  ? 106  ASP C OD2 1 
ATOM   7237  N  N   . VAL C  1 76  ? 69.798  28.118  16.301  1.00 50.30  ? 107  VAL C N   1 
ATOM   7238  C  CA  . VAL C  1 76  ? 70.643  27.993  17.476  1.00 54.76  ? 107  VAL C CA  1 
ATOM   7239  C  C   . VAL C  1 76  ? 69.781  28.147  18.730  1.00 59.77  ? 107  VAL C C   1 
ATOM   7240  O  O   . VAL C  1 76  ? 68.903  29.002  18.778  1.00 60.04  ? 107  VAL C O   1 
ATOM   7241  C  CB  . VAL C  1 76  ? 71.737  29.072  17.510  1.00 53.50  ? 107  VAL C CB  1 
ATOM   7242  C  CG1 . VAL C  1 76  ? 72.658  28.947  16.311  1.00 52.70  ? 107  VAL C CG1 1 
ATOM   7243  C  CG2 . VAL C  1 76  ? 71.110  30.460  17.554  1.00 52.40  ? 107  VAL C CG2 1 
ATOM   7244  N  N   . ALA C  1 77  ? 70.006  27.285  19.710  1.00 66.48  ? 108  ALA C N   1 
ATOM   7245  C  CA  . ALA C  1 77  ? 69.225  27.328  20.938  1.00 73.25  ? 108  ALA C CA  1 
ATOM   7246  C  C   . ALA C  1 77  ? 69.880  28.229  21.976  1.00 78.08  ? 108  ALA C C   1 
ATOM   7247  O  O   . ALA C  1 77  ? 70.855  28.924  21.690  1.00 78.46  ? 108  ALA C O   1 
ATOM   7248  C  CB  . ALA C  1 77  ? 69.031  25.929  21.497  1.00 72.03  ? 108  ALA C CB  1 
ATOM   7249  N  N   . ASN C  1 78  ? 69.238  28.324  23.127  1.00 84.25  ? 109  ASN C N   1 
ATOM   7250  C  CA  . ASN C  1 78  ? 69.656  29.103  24.270  1.00 89.98  ? 109  ASN C CA  1 
ATOM   7251  C  C   . ASN C  1 78  ? 68.849  28.625  25.492  1.00 92.96  ? 109  ASN C C   1 
ATOM   7252  O  O   . ASN C  1 78  ? 69.139  29.055  26.602  1.00 93.76  ? 109  ASN C O   1 
ATOM   7253  C  CB  . ASN C  1 78  ? 69.274  30.584  24.153  1.00 90.86  ? 109  ASN C CB  1 
ATOM   7254  C  CG  . ASN C  1 78  ? 69.436  31.182  22.795  1.00 92.08  ? 109  ASN C CG  1 
ATOM   7255  O  OD1 . ASN C  1 78  ? 70.572  31.208  22.297  1.00 93.43  ? 109  ASN C OD1 1 
ATOM   7256  N  ND2 . ASN C  1 78  ? 68.446  31.657  22.061  1.00 91.82  ? 109  ASN C ND2 1 
ATOM   7257  N  N   . TYR C  1 79  ? 67.842  27.818  25.215  1.00 96.24  ? 110  TYR C N   1 
ATOM   7258  C  CA  . TYR C  1 79  ? 66.909  27.329  26.193  1.00 98.83  ? 110  TYR C CA  1 
ATOM   7259  C  C   . TYR C  1 79  ? 67.481  27.084  27.559  1.00 99.58  ? 110  TYR C C   1 
ATOM   7260  O  O   . TYR C  1 79  ? 66.734  26.831  28.513  1.00 99.93  ? 110  TYR C O   1 
ATOM   7261  C  CB  . TYR C  1 79  ? 65.966  26.268  25.685  1.00 99.43  ? 110  TYR C CB  1 
ATOM   7262  C  CG  . TYR C  1 79  ? 66.658  24.944  25.454  1.00 100.00 ? 110  TYR C CG  1 
ATOM   7263  C  CD1 . TYR C  1 79  ? 67.326  24.691  24.265  1.00 100.00 ? 110  TYR C CD1 1 
ATOM   7264  C  CD2 . TYR C  1 79  ? 66.648  23.971  26.442  1.00 100.00 ? 110  TYR C CD2 1 
ATOM   7265  C  CE1 . TYR C  1 79  ? 67.962  23.482  24.060  1.00 100.00 ? 110  TYR C CE1 1 
ATOM   7266  C  CE2 . TYR C  1 79  ? 67.283  22.759  26.244  1.00 100.00 ? 110  TYR C CE2 1 
ATOM   7267  C  CZ  . TYR C  1 79  ? 67.936  22.525  25.053  1.00 100.00 ? 110  TYR C CZ  1 
ATOM   7268  O  OH  . TYR C  1 79  ? 68.572  21.321  24.845  1.00 100.00 ? 110  TYR C OH  1 
ATOM   7269  N  N   . ASN C  1 80  ? 68.768  27.276  27.765  1.00 99.69  ? 111  ASN C N   1 
ATOM   7270  C  CA  . ASN C  1 80  ? 69.337  27.507  29.073  1.00 100.00 ? 111  ASN C CA  1 
ATOM   7271  C  C   . ASN C  1 80  ? 68.918  28.828  29.728  1.00 100.00 ? 111  ASN C C   1 
ATOM   7272  O  O   . ASN C  1 80  ? 68.452  28.800  30.885  1.00 100.00 ? 111  ASN C O   1 
ATOM   7273  C  CB  . ASN C  1 80  ? 70.866  27.467  28.946  1.00 99.99  ? 111  ASN C CB  1 
ATOM   7274  C  CG  . ASN C  1 80  ? 71.561  27.503  30.287  1.00 100.00 ? 111  ASN C CG  1 
ATOM   7275  O  OD1 . ASN C  1 80  ? 71.286  26.691  31.170  1.00 100.00 ? 111  ASN C OD1 1 
ATOM   7276  N  ND2 . ASN C  1 80  ? 72.476  28.452  30.457  1.00 100.00 ? 111  ASN C ND2 1 
ATOM   7277  N  N   . PHE C  1 81  ? 69.174  29.991  29.127  1.00 100.00 ? 112  PHE C N   1 
ATOM   7278  C  CA  . PHE C  1 81  ? 68.805  31.276  29.738  1.00 100.00 ? 112  PHE C CA  1 
ATOM   7279  C  C   . PHE C  1 81  ? 67.383  31.629  29.359  1.00 100.00 ? 112  PHE C C   1 
ATOM   7280  O  O   . PHE C  1 81  ? 66.652  32.292  30.082  1.00 100.00 ? 112  PHE C O   1 
ATOM   7281  C  CB  . PHE C  1 81  ? 69.838  32.354  29.440  1.00 100.00 ? 112  PHE C CB  1 
ATOM   7282  C  CG  . PHE C  1 81  ? 71.062  32.119  30.302  1.00 100.00 ? 112  PHE C CG  1 
ATOM   7283  C  CD1 . PHE C  1 81  ? 70.887  31.872  31.657  1.00 100.00 ? 112  PHE C CD1 1 
ATOM   7284  C  CD2 . PHE C  1 81  ? 72.333  32.115  29.777  1.00 100.00 ? 112  PHE C CD2 1 
ATOM   7285  C  CE1 . PHE C  1 81  ? 71.974  31.640  32.476  1.00 100.00 ? 112  PHE C CE1 1 
ATOM   7286  C  CE2 . PHE C  1 81  ? 73.428  31.885  30.593  1.00 100.00 ? 112  PHE C CE2 1 
ATOM   7287  C  CZ  . PHE C  1 81  ? 73.247  31.647  31.942  1.00 100.00 ? 112  PHE C CZ  1 
ATOM   7288  N  N   . PHE C  1 82  ? 66.987  31.055  28.223  1.00 100.00 ? 113  PHE C N   1 
ATOM   7289  C  CA  . PHE C  1 82  ? 65.556  31.131  27.824  1.00 100.00 ? 113  PHE C CA  1 
ATOM   7290  C  C   . PHE C  1 82  ? 64.921  30.097  28.749  1.00 100.00 ? 113  PHE C C   1 
ATOM   7291  O  O   . PHE C  1 82  ? 65.647  29.170  29.161  1.00 100.00 ? 113  PHE C O   1 
ATOM   7292  C  CB  . PHE C  1 82  ? 65.468  30.833  26.337  1.00 100.00 ? 113  PHE C CB  1 
ATOM   7293  C  CG  . PHE C  1 82  ? 66.341  31.734  25.495  1.00 100.00 ? 113  PHE C CG  1 
ATOM   7294  C  CD1 . PHE C  1 82  ? 67.424  32.401  26.036  1.00 100.00 ? 113  PHE C CD1 1 
ATOM   7295  C  CD2 . PHE C  1 82  ? 66.084  31.917  24.146  1.00 100.00 ? 113  PHE C CD2 1 
ATOM   7296  C  CE1 . PHE C  1 82  ? 68.240  33.229  25.306  1.00 100.00 ? 113  PHE C CE1 1 
ATOM   7297  C  CE2 . PHE C  1 82  ? 66.875  32.767  23.409  1.00 100.00 ? 113  PHE C CE2 1 
ATOM   7298  C  CZ  . PHE C  1 82  ? 67.961  33.418  23.968  1.00 100.00 ? 113  PHE C CZ  1 
ATOM   7299  N  N   . PRO C  1 83  ? 63.772  30.350  29.344  1.00 100.00 ? 114  PRO C N   1 
ATOM   7300  C  CA  . PRO C  1 83  ? 63.236  29.501  30.386  1.00 100.00 ? 114  PRO C CA  1 
ATOM   7301  C  C   . PRO C  1 83  ? 63.265  28.016  30.082  1.00 100.00 ? 114  PRO C C   1 
ATOM   7302  O  O   . PRO C  1 83  ? 63.353  27.571  28.942  1.00 100.00 ? 114  PRO C O   1 
ATOM   7303  C  CB  . PRO C  1 83  ? 61.807  29.982  30.582  1.00 100.00 ? 114  PRO C CB  1 
ATOM   7304  C  CG  . PRO C  1 83  ? 61.792  31.375  30.077  1.00 100.00 ? 114  PRO C CG  1 
ATOM   7305  C  CD  . PRO C  1 83  ? 62.865  31.476  29.030  1.00 100.00 ? 114  PRO C CD  1 
ATOM   7306  N  N   . ARG C  1 84  ? 63.141  27.245  31.152  1.00 100.00 ? 115  ARG C N   1 
ATOM   7307  C  CA  . ARG C  1 84  ? 63.158  25.818  31.181  1.00 99.63  ? 115  ARG C CA  1 
ATOM   7308  C  C   . ARG C  1 84  ? 62.655  25.101  29.939  1.00 98.74  ? 115  ARG C C   1 
ATOM   7309  O  O   . ARG C  1 84  ? 61.590  25.427  29.412  1.00 100.00 ? 115  ARG C O   1 
ATOM   7310  C  CB  . ARG C  1 84  ? 62.473  25.260  32.433  1.00 100.00 ? 115  ARG C CB  1 
ATOM   7311  C  CG  . ARG C  1 84  ? 61.722  26.302  33.245  1.00 100.00 ? 115  ARG C CG  1 
ATOM   7312  C  CD  . ARG C  1 84  ? 60.218  26.146  33.089  1.00 100.00 ? 115  ARG C CD  1 
ATOM   7313  N  NE  . ARG C  1 84  ? 59.693  25.062  33.913  1.00 100.00 ? 115  ARG C NE  1 
ATOM   7314  C  CZ  . ARG C  1 84  ? 58.539  25.115  34.571  1.00 100.00 ? 115  ARG C CZ  1 
ATOM   7315  N  NH1 . ARG C  1 84  ? 57.786  26.204  34.502  1.00 100.00 ? 115  ARG C NH1 1 
ATOM   7316  N  NH2 . ARG C  1 84  ? 58.142  24.079  35.298  1.00 100.00 ? 115  ARG C NH2 1 
ATOM   7317  N  N   . LYS C  1 85  ? 63.474  24.109  29.516  1.00 95.53  ? 116  LYS C N   1 
ATOM   7318  C  CA  . LYS C  1 85  ? 63.138  23.269  28.374  1.00 91.38  ? 116  LYS C CA  1 
ATOM   7319  C  C   . LYS C  1 85  ? 61.677  22.922  28.466  1.00 87.43  ? 116  LYS C C   1 
ATOM   7320  O  O   . LYS C  1 85  ? 61.289  22.074  29.276  1.00 87.33  ? 116  LYS C O   1 
ATOM   7321  C  CB  . LYS C  1 85  ? 64.039  22.033  28.308  1.00 91.47  ? 116  LYS C CB  1 
ATOM   7322  C  CG  . LYS C  1 85  ? 64.118  21.387  26.927  1.00 92.82  ? 116  LYS C CG  1 
ATOM   7323  C  CD  . LYS C  1 85  ? 63.551  22.294  25.842  1.00 93.65  ? 116  LYS C CD  1 
ATOM   7324  C  CE  . LYS C  1 85  ? 63.250  21.513  24.569  1.00 93.68  ? 116  LYS C CE  1 
ATOM   7325  N  NZ  . LYS C  1 85  ? 64.482  21.240  23.776  1.00 93.35  ? 116  LYS C NZ  1 
ATOM   7326  N  N   . PRO C  1 86  ? 60.928  23.601  27.620  1.00 83.68  ? 117  PRO C N   1 
ATOM   7327  C  CA  . PRO C  1 86  ? 59.471  23.565  27.603  1.00 79.83  ? 117  PRO C CA  1 
ATOM   7328  C  C   . PRO C  1 86  ? 58.871  22.214  27.317  1.00 76.33  ? 117  PRO C C   1 
ATOM   7329  O  O   . PRO C  1 86  ? 59.538  21.322  26.791  1.00 75.20  ? 117  PRO C O   1 
ATOM   7330  C  CB  . PRO C  1 86  ? 59.102  24.485  26.438  1.00 80.73  ? 117  PRO C CB  1 
ATOM   7331  C  CG  . PRO C  1 86  ? 60.298  25.346  26.258  1.00 81.35  ? 117  PRO C CG  1 
ATOM   7332  C  CD  . PRO C  1 86  ? 61.462  24.472  26.574  1.00 82.77  ? 117  PRO C CD  1 
ATOM   7333  N  N   . LYS C  1 87  ? 57.605  22.134  27.679  1.00 73.24  ? 118  LYS C N   1 
ATOM   7334  C  CA  . LYS C  1 87  ? 56.827  20.943  27.496  1.00 70.19  ? 118  LYS C CA  1 
ATOM   7335  C  C   . LYS C  1 87  ? 55.495  21.064  28.212  1.00 67.12  ? 118  LYS C C   1 
ATOM   7336  O  O   . LYS C  1 87  ? 55.435  21.048  29.442  1.00 66.72  ? 118  LYS C O   1 
ATOM   7337  C  CB  . LYS C  1 87  ? 57.598  19.716  27.987  1.00 71.11  ? 118  LYS C CB  1 
ATOM   7338  C  CG  . LYS C  1 87  ? 56.811  18.417  27.913  1.00 72.61  ? 118  LYS C CG  1 
ATOM   7339  C  CD  . LYS C  1 87  ? 57.616  17.251  28.465  1.00 72.54  ? 118  LYS C CD  1 
ATOM   7340  C  CE  . LYS C  1 87  ? 57.780  17.358  29.972  1.00 72.72  ? 118  LYS C CE  1 
ATOM   7341  N  NZ  . LYS C  1 87  ? 56.467  17.448  30.668  1.00 73.72  ? 118  LYS C NZ  1 
ATOM   7342  N  N   . TRP C  1 88  ? 54.431  21.194  27.439  1.00 63.88  ? 119  TRP C N   1 
ATOM   7343  C  CA  . TRP C  1 88  ? 53.141  21.245  28.233  1.00 61.55  ? 119  TRP C CA  1 
ATOM   7344  C  C   . TRP C  1 88  ? 53.086  20.241  29.374  1.00 61.41  ? 119  TRP C C   1 
ATOM   7345  O  O   . TRP C  1 88  ? 53.441  19.072  29.227  1.00 60.85  ? 119  TRP C O   1 
ATOM   7346  C  CB  . TRP C  1 88  ? 52.029  21.027  27.212  1.00 58.56  ? 119  TRP C CB  1 
ATOM   7347  C  CG  . TRP C  1 88  ? 52.052  22.040  26.111  1.00 53.47  ? 119  TRP C CG  1 
ATOM   7348  C  CD1 . TRP C  1 88  ? 52.366  21.824  24.801  1.00 51.47  ? 119  TRP C CD1 1 
ATOM   7349  C  CD2 . TRP C  1 88  ? 51.751  23.434  26.229  1.00 50.83  ? 119  TRP C CD2 1 
ATOM   7350  N  NE1 . TRP C  1 88  ? 52.279  23.000  24.095  1.00 49.83  ? 119  TRP C NE1 1 
ATOM   7351  C  CE2 . TRP C  1 88  ? 51.903  24.003  24.950  1.00 50.11  ? 119  TRP C CE2 1 
ATOM   7352  C  CE3 . TRP C  1 88  ? 51.366  24.255  27.293  1.00 49.28  ? 119  TRP C CE3 1 
ATOM   7353  C  CZ2 . TRP C  1 88  ? 51.683  25.357  24.706  1.00 50.02  ? 119  TRP C CZ2 1 
ATOM   7354  C  CZ3 . TRP C  1 88  ? 51.148  25.598  27.048  1.00 49.82  ? 119  TRP C CZ3 1 
ATOM   7355  C  CH2 . TRP C  1 88  ? 51.307  26.136  25.765  1.00 49.75  ? 119  TRP C CH2 1 
ATOM   7356  N  N   . ASP C  1 89  ? 52.638  20.720  30.531  1.00 60.93  ? 120  ASP C N   1 
ATOM   7357  C  CA  . ASP C  1 89  ? 52.540  19.883  31.717  1.00 60.02  ? 120  ASP C CA  1 
ATOM   7358  C  C   . ASP C  1 89  ? 51.250  19.085  31.740  1.00 58.21  ? 120  ASP C C   1 
ATOM   7359  O  O   . ASP C  1 89  ? 50.780  18.628  32.777  1.00 57.47  ? 120  ASP C O   1 
ATOM   7360  C  CB  . ASP C  1 89  ? 52.706  20.738  32.972  1.00 61.86  ? 120  ASP C CB  1 
ATOM   7361  C  CG  . ASP C  1 89  ? 54.070  21.409  33.018  1.00 64.61  ? 120  ASP C CG  1 
ATOM   7362  O  OD1 . ASP C  1 89  ? 55.089  20.690  32.993  1.00 65.24  ? 120  ASP C OD1 1 
ATOM   7363  O  OD2 . ASP C  1 89  ? 54.127  22.655  33.077  1.00 66.34  ? 120  ASP C OD2 1 
ATOM   7364  N  N   . LYS C  1 90  ? 50.626  18.933  30.578  1.00 56.19  ? 121  LYS C N   1 
ATOM   7365  C  CA  . LYS C  1 90  ? 49.395  18.188  30.423  1.00 54.93  ? 121  LYS C CA  1 
ATOM   7366  C  C   . LYS C  1 90  ? 49.197  17.774  28.969  1.00 54.91  ? 121  LYS C C   1 
ATOM   7367  O  O   . LYS C  1 90  ? 49.614  18.507  28.076  1.00 54.72  ? 121  LYS C O   1 
ATOM   7368  C  CB  . LYS C  1 90  ? 48.198  18.969  30.937  1.00 56.31  ? 121  LYS C CB  1 
ATOM   7369  C  CG  . LYS C  1 90  ? 48.349  20.453  31.145  1.00 56.56  ? 121  LYS C CG  1 
ATOM   7370  C  CD  . LYS C  1 90  ? 47.966  21.281  29.936  1.00 56.20  ? 121  LYS C CD  1 
ATOM   7371  C  CE  . LYS C  1 90  ? 48.096  22.769  30.242  1.00 56.04  ? 121  LYS C CE  1 
ATOM   7372  N  NZ  . LYS C  1 90  ? 47.284  23.616  29.326  1.00 54.30  ? 121  LYS C NZ  1 
ATOM   7373  N  N   . ASN C  1 91  ? 48.575  16.628  28.730  1.00 55.17  ? 122  ASN C N   1 
ATOM   7374  C  CA  . ASN C  1 91  ? 48.373  16.125  27.377  1.00 55.59  ? 122  ASN C CA  1 
ATOM   7375  C  C   . ASN C  1 91  ? 47.151  16.720  26.703  1.00 54.84  ? 122  ASN C C   1 
ATOM   7376  O  O   . ASN C  1 91  ? 46.941  16.552  25.500  1.00 52.84  ? 122  ASN C O   1 
ATOM   7377  C  CB  . ASN C  1 91  ? 48.298  14.596  27.385  1.00 56.34  ? 122  ASN C CB  1 
ATOM   7378  C  CG  . ASN C  1 91  ? 49.583  13.971  27.892  1.00 58.14  ? 122  ASN C CG  1 
ATOM   7379  O  OD1 . ASN C  1 91  ? 50.515  14.670  28.297  1.00 59.20  ? 122  ASN C OD1 1 
ATOM   7380  N  ND2 . ASN C  1 91  ? 49.642  12.645  27.866  1.00 58.63  ? 122  ASN C ND2 1 
ATOM   7381  N  N   . GLN C  1 92  ? 46.316  17.396  27.483  1.00 55.85  ? 123  GLN C N   1 
ATOM   7382  C  CA  . GLN C  1 92  ? 45.102  18.017  26.964  1.00 54.97  ? 123  GLN C CA  1 
ATOM   7383  C  C   . GLN C  1 92  ? 45.402  19.470  26.608  1.00 52.73  ? 123  GLN C C   1 
ATOM   7384  O  O   . GLN C  1 92  ? 45.473  20.322  27.488  1.00 52.94  ? 123  GLN C O   1 
ATOM   7385  C  CB  . GLN C  1 92  ? 43.969  17.970  27.993  1.00 56.46  ? 123  GLN C CB  1 
ATOM   7386  C  CG  . GLN C  1 92  ? 43.932  16.691  28.782  1.00 58.65  ? 123  GLN C CG  1 
ATOM   7387  C  CD  . GLN C  1 92  ? 44.818  16.622  29.981  1.00 60.59  ? 123  GLN C CD  1 
ATOM   7388  O  OE1 . GLN C  1 92  ? 44.839  17.529  30.819  1.00 60.64  ? 123  GLN C OE1 1 
ATOM   7389  N  NE2 . GLN C  1 92  ? 45.598  15.552  30.112  1.00 59.22  ? 123  GLN C NE2 1 
ATOM   7390  N  N   . ILE C  1 93  ? 45.641  19.723  25.329  1.00 50.43  ? 124  ILE C N   1 
ATOM   7391  C  CA  . ILE C  1 93  ? 45.962  21.075  24.876  1.00 47.47  ? 124  ILE C CA  1 
ATOM   7392  C  C   . ILE C  1 93  ? 44.823  21.646  24.037  1.00 45.02  ? 124  ILE C C   1 
ATOM   7393  O  O   . ILE C  1 93  ? 44.128  20.871  23.383  1.00 44.37  ? 124  ILE C O   1 
ATOM   7394  C  CB  . ILE C  1 93  ? 47.249  21.106  24.039  1.00 47.09  ? 124  ILE C CB  1 
ATOM   7395  C  CG1 . ILE C  1 93  ? 48.382  20.352  24.732  1.00 46.33  ? 124  ILE C CG1 1 
ATOM   7396  C  CG2 . ILE C  1 93  ? 47.672  22.533  23.737  1.00 47.38  ? 124  ILE C CG2 1 
ATOM   7397  C  CD1 . ILE C  1 93  ? 48.949  21.063  25.938  1.00 47.79  ? 124  ILE C CD1 1 
ATOM   7398  N  N   . THR C  1 94  ? 44.642  22.957  24.082  1.00 42.97  ? 125  THR C N   1 
ATOM   7399  C  CA  . THR C  1 94  ? 43.577  23.632  23.358  1.00 41.62  ? 125  THR C CA  1 
ATOM   7400  C  C   . THR C  1 94  ? 44.116  24.734  22.452  1.00 40.80  ? 125  THR C C   1 
ATOM   7401  O  O   . THR C  1 94  ? 45.012  25.483  22.834  1.00 40.79  ? 125  THR C O   1 
ATOM   7402  C  CB  . THR C  1 94  ? 42.497  24.197  24.294  1.00 40.47  ? 125  THR C CB  1 
ATOM   7403  O  OG1 . THR C  1 94  ? 43.030  25.156  25.213  1.00 39.08  ? 125  THR C OG1 1 
ATOM   7404  C  CG2 . THR C  1 94  ? 41.843  23.082  25.085  1.00 40.44  ? 125  THR C CG2 1 
ATOM   7405  N  N   . TYR C  1 95  ? 43.583  24.803  21.234  1.00 38.48  ? 126  TYR C N   1 
ATOM   7406  C  CA  . TYR C  1 95  ? 44.027  25.794  20.259  1.00 34.89  ? 126  TYR C CA  1 
ATOM   7407  C  C   . TYR C  1 95  ? 42.842  26.648  19.825  1.00 35.27  ? 126  TYR C C   1 
ATOM   7408  O  O   . TYR C  1 95  ? 41.758  26.096  19.631  1.00 37.08  ? 126  TYR C O   1 
ATOM   7409  C  CB  . TYR C  1 95  ? 44.642  25.100  19.060  1.00 32.19  ? 126  TYR C CB  1 
ATOM   7410  C  CG  . TYR C  1 95  ? 43.707  24.511  18.033  1.00 29.88  ? 126  TYR C CG  1 
ATOM   7411  C  CD1 . TYR C  1 95  ? 43.244  25.263  16.960  1.00 28.42  ? 126  TYR C CD1 1 
ATOM   7412  C  CD2 . TYR C  1 95  ? 43.300  23.186  18.086  1.00 26.95  ? 126  TYR C CD2 1 
ATOM   7413  C  CE1 . TYR C  1 95  ? 42.409  24.732  16.002  1.00 27.00  ? 126  TYR C CE1 1 
ATOM   7414  C  CE2 . TYR C  1 95  ? 42.463  22.635  17.130  1.00 24.93  ? 126  TYR C CE2 1 
ATOM   7415  C  CZ  . TYR C  1 95  ? 42.018  23.411  16.087  1.00 27.15  ? 126  TYR C CZ  1 
ATOM   7416  O  OH  . TYR C  1 95  ? 41.178  22.898  15.112  1.00 25.23  ? 126  TYR C OH  1 
ATOM   7417  N  N   . ARG C  1 96  ? 43.055  27.945  19.685  1.00 33.28  ? 127  ARG C N   1 
ATOM   7418  C  CA  . ARG C  1 96  ? 42.005  28.839  19.212  1.00 31.27  ? 127  ARG C CA  1 
ATOM   7419  C  C   . ARG C  1 96  ? 42.492  29.625  17.993  1.00 30.46  ? 127  ARG C C   1 
ATOM   7420  O  O   . ARG C  1 96  ? 43.625  30.101  17.998  1.00 31.25  ? 127  ARG C O   1 
ATOM   7421  C  CB  . ARG C  1 96  ? 41.584  29.809  20.318  1.00 30.15  ? 127  ARG C CB  1 
ATOM   7422  C  CG  . ARG C  1 96  ? 40.739  30.954  19.774  1.00 29.39  ? 127  ARG C CG  1 
ATOM   7423  C  CD  . ARG C  1 96  ? 40.297  31.895  20.859  1.00 32.55  ? 127  ARG C CD  1 
ATOM   7424  N  NE  . ARG C  1 96  ? 39.635  33.084  20.314  1.00 34.31  ? 127  ARG C NE  1 
ATOM   7425  C  CZ  . ARG C  1 96  ? 39.121  34.037  21.075  1.00 35.00  ? 127  ARG C CZ  1 
ATOM   7426  N  NH1 . ARG C  1 96  ? 39.163  33.959  22.400  1.00 35.52  ? 127  ARG C NH1 1 
ATOM   7427  N  NH2 . ARG C  1 96  ? 38.553  35.091  20.521  1.00 35.69  ? 127  ARG C NH2 1 
ATOM   7428  N  N   . ILE C  1 97  ? 41.675  29.705  16.962  1.00 29.33  ? 128  ILE C N   1 
ATOM   7429  C  CA  . ILE C  1 97  ? 42.016  30.425  15.739  1.00 28.88  ? 128  ILE C CA  1 
ATOM   7430  C  C   . ILE C  1 97  ? 41.460  31.840  15.807  1.00 29.56  ? 128  ILE C C   1 
ATOM   7431  O  O   . ILE C  1 97  ? 40.246  32.051  15.898  1.00 32.03  ? 128  ILE C O   1 
ATOM   7432  C  CB  . ILE C  1 97  ? 41.500  29.683  14.501  1.00 27.41  ? 128  ILE C CB  1 
ATOM   7433  C  CG1 . ILE C  1 97  ? 42.241  28.358  14.326  1.00 27.04  ? 128  ILE C CG1 1 
ATOM   7434  C  CG2 . ILE C  1 97  ? 41.604  30.497  13.224  1.00 26.75  ? 128  ILE C CG2 1 
ATOM   7435  C  CD1 . ILE C  1 97  ? 41.557  27.381  13.400  1.00 28.00  ? 128  ILE C CD1 1 
ATOM   7436  N  N   . ILE C  1 98  ? 42.338  32.853  15.853  1.00 28.09  ? 129  ILE C N   1 
ATOM   7437  C  CA  . ILE C  1 98  ? 41.874  34.215  15.968  1.00 26.70  ? 129  ILE C CA  1 
ATOM   7438  C  C   . ILE C  1 98  ? 41.963  34.994  14.659  1.00 25.67  ? 129  ILE C C   1 
ATOM   7439  O  O   . ILE C  1 98  ? 41.418  36.115  14.560  1.00 24.72  ? 129  ILE C O   1 
ATOM   7440  C  CB  . ILE C  1 98  ? 42.621  35.013  17.056  1.00 27.23  ? 129  ILE C CB  1 
ATOM   7441  C  CG1 . ILE C  1 98  ? 44.005  35.384  16.544  1.00 28.52  ? 129  ILE C CG1 1 
ATOM   7442  C  CG2 . ILE C  1 98  ? 42.680  34.269  18.363  1.00 25.72  ? 129  ILE C CG2 1 
ATOM   7443  C  CD1 . ILE C  1 98  ? 44.966  35.842  17.609  1.00 30.29  ? 129  ILE C CD1 1 
ATOM   7444  N  N   . GLY C  1 99  ? 42.598  34.399  13.663  1.00 25.50  ? 130  GLY C N   1 
ATOM   7445  C  CA  . GLY C  1 99  ? 42.701  35.063  12.367  1.00 27.71  ? 130  GLY C CA  1 
ATOM   7446  C  C   . GLY C  1 99  ? 42.841  34.072  11.230  1.00 30.00  ? 130  GLY C C   1 
ATOM   7447  O  O   . GLY C  1 99  ? 43.193  32.903  11.460  1.00 32.77  ? 130  GLY C O   1 
ATOM   7448  N  N   . TYR C  1 100 ? 42.444  34.448  10.021  1.00 29.00  ? 131  TYR C N   1 
ATOM   7449  C  CA  . TYR C  1 100 ? 42.545  33.573  8.860   1.00 27.49  ? 131  TYR C CA  1 
ATOM   7450  C  C   . TYR C  1 100 ? 43.267  34.270  7.710   1.00 26.94  ? 131  TYR C C   1 
ATOM   7451  O  O   . TYR C  1 100 ? 43.719  35.412  7.809   1.00 26.61  ? 131  TYR C O   1 
ATOM   7452  C  CB  . TYR C  1 100 ? 41.141  33.205  8.342   1.00 26.64  ? 131  TYR C CB  1 
ATOM   7453  C  CG  . TYR C  1 100 ? 40.378  32.305  9.274   1.00 24.55  ? 131  TYR C CG  1 
ATOM   7454  C  CD1 . TYR C  1 100 ? 39.907  32.764  10.493  1.00 24.66  ? 131  TYR C CD1 1 
ATOM   7455  C  CD2 . TYR C  1 100 ? 40.101  30.987  8.930   1.00 25.16  ? 131  TYR C CD2 1 
ATOM   7456  C  CE1 . TYR C  1 100 ? 39.214  31.943  11.355  1.00 26.42  ? 131  TYR C CE1 1 
ATOM   7457  C  CE2 . TYR C  1 100 ? 39.409  30.152  9.787   1.00 26.33  ? 131  TYR C CE2 1 
ATOM   7458  C  CZ  . TYR C  1 100 ? 38.970  30.632  10.995  1.00 26.98  ? 131  TYR C CZ  1 
ATOM   7459  O  OH  . TYR C  1 100 ? 38.270  29.811  11.839  1.00 28.60  ? 131  TYR C OH  1 
ATOM   7460  N  N   . THR C  1 101 ? 43.347  33.578  6.587   1.00 26.80  ? 132  THR C N   1 
ATOM   7461  C  CA  . THR C  1 101 ? 43.959  34.182  5.399   1.00 27.52  ? 132  THR C CA  1 
ATOM   7462  C  C   . THR C  1 101 ? 42.946  34.221  4.284   1.00 27.51  ? 132  THR C C   1 
ATOM   7463  O  O   . THR C  1 101 ? 42.242  33.239  4.004   1.00 28.84  ? 132  THR C O   1 
ATOM   7464  C  CB  . THR C  1 101 ? 45.187  33.357  4.965   1.00 29.05  ? 132  THR C CB  1 
ATOM   7465  O  OG1 . THR C  1 101 ? 45.672  33.822  3.708   1.00 29.28  ? 132  THR C OG1 1 
ATOM   7466  C  CG2 . THR C  1 101 ? 44.868  31.882  4.861   1.00 28.89  ? 132  THR C CG2 1 
ATOM   7467  N  N   . PRO C  1 102 ? 42.904  35.313  3.542   1.00 27.20  ? 133  PRO C N   1 
ATOM   7468  C  CA  . PRO C  1 102 ? 41.954  35.490  2.453   1.00 27.47  ? 133  PRO C CA  1 
ATOM   7469  C  C   . PRO C  1 102 ? 42.224  34.480  1.341   1.00 28.44  ? 133  PRO C C   1 
ATOM   7470  O  O   . PRO C  1 102 ? 41.477  34.423  0.375   1.00 29.77  ? 133  PRO C O   1 
ATOM   7471  C  CB  . PRO C  1 102 ? 42.273  36.899  1.943   1.00 26.29  ? 133  PRO C CB  1 
ATOM   7472  C  CG  . PRO C  1 102 ? 42.800  37.601  3.148   1.00 26.73  ? 133  PRO C CG  1 
ATOM   7473  C  CD  . PRO C  1 102 ? 43.675  36.542  3.805   1.00 26.88  ? 133  PRO C CD  1 
ATOM   7474  N  N   . ASP C  1 103 ? 43.325  33.744  1.457   1.00 30.03  ? 134  ASP C N   1 
ATOM   7475  C  CA  . ASP C  1 103 ? 43.752  32.796  0.463   1.00 31.19  ? 134  ASP C CA  1 
ATOM   7476  C  C   . ASP C  1 103 ? 42.992  31.493  0.458   1.00 32.07  ? 134  ASP C C   1 
ATOM   7477  O  O   . ASP C  1 103 ? 42.814  30.861  -0.582  1.00 32.67  ? 134  ASP C O   1 
ATOM   7478  C  CB  . ASP C  1 103 ? 45.248  32.531  0.609   1.00 33.06  ? 134  ASP C CB  1 
ATOM   7479  C  CG  . ASP C  1 103 ? 46.076  33.715  0.163   1.00 34.07  ? 134  ASP C CG  1 
ATOM   7480  O  OD1 . ASP C  1 103 ? 45.519  34.598  -0.509  1.00 32.80  ? 134  ASP C OD1 1 
ATOM   7481  O  OD2 . ASP C  1 103 ? 47.280  33.732  0.498   1.00 38.25  ? 134  ASP C OD2 1 
ATOM   7482  N  N   . LEU C  1 104 ? 42.508  31.087  1.609   1.00 32.48  ? 135  LEU C N   1 
ATOM   7483  C  CA  . LEU C  1 104 ? 41.756  29.853  1.776   1.00 32.61  ? 135  LEU C CA  1 
ATOM   7484  C  C   . LEU C  1 104 ? 40.453  30.120  2.526   1.00 35.13  ? 135  LEU C C   1 
ATOM   7485  O  O   . LEU C  1 104 ? 40.323  31.158  3.163   1.00 36.99  ? 135  LEU C O   1 
ATOM   7486  C  CB  . LEU C  1 104 ? 42.580  28.908  2.624   1.00 31.54  ? 135  LEU C CB  1 
ATOM   7487  C  CG  . LEU C  1 104 ? 43.998  28.603  2.166   1.00 28.34  ? 135  LEU C CG  1 
ATOM   7488  C  CD1 . LEU C  1 104 ? 44.642  27.822  3.304   1.00 25.60  ? 135  LEU C CD1 1 
ATOM   7489  C  CD2 . LEU C  1 104 ? 44.020  27.880  0.850   1.00 27.42  ? 135  LEU C CD2 1 
ATOM   7490  N  N   . ASP C  1 105 ? 39.463  29.250  2.339   1.00 36.11  ? 136  ASP C N   1 
ATOM   7491  C  CA  . ASP C  1 105 ? 38.127  29.458  2.926   1.00 34.45  ? 136  ASP C CA  1 
ATOM   7492  C  C   . ASP C  1 105 ? 38.200  29.037  4.386   1.00 32.26  ? 136  ASP C C   1 
ATOM   7493  O  O   . ASP C  1 105 ? 38.999  28.159  4.706   1.00 29.27  ? 136  ASP C O   1 
ATOM   7494  C  CB  . ASP C  1 105 ? 37.066  28.637  2.204   1.00 36.92  ? 136  ASP C CB  1 
ATOM   7495  C  CG  . ASP C  1 105 ? 37.447  27.162  2.183   1.00 40.57  ? 136  ASP C CG  1 
ATOM   7496  O  OD1 . ASP C  1 105 ? 38.296  26.851  1.312   1.00 41.14  ? 136  ASP C OD1 1 
ATOM   7497  O  OD2 . ASP C  1 105 ? 36.917  26.385  3.006   1.00 41.95  ? 136  ASP C OD2 1 
ATOM   7498  N  N   . PRO C  1 106 ? 37.393  29.634  5.230   1.00 31.73  ? 137  PRO C N   1 
ATOM   7499  C  CA  . PRO C  1 106 ? 37.437  29.360  6.655   1.00 32.20  ? 137  PRO C CA  1 
ATOM   7500  C  C   . PRO C  1 106 ? 37.627  27.902  6.951   1.00 33.52  ? 137  PRO C C   1 
ATOM   7501  O  O   . PRO C  1 106 ? 38.535  27.520  7.692   1.00 34.96  ? 137  PRO C O   1 
ATOM   7502  C  CB  . PRO C  1 106 ? 36.156  29.964  7.181   1.00 31.50  ? 137  PRO C CB  1 
ATOM   7503  C  CG  . PRO C  1 106 ? 35.932  31.134  6.274   1.00 31.21  ? 137  PRO C CG  1 
ATOM   7504  C  CD  . PRO C  1 106 ? 36.400  30.692  4.914   1.00 31.95  ? 137  PRO C CD  1 
ATOM   7505  N  N   . GLU C  1 107 ? 36.782  27.067  6.350   1.00 32.95  ? 138  GLU C N   1 
ATOM   7506  C  CA  . GLU C  1 107 ? 36.863  25.630  6.546   1.00 31.74  ? 138  GLU C CA  1 
ATOM   7507  C  C   . GLU C  1 107 ? 38.220  25.057  6.177   1.00 30.70  ? 138  GLU C C   1 
ATOM   7508  O  O   . GLU C  1 107 ? 38.923  24.516  7.035   1.00 29.57  ? 138  GLU C O   1 
ATOM   7509  C  CB  . GLU C  1 107 ? 35.769  24.912  5.761   1.00 33.78  ? 138  GLU C CB  1 
ATOM   7510  C  CG  . GLU C  1 107 ? 34.380  25.118  6.338   1.00 39.25  ? 138  GLU C CG  1 
ATOM   7511  C  CD  . GLU C  1 107 ? 33.305  24.383  5.561   1.00 43.12  ? 138  GLU C CD  1 
ATOM   7512  O  OE1 . GLU C  1 107 ? 33.482  23.166  5.332   1.00 44.64  ? 138  GLU C OE1 1 
ATOM   7513  O  OE2 . GLU C  1 107 ? 32.291  25.011  5.174   1.00 43.78  ? 138  GLU C OE2 1 
ATOM   7514  N  N   . THR C  1 108 ? 38.637  25.192  4.922   1.00 28.09  ? 139  THR C N   1 
ATOM   7515  C  CA  . THR C  1 108 ? 39.941  24.703  4.496   1.00 24.93  ? 139  THR C CA  1 
ATOM   7516  C  C   . THR C  1 108 ? 41.074  25.081  5.441   1.00 25.43  ? 139  THR C C   1 
ATOM   7517  O  O   . THR C  1 108 ? 41.961  24.267  5.718   1.00 25.03  ? 139  THR C O   1 
ATOM   7518  C  CB  . THR C  1 108 ? 40.311  25.242  3.104   1.00 22.64  ? 139  THR C CB  1 
ATOM   7519  O  OG1 . THR C  1 108 ? 39.398  24.657  2.144   1.00 20.89  ? 139  THR C OG1 1 
ATOM   7520  C  CG2 . THR C  1 108 ? 41.729  24.889  2.730   1.00 21.87  ? 139  THR C CG2 1 
ATOM   7521  N  N   . VAL C  1 109 ? 41.048  26.286  5.975   1.00 25.97  ? 140  VAL C N   1 
ATOM   7522  C  CA  . VAL C  1 109 ? 42.004  26.692  6.978   1.00 28.51  ? 140  VAL C CA  1 
ATOM   7523  C  C   . VAL C  1 109 ? 41.791  25.951  8.290   1.00 29.89  ? 140  VAL C C   1 
ATOM   7524  O  O   . VAL C  1 109 ? 42.708  25.317  8.805   1.00 30.44  ? 140  VAL C O   1 
ATOM   7525  C  CB  . VAL C  1 109 ? 41.960  28.203  7.254   1.00 29.34  ? 140  VAL C CB  1 
ATOM   7526  C  CG1 . VAL C  1 109 ? 42.830  28.551  8.455   1.00 28.80  ? 140  VAL C CG1 1 
ATOM   7527  C  CG2 . VAL C  1 109 ? 42.499  28.918  6.011   1.00 30.95  ? 140  VAL C CG2 1 
ATOM   7528  N  N   . ASP C  1 110 ? 40.573  26.014  8.819   1.00 31.24  ? 141  ASP C N   1 
ATOM   7529  C  CA  . ASP C  1 110 ? 40.243  25.317  10.058  1.00 32.93  ? 141  ASP C CA  1 
ATOM   7530  C  C   . ASP C  1 110 ? 40.745  23.871  10.010  1.00 34.16  ? 141  ASP C C   1 
ATOM   7531  O  O   . ASP C  1 110 ? 41.281  23.320  10.976  1.00 33.06  ? 141  ASP C O   1 
ATOM   7532  C  CB  . ASP C  1 110 ? 38.727  25.343  10.251  1.00 34.32  ? 141  ASP C CB  1 
ATOM   7533  C  CG  . ASP C  1 110 ? 38.186  26.649  10.773  1.00 35.26  ? 141  ASP C CG  1 
ATOM   7534  O  OD1 . ASP C  1 110 ? 38.906  27.342  11.520  1.00 36.43  ? 141  ASP C OD1 1 
ATOM   7535  O  OD2 . ASP C  1 110 ? 37.033  27.015  10.461  1.00 36.00  ? 141  ASP C OD2 1 
ATOM   7536  N  N   . ASP C  1 111 ? 40.564  23.220  8.865   1.00 34.55  ? 142  ASP C N   1 
ATOM   7537  C  CA  . ASP C  1 111 ? 40.985  21.848  8.657   1.00 34.78  ? 142  ASP C CA  1 
ATOM   7538  C  C   . ASP C  1 111 ? 42.503  21.718  8.699   1.00 34.79  ? 142  ASP C C   1 
ATOM   7539  O  O   . ASP C  1 111 ? 43.031  20.983  9.521   1.00 34.31  ? 142  ASP C O   1 
ATOM   7540  C  CB  . ASP C  1 111 ? 40.481  21.329  7.307   1.00 35.31  ? 142  ASP C CB  1 
ATOM   7541  C  CG  . ASP C  1 111 ? 40.658  19.828  7.185   1.00 36.86  ? 142  ASP C CG  1 
ATOM   7542  O  OD1 . ASP C  1 111 ? 40.099  19.105  8.036   1.00 37.24  ? 142  ASP C OD1 1 
ATOM   7543  O  OD2 . ASP C  1 111 ? 41.347  19.390  6.242   1.00 37.71  ? 142  ASP C OD2 1 
ATOM   7544  N  N   . ALA C  1 112 ? 43.160  22.441  7.803   1.00 34.49  ? 143  ALA C N   1 
ATOM   7545  C  CA  . ALA C  1 112 ? 44.611  22.456  7.710   1.00 33.67  ? 143  ALA C CA  1 
ATOM   7546  C  C   . ALA C  1 112 ? 45.261  22.495  9.082   1.00 32.30  ? 143  ALA C C   1 
ATOM   7547  O  O   . ALA C  1 112 ? 46.152  21.699  9.378   1.00 31.83  ? 143  ALA C O   1 
ATOM   7548  C  CB  . ALA C  1 112 ? 45.061  23.618  6.843   1.00 33.21  ? 143  ALA C CB  1 
ATOM   7549  N  N   . PHE C  1 113 ? 44.821  23.380  9.972   1.00 30.57  ? 144  PHE C N   1 
ATOM   7550  C  CA  . PHE C  1 113 ? 45.367  23.404  11.322  1.00 29.90  ? 144  PHE C CA  1 
ATOM   7551  C  C   . PHE C  1 113 ? 45.056  22.115  12.079  1.00 29.38  ? 144  PHE C C   1 
ATOM   7552  O  O   . PHE C  1 113 ? 45.933  21.522  12.711  1.00 29.54  ? 144  PHE C O   1 
ATOM   7553  C  CB  . PHE C  1 113 ? 44.892  24.609  12.096  1.00 30.66  ? 144  PHE C CB  1 
ATOM   7554  C  CG  . PHE C  1 113 ? 45.271  25.947  11.566  1.00 32.77  ? 144  PHE C CG  1 
ATOM   7555  C  CD1 . PHE C  1 113 ? 46.504  26.159  10.976  1.00 34.19  ? 144  PHE C CD1 1 
ATOM   7556  C  CD2 . PHE C  1 113 ? 44.414  27.031  11.659  1.00 33.61  ? 144  PHE C CD2 1 
ATOM   7557  C  CE1 . PHE C  1 113 ? 46.871  27.393  10.480  1.00 33.34  ? 144  PHE C CE1 1 
ATOM   7558  C  CE2 . PHE C  1 113 ? 44.770  28.270  11.172  1.00 33.48  ? 144  PHE C CE2 1 
ATOM   7559  C  CZ  . PHE C  1 113 ? 46.001  28.458  10.579  1.00 31.53  ? 144  PHE C CZ  1 
ATOM   7560  N  N   . ALA C  1 114 ? 43.808  21.681  11.982  1.00 29.79  ? 145  ALA C N   1 
ATOM   7561  C  CA  . ALA C  1 114 ? 43.343  20.454  12.603  1.00 30.73  ? 145  ALA C CA  1 
ATOM   7562  C  C   . ALA C  1 114 ? 44.182  19.257  12.161  1.00 31.93  ? 145  ALA C C   1 
ATOM   7563  O  O   . ALA C  1 114 ? 44.660  18.487  12.988  1.00 32.49  ? 145  ALA C O   1 
ATOM   7564  C  CB  . ALA C  1 114 ? 41.893  20.198  12.224  1.00 29.80  ? 145  ALA C CB  1 
ATOM   7565  N  N   . ARG C  1 115 ? 44.315  19.083  10.852  1.00 32.11  ? 146  ARG C N   1 
ATOM   7566  C  CA  . ARG C  1 115 ? 45.113  17.991  10.306  1.00 32.06  ? 146  ARG C CA  1 
ATOM   7567  C  C   . ARG C  1 115 ? 46.552  18.109  10.808  1.00 33.98  ? 146  ARG C C   1 
ATOM   7568  O  O   . ARG C  1 115 ? 47.201  17.102  11.088  1.00 35.14  ? 146  ARG C O   1 
ATOM   7569  C  CB  . ARG C  1 115 ? 45.102  18.046  8.778   1.00 31.07  ? 146  ARG C CB  1 
ATOM   7570  C  CG  . ARG C  1 115 ? 43.942  17.324  8.128   1.00 32.53  ? 146  ARG C CG  1 
ATOM   7571  C  CD  . ARG C  1 115 ? 43.683  17.813  6.721   1.00 34.83  ? 146  ARG C CD  1 
ATOM   7572  N  NE  . ARG C  1 115 ? 44.886  18.088  5.959   1.00 38.78  ? 146  ARG C NE  1 
ATOM   7573  C  CZ  . ARG C  1 115 ? 45.037  19.075  5.084   1.00 40.58  ? 146  ARG C CZ  1 
ATOM   7574  N  NH1 . ARG C  1 115 ? 44.030  19.908  4.856   1.00 42.14  ? 146  ARG C NH1 1 
ATOM   7575  N  NH2 . ARG C  1 115 ? 46.182  19.243  4.437   1.00 38.13  ? 146  ARG C NH2 1 
ATOM   7576  N  N   . ALA C  1 116 ? 47.053  19.337  10.891  1.00 33.73  ? 147  ALA C N   1 
ATOM   7577  C  CA  . ALA C  1 116 ? 48.410  19.588  11.358  1.00 32.97  ? 147  ALA C CA  1 
ATOM   7578  C  C   . ALA C  1 116 ? 48.554  19.219  12.827  1.00 33.72  ? 147  ALA C C   1 
ATOM   7579  O  O   . ALA C  1 116 ? 49.595  18.711  13.246  1.00 35.10  ? 147  ALA C O   1 
ATOM   7580  C  CB  . ALA C  1 116 ? 48.778  21.045  11.167  1.00 33.84  ? 147  ALA C CB  1 
ATOM   7581  N  N   . PHE C  1 117 ? 47.517  19.446  13.630  1.00 33.06  ? 148  PHE C N   1 
ATOM   7582  C  CA  . PHE C  1 117 ? 47.608  19.023  15.035  1.00 33.78  ? 148  PHE C CA  1 
ATOM   7583  C  C   . PHE C  1 117 ? 47.606  17.527  15.164  1.00 36.03  ? 148  PHE C C   1 
ATOM   7584  O  O   . PHE C  1 117 ? 48.359  16.962  15.955  1.00 39.73  ? 148  PHE C O   1 
ATOM   7585  C  CB  . PHE C  1 117 ? 46.459  19.623  15.834  1.00 31.83  ? 148  PHE C CB  1 
ATOM   7586  C  CG  . PHE C  1 117 ? 46.675  21.046  16.257  1.00 30.95  ? 148  PHE C CG  1 
ATOM   7587  C  CD1 . PHE C  1 117 ? 47.563  21.350  17.272  1.00 29.36  ? 148  PHE C CD1 1 
ATOM   7588  C  CD2 . PHE C  1 117 ? 45.984  22.076  15.641  1.00 30.27  ? 148  PHE C CD2 1 
ATOM   7589  C  CE1 . PHE C  1 117 ? 47.761  22.659  17.668  1.00 28.61  ? 148  PHE C CE1 1 
ATOM   7590  C  CE2 . PHE C  1 117 ? 46.178  23.387  16.031  1.00 28.56  ? 148  PHE C CE2 1 
ATOM   7591  C  CZ  . PHE C  1 117 ? 47.067  23.679  17.046  1.00 27.56  ? 148  PHE C CZ  1 
ATOM   7592  N  N   . GLN C  1 118 ? 46.751  16.928  14.387  1.00 36.48  ? 149  GLN C N   1 
ATOM   7593  C  CA  . GLN C  1 118 ? 46.609  15.502  14.359  1.00 37.40  ? 149  GLN C CA  1 
ATOM   7594  C  C   . GLN C  1 118 ? 47.934  14.804  14.118  1.00 38.33  ? 149  GLN C C   1 
ATOM   7595  O  O   . GLN C  1 118 ? 48.053  13.596  14.313  1.00 42.05  ? 149  GLN C O   1 
ATOM   7596  C  CB  . GLN C  1 118 ? 45.664  15.125  13.218  1.00 39.01  ? 149  GLN C CB  1 
ATOM   7597  C  CG  . GLN C  1 118 ? 45.413  13.645  13.101  1.00 41.66  ? 149  GLN C CG  1 
ATOM   7598  C  CD  . GLN C  1 118 ? 44.745  13.118  14.339  1.00 44.28  ? 149  GLN C CD  1 
ATOM   7599  O  OE1 . GLN C  1 118 ? 43.823  13.744  14.860  1.00 43.60  ? 149  GLN C OE1 1 
ATOM   7600  N  NE2 . GLN C  1 118 ? 45.047  12.001  14.979  1.00 45.76  ? 149  GLN C NE2 1 
ATOM   7601  N  N   . VAL C  1 119 ? 48.936  15.568  13.728  1.00 38.88  ? 150  VAL C N   1 
ATOM   7602  C  CA  . VAL C  1 119 ? 50.151  14.957  13.237  1.00 37.66  ? 150  VAL C CA  1 
ATOM   7603  C  C   . VAL C  1 119 ? 51.057  14.632  14.364  1.00 38.52  ? 150  VAL C C   1 
ATOM   7604  O  O   . VAL C  1 119 ? 51.984  13.835  14.208  1.00 40.16  ? 150  VAL C O   1 
ATOM   7605  C  CB  . VAL C  1 119 ? 50.882  15.856  12.226  1.00 36.62  ? 150  VAL C CB  1 
ATOM   7606  C  CG1 . VAL C  1 119 ? 52.232  15.258  11.860  1.00 36.19  ? 150  VAL C CG1 1 
ATOM   7607  C  CG2 . VAL C  1 119 ? 50.030  16.064  10.983  1.00 35.42  ? 150  VAL C CG2 1 
ATOM   7608  N  N   . TRP C  1 120 ? 50.743  15.266  15.453  1.00 38.45  ? 151  TRP C N   1 
ATOM   7609  C  CA  . TRP C  1 120 ? 51.492  15.108  16.650  1.00 39.33  ? 151  TRP C CA  1 
ATOM   7610  C  C   . TRP C  1 120 ? 50.759  14.170  17.590  1.00 40.49  ? 151  TRP C C   1 
ATOM   7611  O  O   . TRP C  1 120 ? 51.378  13.396  18.312  1.00 40.06  ? 151  TRP C O   1 
ATOM   7612  C  CB  . TRP C  1 120 ? 51.763  16.491  17.219  1.00 39.40  ? 151  TRP C CB  1 
ATOM   7613  C  CG  . TRP C  1 120 ? 52.658  17.298  16.330  1.00 37.81  ? 151  TRP C CG  1 
ATOM   7614  C  CD1 . TRP C  1 120 ? 52.349  18.447  15.651  1.00 38.33  ? 151  TRP C CD1 1 
ATOM   7615  C  CD2 . TRP C  1 120 ? 54.019  17.004  16.021  1.00 38.71  ? 151  TRP C CD2 1 
ATOM   7616  N  NE1 . TRP C  1 120 ? 53.449  18.887  14.946  1.00 39.50  ? 151  TRP C NE1 1 
ATOM   7617  C  CE2 . TRP C  1 120 ? 54.488  18.018  15.162  1.00 39.82  ? 151  TRP C CE2 1 
ATOM   7618  C  CE3 . TRP C  1 120 ? 54.888  15.980  16.399  1.00 38.28  ? 151  TRP C CE3 1 
ATOM   7619  C  CZ2 . TRP C  1 120 ? 55.797  18.036  14.683  1.00 39.37  ? 151  TRP C CZ2 1 
ATOM   7620  C  CZ3 . TRP C  1 120 ? 56.183  16.000  15.922  1.00 39.30  ? 151  TRP C CZ3 1 
ATOM   7621  C  CH2 . TRP C  1 120 ? 56.626  17.021  15.074  1.00 37.95  ? 151  TRP C CH2 1 
ATOM   7622  N  N   . SER C  1 121 ? 49.431  14.225  17.580  1.00 42.32  ? 152  SER C N   1 
ATOM   7623  C  CA  . SER C  1 121 ? 48.643  13.353  18.442  1.00 44.20  ? 152  SER C CA  1 
ATOM   7624  C  C   . SER C  1 121 ? 48.750  11.898  17.987  1.00 45.22  ? 152  SER C C   1 
ATOM   7625  O  O   . SER C  1 121 ? 48.771  10.982  18.809  1.00 44.65  ? 152  SER C O   1 
ATOM   7626  C  CB  . SER C  1 121 ? 47.180  13.803  18.480  1.00 44.59  ? 152  SER C CB  1 
ATOM   7627  O  OG  . SER C  1 121 ? 46.738  14.223  17.203  1.00 45.31  ? 152  SER C OG  1 
ATOM   7628  N  N   . ASP C  1 122 ? 48.822  11.702  16.674  1.00 46.52  ? 153  ASP C N   1 
ATOM   7629  C  CA  . ASP C  1 122 ? 48.916  10.367  16.086  1.00 48.08  ? 153  ASP C CA  1 
ATOM   7630  C  C   . ASP C  1 122 ? 50.048  9.542   16.694  1.00 49.64  ? 153  ASP C C   1 
ATOM   7631  O  O   . ASP C  1 122 ? 50.019  8.311   16.660  1.00 51.02  ? 153  ASP C O   1 
ATOM   7632  C  CB  . ASP C  1 122 ? 49.134  10.460  14.572  1.00 47.79  ? 153  ASP C CB  1 
ATOM   7633  C  CG  . ASP C  1 122 ? 47.843  10.627  13.796  1.00 49.35  ? 153  ASP C CG  1 
ATOM   7634  O  OD1 . ASP C  1 122 ? 46.762  10.456  14.396  1.00 46.89  ? 153  ASP C OD1 1 
ATOM   7635  O  OD2 . ASP C  1 122 ? 47.914  10.928  12.585  1.00 49.81  ? 153  ASP C OD2 1 
ATOM   7636  N  N   . VAL C  1 123 ? 51.050  10.211  17.253  1.00 50.44  ? 154  VAL C N   1 
ATOM   7637  C  CA  . VAL C  1 123 ? 52.199  9.503   17.807  1.00 50.33  ? 154  VAL C CA  1 
ATOM   7638  C  C   . VAL C  1 123 ? 52.364  9.717   19.306  1.00 50.31  ? 154  VAL C C   1 
ATOM   7639  O  O   . VAL C  1 123 ? 53.237  9.118   19.936  1.00 51.60  ? 154  VAL C O   1 
ATOM   7640  C  CB  . VAL C  1 123 ? 53.506  9.926   17.113  1.00 52.05  ? 154  VAL C CB  1 
ATOM   7641  C  CG1 . VAL C  1 123 ? 53.363  9.827   15.603  1.00 50.97  ? 154  VAL C CG1 1 
ATOM   7642  C  CG2 . VAL C  1 123 ? 53.893  11.339  17.527  1.00 53.63  ? 154  VAL C CG2 1 
ATOM   7643  N  N   . THR C  1 124 ? 51.535  10.565  19.899  1.00 50.26  ? 155  THR C N   1 
ATOM   7644  C  CA  . THR C  1 124 ? 51.671  10.834  21.323  1.00 50.46  ? 155  THR C CA  1 
ATOM   7645  C  C   . THR C  1 124 ? 50.338  10.918  22.043  1.00 52.12  ? 155  THR C C   1 
ATOM   7646  O  O   . THR C  1 124 ? 49.286  11.015  21.413  1.00 52.44  ? 155  THR C O   1 
ATOM   7647  C  CB  . THR C  1 124 ? 52.407  12.149  21.583  1.00 50.17  ? 155  THR C CB  1 
ATOM   7648  O  OG1 . THR C  1 124 ? 51.552  13.250  21.248  1.00 49.81  ? 155  THR C OG1 1 
ATOM   7649  C  CG2 . THR C  1 124 ? 53.681  12.219  20.758  1.00 50.22  ? 155  THR C CG2 1 
ATOM   7650  N  N   . PRO C  1 125 ? 50.416  10.853  23.371  1.00 53.16  ? 156  PRO C N   1 
ATOM   7651  C  CA  . PRO C  1 125 ? 49.261  10.958  24.265  1.00 53.57  ? 156  PRO C CA  1 
ATOM   7652  C  C   . PRO C  1 125 ? 48.605  12.334  24.316  1.00 53.67  ? 156  PRO C C   1 
ATOM   7653  O  O   . PRO C  1 125 ? 47.772  12.584  25.191  1.00 53.12  ? 156  PRO C O   1 
ATOM   7654  C  CB  . PRO C  1 125 ? 49.856  10.751  25.661  1.00 54.31  ? 156  PRO C CB  1 
ATOM   7655  C  CG  . PRO C  1 125 ? 51.154  10.078  25.411  1.00 54.77  ? 156  PRO C CG  1 
ATOM   7656  C  CD  . PRO C  1 125 ? 51.656  10.649  24.122  1.00 53.58  ? 156  PRO C CD  1 
ATOM   7657  N  N   . LEU C  1 126 ? 48.956  13.219  23.406  1.00 54.58  ? 157  LEU C N   1 
ATOM   7658  C  CA  . LEU C  1 126 ? 48.460  14.572  23.301  1.00 54.11  ? 157  LEU C CA  1 
ATOM   7659  C  C   . LEU C  1 126 ? 47.151  14.705  22.528  1.00 53.97  ? 157  LEU C C   1 
ATOM   7660  O  O   . LEU C  1 126 ? 46.992  14.159  21.436  1.00 53.81  ? 157  LEU C O   1 
ATOM   7661  C  CB  . LEU C  1 126 ? 49.519  15.447  22.598  1.00 52.29  ? 157  LEU C CB  1 
ATOM   7662  C  CG  . LEU C  1 126 ? 50.716  15.829  23.471  1.00 50.82  ? 157  LEU C CG  1 
ATOM   7663  C  CD1 . LEU C  1 126 ? 51.840  16.342  22.591  1.00 49.16  ? 157  LEU C CD1 1 
ATOM   7664  C  CD2 . LEU C  1 126 ? 50.303  16.860  24.507  1.00 50.24  ? 157  LEU C CD2 1 
ATOM   7665  N  N   . ARG C  1 127 ? 46.233  15.479  23.107  1.00 53.32  ? 158  ARG C N   1 
ATOM   7666  C  CA  . ARG C  1 127 ? 44.941  15.747  22.488  1.00 53.10  ? 158  ARG C CA  1 
ATOM   7667  C  C   . ARG C  1 127 ? 44.690  17.258  22.415  1.00 50.65  ? 158  ARG C C   1 
ATOM   7668  O  O   . ARG C  1 127 ? 44.899  17.980  23.392  1.00 51.13  ? 158  ARG C O   1 
ATOM   7669  C  CB  . ARG C  1 127 ? 43.790  15.052  23.189  1.00 55.93  ? 158  ARG C CB  1 
ATOM   7670  C  CG  . ARG C  1 127 ? 44.087  13.747  23.893  1.00 59.22  ? 158  ARG C CG  1 
ATOM   7671  C  CD  . ARG C  1 127 ? 42.886  13.198  24.648  1.00 61.91  ? 158  ARG C CD  1 
ATOM   7672  N  NE  . ARG C  1 127 ? 42.157  14.231  25.369  1.00 65.83  ? 158  ARG C NE  1 
ATOM   7673  C  CZ  . ARG C  1 127 ? 42.568  14.814  26.490  1.00 66.67  ? 158  ARG C CZ  1 
ATOM   7674  N  NH1 . ARG C  1 127 ? 43.718  14.461  27.044  1.00 67.78  ? 158  ARG C NH1 1 
ATOM   7675  N  NH2 . ARG C  1 127 ? 41.781  15.748  27.010  1.00 64.51  ? 158  ARG C NH2 1 
ATOM   7676  N  N   . PHE C  1 128 ? 44.276  17.722  21.243  1.00 47.43  ? 159  PHE C N   1 
ATOM   7677  C  CA  . PHE C  1 128 ? 44.039  19.142  21.014  1.00 45.19  ? 159  PHE C CA  1 
ATOM   7678  C  C   . PHE C  1 128 ? 42.557  19.420  20.807  1.00 43.15  ? 159  PHE C C   1 
ATOM   7679  O  O   . PHE C  1 128 ? 41.856  18.702  20.094  1.00 43.30  ? 159  PHE C O   1 
ATOM   7680  C  CB  . PHE C  1 128 ? 44.844  19.623  19.807  1.00 45.61  ? 159  PHE C CB  1 
ATOM   7681  C  CG  . PHE C  1 128 ? 46.320  19.361  19.846  1.00 45.57  ? 159  PHE C CG  1 
ATOM   7682  C  CD1 . PHE C  1 128 ? 47.143  19.995  20.763  1.00 44.74  ? 159  PHE C CD1 1 
ATOM   7683  C  CD2 . PHE C  1 128 ? 46.914  18.488  18.949  1.00 45.65  ? 159  PHE C CD2 1 
ATOM   7684  C  CE1 . PHE C  1 128 ? 48.503  19.770  20.805  1.00 43.12  ? 159  PHE C CE1 1 
ATOM   7685  C  CE2 . PHE C  1 128 ? 48.274  18.251  18.977  1.00 45.88  ? 159  PHE C CE2 1 
ATOM   7686  C  CZ  . PHE C  1 128 ? 49.071  18.892  19.907  1.00 44.86  ? 159  PHE C CZ  1 
ATOM   7687  N  N   . SER C  1 129 ? 42.031  20.456  21.443  1.00 41.38  ? 160  SER C N   1 
ATOM   7688  C  CA  . SER C  1 129 ? 40.625  20.802  21.295  1.00 39.12  ? 160  SER C CA  1 
ATOM   7689  C  C   . SER C  1 129 ? 40.469  22.296  21.011  1.00 38.44  ? 160  SER C C   1 
ATOM   7690  O  O   . SER C  1 129 ? 40.872  23.141  21.803  1.00 38.98  ? 160  SER C O   1 
ATOM   7691  C  CB  . SER C  1 129 ? 39.840  20.442  22.555  1.00 38.94  ? 160  SER C CB  1 
ATOM   7692  O  OG  . SER C  1 129 ? 40.604  19.610  23.404  1.00 39.39  ? 160  SER C OG  1 
ATOM   7693  N  N   . ARG C  1 130 ? 39.888  22.573  19.849  1.00 35.52  ? 161  ARG C N   1 
ATOM   7694  C  CA  . ARG C  1 130 ? 39.665  23.966  19.457  1.00 30.65  ? 161  ARG C CA  1 
ATOM   7695  C  C   . ARG C  1 130 ? 38.651  24.604  20.402  1.00 28.41  ? 161  ARG C C   1 
ATOM   7696  O  O   . ARG C  1 130 ? 37.743  23.946  20.859  1.00 26.97  ? 161  ARG C O   1 
ATOM   7697  C  CB  . ARG C  1 130 ? 39.275  24.046  17.998  1.00 27.43  ? 161  ARG C CB  1 
ATOM   7698  C  CG  . ARG C  1 130 ? 38.207  25.013  17.583  1.00 26.04  ? 161  ARG C CG  1 
ATOM   7699  C  CD  . ARG C  1 130 ? 38.727  26.334  17.084  1.00 26.86  ? 161  ARG C CD  1 
ATOM   7700  N  NE  . ARG C  1 130 ? 37.977  26.859  15.947  1.00 25.48  ? 161  ARG C NE  1 
ATOM   7701  C  CZ  . ARG C  1 130 ? 37.712  26.222  14.815  1.00 21.75  ? 161  ARG C CZ  1 
ATOM   7702  N  NH1 . ARG C  1 130 ? 38.094  24.982  14.593  1.00 20.62  ? 161  ARG C NH1 1 
ATOM   7703  N  NH2 . ARG C  1 130 ? 37.037  26.797  13.849  1.00 18.87  ? 161  ARG C NH2 1 
ATOM   7704  N  N   . ILE C  1 131 ? 38.860  25.887  20.652  1.00 27.67  ? 162  ILE C N   1 
ATOM   7705  C  CA  . ILE C  1 131 ? 37.886  26.625  21.472  1.00 28.13  ? 162  ILE C CA  1 
ATOM   7706  C  C   . ILE C  1 131 ? 37.555  27.919  20.744  1.00 30.98  ? 162  ILE C C   1 
ATOM   7707  O  O   . ILE C  1 131 ? 38.301  28.336  19.847  1.00 31.13  ? 162  ILE C O   1 
ATOM   7708  C  CB  . ILE C  1 131 ? 38.420  26.891  22.874  1.00 25.32  ? 162  ILE C CB  1 
ATOM   7709  C  CG1 . ILE C  1 131 ? 39.636  27.792  22.822  1.00 25.21  ? 162  ILE C CG1 1 
ATOM   7710  C  CG2 . ILE C  1 131 ? 38.671  25.602  23.628  1.00 20.66  ? 162  ILE C CG2 1 
ATOM   7711  C  CD1 . ILE C  1 131 ? 39.988  28.475  24.111  1.00 22.76  ? 162  ILE C CD1 1 
ATOM   7712  N  N   . HIS C  1 132 ? 36.395  28.513  21.008  1.00 33.02  ? 163  HIS C N   1 
ATOM   7713  C  CA  . HIS C  1 132 ? 36.003  29.687  20.239  1.00 34.52  ? 163  HIS C CA  1 
ATOM   7714  C  C   . HIS C  1 132 ? 35.961  30.984  21.011  1.00 36.15  ? 163  HIS C C   1 
ATOM   7715  O  O   . HIS C  1 132 ? 35.641  32.043  20.465  1.00 35.12  ? 163  HIS C O   1 
ATOM   7716  C  CB  . HIS C  1 132 ? 34.642  29.452  19.586  1.00 34.94  ? 163  HIS C CB  1 
ATOM   7717  C  CG  . HIS C  1 132 ? 34.697  28.436  18.490  1.00 36.45  ? 163  HIS C CG  1 
ATOM   7718  N  ND1 . HIS C  1 132 ? 35.013  27.118  18.740  1.00 37.00  ? 163  HIS C ND1 1 
ATOM   7719  C  CD2 . HIS C  1 132 ? 34.483  28.533  17.161  1.00 37.08  ? 163  HIS C CD2 1 
ATOM   7720  C  CE1 . HIS C  1 132 ? 34.986  26.445  17.604  1.00 37.86  ? 163  HIS C CE1 1 
ATOM   7721  N  NE2 . HIS C  1 132 ? 34.670  27.278  16.634  1.00 38.73  ? 163  HIS C NE2 1 
ATOM   7722  N  N   . ASP C  1 133 ? 36.290  30.905  22.291  1.00 39.03  ? 164  ASP C N   1 
ATOM   7723  C  CA  . ASP C  1 133 ? 36.300  32.107  23.108  1.00 42.11  ? 164  ASP C CA  1 
ATOM   7724  C  C   . ASP C  1 133 ? 37.170  31.882  24.336  1.00 42.46  ? 164  ASP C C   1 
ATOM   7725  O  O   . ASP C  1 133 ? 36.963  30.915  25.060  1.00 42.10  ? 164  ASP C O   1 
ATOM   7726  C  CB  . ASP C  1 133 ? 34.880  32.477  23.531  1.00 45.77  ? 164  ASP C CB  1 
ATOM   7727  C  CG  . ASP C  1 133 ? 34.630  33.974  23.516  1.00 50.60  ? 164  ASP C CG  1 
ATOM   7728  O  OD1 . ASP C  1 133 ? 35.605  34.750  23.657  1.00 50.88  ? 164  ASP C OD1 1 
ATOM   7729  O  OD2 . ASP C  1 133 ? 33.443  34.351  23.361  1.00 53.02  ? 164  ASP C OD2 1 
ATOM   7730  N  N   . GLY C  1 134 ? 38.106  32.793  24.562  1.00 43.74  ? 165  GLY C N   1 
ATOM   7731  C  CA  . GLY C  1 134 ? 38.924  32.693  25.765  1.00 45.77  ? 165  GLY C CA  1 
ATOM   7732  C  C   . GLY C  1 134 ? 40.396  32.574  25.404  1.00 47.04  ? 165  GLY C C   1 
ATOM   7733  O  O   . GLY C  1 134 ? 40.785  32.609  24.242  1.00 46.62  ? 165  GLY C O   1 
ATOM   7734  N  N   . GLU C  1 135 ? 41.213  32.451  26.445  1.00 48.59  ? 166  GLU C N   1 
ATOM   7735  C  CA  . GLU C  1 135 ? 42.646  32.325  26.235  1.00 50.47  ? 166  GLU C CA  1 
ATOM   7736  C  C   . GLU C  1 135 ? 43.018  30.857  26.079  1.00 50.48  ? 166  GLU C C   1 
ATOM   7737  O  O   . GLU C  1 135 ? 43.040  30.140  27.076  1.00 51.22  ? 166  GLU C O   1 
ATOM   7738  C  CB  . GLU C  1 135 ? 43.408  32.945  27.405  1.00 51.86  ? 166  GLU C CB  1 
ATOM   7739  C  CG  . GLU C  1 135 ? 44.903  33.055  27.157  1.00 57.19  ? 166  GLU C CG  1 
ATOM   7740  C  CD  . GLU C  1 135 ? 45.266  34.059  26.084  1.00 60.49  ? 166  GLU C CD  1 
ATOM   7741  O  OE1 . GLU C  1 135 ? 44.371  34.735  25.532  1.00 61.72  ? 166  GLU C OE1 1 
ATOM   7742  O  OE2 . GLU C  1 135 ? 46.478  34.180  25.786  1.00 63.20  ? 166  GLU C OE2 1 
ATOM   7743  N  N   . ALA C  1 136 ? 43.252  30.427  24.845  1.00 49.85  ? 167  ALA C N   1 
ATOM   7744  C  CA  . ALA C  1 136 ? 43.626  29.030  24.606  1.00 48.61  ? 167  ALA C CA  1 
ATOM   7745  C  C   . ALA C  1 136 ? 45.113  28.856  24.900  1.00 47.20  ? 167  ALA C C   1 
ATOM   7746  O  O   . ALA C  1 136 ? 45.805  29.847  25.122  1.00 48.04  ? 167  ALA C O   1 
ATOM   7747  C  CB  . ALA C  1 136 ? 43.345  28.627  23.164  1.00 49.26  ? 167  ALA C CB  1 
ATOM   7748  N  N   . ASP C  1 137 ? 45.584  27.618  24.881  1.00 45.06  ? 168  ASP C N   1 
ATOM   7749  C  CA  . ASP C  1 137 ? 47.002  27.337  25.096  1.00 41.38  ? 168  ASP C CA  1 
ATOM   7750  C  C   . ASP C  1 137 ? 47.794  27.748  23.861  1.00 40.10  ? 168  ASP C C   1 
ATOM   7751  O  O   . ASP C  1 137 ? 48.883  28.292  23.999  1.00 42.11  ? 168  ASP C O   1 
ATOM   7752  C  CB  . ASP C  1 137 ? 47.221  25.856  25.376  1.00 41.61  ? 168  ASP C CB  1 
ATOM   7753  C  CG  . ASP C  1 137 ? 46.558  25.387  26.653  1.00 42.24  ? 168  ASP C CG  1 
ATOM   7754  O  OD1 . ASP C  1 137 ? 47.144  25.515  27.748  1.00 42.60  ? 168  ASP C OD1 1 
ATOM   7755  O  OD2 . ASP C  1 137 ? 45.427  24.870  26.580  1.00 42.63  ? 168  ASP C OD2 1 
ATOM   7756  N  N   . ILE C  1 138 ? 47.259  27.450  22.683  1.00 37.06  ? 169  ILE C N   1 
ATOM   7757  C  CA  . ILE C  1 138 ? 47.958  27.792  21.439  1.00 34.42  ? 169  ILE C CA  1 
ATOM   7758  C  C   . ILE C  1 138 ? 47.065  28.720  20.615  1.00 34.27  ? 169  ILE C C   1 
ATOM   7759  O  O   . ILE C  1 138 ? 46.062  28.198  20.134  1.00 37.41  ? 169  ILE C O   1 
ATOM   7760  C  CB  . ILE C  1 138 ? 48.209  26.526  20.588  1.00 32.27  ? 169  ILE C CB  1 
ATOM   7761  C  CG1 . ILE C  1 138 ? 49.343  25.711  21.219  1.00 29.85  ? 169  ILE C CG1 1 
ATOM   7762  C  CG2 . ILE C  1 138 ? 48.540  26.897  19.150  1.00 30.59  ? 169  ILE C CG2 1 
ATOM   7763  C  CD1 . ILE C  1 138 ? 49.640  24.433  20.512  1.00 28.99  ? 169  ILE C CD1 1 
ATOM   7764  N  N   . MET C  1 139 ? 47.427  29.979  20.485  1.00 31.86  ? 170  MET C N   1 
ATOM   7765  C  CA  . MET C  1 139 ? 46.613  30.961  19.757  1.00 29.71  ? 170  MET C CA  1 
ATOM   7766  C  C   . MET C  1 139 ? 47.130  31.115  18.329  1.00 28.82  ? 170  MET C C   1 
ATOM   7767  O  O   . MET C  1 139 ? 48.287  31.488  18.105  1.00 30.17  ? 170  MET C O   1 
ATOM   7768  C  CB  . MET C  1 139 ? 46.643  32.307  20.457  1.00 30.72  ? 170  MET C CB  1 
ATOM   7769  C  CG  . MET C  1 139 ? 46.152  32.374  21.875  1.00 32.14  ? 170  MET C CG  1 
ATOM   7770  S  SD  . MET C  1 139 ? 44.384  32.209  22.086  1.00 36.52  ? 170  MET C SD  1 
ATOM   7771  C  CE  . MET C  1 139 ? 43.743  33.647  21.256  1.00 30.69  ? 170  MET C CE  1 
ATOM   7772  N  N   . ILE C  1 140 ? 46.327  30.782  17.328  1.00 26.96  ? 171  ILE C N   1 
ATOM   7773  C  CA  . ILE C  1 140 ? 46.748  30.807  15.935  1.00 27.75  ? 171  ILE C CA  1 
ATOM   7774  C  C   . ILE C  1 140 ? 46.255  32.059  15.216  1.00 28.95  ? 171  ILE C C   1 
ATOM   7775  O  O   . ILE C  1 140 ? 45.047  32.259  15.093  1.00 29.92  ? 171  ILE C O   1 
ATOM   7776  C  CB  . ILE C  1 140 ? 46.217  29.593  15.166  1.00 28.10  ? 171  ILE C CB  1 
ATOM   7777  C  CG1 . ILE C  1 140 ? 46.578  28.306  15.880  1.00 29.68  ? 171  ILE C CG1 1 
ATOM   7778  C  CG2 . ILE C  1 140 ? 46.611  29.585  13.714  1.00 26.27  ? 171  ILE C CG2 1 
ATOM   7779  C  CD1 . ILE C  1 140 ? 45.906  27.047  15.413  1.00 30.22  ? 171  ILE C CD1 1 
ATOM   7780  N  N   . ASN C  1 141 ? 47.186  32.808  14.625  1.00 28.12  ? 172  ASN C N   1 
ATOM   7781  C  CA  . ASN C  1 141 ? 46.810  34.018  13.937  1.00 26.02  ? 172  ASN C CA  1 
ATOM   7782  C  C   . ASN C  1 141 ? 47.704  34.337  12.754  1.00 25.50  ? 172  ASN C C   1 
ATOM   7783  O  O   . ASN C  1 141 ? 48.856  33.926  12.787  1.00 27.45  ? 172  ASN C O   1 
ATOM   7784  C  CB  . ASN C  1 141 ? 46.904  35.175  14.936  1.00 24.27  ? 172  ASN C CB  1 
ATOM   7785  C  CG  . ASN C  1 141 ? 46.241  36.425  14.407  1.00 25.37  ? 172  ASN C CG  1 
ATOM   7786  O  OD1 . ASN C  1 141 ? 45.626  36.464  13.338  1.00 26.32  ? 172  ASN C OD1 1 
ATOM   7787  N  ND2 . ASN C  1 141 ? 46.341  37.506  15.165  1.00 25.84  ? 172  ASN C ND2 1 
ATOM   7788  N  N   . PHE C  1 142 ? 47.195  35.084  11.786  1.00 25.15  ? 173  PHE C N   1 
ATOM   7789  C  CA  . PHE C  1 142 ? 48.017  35.502  10.651  1.00 27.56  ? 173  PHE C CA  1 
ATOM   7790  C  C   . PHE C  1 142 ? 48.342  36.993  10.814  1.00 27.95  ? 173  PHE C C   1 
ATOM   7791  O  O   . PHE C  1 142 ? 47.431  37.739  11.174  1.00 30.78  ? 173  PHE C O   1 
ATOM   7792  C  CB  . PHE C  1 142 ? 47.351  35.288  9.313   1.00 29.24  ? 173  PHE C CB  1 
ATOM   7793  C  CG  . PHE C  1 142 ? 46.963  33.896  8.946   1.00 30.65  ? 173  PHE C CG  1 
ATOM   7794  C  CD1 . PHE C  1 142 ? 45.920  33.235  9.565   1.00 30.12  ? 173  PHE C CD1 1 
ATOM   7795  C  CD2 . PHE C  1 142 ? 47.634  33.247  7.925   1.00 30.60  ? 173  PHE C CD2 1 
ATOM   7796  C  CE1 . PHE C  1 142 ? 45.580  31.952  9.196   1.00 29.98  ? 173  PHE C CE1 1 
ATOM   7797  C  CE2 . PHE C  1 142 ? 47.289  31.959  7.549   1.00 30.61  ? 173  PHE C CE2 1 
ATOM   7798  C  CZ  . PHE C  1 142 ? 46.269  31.297  8.178   1.00 30.12  ? 173  PHE C CZ  1 
ATOM   7799  N  N   . GLY C  1 143 ? 49.568  37.403  10.534  1.00 27.55  ? 174  GLY C N   1 
ATOM   7800  C  CA  . GLY C  1 143 ? 49.950  38.807  10.668  1.00 25.90  ? 174  GLY C CA  1 
ATOM   7801  C  C   . GLY C  1 143 ? 51.134  39.106  9.785   1.00 24.77  ? 174  GLY C C   1 
ATOM   7802  O  O   . GLY C  1 143 ? 51.769  38.191  9.265   1.00 24.12  ? 174  GLY C O   1 
ATOM   7803  N  N   . ARG C  1 144 ? 51.415  40.375  9.526   1.00 25.02  ? 175  ARG C N   1 
ATOM   7804  C  CA  . ARG C  1 144 ? 52.477  40.825  8.669   1.00 25.51  ? 175  ARG C CA  1 
ATOM   7805  C  C   . ARG C  1 144 ? 53.471  41.738  9.387   1.00 27.07  ? 175  ARG C C   1 
ATOM   7806  O  O   . ARG C  1 144 ? 53.072  42.445  10.305  1.00 27.14  ? 175  ARG C O   1 
ATOM   7807  C  CB  . ARG C  1 144 ? 52.011  41.501  7.389   1.00 22.85  ? 175  ARG C CB  1 
ATOM   7808  C  CG  . ARG C  1 144 ? 51.326  42.837  7.536   1.00 21.37  ? 175  ARG C CG  1 
ATOM   7809  C  CD  . ARG C  1 144 ? 50.089  42.882  6.620   1.00 22.97  ? 175  ARG C CD  1 
ATOM   7810  N  NE  . ARG C  1 144 ? 50.578  43.059  5.251   1.00 22.44  ? 175  ARG C NE  1 
ATOM   7811  C  CZ  . ARG C  1 144 ? 50.952  44.260  4.801   1.00 24.18  ? 175  ARG C CZ  1 
ATOM   7812  N  NH1 . ARG C  1 144 ? 50.881  45.347  5.555   1.00 23.12  ? 175  ARG C NH1 1 
ATOM   7813  N  NH2 . ARG C  1 144 ? 51.401  44.341  3.552   1.00 24.73  ? 175  ARG C NH2 1 
ATOM   7814  N  N   . TRP C  1 145 ? 54.704  41.716  8.868   1.00 27.47  ? 176  TRP C N   1 
ATOM   7815  C  CA  . TRP C  1 145 ? 55.781  42.429  9.541   1.00 27.09  ? 176  TRP C CA  1 
ATOM   7816  C  C   . TRP C  1 145 ? 55.666  42.295  11.052  1.00 25.93  ? 176  TRP C C   1 
ATOM   7817  O  O   . TRP C  1 145 ? 55.504  41.188  11.557  1.00 28.34  ? 176  TRP C O   1 
ATOM   7818  C  CB  . TRP C  1 145 ? 55.782  43.904  9.142   1.00 28.17  ? 176  TRP C CB  1 
ATOM   7819  C  CG  . TRP C  1 145 ? 55.991  44.127  7.678   1.00 32.23  ? 176  TRP C CG  1 
ATOM   7820  C  CD1 . TRP C  1 145 ? 55.032  44.400  6.747   1.00 32.84  ? 176  TRP C CD1 1 
ATOM   7821  C  CD2 . TRP C  1 145 ? 57.238  44.096  6.975   1.00 33.87  ? 176  TRP C CD2 1 
ATOM   7822  N  NE1 . TRP C  1 145 ? 55.605  44.541  5.507   1.00 33.15  ? 176  TRP C NE1 1 
ATOM   7823  C  CE2 . TRP C  1 145 ? 56.958  44.359  5.619   1.00 33.34  ? 176  TRP C CE2 1 
ATOM   7824  C  CE3 . TRP C  1 145 ? 58.564  43.870  7.358   1.00 35.57  ? 176  TRP C CE3 1 
ATOM   7825  C  CZ2 . TRP C  1 145 ? 57.954  44.405  4.647   1.00 33.37  ? 176  TRP C CZ2 1 
ATOM   7826  C  CZ3 . TRP C  1 145 ? 59.551  43.916  6.391   1.00 36.77  ? 176  TRP C CZ3 1 
ATOM   7827  C  CH2 . TRP C  1 145 ? 59.241  44.181  5.052   1.00 34.27  ? 176  TRP C CH2 1 
ATOM   7828  N  N   . GLU C  1 146 ? 55.732  43.450  11.674  1.00 24.18  ? 177  GLU C N   1 
ATOM   7829  C  CA  . GLU C  1 146 ? 55.545  43.550  13.098  1.00 24.27  ? 177  GLU C CA  1 
ATOM   7830  C  C   . GLU C  1 146 ? 54.066  43.408  13.401  1.00 24.25  ? 177  GLU C C   1 
ATOM   7831  O  O   . GLU C  1 146 ? 53.285  44.330  13.167  1.00 23.22  ? 177  GLU C O   1 
ATOM   7832  C  CB  . GLU C  1 146 ? 56.100  44.872  13.623  1.00 22.83  ? 177  GLU C CB  1 
ATOM   7833  C  CG  . GLU C  1 146 ? 56.008  45.014  15.131  1.00 22.74  ? 177  GLU C CG  1 
ATOM   7834  C  CD  . GLU C  1 146 ? 56.107  43.678  15.838  1.00 26.37  ? 177  GLU C CD  1 
ATOM   7835  O  OE1 . GLU C  1 146 ? 57.210  43.092  15.846  1.00 26.84  ? 177  GLU C OE1 1 
ATOM   7836  O  OE2 . GLU C  1 146 ? 55.082  43.215  16.382  1.00 32.60  ? 177  GLU C OE2 1 
ATOM   7837  N  N   . HIS C  1 147 ? 53.699  42.249  13.902  1.00 25.31  ? 178  HIS C N   1 
ATOM   7838  C  CA  . HIS C  1 147 ? 52.316  41.948  14.217  1.00 25.21  ? 178  HIS C CA  1 
ATOM   7839  C  C   . HIS C  1 147 ? 52.135  41.765  15.734  1.00 25.21  ? 178  HIS C C   1 
ATOM   7840  O  O   . HIS C  1 147 ? 51.268  40.966  16.107  1.00 25.94  ? 178  HIS C O   1 
ATOM   7841  C  CB  . HIS C  1 147 ? 51.904  40.672  13.485  1.00 24.29  ? 178  HIS C CB  1 
ATOM   7842  C  CG  . HIS C  1 147 ? 53.027  39.600  13.474  1.00 25.46  ? 178  HIS C CG  1 
ATOM   7843  N  ND1 . HIS C  1 147 ? 54.350  39.912  13.237  1.00 26.92  ? 178  HIS C ND1 1 
ATOM   7844  C  CD2 . HIS C  1 147 ? 52.990  38.261  13.675  1.00 28.21  ? 178  HIS C CD2 1 
ATOM   7845  C  CE1 . HIS C  1 147 ? 55.079  38.811  13.293  1.00 26.30  ? 178  HIS C CE1 1 
ATOM   7846  N  NE2 . HIS C  1 147 ? 54.278  37.796  13.558  1.00 27.14  ? 178  HIS C NE2 1 
ATOM   7847  N  N   . GLY C  1 148 ? 52.822  42.583  16.522  1.00 24.53  ? 179  GLY C N   1 
ATOM   7848  C  CA  . GLY C  1 148 ? 52.643  42.672  17.937  1.00 25.23  ? 179  GLY C CA  1 
ATOM   7849  C  C   . GLY C  1 148 ? 53.351  41.691  18.824  1.00 25.49  ? 179  GLY C C   1 
ATOM   7850  O  O   . GLY C  1 148 ? 52.789  41.177  19.803  1.00 27.14  ? 179  GLY C O   1 
ATOM   7851  N  N   . ASP C  1 149 ? 54.644  41.482  18.604  1.00 26.03  ? 180  ASP C N   1 
ATOM   7852  C  CA  . ASP C  1 149 ? 55.425  40.609  19.455  1.00 26.90  ? 180  ASP C CA  1 
ATOM   7853  C  C   . ASP C  1 149 ? 56.915  40.795  19.322  1.00 27.56  ? 180  ASP C C   1 
ATOM   7854  O  O   . ASP C  1 149 ? 57.700  39.983  19.832  1.00 29.73  ? 180  ASP C O   1 
ATOM   7855  C  CB  . ASP C  1 149 ? 54.996  39.169  19.315  1.00 29.12  ? 180  ASP C CB  1 
ATOM   7856  C  CG  . ASP C  1 149 ? 55.472  38.503  18.043  1.00 30.76  ? 180  ASP C CG  1 
ATOM   7857  O  OD1 . ASP C  1 149 ? 56.067  39.211  17.199  1.00 31.95  ? 180  ASP C OD1 1 
ATOM   7858  O  OD2 . ASP C  1 149 ? 55.227  37.273  17.957  1.00 29.57  ? 180  ASP C OD2 1 
ATOM   7859  N  N   . GLY C  1 150 ? 57.337  41.841  18.615  1.00 26.64  ? 181  GLY C N   1 
ATOM   7860  C  CA  . GLY C  1 150 ? 58.736  42.172  18.481  1.00 27.37  ? 181  GLY C CA  1 
ATOM   7861  C  C   . GLY C  1 150 ? 59.487  41.337  17.472  1.00 28.62  ? 181  GLY C C   1 
ATOM   7862  O  O   . GLY C  1 150 ? 60.639  41.621  17.146  1.00 30.85  ? 181  GLY C O   1 
ATOM   7863  N  N   . TYR C  1 151 ? 58.859  40.280  16.970  1.00 27.90  ? 182  TYR C N   1 
ATOM   7864  C  CA  . TYR C  1 151 ? 59.523  39.422  15.969  1.00 27.31  ? 182  TYR C CA  1 
ATOM   7865  C  C   . TYR C  1 151 ? 58.813  39.552  14.623  1.00 25.47  ? 182  TYR C C   1 
ATOM   7866  O  O   . TYR C  1 151 ? 57.959  38.733  14.332  1.00 27.38  ? 182  TYR C O   1 
ATOM   7867  C  CB  . TYR C  1 151 ? 59.497  37.976  16.474  1.00 27.57  ? 182  TYR C CB  1 
ATOM   7868  C  CG  . TYR C  1 151 ? 60.254  37.807  17.780  1.00 28.30  ? 182  TYR C CG  1 
ATOM   7869  C  CD1 . TYR C  1 151 ? 61.647  37.725  17.802  1.00 29.85  ? 182  TYR C CD1 1 
ATOM   7870  C  CD2 . TYR C  1 151 ? 59.576  37.751  18.981  1.00 28.38  ? 182  TYR C CD2 1 
ATOM   7871  C  CE1 . TYR C  1 151 ? 62.306  37.571  19.010  1.00 30.97  ? 182  TYR C CE1 1 
ATOM   7872  C  CE2 . TYR C  1 151 ? 60.237  37.603  20.193  1.00 29.43  ? 182  TYR C CE2 1 
ATOM   7873  C  CZ  . TYR C  1 151 ? 61.605  37.520  20.183  1.00 30.38  ? 182  TYR C CZ  1 
ATOM   7874  O  OH  . TYR C  1 151 ? 62.290  37.363  21.369  1.00 32.89  ? 182  TYR C OH  1 
ATOM   7875  N  N   . PRO C  1 152 ? 59.122  40.592  13.858  1.00 23.22  ? 183  PRO C N   1 
ATOM   7876  C  CA  . PRO C  1 152 ? 58.471  40.947  12.629  1.00 22.72  ? 183  PRO C CA  1 
ATOM   7877  C  C   . PRO C  1 152 ? 58.635  39.982  11.486  1.00 22.90  ? 183  PRO C C   1 
ATOM   7878  O  O   . PRO C  1 152 ? 59.564  39.214  11.451  1.00 26.22  ? 183  PRO C O   1 
ATOM   7879  C  CB  . PRO C  1 152 ? 59.068  42.293  12.216  1.00 22.24  ? 183  PRO C CB  1 
ATOM   7880  C  CG  . PRO C  1 152 ? 60.374  42.288  12.894  1.00 22.10  ? 183  PRO C CG  1 
ATOM   7881  C  CD  . PRO C  1 152 ? 60.166  41.573  14.169  1.00 20.55  ? 183  PRO C CD  1 
ATOM   7882  N  N   . PHE C  1 153 ? 57.680  40.005  10.559  1.00 23.04  ? 184  PHE C N   1 
ATOM   7883  C  CA  . PHE C  1 153 ? 57.815  39.158  9.367   1.00 23.82  ? 184  PHE C CA  1 
ATOM   7884  C  C   . PHE C  1 153 ? 58.464  40.044  8.303   1.00 24.01  ? 184  PHE C C   1 
ATOM   7885  O  O   . PHE C  1 153 ? 59.008  41.060  8.682   1.00 21.90  ? 184  PHE C O   1 
ATOM   7886  C  CB  . PHE C  1 153 ? 56.506  38.601  8.884   1.00 25.65  ? 184  PHE C CB  1 
ATOM   7887  C  CG  . PHE C  1 153 ? 55.941  37.496  9.724   1.00 25.69  ? 184  PHE C CG  1 
ATOM   7888  C  CD1 . PHE C  1 153 ? 56.745  36.456  10.153  1.00 25.07  ? 184  PHE C CD1 1 
ATOM   7889  C  CD2 . PHE C  1 153 ? 54.599  37.486  10.067  1.00 25.06  ? 184  PHE C CD2 1 
ATOM   7890  C  CE1 . PHE C  1 153 ? 56.217  35.437  10.927  1.00 24.90  ? 184  PHE C CE1 1 
ATOM   7891  C  CE2 . PHE C  1 153 ? 54.078  36.462  10.828  1.00 26.16  ? 184  PHE C CE2 1 
ATOM   7892  C  CZ  . PHE C  1 153 ? 54.883  35.433  11.272  1.00 24.47  ? 184  PHE C CZ  1 
ATOM   7893  N  N   . ASP C  1 154 ? 58.421  39.641  7.054   1.00 25.75  ? 185  ASP C N   1 
ATOM   7894  C  CA  . ASP C  1 154 ? 59.196  40.291  6.024   1.00 26.51  ? 185  ASP C CA  1 
ATOM   7895  C  C   . ASP C  1 154 ? 58.578  40.372  4.659   1.00 27.46  ? 185  ASP C C   1 
ATOM   7896  O  O   . ASP C  1 154 ? 59.272  40.732  3.719   1.00 28.10  ? 185  ASP C O   1 
ATOM   7897  C  CB  . ASP C  1 154 ? 60.545  39.581  5.872   1.00 29.47  ? 185  ASP C CB  1 
ATOM   7898  C  CG  . ASP C  1 154 ? 60.450  38.095  5.623   1.00 32.30  ? 185  ASP C CG  1 
ATOM   7899  O  OD1 . ASP C  1 154 ? 59.368  37.518  5.759   1.00 34.73  ? 185  ASP C OD1 1 
ATOM   7900  O  OD2 . ASP C  1 154 ? 61.513  37.500  5.305   1.00 32.67  ? 185  ASP C OD2 1 
ATOM   7901  N  N   . GLY C  1 155 ? 57.260  40.277  4.577   1.00 29.25  ? 186  GLY C N   1 
ATOM   7902  C  CA  . GLY C  1 155 ? 56.614  40.418  3.265   1.00 28.64  ? 186  GLY C CA  1 
ATOM   7903  C  C   . GLY C  1 155 ? 56.671  39.075  2.552   1.00 28.61  ? 186  GLY C C   1 
ATOM   7904  O  O   . GLY C  1 155 ? 56.660  38.038  3.171   1.00 28.19  ? 186  GLY C O   1 
ATOM   7905  N  N   . LYS C  1 156 ? 56.546  39.122  1.226   1.00 29.44  ? 187  LYS C N   1 
ATOM   7906  C  CA  . LYS C  1 156 ? 56.442  37.860  0.487   1.00 31.83  ? 187  LYS C CA  1 
ATOM   7907  C  C   . LYS C  1 156 ? 57.666  37.017  0.765   1.00 33.12  ? 187  LYS C C   1 
ATOM   7908  O  O   . LYS C  1 156 ? 58.779  37.477  0.983   1.00 34.66  ? 187  LYS C O   1 
ATOM   7909  C  CB  . LYS C  1 156 ? 56.194  38.081  -0.988  1.00 32.12  ? 187  LYS C CB  1 
ATOM   7910  C  CG  . LYS C  1 156 ? 54.891  37.611  -1.587  1.00 36.07  ? 187  LYS C CG  1 
ATOM   7911  C  CD  . LYS C  1 156 ? 54.991  36.335  -2.387  1.00 36.21  ? 187  LYS C CD  1 
ATOM   7912  C  CE  . LYS C  1 156 ? 53.672  35.673  -2.733  1.00 37.08  ? 187  LYS C CE  1 
ATOM   7913  N  NZ  . LYS C  1 156 ? 53.852  34.182  -2.722  1.00 41.27  ? 187  LYS C NZ  1 
ATOM   7914  N  N   . ASP C  1 157 ? 57.522  35.686  0.654   1.00 34.60  ? 188  ASP C N   1 
ATOM   7915  C  CA  . ASP C  1 157 ? 58.623  34.777  0.692   1.00 35.54  ? 188  ASP C CA  1 
ATOM   7916  C  C   . ASP C  1 157 ? 59.469  34.975  1.932   1.00 35.64  ? 188  ASP C C   1 
ATOM   7917  O  O   . ASP C  1 157 ? 58.937  35.470  2.920   1.00 37.02  ? 188  ASP C O   1 
ATOM   7918  C  CB  . ASP C  1 157 ? 59.412  34.987  -0.592  1.00 36.14  ? 188  ASP C CB  1 
ATOM   7919  C  CG  . ASP C  1 157 ? 58.543  34.695  -1.806  1.00 37.85  ? 188  ASP C CG  1 
ATOM   7920  O  OD1 . ASP C  1 157 ? 57.526  33.983  -1.644  1.00 37.81  ? 188  ASP C OD1 1 
ATOM   7921  O  OD2 . ASP C  1 157 ? 58.865  35.179  -2.910  1.00 40.08  ? 188  ASP C OD2 1 
ATOM   7922  N  N   . GLY C  1 158 ? 60.713  34.510  2.102   1.00 33.24  ? 189  GLY C N   1 
ATOM   7923  C  CA  . GLY C  1 158 ? 61.366  34.611  3.421   1.00 30.01  ? 189  GLY C CA  1 
ATOM   7924  C  C   . GLY C  1 158 ? 60.786  33.859  4.605   1.00 30.19  ? 189  GLY C C   1 
ATOM   7925  O  O   . GLY C  1 158 ? 60.421  32.680  4.451   1.00 30.72  ? 189  GLY C O   1 
ATOM   7926  N  N   . LEU C  1 159 ? 60.789  34.431  5.813   1.00 29.91  ? 190  LEU C N   1 
ATOM   7927  C  CA  . LEU C  1 159 ? 60.244  33.825  7.042   1.00 29.37  ? 190  LEU C CA  1 
ATOM   7928  C  C   . LEU C  1 159 ? 58.758  33.592  6.821   1.00 26.67  ? 190  LEU C C   1 
ATOM   7929  O  O   . LEU C  1 159 ? 58.045  34.508  6.496   1.00 26.77  ? 190  LEU C O   1 
ATOM   7930  C  CB  . LEU C  1 159 ? 60.506  34.688  8.263   1.00 29.58  ? 190  LEU C CB  1 
ATOM   7931  C  CG  . LEU C  1 159 ? 61.664  35.675  8.205   1.00 29.39  ? 190  LEU C CG  1 
ATOM   7932  C  CD1 . LEU C  1 159 ? 61.675  36.492  9.476   1.00 30.35  ? 190  LEU C CD1 1 
ATOM   7933  C  CD2 . LEU C  1 159 ? 63.015  35.008  7.982   1.00 31.54  ? 190  LEU C CD2 1 
ATOM   7934  N  N   . LEU C  1 160 ? 58.253  32.401  7.122   1.00 24.09  ? 191  LEU C N   1 
ATOM   7935  C  CA  . LEU C  1 160 ? 56.930  31.996  6.661   1.00 24.46  ? 191  LEU C CA  1 
ATOM   7936  C  C   . LEU C  1 160 ? 56.067  31.929  7.914   1.00 25.61  ? 191  LEU C C   1 
ATOM   7937  O  O   . LEU C  1 160 ? 54.874  32.169  7.891   1.00 24.94  ? 191  LEU C O   1 
ATOM   7938  C  CB  . LEU C  1 160 ? 56.878  30.610  6.015   1.00 23.55  ? 191  LEU C CB  1 
ATOM   7939  C  CG  . LEU C  1 160 ? 57.409  30.454  4.597   1.00 23.01  ? 191  LEU C CG  1 
ATOM   7940  C  CD1 . LEU C  1 160 ? 57.098  29.083  4.038   1.00 22.85  ? 191  LEU C CD1 1 
ATOM   7941  C  CD2 . LEU C  1 160 ? 56.907  31.588  3.726   1.00 21.18  ? 191  LEU C CD2 1 
ATOM   7942  N  N   . ALA C  1 161 ? 56.728  31.627  9.022   1.00 26.45  ? 192  ALA C N   1 
ATOM   7943  C  CA  . ALA C  1 161 ? 55.914  31.563  10.230  1.00 26.36  ? 192  ALA C CA  1 
ATOM   7944  C  C   . ALA C  1 161 ? 56.861  31.610  11.414  1.00 25.83  ? 192  ALA C C   1 
ATOM   7945  O  O   . ALA C  1 161 ? 58.077  31.624  11.330  1.00 26.83  ? 192  ALA C O   1 
ATOM   7946  C  CB  . ALA C  1 161 ? 54.988  30.372  10.291  1.00 29.02  ? 192  ALA C CB  1 
ATOM   7947  N  N   . HIS C  1 162 ? 56.183  31.589  12.558  1.00 24.72  ? 193  HIS C N   1 
ATOM   7948  C  CA  . HIS C  1 162 ? 56.945  31.416  13.793  1.00 23.98  ? 193  HIS C CA  1 
ATOM   7949  C  C   . HIS C  1 162 ? 56.022  31.057  14.939  1.00 23.76  ? 193  HIS C C   1 
ATOM   7950  O  O   . HIS C  1 162 ? 54.821  31.305  14.885  1.00 23.97  ? 193  HIS C O   1 
ATOM   7951  C  CB  . HIS C  1 162 ? 57.818  32.600  13.982  1.00 23.43  ? 193  HIS C CB  1 
ATOM   7952  C  CG  . HIS C  1 162 ? 57.078  33.883  14.422  1.00 28.72  ? 193  HIS C CG  1 
ATOM   7953  N  ND1 . HIS C  1 162 ? 57.254  35.094  13.788  1.00 29.06  ? 193  HIS C ND1 1 
ATOM   7954  C  CD2 . HIS C  1 162 ? 56.190  34.102  15.418  1.00 32.08  ? 193  HIS C CD2 1 
ATOM   7955  C  CE1 . HIS C  1 162 ? 56.503  36.007  14.375  1.00 30.54  ? 193  HIS C CE1 1 
ATOM   7956  N  NE2 . HIS C  1 162 ? 55.847  35.431  15.367  1.00 30.72  ? 193  HIS C NE2 1 
ATOM   7957  N  N   . ALA C  1 163 ? 56.579  30.432  15.962  1.00 23.08  ? 194  ALA C N   1 
ATOM   7958  C  CA  . ALA C  1 163 ? 55.788  30.038  17.113  1.00 23.30  ? 194  ALA C CA  1 
ATOM   7959  C  C   . ALA C  1 163 ? 56.628  30.043  18.375  1.00 23.27  ? 194  ALA C C   1 
ATOM   7960  O  O   . ALA C  1 163 ? 57.856  29.988  18.315  1.00 24.03  ? 194  ALA C O   1 
ATOM   7961  C  CB  . ALA C  1 163 ? 55.160  28.675  16.884  1.00 23.25  ? 194  ALA C CB  1 
ATOM   7962  N  N   . PHE C  1 164 ? 55.961  30.103  19.516  1.00 22.47  ? 195  PHE C N   1 
ATOM   7963  C  CA  . PHE C  1 164 ? 56.662  30.133  20.786  1.00 22.53  ? 195  PHE C CA  1 
ATOM   7964  C  C   . PHE C  1 164 ? 56.566  28.804  21.510  1.00 23.73  ? 195  PHE C C   1 
ATOM   7965  O  O   . PHE C  1 164 ? 55.545  28.119  21.438  1.00 25.00  ? 195  PHE C O   1 
ATOM   7966  C  CB  . PHE C  1 164 ? 56.123  31.262  21.654  1.00 22.79  ? 195  PHE C CB  1 
ATOM   7967  C  CG  . PHE C  1 164 ? 56.227  32.599  20.994  1.00 23.62  ? 195  PHE C CG  1 
ATOM   7968  C  CD1 . PHE C  1 164 ? 57.409  33.312  21.047  1.00 24.90  ? 195  PHE C CD1 1 
ATOM   7969  C  CD2 . PHE C  1 164 ? 55.148  33.135  20.315  1.00 24.53  ? 195  PHE C CD2 1 
ATOM   7970  C  CE1 . PHE C  1 164 ? 57.515  34.544  20.432  1.00 24.46  ? 195  PHE C CE1 1 
ATOM   7971  C  CE2 . PHE C  1 164 ? 55.246  34.366  19.698  1.00 24.71  ? 195  PHE C CE2 1 
ATOM   7972  C  CZ  . PHE C  1 164 ? 56.431  35.073  19.756  1.00 25.08  ? 195  PHE C CZ  1 
ATOM   7973  N  N   . ALA C  1 165 ? 57.641  28.458  22.201  1.00 25.37  ? 196  ALA C N   1 
ATOM   7974  C  CA  . ALA C  1 165 ? 57.696  27.220  22.951  1.00 26.44  ? 196  ALA C CA  1 
ATOM   7975  C  C   . ALA C  1 165 ? 56.629  27.190  24.022  1.00 27.35  ? 196  ALA C C   1 
ATOM   7976  O  O   . ALA C  1 165 ? 56.167  28.230  24.478  1.00 26.72  ? 196  ALA C O   1 
ATOM   7977  C  CB  . ALA C  1 165 ? 59.076  27.032  23.563  1.00 27.66  ? 196  ALA C CB  1 
ATOM   7978  N  N   . PRO C  1 166 ? 56.242  26.000  24.442  1.00 30.09  ? 197  PRO C N   1 
ATOM   7979  C  CA  . PRO C  1 166 ? 55.202  25.836  25.450  1.00 31.83  ? 197  PRO C CA  1 
ATOM   7980  C  C   . PRO C  1 166 ? 55.445  26.737  26.639  1.00 33.02  ? 197  PRO C C   1 
ATOM   7981  O  O   . PRO C  1 166 ? 56.588  26.967  27.032  1.00 33.56  ? 197  PRO C O   1 
ATOM   7982  C  CB  . PRO C  1 166 ? 55.347  24.368  25.839  1.00 31.89  ? 197  PRO C CB  1 
ATOM   7983  C  CG  . PRO C  1 166 ? 55.753  23.723  24.556  1.00 30.99  ? 197  PRO C CG  1 
ATOM   7984  C  CD  . PRO C  1 166 ? 56.739  24.689  23.955  1.00 31.33  ? 197  PRO C CD  1 
ATOM   7985  N  N   . GLY C  1 167 ? 54.374  27.307  27.186  1.00 34.24  ? 198  GLY C N   1 
ATOM   7986  C  CA  . GLY C  1 167 ? 54.519  28.174  28.345  1.00 34.16  ? 198  GLY C CA  1 
ATOM   7987  C  C   . GLY C  1 167 ? 53.345  29.121  28.491  1.00 33.90  ? 198  GLY C C   1 
ATOM   7988  O  O   . GLY C  1 167 ? 52.477  29.221  27.628  1.00 33.54  ? 198  GLY C O   1 
ATOM   7989  N  N   . THR C  1 168 ? 53.335  29.838  29.611  1.00 33.50  ? 199  THR C N   1 
ATOM   7990  C  CA  . THR C  1 168 ? 52.270  30.817  29.823  1.00 33.51  ? 199  THR C CA  1 
ATOM   7991  C  C   . THR C  1 168 ? 52.527  32.032  28.935  1.00 34.02  ? 199  THR C C   1 
ATOM   7992  O  O   . THR C  1 168 ? 53.573  32.121  28.299  1.00 33.09  ? 199  THR C O   1 
ATOM   7993  C  CB  . THR C  1 168 ? 52.240  31.273  31.292  1.00 32.78  ? 199  THR C CB  1 
ATOM   7994  O  OG1 . THR C  1 168 ? 53.562  31.683  31.646  1.00 29.47  ? 199  THR C OG1 1 
ATOM   7995  C  CG2 . THR C  1 168 ? 51.759  30.146  32.190  1.00 30.94  ? 199  THR C CG2 1 
ATOM   7996  N  N   . GLY C  1 169 ? 51.565  32.941  28.882  1.00 34.64  ? 200  GLY C N   1 
ATOM   7997  C  CA  . GLY C  1 169 ? 51.708  34.135  28.061  1.00 36.49  ? 200  GLY C CA  1 
ATOM   7998  C  C   . GLY C  1 169 ? 51.568  33.838  26.578  1.00 36.78  ? 200  GLY C C   1 
ATOM   7999  O  O   . GLY C  1 169 ? 50.607  33.209  26.144  1.00 38.90  ? 200  GLY C O   1 
ATOM   8000  N  N   . VAL C  1 170 ? 52.527  34.280  25.775  1.00 35.32  ? 201  VAL C N   1 
ATOM   8001  C  CA  . VAL C  1 170 ? 52.491  34.053  24.329  1.00 34.90  ? 201  VAL C CA  1 
ATOM   8002  C  C   . VAL C  1 170 ? 52.933  32.641  23.989  1.00 35.91  ? 201  VAL C C   1 
ATOM   8003  O  O   . VAL C  1 170 ? 52.895  32.188  22.843  1.00 35.66  ? 201  VAL C O   1 
ATOM   8004  C  CB  . VAL C  1 170 ? 53.354  35.096  23.605  1.00 34.10  ? 201  VAL C CB  1 
ATOM   8005  C  CG1 . VAL C  1 170 ? 54.754  34.595  23.301  1.00 31.86  ? 201  VAL C CG1 1 
ATOM   8006  C  CG2 . VAL C  1 170 ? 52.666  35.615  22.358  1.00 34.29  ? 201  VAL C CG2 1 
ATOM   8007  N  N   . GLY C  1 171 ? 53.352  31.884  25.003  1.00 36.20  ? 202  GLY C N   1 
ATOM   8008  C  CA  . GLY C  1 171 ? 53.851  30.542  24.791  1.00 37.86  ? 202  GLY C CA  1 
ATOM   8009  C  C   . GLY C  1 171 ? 52.913  29.667  23.995  1.00 38.52  ? 202  GLY C C   1 
ATOM   8010  O  O   . GLY C  1 171 ? 51.731  29.562  24.321  1.00 40.87  ? 202  GLY C O   1 
ATOM   8011  N  N   . GLY C  1 172 ? 53.425  29.003  22.962  1.00 38.29  ? 203  GLY C N   1 
ATOM   8012  C  CA  . GLY C  1 172 ? 52.617  28.079  22.174  1.00 37.77  ? 203  GLY C CA  1 
ATOM   8013  C  C   . GLY C  1 172 ? 51.968  28.758  20.980  1.00 36.74  ? 203  GLY C C   1 
ATOM   8014  O  O   . GLY C  1 172 ? 51.500  28.118  20.038  1.00 35.02  ? 203  GLY C O   1 
ATOM   8015  N  N   . ASP C  1 173 ? 51.957  30.097  21.047  1.00 35.99  ? 204  ASP C N   1 
ATOM   8016  C  CA  . ASP C  1 173 ? 51.312  30.866  19.989  1.00 35.06  ? 204  ASP C CA  1 
ATOM   8017  C  C   . ASP C  1 173 ? 51.956  30.565  18.650  1.00 33.31  ? 204  ASP C C   1 
ATOM   8018  O  O   . ASP C  1 173 ? 53.155  30.297  18.568  1.00 33.30  ? 204  ASP C O   1 
ATOM   8019  C  CB  . ASP C  1 173 ? 51.301  32.339  20.339  1.00 35.51  ? 204  ASP C CB  1 
ATOM   8020  C  CG  . ASP C  1 173 ? 50.292  32.690  21.420  1.00 37.48  ? 204  ASP C CG  1 
ATOM   8021  O  OD1 . ASP C  1 173 ? 49.732  31.751  22.037  1.00 38.26  ? 204  ASP C OD1 1 
ATOM   8022  O  OD2 . ASP C  1 173 ? 50.057  33.890  21.663  1.00 37.89  ? 204  ASP C OD2 1 
ATOM   8023  N  N   . SER C  1 174 ? 51.149  30.483  17.600  1.00 30.94  ? 205  SER C N   1 
ATOM   8024  C  CA  . SER C  1 174 ? 51.677  30.185  16.273  1.00 28.98  ? 205  SER C CA  1 
ATOM   8025  C  C   . SER C  1 174 ? 51.137  31.240  15.313  1.00 27.36  ? 205  SER C C   1 
ATOM   8026  O  O   . SER C  1 174 ? 49.921  31.286  15.098  1.00 28.55  ? 205  SER C O   1 
ATOM   8027  C  CB  . SER C  1 174 ? 51.185  28.807  15.823  1.00 30.69  ? 205  SER C CB  1 
ATOM   8028  O  OG  . SER C  1 174 ? 51.428  27.843  16.827  1.00 29.67  ? 205  SER C OG  1 
ATOM   8029  N  N   . HIS C  1 175 ? 52.017  32.069  14.795  1.00 24.32  ? 206  HIS C N   1 
ATOM   8030  C  CA  . HIS C  1 175 ? 51.636  33.157  13.907  1.00 22.21  ? 206  HIS C CA  1 
ATOM   8031  C  C   . HIS C  1 175 ? 52.186  32.913  12.505  1.00 20.61  ? 206  HIS C C   1 
ATOM   8032  O  O   . HIS C  1 175 ? 53.114  32.146  12.345  1.00 20.44  ? 206  HIS C O   1 
ATOM   8033  C  CB  . HIS C  1 175 ? 52.235  34.490  14.377  1.00 23.01  ? 206  HIS C CB  1 
ATOM   8034  C  CG  . HIS C  1 175 ? 51.940  34.843  15.796  1.00 24.71  ? 206  HIS C CG  1 
ATOM   8035  N  ND1 . HIS C  1 175 ? 52.864  35.355  16.654  1.00 24.05  ? 206  HIS C ND1 1 
ATOM   8036  C  CD2 . HIS C  1 175 ? 50.788  34.710  16.502  1.00 28.44  ? 206  HIS C CD2 1 
ATOM   8037  C  CE1 . HIS C  1 175 ? 52.307  35.566  17.828  1.00 28.61  ? 206  HIS C CE1 1 
ATOM   8038  N  NE2 . HIS C  1 175 ? 51.036  35.180  17.774  1.00 29.10  ? 206  HIS C NE2 1 
ATOM   8039  N  N   . PHE C  1 176 ? 51.420  33.334  11.501  1.00 18.82  ? 207  PHE C N   1 
ATOM   8040  C  CA  . PHE C  1 176 ? 51.714  33.139  10.099  1.00 19.14  ? 207  PHE C CA  1 
ATOM   8041  C  C   . PHE C  1 176 ? 51.816  34.454  9.337   1.00 21.75  ? 207  PHE C C   1 
ATOM   8042  O  O   . PHE C  1 176 ? 51.051  35.391  9.566   1.00 23.39  ? 207  PHE C O   1 
ATOM   8043  C  CB  . PHE C  1 176 ? 50.665  32.223  9.447   1.00 16.94  ? 207  PHE C CB  1 
ATOM   8044  C  CG  . PHE C  1 176 ? 50.607  30.865  10.085  1.00 17.96  ? 207  PHE C CG  1 
ATOM   8045  C  CD1 . PHE C  1 176 ? 50.187  30.694  11.388  1.00 17.62  ? 207  PHE C CD1 1 
ATOM   8046  C  CD2 . PHE C  1 176 ? 51.015  29.719  9.413   1.00 15.40  ? 207  PHE C CD2 1 
ATOM   8047  C  CE1 . PHE C  1 176 ? 50.162  29.471  12.020  1.00 17.15  ? 207  PHE C CE1 1 
ATOM   8048  C  CE2 . PHE C  1 176 ? 50.978  28.482  10.026  1.00 16.36  ? 207  PHE C CE2 1 
ATOM   8049  C  CZ  . PHE C  1 176 ? 50.534  28.362  11.326  1.00 15.00  ? 207  PHE C CZ  1 
ATOM   8050  N  N   . ASP C  1 177 ? 52.821  34.575  8.470   1.00 24.30  ? 208  ASP C N   1 
ATOM   8051  C  CA  . ASP C  1 177 ? 53.017  35.786  7.701   1.00 24.88  ? 208  ASP C CA  1 
ATOM   8052  C  C   . ASP C  1 177 ? 51.909  35.960  6.672   1.00 26.36  ? 208  ASP C C   1 
ATOM   8053  O  O   . ASP C  1 177 ? 51.796  35.259  5.672   1.00 26.62  ? 208  ASP C O   1 
ATOM   8054  C  CB  . ASP C  1 177 ? 54.387  35.753  7.024   1.00 25.82  ? 208  ASP C CB  1 
ATOM   8055  C  CG  . ASP C  1 177 ? 54.786  37.095  6.455   1.00 26.58  ? 208  ASP C CG  1 
ATOM   8056  O  OD1 . ASP C  1 177 ? 53.887  37.958  6.367   1.00 26.52  ? 208  ASP C OD1 1 
ATOM   8057  O  OD2 . ASP C  1 177 ? 55.953  37.281  6.102   1.00 29.00  ? 208  ASP C OD2 1 
ATOM   8058  N  N   . ASP C  1 178 ? 51.069  36.962  6.879   1.00 28.16  ? 209  ASP C N   1 
ATOM   8059  C  CA  . ASP C  1 178 ? 49.906  37.233  6.064   1.00 29.89  ? 209  ASP C CA  1 
ATOM   8060  C  C   . ASP C  1 178 ? 50.257  37.715  4.674   1.00 29.70  ? 209  ASP C C   1 
ATOM   8061  O  O   . ASP C  1 178 ? 49.421  37.838  3.780   1.00 29.30  ? 209  ASP C O   1 
ATOM   8062  C  CB  . ASP C  1 178 ? 48.999  38.264  6.758   1.00 31.63  ? 209  ASP C CB  1 
ATOM   8063  C  CG  . ASP C  1 178 ? 47.650  38.364  6.083   1.00 34.74  ? 209  ASP C CG  1 
ATOM   8064  O  OD1 . ASP C  1 178 ? 46.997  37.311  5.861   1.00 36.77  ? 209  ASP C OD1 1 
ATOM   8065  O  OD2 . ASP C  1 178 ? 47.199  39.499  5.797   1.00 34.03  ? 209  ASP C OD2 1 
ATOM   8066  N  N   . ASP C  1 179 ? 51.537  37.986  4.431   1.00 30.96  ? 210  ASP C N   1 
ATOM   8067  C  CA  . ASP C  1 179 ? 51.965  38.480  3.128   1.00 32.09  ? 210  ASP C CA  1 
ATOM   8068  C  C   . ASP C  1 179 ? 52.309  37.319  2.197   1.00 32.44  ? 210  ASP C C   1 
ATOM   8069  O  O   . ASP C  1 179 ? 52.805  37.551  1.094   1.00 32.40  ? 210  ASP C O   1 
ATOM   8070  C  CB  . ASP C  1 179 ? 53.181  39.383  3.271   1.00 32.84  ? 210  ASP C CB  1 
ATOM   8071  C  CG  . ASP C  1 179 ? 52.952  40.599  4.149   1.00 33.88  ? 210  ASP C CG  1 
ATOM   8072  O  OD1 . ASP C  1 179 ? 52.026  41.387  3.849   1.00 29.77  ? 210  ASP C OD1 1 
ATOM   8073  O  OD2 . ASP C  1 179 ? 53.722  40.764  5.134   1.00 33.53  ? 210  ASP C OD2 1 
ATOM   8074  N  N   . GLU C  1 180 ? 52.046  36.102  2.653   1.00 32.30  ? 211  GLU C N   1 
ATOM   8075  C  CA  . GLU C  1 180 ? 52.375  34.915  1.887   1.00 31.94  ? 211  GLU C CA  1 
ATOM   8076  C  C   . GLU C  1 180 ? 51.193  34.396  1.094   1.00 31.71  ? 211  GLU C C   1 
ATOM   8077  O  O   . GLU C  1 180 ? 50.038  34.491  1.526   1.00 33.57  ? 211  GLU C O   1 
ATOM   8078  C  CB  . GLU C  1 180 ? 52.877  33.816  2.838   1.00 32.93  ? 211  GLU C CB  1 
ATOM   8079  C  CG  . GLU C  1 180 ? 54.304  34.040  3.323   1.00 33.39  ? 211  GLU C CG  1 
ATOM   8080  C  CD  . GLU C  1 180 ? 55.217  34.399  2.164   1.00 34.48  ? 211  GLU C CD  1 
ATOM   8081  O  OE1 . GLU C  1 180 ? 54.905  34.006  1.019   1.00 32.93  ? 211  GLU C OE1 1 
ATOM   8082  O  OE2 . GLU C  1 180 ? 56.219  35.076  2.389   1.00 34.82  ? 211  GLU C OE2 1 
ATOM   8083  N  N   . LEU C  1 181 ? 51.490  33.794  -0.064  1.00 29.11  ? 212  LEU C N   1 
ATOM   8084  C  CA  . LEU C  1 181 ? 50.412  33.171  -0.844  1.00 26.07  ? 212  LEU C CA  1 
ATOM   8085  C  C   . LEU C  1 181 ? 50.076  31.843  -0.169  1.00 26.06  ? 212  LEU C C   1 
ATOM   8086  O  O   . LEU C  1 181 ? 50.570  30.804  -0.581  1.00 26.97  ? 212  LEU C O   1 
ATOM   8087  C  CB  . LEU C  1 181 ? 50.810  32.992  -2.293  1.00 21.55  ? 212  LEU C CB  1 
ATOM   8088  C  CG  . LEU C  1 181 ? 50.004  31.989  -3.127  1.00 20.50  ? 212  LEU C CG  1 
ATOM   8089  C  CD1 . LEU C  1 181 ? 48.511  32.063  -2.913  1.00 19.64  ? 212  LEU C CD1 1 
ATOM   8090  C  CD2 . LEU C  1 181 ? 50.363  32.123  -4.592  1.00 20.99  ? 212  LEU C CD2 1 
ATOM   8091  N  N   . TRP C  1 182 ? 49.213  31.863  0.860   1.00 25.27  ? 213  TRP C N   1 
ATOM   8092  C  CA  . TRP C  1 182 ? 48.903  30.607  1.523   1.00 25.66  ? 213  TRP C CA  1 
ATOM   8093  C  C   . TRP C  1 182 ? 48.110  29.693  0.594   1.00 27.93  ? 213  TRP C C   1 
ATOM   8094  O  O   . TRP C  1 182 ? 47.136  30.129  0.010   1.00 28.43  ? 213  TRP C O   1 
ATOM   8095  C  CB  . TRP C  1 182 ? 48.149  30.766  2.844   1.00 25.43  ? 213  TRP C CB  1 
ATOM   8096  C  CG  . TRP C  1 182 ? 49.112  31.305  3.868   1.00 21.81  ? 213  TRP C CG  1 
ATOM   8097  C  CD1 . TRP C  1 182 ? 49.148  32.589  4.294   1.00 20.79  ? 213  TRP C CD1 1 
ATOM   8098  C  CD2 . TRP C  1 182 ? 50.225  30.634  4.460   1.00 22.70  ? 213  TRP C CD2 1 
ATOM   8099  N  NE1 . TRP C  1 182 ? 50.197  32.736  5.172   1.00 23.56  ? 213  TRP C NE1 1 
ATOM   8100  C  CE2 . TRP C  1 182 ? 50.882  31.582  5.281   1.00 23.30  ? 213  TRP C CE2 1 
ATOM   8101  C  CE3 . TRP C  1 182 ? 50.710  29.331  4.379   1.00 24.72  ? 213  TRP C CE3 1 
ATOM   8102  C  CZ2 . TRP C  1 182 ? 52.001  31.241  6.035   1.00 24.26  ? 213  TRP C CZ2 1 
ATOM   8103  C  CZ3 . TRP C  1 182 ? 51.819  29.016  5.135   1.00 24.58  ? 213  TRP C CZ3 1 
ATOM   8104  C  CH2 . TRP C  1 182 ? 52.451  29.954  5.949   1.00 23.27  ? 213  TRP C CH2 1 
ATOM   8105  N  N   . THR C  1 183 ? 48.580  28.455  0.530   1.00 28.35  ? 214  THR C N   1 
ATOM   8106  C  CA  . THR C  1 183 ? 48.017  27.465  -0.402  1.00 28.30  ? 214  THR C CA  1 
ATOM   8107  C  C   . THR C  1 183 ? 48.043  26.108  0.264   1.00 28.59  ? 214  THR C C   1 
ATOM   8108  O  O   . THR C  1 183 ? 48.560  26.027  1.392   1.00 29.84  ? 214  THR C O   1 
ATOM   8109  C  CB  . THR C  1 183 ? 48.926  27.571  -1.647  1.00 27.77  ? 214  THR C CB  1 
ATOM   8110  O  OG1 . THR C  1 183 ? 48.302  28.443  -2.594  1.00 31.10  ? 214  THR C OG1 1 
ATOM   8111  C  CG2 . THR C  1 183 ? 49.350  26.275  -2.229  1.00 29.42  ? 214  THR C CG2 1 
ATOM   8112  N  N   . LEU C  1 184 ? 47.527  25.061  -0.362  1.00 27.34  ? 215  LEU C N   1 
ATOM   8113  C  CA  . LEU C  1 184 ? 47.710  23.690  0.098   1.00 25.68  ? 215  LEU C CA  1 
ATOM   8114  C  C   . LEU C  1 184 ? 48.968  22.967  -0.382  1.00 25.42  ? 215  LEU C C   1 
ATOM   8115  O  O   . LEU C  1 184 ? 49.113  21.743  -0.231  1.00 23.36  ? 215  LEU C O   1 
ATOM   8116  C  CB  . LEU C  1 184 ? 46.475  22.867  -0.220  1.00 24.25  ? 215  LEU C CB  1 
ATOM   8117  C  CG  . LEU C  1 184 ? 45.427  22.514  0.805   1.00 21.91  ? 215  LEU C CG  1 
ATOM   8118  C  CD1 . LEU C  1 184 ? 45.753  22.875  2.235   1.00 20.23  ? 215  LEU C CD1 1 
ATOM   8119  C  CD2 . LEU C  1 184 ? 44.039  22.978  0.422   1.00 22.37  ? 215  LEU C CD2 1 
ATOM   8120  N  N   . GLY C  1 185 ? 49.940  23.704  -0.899  1.00 24.77  ? 216  GLY C N   1 
ATOM   8121  C  CA  . GLY C  1 185 ? 51.182  23.176  -1.363  1.00 26.90  ? 216  GLY C CA  1 
ATOM   8122  C  C   . GLY C  1 185 ? 51.328  23.090  -2.866  1.00 28.17  ? 216  GLY C C   1 
ATOM   8123  O  O   . GLY C  1 185 ? 52.443  23.075  -3.378  1.00 27.90  ? 216  GLY C O   1 
ATOM   8124  N  N   . GLU C  1 186 ? 50.229  23.029  -3.602  1.00 29.68  ? 217  GLU C N   1 
ATOM   8125  C  CA  . GLU C  1 186 ? 50.278  22.921  -5.050  1.00 32.06  ? 217  GLU C CA  1 
ATOM   8126  C  C   . GLU C  1 186 ? 49.714  24.131  -5.788  1.00 33.62  ? 217  GLU C C   1 
ATOM   8127  O  O   . GLU C  1 186 ? 49.037  23.990  -6.806  1.00 33.36  ? 217  GLU C O   1 
ATOM   8128  C  CB  . GLU C  1 186 ? 49.479  21.689  -5.509  1.00 32.37  ? 217  GLU C CB  1 
ATOM   8129  C  CG  . GLU C  1 186 ? 49.691  20.456  -4.646  1.00 33.15  ? 217  GLU C CG  1 
ATOM   8130  C  CD  . GLU C  1 186 ? 49.488  19.165  -5.413  1.00 33.52  ? 217  GLU C CD  1 
ATOM   8131  O  OE1 . GLU C  1 186 ? 48.341  18.894  -5.826  1.00 35.27  ? 217  GLU C OE1 1 
ATOM   8132  O  OE2 . GLU C  1 186 ? 50.476  18.425  -5.603  1.00 33.07  ? 217  GLU C OE2 1 
ATOM   8133  N  N   . GLY C  1 187 ? 49.975  25.334  -5.308  1.00 35.30  ? 218  GLY C N   1 
ATOM   8134  C  CA  . GLY C  1 187 ? 49.484  26.518  -5.989  1.00 35.54  ? 218  GLY C CA  1 
ATOM   8135  C  C   . GLY C  1 187 ? 48.143  26.986  -5.429  1.00 35.29  ? 218  GLY C C   1 
ATOM   8136  O  O   . GLY C  1 187 ? 47.541  26.313  -4.592  1.00 34.59  ? 218  GLY C O   1 
ATOM   8137  N  N   . GLN C  1 188 ? 47.698  28.138  -5.924  1.00 33.93  ? 219  GLN C N   1 
ATOM   8138  C  CA  . GLN C  1 188 ? 46.466  28.775  -5.467  1.00 32.64  ? 219  GLN C CA  1 
ATOM   8139  C  C   . GLN C  1 188 ? 45.268  27.847  -5.428  1.00 33.57  ? 219  GLN C C   1 
ATOM   8140  O  O   . GLN C  1 188 ? 45.010  27.044  -6.322  1.00 34.65  ? 219  GLN C O   1 
ATOM   8141  C  CB  . GLN C  1 188 ? 46.113  29.985  -6.328  1.00 32.21  ? 219  GLN C CB  1 
ATOM   8142  C  CG  . GLN C  1 188 ? 44.940  30.783  -5.786  1.00 36.15  ? 219  GLN C CG  1 
ATOM   8143  C  CD  . GLN C  1 188 ? 44.695  32.067  -6.550  1.00 38.42  ? 219  GLN C CD  1 
ATOM   8144  O  OE1 . GLN C  1 188 ? 45.425  32.394  -7.483  1.00 42.27  ? 219  GLN C OE1 1 
ATOM   8145  N  NE2 . GLN C  1 188 ? 43.723  32.942  -6.322  1.00 36.75  ? 219  GLN C NE2 1 
ATOM   8146  N  N   . VAL C  1 189 ? 44.505  28.039  -4.350  1.00 32.27  ? 220  VAL C N   1 
ATOM   8147  C  CA  . VAL C  1 189 ? 43.286  27.355  -4.034  1.00 29.02  ? 220  VAL C CA  1 
ATOM   8148  C  C   . VAL C  1 189 ? 42.119  28.339  -3.964  1.00 30.34  ? 220  VAL C C   1 
ATOM   8149  O  O   . VAL C  1 189 ? 42.301  29.438  -3.460  1.00 33.32  ? 220  VAL C O   1 
ATOM   8150  C  CB  . VAL C  1 189 ? 43.354  26.585  -2.702  1.00 25.64  ? 220  VAL C CB  1 
ATOM   8151  C  CG1 . VAL C  1 189 ? 42.217  25.578  -2.620  1.00 26.38  ? 220  VAL C CG1 1 
ATOM   8152  C  CG2 . VAL C  1 189 ? 44.660  25.825  -2.626  1.00 26.69  ? 220  VAL C CG2 1 
ATOM   8153  N  N   . VAL C  1 190 ? 40.963  27.970  -4.482  1.00 29.24  ? 221  VAL C N   1 
ATOM   8154  C  CA  . VAL C  1 190 ? 39.792  28.798  -4.564  1.00 26.71  ? 221  VAL C CA  1 
ATOM   8155  C  C   . VAL C  1 190 ? 38.525  27.970  -4.412  1.00 28.44  ? 221  VAL C C   1 
ATOM   8156  O  O   . VAL C  1 190 ? 38.128  27.339  -5.409  1.00 30.53  ? 221  VAL C O   1 
ATOM   8157  C  CB  . VAL C  1 190 ? 39.750  29.579  -5.896  1.00 23.14  ? 221  VAL C CB  1 
ATOM   8158  C  CG1 . VAL C  1 190 ? 38.402  30.286  -6.028  1.00 23.55  ? 221  VAL C CG1 1 
ATOM   8159  C  CG2 . VAL C  1 190 ? 40.822  30.645  -5.944  1.00 25.18  ? 221  VAL C CG2 1 
ATOM   8160  N  N   . ARG C  1 191 ? 37.931  27.860  -3.231  1.00 29.27  ? 222  ARG C N   1 
ATOM   8161  C  CA  . ARG C  1 191 ? 36.731  26.974  -3.166  1.00 30.41  ? 222  ARG C CA  1 
ATOM   8162  C  C   . ARG C  1 191 ? 35.541  27.731  -3.732  1.00 30.85  ? 222  ARG C C   1 
ATOM   8163  O  O   . ARG C  1 191 ? 35.240  28.839  -3.271  1.00 31.61  ? 222  ARG C O   1 
ATOM   8164  C  CB  . ARG C  1 191 ? 36.502  26.613  -1.709  1.00 30.89  ? 222  ARG C CB  1 
ATOM   8165  C  CG  . ARG C  1 191 ? 35.614  25.436  -1.420  1.00 30.73  ? 222  ARG C CG  1 
ATOM   8166  C  CD  . ARG C  1 191 ? 35.293  25.297  0.065   1.00 30.43  ? 222  ARG C CD  1 
ATOM   8167  N  NE  . ARG C  1 191 ? 34.360  24.186  0.293   1.00 32.46  ? 222  ARG C NE  1 
ATOM   8168  C  CZ  . ARG C  1 191 ? 33.924  23.819  1.484   1.00 32.05  ? 222  ARG C CZ  1 
ATOM   8169  N  NH1 . ARG C  1 191 ? 34.336  24.473  2.562   1.00 29.62  ? 222  ARG C NH1 1 
ATOM   8170  N  NH2 . ARG C  1 191 ? 33.085  22.806  1.630   1.00 31.36  ? 222  ARG C NH2 1 
ATOM   8171  N  N   . VAL C  1 192 ? 34.897  27.172  -4.751  1.00 29.73  ? 223  VAL C N   1 
ATOM   8172  C  CA  . VAL C  1 192 ? 33.833  27.860  -5.460  1.00 29.47  ? 223  VAL C CA  1 
ATOM   8173  C  C   . VAL C  1 192 ? 32.484  27.782  -4.772  1.00 31.45  ? 223  VAL C C   1 
ATOM   8174  O  O   . VAL C  1 192 ? 32.222  26.860  -4.005  1.00 31.18  ? 223  VAL C O   1 
ATOM   8175  C  CB  . VAL C  1 192 ? 33.695  27.345  -6.902  1.00 27.52  ? 223  VAL C CB  1 
ATOM   8176  C  CG1 . VAL C  1 192 ? 35.073  27.237  -7.528  1.00 23.54  ? 223  VAL C CG1 1 
ATOM   8177  C  CG2 . VAL C  1 192 ? 32.989  26.009  -6.910  1.00 27.55  ? 223  VAL C CG2 1 
ATOM   8178  N  N   . LYS C  1 193 ? 31.638  28.770  -5.065  1.00 32.43  ? 224  LYS C N   1 
ATOM   8179  C  CA  . LYS C  1 193 ? 30.302  28.847  -4.494  1.00 31.43  ? 224  LYS C CA  1 
ATOM   8180  C  C   . LYS C  1 193 ? 29.251  28.791  -5.593  1.00 32.43  ? 224  LYS C C   1 
ATOM   8181  O  O   . LYS C  1 193 ? 29.473  29.269  -6.702  1.00 32.61  ? 224  LYS C O   1 
ATOM   8182  C  CB  . LYS C  1 193 ? 30.130  30.155  -3.712  1.00 30.31  ? 224  LYS C CB  1 
ATOM   8183  C  CG  . LYS C  1 193 ? 30.753  30.128  -2.325  1.00 28.93  ? 224  LYS C CG  1 
ATOM   8184  C  CD  . LYS C  1 193 ? 30.091  29.072  -1.454  1.00 28.87  ? 224  LYS C CD  1 
ATOM   8185  C  CE  . LYS C  1 193 ? 29.876  29.602  -0.045  1.00 28.59  ? 224  LYS C CE  1 
ATOM   8186  N  NZ  . LYS C  1 193 ? 29.365  28.563  0.884   1.00 30.50  ? 224  LYS C NZ  1 
ATOM   8187  N  N   . TYR C  1 194 ? 28.090  28.264  -5.255  1.00 33.83  ? 225  TYR C N   1 
ATOM   8188  C  CA  . TYR C  1 194 ? 26.974  28.183  -6.175  1.00 33.83  ? 225  TYR C CA  1 
ATOM   8189  C  C   . TYR C  1 194 ? 27.341  27.450  -7.437  1.00 33.90  ? 225  TYR C C   1 
ATOM   8190  O  O   . TYR C  1 194 ? 28.021  26.418  -7.373  1.00 32.89  ? 225  TYR C O   1 
ATOM   8191  C  CB  . TYR C  1 194 ? 26.432  29.593  -6.453  1.00 34.82  ? 225  TYR C CB  1 
ATOM   8192  C  CG  . TYR C  1 194 ? 26.169  30.292  -5.119  1.00 36.65  ? 225  TYR C CG  1 
ATOM   8193  C  CD1 . TYR C  1 194 ? 25.323  29.719  -4.184  1.00 37.89  ? 225  TYR C CD1 1 
ATOM   8194  C  CD2 . TYR C  1 194 ? 26.796  31.480  -4.789  1.00 37.17  ? 225  TYR C CD2 1 
ATOM   8195  C  CE1 . TYR C  1 194 ? 25.085  30.317  -2.962  1.00 39.29  ? 225  TYR C CE1 1 
ATOM   8196  C  CE2 . TYR C  1 194 ? 26.569  32.095  -3.569  1.00 39.69  ? 225  TYR C CE2 1 
ATOM   8197  C  CZ  . TYR C  1 194 ? 25.714  31.504  -2.663  1.00 40.87  ? 225  TYR C CZ  1 
ATOM   8198  O  OH  . TYR C  1 194 ? 25.490  32.115  -1.450  1.00 44.60  ? 225  TYR C OH  1 
ATOM   8199  N  N   . GLY C  1 195 ? 26.860  27.925  -8.579  1.00 34.04  ? 226  GLY C N   1 
ATOM   8200  C  CA  . GLY C  1 195 ? 27.116  27.163  -9.821  1.00 34.95  ? 226  GLY C CA  1 
ATOM   8201  C  C   . GLY C  1 195 ? 26.535  25.753  -9.604  1.00 35.76  ? 226  GLY C C   1 
ATOM   8202  O  O   . GLY C  1 195 ? 25.649  25.561  -8.769  1.00 34.86  ? 226  GLY C O   1 
ATOM   8203  N  N   . ASN C  1 196 ? 27.078  24.771  -10.306 1.00 35.92  ? 227  ASN C N   1 
ATOM   8204  C  CA  . ASN C  1 196 ? 26.626  23.395  -10.159 1.00 35.07  ? 227  ASN C CA  1 
ATOM   8205  C  C   . ASN C  1 196 ? 27.663  22.549  -9.425  1.00 36.12  ? 227  ASN C C   1 
ATOM   8206  O  O   . ASN C  1 196 ? 27.529  21.328  -9.403  1.00 35.25  ? 227  ASN C O   1 
ATOM   8207  C  CB  . ASN C  1 196 ? 26.342  22.766  -11.524 1.00 33.33  ? 227  ASN C CB  1 
ATOM   8208  C  CG  . ASN C  1 196 ? 27.551  22.763  -12.433 1.00 33.09  ? 227  ASN C CG  1 
ATOM   8209  O  OD1 . ASN C  1 196 ? 28.683  22.617  -11.964 1.00 35.11  ? 227  ASN C OD1 1 
ATOM   8210  N  ND2 . ASN C  1 196 ? 27.345  22.932  -13.734 1.00 30.95  ? 227  ASN C ND2 1 
ATOM   8211  N  N   . ALA C  1 197 ? 28.613  23.183  -8.745  1.00 37.06  ? 228  ALA C N   1 
ATOM   8212  C  CA  . ALA C  1 197 ? 29.653  22.455  -8.017  1.00 35.94  ? 228  ALA C CA  1 
ATOM   8213  C  C   . ALA C  1 197 ? 30.004  23.097  -6.681  1.00 35.94  ? 228  ALA C C   1 
ATOM   8214  O  O   . ALA C  1 197 ? 31.021  22.803  -6.033  1.00 34.55  ? 228  ALA C O   1 
ATOM   8215  C  CB  . ALA C  1 197 ? 30.882  22.337  -8.912  1.00 35.04  ? 228  ALA C CB  1 
ATOM   8216  N  N   . ASP C  1 198 ? 29.114  23.961  -6.194  1.00 35.09  ? 229  ASP C N   1 
ATOM   8217  C  CA  . ASP C  1 198 ? 29.323  24.640  -4.924  1.00 35.11  ? 229  ASP C CA  1 
ATOM   8218  C  C   . ASP C  1 198 ? 29.866  23.705  -3.854  1.00 35.75  ? 229  ASP C C   1 
ATOM   8219  O  O   . ASP C  1 198 ? 29.246  22.689  -3.532  1.00 37.41  ? 229  ASP C O   1 
ATOM   8220  C  CB  . ASP C  1 198 ? 28.087  25.418  -4.535  1.00 32.53  ? 229  ASP C CB  1 
ATOM   8221  C  CG  . ASP C  1 198 ? 28.153  25.985  -3.131  1.00 32.36  ? 229  ASP C CG  1 
ATOM   8222  O  OD1 . ASP C  1 198 ? 28.213  25.190  -2.170  1.00 28.23  ? 229  ASP C OD1 1 
ATOM   8223  O  OD2 . ASP C  1 198 ? 28.140  27.227  -2.991  1.00 36.41  ? 229  ASP C OD2 1 
ATOM   8224  N  N   . GLY C  1 199 ? 31.037  24.103  -3.344  1.00 36.21  ? 230  GLY C N   1 
ATOM   8225  C  CA  . GLY C  1 199 ? 31.761  23.364  -2.330  1.00 36.82  ? 230  GLY C CA  1 
ATOM   8226  C  C   . GLY C  1 199 ? 33.065  22.798  -2.901  1.00 37.43  ? 230  GLY C C   1 
ATOM   8227  O  O   . GLY C  1 199 ? 33.934  22.343  -2.157  1.00 36.19  ? 230  GLY C O   1 
ATOM   8228  N  N   . GLU C  1 200 ? 33.190  22.847  -4.229  1.00 38.46  ? 231  GLU C N   1 
ATOM   8229  C  CA  . GLU C  1 200 ? 34.349  22.289  -4.931  1.00 38.52  ? 231  GLU C CA  1 
ATOM   8230  C  C   . GLU C  1 200 ? 35.497  23.271  -5.066  1.00 38.33  ? 231  GLU C C   1 
ATOM   8231  O  O   . GLU C  1 200 ? 35.284  24.475  -5.187  1.00 39.46  ? 231  GLU C O   1 
ATOM   8232  C  CB  . GLU C  1 200 ? 33.936  21.796  -6.317  1.00 39.44  ? 231  GLU C CB  1 
ATOM   8233  C  CG  . GLU C  1 200 ? 32.985  20.614  -6.288  1.00 39.89  ? 231  GLU C CG  1 
ATOM   8234  C  CD  . GLU C  1 200 ? 33.576  19.424  -5.563  1.00 40.05  ? 231  GLU C CD  1 
ATOM   8235  O  OE1 . GLU C  1 200 ? 34.633  18.928  -6.006  1.00 41.58  ? 231  GLU C OE1 1 
ATOM   8236  O  OE2 . GLU C  1 200 ? 32.985  18.988  -4.553  1.00 36.65  ? 231  GLU C OE2 1 
ATOM   8237  N  N   . TYR C  1 201 ? 36.721  22.763  -5.100  1.00 36.67  ? 232  TYR C N   1 
ATOM   8238  C  CA  . TYR C  1 201 ? 37.889  23.615  -5.289  1.00 35.83  ? 232  TYR C CA  1 
ATOM   8239  C  C   . TYR C  1 201 ? 38.068  23.902  -6.781  1.00 36.16  ? 232  TYR C C   1 
ATOM   8240  O  O   . TYR C  1 201 ? 37.729  23.060  -7.599  1.00 35.59  ? 232  TYR C O   1 
ATOM   8241  C  CB  . TYR C  1 201 ? 39.139  22.945  -4.760  1.00 35.19  ? 232  TYR C CB  1 
ATOM   8242  C  CG  . TYR C  1 201 ? 39.335  22.888  -3.272  1.00 34.39  ? 232  TYR C CG  1 
ATOM   8243  C  CD1 . TYR C  1 201 ? 38.507  23.535  -2.377  1.00 33.47  ? 232  TYR C CD1 1 
ATOM   8244  C  CD2 . TYR C  1 201 ? 40.402  22.166  -2.742  1.00 35.93  ? 232  TYR C CD2 1 
ATOM   8245  C  CE1 . TYR C  1 201 ? 38.717  23.458  -1.016  1.00 33.67  ? 232  TYR C CE1 1 
ATOM   8246  C  CE2 . TYR C  1 201 ? 40.623  22.087  -1.386  1.00 34.64  ? 232  TYR C CE2 1 
ATOM   8247  C  CZ  . TYR C  1 201 ? 39.773  22.736  -0.521  1.00 34.03  ? 232  TYR C CZ  1 
ATOM   8248  O  OH  . TYR C  1 201 ? 40.028  22.636  0.825   1.00 34.65  ? 232  TYR C OH  1 
ATOM   8249  N  N   . CYS C  1 202 ? 38.604  25.068  -7.118  1.00 37.84  ? 233  CYS C N   1 
ATOM   8250  C  CA  . CYS C  1 202 ? 38.857  25.378  -8.536  1.00 39.21  ? 233  CYS C CA  1 
ATOM   8251  C  C   . CYS C  1 202 ? 39.970  24.423  -8.998  1.00 40.50  ? 233  CYS C C   1 
ATOM   8252  O  O   . CYS C  1 202 ? 40.878  24.150  -8.204  1.00 40.31  ? 233  CYS C O   1 
ATOM   8253  C  CB  . CYS C  1 202 ? 39.338  26.815  -8.674  1.00 38.65  ? 233  CYS C CB  1 
ATOM   8254  S  SG  . CYS C  1 202 ? 38.150  28.152  -8.488  1.00 39.34  ? 233  CYS C SG  1 
ATOM   8255  N  N   . LYS C  1 203 ? 39.882  23.891  -10.210 1.00 41.06  ? 234  LYS C N   1 
ATOM   8256  C  CA  . LYS C  1 203 ? 40.956  23.013  -10.680 1.00 42.57  ? 234  LYS C CA  1 
ATOM   8257  C  C   . LYS C  1 203 ? 41.891  23.781  -11.605 1.00 43.09  ? 234  LYS C C   1 
ATOM   8258  O  O   . LYS C  1 203 ? 41.538  24.058  -12.751 1.00 43.80  ? 234  LYS C O   1 
ATOM   8259  C  CB  . LYS C  1 203 ? 40.419  21.773  -11.383 1.00 44.89  ? 234  LYS C CB  1 
ATOM   8260  C  CG  . LYS C  1 203 ? 41.476  21.062  -12.220 1.00 47.00  ? 234  LYS C CG  1 
ATOM   8261  C  CD  . LYS C  1 203 ? 41.562  19.582  -11.898 1.00 49.36  ? 234  LYS C CD  1 
ATOM   8262  C  CE  . LYS C  1 203 ? 42.161  19.303  -10.533 1.00 49.71  ? 234  LYS C CE  1 
ATOM   8263  N  NZ  . LYS C  1 203 ? 41.183  18.676  -9.597  1.00 50.80  ? 234  LYS C NZ  1 
ATOM   8264  N  N   . PHE C  1 204 ? 43.075  24.136  -11.117 1.00 43.33  ? 235  PHE C N   1 
ATOM   8265  C  CA  . PHE C  1 204 ? 44.021  24.878  -11.944 1.00 43.59  ? 235  PHE C CA  1 
ATOM   8266  C  C   . PHE C  1 204 ? 45.180  23.984  -12.374 1.00 43.85  ? 235  PHE C C   1 
ATOM   8267  O  O   . PHE C  1 204 ? 45.843  23.360  -11.545 1.00 44.21  ? 235  PHE C O   1 
ATOM   8268  C  CB  . PHE C  1 204 ? 44.559  26.091  -11.182 1.00 44.79  ? 235  PHE C CB  1 
ATOM   8269  C  CG  . PHE C  1 204 ? 43.497  27.041  -10.709 1.00 43.85  ? 235  PHE C CG  1 
ATOM   8270  C  CD1 . PHE C  1 204 ? 42.571  27.545  -11.603 1.00 43.67  ? 235  PHE C CD1 1 
ATOM   8271  C  CD2 . PHE C  1 204 ? 43.414  27.423  -9.382  1.00 43.03  ? 235  PHE C CD2 1 
ATOM   8272  C  CE1 . PHE C  1 204 ? 41.581  28.407  -11.171 1.00 43.19  ? 235  PHE C CE1 1 
ATOM   8273  C  CE2 . PHE C  1 204 ? 42.435  28.288  -8.948  1.00 41.87  ? 235  PHE C CE2 1 
ATOM   8274  C  CZ  . PHE C  1 204 ? 41.513  28.784  -9.848  1.00 42.64  ? 235  PHE C CZ  1 
ATOM   8275  N  N   . PRO C  1 205 ? 45.425  23.939  -13.671 1.00 43.55  ? 236  PRO C N   1 
ATOM   8276  C  CA  . PRO C  1 205 ? 44.646  24.688  -14.643 1.00 45.01  ? 236  PRO C CA  1 
ATOM   8277  C  C   . PRO C  1 205 ? 43.399  23.929  -15.070 1.00 47.42  ? 236  PRO C C   1 
ATOM   8278  O  O   . PRO C  1 205 ? 43.195  22.766  -14.744 1.00 48.11  ? 236  PRO C O   1 
ATOM   8279  C  CB  . PRO C  1 205 ? 45.598  24.714  -15.855 1.00 43.44  ? 236  PRO C CB  1 
ATOM   8280  C  CG  . PRO C  1 205 ? 46.175  23.331  -15.792 1.00 42.43  ? 236  PRO C CG  1 
ATOM   8281  C  CD  . PRO C  1 205 ? 46.464  23.109  -14.325 1.00 41.86  ? 236  PRO C CD  1 
ATOM   8282  N  N   . PHE C  1 206 ? 42.513  24.633  -15.756 1.00 49.22  ? 237  PHE C N   1 
ATOM   8283  C  CA  . PHE C  1 206 ? 41.310  24.005  -16.300 1.00 51.10  ? 237  PHE C CA  1 
ATOM   8284  C  C   . PHE C  1 206 ? 41.209  24.493  -17.748 1.00 53.36  ? 237  PHE C C   1 
ATOM   8285  O  O   . PHE C  1 206 ? 41.739  25.564  -18.046 1.00 51.34  ? 237  PHE C O   1 
ATOM   8286  C  CB  . PHE C  1 206 ? 40.075  24.361  -15.510 1.00 50.81  ? 237  PHE C CB  1 
ATOM   8287  C  CG  . PHE C  1 206 ? 39.627  25.789  -15.618 1.00 51.51  ? 237  PHE C CG  1 
ATOM   8288  C  CD1 . PHE C  1 206 ? 40.249  26.789  -14.895 1.00 51.24  ? 237  PHE C CD1 1 
ATOM   8289  C  CD2 . PHE C  1 206 ? 38.571  26.136  -16.444 1.00 51.31  ? 237  PHE C CD2 1 
ATOM   8290  C  CE1 . PHE C  1 206 ? 39.826  28.102  -14.993 1.00 49.44  ? 237  PHE C CE1 1 
ATOM   8291  C  CE2 . PHE C  1 206 ? 38.143  27.439  -16.549 1.00 49.88  ? 237  PHE C CE2 1 
ATOM   8292  C  CZ  . PHE C  1 206 ? 38.778  28.425  -15.824 1.00 48.82  ? 237  PHE C CZ  1 
ATOM   8293  N  N   . LEU C  1 207 ? 40.642  23.662  -18.606 1.00 57.38  ? 238  LEU C N   1 
ATOM   8294  C  CA  . LEU C  1 207 ? 40.578  24.004  -20.024 1.00 62.18  ? 238  LEU C CA  1 
ATOM   8295  C  C   . LEU C  1 207 ? 39.187  24.463  -20.432 1.00 64.26  ? 238  LEU C C   1 
ATOM   8296  O  O   . LEU C  1 207 ? 38.218  23.724  -20.270 1.00 64.63  ? 238  LEU C O   1 
ATOM   8297  C  CB  . LEU C  1 207 ? 40.993  22.811  -20.887 1.00 63.25  ? 238  LEU C CB  1 
ATOM   8298  C  CG  . LEU C  1 207 ? 41.207  23.093  -22.375 1.00 63.60  ? 238  LEU C CG  1 
ATOM   8299  C  CD1 . LEU C  1 207 ? 42.635  23.565  -22.617 1.00 62.66  ? 238  LEU C CD1 1 
ATOM   8300  C  CD2 . LEU C  1 207 ? 40.918  21.843  -23.194 1.00 63.65  ? 238  LEU C CD2 1 
ATOM   8301  N  N   . PHE C  1 208 ? 39.113  25.670  -20.983 1.00 67.18  ? 239  PHE C N   1 
ATOM   8302  C  CA  . PHE C  1 208 ? 37.845  26.220  -21.441 1.00 69.59  ? 239  PHE C CA  1 
ATOM   8303  C  C   . PHE C  1 208 ? 38.017  27.000  -22.742 1.00 70.22  ? 239  PHE C C   1 
ATOM   8304  O  O   . PHE C  1 208 ? 38.868  27.881  -22.853 1.00 69.01  ? 239  PHE C O   1 
ATOM   8305  C  CB  . PHE C  1 208 ? 37.192  27.090  -20.360 1.00 70.49  ? 239  PHE C CB  1 
ATOM   8306  C  CG  . PHE C  1 208 ? 35.986  27.833  -20.873 1.00 71.27  ? 239  PHE C CG  1 
ATOM   8307  C  CD1 . PHE C  1 208 ? 34.870  27.120  -21.274 1.00 70.74  ? 239  PHE C CD1 1 
ATOM   8308  C  CD2 . PHE C  1 208 ? 35.974  29.211  -20.976 1.00 71.41  ? 239  PHE C CD2 1 
ATOM   8309  C  CE1 . PHE C  1 208 ? 33.753  27.762  -21.765 1.00 69.99  ? 239  PHE C CE1 1 
ATOM   8310  C  CE2 . PHE C  1 208 ? 34.853  29.859  -21.467 1.00 70.93  ? 239  PHE C CE2 1 
ATOM   8311  C  CZ  . PHE C  1 208 ? 33.748  29.138  -21.861 1.00 69.85  ? 239  PHE C CZ  1 
ATOM   8312  N  N   . ASN C  1 209 ? 37.210  26.625  -23.732 1.00 70.85  ? 240  ASN C N   1 
ATOM   8313  C  CA  . ASN C  1 209 ? 37.258  27.256  -25.046 1.00 71.73  ? 240  ASN C CA  1 
ATOM   8314  C  C   . ASN C  1 209 ? 38.604  26.982  -25.709 1.00 72.17  ? 240  ASN C C   1 
ATOM   8315  O  O   . ASN C  1 209 ? 39.166  27.822  -26.407 1.00 71.96  ? 240  ASN C O   1 
ATOM   8316  C  CB  . ASN C  1 209 ? 37.024  28.758  -24.908 1.00 72.72  ? 240  ASN C CB  1 
ATOM   8317  C  CG  . ASN C  1 209 ? 36.403  29.376  -26.144 1.00 73.23  ? 240  ASN C CG  1 
ATOM   8318  O  OD1 . ASN C  1 209 ? 36.955  29.273  -27.240 1.00 74.42  ? 240  ASN C OD1 1 
ATOM   8319  N  ND2 . ASN C  1 209 ? 35.257  30.023  -25.966 1.00 72.14  ? 240  ASN C ND2 1 
ATOM   8320  N  N   . GLY C  1 210 ? 39.104  25.763  -25.489 1.00 71.77  ? 241  GLY C N   1 
ATOM   8321  C  CA  . GLY C  1 210 ? 40.408  25.398  -26.047 1.00 71.36  ? 241  GLY C CA  1 
ATOM   8322  C  C   . GLY C  1 210 ? 41.438  26.413  -25.543 1.00 71.85  ? 241  GLY C C   1 
ATOM   8323  O  O   . GLY C  1 210 ? 41.990  27.199  -26.306 1.00 72.60  ? 241  GLY C O   1 
ATOM   8324  N  N   . LYS C  1 211 ? 41.616  26.425  -24.225 1.00 71.67  ? 242  LYS C N   1 
ATOM   8325  C  CA  . LYS C  1 211 ? 42.539  27.374  -23.607 1.00 70.58  ? 242  LYS C CA  1 
ATOM   8326  C  C   . LYS C  1 211 ? 42.811  26.983  -22.161 1.00 69.50  ? 242  LYS C C   1 
ATOM   8327  O  O   . LYS C  1 211 ? 41.976  26.355  -21.507 1.00 68.32  ? 242  LYS C O   1 
ATOM   8328  C  CB  . LYS C  1 211 ? 41.931  28.781  -23.648 1.00 70.96  ? 242  LYS C CB  1 
ATOM   8329  C  CG  . LYS C  1 211 ? 42.942  29.907  -23.602 1.00 71.97  ? 242  LYS C CG  1 
ATOM   8330  C  CD  . LYS C  1 211 ? 43.276  30.306  -22.179 1.00 73.50  ? 242  LYS C CD  1 
ATOM   8331  C  CE  . LYS C  1 211 ? 43.165  31.793  -21.942 1.00 74.44  ? 242  LYS C CE  1 
ATOM   8332  N  NZ  . LYS C  1 211 ? 43.491  32.601  -23.140 1.00 75.16  ? 242  LYS C NZ  1 
ATOM   8333  N  N   . GLU C  1 212 ? 43.985  27.360  -21.660 1.00 67.60  ? 243  GLU C N   1 
ATOM   8334  C  CA  . GLU C  1 212 ? 44.281  27.037  -20.261 1.00 65.25  ? 243  GLU C CA  1 
ATOM   8335  C  C   . GLU C  1 212 ? 43.986  28.192  -19.324 1.00 62.84  ? 243  GLU C C   1 
ATOM   8336  O  O   . GLU C  1 212 ? 44.167  29.352  -19.687 1.00 62.67  ? 243  GLU C O   1 
ATOM   8337  C  CB  . GLU C  1 212 ? 45.753  26.616  -20.150 1.00 65.70  ? 243  GLU C CB  1 
ATOM   8338  C  CG  . GLU C  1 212 ? 46.039  25.314  -20.899 1.00 64.84  ? 243  GLU C CG  1 
ATOM   8339  C  CD  . GLU C  1 212 ? 46.752  24.294  -20.033 1.00 64.35  ? 243  GLU C CD  1 
ATOM   8340  O  OE1 . GLU C  1 212 ? 47.804  24.665  -19.465 1.00 64.07  ? 243  GLU C OE1 1 
ATOM   8341  O  OE2 . GLU C  1 212 ? 46.268  23.147  -19.930 1.00 62.09  ? 243  GLU C OE2 1 
ATOM   8342  N  N   . TYR C  1 213 ? 43.532  27.914  -18.108 1.00 59.93  ? 244  TYR C N   1 
ATOM   8343  C  CA  . TYR C  1 213 ? 43.239  28.944  -17.119 1.00 56.98  ? 244  TYR C CA  1 
ATOM   8344  C  C   . TYR C  1 213 ? 43.737  28.494  -15.745 1.00 54.40  ? 244  TYR C C   1 
ATOM   8345  O  O   . TYR C  1 213 ? 43.300  27.482  -15.198 1.00 53.68  ? 244  TYR C O   1 
ATOM   8346  C  CB  . TYR C  1 213 ? 41.749  29.270  -17.085 1.00 58.29  ? 244  TYR C CB  1 
ATOM   8347  C  CG  . TYR C  1 213 ? 41.223  30.008  -18.296 1.00 59.34  ? 244  TYR C CG  1 
ATOM   8348  C  CD1 . TYR C  1 213 ? 41.600  31.324  -18.534 1.00 59.85  ? 244  TYR C CD1 1 
ATOM   8349  C  CD2 . TYR C  1 213 ? 40.367  29.416  -19.209 1.00 60.63  ? 244  TYR C CD2 1 
ATOM   8350  C  CE1 . TYR C  1 213 ? 41.140  32.025  -19.627 1.00 59.85  ? 244  TYR C CE1 1 
ATOM   8351  C  CE2 . TYR C  1 213 ? 39.902  30.107  -20.316 1.00 61.10  ? 244  TYR C CE2 1 
ATOM   8352  C  CZ  . TYR C  1 213 ? 40.292  31.414  -20.524 1.00 60.71  ? 244  TYR C CZ  1 
ATOM   8353  O  OH  . TYR C  1 213 ? 39.836  32.105  -21.624 1.00 59.56  ? 244  TYR C OH  1 
ATOM   8354  N  N   . ASN C  1 214 ? 44.689  29.250  -15.206 1.00 51.76  ? 245  ASN C N   1 
ATOM   8355  C  CA  . ASN C  1 214 ? 45.307  28.932  -13.926 1.00 49.33  ? 245  ASN C CA  1 
ATOM   8356  C  C   . ASN C  1 214 ? 44.803  29.814  -12.795 1.00 47.76  ? 245  ASN C C   1 
ATOM   8357  O  O   . ASN C  1 214 ? 45.396  29.949  -11.731 1.00 46.46  ? 245  ASN C O   1 
ATOM   8358  C  CB  . ASN C  1 214 ? 46.824  29.039  -14.072 1.00 49.51  ? 245  ASN C CB  1 
ATOM   8359  C  CG  . ASN C  1 214 ? 47.400  27.857  -14.835 1.00 49.28  ? 245  ASN C CG  1 
ATOM   8360  O  OD1 . ASN C  1 214 ? 47.427  26.724  -14.357 1.00 49.12  ? 245  ASN C OD1 1 
ATOM   8361  N  ND2 . ASN C  1 214 ? 47.876  28.106  -16.048 1.00 48.97  ? 245  ASN C ND2 1 
ATOM   8362  N  N   . SER C  1 215 ? 43.668  30.439  -13.072 1.00 47.00  ? 246  SER C N   1 
ATOM   8363  C  CA  . SER C  1 215 ? 42.980  31.306  -12.129 1.00 44.36  ? 246  SER C CA  1 
ATOM   8364  C  C   . SER C  1 215 ? 41.551  31.517  -12.632 1.00 42.44  ? 246  SER C C   1 
ATOM   8365  O  O   . SER C  1 215 ? 41.242  31.095  -13.747 1.00 41.37  ? 246  SER C O   1 
ATOM   8366  C  CB  . SER C  1 215 ? 43.712  32.641  -12.040 1.00 43.52  ? 246  SER C CB  1 
ATOM   8367  O  OG  . SER C  1 215 ? 43.313  33.464  -13.122 1.00 42.69  ? 246  SER C OG  1 
ATOM   8368  N  N   . CYS C  1 216 ? 40.698  32.063  -11.784 1.00 40.62  ? 247  CYS C N   1 
ATOM   8369  C  CA  . CYS C  1 216 ? 39.331  32.336  -12.204 1.00 39.30  ? 247  CYS C CA  1 
ATOM   8370  C  C   . CYS C  1 216 ? 39.287  33.402  -13.291 1.00 41.34  ? 247  CYS C C   1 
ATOM   8371  O  O   . CYS C  1 216 ? 40.264  34.157  -13.439 1.00 39.90  ? 247  CYS C O   1 
ATOM   8372  C  CB  . CYS C  1 216 ? 38.480  32.765  -11.007 1.00 36.09  ? 247  CYS C CB  1 
ATOM   8373  S  SG  . CYS C  1 216 ? 38.242  31.479  -9.760  1.00 35.38  ? 247  CYS C SG  1 
ATOM   8374  N  N   . THR C  1 217 ? 38.226  33.414  -14.071 1.00 44.49  ? 248  THR C N   1 
ATOM   8375  C  CA  . THR C  1 217 ? 38.018  34.420  -15.082 1.00 47.92  ? 248  THR C CA  1 
ATOM   8376  C  C   . THR C  1 217 ? 36.537  34.797  -15.229 1.00 51.74  ? 248  THR C C   1 
ATOM   8377  O  O   . THR C  1 217 ? 35.640  33.988  -15.014 1.00 53.09  ? 248  THR C O   1 
ATOM   8378  C  CB  . THR C  1 217 ? 38.493  34.030  -16.488 1.00 46.31  ? 248  THR C CB  1 
ATOM   8379  O  OG1 . THR C  1 217 ? 37.921  32.781  -16.875 1.00 43.23  ? 248  THR C OG1 1 
ATOM   8380  C  CG2 . THR C  1 217 ? 39.988  34.082  -16.616 1.00 48.06  ? 248  THR C CG2 1 
ATOM   8381  N  N   . ASP C  1 218 ? 36.353  36.022  -15.717 1.00 53.15  ? 249  ASP C N   1 
ATOM   8382  C  CA  . ASP C  1 218 ? 35.027  36.532  -16.035 1.00 54.81  ? 249  ASP C CA  1 
ATOM   8383  C  C   . ASP C  1 218 ? 34.751  36.241  -17.514 1.00 55.10  ? 249  ASP C C   1 
ATOM   8384  O  O   . ASP C  1 218 ? 33.752  36.704  -18.050 1.00 56.19  ? 249  ASP C O   1 
ATOM   8385  C  CB  . ASP C  1 218 ? 34.991  38.044  -15.790 1.00 55.87  ? 249  ASP C CB  1 
ATOM   8386  C  CG  . ASP C  1 218 ? 36.136  38.746  -16.502 1.00 56.91  ? 249  ASP C CG  1 
ATOM   8387  O  OD1 . ASP C  1 218 ? 36.338  38.469  -17.703 1.00 56.73  ? 249  ASP C OD1 1 
ATOM   8388  O  OD2 . ASP C  1 218 ? 36.820  39.567  -15.856 1.00 58.76  ? 249  ASP C OD2 1 
ATOM   8389  N  N   . THR C  1 219 ? 35.672  35.530  -18.144 1.00 55.39  ? 250  THR C N   1 
ATOM   8390  C  CA  . THR C  1 219 ? 35.583  35.194  -19.549 1.00 56.50  ? 250  THR C CA  1 
ATOM   8391  C  C   . THR C  1 219 ? 34.397  34.286  -19.845 1.00 56.69  ? 250  THR C C   1 
ATOM   8392  O  O   . THR C  1 219 ? 34.098  33.374  -19.083 1.00 55.38  ? 250  THR C O   1 
ATOM   8393  C  CB  . THR C  1 219 ? 36.845  34.502  -20.084 1.00 58.07  ? 250  THR C CB  1 
ATOM   8394  O  OG1 . THR C  1 219 ? 37.770  35.514  -20.520 1.00 58.22  ? 250  THR C OG1 1 
ATOM   8395  C  CG2 . THR C  1 219 ? 36.513  33.591  -21.256 1.00 57.81  ? 250  THR C CG2 1 
ATOM   8396  N  N   . GLY C  1 220 ? 33.740  34.564  -20.974 1.00 56.66  ? 251  GLY C N   1 
ATOM   8397  C  CA  . GLY C  1 220 ? 32.562  33.789  -21.355 1.00 55.87  ? 251  GLY C CA  1 
ATOM   8398  C  C   . GLY C  1 220 ? 31.392  34.157  -20.440 1.00 56.02  ? 251  GLY C C   1 
ATOM   8399  O  O   . GLY C  1 220 ? 30.351  33.501  -20.469 1.00 56.36  ? 251  GLY C O   1 
ATOM   8400  N  N   . ARG C  1 221 ? 31.570  35.212  -19.668 1.00 55.32  ? 252  ARG C N   1 
ATOM   8401  C  CA  . ARG C  1 221 ? 30.576  35.730  -18.741 1.00 54.09  ? 252  ARG C CA  1 
ATOM   8402  C  C   . ARG C  1 221 ? 30.325  37.205  -19.065 1.00 53.98  ? 252  ARG C C   1 
ATOM   8403  O  O   . ARG C  1 221 ? 31.251  37.919  -19.451 1.00 53.76  ? 252  ARG C O   1 
ATOM   8404  C  CB  . ARG C  1 221 ? 31.111  35.628  -17.313 1.00 54.07  ? 252  ARG C CB  1 
ATOM   8405  C  CG  . ARG C  1 221 ? 30.100  35.174  -16.286 1.00 52.58  ? 252  ARG C CG  1 
ATOM   8406  C  CD  . ARG C  1 221 ? 29.690  33.734  -16.522 1.00 51.74  ? 252  ARG C CD  1 
ATOM   8407  N  NE  . ARG C  1 221 ? 28.785  33.243  -15.495 1.00 53.18  ? 252  ARG C NE  1 
ATOM   8408  C  CZ  . ARG C  1 221 ? 27.687  33.861  -15.088 1.00 52.75  ? 252  ARG C CZ  1 
ATOM   8409  N  NH1 . ARG C  1 221 ? 27.341  35.022  -15.620 1.00 54.29  ? 252  ARG C NH1 1 
ATOM   8410  N  NH2 . ARG C  1 221 ? 26.900  33.350  -14.153 1.00 52.76  ? 252  ARG C NH2 1 
ATOM   8411  N  N   . SER C  1 222 ? 29.093  37.662  -18.903 1.00 53.72  ? 253  SER C N   1 
ATOM   8412  C  CA  . SER C  1 222 ? 28.768  39.048  -19.220 1.00 53.49  ? 253  SER C CA  1 
ATOM   8413  C  C   . SER C  1 222 ? 28.647  39.935  -17.993 1.00 52.20  ? 253  SER C C   1 
ATOM   8414  O  O   . SER C  1 222 ? 28.872  41.146  -18.059 1.00 52.51  ? 253  SER C O   1 
ATOM   8415  C  CB  . SER C  1 222 ? 27.471  39.109  -20.033 1.00 54.71  ? 253  SER C CB  1 
ATOM   8416  O  OG  . SER C  1 222 ? 27.621  38.403  -21.253 1.00 56.76  ? 253  SER C OG  1 
ATOM   8417  N  N   . ASP C  1 223 ? 28.279  39.352  -16.860 1.00 50.04  ? 254  ASP C N   1 
ATOM   8418  C  CA  . ASP C  1 223 ? 28.127  40.110  -15.629 1.00 48.34  ? 254  ASP C CA  1 
ATOM   8419  C  C   . ASP C  1 223 ? 29.453  40.367  -14.936 1.00 46.38  ? 254  ASP C C   1 
ATOM   8420  O  O   . ASP C  1 223 ? 29.508  41.128  -13.968 1.00 47.09  ? 254  ASP C O   1 
ATOM   8421  C  CB  . ASP C  1 223 ? 27.182  39.376  -14.674 1.00 49.46  ? 254  ASP C CB  1 
ATOM   8422  C  CG  . ASP C  1 223 ? 27.158  37.884  -14.946 1.00 48.05  ? 254  ASP C CG  1 
ATOM   8423  O  OD1 . ASP C  1 223 ? 28.241  37.270  -14.985 1.00 49.13  ? 254  ASP C OD1 1 
ATOM   8424  O  OD2 . ASP C  1 223 ? 26.036  37.370  -15.118 1.00 47.52  ? 254  ASP C OD2 1 
ATOM   8425  N  N   . GLY C  1 224 ? 30.506  39.691  -15.375 1.00 43.89  ? 255  GLY C N   1 
ATOM   8426  C  CA  . GLY C  1 224 ? 31.830  39.888  -14.809 1.00 40.56  ? 255  GLY C CA  1 
ATOM   8427  C  C   . GLY C  1 224 ? 32.013  39.129  -13.508 1.00 38.41  ? 255  GLY C C   1 
ATOM   8428  O  O   . GLY C  1 224 ? 32.885  39.450  -12.704 1.00 38.57  ? 255  GLY C O   1 
ATOM   8429  N  N   . PHE C  1 225 ? 31.152  38.149  -13.276 1.00 36.24  ? 256  PHE C N   1 
ATOM   8430  C  CA  . PHE C  1 225 ? 31.316  37.315  -12.072 1.00 34.26  ? 256  PHE C CA  1 
ATOM   8431  C  C   . PHE C  1 225 ? 32.456  36.336  -12.397 1.00 33.90  ? 256  PHE C C   1 
ATOM   8432  O  O   . PHE C  1 225 ? 32.489  35.785  -13.486 1.00 33.85  ? 256  PHE C O   1 
ATOM   8433  C  CB  . PHE C  1 225 ? 30.031  36.530  -11.840 1.00 32.50  ? 256  PHE C CB  1 
ATOM   8434  C  CG  . PHE C  1 225 ? 29.051  37.201  -10.924 1.00 31.00  ? 256  PHE C CG  1 
ATOM   8435  C  CD1 . PHE C  1 225 ? 29.267  37.229  -9.567  1.00 31.18  ? 256  PHE C CD1 1 
ATOM   8436  C  CD2 . PHE C  1 225 ? 27.907  37.799  -11.418 1.00 32.16  ? 256  PHE C CD2 1 
ATOM   8437  C  CE1 . PHE C  1 225 ? 28.368  37.832  -8.714  1.00 30.81  ? 256  PHE C CE1 1 
ATOM   8438  C  CE2 . PHE C  1 225 ? 26.993  38.405  -10.573 1.00 31.27  ? 256  PHE C CE2 1 
ATOM   8439  C  CZ  . PHE C  1 225 ? 27.230  38.424  -9.215  1.00 30.83  ? 256  PHE C CZ  1 
ATOM   8440  N  N   . LEU C  1 226 ? 33.332  36.135  -11.430 1.00 33.09  ? 257  LEU C N   1 
ATOM   8441  C  CA  . LEU C  1 226 ? 34.452  35.199  -11.649 1.00 32.42  ? 257  LEU C CA  1 
ATOM   8442  C  C   . LEU C  1 226 ? 34.005  33.766  -11.437 1.00 34.83  ? 257  LEU C C   1 
ATOM   8443  O  O   . LEU C  1 226 ? 33.242  33.472  -10.508 1.00 35.23  ? 257  LEU C O   1 
ATOM   8444  C  CB  . LEU C  1 226 ? 35.527  35.598  -10.639 1.00 28.89  ? 257  LEU C CB  1 
ATOM   8445  C  CG  . LEU C  1 226 ? 36.289  36.891  -10.957 1.00 27.04  ? 257  LEU C CG  1 
ATOM   8446  C  CD1 . LEU C  1 226 ? 37.516  37.017  -10.086 1.00 23.73  ? 257  LEU C CD1 1 
ATOM   8447  C  CD2 . LEU C  1 226 ? 36.596  37.010  -12.430 1.00 24.09  ? 257  LEU C CD2 1 
ATOM   8448  N  N   . TRP C  1 227 ? 34.473  32.871  -12.304 1.00 37.48  ? 258  TRP C N   1 
ATOM   8449  C  CA  . TRP C  1 227 ? 34.177  31.448  -12.185 1.00 39.63  ? 258  TRP C CA  1 
ATOM   8450  C  C   . TRP C  1 227 ? 35.403  30.621  -12.587 1.00 40.43  ? 258  TRP C C   1 
ATOM   8451  O  O   . TRP C  1 227 ? 36.423  31.174  -13.002 1.00 40.01  ? 258  TRP C O   1 
ATOM   8452  C  CB  . TRP C  1 227 ? 32.987  31.070  -13.083 1.00 40.32  ? 258  TRP C CB  1 
ATOM   8453  C  CG  . TRP C  1 227 ? 33.393  31.080  -14.531 1.00 40.68  ? 258  TRP C CG  1 
ATOM   8454  C  CD1 . TRP C  1 227 ? 33.526  32.197  -15.302 1.00 40.90  ? 258  TRP C CD1 1 
ATOM   8455  C  CD2 . TRP C  1 227 ? 33.748  29.967  -15.358 1.00 40.22  ? 258  TRP C CD2 1 
ATOM   8456  N  NE1 . TRP C  1 227 ? 33.927  31.843  -16.562 1.00 41.16  ? 258  TRP C NE1 1 
ATOM   8457  C  CE2 . TRP C  1 227 ? 34.074  30.479  -16.629 1.00 40.41  ? 258  TRP C CE2 1 
ATOM   8458  C  CE3 . TRP C  1 227 ? 33.814  28.585  -15.165 1.00 39.46  ? 258  TRP C CE3 1 
ATOM   8459  C  CZ2 . TRP C  1 227 ? 34.466  29.670  -17.696 1.00 39.67  ? 258  TRP C CZ2 1 
ATOM   8460  C  CZ3 . TRP C  1 227 ? 34.201  27.781  -16.224 1.00 39.72  ? 258  TRP C CZ3 1 
ATOM   8461  C  CH2 . TRP C  1 227 ? 34.526  28.328  -17.474 1.00 39.64  ? 258  TRP C CH2 1 
ATOM   8462  N  N   . CYS C  1 228 ? 35.281  29.319  -12.467 1.00 40.13  ? 259  CYS C N   1 
ATOM   8463  C  CA  . CYS C  1 228 ? 36.307  28.366  -12.871 1.00 40.61  ? 259  CYS C CA  1 
ATOM   8464  C  C   . CYS C  1 228 ? 35.738  26.957  -12.979 1.00 41.98  ? 259  CYS C C   1 
ATOM   8465  O  O   . CYS C  1 228 ? 34.653  26.689  -12.458 1.00 42.96  ? 259  CYS C O   1 
ATOM   8466  C  CB  . CYS C  1 228 ? 37.480  28.396  -11.889 1.00 39.38  ? 259  CYS C CB  1 
ATOM   8467  S  SG  . CYS C  1 228 ? 37.061  27.882  -10.208 1.00 37.70  ? 259  CYS C SG  1 
ATOM   8468  N  N   . SER C  1 229 ? 36.385  26.091  -13.715 1.00 43.34  ? 260  SER C N   1 
ATOM   8469  C  CA  . SER C  1 229 ? 35.903  24.711  -13.847 1.00 45.12  ? 260  SER C CA  1 
ATOM   8470  C  C   . SER C  1 229 ? 36.429  23.925  -12.653 1.00 46.98  ? 260  SER C C   1 
ATOM   8471  O  O   . SER C  1 229 ? 37.602  24.082  -12.306 1.00 48.79  ? 260  SER C O   1 
ATOM   8472  C  CB  . SER C  1 229 ? 36.455  24.121  -15.147 1.00 44.76  ? 260  SER C CB  1 
ATOM   8473  O  OG  . SER C  1 229 ? 35.770  22.965  -15.568 1.00 43.73  ? 260  SER C OG  1 
ATOM   8474  N  N   . THR C  1 230 ? 35.605  23.090  -12.034 1.00 48.17  ? 261  THR C N   1 
ATOM   8475  C  CA  . THR C  1 230 ? 36.074  22.317  -10.892 1.00 51.15  ? 261  THR C CA  1 
ATOM   8476  C  C   . THR C  1 230 ? 36.770  21.029  -11.301 1.00 53.33  ? 261  THR C C   1 
ATOM   8477  O  O   . THR C  1 230 ? 37.225  20.277  -10.437 1.00 53.48  ? 261  THR C O   1 
ATOM   8478  C  CB  . THR C  1 230 ? 34.960  22.003  -9.891  1.00 50.28  ? 261  THR C CB  1 
ATOM   8479  O  OG1 . THR C  1 230 ? 34.187  20.908  -10.379 1.00 53.70  ? 261  THR C OG1 1 
ATOM   8480  C  CG2 . THR C  1 230 ? 34.065  23.213  -9.731  1.00 50.66  ? 261  THR C CG2 1 
ATOM   8481  N  N   . THR C  1 231 ? 36.813  20.797  -12.599 1.00 55.76  ? 262  THR C N   1 
ATOM   8482  C  CA  . THR C  1 231 ? 37.496  19.658  -13.211 1.00 57.92  ? 262  THR C CA  1 
ATOM   8483  C  C   . THR C  1 231 ? 38.298  20.204  -14.398 1.00 60.17  ? 262  THR C C   1 
ATOM   8484  O  O   . THR C  1 231 ? 38.000  21.332  -14.811 1.00 60.88  ? 262  THR C O   1 
ATOM   8485  C  CB  . THR C  1 231 ? 36.462  18.660  -13.761 1.00 58.06  ? 262  THR C CB  1 
ATOM   8486  O  OG1 . THR C  1 231 ? 35.743  19.281  -14.833 1.00 58.54  ? 262  THR C OG1 1 
ATOM   8487  C  CG2 . THR C  1 231 ? 35.490  18.231  -12.673 1.00 57.78  ? 262  THR C CG2 1 
ATOM   8488  N  N   . TYR C  1 232 ? 39.243  19.453  -14.942 1.00 62.63  ? 263  TYR C N   1 
ATOM   8489  C  CA  . TYR C  1 232 ? 40.063  20.000  -16.011 1.00 65.88  ? 263  TYR C CA  1 
ATOM   8490  C  C   . TYR C  1 232 ? 39.318  20.275  -17.304 1.00 67.95  ? 263  TYR C C   1 
ATOM   8491  O  O   . TYR C  1 232 ? 39.229  21.411  -17.775 1.00 67.99  ? 263  TYR C O   1 
ATOM   8492  C  CB  . TYR C  1 232 ? 41.289  19.125  -16.303 1.00 65.11  ? 263  TYR C CB  1 
ATOM   8493  C  CG  . TYR C  1 232 ? 42.132  19.705  -17.429 1.00 63.80  ? 263  TYR C CG  1 
ATOM   8494  C  CD1 . TYR C  1 232 ? 42.924  20.823  -17.211 1.00 62.64  ? 263  TYR C CD1 1 
ATOM   8495  C  CD2 . TYR C  1 232 ? 42.125  19.148  -18.698 1.00 63.54  ? 263  TYR C CD2 1 
ATOM   8496  C  CE1 . TYR C  1 232 ? 43.688  21.362  -18.231 1.00 62.69  ? 263  TYR C CE1 1 
ATOM   8497  C  CE2 . TYR C  1 232 ? 42.885  19.674  -19.728 1.00 61.86  ? 263  TYR C CE2 1 
ATOM   8498  C  CZ  . TYR C  1 232 ? 43.664  20.785  -19.484 1.00 62.60  ? 263  TYR C CZ  1 
ATOM   8499  O  OH  . TYR C  1 232 ? 44.423  21.316  -20.500 1.00 63.29  ? 263  TYR C OH  1 
ATOM   8500  N  N   . ASN C  1 233 ? 38.918  19.191  -17.971 1.00 70.16  ? 264  ASN C N   1 
ATOM   8501  C  CA  . ASN C  1 233 ? 38.224  19.354  -19.251 1.00 72.80  ? 264  ASN C CA  1 
ATOM   8502  C  C   . ASN C  1 233 ? 36.813  19.852  -18.964 1.00 73.52  ? 264  ASN C C   1 
ATOM   8503  O  O   . ASN C  1 233 ? 36.019  19.105  -18.391 1.00 73.47  ? 264  ASN C O   1 
ATOM   8504  C  CB  . ASN C  1 233 ? 38.190  18.035  -20.008 1.00 74.59  ? 264  ASN C CB  1 
ATOM   8505  C  CG  . ASN C  1 233 ? 38.015  18.210  -21.504 1.00 76.84  ? 264  ASN C CG  1 
ATOM   8506  O  OD1 . ASN C  1 233 ? 36.964  18.678  -21.954 1.00 78.08  ? 264  ASN C OD1 1 
ATOM   8507  N  ND2 . ASN C  1 233 ? 39.035  17.843  -22.274 1.00 76.48  ? 264  ASN C ND2 1 
ATOM   8508  N  N   . PHE C  1 234 ? 36.525  21.089  -19.347 1.00 74.16  ? 265  PHE C N   1 
ATOM   8509  C  CA  . PHE C  1 234 ? 35.213  21.672  -19.104 1.00 75.61  ? 265  PHE C CA  1 
ATOM   8510  C  C   . PHE C  1 234 ? 34.116  21.077  -19.977 1.00 76.75  ? 265  PHE C C   1 
ATOM   8511  O  O   . PHE C  1 234 ? 32.931  21.305  -19.710 1.00 76.54  ? 265  PHE C O   1 
ATOM   8512  C  CB  . PHE C  1 234 ? 35.248  23.183  -19.306 1.00 74.85  ? 265  PHE C CB  1 
ATOM   8513  C  CG  . PHE C  1 234 ? 34.075  23.933  -18.747 1.00 73.75  ? 265  PHE C CG  1 
ATOM   8514  C  CD1 . PHE C  1 234 ? 33.533  23.596  -17.522 1.00 73.12  ? 265  PHE C CD1 1 
ATOM   8515  C  CD2 . PHE C  1 234 ? 33.521  24.992  -19.447 1.00 72.77  ? 265  PHE C CD2 1 
ATOM   8516  C  CE1 . PHE C  1 234 ? 32.457  24.294  -17.007 1.00 72.98  ? 265  PHE C CE1 1 
ATOM   8517  C  CE2 . PHE C  1 234 ? 32.453  25.696  -18.941 1.00 72.69  ? 265  PHE C CE2 1 
ATOM   8518  C  CZ  . PHE C  1 234 ? 31.918  25.347  -17.716 1.00 72.71  ? 265  PHE C CZ  1 
ATOM   8519  N  N   . GLU C  1 235 ? 34.479  20.297  -20.983 1.00 77.77  ? 266  GLU C N   1 
ATOM   8520  C  CA  . GLU C  1 235 ? 33.517  19.672  -21.869 1.00 78.71  ? 266  GLU C CA  1 
ATOM   8521  C  C   . GLU C  1 235 ? 33.145  18.263  -21.448 1.00 78.79  ? 266  GLU C C   1 
ATOM   8522  O  O   . GLU C  1 235 ? 31.957  17.927  -21.379 1.00 78.76  ? 266  GLU C O   1 
ATOM   8523  C  CB  . GLU C  1 235 ? 34.038  19.661  -23.308 1.00 79.96  ? 266  GLU C CB  1 
ATOM   8524  C  CG  . GLU C  1 235 ? 33.375  20.684  -24.213 1.00 82.66  ? 266  GLU C CG  1 
ATOM   8525  C  CD  . GLU C  1 235 ? 33.875  22.093  -23.974 1.00 85.33  ? 266  GLU C CD  1 
ATOM   8526  O  OE1 . GLU C  1 235 ? 33.881  22.534  -22.805 1.00 86.50  ? 266  GLU C OE1 1 
ATOM   8527  O  OE2 . GLU C  1 235 ? 34.264  22.765  -24.954 1.00 86.44  ? 266  GLU C OE2 1 
ATOM   8528  N  N   . LYS C  1 236 ? 34.134  17.413  -21.167 1.00 79.26  ? 267  LYS C N   1 
ATOM   8529  C  CA  . LYS C  1 236 ? 33.813  16.036  -20.771 1.00 80.36  ? 267  LYS C CA  1 
ATOM   8530  C  C   . LYS C  1 236 ? 33.083  16.049  -19.437 1.00 80.03  ? 267  LYS C C   1 
ATOM   8531  O  O   . LYS C  1 236 ? 32.396  15.116  -19.037 1.00 81.28  ? 267  LYS C O   1 
ATOM   8532  C  CB  . LYS C  1 236 ? 35.026  15.131  -20.769 1.00 81.19  ? 267  LYS C CB  1 
ATOM   8533  C  CG  . LYS C  1 236 ? 36.156  15.474  -19.820 1.00 81.79  ? 267  LYS C CG  1 
ATOM   8534  C  CD  . LYS C  1 236 ? 37.401  14.644  -20.107 1.00 80.39  ? 267  LYS C CD  1 
ATOM   8535  C  CE  . LYS C  1 236 ? 38.483  14.831  -19.059 1.00 79.29  ? 267  LYS C CE  1 
ATOM   8536  N  NZ  . LYS C  1 236 ? 39.800  14.294  -19.503 1.00 75.61  ? 267  LYS C NZ  1 
ATOM   8537  N  N   . ASP C  1 237 ? 33.320  17.121  -18.690 1.00 78.61  ? 268  ASP C N   1 
ATOM   8538  C  CA  . ASP C  1 237 ? 32.683  17.343  -17.393 1.00 76.87  ? 268  ASP C CA  1 
ATOM   8539  C  C   . ASP C  1 237 ? 32.227  18.804  -17.372 1.00 75.19  ? 268  ASP C C   1 
ATOM   8540  O  O   . ASP C  1 237 ? 33.050  19.689  -17.623 1.00 75.91  ? 268  ASP C O   1 
ATOM   8541  C  CB  . ASP C  1 237 ? 33.685  17.087  -16.270 1.00 77.41  ? 268  ASP C CB  1 
ATOM   8542  C  CG  . ASP C  1 237 ? 34.851  16.210  -16.686 1.00 76.84  ? 268  ASP C CG  1 
ATOM   8543  O  OD1 . ASP C  1 237 ? 34.607  15.006  -16.922 1.00 75.66  ? 268  ASP C OD1 1 
ATOM   8544  O  OD2 . ASP C  1 237 ? 35.981  16.728  -16.793 1.00 76.54  ? 268  ASP C OD2 1 
ATOM   8545  N  N   . GLY C  1 238 ? 30.945  19.056  -17.153 1.00 72.27  ? 269  GLY C N   1 
ATOM   8546  C  CA  . GLY C  1 238 ? 30.448  20.427  -17.217 1.00 67.85  ? 269  GLY C CA  1 
ATOM   8547  C  C   . GLY C  1 238 ? 30.364  21.122  -15.877 1.00 64.99  ? 269  GLY C C   1 
ATOM   8548  O  O   . GLY C  1 238 ? 29.680  22.139  -15.738 1.00 64.42  ? 269  GLY C O   1 
ATOM   8549  N  N   . LYS C  1 239 ? 31.065  20.626  -14.867 1.00 63.22  ? 270  LYS C N   1 
ATOM   8550  C  CA  . LYS C  1 239 ? 31.036  21.195  -13.536 1.00 61.15  ? 270  LYS C CA  1 
ATOM   8551  C  C   . LYS C  1 239 ? 31.970  22.387  -13.359 1.00 59.03  ? 270  LYS C C   1 
ATOM   8552  O  O   . LYS C  1 239 ? 33.124  22.382  -13.770 1.00 58.00  ? 270  LYS C O   1 
ATOM   8553  C  CB  . LYS C  1 239 ? 31.337  20.131  -12.483 1.00 62.46  ? 270  LYS C CB  1 
ATOM   8554  C  CG  . LYS C  1 239 ? 30.431  18.911  -12.549 1.00 62.60  ? 270  LYS C CG  1 
ATOM   8555  C  CD  . LYS C  1 239 ? 30.856  17.884  -11.508 1.00 64.23  ? 270  LYS C CD  1 
ATOM   8556  C  CE  . LYS C  1 239 ? 30.463  16.476  -11.925 1.00 63.39  ? 270  LYS C CE  1 
ATOM   8557  N  NZ  . LYS C  1 239 ? 30.977  15.454  -10.965 1.00 61.71  ? 270  LYS C NZ  1 
ATOM   8558  N  N   . TYR C  1 240 ? 31.454  23.416  -12.701 1.00 56.61  ? 271  TYR C N   1 
ATOM   8559  C  CA  . TYR C  1 240 ? 32.143  24.659  -12.438 1.00 52.89  ? 271  TYR C CA  1 
ATOM   8560  C  C   . TYR C  1 240 ? 31.456  25.357  -11.247 1.00 48.84  ? 271  TYR C C   1 
ATOM   8561  O  O   . TYR C  1 240 ? 30.420  24.896  -10.796 1.00 46.44  ? 271  TYR C O   1 
ATOM   8562  C  CB  . TYR C  1 240 ? 31.998  25.638  -13.621 1.00 54.40  ? 271  TYR C CB  1 
ATOM   8563  C  CG  . TYR C  1 240 ? 30.604  26.230  -13.708 1.00 57.28  ? 271  TYR C CG  1 
ATOM   8564  C  CD1 . TYR C  1 240 ? 29.498  25.407  -13.878 1.00 59.17  ? 271  TYR C CD1 1 
ATOM   8565  C  CD2 . TYR C  1 240 ? 30.391  27.591  -13.621 1.00 58.36  ? 271  TYR C CD2 1 
ATOM   8566  C  CE1 . TYR C  1 240 ? 28.225  25.931  -13.966 1.00 60.63  ? 271  TYR C CE1 1 
ATOM   8567  C  CE2 . TYR C  1 240 ? 29.119  28.128  -13.710 1.00 60.66  ? 271  TYR C CE2 1 
ATOM   8568  C  CZ  . TYR C  1 240 ? 28.038  27.294  -13.881 1.00 61.13  ? 271  TYR C CZ  1 
ATOM   8569  O  OH  . TYR C  1 240 ? 26.770  27.813  -13.971 1.00 60.43  ? 271  TYR C OH  1 
ATOM   8570  N  N   . GLY C  1 241 ? 32.026  26.492  -10.879 1.00 45.32  ? 272  GLY C N   1 
ATOM   8571  C  CA  . GLY C  1 241 ? 31.429  27.329  -9.851  1.00 41.80  ? 272  GLY C CA  1 
ATOM   8572  C  C   . GLY C  1 241 ? 31.920  28.769  -9.957  1.00 39.39  ? 272  GLY C C   1 
ATOM   8573  O  O   . GLY C  1 241 ? 32.811  29.072  -10.750 1.00 39.01  ? 272  GLY C O   1 
ATOM   8574  N  N   . PHE C  1 242 ? 31.350  29.648  -9.137  1.00 36.73  ? 273  PHE C N   1 
ATOM   8575  C  CA  . PHE C  1 242 ? 31.793  31.033  -9.102  1.00 33.54  ? 273  PHE C CA  1 
ATOM   8576  C  C   . PHE C  1 242 ? 32.779  31.233  -7.949  1.00 33.17  ? 273  PHE C C   1 
ATOM   8577  O  O   . PHE C  1 242 ? 32.558  30.761  -6.832  1.00 32.15  ? 273  PHE C O   1 
ATOM   8578  C  CB  . PHE C  1 242 ? 30.585  31.952  -8.869  1.00 31.70  ? 273  PHE C CB  1 
ATOM   8579  C  CG  . PHE C  1 242 ? 29.650  31.867  -10.054 1.00 30.35  ? 273  PHE C CG  1 
ATOM   8580  C  CD1 . PHE C  1 242 ? 29.832  32.657  -11.168 1.00 30.10  ? 273  PHE C CD1 1 
ATOM   8581  C  CD2 . PHE C  1 242 ? 28.600  30.949  -10.035 1.00 30.57  ? 273  PHE C CD2 1 
ATOM   8582  C  CE1 . PHE C  1 242 ? 28.979  32.546  -12.246 1.00 29.89  ? 273  PHE C CE1 1 
ATOM   8583  C  CE2 . PHE C  1 242 ? 27.754  30.846  -11.120 1.00 31.55  ? 273  PHE C CE2 1 
ATOM   8584  C  CZ  . PHE C  1 242 ? 27.960  31.650  -12.208 1.00 30.34  ? 273  PHE C CZ  1 
ATOM   8585  N  N   . CYS C  1 243 ? 33.883  31.874  -8.292  1.00 33.02  ? 274  CYS C N   1 
ATOM   8586  C  CA  . CYS C  1 243 ? 34.922  32.127  -7.294  1.00 32.46  ? 274  CYS C CA  1 
ATOM   8587  C  C   . CYS C  1 243 ? 34.572  33.371  -6.493  1.00 32.31  ? 274  CYS C C   1 
ATOM   8588  O  O   . CYS C  1 243 ? 34.045  34.307  -7.092  1.00 32.30  ? 274  CYS C O   1 
ATOM   8589  C  CB  . CYS C  1 243 ? 36.223  32.413  -8.050  1.00 32.43  ? 274  CYS C CB  1 
ATOM   8590  S  SG  . CYS C  1 243 ? 36.394  31.224  -9.404  1.00 34.70  ? 274  CYS C SG  1 
ATOM   8591  N  N   . PRO C  1 244 ? 34.786  33.320  -5.194  1.00 31.64  ? 275  PRO C N   1 
ATOM   8592  C  CA  . PRO C  1 244 ? 34.584  34.386  -4.233  1.00 31.37  ? 275  PRO C CA  1 
ATOM   8593  C  C   . PRO C  1 244 ? 35.329  35.680  -4.514  1.00 32.47  ? 275  PRO C C   1 
ATOM   8594  O  O   . PRO C  1 244 ? 36.334  35.684  -5.224  1.00 32.93  ? 275  PRO C O   1 
ATOM   8595  C  CB  . PRO C  1 244 ? 35.071  33.832  -2.908  1.00 32.04  ? 275  PRO C CB  1 
ATOM   8596  C  CG  . PRO C  1 244 ? 35.137  32.369  -3.081  1.00 33.07  ? 275  PRO C CG  1 
ATOM   8597  C  CD  . PRO C  1 244 ? 35.460  32.164  -4.531  1.00 33.17  ? 275  PRO C CD  1 
ATOM   8598  N  N   . HIS C  1 245 ? 34.903  36.778  -3.925  1.00 33.96  ? 276  HIS C N   1 
ATOM   8599  C  CA  . HIS C  1 245 ? 35.493  38.104  -3.940  1.00 34.44  ? 276  HIS C CA  1 
ATOM   8600  C  C   . HIS C  1 245 ? 34.454  39.094  -3.379  1.00 33.96  ? 276  HIS C C   1 
ATOM   8601  O  O   . HIS C  1 245 ? 33.260  38.792  -3.373  1.00 34.31  ? 276  HIS C O   1 
ATOM   8602  C  CB  . HIS C  1 245 ? 36.084  38.564  -5.241  1.00 34.69  ? 276  HIS C CB  1 
ATOM   8603  C  CG  . HIS C  1 245 ? 37.408  39.270  -5.272  1.00 36.24  ? 276  HIS C CG  1 
ATOM   8604  N  ND1 . HIS C  1 245 ? 37.880  39.964  -6.368  1.00 35.02  ? 276  HIS C ND1 1 
ATOM   8605  C  CD2 . HIS C  1 245 ? 38.399  39.375  -4.357  1.00 38.16  ? 276  HIS C CD2 1 
ATOM   8606  C  CE1 . HIS C  1 245 ? 39.088  40.446  -6.129  1.00 39.76  ? 276  HIS C CE1 1 
ATOM   8607  N  NE2 . HIS C  1 245 ? 39.436  40.104  -4.901  1.00 41.34  ? 276  HIS C NE2 1 
ATOM   8608  N  N   . GLU C  1 246 ? 34.931  40.178  -2.812  1.00 31.81  ? 277  GLU C N   1 
ATOM   8609  C  CA  . GLU C  1 246 ? 34.169  41.095  -1.989  1.00 28.67  ? 277  GLU C CA  1 
ATOM   8610  C  C   . GLU C  1 246 ? 33.697  42.213  -2.913  1.00 26.99  ? 277  GLU C C   1 
ATOM   8611  O  O   . GLU C  1 246 ? 32.762  42.928  -2.665  1.00 26.64  ? 277  GLU C O   1 
ATOM   8612  C  CB  . GLU C  1 246 ? 34.938  41.641  -0.800  1.00 29.40  ? 277  GLU C CB  1 
ATOM   8613  C  CG  . GLU C  1 246 ? 36.398  41.989  -1.054  1.00 30.35  ? 277  GLU C CG  1 
ATOM   8614  C  CD  . GLU C  1 246 ? 37.255  40.741  -0.999  1.00 31.24  ? 277  GLU C CD  1 
ATOM   8615  O  OE1 . GLU C  1 246 ? 36.900  39.758  -1.673  1.00 32.84  ? 277  GLU C OE1 1 
ATOM   8616  O  OE2 . GLU C  1 246 ? 38.256  40.753  -0.267  1.00 31.30  ? 277  GLU C OE2 1 
ATOM   8617  N  N   . ALA C  1 247 ? 34.324  42.195  -4.074  1.00 25.45  ? 278  ALA C N   1 
ATOM   8618  C  CA  . ALA C  1 247 ? 34.030  43.112  -5.146  1.00 25.58  ? 278  ALA C CA  1 
ATOM   8619  C  C   . ALA C  1 247 ? 32.886  42.624  -6.018  1.00 26.73  ? 278  ALA C C   1 
ATOM   8620  O  O   . ALA C  1 247 ? 32.327  43.409  -6.774  1.00 26.29  ? 278  ALA C O   1 
ATOM   8621  C  CB  . ALA C  1 247 ? 35.266  43.315  -6.005  1.00 25.56  ? 278  ALA C CB  1 
ATOM   8622  N  N   . LEU C  1 248 ? 32.600  41.318  -5.902  1.00 27.80  ? 279  LEU C N   1 
ATOM   8623  C  CA  . LEU C  1 248 ? 31.571  40.730  -6.755  1.00 29.26  ? 279  LEU C CA  1 
ATOM   8624  C  C   . LEU C  1 248 ? 30.341  40.380  -5.946  1.00 29.90  ? 279  LEU C C   1 
ATOM   8625  O  O   . LEU C  1 248 ? 29.219  40.715  -6.335  1.00 32.74  ? 279  LEU C O   1 
ATOM   8626  C  CB  . LEU C  1 248 ? 32.119  39.343  -7.204  1.00 31.35  ? 279  LEU C CB  1 
ATOM   8627  C  CG  . LEU C  1 248 ? 33.503  39.338  -7.857  1.00 31.12  ? 279  LEU C CG  1 
ATOM   8628  C  CD1 . LEU C  1 248 ? 33.951  37.916  -8.158  1.00 33.45  ? 279  LEU C CD1 1 
ATOM   8629  C  CD2 . LEU C  1 248 ? 33.502  40.178  -9.125  1.00 26.12  ? 279  LEU C CD2 1 
ATOM   8630  N  N   . PHE C  1 249 ? 30.629  39.682  -4.837  1.00 29.42  ? 280  PHE C N   1 
ATOM   8631  C  CA  . PHE C  1 249 ? 29.604  39.184  -3.941  1.00 30.06  ? 280  PHE C CA  1 
ATOM   8632  C  C   . PHE C  1 249 ? 30.058  39.133  -2.486  1.00 30.26  ? 280  PHE C C   1 
ATOM   8633  O  O   . PHE C  1 249 ? 31.192  39.477  -2.163  1.00 33.05  ? 280  PHE C O   1 
ATOM   8634  C  CB  . PHE C  1 249 ? 29.125  37.773  -4.409  1.00 30.27  ? 280  PHE C CB  1 
ATOM   8635  C  CG  . PHE C  1 249 ? 30.191  36.678  -4.650  1.00 34.92  ? 280  PHE C CG  1 
ATOM   8636  C  CD1 . PHE C  1 249 ? 31.245  36.831  -5.557  1.00 40.33  ? 280  PHE C CD1 1 
ATOM   8637  C  CD2 . PHE C  1 249 ? 30.123  35.455  -3.980  1.00 32.91  ? 280  PHE C CD2 1 
ATOM   8638  C  CE1 . PHE C  1 249 ? 32.166  35.817  -5.793  1.00 42.52  ? 280  PHE C CE1 1 
ATOM   8639  C  CE2 . PHE C  1 249 ? 31.048  34.440  -4.209  1.00 36.42  ? 280  PHE C CE2 1 
ATOM   8640  C  CZ  . PHE C  1 249 ? 32.066  34.621  -5.119  1.00 41.37  ? 280  PHE C CZ  1 
ATOM   8641  N  N   . THR C  1 250 ? 29.140  38.706  -1.631  1.00 30.41  ? 281  THR C N   1 
ATOM   8642  C  CA  . THR C  1 250 ? 29.430  38.525  -0.219  1.00 29.75  ? 281  THR C CA  1 
ATOM   8643  C  C   . THR C  1 250 ? 28.752  37.269  0.274   1.00 29.06  ? 281  THR C C   1 
ATOM   8644  O  O   . THR C  1 250 ? 27.937  36.674  -0.429  1.00 29.05  ? 281  THR C O   1 
ATOM   8645  C  CB  . THR C  1 250 ? 28.971  39.706  0.640   1.00 29.44  ? 281  THR C CB  1 
ATOM   8646  O  OG1 . THR C  1 250 ? 27.779  40.271  0.088   1.00 30.66  ? 281  THR C OG1 1 
ATOM   8647  C  CG2 . THR C  1 250 ? 30.061  40.763  0.718   1.00 28.02  ? 281  THR C CG2 1 
ATOM   8648  N  N   . MET C  1 251 ? 29.075  36.852  1.474   1.00 27.70  ? 282  MET C N   1 
ATOM   8649  C  CA  . MET C  1 251 ? 28.456  35.662  1.998   1.00 30.16  ? 282  MET C CA  1 
ATOM   8650  C  C   . MET C  1 251 ? 27.864  35.914  3.374   1.00 30.34  ? 282  MET C C   1 
ATOM   8651  O  O   . MET C  1 251 ? 28.500  36.482  4.253   1.00 30.33  ? 282  MET C O   1 
ATOM   8652  C  CB  . MET C  1 251 ? 29.457  34.506  2.030   1.00 32.94  ? 282  MET C CB  1 
ATOM   8653  C  CG  . MET C  1 251 ? 29.855  33.993  0.653   1.00 38.01  ? 282  MET C CG  1 
ATOM   8654  S  SD  . MET C  1 251 ? 28.484  33.221  -0.231  1.00 42.94  ? 282  MET C SD  1 
ATOM   8655  C  CE  . MET C  1 251 ? 27.917  32.040  0.990   1.00 40.21  ? 282  MET C CE  1 
ATOM   8656  N  N   . GLY C  1 252 ? 26.632  35.433  3.532   1.00 30.80  ? 283  GLY C N   1 
ATOM   8657  C  CA  . GLY C  1 252 ? 25.937  35.516  4.803   1.00 29.90  ? 283  GLY C CA  1 
ATOM   8658  C  C   . GLY C  1 252 ? 25.523  36.941  5.144   1.00 29.56  ? 283  GLY C C   1 
ATOM   8659  O  O   . GLY C  1 252 ? 25.175  37.739  4.277   1.00 27.51  ? 283  GLY C O   1 
ATOM   8660  N  N   . GLY C  1 253 ? 25.593  37.269  6.435   1.00 30.42  ? 284  GLY C N   1 
ATOM   8661  C  CA  . GLY C  1 253 ? 25.164  38.596  6.859   1.00 33.47  ? 284  GLY C CA  1 
ATOM   8662  C  C   . GLY C  1 253 ? 23.737  38.793  6.349   1.00 35.89  ? 284  GLY C C   1 
ATOM   8663  O  O   . GLY C  1 253 ? 23.004  37.825  6.130   1.00 37.82  ? 284  GLY C O   1 
ATOM   8664  N  N   . ASN C  1 254 ? 23.388  40.045  6.105   1.00 35.59  ? 285  ASN C N   1 
ATOM   8665  C  CA  . ASN C  1 254 ? 22.055  40.367  5.596   1.00 32.94  ? 285  ASN C CA  1 
ATOM   8666  C  C   . ASN C  1 254 ? 22.152  41.044  4.239   1.00 33.03  ? 285  ASN C C   1 
ATOM   8667  O  O   . ASN C  1 254 ? 21.182  41.622  3.752   1.00 33.24  ? 285  ASN C O   1 
ATOM   8668  C  CB  . ASN C  1 254 ? 21.423  41.358  6.586   1.00 33.14  ? 285  ASN C CB  1 
ATOM   8669  C  CG  . ASN C  1 254 ? 22.318  42.569  6.797   1.00 34.65  ? 285  ASN C CG  1 
ATOM   8670  O  OD1 . ASN C  1 254 ? 23.405  42.627  6.225   1.00 37.35  ? 285  ASN C OD1 1 
ATOM   8671  N  ND2 . ASN C  1 254 ? 21.850  43.498  7.622   1.00 34.60  ? 285  ASN C ND2 1 
ATOM   8672  N  N   . ALA C  1 255 ? 23.343  41.060  3.656   1.00 33.12  ? 286  ALA C N   1 
ATOM   8673  C  CA  . ALA C  1 255 ? 23.546  41.836  2.429   1.00 32.80  ? 286  ALA C CA  1 
ATOM   8674  C  C   . ALA C  1 255 ? 22.885  41.116  1.264   1.00 32.81  ? 286  ALA C C   1 
ATOM   8675  O  O   . ALA C  1 255 ? 22.573  41.753  0.257   1.00 32.75  ? 286  ALA C O   1 
ATOM   8676  C  CB  . ALA C  1 255 ? 25.015  42.074  2.165   1.00 33.04  ? 286  ALA C CB  1 
ATOM   8677  N  N   . GLU C  1 256 ? 22.674  39.819  1.396   1.00 32.34  ? 287  GLU C N   1 
ATOM   8678  C  CA  . GLU C  1 256 ? 22.031  39.009  0.393   1.00 32.91  ? 287  GLU C CA  1 
ATOM   8679  C  C   . GLU C  1 256 ? 22.832  38.802  -0.878  1.00 32.50  ? 287  GLU C C   1 
ATOM   8680  O  O   . GLU C  1 256 ? 22.282  38.738  -1.980  1.00 31.17  ? 287  GLU C O   1 
ATOM   8681  C  CB  . GLU C  1 256 ? 20.626  39.514  0.080   1.00 34.85  ? 287  GLU C CB  1 
ATOM   8682  C  CG  . GLU C  1 256 ? 19.678  39.370  1.265   1.00 39.96  ? 287  GLU C CG  1 
ATOM   8683  C  CD  . GLU C  1 256 ? 18.231  39.606  0.892   1.00 42.07  ? 287  GLU C CD  1 
ATOM   8684  O  OE1 . GLU C  1 256 ? 17.891  40.748  0.520   1.00 39.33  ? 287  GLU C OE1 1 
ATOM   8685  O  OE2 . GLU C  1 256 ? 17.438  38.643  0.975   1.00 45.32  ? 287  GLU C OE2 1 
ATOM   8686  N  N   . GLY C  1 257 ? 24.139  38.649  -0.717  1.00 31.70  ? 288  GLY C N   1 
ATOM   8687  C  CA  . GLY C  1 257 ? 25.079  38.383  -1.779  1.00 30.86  ? 288  GLY C CA  1 
ATOM   8688  C  C   . GLY C  1 257 ? 25.514  39.611  -2.550  1.00 30.24  ? 288  GLY C C   1 
ATOM   8689  O  O   . GLY C  1 257 ? 25.983  39.543  -3.687  1.00 31.30  ? 288  GLY C O   1 
ATOM   8690  N  N   . GLN C  1 258 ? 25.339  40.770  -1.934  1.00 28.76  ? 289  GLN C N   1 
ATOM   8691  C  CA  . GLN C  1 258 ? 25.706  42.023  -2.593  1.00 27.14  ? 289  GLN C CA  1 
ATOM   8692  C  C   . GLN C  1 258 ? 27.184  42.317  -2.404  1.00 25.54  ? 289  GLN C C   1 
ATOM   8693  O  O   . GLN C  1 258 ? 27.789  41.901  -1.423  1.00 27.09  ? 289  GLN C O   1 
ATOM   8694  C  CB  . GLN C  1 258 ? 24.845  43.146  -1.993  1.00 26.81  ? 289  GLN C CB  1 
ATOM   8695  C  CG  . GLN C  1 258 ? 23.396  43.094  -2.462  1.00 25.09  ? 289  GLN C CG  1 
ATOM   8696  C  CD  . GLN C  1 258 ? 23.336  43.494  -3.927  1.00 26.23  ? 289  GLN C CD  1 
ATOM   8697  O  OE1 . GLN C  1 258 ? 23.601  44.651  -4.240  1.00 27.63  ? 289  GLN C OE1 1 
ATOM   8698  N  NE2 . GLN C  1 258 ? 23.018  42.561  -4.802  1.00 26.44  ? 289  GLN C NE2 1 
ATOM   8699  N  N   . PRO C  1 259 ? 27.788  43.020  -3.341  1.00 23.16  ? 290  PRO C N   1 
ATOM   8700  C  CA  . PRO C  1 259 ? 29.189  43.406  -3.228  1.00 21.65  ? 290  PRO C CA  1 
ATOM   8701  C  C   . PRO C  1 259 ? 29.414  44.260  -1.986  1.00 23.07  ? 290  PRO C C   1 
ATOM   8702  O  O   . PRO C  1 259 ? 28.455  44.732  -1.374  1.00 24.98  ? 290  PRO C O   1 
ATOM   8703  C  CB  . PRO C  1 259 ? 29.439  44.222  -4.490  1.00 19.22  ? 290  PRO C CB  1 
ATOM   8704  C  CG  . PRO C  1 259 ? 28.369  43.840  -5.440  1.00 16.93  ? 290  PRO C CG  1 
ATOM   8705  C  CD  . PRO C  1 259 ? 27.181  43.545  -4.578  1.00 20.53  ? 290  PRO C CD  1 
ATOM   8706  N  N   . CYS C  1 260 ? 30.672  44.461  -1.620  1.00 23.54  ? 291  CYS C N   1 
ATOM   8707  C  CA  . CYS C  1 260 ? 30.998  45.372  -0.528  1.00 23.27  ? 291  CYS C CA  1 
ATOM   8708  C  C   . CYS C  1 260 ? 30.940  46.791  -1.112  1.00 23.53  ? 291  CYS C C   1 
ATOM   8709  O  O   . CYS C  1 260 ? 30.890  46.959  -2.316  1.00 22.89  ? 291  CYS C O   1 
ATOM   8710  C  CB  . CYS C  1 260 ? 32.387  45.132  0.034   1.00 22.26  ? 291  CYS C CB  1 
ATOM   8711  S  SG  . CYS C  1 260 ? 32.763  43.438  0.489   1.00 24.02  ? 291  CYS C SG  1 
ATOM   8712  N  N   . LYS C  1 261 ? 31.034  47.767  -0.213  1.00 24.48  ? 292  LYS C N   1 
ATOM   8713  C  CA  . LYS C  1 261 ? 31.138  49.129  -0.702  1.00 27.48  ? 292  LYS C CA  1 
ATOM   8714  C  C   . LYS C  1 261 ? 32.392  49.786  -0.133  1.00 29.42  ? 292  LYS C C   1 
ATOM   8715  O  O   . LYS C  1 261 ? 32.482  50.015  1.077   1.00 31.38  ? 292  LYS C O   1 
ATOM   8716  C  CB  . LYS C  1 261 ? 29.895  49.929  -0.375  1.00 25.82  ? 292  LYS C CB  1 
ATOM   8717  C  CG  . LYS C  1 261 ? 29.932  51.335  -0.954  1.00 24.14  ? 292  LYS C CG  1 
ATOM   8718  C  CD  . LYS C  1 261 ? 30.402  51.298  -2.397  1.00 23.56  ? 292  LYS C CD  1 
ATOM   8719  C  CE  . LYS C  1 261 ? 30.097  52.627  -3.068  1.00 24.72  ? 292  LYS C CE  1 
ATOM   8720  N  NZ  . LYS C  1 261 ? 28.722  52.649  -3.642  1.00 27.01  ? 292  LYS C NZ  1 
ATOM   8721  N  N   . PHE C  1 262 ? 33.372  50.035  -1.005  1.00 28.44  ? 293  PHE C N   1 
ATOM   8722  C  CA  . PHE C  1 262 ? 34.573  50.682  -0.497  1.00 28.18  ? 293  PHE C CA  1 
ATOM   8723  C  C   . PHE C  1 262 ? 34.685  52.124  -0.972  1.00 27.20  ? 293  PHE C C   1 
ATOM   8724  O  O   . PHE C  1 262 ? 34.580  52.403  -2.167  1.00 28.55  ? 293  PHE C O   1 
ATOM   8725  C  CB  . PHE C  1 262 ? 35.832  49.896  -0.889  1.00 27.93  ? 293  PHE C CB  1 
ATOM   8726  C  CG  . PHE C  1 262 ? 35.840  48.463  -0.443  1.00 27.66  ? 293  PHE C CG  1 
ATOM   8727  C  CD1 . PHE C  1 262 ? 35.550  48.133  0.865   1.00 28.42  ? 293  PHE C CD1 1 
ATOM   8728  C  CD2 . PHE C  1 262 ? 36.139  47.434  -1.324  1.00 27.08  ? 293  PHE C CD2 1 
ATOM   8729  C  CE1 . PHE C  1 262 ? 35.562  46.818  1.280   1.00 29.54  ? 293  PHE C CE1 1 
ATOM   8730  C  CE2 . PHE C  1 262 ? 36.129  46.118  -0.905  1.00 28.16  ? 293  PHE C CE2 1 
ATOM   8731  C  CZ  . PHE C  1 262 ? 35.854  45.795  0.405   1.00 27.90  ? 293  PHE C CZ  1 
ATOM   8732  N  N   . PRO C  1 263 ? 34.927  53.027  -0.038  1.00 25.91  ? 294  PRO C N   1 
ATOM   8733  C  CA  . PRO C  1 263 ? 34.945  52.635  1.362   1.00 26.51  ? 294  PRO C CA  1 
ATOM   8734  C  C   . PRO C  1 263 ? 33.557  52.732  1.986   1.00 26.94  ? 294  PRO C C   1 
ATOM   8735  O  O   . PRO C  1 263 ? 32.626  53.348  1.468   1.00 25.79  ? 294  PRO C O   1 
ATOM   8736  C  CB  . PRO C  1 263 ? 35.839  53.709  1.980   1.00 25.92  ? 294  PRO C CB  1 
ATOM   8737  C  CG  . PRO C  1 263 ? 35.551  54.934  1.187   1.00 25.11  ? 294  PRO C CG  1 
ATOM   8738  C  CD  . PRO C  1 263 ? 35.226  54.458  -0.199  1.00 25.31  ? 294  PRO C CD  1 
ATOM   8739  N  N   . PHE C  1 264 ? 33.440  52.072  3.131   1.00 26.63  ? 295  PHE C N   1 
ATOM   8740  C  CA  . PHE C  1 264 ? 32.174  52.091  3.865   1.00 26.90  ? 295  PHE C CA  1 
ATOM   8741  C  C   . PHE C  1 264 ? 32.519  52.511  5.295   1.00 27.80  ? 295  PHE C C   1 
ATOM   8742  O  O   . PHE C  1 264 ? 33.581  52.111  5.789   1.00 28.80  ? 295  PHE C O   1 
ATOM   8743  C  CB  . PHE C  1 264 ? 31.552  50.702  3.845   1.00 24.66  ? 295  PHE C CB  1 
ATOM   8744  C  CG  . PHE C  1 264 ? 32.284  49.710  4.701   1.00 22.18  ? 295  PHE C CG  1 
ATOM   8745  C  CD1 . PHE C  1 264 ? 31.993  49.581  6.045   1.00 20.74  ? 295  PHE C CD1 1 
ATOM   8746  C  CD2 . PHE C  1 264 ? 33.255  48.886  4.133   1.00 21.53  ? 295  PHE C CD2 1 
ATOM   8747  C  CE1 . PHE C  1 264 ? 32.662  48.673  6.819   1.00 20.32  ? 295  PHE C CE1 1 
ATOM   8748  C  CE2 . PHE C  1 264 ? 33.922  47.981  4.933   1.00 21.60  ? 295  PHE C CE2 1 
ATOM   8749  C  CZ  . PHE C  1 264 ? 33.622  47.868  6.274   1.00 21.55  ? 295  PHE C CZ  1 
ATOM   8750  N  N   . ARG C  1 265 ? 31.756  53.421  5.859   1.00 28.07  ? 296  ARG C N   1 
ATOM   8751  C  CA  . ARG C  1 265 ? 32.031  53.938  7.178   1.00 27.98  ? 296  ARG C CA  1 
ATOM   8752  C  C   . ARG C  1 265 ? 31.437  53.058  8.267   1.00 27.03  ? 296  ARG C C   1 
ATOM   8753  O  O   . ARG C  1 265 ? 30.326  52.587  8.154   1.00 27.57  ? 296  ARG C O   1 
ATOM   8754  C  CB  . ARG C  1 265 ? 31.506  55.375  7.348   1.00 28.68  ? 296  ARG C CB  1 
ATOM   8755  C  CG  . ARG C  1 265 ? 31.651  55.890  8.777   1.00 29.48  ? 296  ARG C CG  1 
ATOM   8756  C  CD  . ARG C  1 265 ? 31.291  57.346  8.860   1.00 29.05  ? 296  ARG C CD  1 
ATOM   8757  N  NE  . ARG C  1 265 ? 31.459  57.899  10.198  1.00 29.70  ? 296  ARG C NE  1 
ATOM   8758  C  CZ  . ARG C  1 265 ? 30.925  59.058  10.592  1.00 30.77  ? 296  ARG C CZ  1 
ATOM   8759  N  NH1 . ARG C  1 265 ? 30.166  59.769  9.764   1.00 26.94  ? 296  ARG C NH1 1 
ATOM   8760  N  NH2 . ARG C  1 265 ? 31.132  59.495  11.830  1.00 30.09  ? 296  ARG C NH2 1 
ATOM   8761  N  N   . PHE C  1 266 ? 32.191  52.764  9.291   1.00 26.65  ? 297  PHE C N   1 
ATOM   8762  C  CA  . PHE C  1 266 ? 31.793  52.033  10.462  1.00 27.12  ? 297  PHE C CA  1 
ATOM   8763  C  C   . PHE C  1 266 ? 32.259  52.830  11.681  1.00 28.08  ? 297  PHE C C   1 
ATOM   8764  O  O   . PHE C  1 266 ? 33.442  52.844  11.998  1.00 27.97  ? 297  PHE C O   1 
ATOM   8765  C  CB  . PHE C  1 266 ? 32.414  50.638  10.481  1.00 26.29  ? 297  PHE C CB  1 
ATOM   8766  C  CG  . PHE C  1 266 ? 32.033  49.871  11.715  1.00 25.70  ? 297  PHE C CG  1 
ATOM   8767  C  CD1 . PHE C  1 266 ? 30.728  49.902  12.185  1.00 24.20  ? 297  PHE C CD1 1 
ATOM   8768  C  CD2 . PHE C  1 266 ? 32.985  49.128  12.382  1.00 25.51  ? 297  PHE C CD2 1 
ATOM   8769  C  CE1 . PHE C  1 266 ? 30.398  49.199  13.334  1.00 24.15  ? 297  PHE C CE1 1 
ATOM   8770  C  CE2 . PHE C  1 266 ? 32.660  48.418  13.501  1.00 25.02  ? 297  PHE C CE2 1 
ATOM   8771  C  CZ  . PHE C  1 266 ? 31.362  48.454  13.989  1.00 26.86  ? 297  PHE C CZ  1 
ATOM   8772  N  N   . GLN C  1 267 ? 31.338  53.558  12.286  1.00 29.24  ? 298  GLN C N   1 
ATOM   8773  C  CA  . GLN C  1 267 ? 31.720  54.420  13.402  1.00 31.75  ? 298  GLN C CA  1 
ATOM   8774  C  C   . GLN C  1 267 ? 32.835  55.378  12.923  1.00 33.72  ? 298  GLN C C   1 
ATOM   8775  O  O   . GLN C  1 267 ? 32.954  55.663  11.733  1.00 35.94  ? 298  GLN C O   1 
ATOM   8776  C  CB  . GLN C  1 267 ? 31.884  53.632  14.674  1.00 30.24  ? 298  GLN C CB  1 
ATOM   8777  C  CG  . GLN C  1 267 ? 30.913  54.019  15.774  1.00 35.68  ? 298  GLN C CG  1 
ATOM   8778  C  CD  . GLN C  1 267 ? 29.493  54.155  15.268  1.00 40.34  ? 298  GLN C CD  1 
ATOM   8779  O  OE1 . GLN C  1 267 ? 28.734  54.998  15.744  1.00 47.20  ? 298  GLN C OE1 1 
ATOM   8780  N  NE2 . GLN C  1 267 ? 28.926  53.431  14.311  1.00 41.61  ? 298  GLN C NE2 1 
ATOM   8781  N  N   . GLY C  1 268 ? 33.664  55.907  13.811  1.00 34.43  ? 299  GLY C N   1 
ATOM   8782  C  CA  . GLY C  1 268 ? 34.650  56.924  13.418  1.00 33.68  ? 299  GLY C CA  1 
ATOM   8783  C  C   . GLY C  1 268 ? 35.765  56.433  12.475  1.00 32.74  ? 299  GLY C C   1 
ATOM   8784  O  O   . GLY C  1 268 ? 36.935  56.774  12.647  1.00 34.68  ? 299  GLY C O   1 
ATOM   8785  N  N   . THR C  1 269 ? 35.450  55.648  11.440  1.00 32.52  ? 300  THR C N   1 
ATOM   8786  C  CA  . THR C  1 269 ? 36.517  55.171  10.547  1.00 30.97  ? 300  THR C CA  1 
ATOM   8787  C  C   . THR C  1 269 ? 35.996  54.722  9.181   1.00 30.70  ? 300  THR C C   1 
ATOM   8788  O  O   . THR C  1 269 ? 34.919  54.138  9.077   1.00 31.25  ? 300  THR C O   1 
ATOM   8789  C  CB  . THR C  1 269 ? 37.284  54.002  11.171  1.00 32.05  ? 300  THR C CB  1 
ATOM   8790  O  OG1 . THR C  1 269 ? 37.723  54.364  12.487  1.00 30.14  ? 300  THR C OG1 1 
ATOM   8791  C  CG2 . THR C  1 269 ? 38.484  53.631  10.314  1.00 30.47  ? 300  THR C CG2 1 
ATOM   8792  N  N   . SER C  1 270 ? 36.778  54.995  8.133   1.00 29.77  ? 301  SER C N   1 
ATOM   8793  C  CA  . SER C  1 270 ? 36.390  54.538  6.783   1.00 31.43  ? 301  SER C CA  1 
ATOM   8794  C  C   . SER C  1 270 ? 37.220  53.342  6.337   1.00 32.04  ? 301  SER C C   1 
ATOM   8795  O  O   . SER C  1 270 ? 38.438  53.458  6.193   1.00 32.61  ? 301  SER C O   1 
ATOM   8796  C  CB  . SER C  1 270 ? 36.535  55.696  5.794   1.00 33.20  ? 301  SER C CB  1 
ATOM   8797  O  OG  . SER C  1 270 ? 35.598  55.579  4.735   1.00 33.59  ? 301  SER C OG  1 
ATOM   8798  N  N   . TYR C  1 271 ? 36.546  52.222  6.100   1.00 31.47  ? 302  TYR C N   1 
ATOM   8799  C  CA  . TYR C  1 271 ? 37.192  50.982  5.684   1.00 30.22  ? 302  TYR C CA  1 
ATOM   8800  C  C   . TYR C  1 271 ? 37.196  50.791  4.176   1.00 30.84  ? 302  TYR C C   1 
ATOM   8801  O  O   . TYR C  1 271 ? 36.135  50.754  3.551   1.00 32.21  ? 302  TYR C O   1 
ATOM   8802  C  CB  . TYR C  1 271 ? 36.498  49.785  6.353   1.00 24.98  ? 302  TYR C CB  1 
ATOM   8803  C  CG  . TYR C  1 271 ? 36.656  49.854  7.859   1.00 23.22  ? 302  TYR C CG  1 
ATOM   8804  C  CD1 . TYR C  1 271 ? 35.808  50.638  8.622   1.00 23.33  ? 302  TYR C CD1 1 
ATOM   8805  C  CD2 . TYR C  1 271 ? 37.667  49.152  8.499   1.00 21.60  ? 302  TYR C CD2 1 
ATOM   8806  C  CE1 . TYR C  1 271 ? 35.964  50.722  9.998   1.00 21.82  ? 302  TYR C CE1 1 
ATOM   8807  C  CE2 . TYR C  1 271 ? 37.818  49.223  9.868   1.00 21.35  ? 302  TYR C CE2 1 
ATOM   8808  C  CZ  . TYR C  1 271 ? 36.970  50.009  10.615  1.00 20.90  ? 302  TYR C CZ  1 
ATOM   8809  O  OH  . TYR C  1 271 ? 37.113  50.089  11.978  1.00 18.17  ? 302  TYR C OH  1 
ATOM   8810  N  N   . ASP C  1 272 ? 38.390  50.624  3.602   1.00 28.57  ? 303  ASP C N   1 
ATOM   8811  C  CA  . ASP C  1 272 ? 38.520  50.433  2.156   1.00 26.43  ? 303  ASP C CA  1 
ATOM   8812  C  C   . ASP C  1 272 ? 38.722  48.949  1.859   1.00 26.61  ? 303  ASP C C   1 
ATOM   8813  O  O   . ASP C  1 272 ? 39.167  48.544  0.789   1.00 27.38  ? 303  ASP C O   1 
ATOM   8814  C  CB  . ASP C  1 272 ? 39.673  51.257  1.636   1.00 25.39  ? 303  ASP C CB  1 
ATOM   8815  C  CG  . ASP C  1 272 ? 39.641  51.411  0.133   1.00 25.78  ? 303  ASP C CG  1 
ATOM   8816  O  OD1 . ASP C  1 272 ? 38.606  51.811  -0.448  1.00 24.93  ? 303  ASP C OD1 1 
ATOM   8817  O  OD2 . ASP C  1 272 ? 40.675  51.144  -0.497  1.00 25.54  ? 303  ASP C OD2 1 
ATOM   8818  N  N   . SER C  1 273 ? 38.362  48.080  2.797   1.00 27.09  ? 304  SER C N   1 
ATOM   8819  C  CA  . SER C  1 273 ? 38.478  46.636  2.548   1.00 28.46  ? 304  SER C CA  1 
ATOM   8820  C  C   . SER C  1 273 ? 37.714  45.874  3.631   1.00 28.41  ? 304  SER C C   1 
ATOM   8821  O  O   . SER C  1 273 ? 37.197  46.477  4.568   1.00 28.16  ? 304  SER C O   1 
ATOM   8822  C  CB  . SER C  1 273 ? 39.964  46.258  2.651   1.00 28.33  ? 304  SER C CB  1 
ATOM   8823  O  OG  . SER C  1 273 ? 40.288  46.236  4.042   1.00 30.77  ? 304  SER C OG  1 
ATOM   8824  N  N   . CYS C  1 274 ? 37.573  44.554  3.411   1.00 27.25  ? 305  CYS C N   1 
ATOM   8825  C  CA  . CYS C  1 274 ? 36.920  43.860  4.512   1.00 27.74  ? 305  CYS C CA  1 
ATOM   8826  C  C   . CYS C  1 274 ? 37.742  43.952  5.791   1.00 25.49  ? 305  CYS C C   1 
ATOM   8827  O  O   . CYS C  1 274 ? 38.939  44.217  5.627   1.00 23.56  ? 305  CYS C O   1 
ATOM   8828  C  CB  . CYS C  1 274 ? 36.671  42.395  4.148   1.00 29.41  ? 305  CYS C CB  1 
ATOM   8829  S  SG  . CYS C  1 274 ? 35.494  42.150  2.798   1.00 35.19  ? 305  CYS C SG  1 
ATOM   8830  N  N   . THR C  1 275 ? 37.170  43.731  6.903   1.00 24.79  ? 306  THR C N   1 
ATOM   8831  C  CA  . THR C  1 275 ? 37.882  43.802  8.155   1.00 23.20  ? 306  THR C CA  1 
ATOM   8832  C  C   . THR C  1 275 ? 37.253  42.830  9.164   1.00 23.02  ? 306  THR C C   1 
ATOM   8833  O  O   . THR C  1 275 ? 36.298  42.115  8.864   1.00 21.77  ? 306  THR C O   1 
ATOM   8834  C  CB  . THR C  1 275 ? 37.849  45.204  8.784   1.00 23.81  ? 306  THR C CB  1 
ATOM   8835  O  OG1 . THR C  1 275 ? 38.615  45.186  10.005  1.00 24.48  ? 306  THR C OG1 1 
ATOM   8836  C  CG2 . THR C  1 275 ? 36.431  45.532  9.237   1.00 23.19  ? 306  THR C CG2 1 
ATOM   8837  N  N   . THR C  1 276 ? 37.881  42.738  10.310  1.00 23.83  ? 307  THR C N   1 
ATOM   8838  C  CA  . THR C  1 276 ? 37.310  41.842  11.338  1.00 26.96  ? 307  THR C CA  1 
ATOM   8839  C  C   . THR C  1 276 ? 36.943  42.808  12.484  1.00 28.88  ? 307  THR C C   1 
ATOM   8840  O  O   . THR C  1 276 ? 36.419  42.383  13.496  1.00 31.14  ? 307  THR C O   1 
ATOM   8841  C  CB  . THR C  1 276 ? 38.441  40.929  11.847  1.00 27.24  ? 307  THR C CB  1 
ATOM   8842  O  OG1 . THR C  1 276 ? 39.405  41.794  12.505  1.00 32.00  ? 307  THR C OG1 1 
ATOM   8843  C  CG2 . THR C  1 276 ? 39.139  40.283  10.665  1.00 26.71  ? 307  THR C CG2 1 
ATOM   8844  N  N   . GLU C  1 277 ? 37.156  44.094  12.174  1.00 29.09  ? 308  GLU C N   1 
ATOM   8845  C  CA  . GLU C  1 277 ? 36.962  45.095  13.235  1.00 29.26  ? 308  GLU C CA  1 
ATOM   8846  C  C   . GLU C  1 277 ? 35.601  44.821  13.872  1.00 29.76  ? 308  GLU C C   1 
ATOM   8847  O  O   . GLU C  1 277 ? 34.586  44.746  13.173  1.00 29.31  ? 308  GLU C O   1 
ATOM   8848  C  CB  . GLU C  1 277 ? 37.006  46.488  12.591  1.00 28.17  ? 308  GLU C CB  1 
ATOM   8849  C  CG  . GLU C  1 277 ? 36.367  47.642  13.389  1.00 31.99  ? 308  GLU C CG  1 
ATOM   8850  C  CD  . GLU C  1 277 ? 36.649  47.651  14.896  1.00 33.29  ? 308  GLU C CD  1 
ATOM   8851  O  OE1 . GLU C  1 277 ? 37.807  47.886  15.308  1.00 32.58  ? 308  GLU C OE1 1 
ATOM   8852  O  OE2 . GLU C  1 277 ? 35.689  47.441  15.675  1.00 36.70  ? 308  GLU C OE2 1 
ATOM   8853  N  N   . GLY C  1 278 ? 35.561  44.647  15.184  1.00 30.55  ? 309  GLY C N   1 
ATOM   8854  C  CA  . GLY C  1 278 ? 34.308  44.375  15.868  1.00 31.27  ? 309  GLY C CA  1 
ATOM   8855  C  C   . GLY C  1 278 ? 34.179  42.898  16.244  1.00 32.76  ? 309  GLY C C   1 
ATOM   8856  O  O   . GLY C  1 278 ? 33.862  42.562  17.384  1.00 32.84  ? 309  GLY C O   1 
ATOM   8857  N  N   . ARG C  1 279 ? 34.420  42.004  15.287  1.00 35.20  ? 310  ARG C N   1 
ATOM   8858  C  CA  . ARG C  1 279 ? 34.322  40.567  15.546  1.00 37.41  ? 310  ARG C CA  1 
ATOM   8859  C  C   . ARG C  1 279 ? 35.421  40.095  16.497  1.00 39.52  ? 310  ARG C C   1 
ATOM   8860  O  O   . ARG C  1 279 ? 36.380  40.823  16.747  1.00 39.87  ? 310  ARG C O   1 
ATOM   8861  C  CB  . ARG C  1 279 ? 34.396  39.771  14.243  1.00 36.24  ? 310  ARG C CB  1 
ATOM   8862  C  CG  . ARG C  1 279 ? 33.748  40.456  13.054  1.00 36.70  ? 310  ARG C CG  1 
ATOM   8863  C  CD  . ARG C  1 279 ? 33.278  39.442  12.026  1.00 37.63  ? 310  ARG C CD  1 
ATOM   8864  N  NE  . ARG C  1 279 ? 31.847  39.178  12.136  1.00 37.25  ? 310  ARG C NE  1 
ATOM   8865  C  CZ  . ARG C  1 279 ? 31.324  38.127  12.760  1.00 35.06  ? 310  ARG C CZ  1 
ATOM   8866  N  NH1 . ARG C  1 279 ? 32.117  37.234  13.336  1.00 33.93  ? 310  ARG C NH1 1 
ATOM   8867  N  NH2 . ARG C  1 279 ? 30.007  37.973  12.807  1.00 37.12  ? 310  ARG C NH2 1 
ATOM   8868  N  N   . THR C  1 280 ? 35.242  38.873  16.974  1.00 40.12  ? 311  THR C N   1 
ATOM   8869  C  CA  . THR C  1 280 ? 36.198  38.229  17.870  1.00 40.04  ? 311  THR C CA  1 
ATOM   8870  C  C   . THR C  1 280 ? 36.441  36.801  17.383  1.00 39.68  ? 311  THR C C   1 
ATOM   8871  O  O   . THR C  1 280 ? 36.842  35.937  18.143  1.00 40.12  ? 311  THR C O   1 
ATOM   8872  C  CB  . THR C  1 280 ? 35.657  38.186  19.308  1.00 41.44  ? 311  THR C CB  1 
ATOM   8873  O  OG1 . THR C  1 280 ? 36.701  37.787  20.204  1.00 44.42  ? 311  THR C OG1 1 
ATOM   8874  C  CG2 . THR C  1 280 ? 34.496  37.215  19.426  1.00 41.86  ? 311  THR C CG2 1 
ATOM   8875  N  N   . ASP C  1 281 ? 36.127  36.568  16.110  1.00 38.81  ? 312  ASP C N   1 
ATOM   8876  C  CA  . ASP C  1 281 ? 36.332  35.248  15.518  1.00 37.16  ? 312  ASP C CA  1 
ATOM   8877  C  C   . ASP C  1 281 ? 37.071  35.350  14.194  1.00 37.66  ? 312  ASP C C   1 
ATOM   8878  O  O   . ASP C  1 281 ? 36.834  34.546  13.287  1.00 38.53  ? 312  ASP C O   1 
ATOM   8879  C  CB  . ASP C  1 281 ? 34.977  34.579  15.300  1.00 36.62  ? 312  ASP C CB  1 
ATOM   8880  C  CG  . ASP C  1 281 ? 34.090  35.431  14.415  1.00 37.44  ? 312  ASP C CG  1 
ATOM   8881  O  OD1 . ASP C  1 281 ? 34.657  36.247  13.662  1.00 39.40  ? 312  ASP C OD1 1 
ATOM   8882  O  OD2 . ASP C  1 281 ? 32.861  35.268  14.499  1.00 37.57  ? 312  ASP C OD2 1 
ATOM   8883  N  N   . GLY C  1 282 ? 37.862  36.401  13.993  1.00 37.78  ? 313  GLY C N   1 
ATOM   8884  C  CA  . GLY C  1 282 ? 38.584  36.615  12.765  1.00 36.23  ? 313  GLY C CA  1 
ATOM   8885  C  C   . GLY C  1 282 ? 37.804  36.561  11.481  1.00 34.78  ? 313  GLY C C   1 
ATOM   8886  O  O   . GLY C  1 282 ? 38.394  36.597  10.386  1.00 35.36  ? 313  GLY C O   1 
ATOM   8887  N  N   . TYR C  1 283 ? 36.473  36.507  11.462  1.00 34.17  ? 314  TYR C N   1 
ATOM   8888  C  CA  . TYR C  1 283 ? 35.801  36.435  10.169  1.00 34.25  ? 314  TYR C CA  1 
ATOM   8889  C  C   . TYR C  1 283 ? 35.794  37.790  9.488   1.00 32.83  ? 314  TYR C C   1 
ATOM   8890  O  O   . TYR C  1 283 ? 35.341  38.750  10.103  1.00 31.02  ? 314  TYR C O   1 
ATOM   8891  C  CB  . TYR C  1 283 ? 34.384  35.871  10.288  1.00 36.37  ? 314  TYR C CB  1 
ATOM   8892  C  CG  . TYR C  1 283 ? 34.379  34.379  10.548  1.00 40.27  ? 314  TYR C CG  1 
ATOM   8893  C  CD1 . TYR C  1 283 ? 35.029  33.507  9.682   1.00 43.41  ? 314  TYR C CD1 1 
ATOM   8894  C  CD2 . TYR C  1 283 ? 33.753  33.832  11.657  1.00 42.40  ? 314  TYR C CD2 1 
ATOM   8895  C  CE1 . TYR C  1 283 ? 35.052  32.144  9.908   1.00 45.39  ? 314  TYR C CE1 1 
ATOM   8896  C  CE2 . TYR C  1 283 ? 33.768  32.467  11.896  1.00 44.58  ? 314  TYR C CE2 1 
ATOM   8897  C  CZ  . TYR C  1 283 ? 34.417  31.627  11.017  1.00 45.77  ? 314  TYR C CZ  1 
ATOM   8898  O  OH  . TYR C  1 283 ? 34.437  30.269  11.243  1.00 45.92  ? 314  TYR C OH  1 
ATOM   8899  N  N   . ARG C  1 284 ? 36.235  37.852  8.235   1.00 32.82  ? 315  ARG C N   1 
ATOM   8900  C  CA  . ARG C  1 284 ? 36.206  39.103  7.498   1.00 32.89  ? 315  ARG C CA  1 
ATOM   8901  C  C   . ARG C  1 284 ? 34.782  39.442  7.067   1.00 32.58  ? 315  ARG C C   1 
ATOM   8902  O  O   . ARG C  1 284 ? 34.067  38.572  6.579   1.00 33.64  ? 315  ARG C O   1 
ATOM   8903  C  CB  . ARG C  1 284 ? 37.124  39.109  6.292   1.00 32.66  ? 315  ARG C CB  1 
ATOM   8904  C  CG  . ARG C  1 284 ? 38.593  38.952  6.569   1.00 32.74  ? 315  ARG C CG  1 
ATOM   8905  C  CD  . ARG C  1 284 ? 39.471  39.623  5.563   1.00 36.23  ? 315  ARG C CD  1 
ATOM   8906  N  NE  . ARG C  1 284 ? 39.086  39.527  4.168   1.00 35.44  ? 315  ARG C NE  1 
ATOM   8907  C  CZ  . ARG C  1 284 ? 39.113  38.478  3.369   1.00 35.17  ? 315  ARG C CZ  1 
ATOM   8908  N  NH1 . ARG C  1 284 ? 39.510  37.299  3.858   1.00 36.79  ? 315  ARG C NH1 1 
ATOM   8909  N  NH2 . ARG C  1 284 ? 38.747  38.547  2.091   1.00 33.82  ? 315  ARG C NH2 1 
ATOM   8910  N  N   . TRP C  1 285 ? 34.433  40.700  7.192   1.00 30.11  ? 316  TRP C N   1 
ATOM   8911  C  CA  . TRP C  1 285 ? 33.158  41.248  6.789   1.00 26.40  ? 316  TRP C CA  1 
ATOM   8912  C  C   . TRP C  1 285 ? 33.362  42.642  6.166   1.00 25.51  ? 316  TRP C C   1 
ATOM   8913  O  O   . TRP C  1 285 ? 34.443  43.206  6.253   1.00 25.10  ? 316  TRP C O   1 
ATOM   8914  C  CB  . TRP C  1 285 ? 32.257  41.392  8.019   1.00 24.82  ? 316  TRP C CB  1 
ATOM   8915  C  CG  . TRP C  1 285 ? 32.704  42.430  9.005   1.00 20.18  ? 316  TRP C CG  1 
ATOM   8916  C  CD1 . TRP C  1 285 ? 33.713  42.319  9.907   1.00 18.89  ? 316  TRP C CD1 1 
ATOM   8917  C  CD2 . TRP C  1 285 ? 32.134  43.724  9.202   1.00 20.03  ? 316  TRP C CD2 1 
ATOM   8918  N  NE1 . TRP C  1 285 ? 33.834  43.479  10.637  1.00 18.09  ? 316  TRP C NE1 1 
ATOM   8919  C  CE2 . TRP C  1 285 ? 32.871  44.354  10.218  1.00 20.20  ? 316  TRP C CE2 1 
ATOM   8920  C  CE3 . TRP C  1 285 ? 31.103  44.442  8.588   1.00 19.89  ? 316  TRP C CE3 1 
ATOM   8921  C  CZ2 . TRP C  1 285 ? 32.569  45.650  10.661  1.00 20.92  ? 316  TRP C CZ2 1 
ATOM   8922  C  CZ3 . TRP C  1 285 ? 30.805  45.711  9.014   1.00 18.47  ? 316  TRP C CZ3 1 
ATOM   8923  C  CH2 . TRP C  1 285 ? 31.535  46.279  10.038  1.00 20.06  ? 316  TRP C CH2 1 
ATOM   8924  N  N   . CYS C  1 286 ? 32.311  43.177  5.625   1.00 23.90  ? 317  CYS C N   1 
ATOM   8925  C  CA  . CYS C  1 286 ? 32.374  44.500  5.018   1.00 22.83  ? 317  CYS C CA  1 
ATOM   8926  C  C   . CYS C  1 286 ? 30.987  45.118  4.898   1.00 23.22  ? 317  CYS C C   1 
ATOM   8927  O  O   . CYS C  1 286 ? 30.007  44.373  4.848   1.00 24.80  ? 317  CYS C O   1 
ATOM   8928  C  CB  . CYS C  1 286 ? 33.048  44.427  3.646   1.00 20.69  ? 317  CYS C CB  1 
ATOM   8929  S  SG  . CYS C  1 286 ? 32.151  43.441  2.425   1.00 21.28  ? 317  CYS C SG  1 
ATOM   8930  N  N   . GLY C  1 287 ? 30.918  46.412  4.919   1.00 22.79  ? 318  GLY C N   1 
ATOM   8931  C  CA  . GLY C  1 287 ? 29.620  47.060  4.746   1.00 23.03  ? 318  GLY C CA  1 
ATOM   8932  C  C   . GLY C  1 287 ? 29.320  46.892  3.247   1.00 23.88  ? 318  GLY C C   1 
ATOM   8933  O  O   . GLY C  1 287 ? 30.271  46.973  2.472   1.00 23.55  ? 318  GLY C O   1 
ATOM   8934  N  N   . THR C  1 288 ? 28.087  46.622  2.890   1.00 22.67  ? 319  THR C N   1 
ATOM   8935  C  CA  . THR C  1 288 ? 27.702  46.489  1.506   1.00 23.15  ? 319  THR C CA  1 
ATOM   8936  C  C   . THR C  1 288 ? 27.021  47.768  1.041   1.00 25.17  ? 319  THR C C   1 
ATOM   8937  O  O   . THR C  1 288 ? 26.557  47.863  -0.082  1.00 24.84  ? 319  THR C O   1 
ATOM   8938  C  CB  . THR C  1 288 ? 26.770  45.289  1.312   1.00 22.59  ? 319  THR C CB  1 
ATOM   8939  O  OG1 . THR C  1 288 ? 25.748  45.316  2.317   1.00 24.55  ? 319  THR C OG1 1 
ATOM   8940  C  CG2 . THR C  1 288 ? 27.622  44.025  1.435   1.00 23.72  ? 319  THR C CG2 1 
ATOM   8941  N  N   . THR C  1 289 ? 27.110  48.763  1.889   1.00 26.21  ? 320  THR C N   1 
ATOM   8942  C  CA  . THR C  1 289 ? 26.551  50.096  1.754   1.00 26.25  ? 320  THR C CA  1 
ATOM   8943  C  C   . THR C  1 289 ? 27.654  51.119  1.999   1.00 25.42  ? 320  THR C C   1 
ATOM   8944  O  O   . THR C  1 289 ? 28.785  50.684  2.283   1.00 25.98  ? 320  THR C O   1 
ATOM   8945  C  CB  . THR C  1 289 ? 25.421  50.278  2.774   1.00 24.80  ? 320  THR C CB  1 
ATOM   8946  O  OG1 . THR C  1 289 ? 25.054  51.646  2.906   1.00 27.46  ? 320  THR C OG1 1 
ATOM   8947  C  CG2 . THR C  1 289 ? 25.839  49.798  4.159   1.00 24.74  ? 320  THR C CG2 1 
ATOM   8948  N  N   . GLU C  1 290 ? 27.411  52.409  1.863   1.00 24.16  ? 321  GLU C N   1 
ATOM   8949  C  CA  . GLU C  1 290 ? 28.441  53.402  2.099   1.00 22.40  ? 321  GLU C CA  1 
ATOM   8950  C  C   . GLU C  1 290 ? 28.555  53.751  3.583   1.00 22.45  ? 321  GLU C C   1 
ATOM   8951  O  O   . GLU C  1 290 ? 29.589  54.244  4.000   1.00 24.48  ? 321  GLU C O   1 
ATOM   8952  C  CB  . GLU C  1 290 ? 28.171  54.695  1.353   1.00 19.28  ? 321  GLU C CB  1 
ATOM   8953  C  CG  . GLU C  1 290 ? 28.779  54.806  -0.025  1.00 18.49  ? 321  GLU C CG  1 
ATOM   8954  C  CD  . GLU C  1 290 ? 28.290  56.085  -0.700  1.00 18.59  ? 321  GLU C CD  1 
ATOM   8955  O  OE1 . GLU C  1 290 ? 27.994  57.012  0.084   1.00 17.73  ? 321  GLU C OE1 1 
ATOM   8956  O  OE2 . GLU C  1 290 ? 28.238  56.058  -1.941  1.00 15.18  ? 321  GLU C OE2 1 
ATOM   8957  N  N   . ASP C  1 291 ? 27.501  53.539  4.339   1.00 22.11  ? 322  ASP C N   1 
ATOM   8958  C  CA  . ASP C  1 291 ? 27.473  53.805  5.779   1.00 20.55  ? 322  ASP C CA  1 
ATOM   8959  C  C   . ASP C  1 291 ? 26.942  52.551  6.440   1.00 20.98  ? 322  ASP C C   1 
ATOM   8960  O  O   . ASP C  1 291 ? 25.746  52.273  6.396   1.00 20.88  ? 322  ASP C O   1 
ATOM   8961  C  CB  . ASP C  1 291 ? 26.525  54.973  6.072   1.00 22.15  ? 322  ASP C CB  1 
ATOM   8962  C  CG  . ASP C  1 291 ? 26.565  55.335  7.548   1.00 24.31  ? 322  ASP C CG  1 
ATOM   8963  O  OD1 . ASP C  1 291 ? 26.770  54.421  8.379   1.00 23.73  ? 322  ASP C OD1 1 
ATOM   8964  O  OD2 . ASP C  1 291 ? 26.402  56.525  7.880   1.00 21.62  ? 322  ASP C OD2 1 
ATOM   8965  N  N   . TYR C  1 292 ? 27.786  51.735  7.036   1.00 22.28  ? 323  TYR C N   1 
ATOM   8966  C  CA  . TYR C  1 292 ? 27.245  50.532  7.638   1.00 22.06  ? 323  TYR C CA  1 
ATOM   8967  C  C   . TYR C  1 292 ? 26.390  50.858  8.847   1.00 22.06  ? 323  TYR C C   1 
ATOM   8968  O  O   . TYR C  1 292 ? 25.407  50.179  9.138   1.00 21.62  ? 323  TYR C O   1 
ATOM   8969  C  CB  . TYR C  1 292 ? 28.318  49.549  8.057   1.00 22.63  ? 323  TYR C CB  1 
ATOM   8970  C  CG  . TYR C  1 292 ? 27.766  48.522  9.007   1.00 24.83  ? 323  TYR C CG  1 
ATOM   8971  C  CD1 . TYR C  1 292 ? 26.830  47.596  8.576   1.00 24.06  ? 323  TYR C CD1 1 
ATOM   8972  C  CD2 . TYR C  1 292 ? 28.162  48.495  10.333  1.00 26.91  ? 323  TYR C CD2 1 
ATOM   8973  C  CE1 . TYR C  1 292 ? 26.298  46.668  9.443   1.00 25.72  ? 323  TYR C CE1 1 
ATOM   8974  C  CE2 . TYR C  1 292 ? 27.634  47.570  11.211  1.00 27.97  ? 323  TYR C CE2 1 
ATOM   8975  C  CZ  . TYR C  1 292 ? 26.701  46.660  10.760  1.00 27.74  ? 323  TYR C CZ  1 
ATOM   8976  O  OH  . TYR C  1 292 ? 26.170  45.739  11.631  1.00 32.88  ? 323  TYR C OH  1 
ATOM   8977  N  N   . ASP C  1 293 ? 26.767  51.898  9.560   1.00 22.40  ? 324  ASP C N   1 
ATOM   8978  C  CA  . ASP C  1 293 ? 26.024  52.300  10.729  1.00 24.57  ? 324  ASP C CA  1 
ATOM   8979  C  C   . ASP C  1 293 ? 24.590  52.648  10.364  1.00 24.31  ? 324  ASP C C   1 
ATOM   8980  O  O   . ASP C  1 293 ? 23.662  52.287  11.081  1.00 24.37  ? 324  ASP C O   1 
ATOM   8981  C  CB  . ASP C  1 293 ? 26.713  53.481  11.404  1.00 25.85  ? 324  ASP C CB  1 
ATOM   8982  C  CG  . ASP C  1 293 ? 28.004  53.069  12.069  1.00 29.72  ? 324  ASP C CG  1 
ATOM   8983  O  OD1 . ASP C  1 293 ? 27.999  52.031  12.762  1.00 30.73  ? 324  ASP C OD1 1 
ATOM   8984  O  OD2 . ASP C  1 293 ? 29.016  53.777  11.896  1.00 32.83  ? 324  ASP C OD2 1 
ATOM   8985  N  N   . ARG C  1 294 ? 24.396  53.380  9.289   1.00 23.86  ? 325  ARG C N   1 
ATOM   8986  C  CA  . ARG C  1 294 ? 23.134  53.886  8.849   1.00 24.32  ? 325  ARG C CA  1 
ATOM   8987  C  C   . ARG C  1 294 ? 22.277  52.774  8.262   1.00 22.91  ? 325  ARG C C   1 
ATOM   8988  O  O   . ARG C  1 294 ? 21.152  52.631  8.681   1.00 22.96  ? 325  ARG C O   1 
ATOM   8989  C  CB  . ARG C  1 294 ? 23.263  55.028  7.839   1.00 27.12  ? 325  ARG C CB  1 
ATOM   8990  C  CG  . ARG C  1 294 ? 21.918  55.515  7.327   1.00 33.61  ? 325  ARG C CG  1 
ATOM   8991  C  CD  . ARG C  1 294 ? 22.046  56.663  6.365   1.00 39.22  ? 325  ARG C CD  1 
ATOM   8992  N  NE  . ARG C  1 294 ? 23.045  56.423  5.332   1.00 48.76  ? 325  ARG C NE  1 
ATOM   8993  C  CZ  . ARG C  1 294 ? 22.790  55.841  4.163   1.00 53.16  ? 325  ARG C CZ  1 
ATOM   8994  N  NH1 . ARG C  1 294 ? 21.556  55.433  3.869   1.00 53.24  ? 325  ARG C NH1 1 
ATOM   8995  N  NH2 . ARG C  1 294 ? 23.784  55.676  3.292   1.00 53.21  ? 325  ARG C NH2 1 
ATOM   8996  N  N   . ASP C  1 295 ? 22.844  52.020  7.345   1.00 22.24  ? 326  ASP C N   1 
ATOM   8997  C  CA  . ASP C  1 295 ? 22.164  50.966  6.639   1.00 22.02  ? 326  ASP C CA  1 
ATOM   8998  C  C   . ASP C  1 295 ? 22.182  49.621  7.303   1.00 24.23  ? 326  ASP C C   1 
ATOM   8999  O  O   . ASP C  1 295 ? 21.402  48.729  6.932   1.00 26.39  ? 326  ASP C O   1 
ATOM   9000  C  CB  . ASP C  1 295 ? 22.683  50.903  5.206   1.00 21.34  ? 326  ASP C CB  1 
ATOM   9001  C  CG  . ASP C  1 295 ? 22.693  52.266  4.541   1.00 21.03  ? 326  ASP C CG  1 
ATOM   9002  O  OD1 . ASP C  1 295 ? 21.582  52.780  4.284   1.00 21.58  ? 326  ASP C OD1 1 
ATOM   9003  O  OD2 . ASP C  1 295 ? 23.782  52.790  4.264   1.00 22.01  ? 326  ASP C OD2 1 
ATOM   9004  N  N   . LYS C  1 296 ? 23.072  49.379  8.252   1.00 27.21  ? 327  LYS C N   1 
ATOM   9005  C  CA  . LYS C  1 296 ? 23.193  48.101  8.927   1.00 29.43  ? 327  LYS C CA  1 
ATOM   9006  C  C   . LYS C  1 296 ? 23.305  46.945  7.935   1.00 30.46  ? 327  LYS C C   1 
ATOM   9007  O  O   . LYS C  1 296 ? 23.006  45.822  8.336   1.00 30.76  ? 327  LYS C O   1 
ATOM   9008  C  CB  . LYS C  1 296 ? 21.948  47.792  9.762   1.00 31.22  ? 327  LYS C CB  1 
ATOM   9009  C  CG  . LYS C  1 296 ? 21.943  48.437  11.130  1.00 32.66  ? 327  LYS C CG  1 
ATOM   9010  C  CD  . LYS C  1 296 ? 21.543  49.893  11.030  1.00 35.15  ? 327  LYS C CD  1 
ATOM   9011  C  CE  . LYS C  1 296 ? 20.037  50.068  10.910  1.00 38.88  ? 327  LYS C CE  1 
ATOM   9012  N  NZ  . LYS C  1 296 ? 19.633  51.504  10.984  1.00 38.63  ? 327  LYS C NZ  1 
ATOM   9013  N  N   . LYS C  1 297 ? 23.697  47.210  6.703   1.00 30.38  ? 328  LYS C N   1 
ATOM   9014  C  CA  . LYS C  1 297 ? 23.787  46.111  5.747   1.00 29.84  ? 328  LYS C CA  1 
ATOM   9015  C  C   . LYS C  1 297 ? 25.249  45.694  5.601   1.00 30.43  ? 328  LYS C C   1 
ATOM   9016  O  O   . LYS C  1 297 ? 26.141  46.528  5.432   1.00 31.01  ? 328  LYS C O   1 
ATOM   9017  C  CB  . LYS C  1 297 ? 23.226  46.504  4.394   1.00 29.44  ? 328  LYS C CB  1 
ATOM   9018  C  CG  . LYS C  1 297 ? 21.741  46.761  4.312   1.00 30.31  ? 328  LYS C CG  1 
ATOM   9019  C  CD  . LYS C  1 297 ? 20.946  45.469  4.321   1.00 31.91  ? 328  LYS C CD  1 
ATOM   9020  C  CE  . LYS C  1 297 ? 19.456  45.737  4.185   1.00 31.07  ? 328  LYS C CE  1 
ATOM   9021  N  NZ  . LYS C  1 297 ? 18.706  44.514  3.783   1.00 30.86  ? 328  LYS C NZ  1 
ATOM   9022  N  N   . TYR C  1 298 ? 25.456  44.389  5.732   1.00 30.00  ? 329  TYR C N   1 
ATOM   9023  C  CA  . TYR C  1 298 ? 26.820  43.885  5.645   1.00 29.66  ? 329  TYR C CA  1 
ATOM   9024  C  C   . TYR C  1 298 ? 26.805  42.417  5.201   1.00 30.18  ? 329  TYR C C   1 
ATOM   9025  O  O   . TYR C  1 298 ? 25.775  41.764  5.233   1.00 30.65  ? 329  TYR C O   1 
ATOM   9026  C  CB  . TYR C  1 298 ? 27.418  43.903  7.067   1.00 29.49  ? 329  TYR C CB  1 
ATOM   9027  C  CG  . TYR C  1 298 ? 26.797  42.806  7.916   1.00 27.29  ? 329  TYR C CG  1 
ATOM   9028  C  CD1 . TYR C  1 298 ? 25.511  42.941  8.414   1.00 26.13  ? 329  TYR C CD1 1 
ATOM   9029  C  CD2 . TYR C  1 298 ? 27.504  41.646  8.190   1.00 28.40  ? 329  TYR C CD2 1 
ATOM   9030  C  CE1 . TYR C  1 298 ? 24.952  41.934  9.175   1.00 28.38  ? 329  TYR C CE1 1 
ATOM   9031  C  CE2 . TYR C  1 298 ? 26.948  40.646  8.953   1.00 29.00  ? 329  TYR C CE2 1 
ATOM   9032  C  CZ  . TYR C  1 298 ? 25.679  40.793  9.447   1.00 30.16  ? 329  TYR C CZ  1 
ATOM   9033  O  OH  . TYR C  1 298 ? 25.109  39.804  10.217  1.00 30.39  ? 329  TYR C OH  1 
ATOM   9034  N  N   . GLY C  1 299 ? 27.987  41.994  4.774   1.00 30.07  ? 330  GLY C N   1 
ATOM   9035  C  CA  . GLY C  1 299 ? 28.165  40.618  4.338   1.00 32.58  ? 330  GLY C CA  1 
ATOM   9036  C  C   . GLY C  1 299 ? 29.602  40.186  4.603   1.00 34.00  ? 330  GLY C C   1 
ATOM   9037  O  O   . GLY C  1 299 ? 30.514  41.020  4.668   1.00 35.72  ? 330  GLY C O   1 
ATOM   9038  N  N   . PHE C  1 300 ? 29.816  38.892  4.790   1.00 34.88  ? 331  PHE C N   1 
ATOM   9039  C  CA  . PHE C  1 300 ? 31.158  38.400  5.053   1.00 36.23  ? 331  PHE C CA  1 
ATOM   9040  C  C   . PHE C  1 300 ? 31.969  38.245  3.769   1.00 36.52  ? 331  PHE C C   1 
ATOM   9041  O  O   . PHE C  1 300 ? 31.452  38.145  2.658   1.00 36.47  ? 331  PHE C O   1 
ATOM   9042  C  CB  . PHE C  1 300 ? 31.119  37.061  5.792   1.00 36.43  ? 331  PHE C CB  1 
ATOM   9043  C  CG  . PHE C  1 300 ? 30.580  37.166  7.187   1.00 37.02  ? 331  PHE C CG  1 
ATOM   9044  C  CD1 . PHE C  1 300 ? 31.456  37.421  8.229   1.00 37.76  ? 331  PHE C CD1 1 
ATOM   9045  C  CD2 . PHE C  1 300 ? 29.229  37.033  7.474   1.00 35.90  ? 331  PHE C CD2 1 
ATOM   9046  C  CE1 . PHE C  1 300 ? 30.993  37.534  9.519   1.00 37.55  ? 331  PHE C CE1 1 
ATOM   9047  C  CE2 . PHE C  1 300 ? 28.775  37.137  8.774   1.00 36.60  ? 331  PHE C CE2 1 
ATOM   9048  C  CZ  . PHE C  1 300 ? 29.656  37.386  9.807   1.00 37.46  ? 331  PHE C CZ  1 
ATOM   9049  N  N   . CYS C  1 301 ? 33.280  38.186  3.964   1.00 36.07  ? 332  CYS C N   1 
ATOM   9050  C  CA  . CYS C  1 301 ? 34.240  37.974  2.887   1.00 36.00  ? 332  CYS C CA  1 
ATOM   9051  C  C   . CYS C  1 301 ? 35.104  36.768  3.258   1.00 36.88  ? 332  CYS C C   1 
ATOM   9052  O  O   . CYS C  1 301 ? 36.111  36.892  3.951   1.00 36.58  ? 332  CYS C O   1 
ATOM   9053  C  CB  . CYS C  1 301 ? 35.113  39.223  2.723   1.00 35.32  ? 332  CYS C CB  1 
ATOM   9054  S  SG  . CYS C  1 301 ? 34.192  40.764  2.940   1.00 34.39  ? 332  CYS C SG  1 
ATOM   9055  N  N   . PRO C  1 302 ? 34.705  35.580  2.841   1.00 36.63  ? 333  PRO C N   1 
ATOM   9056  C  CA  . PRO C  1 302 ? 35.339  34.359  3.299   1.00 36.12  ? 333  PRO C CA  1 
ATOM   9057  C  C   . PRO C  1 302 ? 36.651  34.053  2.615   1.00 35.82  ? 333  PRO C C   1 
ATOM   9058  O  O   . PRO C  1 302 ? 37.544  33.386  3.162   1.00 36.66  ? 333  PRO C O   1 
ATOM   9059  C  CB  . PRO C  1 302 ? 34.293  33.276  3.018   1.00 35.28  ? 333  PRO C CB  1 
ATOM   9060  C  CG  . PRO C  1 302 ? 33.004  34.023  2.980   1.00 34.59  ? 333  PRO C CG  1 
ATOM   9061  C  CD  . PRO C  1 302 ? 33.385  35.280  2.207   1.00 35.68  ? 333  PRO C CD  1 
ATOM   9062  N  N   . GLU C  1 303 ? 36.761  34.453  1.350   1.00 34.88  ? 334  GLU C N   1 
ATOM   9063  C  CA  . GLU C  1 303 ? 37.973  34.115  0.598   1.00 36.33  ? 334  GLU C CA  1 
ATOM   9064  C  C   . GLU C  1 303 ? 38.128  35.055  -0.587  1.00 35.83  ? 334  GLU C C   1 
ATOM   9065  O  O   . GLU C  1 303 ? 37.117  35.380  -1.225  1.00 35.42  ? 334  GLU C O   1 
ATOM   9066  C  CB  . GLU C  1 303 ? 37.891  32.676  0.085   1.00 39.06  ? 334  GLU C CB  1 
ATOM   9067  C  CG  . GLU C  1 303 ? 38.574  32.433  -1.246  1.00 44.71  ? 334  GLU C CG  1 
ATOM   9068  C  CD  . GLU C  1 303 ? 38.726  30.992  -1.625  1.00 46.46  ? 334  GLU C CD  1 
ATOM   9069  O  OE1 . GLU C  1 303 ? 37.772  30.188  -1.466  1.00 49.63  ? 334  GLU C OE1 1 
ATOM   9070  O  OE2 . GLU C  1 303 ? 39.849  30.589  -2.010  1.00 45.82  ? 334  GLU C OE2 1 
ATOM   9071  N  N   . THR C  1 304 ? 39.362  35.445  -0.903  1.00 34.99  ? 335  THR C N   1 
ATOM   9072  C  CA  . THR C  1 304 ? 39.475  36.326  -2.063  1.00 33.37  ? 335  THR C CA  1 
ATOM   9073  C  C   . THR C  1 304 ? 40.137  35.635  -3.228  1.00 32.23  ? 335  THR C C   1 
ATOM   9074  O  O   . THR C  1 304 ? 41.240  35.103  -3.097  1.00 32.37  ? 335  THR C O   1 
ATOM   9075  C  CB  . THR C  1 304 ? 40.147  37.657  -1.736  1.00 34.27  ? 335  THR C CB  1 
ATOM   9076  O  OG1 . THR C  1 304 ? 39.249  38.435  -0.925  1.00 33.90  ? 335  THR C OG1 1 
ATOM   9077  C  CG2 . THR C  1 304 ? 40.575  38.364  -2.990  1.00 32.79  ? 335  THR C CG2 1 
ATOM   9078  N  N   . ALA C  1 305 ? 39.468  35.628  -4.377  1.00 30.72  ? 336  ALA C N   1 
ATOM   9079  C  CA  . ALA C  1 305 ? 40.074  35.029  -5.552  1.00 31.25  ? 336  ALA C CA  1 
ATOM   9080  C  C   . ALA C  1 305 ? 41.182  35.962  -6.074  1.00 33.51  ? 336  ALA C C   1 
ATOM   9081  O  O   . ALA C  1 305 ? 40.908  37.169  -6.178  1.00 34.91  ? 336  ALA C O   1 
ATOM   9082  C  CB  . ALA C  1 305 ? 39.043  34.873  -6.651  1.00 29.52  ? 336  ALA C CB  1 
ATOM   9083  N  N   . MET C  1 306 ? 42.342  35.431  -6.371  1.00 33.78  ? 337  MET C N   1 
ATOM   9084  C  CA  . MET C  1 306 ? 43.462  36.195  -6.882  1.00 33.63  ? 337  MET C CA  1 
ATOM   9085  C  C   . MET C  1 306 ? 43.926  35.633  -8.216  1.00 33.42  ? 337  MET C C   1 
ATOM   9086  O  O   . MET C  1 306 ? 44.035  34.417  -8.385  1.00 35.06  ? 337  MET C O   1 
ATOM   9087  C  CB  . MET C  1 306 ? 44.607  36.153  -5.858  1.00 36.41  ? 337  MET C CB  1 
ATOM   9088  C  CG  . MET C  1 306 ? 44.240  36.863  -4.555  1.00 40.63  ? 337  MET C CG  1 
ATOM   9089  S  SD  . MET C  1 306 ? 43.862  38.622  -4.817  1.00 49.45  ? 337  MET C SD  1 
ATOM   9090  C  CE  . MET C  1 306 ? 45.535  39.290  -4.857  1.00 43.45  ? 337  MET C CE  1 
ATOM   9091  N  N   . SER C  1 307 ? 44.202  36.500  -9.177  1.00 33.47  ? 338  SER C N   1 
ATOM   9092  C  CA  . SER C  1 307 ? 44.718  36.088  -10.480 1.00 34.78  ? 338  SER C CA  1 
ATOM   9093  C  C   . SER C  1 307 ? 46.163  36.561  -10.663 1.00 36.32  ? 338  SER C C   1 
ATOM   9094  O  O   . SER C  1 307 ? 46.861  36.224  -11.614 1.00 37.70  ? 338  SER C O   1 
ATOM   9095  C  CB  . SER C  1 307 ? 43.852  36.632  -11.603 1.00 33.04  ? 338  SER C CB  1 
ATOM   9096  O  OG  . SER C  1 307 ? 42.567  36.033  -11.587 1.00 33.78  ? 338  SER C OG  1 
ATOM   9097  N  N   . THR C  1 308 ? 46.591  37.361  -9.710  1.00 36.19  ? 339  THR C N   1 
ATOM   9098  C  CA  . THR C  1 308 ? 47.944  37.905  -9.654  1.00 34.91  ? 339  THR C CA  1 
ATOM   9099  C  C   . THR C  1 308 ? 48.231  38.145  -8.185  1.00 34.49  ? 339  THR C C   1 
ATOM   9100  O  O   . THR C  1 308 ? 47.282  38.096  -7.385  1.00 36.13  ? 339  THR C O   1 
ATOM   9101  C  CB  . THR C  1 308 ? 48.016  39.182  -10.487 1.00 36.58  ? 339  THR C CB  1 
ATOM   9102  O  OG1 . THR C  1 308 ? 49.106  39.065  -11.403 1.00 39.00  ? 339  THR C OG1 1 
ATOM   9103  C  CG2 . THR C  1 308 ? 48.115  40.446  -9.668  1.00 35.88  ? 339  THR C CG2 1 
ATOM   9104  N  N   . VAL C  1 309 ? 49.471  38.301  -7.777  1.00 33.97  ? 340  VAL C N   1 
ATOM   9105  C  CA  . VAL C  1 309 ? 49.700  38.438  -6.336  1.00 35.78  ? 340  VAL C CA  1 
ATOM   9106  C  C   . VAL C  1 309 ? 50.626  39.598  -6.034  1.00 37.08  ? 340  VAL C C   1 
ATOM   9107  O  O   . VAL C  1 309 ? 51.658  39.753  -6.684  1.00 40.03  ? 340  VAL C O   1 
ATOM   9108  C  CB  . VAL C  1 309 ? 50.295  37.153  -5.728  1.00 35.60  ? 340  VAL C CB  1 
ATOM   9109  C  CG1 . VAL C  1 309 ? 50.827  37.437  -4.329  1.00 36.55  ? 340  VAL C CG1 1 
ATOM   9110  C  CG2 . VAL C  1 309 ? 49.249  36.047  -5.665  1.00 36.45  ? 340  VAL C CG2 1 
ATOM   9111  N  N   . GLY C  1 310 ? 50.287  40.362  -5.004  1.00 36.81  ? 341  GLY C N   1 
ATOM   9112  C  CA  . GLY C  1 310 ? 51.121  41.508  -4.635  1.00 37.78  ? 341  GLY C CA  1 
ATOM   9113  C  C   . GLY C  1 310 ? 51.076  42.563  -5.733  1.00 38.42  ? 341  GLY C C   1 
ATOM   9114  O  O   . GLY C  1 310 ? 50.221  42.486  -6.615  1.00 39.05  ? 341  GLY C O   1 
ATOM   9115  N  N   . GLY C  1 311 ? 51.963  43.538  -5.653  1.00 39.83  ? 342  GLY C N   1 
ATOM   9116  C  CA  . GLY C  1 311 ? 52.022  44.585  -6.658  1.00 43.86  ? 342  GLY C CA  1 
ATOM   9117  C  C   . GLY C  1 311 ? 51.009  45.689  -6.412  1.00 46.23  ? 342  GLY C C   1 
ATOM   9118  O  O   . GLY C  1 311 ? 50.442  45.819  -5.330  1.00 46.18  ? 342  GLY C O   1 
ATOM   9119  N  N   . ASN C  1 312 ? 50.783  46.491  -7.447  1.00 48.10  ? 343  ASN C N   1 
ATOM   9120  C  CA  . ASN C  1 312 ? 49.851  47.603  -7.365  1.00 49.64  ? 343  ASN C CA  1 
ATOM   9121  C  C   . ASN C  1 312 ? 48.601  47.343  -8.196  1.00 50.21  ? 343  ASN C C   1 
ATOM   9122  O  O   . ASN C  1 312 ? 47.804  48.263  -8.390  1.00 50.98  ? 343  ASN C O   1 
ATOM   9123  C  CB  . ASN C  1 312 ? 50.528  48.893  -7.842  1.00 51.55  ? 343  ASN C CB  1 
ATOM   9124  C  CG  . ASN C  1 312 ? 50.916  48.841  -9.305  1.00 53.39  ? 343  ASN C CG  1 
ATOM   9125  O  OD1 . ASN C  1 312 ? 50.280  48.177  -10.123 1.00 53.92  ? 343  ASN C OD1 1 
ATOM   9126  N  ND2 . ASN C  1 312 ? 51.983  49.555  -9.650  1.00 53.36  ? 343  ASN C ND2 1 
ATOM   9127  N  N   . SER C  1 313 ? 48.449  46.127  -8.713  1.00 50.03  ? 344  SER C N   1 
ATOM   9128  C  CA  . SER C  1 313 ? 47.285  45.804  -9.532  1.00 49.98  ? 344  SER C CA  1 
ATOM   9129  C  C   . SER C  1 313 ? 46.207  45.138  -8.683  1.00 50.09  ? 344  SER C C   1 
ATOM   9130  O  O   . SER C  1 313 ? 45.276  44.533  -9.217  1.00 49.53  ? 344  SER C O   1 
ATOM   9131  C  CB  . SER C  1 313 ? 47.649  44.917  -10.711 1.00 51.36  ? 344  SER C CB  1 
ATOM   9132  O  OG  . SER C  1 313 ? 48.539  45.559  -11.604 1.00 51.58  ? 344  SER C OG  1 
ATOM   9133  N  N   . GLU C  1 314 ? 46.393  45.157  -7.377  1.00 50.06  ? 345  GLU C N   1 
ATOM   9134  C  CA  . GLU C  1 314 ? 45.498  44.659  -6.364  1.00 49.83  ? 345  GLU C CA  1 
ATOM   9135  C  C   . GLU C  1 314 ? 44.843  43.327  -6.663  1.00 48.28  ? 345  GLU C C   1 
ATOM   9136  O  O   . GLU C  1 314 ? 43.801  43.001  -6.084  1.00 48.08  ? 345  GLU C O   1 
ATOM   9137  C  CB  . GLU C  1 314 ? 44.418  45.709  -6.060  1.00 52.31  ? 345  GLU C CB  1 
ATOM   9138  C  CG  . GLU C  1 314 ? 44.022  45.821  -4.599  1.00 54.96  ? 345  GLU C CG  1 
ATOM   9139  C  CD  . GLU C  1 314 ? 43.846  47.261  -4.147  1.00 56.75  ? 345  GLU C CD  1 
ATOM   9140  O  OE1 . GLU C  1 314 ? 42.896  47.933  -4.602  1.00 58.14  ? 345  GLU C OE1 1 
ATOM   9141  O  OE2 . GLU C  1 314 ? 44.675  47.718  -3.333  1.00 56.79  ? 345  GLU C OE2 1 
ATOM   9142  N  N   . GLY C  1 315 ? 45.425  42.511  -7.530  1.00 47.21  ? 346  GLY C N   1 
ATOM   9143  C  CA  . GLY C  1 315 ? 44.856  41.220  -7.879  1.00 44.69  ? 346  GLY C CA  1 
ATOM   9144  C  C   . GLY C  1 315 ? 44.602  41.046  -9.367  1.00 43.87  ? 346  GLY C C   1 
ATOM   9145  O  O   . GLY C  1 315 ? 44.631  39.935  -9.903  1.00 42.98  ? 346  GLY C O   1 
ATOM   9146  N  N   . ALA C  1 316 ? 44.362  42.140  -10.077 1.00 43.85  ? 347  ALA C N   1 
ATOM   9147  C  CA  . ALA C  1 316 ? 44.101  42.100  -11.509 1.00 44.38  ? 347  ALA C CA  1 
ATOM   9148  C  C   . ALA C  1 316 ? 45.092  41.201  -12.238 1.00 45.51  ? 347  ALA C C   1 
ATOM   9149  O  O   . ALA C  1 316 ? 46.297  41.168  -11.963 1.00 46.22  ? 347  ALA C O   1 
ATOM   9150  C  CB  . ALA C  1 316 ? 44.110  43.507  -12.067 1.00 44.99  ? 347  ALA C CB  1 
ATOM   9151  N  N   . PRO C  1 317 ? 44.546  40.425  -13.169 1.00 45.83  ? 348  PRO C N   1 
ATOM   9152  C  CA  . PRO C  1 317 ? 45.201  39.398  -13.944 1.00 46.92  ? 348  PRO C CA  1 
ATOM   9153  C  C   . PRO C  1 317 ? 46.258  40.014  -14.836 1.00 47.46  ? 348  PRO C C   1 
ATOM   9154  O  O   . PRO C  1 317 ? 46.375  41.242  -14.855 1.00 48.37  ? 348  PRO C O   1 
ATOM   9155  C  CB  . PRO C  1 317 ? 44.106  38.706  -14.760 1.00 46.49  ? 348  PRO C CB  1 
ATOM   9156  C  CG  . PRO C  1 317 ? 43.033  39.726  -14.873 1.00 46.64  ? 348  PRO C CG  1 
ATOM   9157  C  CD  . PRO C  1 317 ? 43.102  40.477  -13.568 1.00 45.99  ? 348  PRO C CD  1 
ATOM   9158  N  N   . CYS C  1 318 ? 47.032  39.183  -15.510 1.00 47.98  ? 349  CYS C N   1 
ATOM   9159  C  CA  . CYS C  1 318 ? 48.055  39.696  -16.410 1.00 49.23  ? 349  CYS C CA  1 
ATOM   9160  C  C   . CYS C  1 318 ? 47.461  40.097  -17.753 1.00 50.44  ? 349  CYS C C   1 
ATOM   9161  O  O   . CYS C  1 318 ? 46.314  39.713  -18.021 1.00 50.61  ? 349  CYS C O   1 
ATOM   9162  C  CB  . CYS C  1 318 ? 49.161  38.658  -16.609 1.00 48.86  ? 349  CYS C CB  1 
ATOM   9163  S  SG  . CYS C  1 318 ? 50.119  38.291  -15.121 1.00 51.31  ? 349  CYS C SG  1 
ATOM   9164  N  N   . VAL C  1 319 ? 48.227  40.809  -18.546 1.00 51.83  ? 350  VAL C N   1 
ATOM   9165  C  CA  . VAL C  1 319 ? 47.784  41.190  -19.879 1.00 54.04  ? 350  VAL C CA  1 
ATOM   9166  C  C   . VAL C  1 319 ? 48.813  40.776  -20.920 1.00 56.90  ? 350  VAL C C   1 
ATOM   9167  O  O   . VAL C  1 319 ? 49.872  41.393  -21.021 1.00 57.81  ? 350  VAL C O   1 
ATOM   9168  C  CB  . VAL C  1 319 ? 47.532  42.700  -19.989 1.00 53.06  ? 350  VAL C CB  1 
ATOM   9169  C  CG1 . VAL C  1 319 ? 47.296  43.081  -21.447 1.00 53.72  ? 350  VAL C CG1 1 
ATOM   9170  C  CG2 . VAL C  1 319 ? 46.291  43.076  -19.186 1.00 52.70  ? 350  VAL C CG2 1 
ATOM   9171  N  N   . PHE C  1 320 ? 48.518  39.718  -21.671 1.00 59.12  ? 351  PHE C N   1 
ATOM   9172  C  CA  . PHE C  1 320 ? 49.467  39.216  -22.653 1.00 60.72  ? 351  PHE C CA  1 
ATOM   9173  C  C   . PHE C  1 320 ? 49.039  39.466  -24.092 1.00 62.01  ? 351  PHE C C   1 
ATOM   9174  O  O   . PHE C  1 320 ? 47.951  39.067  -24.498 1.00 61.88  ? 351  PHE C O   1 
ATOM   9175  C  CB  . PHE C  1 320 ? 49.684  37.709  -22.463 1.00 59.69  ? 351  PHE C CB  1 
ATOM   9176  C  CG  . PHE C  1 320 ? 50.210  37.335  -21.112 1.00 59.93  ? 351  PHE C CG  1 
ATOM   9177  C  CD1 . PHE C  1 320 ? 51.389  37.881  -20.637 1.00 60.81  ? 351  PHE C CD1 1 
ATOM   9178  C  CD2 . PHE C  1 320 ? 49.531  36.436  -20.310 1.00 60.40  ? 351  PHE C CD2 1 
ATOM   9179  C  CE1 . PHE C  1 320 ? 51.871  37.535  -19.390 1.00 61.20  ? 351  PHE C CE1 1 
ATOM   9180  C  CE2 . PHE C  1 320 ? 50.009  36.085  -19.065 1.00 60.02  ? 351  PHE C CE2 1 
ATOM   9181  C  CZ  . PHE C  1 320 ? 51.186  36.635  -18.601 1.00 60.04  ? 351  PHE C CZ  1 
ATOM   9182  N  N   . PRO C  1 321 ? 49.942  40.034  -24.879 1.00 63.33  ? 352  PRO C N   1 
ATOM   9183  C  CA  . PRO C  1 321 ? 51.265  40.432  -24.427 1.00 64.17  ? 352  PRO C CA  1 
ATOM   9184  C  C   . PRO C  1 321 ? 51.318  41.855  -23.901 1.00 65.17  ? 352  PRO C C   1 
ATOM   9185  O  O   . PRO C  1 321 ? 50.475  42.689  -24.230 1.00 64.00  ? 352  PRO C O   1 
ATOM   9186  C  CB  . PRO C  1 321 ? 52.097  40.300  -25.704 1.00 63.17  ? 352  PRO C CB  1 
ATOM   9187  C  CG  . PRO C  1 321 ? 51.154  40.642  -26.796 1.00 62.82  ? 352  PRO C CG  1 
ATOM   9188  C  CD  . PRO C  1 321 ? 49.779  40.270  -26.335 1.00 62.67  ? 352  PRO C CD  1 
ATOM   9189  N  N   . PHE C  1 322 ? 52.317  42.136  -23.063 1.00 67.04  ? 353  PHE C N   1 
ATOM   9190  C  CA  . PHE C  1 322 ? 52.459  43.466  -22.480 1.00 69.35  ? 353  PHE C CA  1 
ATOM   9191  C  C   . PHE C  1 322 ? 53.811  44.081  -22.822 1.00 70.04  ? 353  PHE C C   1 
ATOM   9192  O  O   . PHE C  1 322 ? 54.752  43.359  -23.144 1.00 70.62  ? 353  PHE C O   1 
ATOM   9193  C  CB  . PHE C  1 322 ? 52.279  43.431  -20.971 1.00 70.30  ? 353  PHE C CB  1 
ATOM   9194  C  CG  . PHE C  1 322 ? 53.360  42.709  -20.223 1.00 70.72  ? 353  PHE C CG  1 
ATOM   9195  C  CD1 . PHE C  1 322 ? 53.333  41.331  -20.106 1.00 71.56  ? 353  PHE C CD1 1 
ATOM   9196  C  CD2 . PHE C  1 322 ? 54.394  43.404  -19.624 1.00 71.17  ? 353  PHE C CD2 1 
ATOM   9197  C  CE1 . PHE C  1 322 ? 54.321  40.663  -19.408 1.00 72.35  ? 353  PHE C CE1 1 
ATOM   9198  C  CE2 . PHE C  1 322 ? 55.383  42.744  -18.924 1.00 72.16  ? 353  PHE C CE2 1 
ATOM   9199  C  CZ  . PHE C  1 322 ? 55.347  41.370  -18.817 1.00 72.39  ? 353  PHE C CZ  1 
ATOM   9200  N  N   . THR C  1 323 ? 53.904  45.401  -22.701 1.00 70.53  ? 354  THR C N   1 
ATOM   9201  C  CA  . THR C  1 323 ? 55.116  46.126  -23.049 1.00 70.11  ? 354  THR C CA  1 
ATOM   9202  C  C   . THR C  1 323 ? 55.875  46.676  -21.853 1.00 68.42  ? 354  THR C C   1 
ATOM   9203  O  O   . THR C  1 323 ? 55.374  47.519  -21.110 1.00 68.08  ? 354  THR C O   1 
ATOM   9204  C  CB  . THR C  1 323 ? 54.779  47.285  -24.015 1.00 70.64  ? 354  THR C CB  1 
ATOM   9205  O  OG1 . THR C  1 323 ? 53.827  46.797  -24.975 1.00 71.30  ? 354  THR C OG1 1 
ATOM   9206  C  CG2 . THR C  1 323 ? 56.026  47.755  -24.739 1.00 70.86  ? 354  THR C CG2 1 
ATOM   9207  N  N   . PHE C  1 324 ? 57.122  46.245  -21.697 1.00 66.43  ? 355  PHE C N   1 
ATOM   9208  C  CA  . PHE C  1 324 ? 57.981  46.666  -20.598 1.00 64.68  ? 355  PHE C CA  1 
ATOM   9209  C  C   . PHE C  1 324 ? 59.335  47.136  -21.126 1.00 65.04  ? 355  PHE C C   1 
ATOM   9210  O  O   . PHE C  1 324 ? 59.989  46.411  -21.876 1.00 65.61  ? 355  PHE C O   1 
ATOM   9211  C  CB  . PHE C  1 324 ? 58.194  45.506  -19.622 1.00 62.11  ? 355  PHE C CB  1 
ATOM   9212  C  CG  . PHE C  1 324 ? 59.108  45.802  -18.473 1.00 58.48  ? 355  PHE C CG  1 
ATOM   9213  C  CD1 . PHE C  1 324 ? 58.768  46.753  -17.527 1.00 57.52  ? 355  PHE C CD1 1 
ATOM   9214  C  CD2 . PHE C  1 324 ? 60.307  45.131  -18.319 1.00 56.63  ? 355  PHE C CD2 1 
ATOM   9215  C  CE1 . PHE C  1 324 ? 59.605  47.025  -16.464 1.00 56.47  ? 355  PHE C CE1 1 
ATOM   9216  C  CE2 . PHE C  1 324 ? 61.149  45.396  -17.260 1.00 54.93  ? 355  PHE C CE2 1 
ATOM   9217  C  CZ  . PHE C  1 324 ? 60.797  46.346  -16.328 1.00 54.50  ? 355  PHE C CZ  1 
ATOM   9218  N  N   . LEU C  1 325 ? 59.728  48.343  -20.746 1.00 64.50  ? 356  LEU C N   1 
ATOM   9219  C  CA  . LEU C  1 325 ? 60.977  48.954  -21.164 1.00 63.00  ? 356  LEU C CA  1 
ATOM   9220  C  C   . LEU C  1 325 ? 61.132  48.946  -22.679 1.00 63.38  ? 356  LEU C C   1 
ATOM   9221  O  O   . LEU C  1 325 ? 62.201  48.661  -23.213 1.00 62.81  ? 356  LEU C O   1 
ATOM   9222  C  CB  . LEU C  1 325 ? 62.185  48.288  -20.519 1.00 60.70  ? 356  LEU C CB  1 
ATOM   9223  C  CG  . LEU C  1 325 ? 62.288  48.312  -18.999 1.00 58.95  ? 356  LEU C CG  1 
ATOM   9224  C  CD1 . LEU C  1 325 ? 63.646  47.790  -18.550 1.00 57.79  ? 356  LEU C CD1 1 
ATOM   9225  C  CD2 . LEU C  1 325 ? 62.041  49.703  -18.446 1.00 57.20  ? 356  LEU C CD2 1 
ATOM   9226  N  N   . GLY C  1 326 ? 60.035  49.215  -23.379 1.00 64.12  ? 357  GLY C N   1 
ATOM   9227  C  CA  . GLY C  1 326 ? 60.016  49.237  -24.828 1.00 65.35  ? 357  GLY C CA  1 
ATOM   9228  C  C   . GLY C  1 326 ? 59.810  47.860  -25.438 1.00 66.14  ? 357  GLY C C   1 
ATOM   9229  O  O   . GLY C  1 326 ? 59.260  47.728  -26.533 1.00 65.08  ? 357  GLY C O   1 
ATOM   9230  N  N   . ASN C  1 327 ? 60.260  46.822  -24.746 1.00 67.79  ? 358  ASN C N   1 
ATOM   9231  C  CA  . ASN C  1 327 ? 60.125  45.462  -25.242 1.00 70.13  ? 358  ASN C CA  1 
ATOM   9232  C  C   . ASN C  1 327 ? 58.754  44.881  -24.921 1.00 71.02  ? 358  ASN C C   1 
ATOM   9233  O  O   . ASN C  1 327 ? 58.066  45.347  -24.015 1.00 72.13  ? 358  ASN C O   1 
ATOM   9234  C  CB  . ASN C  1 327 ? 61.225  44.569  -24.675 1.00 71.37  ? 358  ASN C CB  1 
ATOM   9235  C  CG  . ASN C  1 327 ? 62.536  44.722  -25.419 1.00 72.48  ? 358  ASN C CG  1 
ATOM   9236  O  OD1 . ASN C  1 327 ? 63.553  45.092  -24.831 1.00 73.39  ? 358  ASN C OD1 1 
ATOM   9237  N  ND2 . ASN C  1 327 ? 62.513  44.442  -26.717 1.00 72.54  ? 358  ASN C ND2 1 
ATOM   9238  N  N   . LYS C  1 328 ? 58.377  43.859  -25.678 1.00 70.64  ? 359  LYS C N   1 
ATOM   9239  C  CA  . LYS C  1 328 ? 57.080  43.211  -25.523 1.00 69.83  ? 359  LYS C CA  1 
ATOM   9240  C  C   . LYS C  1 328 ? 57.239  41.790  -24.999 1.00 68.60  ? 359  LYS C C   1 
ATOM   9241  O  O   . LYS C  1 328 ? 58.215  41.102  -25.302 1.00 68.25  ? 359  LYS C O   1 
ATOM   9242  C  CB  . LYS C  1 328 ? 56.348  43.213  -26.863 1.00 71.20  ? 359  LYS C CB  1 
ATOM   9243  C  CG  . LYS C  1 328 ? 54.913  42.733  -26.832 1.00 72.13  ? 359  LYS C CG  1 
ATOM   9244  C  CD  . LYS C  1 328 ? 54.412  42.393  -28.228 1.00 72.06  ? 359  LYS C CD  1 
ATOM   9245  C  CE  . LYS C  1 328 ? 55.201  41.255  -28.848 1.00 73.42  ? 359  LYS C CE  1 
ATOM   9246  N  NZ  . LYS C  1 328 ? 55.369  40.099  -27.926 1.00 71.93  ? 359  LYS C NZ  1 
ATOM   9247  N  N   . TYR C  1 329 ? 56.339  41.402  -24.097 1.00 66.89  ? 360  TYR C N   1 
ATOM   9248  C  CA  . TYR C  1 329 ? 56.397  40.089  -23.470 1.00 64.96  ? 360  TYR C CA  1 
ATOM   9249  C  C   . TYR C  1 329 ? 55.069  39.361  -23.660 1.00 64.91  ? 360  TYR C C   1 
ATOM   9250  O  O   . TYR C  1 329 ? 54.019  39.999  -23.619 1.00 65.84  ? 360  TYR C O   1 
ATOM   9251  C  CB  . TYR C  1 329 ? 56.674  40.219  -21.972 1.00 64.03  ? 360  TYR C CB  1 
ATOM   9252  C  CG  . TYR C  1 329 ? 57.995  40.878  -21.647 1.00 63.03  ? 360  TYR C CG  1 
ATOM   9253  C  CD1 . TYR C  1 329 ? 58.220  42.212  -21.949 1.00 61.74  ? 360  TYR C CD1 1 
ATOM   9254  C  CD2 . TYR C  1 329 ? 59.015  40.164  -21.034 1.00 62.62  ? 360  TYR C CD2 1 
ATOM   9255  C  CE1 . TYR C  1 329 ? 59.423  42.817  -21.670 1.00 61.56  ? 360  TYR C CE1 1 
ATOM   9256  C  CE2 . TYR C  1 329 ? 60.223  40.763  -20.738 1.00 61.59  ? 360  TYR C CE2 1 
ATOM   9257  C  CZ  . TYR C  1 329 ? 60.419  42.089  -21.058 1.00 61.55  ? 360  TYR C CZ  1 
ATOM   9258  O  OH  . TYR C  1 329 ? 61.626  42.669  -20.752 1.00 61.66  ? 360  TYR C OH  1 
ATOM   9259  N  N   . GLU C  1 330 ? 55.146  38.055  -23.860 1.00 63.17  ? 361  GLU C N   1 
ATOM   9260  C  CA  . GLU C  1 330 ? 53.941  37.252  -24.065 1.00 60.54  ? 361  GLU C CA  1 
ATOM   9261  C  C   . GLU C  1 330 ? 53.785  36.268  -22.910 1.00 58.24  ? 361  GLU C C   1 
ATOM   9262  O  O   . GLU C  1 330 ? 53.060  35.286  -23.020 1.00 58.05  ? 361  GLU C O   1 
ATOM   9263  C  CB  . GLU C  1 330 ? 54.051  36.490  -25.383 1.00 62.11  ? 361  GLU C CB  1 
ATOM   9264  C  CG  . GLU C  1 330 ? 54.314  37.363  -26.599 1.00 64.39  ? 361  GLU C CG  1 
ATOM   9265  C  CD  . GLU C  1 330 ? 53.105  37.470  -27.508 1.00 65.76  ? 361  GLU C CD  1 
ATOM   9266  O  OE1 . GLU C  1 330 ? 51.973  37.290  -27.008 1.00 66.29  ? 361  GLU C OE1 1 
ATOM   9267  O  OE2 . GLU C  1 330 ? 53.265  37.727  -28.720 1.00 66.44  ? 361  GLU C OE2 1 
ATOM   9268  N  N   . SER C  1 331 ? 54.490  36.538  -21.818 1.00 55.25  ? 362  SER C N   1 
ATOM   9269  C  CA  . SER C  1 331 ? 54.453  35.654  -20.661 1.00 52.67  ? 362  SER C CA  1 
ATOM   9270  C  C   . SER C  1 331 ? 55.033  36.366  -19.442 1.00 51.70  ? 362  SER C C   1 
ATOM   9271  O  O   . SER C  1 331 ? 55.581  37.453  -19.570 1.00 52.22  ? 362  SER C O   1 
ATOM   9272  C  CB  . SER C  1 331 ? 55.321  34.415  -20.941 1.00 51.86  ? 362  SER C CB  1 
ATOM   9273  O  OG  . SER C  1 331 ? 56.651  34.652  -20.523 1.00 49.95  ? 362  SER C OG  1 
ATOM   9274  N  N   . CYS C  1 332 ? 54.876  35.739  -18.282 1.00 50.56  ? 363  CYS C N   1 
ATOM   9275  C  CA  . CYS C  1 332 ? 55.444  36.347  -17.088 1.00 49.39  ? 363  CYS C CA  1 
ATOM   9276  C  C   . CYS C  1 332 ? 56.962  36.436  -17.179 1.00 49.77  ? 363  CYS C C   1 
ATOM   9277  O  O   . CYS C  1 332 ? 57.596  35.458  -17.572 1.00 50.79  ? 363  CYS C O   1 
ATOM   9278  C  CB  . CYS C  1 332 ? 55.035  35.560  -15.841 1.00 46.90  ? 363  CYS C CB  1 
ATOM   9279  S  SG  . CYS C  1 332 ? 53.264  35.603  -15.479 1.00 47.77  ? 363  CYS C SG  1 
ATOM   9280  N  N   . THR C  1 333 ? 57.499  37.589  -16.853 1.00 49.26  ? 364  THR C N   1 
ATOM   9281  C  CA  . THR C  1 333 ? 58.938  37.761  -16.911 1.00 48.61  ? 364  THR C CA  1 
ATOM   9282  C  C   . THR C  1 333 ? 59.515  38.081  -15.535 1.00 48.08  ? 364  THR C C   1 
ATOM   9283  O  O   . THR C  1 333 ? 58.812  38.275  -14.556 1.00 48.29  ? 364  THR C O   1 
ATOM   9284  C  CB  . THR C  1 333 ? 59.334  38.930  -17.842 1.00 48.42  ? 364  THR C CB  1 
ATOM   9285  O  OG1 . THR C  1 333 ? 60.762  39.037  -17.872 1.00 48.15  ? 364  THR C OG1 1 
ATOM   9286  C  CG2 . THR C  1 333 ? 58.782  40.234  -17.280 1.00 49.41  ? 364  THR C CG2 1 
ATOM   9287  N  N   . SER C  1 334 ? 60.832  38.171  -15.504 1.00 47.18  ? 365  SER C N   1 
ATOM   9288  C  CA  . SER C  1 334 ? 61.531  38.644  -14.302 1.00 46.59  ? 365  SER C CA  1 
ATOM   9289  C  C   . SER C  1 334 ? 62.310  39.920  -14.647 1.00 46.26  ? 365  SER C C   1 
ATOM   9290  O  O   . SER C  1 334 ? 62.948  40.541  -13.820 1.00 45.69  ? 365  SER C O   1 
ATOM   9291  C  CB  . SER C  1 334 ? 62.538  37.545  -13.936 1.00 47.65  ? 365  SER C CB  1 
ATOM   9292  O  OG  . SER C  1 334 ? 62.963  36.877  -15.116 1.00 47.53  ? 365  SER C OG  1 
ATOM   9293  N  N   . ALA C  1 335 ? 62.232  40.241  -15.937 1.00 46.26  ? 366  ALA C N   1 
ATOM   9294  C  CA  . ALA C  1 335 ? 62.910  41.401  -16.481 1.00 47.16  ? 366  ALA C CA  1 
ATOM   9295  C  C   . ALA C  1 335 ? 62.851  42.562  -15.505 1.00 48.57  ? 366  ALA C C   1 
ATOM   9296  O  O   . ALA C  1 335 ? 61.771  43.029  -15.150 1.00 50.78  ? 366  ALA C O   1 
ATOM   9297  C  CB  . ALA C  1 335 ? 62.316  41.807  -17.822 1.00 45.55  ? 366  ALA C CB  1 
ATOM   9298  N  N   . GLY C  1 336 ? 64.010  43.014  -15.054 1.00 49.23  ? 367  GLY C N   1 
ATOM   9299  C  CA  . GLY C  1 336 ? 64.062  44.162  -14.162 1.00 50.28  ? 367  GLY C CA  1 
ATOM   9300  C  C   . GLY C  1 336 ? 64.427  43.931  -12.662 1.00 51.91  ? 367  GLY C C   1 
ATOM   9301  O  O   . GLY C  1 336 ? 64.402  44.855  -11.841 1.00 53.03  ? 367  GLY C O   1 
ATOM   9302  N  N   . ARG C  1 337 ? 64.785  42.740  -12.189 1.00 53.67  ? 368  ARG C N   1 
ATOM   9303  C  CA  . ARG C  1 337 ? 65.116  42.616  -10.760 1.00 55.82  ? 368  ARG C CA  1 
ATOM   9304  C  C   . ARG C  1 337 ? 66.321  41.739  -10.540 1.00 56.78  ? 368  ARG C C   1 
ATOM   9305  O  O   . ARG C  1 337 ? 66.866  41.170  -11.485 1.00 57.39  ? 368  ARG C O   1 
ATOM   9306  C  CB  . ARG C  1 337 ? 63.968  42.035  -9.934  1.00 54.42  ? 368  ARG C CB  1 
ATOM   9307  C  CG  . ARG C  1 337 ? 62.693  41.800  -10.727 1.00 52.87  ? 368  ARG C CG  1 
ATOM   9308  C  CD  . ARG C  1 337 ? 61.591  41.232  -9.847  1.00 50.41  ? 368  ARG C CD  1 
ATOM   9309  N  NE  . ARG C  1 337 ? 60.949  42.265  -9.040  1.00 46.84  ? 368  ARG C NE  1 
ATOM   9310  C  CZ  . ARG C  1 337 ? 60.533  42.085  -7.791  1.00 44.10  ? 368  ARG C CZ  1 
ATOM   9311  N  NH1 . ARG C  1 337 ? 60.694  40.908  -7.202  1.00 42.07  ? 368  ARG C NH1 1 
ATOM   9312  N  NH2 . ARG C  1 337 ? 59.959  43.083  -7.133  1.00 45.43  ? 368  ARG C NH2 1 
ATOM   9313  N  N   . SER C  1 338 ? 66.706  41.642  -9.286  1.00 57.19  ? 369  SER C N   1 
ATOM   9314  C  CA  . SER C  1 338 ? 67.755  40.730  -8.890  1.00 57.71  ? 369  SER C CA  1 
ATOM   9315  C  C   . SER C  1 338 ? 67.297  39.429  -8.255  1.00 56.70  ? 369  SER C C   1 
ATOM   9316  O  O   . SER C  1 338 ? 68.098  38.529  -8.016  1.00 58.18  ? 369  SER C O   1 
ATOM   9317  C  CB  . SER C  1 338 ? 68.646  41.496  -7.911  1.00 60.13  ? 369  SER C CB  1 
ATOM   9318  O  OG  . SER C  1 338 ? 67.905  41.923  -6.778  1.00 60.17  ? 369  SER C OG  1 
ATOM   9319  N  N   . ASP C  1 339 ? 65.999  39.299  -7.980  1.00 55.01  ? 370  ASP C N   1 
ATOM   9320  C  CA  . ASP C  1 339 ? 65.533  38.105  -7.294  1.00 54.27  ? 370  ASP C CA  1 
ATOM   9321  C  C   . ASP C  1 339 ? 64.846  37.085  -8.186  1.00 53.04  ? 370  ASP C C   1 
ATOM   9322  O  O   . ASP C  1 339 ? 64.313  36.089  -7.700  1.00 51.65  ? 370  ASP C O   1 
ATOM   9323  C  CB  . ASP C  1 339 ? 64.645  38.452  -6.090  1.00 55.25  ? 370  ASP C CB  1 
ATOM   9324  C  CG  . ASP C  1 339 ? 63.329  39.104  -6.458  1.00 55.07  ? 370  ASP C CG  1 
ATOM   9325  O  OD1 . ASP C  1 339 ? 62.828  38.848  -7.569  1.00 55.10  ? 370  ASP C OD1 1 
ATOM   9326  O  OD2 . ASP C  1 339 ? 62.799  39.871  -5.624  1.00 53.84  ? 370  ASP C OD2 1 
ATOM   9327  N  N   . GLY C  1 340 ? 64.803  37.342  -9.485  1.00 52.44  ? 371  GLY C N   1 
ATOM   9328  C  CA  . GLY C  1 340 ? 64.222  36.461  -10.463 1.00 52.22  ? 371  GLY C CA  1 
ATOM   9329  C  C   . GLY C  1 340 ? 62.806  36.004  -10.211 1.00 51.62  ? 371  GLY C C   1 
ATOM   9330  O  O   . GLY C  1 340 ? 62.399  34.935  -10.680 1.00 51.25  ? 371  GLY C O   1 
ATOM   9331  N  N   . LYS C  1 341 ? 62.008  36.798  -9.506  1.00 51.81  ? 372  LYS C N   1 
ATOM   9332  C  CA  . LYS C  1 341 ? 60.611  36.450  -9.261  1.00 51.11  ? 372  LYS C CA  1 
ATOM   9333  C  C   . LYS C  1 341 ? 59.783  36.883  -10.472 1.00 49.80  ? 372  LYS C C   1 
ATOM   9334  O  O   . LYS C  1 341 ? 60.033  37.948  -11.028 1.00 49.58  ? 372  LYS C O   1 
ATOM   9335  C  CB  . LYS C  1 341 ? 60.082  37.126  -8.006  1.00 52.34  ? 372  LYS C CB  1 
ATOM   9336  C  CG  . LYS C  1 341 ? 60.643  36.596  -6.701  1.00 54.40  ? 372  LYS C CG  1 
ATOM   9337  C  CD  . LYS C  1 341 ? 59.938  37.214  -5.507  1.00 57.06  ? 372  LYS C CD  1 
ATOM   9338  C  CE  . LYS C  1 341 ? 60.560  36.807  -4.186  1.00 58.54  ? 372  LYS C CE  1 
ATOM   9339  N  NZ  . LYS C  1 341 ? 60.039  37.623  -3.048  1.00 59.60  ? 372  LYS C NZ  1 
ATOM   9340  N  N   . MET C  1 342 ? 58.837  36.051  -10.866 1.00 48.58  ? 373  MET C N   1 
ATOM   9341  C  CA  . MET C  1 342 ? 58.016  36.317  -12.033 1.00 48.09  ? 373  MET C CA  1 
ATOM   9342  C  C   . MET C  1 342 ? 56.935  37.353  -11.777 1.00 47.67  ? 373  MET C C   1 
ATOM   9343  O  O   . MET C  1 342 ? 56.137  37.234  -10.850 1.00 46.81  ? 373  MET C O   1 
ATOM   9344  C  CB  . MET C  1 342 ? 57.398  35.004  -12.533 1.00 48.62  ? 373  MET C CB  1 
ATOM   9345  C  CG  . MET C  1 342 ? 58.439  33.938  -12.839 1.00 48.20  ? 373  MET C CG  1 
ATOM   9346  S  SD  . MET C  1 342 ? 59.906  34.622  -13.636 1.00 46.42  ? 373  MET C SD  1 
ATOM   9347  C  CE  . MET C  1 342 ? 59.484  34.396  -15.360 1.00 44.66  ? 373  MET C CE  1 
ATOM   9348  N  N   . TRP C  1 343 ? 56.902  38.384  -12.610 1.00 47.43  ? 374  TRP C N   1 
ATOM   9349  C  CA  . TRP C  1 343 ? 55.912  39.446  -12.523 1.00 47.04  ? 374  TRP C CA  1 
ATOM   9350  C  C   . TRP C  1 343 ? 55.347  39.728  -13.914 1.00 46.16  ? 374  TRP C C   1 
ATOM   9351  O  O   . TRP C  1 343 ? 55.911  39.288  -14.918 1.00 46.15  ? 374  TRP C O   1 
ATOM   9352  C  CB  . TRP C  1 343 ? 56.521  40.726  -11.923 1.00 47.11  ? 374  TRP C CB  1 
ATOM   9353  C  CG  . TRP C  1 343 ? 57.397  41.446  -12.903 1.00 46.69  ? 374  TRP C CG  1 
ATOM   9354  C  CD1 . TRP C  1 343 ? 58.719  41.214  -13.125 1.00 46.80  ? 374  TRP C CD1 1 
ATOM   9355  C  CD2 . TRP C  1 343 ? 57.016  42.485  -13.811 1.00 46.96  ? 374  TRP C CD2 1 
ATOM   9356  N  NE1 . TRP C  1 343 ? 59.190  42.046  -14.110 1.00 46.75  ? 374  TRP C NE1 1 
ATOM   9357  C  CE2 . TRP C  1 343 ? 58.164  42.833  -14.552 1.00 46.53  ? 374  TRP C CE2 1 
ATOM   9358  C  CE3 . TRP C  1 343 ? 55.826  43.162  -14.075 1.00 46.78  ? 374  TRP C CE3 1 
ATOM   9359  C  CZ2 . TRP C  1 343 ? 58.146  43.820  -15.532 1.00 47.52  ? 374  TRP C CZ2 1 
ATOM   9360  C  CZ3 . TRP C  1 343 ? 55.810  44.135  -15.053 1.00 46.97  ? 374  TRP C CZ3 1 
ATOM   9361  C  CH2 . TRP C  1 343 ? 56.965  44.458  -15.771 1.00 46.44  ? 374  TRP C CH2 1 
ATOM   9362  N  N   . CYS C  1 344 ? 54.242  40.450  -13.971 1.00 44.94  ? 375  CYS C N   1 
ATOM   9363  C  CA  . CYS C  1 344 ? 53.637  40.778  -15.252 1.00 45.87  ? 375  CYS C CA  1 
ATOM   9364  C  C   . CYS C  1 344 ? 52.844  42.085  -15.098 1.00 46.34  ? 375  CYS C C   1 
ATOM   9365  O  O   . CYS C  1 344 ? 52.419  42.457  -14.014 1.00 46.33  ? 375  CYS C O   1 
ATOM   9366  C  CB  . CYS C  1 344 ? 52.602  39.688  -15.612 1.00 48.00  ? 375  CYS C CB  1 
ATOM   9367  S  SG  . CYS C  1 344 ? 51.167  39.872  -14.497 1.00 48.55  ? 375  CYS C SG  1 
ATOM   9368  N  N   . ALA C  1 345 ? 52.767  42.782  -16.219 1.00 45.59  ? 376  ALA C N   1 
ATOM   9369  C  CA  . ALA C  1 345 ? 52.017  44.041  -16.219 1.00 44.79  ? 376  ALA C CA  1 
ATOM   9370  C  C   . ALA C  1 345 ? 50.559  43.647  -16.349 1.00 45.49  ? 376  ALA C C   1 
ATOM   9371  O  O   . ALA C  1 345 ? 50.230  42.702  -17.074 1.00 46.50  ? 376  ALA C O   1 
ATOM   9372  C  CB  . ALA C  1 345 ? 52.455  44.880  -17.396 1.00 43.68  ? 376  ALA C CB  1 
ATOM   9373  N  N   . THR C  1 346 ? 49.681  44.328  -15.659 1.00 44.80  ? 377  THR C N   1 
ATOM   9374  C  CA  . THR C  1 346 ? 48.275  43.987  -15.739 1.00 42.68  ? 377  THR C CA  1 
ATOM   9375  C  C   . THR C  1 346 ? 47.594  44.812  -16.821 1.00 44.39  ? 377  THR C C   1 
ATOM   9376  O  O   . THR C  1 346 ? 46.370  44.905  -16.872 1.00 44.15  ? 377  THR C O   1 
ATOM   9377  C  CB  . THR C  1 346 ? 47.606  44.185  -14.386 1.00 40.41  ? 377  THR C CB  1 
ATOM   9378  O  OG1 . THR C  1 346 ? 47.781  45.541  -13.965 1.00 40.28  ? 377  THR C OG1 1 
ATOM   9379  C  CG2 . THR C  1 346 ? 48.224  43.245  -13.358 1.00 36.41  ? 377  THR C CG2 1 
ATOM   9380  N  N   . THR C  1 347 ? 48.399  45.400  -17.698 1.00 45.15  ? 378  THR C N   1 
ATOM   9381  C  CA  . THR C  1 347 ? 47.860  46.225  -18.765 1.00 44.24  ? 378  THR C CA  1 
ATOM   9382  C  C   . THR C  1 347 ? 48.696  46.130  -20.017 1.00 46.20  ? 378  THR C C   1 
ATOM   9383  O  O   . THR C  1 347 ? 49.932  46.163  -19.946 1.00 46.52  ? 378  THR C O   1 
ATOM   9384  C  CB  . THR C  1 347 ? 47.786  47.680  -18.298 1.00 41.67  ? 378  THR C CB  1 
ATOM   9385  O  OG1 . THR C  1 347 ? 47.565  48.540  -19.416 1.00 40.12  ? 378  THR C OG1 1 
ATOM   9386  C  CG2 . THR C  1 347 ? 49.078  48.073  -17.590 1.00 40.53  ? 378  THR C CG2 1 
ATOM   9387  N  N   . ALA C  1 348 ? 48.094  46.077  -21.207 1.00 47.64  ? 379  ALA C N   1 
ATOM   9388  C  CA  . ALA C  1 348 ? 48.899  45.989  -22.427 1.00 48.32  ? 379  ALA C CA  1 
ATOM   9389  C  C   . ALA C  1 348 ? 50.187  46.776  -22.326 1.00 48.67  ? 379  ALA C C   1 
ATOM   9390  O  O   . ALA C  1 348 ? 51.235  46.291  -22.775 1.00 48.50  ? 379  ALA C O   1 
ATOM   9391  C  CB  . ALA C  1 348 ? 48.091  46.335  -23.656 1.00 47.71  ? 379  ALA C CB  1 
ATOM   9392  N  N   . ASN C  1 349 ? 50.210  47.973  -21.741 1.00 48.91  ? 380  ASN C N   1 
ATOM   9393  C  CA  . ASN C  1 349 ? 51.471  48.677  -21.564 1.00 49.79  ? 380  ASN C CA  1 
ATOM   9394  C  C   . ASN C  1 349 ? 51.783  48.951  -20.098 1.00 50.45  ? 380  ASN C C   1 
ATOM   9395  O  O   . ASN C  1 349 ? 50.893  49.336  -19.341 1.00 51.52  ? 380  ASN C O   1 
ATOM   9396  C  CB  . ASN C  1 349 ? 51.533  49.970  -22.368 1.00 51.02  ? 380  ASN C CB  1 
ATOM   9397  C  CG  . ASN C  1 349 ? 52.933  50.562  -22.311 1.00 52.89  ? 380  ASN C CG  1 
ATOM   9398  O  OD1 . ASN C  1 349 ? 53.363  51.010  -21.249 1.00 53.85  ? 380  ASN C OD1 1 
ATOM   9399  N  ND2 . ASN C  1 349 ? 53.622  50.541  -23.441 1.00 53.27  ? 380  ASN C ND2 1 
ATOM   9400  N  N   . TYR C  1 350 ? 53.038  48.755  -19.694 1.00 50.45  ? 381  TYR C N   1 
ATOM   9401  C  CA  . TYR C  1 350 ? 53.453  48.975  -18.315 1.00 50.07  ? 381  TYR C CA  1 
ATOM   9402  C  C   . TYR C  1 350 ? 54.084  50.352  -18.147 1.00 51.40  ? 381  TYR C C   1 
ATOM   9403  O  O   . TYR C  1 350 ? 53.881  51.041  -17.161 1.00 52.02  ? 381  TYR C O   1 
ATOM   9404  C  CB  . TYR C  1 350 ? 54.458  47.927  -17.813 1.00 46.37  ? 381  TYR C CB  1 
ATOM   9405  C  CG  . TYR C  1 350 ? 55.133  48.262  -16.499 1.00 42.44  ? 381  TYR C CG  1 
ATOM   9406  C  CD1 . TYR C  1 350 ? 56.168  49.188  -16.468 1.00 41.13  ? 381  TYR C CD1 1 
ATOM   9407  C  CD2 . TYR C  1 350 ? 54.775  47.682  -15.293 1.00 40.87  ? 381  TYR C CD2 1 
ATOM   9408  C  CE1 . TYR C  1 350 ? 56.806  49.535  -15.299 1.00 39.63  ? 381  TYR C CE1 1 
ATOM   9409  C  CE2 . TYR C  1 350 ? 55.409  48.012  -14.107 1.00 39.64  ? 381  TYR C CE2 1 
ATOM   9410  C  CZ  . TYR C  1 350 ? 56.430  48.940  -14.114 1.00 39.61  ? 381  TYR C CZ  1 
ATOM   9411  O  OH  . TYR C  1 350 ? 57.083  49.291  -12.957 1.00 37.43  ? 381  TYR C OH  1 
ATOM   9412  N  N   . ASP C  1 351 ? 54.974  50.674  -19.081 1.00 52.89  ? 382  ASP C N   1 
ATOM   9413  C  CA  . ASP C  1 351 ? 55.833  51.853  -18.904 1.00 53.15  ? 382  ASP C CA  1 
ATOM   9414  C  C   . ASP C  1 351 ? 54.941  53.024  -18.530 1.00 53.83  ? 382  ASP C C   1 
ATOM   9415  O  O   . ASP C  1 351 ? 55.155  53.671  -17.507 1.00 55.00  ? 382  ASP C O   1 
ATOM   9416  C  CB  . ASP C  1 351 ? 56.547  52.130  -20.223 1.00 53.18  ? 382  ASP C CB  1 
ATOM   9417  C  CG  . ASP C  1 351 ? 57.694  51.162  -20.455 1.00 53.60  ? 382  ASP C CG  1 
ATOM   9418  O  OD1 . ASP C  1 351 ? 58.542  51.052  -19.549 1.00 51.83  ? 382  ASP C OD1 1 
ATOM   9419  O  OD2 . ASP C  1 351 ? 57.707  50.543  -21.537 1.00 54.67  ? 382  ASP C OD2 1 
ATOM   9420  N  N   . ASP C  1 352 ? 53.929  53.284  -19.349 1.00 53.66  ? 383  ASP C N   1 
ATOM   9421  C  CA  . ASP C  1 352 ? 53.034  54.396  -19.098 1.00 55.22  ? 383  ASP C CA  1 
ATOM   9422  C  C   . ASP C  1 352 ? 52.065  54.177  -17.956 1.00 55.51  ? 383  ASP C C   1 
ATOM   9423  O  O   . ASP C  1 352 ? 51.899  55.101  -17.143 1.00 56.52  ? 383  ASP C O   1 
ATOM   9424  C  CB  . ASP C  1 352 ? 52.326  54.834  -20.372 1.00 56.71  ? 383  ASP C CB  1 
ATOM   9425  C  CG  . ASP C  1 352 ? 51.980  53.671  -21.284 1.00 58.38  ? 383  ASP C CG  1 
ATOM   9426  O  OD1 . ASP C  1 352 ? 51.310  52.738  -20.794 1.00 61.63  ? 383  ASP C OD1 1 
ATOM   9427  O  OD2 . ASP C  1 352 ? 52.379  53.708  -22.463 1.00 57.95  ? 383  ASP C OD2 1 
ATOM   9428  N  N   . ASP C  1 353 ? 51.435  53.015  -17.842 1.00 54.29  ? 384  ASP C N   1 
ATOM   9429  C  CA  . ASP C  1 353 ? 50.462  52.737  -16.798 1.00 52.87  ? 384  ASP C CA  1 
ATOM   9430  C  C   . ASP C  1 353 ? 51.091  52.298  -15.482 1.00 51.90  ? 384  ASP C C   1 
ATOM   9431  O  O   . ASP C  1 353 ? 50.498  52.487  -14.419 1.00 50.03  ? 384  ASP C O   1 
ATOM   9432  C  CB  . ASP C  1 353 ? 49.465  51.664  -17.241 1.00 54.35  ? 384  ASP C CB  1 
ATOM   9433  C  CG  . ASP C  1 353 ? 48.712  52.052  -18.496 1.00 55.43  ? 384  ASP C CG  1 
ATOM   9434  O  OD1 . ASP C  1 353 ? 48.268  53.212  -18.578 1.00 55.31  ? 384  ASP C OD1 1 
ATOM   9435  O  OD2 . ASP C  1 353 ? 48.571  51.188  -19.384 1.00 56.50  ? 384  ASP C OD2 1 
ATOM   9436  N  N   . ARG C  1 354 ? 52.221  51.627  -15.553 1.00 51.79  ? 385  ARG C N   1 
ATOM   9437  C  CA  . ARG C  1 354 ? 53.005  51.152  -14.441 1.00 51.75  ? 385  ARG C CA  1 
ATOM   9438  C  C   . ARG C  1 354 ? 52.253  50.287  -13.454 1.00 49.80  ? 385  ARG C C   1 
ATOM   9439  O  O   . ARG C  1 354 ? 52.520  50.300  -12.249 1.00 48.88  ? 385  ARG C O   1 
ATOM   9440  C  CB  . ARG C  1 354 ? 53.741  52.299  -13.742 1.00 53.66  ? 385  ARG C CB  1 
ATOM   9441  C  CG  . ARG C  1 354 ? 55.175  52.500  -14.193 1.00 57.90  ? 385  ARG C CG  1 
ATOM   9442  C  CD  . ARG C  1 354 ? 55.721  53.877  -13.876 1.00 60.90  ? 385  ARG C CD  1 
ATOM   9443  N  NE  . ARG C  1 354 ? 56.018  54.082  -12.474 1.00 66.01  ? 385  ARG C NE  1 
ATOM   9444  C  CZ  . ARG C  1 354 ? 57.035  53.587  -11.786 1.00 69.56  ? 385  ARG C CZ  1 
ATOM   9445  N  NH1 . ARG C  1 354 ? 57.937  52.801  -12.362 1.00 71.15  ? 385  ARG C NH1 1 
ATOM   9446  N  NH2 . ARG C  1 354 ? 57.165  53.875  -10.491 1.00 70.40  ? 385  ARG C NH2 1 
ATOM   9447  N  N   . LYS C  1 355 ? 51.344  49.459  -13.956 1.00 48.30  ? 386  LYS C N   1 
ATOM   9448  C  CA  . LYS C  1 355 ? 50.567  48.568  -13.099 1.00 46.53  ? 386  LYS C CA  1 
ATOM   9449  C  C   . LYS C  1 355 ? 51.059  47.136  -13.232 1.00 44.15  ? 386  LYS C C   1 
ATOM   9450  O  O   . LYS C  1 355 ? 51.061  46.573  -14.326 1.00 44.46  ? 386  LYS C O   1 
ATOM   9451  C  CB  . LYS C  1 355 ? 49.081  48.672  -13.433 1.00 48.54  ? 386  LYS C CB  1 
ATOM   9452  C  CG  . LYS C  1 355 ? 48.469  50.003  -13.004 1.00 47.84  ? 386  LYS C CG  1 
ATOM   9453  C  CD  . LYS C  1 355 ? 48.697  50.265  -11.527 1.00 48.44  ? 386  LYS C CD  1 
ATOM   9454  C  CE  . LYS C  1 355 ? 47.627  51.148  -10.927 1.00 49.49  ? 386  LYS C CE  1 
ATOM   9455  N  NZ  . LYS C  1 355 ? 46.360  50.407  -10.639 1.00 49.99  ? 386  LYS C NZ  1 
ATOM   9456  N  N   . TRP C  1 356 ? 51.520  46.561  -12.127 1.00 40.58  ? 387  TRP C N   1 
ATOM   9457  C  CA  . TRP C  1 356 ? 52.108  45.234  -12.152 1.00 37.93  ? 387  TRP C CA  1 
ATOM   9458  C  C   . TRP C  1 356 ? 51.628  44.360  -11.001 1.00 36.86  ? 387  TRP C C   1 
ATOM   9459  O  O   . TRP C  1 356 ? 51.059  44.824  -10.020 1.00 36.15  ? 387  TRP C O   1 
ATOM   9460  C  CB  . TRP C  1 356 ? 53.644  45.344  -12.086 1.00 37.43  ? 387  TRP C CB  1 
ATOM   9461  C  CG  . TRP C  1 356 ? 54.122  45.712  -10.712 1.00 35.28  ? 387  TRP C CG  1 
ATOM   9462  C  CD1 . TRP C  1 356 ? 54.174  46.964  -10.179 1.00 34.70  ? 387  TRP C CD1 1 
ATOM   9463  C  CD2 . TRP C  1 356 ? 54.604  44.831  -9.694  1.00 34.26  ? 387  TRP C CD2 1 
ATOM   9464  N  NE1 . TRP C  1 356 ? 54.652  46.914  -8.895  1.00 33.49  ? 387  TRP C NE1 1 
ATOM   9465  C  CE2 . TRP C  1 356 ? 54.931  45.617  -8.576  1.00 33.04  ? 387  TRP C CE2 1 
ATOM   9466  C  CE3 . TRP C  1 356 ? 54.794  43.451  -9.617  1.00 34.57  ? 387  TRP C CE3 1 
ATOM   9467  C  CZ2 . TRP C  1 356 ? 55.432  45.073  -7.398  1.00 33.40  ? 387  TRP C CZ2 1 
ATOM   9468  C  CZ3 . TRP C  1 356 ? 55.292  42.908  -8.448  1.00 33.12  ? 387  TRP C CZ3 1 
ATOM   9469  C  CH2 . TRP C  1 356 ? 55.605  43.720  -7.353  1.00 33.41  ? 387  TRP C CH2 1 
ATOM   9470  N  N   . GLY C  1 357 ? 51.917  43.068  -11.133 1.00 34.67  ? 388  GLY C N   1 
ATOM   9471  C  CA  . GLY C  1 357 ? 51.571  42.077  -10.128 1.00 32.32  ? 388  GLY C CA  1 
ATOM   9472  C  C   . GLY C  1 357 ? 52.454  40.841  -10.261 1.00 31.57  ? 388  GLY C C   1 
ATOM   9473  O  O   . GLY C  1 357 ? 53.048  40.627  -11.316 1.00 31.45  ? 388  GLY C O   1 
ATOM   9474  N  N   . PHE C  1 358 ? 52.579  40.054  -9.201  1.00 31.57  ? 389  PHE C N   1 
ATOM   9475  C  CA  . PHE C  1 358 ? 53.398  38.857  -9.213  1.00 30.79  ? 389  PHE C CA  1 
ATOM   9476  C  C   . PHE C  1 358 ? 52.631  37.650  -9.734  1.00 31.52  ? 389  PHE C C   1 
ATOM   9477  O  O   . PHE C  1 358 ? 51.627  37.259  -9.144  1.00 32.52  ? 389  PHE C O   1 
ATOM   9478  C  CB  . PHE C  1 358 ? 53.876  38.508  -7.793  1.00 30.04  ? 389  PHE C CB  1 
ATOM   9479  C  CG  . PHE C  1 358 ? 55.085  39.288  -7.367  1.00 30.60  ? 389  PHE C CG  1 
ATOM   9480  C  CD1 . PHE C  1 358 ? 56.194  39.392  -8.190  1.00 29.35  ? 389  PHE C CD1 1 
ATOM   9481  C  CD2 . PHE C  1 358 ? 55.104  39.914  -6.131  1.00 30.30  ? 389  PHE C CD2 1 
ATOM   9482  C  CE1 . PHE C  1 358 ? 57.293  40.122  -7.792  1.00 30.11  ? 389  PHE C CE1 1 
ATOM   9483  C  CE2 . PHE C  1 358 ? 56.210  40.641  -5.729  1.00 30.14  ? 389  PHE C CE2 1 
ATOM   9484  C  CZ  . PHE C  1 358 ? 57.299  40.746  -6.563  1.00 29.75  ? 389  PHE C CZ  1 
ATOM   9485  N  N   . CYS C  1 359 ? 53.145  37.005  -10.775 1.00 31.98  ? 390  CYS C N   1 
ATOM   9486  C  CA  . CYS C  1 359 ? 52.474  35.785  -11.246 1.00 32.47  ? 390  CYS C CA  1 
ATOM   9487  C  C   . CYS C  1 359 ? 52.521  34.770  -10.113 1.00 32.88  ? 390  CYS C C   1 
ATOM   9488  O  O   . CYS C  1 359 ? 53.608  34.427  -9.653  1.00 33.38  ? 390  CYS C O   1 
ATOM   9489  C  CB  . CYS C  1 359 ? 53.157  35.231  -12.491 1.00 33.56  ? 390  CYS C CB  1 
ATOM   9490  S  SG  . CYS C  1 359 ? 53.389  36.503  -13.710 1.00 39.00  ? 390  CYS C SG  1 
ATOM   9491  N  N   . PRO C  1 360 ? 51.356  34.406  -9.614  1.00 32.55  ? 391  PRO C N   1 
ATOM   9492  C  CA  . PRO C  1 360 ? 51.250  33.493  -8.493  1.00 32.44  ? 391  PRO C CA  1 
ATOM   9493  C  C   . PRO C  1 360 ? 52.109  32.260  -8.721  1.00 32.62  ? 391  PRO C C   1 
ATOM   9494  O  O   . PRO C  1 360 ? 52.215  31.770  -9.841  1.00 32.50  ? 391  PRO C O   1 
ATOM   9495  C  CB  . PRO C  1 360 ? 49.774  33.180  -8.389  1.00 32.36  ? 391  PRO C CB  1 
ATOM   9496  C  CG  . PRO C  1 360 ? 49.070  34.278  -9.101  1.00 34.53  ? 391  PRO C CG  1 
ATOM   9497  C  CD  . PRO C  1 360 ? 50.030  34.811  -10.128 1.00 33.38  ? 391  PRO C CD  1 
ATOM   9498  N  N   . ASP C  1 361 ? 52.813  31.836  -7.681  1.00 32.35  ? 392  ASP C N   1 
ATOM   9499  C  CA  . ASP C  1 361 ? 53.643  30.642  -7.718  1.00 31.66  ? 392  ASP C CA  1 
ATOM   9500  C  C   . ASP C  1 361 ? 52.862  29.480  -7.090  1.00 32.62  ? 392  ASP C C   1 
ATOM   9501  O  O   . ASP C  1 361 ? 51.634  29.444  -7.211  1.00 31.52  ? 392  ASP C O   1 
ATOM   9502  C  CB  . ASP C  1 361 ? 54.969  30.855  -7.000  1.00 28.89  ? 392  ASP C CB  1 
ATOM   9503  C  CG  . ASP C  1 361 ? 54.832  31.060  -5.505  1.00 27.74  ? 392  ASP C CG  1 
ATOM   9504  O  OD1 . ASP C  1 361 ? 53.717  30.794  -4.995  1.00 31.07  ? 392  ASP C OD1 1 
ATOM   9505  O  OD2 . ASP C  1 361 ? 55.781  31.459  -4.818  1.00 23.19  ? 392  ASP C OD2 1 
ATOM   9506  N  N   . GLN C  1 362 ? 53.558  28.607  -6.384  1.00 32.85  ? 393  GLN C N   1 
ATOM   9507  C  CA  . GLN C  1 362 ? 52.992  27.422  -5.773  1.00 32.04  ? 393  GLN C CA  1 
ATOM   9508  C  C   . GLN C  1 362 ? 52.516  27.672  -4.339  1.00 30.57  ? 393  GLN C C   1 
ATOM   9509  O  O   . GLN C  1 362 ? 51.767  26.820  -3.861  1.00 29.23  ? 393  GLN C O   1 
ATOM   9510  C  CB  . GLN C  1 362 ? 54.051  26.310  -5.729  1.00 34.52  ? 393  GLN C CB  1 
ATOM   9511  C  CG  . GLN C  1 362 ? 53.494  24.901  -5.781  1.00 36.16  ? 393  GLN C CG  1 
ATOM   9512  C  CD  . GLN C  1 362 ? 53.093  24.554  -7.208  1.00 38.11  ? 393  GLN C CD  1 
ATOM   9513  O  OE1 . GLN C  1 362 ? 53.275  25.408  -8.078  1.00 36.20  ? 393  GLN C OE1 1 
ATOM   9514  N  NE2 . GLN C  1 362 ? 52.567  23.358  -7.404  1.00 38.93  ? 393  GLN C NE2 1 
ATOM   9515  N  N   . GLY C  1 363 ? 52.970  28.733  -3.719  1.00 28.43  ? 394  GLY C N   1 
ATOM   9516  C  CA  . GLY C  1 363 ? 52.630  29.079  -2.353  1.00 26.09  ? 394  GLY C CA  1 
ATOM   9517  C  C   . GLY C  1 363 ? 53.161  28.034  -1.375  1.00 25.23  ? 394  GLY C C   1 
ATOM   9518  O  O   . GLY C  1 363 ? 54.105  27.312  -1.695  1.00 26.16  ? 394  GLY C O   1 
ATOM   9519  N  N   . TYR C  1 364 ? 52.760  28.110  -0.130  1.00 24.70  ? 395  TYR C N   1 
ATOM   9520  C  CA  . TYR C  1 364 ? 53.139  27.245  0.928   1.00 24.64  ? 395  TYR C CA  1 
ATOM   9521  C  C   . TYR C  1 364 ? 51.953  26.547  1.550   1.00 25.13  ? 395  TYR C C   1 
ATOM   9522  O  O   . TYR C  1 364 ? 50.924  27.152  1.827   1.00 25.45  ? 395  TYR C O   1 
ATOM   9523  C  CB  . TYR C  1 364 ? 53.924  28.018  2.006   1.00 23.94  ? 395  TYR C CB  1 
ATOM   9524  C  CG  . TYR C  1 364 ? 54.972  28.928  1.398   1.00 22.14  ? 395  TYR C CG  1 
ATOM   9525  C  CD1 . TYR C  1 364 ? 56.184  28.427  0.966   1.00 21.27  ? 395  TYR C CD1 1 
ATOM   9526  C  CD2 . TYR C  1 364 ? 54.763  30.289  1.258   1.00 23.67  ? 395  TYR C CD2 1 
ATOM   9527  C  CE1 . TYR C  1 364 ? 57.148  29.219  0.408   1.00 21.23  ? 395  TYR C CE1 1 
ATOM   9528  C  CE2 . TYR C  1 364 ? 55.729  31.104  0.697   1.00 24.43  ? 395  TYR C CE2 1 
ATOM   9529  C  CZ  . TYR C  1 364 ? 56.920  30.562  0.252   1.00 23.27  ? 395  TYR C CZ  1 
ATOM   9530  O  OH  . TYR C  1 364 ? 57.887  31.361  -0.294  1.00 21.63  ? 395  TYR C OH  1 
ATOM   9531  N  N   . SER C  1 365 ? 52.088  25.261  1.845   1.00 26.02  ? 396  SER C N   1 
ATOM   9532  C  CA  . SER C  1 365 ? 51.017  24.502  2.468   1.00 27.38  ? 396  SER C CA  1 
ATOM   9533  C  C   . SER C  1 365 ? 50.765  24.991  3.885   1.00 28.43  ? 396  SER C C   1 
ATOM   9534  O  O   . SER C  1 365 ? 51.620  24.891  4.759   1.00 30.35  ? 396  SER C O   1 
ATOM   9535  C  CB  . SER C  1 365 ? 51.321  23.010  2.505   1.00 26.35  ? 396  SER C CB  1 
ATOM   9536  O  OG  . SER C  1 365 ? 50.289  22.300  3.155   1.00 26.53  ? 396  SER C OG  1 
ATOM   9537  N  N   . LEU C  1 366 ? 49.536  25.443  4.126   1.00 27.45  ? 397  LEU C N   1 
ATOM   9538  C  CA  . LEU C  1 366 ? 49.236  25.891  5.476   1.00 26.41  ? 397  LEU C CA  1 
ATOM   9539  C  C   . LEU C  1 366 ? 49.359  24.685  6.411   1.00 26.26  ? 397  LEU C C   1 
ATOM   9540  O  O   . LEU C  1 366 ? 49.849  24.807  7.515   1.00 27.48  ? 397  LEU C O   1 
ATOM   9541  C  CB  . LEU C  1 366 ? 47.876  26.539  5.636   1.00 25.01  ? 397  LEU C CB  1 
ATOM   9542  C  CG  . LEU C  1 366 ? 47.706  27.184  7.042   1.00 23.48  ? 397  LEU C CG  1 
ATOM   9543  C  CD1 . LEU C  1 366 ? 48.872  28.107  7.305   1.00 22.88  ? 397  LEU C CD1 1 
ATOM   9544  C  CD2 . LEU C  1 366 ? 46.354  27.842  7.113   1.00 24.30  ? 397  LEU C CD2 1 
ATOM   9545  N  N   . PHE C  1 367 ? 48.986  23.534  5.853   1.00 25.20  ? 398  PHE C N   1 
ATOM   9546  C  CA  . PHE C  1 367 ? 49.096  22.293  6.603   1.00 24.61  ? 398  PHE C CA  1 
ATOM   9547  C  C   . PHE C  1 367 ? 50.497  22.080  7.153   1.00 21.45  ? 398  PHE C C   1 
ATOM   9548  O  O   . PHE C  1 367 ? 50.787  22.107  8.340   1.00 20.32  ? 398  PHE C O   1 
ATOM   9549  C  CB  . PHE C  1 367 ? 48.667  21.078  5.765   1.00 27.87  ? 398  PHE C CB  1 
ATOM   9550  C  CG  . PHE C  1 367 ? 49.063  19.763  6.379   1.00 30.15  ? 398  PHE C CG  1 
ATOM   9551  C  CD1 . PHE C  1 367 ? 48.651  19.439  7.663   1.00 31.33  ? 398  PHE C CD1 1 
ATOM   9552  C  CD2 . PHE C  1 367 ? 49.846  18.861  5.687   1.00 30.35  ? 398  PHE C CD2 1 
ATOM   9553  C  CE1 . PHE C  1 367 ? 49.029  18.238  8.231   1.00 33.29  ? 398  PHE C CE1 1 
ATOM   9554  C  CE2 . PHE C  1 367 ? 50.229  17.653  6.241   1.00 30.18  ? 398  PHE C CE2 1 
ATOM   9555  C  CZ  . PHE C  1 367 ? 49.815  17.347  7.522   1.00 32.00  ? 398  PHE C CZ  1 
ATOM   9556  N  N   . LEU C  1 368 ? 51.446  21.948  6.189   1.00 18.91  ? 399  LEU C N   1 
ATOM   9557  C  CA  . LEU C  1 368 ? 52.812  21.628  6.566   1.00 18.26  ? 399  LEU C CA  1 
ATOM   9558  C  C   . LEU C  1 368 ? 53.461  22.670  7.456   1.00 18.24  ? 399  LEU C C   1 
ATOM   9559  O  O   . LEU C  1 368 ? 53.907  22.398  8.583   1.00 18.62  ? 399  LEU C O   1 
ATOM   9560  C  CB  . LEU C  1 368 ? 53.682  21.458  5.313   1.00 15.00  ? 399  LEU C CB  1 
ATOM   9561  C  CG  . LEU C  1 368 ? 53.239  20.322  4.389   1.00 15.00  ? 399  LEU C CG  1 
ATOM   9562  C  CD1 . LEU C  1 368 ? 53.849  20.474  3.021   1.00 15.00  ? 399  LEU C CD1 1 
ATOM   9563  C  CD2 . LEU C  1 368 ? 53.559  18.988  5.016   1.00 15.00  ? 399  LEU C CD2 1 
ATOM   9564  N  N   . VAL C  1 369 ? 53.387  23.928  7.034   1.00 17.52  ? 400  VAL C N   1 
ATOM   9565  C  CA  . VAL C  1 369 ? 53.892  24.993  7.863   1.00 18.60  ? 400  VAL C CA  1 
ATOM   9566  C  C   . VAL C  1 369 ? 53.212  24.996  9.216   1.00 19.80  ? 400  VAL C C   1 
ATOM   9567  O  O   . VAL C  1 369 ? 53.803  25.213  10.241  1.00 19.14  ? 400  VAL C O   1 
ATOM   9568  C  CB  . VAL C  1 369 ? 53.815  26.363  7.227   1.00 18.81  ? 400  VAL C CB  1 
ATOM   9569  C  CG1 . VAL C  1 369 ? 54.604  27.365  8.083   1.00 19.07  ? 400  VAL C CG1 1 
ATOM   9570  C  CG2 . VAL C  1 369 ? 54.287  26.502  5.816   1.00 16.44  ? 400  VAL C CG2 1 
ATOM   9571  N  N   . ALA C  1 370 ? 51.907  24.788  9.243   1.00 22.95  ? 401  ALA C N   1 
ATOM   9572  C  CA  . ALA C  1 370 ? 51.222  24.720  10.539  1.00 25.72  ? 401  ALA C CA  1 
ATOM   9573  C  C   . ALA C  1 370 ? 51.785  23.535  11.336  1.00 27.22  ? 401  ALA C C   1 
ATOM   9574  O  O   . ALA C  1 370 ? 52.100  23.646  12.517  1.00 26.97  ? 401  ALA C O   1 
ATOM   9575  C  CB  . ALA C  1 370 ? 49.727  24.499  10.325  1.00 25.10  ? 401  ALA C CB  1 
ATOM   9576  N  N   . ALA C  1 371 ? 51.872  22.398  10.641  1.00 28.73  ? 402  ALA C N   1 
ATOM   9577  C  CA  . ALA C  1 371 ? 52.412  21.180  11.245  1.00 29.70  ? 402  ALA C CA  1 
ATOM   9578  C  C   . ALA C  1 371 ? 53.734  21.518  11.933  1.00 29.75  ? 402  ALA C C   1 
ATOM   9579  O  O   . ALA C  1 371 ? 53.954  21.286  13.115  1.00 29.58  ? 402  ALA C O   1 
ATOM   9580  C  CB  . ALA C  1 371 ? 52.624  20.127  10.172  1.00 31.02  ? 402  ALA C CB  1 
ATOM   9581  N  N   . HIS C  1 372 ? 54.607  22.137  11.149  1.00 30.03  ? 403  HIS C N   1 
ATOM   9582  C  CA  . HIS C  1 372 ? 55.903  22.560  11.668  1.00 30.71  ? 403  HIS C CA  1 
ATOM   9583  C  C   . HIS C  1 372 ? 55.776  23.389  12.932  1.00 30.19  ? 403  HIS C C   1 
ATOM   9584  O  O   . HIS C  1 372 ? 56.292  23.057  13.995  1.00 28.18  ? 403  HIS C O   1 
ATOM   9585  C  CB  . HIS C  1 372 ? 56.650  23.339  10.584  1.00 33.36  ? 403  HIS C CB  1 
ATOM   9586  C  CG  . HIS C  1 372 ? 58.041  23.808  10.828  1.00 40.66  ? 403  HIS C CG  1 
ATOM   9587  N  ND1 . HIS C  1 372 ? 58.980  23.932  9.820   1.00 43.70  ? 403  HIS C ND1 1 
ATOM   9588  C  CD2 . HIS C  1 372 ? 58.666  24.179  11.976  1.00 41.61  ? 403  HIS C CD2 1 
ATOM   9589  C  CE1 . HIS C  1 372 ? 60.110  24.362  10.340  1.00 44.03  ? 403  HIS C CE1 1 
ATOM   9590  N  NE2 . HIS C  1 372 ? 59.953  24.520  11.640  1.00 41.72  ? 403  HIS C NE2 1 
ATOM   9591  N  N   . GLN C  1 373 ? 55.079  24.515  12.845  1.00 32.47  ? 404  GLN C N   1 
ATOM   9592  C  CA  . GLN C  1 373 ? 54.885  25.436  13.947  1.00 33.97  ? 404  GLN C CA  1 
ATOM   9593  C  C   . GLN C  1 373 ? 54.360  24.763  15.201  1.00 33.97  ? 404  GLN C C   1 
ATOM   9594  O  O   . GLN C  1 373 ? 54.850  24.983  16.305  1.00 34.55  ? 404  GLN C O   1 
ATOM   9595  C  CB  . GLN C  1 373 ? 53.918  26.565  13.561  1.00 34.62  ? 404  GLN C CB  1 
ATOM   9596  C  CG  . GLN C  1 373 ? 54.389  27.374  12.363  1.00 36.12  ? 404  GLN C CG  1 
ATOM   9597  C  CD  . GLN C  1 373 ? 55.845  27.771  12.511  1.00 36.24  ? 404  GLN C CD  1 
ATOM   9598  O  OE1 . GLN C  1 373 ? 56.235  28.286  13.558  1.00 37.22  ? 404  GLN C OE1 1 
ATOM   9599  N  NE2 . GLN C  1 373 ? 56.640  27.528  11.485  1.00 34.25  ? 404  GLN C NE2 1 
ATOM   9600  N  N   . PHE C  1 374 ? 53.352  23.910  15.016  1.00 33.53  ? 405  PHE C N   1 
ATOM   9601  C  CA  . PHE C  1 374 ? 52.773  23.221  16.166  1.00 32.30  ? 405  PHE C CA  1 
ATOM   9602  C  C   . PHE C  1 374 ? 53.841  22.372  16.820  1.00 32.04  ? 405  PHE C C   1 
ATOM   9603  O  O   . PHE C  1 374 ? 53.849  22.197  18.034  1.00 31.40  ? 405  PHE C O   1 
ATOM   9604  C  CB  . PHE C  1 374 ? 51.539  22.451  15.748  1.00 32.05  ? 405  PHE C CB  1 
ATOM   9605  C  CG  . PHE C  1 374 ? 50.440  23.310  15.174  1.00 32.29  ? 405  PHE C CG  1 
ATOM   9606  C  CD1 . PHE C  1 374 ? 50.375  24.667  15.441  1.00 33.47  ? 405  PHE C CD1 1 
ATOM   9607  C  CD2 . PHE C  1 374 ? 49.468  22.775  14.359  1.00 33.28  ? 405  PHE C CD2 1 
ATOM   9608  C  CE1 . PHE C  1 374 ? 49.383  25.472  14.925  1.00 32.79  ? 405  PHE C CE1 1 
ATOM   9609  C  CE2 . PHE C  1 374 ? 48.469  23.570  13.839  1.00 33.06  ? 405  PHE C CE2 1 
ATOM   9610  C  CZ  . PHE C  1 374 ? 48.419  24.920  14.113  1.00 32.03  ? 405  PHE C CZ  1 
ATOM   9611  N  N   . GLY C  1 375 ? 54.835  21.962  16.033  1.00 32.23  ? 406  GLY C N   1 
ATOM   9612  C  CA  . GLY C  1 375 ? 55.972  21.213  16.565  1.00 33.54  ? 406  GLY C CA  1 
ATOM   9613  C  C   . GLY C  1 375 ? 56.692  22.033  17.632  1.00 34.20  ? 406  GLY C C   1 
ATOM   9614  O  O   . GLY C  1 375 ? 57.059  21.551  18.699  1.00 34.45  ? 406  GLY C O   1 
ATOM   9615  N  N   . HIS C  1 376 ? 56.897  23.316  17.347  1.00 34.49  ? 407  HIS C N   1 
ATOM   9616  C  CA  . HIS C  1 376 ? 57.554  24.200  18.313  1.00 35.56  ? 407  HIS C CA  1 
ATOM   9617  C  C   . HIS C  1 376 ? 56.616  24.485  19.486  1.00 35.76  ? 407  HIS C C   1 
ATOM   9618  O  O   . HIS C  1 376 ? 57.011  24.532  20.643  1.00 37.32  ? 407  HIS C O   1 
ATOM   9619  C  CB  . HIS C  1 376 ? 57.861  25.557  17.666  1.00 35.81  ? 407  HIS C CB  1 
ATOM   9620  C  CG  . HIS C  1 376 ? 59.023  25.490  16.735  1.00 37.86  ? 407  HIS C CG  1 
ATOM   9621  N  ND1 . HIS C  1 376 ? 60.327  25.573  17.179  1.00 39.23  ? 407  HIS C ND1 1 
ATOM   9622  C  CD2 . HIS C  1 376 ? 59.076  25.342  15.393  1.00 37.42  ? 407  HIS C CD2 1 
ATOM   9623  C  CE1 . HIS C  1 376 ? 61.136  25.484  16.143  1.00 39.63  ? 407  HIS C CE1 1 
ATOM   9624  N  NE2 . HIS C  1 376 ? 60.398  25.333  15.062  1.00 37.91  ? 407  HIS C NE2 1 
ATOM   9625  N  N   . ALA C  1 377 ? 55.346  24.653  19.140  1.00 34.45  ? 408  ALA C N   1 
ATOM   9626  C  CA  . ALA C  1 377 ? 54.317  24.913  20.132  1.00 32.59  ? 408  ALA C CA  1 
ATOM   9627  C  C   . ALA C  1 377 ? 54.313  23.815  21.191  1.00 32.64  ? 408  ALA C C   1 
ATOM   9628  O  O   . ALA C  1 377 ? 53.779  23.996  22.280  1.00 31.43  ? 408  ALA C O   1 
ATOM   9629  C  CB  . ALA C  1 377 ? 52.951  24.958  19.469  1.00 31.43  ? 408  ALA C CB  1 
ATOM   9630  N  N   . MET C  1 378 ? 54.872  22.664  20.828  1.00 33.76  ? 409  MET C N   1 
ATOM   9631  C  CA  . MET C  1 378 ? 54.938  21.542  21.742  1.00 34.38  ? 409  MET C CA  1 
ATOM   9632  C  C   . MET C  1 378 ? 56.272  21.418  22.444  1.00 33.81  ? 409  MET C C   1 
ATOM   9633  O  O   . MET C  1 378 ? 56.356  20.708  23.455  1.00 34.18  ? 409  MET C O   1 
ATOM   9634  C  CB  . MET C  1 378 ? 54.606  20.250  20.988  1.00 35.85  ? 409  MET C CB  1 
ATOM   9635  C  CG  . MET C  1 378 ? 53.244  20.376  20.280  1.00 37.76  ? 409  MET C CG  1 
ATOM   9636  S  SD  . MET C  1 378 ? 52.001  20.982  21.455  1.00 39.01  ? 409  MET C SD  1 
ATOM   9637  C  CE  . MET C  1 378 ? 52.123  19.681  22.679  1.00 39.04  ? 409  MET C CE  1 
ATOM   9638  N  N   . GLY C  1 379 ? 57.283  22.166  22.006  1.00 33.61  ? 410  GLY C N   1 
ATOM   9639  C  CA  . GLY C  1 379 ? 58.569  22.175  22.689  1.00 33.69  ? 410  GLY C CA  1 
ATOM   9640  C  C   . GLY C  1 379 ? 59.757  21.783  21.828  1.00 34.37  ? 410  GLY C C   1 
ATOM   9641  O  O   . GLY C  1 379 ? 60.925  21.877  22.246  1.00 32.48  ? 410  GLY C O   1 
ATOM   9642  N  N   . LEU C  1 380 ? 59.489  21.323  20.612  1.00 34.63  ? 411  LEU C N   1 
ATOM   9643  C  CA  . LEU C  1 380 ? 60.521  20.900  19.686  1.00 35.81  ? 411  LEU C CA  1 
ATOM   9644  C  C   . LEU C  1 380 ? 61.321  22.072  19.124  1.00 38.93  ? 411  LEU C C   1 
ATOM   9645  O  O   . LEU C  1 380 ? 60.882  23.216  19.165  1.00 40.66  ? 411  LEU C O   1 
ATOM   9646  C  CB  . LEU C  1 380 ? 59.873  20.149  18.524  1.00 31.89  ? 411  LEU C CB  1 
ATOM   9647  C  CG  . LEU C  1 380 ? 59.163  18.837  18.790  1.00 29.45  ? 411  LEU C CG  1 
ATOM   9648  C  CD1 . LEU C  1 380 ? 58.907  18.103  17.484  1.00 26.30  ? 411  LEU C CD1 1 
ATOM   9649  C  CD2 . LEU C  1 380 ? 59.906  18.000  19.813  1.00 29.58  ? 411  LEU C CD2 1 
ATOM   9650  N  N   . GLU C  1 381 ? 62.474  21.787  18.544  1.00 41.97  ? 412  GLU C N   1 
ATOM   9651  C  CA  . GLU C  1 381 ? 63.303  22.780  17.872  1.00 44.87  ? 412  GLU C CA  1 
ATOM   9652  C  C   . GLU C  1 381 ? 63.650  22.300  16.461  1.00 44.54  ? 412  GLU C C   1 
ATOM   9653  O  O   . GLU C  1 381 ? 63.277  21.188  16.080  1.00 46.36  ? 412  GLU C O   1 
ATOM   9654  C  CB  . GLU C  1 381 ? 64.572  23.047  18.669  1.00 49.29  ? 412  GLU C CB  1 
ATOM   9655  C  CG  . GLU C  1 381 ? 64.557  24.320  19.489  1.00 57.75  ? 412  GLU C CG  1 
ATOM   9656  C  CD  . GLU C  1 381 ? 63.694  24.209  20.732  1.00 63.18  ? 412  GLU C CD  1 
ATOM   9657  O  OE1 . GLU C  1 381 ? 63.982  23.334  21.577  1.00 67.08  ? 412  GLU C OE1 1 
ATOM   9658  O  OE2 . GLU C  1 381 ? 62.731  25.000  20.853  1.00 65.06  ? 412  GLU C OE2 1 
ATOM   9659  N  N   . HIS C  1 382 ? 64.358  23.100  15.685  1.00 42.69  ? 413  HIS C N   1 
ATOM   9660  C  CA  . HIS C  1 382 ? 64.723  22.732  14.332  1.00 41.85  ? 413  HIS C CA  1 
ATOM   9661  C  C   . HIS C  1 382 ? 65.621  21.501  14.281  1.00 41.62  ? 413  HIS C C   1 
ATOM   9662  O  O   . HIS C  1 382 ? 66.350  21.220  15.231  1.00 40.99  ? 413  HIS C O   1 
ATOM   9663  C  CB  . HIS C  1 382 ? 65.443  23.900  13.662  1.00 43.18  ? 413  HIS C CB  1 
ATOM   9664  C  CG  . HIS C  1 382 ? 64.495  24.909  13.092  1.00 44.86  ? 413  HIS C CG  1 
ATOM   9665  N  ND1 . HIS C  1 382 ? 64.855  26.225  12.902  1.00 46.11  ? 413  HIS C ND1 1 
ATOM   9666  C  CD2 . HIS C  1 382 ? 63.222  24.786  12.664  1.00 43.94  ? 413  HIS C CD2 1 
ATOM   9667  C  CE1 . HIS C  1 382 ? 63.836  26.874  12.382  1.00 46.35  ? 413  HIS C CE1 1 
ATOM   9668  N  NE2 . HIS C  1 382 ? 62.852  26.020  12.222  1.00 44.22  ? 413  HIS C NE2 1 
ATOM   9669  N  N   . SER C  1 383 ? 65.558  20.796  13.159  1.00 41.02  ? 414  SER C N   1 
ATOM   9670  C  CA  . SER C  1 383 ? 66.332  19.600  12.915  1.00 41.23  ? 414  SER C CA  1 
ATOM   9671  C  C   . SER C  1 383 ? 67.359  19.868  11.816  1.00 42.12  ? 414  SER C C   1 
ATOM   9672  O  O   . SER C  1 383 ? 67.122  20.690  10.935  1.00 42.17  ? 414  SER C O   1 
ATOM   9673  C  CB  . SER C  1 383 ? 65.438  18.452  12.436  1.00 41.80  ? 414  SER C CB  1 
ATOM   9674  O  OG  . SER C  1 383 ? 66.213  17.507  11.709  1.00 42.51  ? 414  SER C OG  1 
ATOM   9675  N  N   . GLN C  1 384 ? 68.447  19.098  11.850  1.00 41.86  ? 415  GLN C N   1 
ATOM   9676  C  CA  . GLN C  1 384 ? 69.443  19.271  10.780  1.00 41.82  ? 415  GLN C CA  1 
ATOM   9677  C  C   . GLN C  1 384 ? 69.162  18.232  9.701   1.00 41.16  ? 415  GLN C C   1 
ATOM   9678  O  O   . GLN C  1 384 ? 69.776  18.201  8.646   1.00 39.60  ? 415  GLN C O   1 
ATOM   9679  C  CB  . GLN C  1 384 ? 70.855  19.155  11.298  1.00 43.79  ? 415  GLN C CB  1 
ATOM   9680  C  CG  . GLN C  1 384 ? 71.241  20.221  12.313  1.00 46.99  ? 415  GLN C CG  1 
ATOM   9681  C  CD  . GLN C  1 384 ? 72.700  20.082  12.713  1.00 49.17  ? 415  GLN C CD  1 
ATOM   9682  O  OE1 . GLN C  1 384 ? 73.582  20.142  11.855  1.00 51.35  ? 415  GLN C OE1 1 
ATOM   9683  N  NE2 . GLN C  1 384 ? 72.945  19.891  14.001  1.00 50.16  ? 415  GLN C NE2 1 
ATOM   9684  N  N   . ASP C  1 385 ? 68.195  17.378  10.012  1.00 40.85  ? 416  ASP C N   1 
ATOM   9685  C  CA  . ASP C  1 385 ? 67.748  16.366  9.055   1.00 39.41  ? 416  ASP C CA  1 
ATOM   9686  C  C   . ASP C  1 385 ? 66.749  17.020  8.108   1.00 38.57  ? 416  ASP C C   1 
ATOM   9687  O  O   . ASP C  1 385 ? 65.624  17.320  8.511   1.00 39.47  ? 416  ASP C O   1 
ATOM   9688  C  CB  . ASP C  1 385 ? 67.083  15.218  9.824   1.00 40.79  ? 416  ASP C CB  1 
ATOM   9689  C  CG  . ASP C  1 385 ? 66.416  14.202  8.930   1.00 42.32  ? 416  ASP C CG  1 
ATOM   9690  O  OD1 . ASP C  1 385 ? 66.536  14.325  7.692   1.00 41.05  ? 416  ASP C OD1 1 
ATOM   9691  O  OD2 . ASP C  1 385 ? 65.763  13.266  9.448   1.00 42.37  ? 416  ASP C OD2 1 
ATOM   9692  N  N   . PRO C  1 386 ? 67.130  17.218  6.860   1.00 37.05  ? 417  PRO C N   1 
ATOM   9693  C  CA  . PRO C  1 386 ? 66.274  17.794  5.841   1.00 35.62  ? 417  PRO C CA  1 
ATOM   9694  C  C   . PRO C  1 386 ? 64.955  17.052  5.709   1.00 36.00  ? 417  PRO C C   1 
ATOM   9695  O  O   . PRO C  1 386 ? 64.019  17.575  5.121   1.00 35.46  ? 417  PRO C O   1 
ATOM   9696  C  CB  . PRO C  1 386 ? 67.080  17.648  4.557   1.00 36.05  ? 417  PRO C CB  1 
ATOM   9697  C  CG  . PRO C  1 386 ? 68.498  17.597  5.005   1.00 38.05  ? 417  PRO C CG  1 
ATOM   9698  C  CD  . PRO C  1 386 ? 68.477  16.896  6.334   1.00 37.55  ? 417  PRO C CD  1 
ATOM   9699  N  N   . GLY C  1 387 ? 64.905  15.804  6.166   1.00 36.41  ? 418  GLY C N   1 
ATOM   9700  C  CA  . GLY C  1 387 ? 63.690  15.014  6.094   1.00 34.41  ? 418  GLY C CA  1 
ATOM   9701  C  C   . GLY C  1 387 ? 62.728  15.456  7.193   1.00 33.38  ? 418  GLY C C   1 
ATOM   9702  O  O   . GLY C  1 387 ? 61.543  15.648  6.949   1.00 34.03  ? 418  GLY C O   1 
ATOM   9703  N  N   . ALA C  1 388 ? 63.255  15.600  8.394   1.00 33.12  ? 419  ALA C N   1 
ATOM   9704  C  CA  . ALA C  1 388 ? 62.462  15.976  9.550   1.00 32.54  ? 419  ALA C CA  1 
ATOM   9705  C  C   . ALA C  1 388 ? 61.543  17.134  9.225   1.00 32.54  ? 419  ALA C C   1 
ATOM   9706  O  O   . ALA C  1 388 ? 61.860  18.109  8.557   1.00 30.38  ? 419  ALA C O   1 
ATOM   9707  C  CB  . ALA C  1 388 ? 63.357  16.249  10.746  1.00 31.74  ? 419  ALA C CB  1 
ATOM   9708  N  N   . LEU C  1 389 ? 60.307  17.031  9.716   1.00 33.14  ? 420  LEU C N   1 
ATOM   9709  C  CA  . LEU C  1 389 ? 59.336  18.109  9.488   1.00 32.53  ? 420  LEU C CA  1 
ATOM   9710  C  C   . LEU C  1 389 ? 59.873  19.374  10.150  1.00 32.90  ? 420  LEU C C   1 
ATOM   9711  O  O   . LEU C  1 389 ? 59.568  20.479  9.715   1.00 34.56  ? 420  LEU C O   1 
ATOM   9712  C  CB  . LEU C  1 389 ? 57.983  17.723  10.069  1.00 30.08  ? 420  LEU C CB  1 
ATOM   9713  C  CG  . LEU C  1 389 ? 56.939  18.815  10.239  1.00 27.41  ? 420  LEU C CG  1 
ATOM   9714  C  CD1 . LEU C  1 389 ? 56.345  19.265  8.929   1.00 23.92  ? 420  LEU C CD1 1 
ATOM   9715  C  CD2 . LEU C  1 389 ? 55.863  18.367  11.228  1.00 29.63  ? 420  LEU C CD2 1 
ATOM   9716  N  N   . MET C  1 390 ? 60.720  19.179  11.163  1.00 31.27  ? 421  MET C N   1 
ATOM   9717  C  CA  . MET C  1 390 ? 61.252  20.296  11.920  1.00 30.78  ? 421  MET C CA  1 
ATOM   9718  C  C   . MET C  1 390 ? 62.457  20.987  11.330  1.00 29.55  ? 421  MET C C   1 
ATOM   9719  O  O   . MET C  1 390 ? 63.098  21.812  11.981  1.00 29.84  ? 421  MET C O   1 
ATOM   9720  C  CB  . MET C  1 390 ? 61.497  19.903  13.375  1.00 30.47  ? 421  MET C CB  1 
ATOM   9721  C  CG  . MET C  1 390 ? 60.209  19.595  14.130  1.00 33.64  ? 421  MET C CG  1 
ATOM   9722  S  SD  . MET C  1 390 ? 58.892  20.764  13.745  1.00 37.26  ? 421  MET C SD  1 
ATOM   9723  C  CE  . MET C  1 390 ? 59.122  21.958  15.058  1.00 36.05  ? 421  MET C CE  1 
ATOM   9724  N  N   . ALA C  1 391 ? 62.816  20.650  10.102  1.00 27.67  ? 422  ALA C N   1 
ATOM   9725  C  CA  . ALA C  1 391 ? 63.923  21.349  9.415   1.00 26.98  ? 422  ALA C CA  1 
ATOM   9726  C  C   . ALA C  1 391 ? 63.397  22.746  9.075   1.00 28.61  ? 422  ALA C C   1 
ATOM   9727  O  O   . ALA C  1 391 ? 62.225  22.872  8.727   1.00 30.50  ? 422  ALA C O   1 
ATOM   9728  C  CB  . ALA C  1 391 ? 64.194  20.615  8.108   1.00 25.47  ? 422  ALA C CB  1 
ATOM   9729  N  N   . PRO C  1 392 ? 64.195  23.784  9.233   1.00 28.36  ? 423  PRO C N   1 
ATOM   9730  C  CA  . PRO C  1 392 ? 63.793  25.133  8.951   1.00 27.92  ? 423  PRO C CA  1 
ATOM   9731  C  C   . PRO C  1 392 ? 63.412  25.439  7.525   1.00 28.44  ? 423  PRO C C   1 
ATOM   9732  O  O   . PRO C  1 392 ? 62.388  26.114  7.328   1.00 29.89  ? 423  PRO C O   1 
ATOM   9733  C  CB  . PRO C  1 392 ? 64.979  25.971  9.410   1.00 27.86  ? 423  PRO C CB  1 
ATOM   9734  C  CG  . PRO C  1 392 ? 66.138  25.043  9.249   1.00 29.31  ? 423  PRO C CG  1 
ATOM   9735  C  CD  . PRO C  1 392 ? 65.606  23.701  9.700   1.00 28.83  ? 423  PRO C CD  1 
ATOM   9736  N  N   . ILE C  1 393 ? 64.245  25.198  6.534   1.00 28.13  ? 424  ILE C N   1 
ATOM   9737  C  CA  . ILE C  1 393 ? 63.896  25.532  5.156   1.00 29.39  ? 424  ILE C CA  1 
ATOM   9738  C  C   . ILE C  1 393 ? 62.607  24.810  4.754   1.00 30.93  ? 424  ILE C C   1 
ATOM   9739  O  O   . ILE C  1 393 ? 62.484  23.638  5.094   1.00 31.60  ? 424  ILE C O   1 
ATOM   9740  C  CB  . ILE C  1 393 ? 64.987  25.115  4.165   1.00 29.04  ? 424  ILE C CB  1 
ATOM   9741  C  CG1 . ILE C  1 393 ? 66.325  25.646  4.640   1.00 30.34  ? 424  ILE C CG1 1 
ATOM   9742  C  CG2 . ILE C  1 393 ? 64.639  25.516  2.753   1.00 27.32  ? 424  ILE C CG2 1 
ATOM   9743  C  CD1 . ILE C  1 393 ? 66.840  26.847  3.908   1.00 30.85  ? 424  ILE C CD1 1 
ATOM   9744  N  N   . TYR C  1 394 ? 61.666  25.480  4.094   1.00 31.95  ? 425  TYR C N   1 
ATOM   9745  C  CA  . TYR C  1 394 ? 60.397  24.888  3.721   1.00 32.52  ? 425  TYR C CA  1 
ATOM   9746  C  C   . TYR C  1 394 ? 60.541  23.999  2.486   1.00 33.76  ? 425  TYR C C   1 
ATOM   9747  O  O   . TYR C  1 394 ? 61.257  24.366  1.563   1.00 34.99  ? 425  TYR C O   1 
ATOM   9748  C  CB  . TYR C  1 394 ? 59.334  25.937  3.433   1.00 29.79  ? 425  TYR C CB  1 
ATOM   9749  C  CG  . TYR C  1 394 ? 58.125  25.494  2.638   1.00 26.62  ? 425  TYR C CG  1 
ATOM   9750  C  CD1 . TYR C  1 394 ? 58.158  25.547  1.243   1.00 25.24  ? 425  TYR C CD1 1 
ATOM   9751  C  CD2 . TYR C  1 394 ? 56.952  25.030  3.228   1.00 24.95  ? 425  TYR C CD2 1 
ATOM   9752  C  CE1 . TYR C  1 394 ? 57.069  25.158  0.491   1.00 23.25  ? 425  TYR C CE1 1 
ATOM   9753  C  CE2 . TYR C  1 394 ? 55.858  24.645  2.467   1.00 23.84  ? 425  TYR C CE2 1 
ATOM   9754  C  CZ  . TYR C  1 394 ? 55.923  24.700  1.098   1.00 23.34  ? 425  TYR C CZ  1 
ATOM   9755  O  OH  . TYR C  1 394 ? 54.867  24.335  0.292   1.00 19.59  ? 425  TYR C OH  1 
ATOM   9756  N  N   . THR C  1 395 ? 59.779  22.912  2.451   1.00 33.55  ? 426  THR C N   1 
ATOM   9757  C  CA  . THR C  1 395 ? 59.801  21.991  1.328   1.00 34.25  ? 426  THR C CA  1 
ATOM   9758  C  C   . THR C  1 395 ? 58.477  21.262  1.170   1.00 34.87  ? 426  THR C C   1 
ATOM   9759  O  O   . THR C  1 395 ? 57.972  20.582  2.070   1.00 34.45  ? 426  THR C O   1 
ATOM   9760  C  CB  . THR C  1 395 ? 60.959  20.990  1.441   1.00 35.44  ? 426  THR C CB  1 
ATOM   9761  O  OG1 . THR C  1 395 ? 62.067  21.472  0.657   1.00 38.74  ? 426  THR C OG1 1 
ATOM   9762  C  CG2 . THR C  1 395 ? 60.591  19.606  0.955   1.00 35.69  ? 426  THR C CG2 1 
ATOM   9763  N  N   . TYR C  1 396 ? 57.898  21.406  -0.022  1.00 34.99  ? 427  TYR C N   1 
ATOM   9764  C  CA  . TYR C  1 396 ? 56.641  20.758  -0.316  1.00 34.60  ? 427  TYR C CA  1 
ATOM   9765  C  C   . TYR C  1 396 ? 56.805  19.248  -0.464  1.00 36.09  ? 427  TYR C C   1 
ATOM   9766  O  O   . TYR C  1 396 ? 57.599  18.755  -1.257  1.00 36.77  ? 427  TYR C O   1 
ATOM   9767  C  CB  . TYR C  1 396 ? 56.051  21.292  -1.616  1.00 33.14  ? 427  TYR C CB  1 
ATOM   9768  C  CG  . TYR C  1 396 ? 54.739  20.603  -1.939  1.00 33.83  ? 427  TYR C CG  1 
ATOM   9769  C  CD1 . TYR C  1 396 ? 53.766  20.424  -0.953  1.00 33.66  ? 427  TYR C CD1 1 
ATOM   9770  C  CD2 . TYR C  1 396 ? 54.480  20.145  -3.217  1.00 33.72  ? 427  TYR C CD2 1 
ATOM   9771  C  CE1 . TYR C  1 396 ? 52.568  19.813  -1.236  1.00 32.95  ? 427  TYR C CE1 1 
ATOM   9772  C  CE2 . TYR C  1 396 ? 53.266  19.535  -3.510  1.00 35.61  ? 427  TYR C CE2 1 
ATOM   9773  C  CZ  . TYR C  1 396 ? 52.326  19.365  -2.511  1.00 33.82  ? 427  TYR C CZ  1 
ATOM   9774  O  OH  . TYR C  1 396 ? 51.133  18.741  -2.814  1.00 33.08  ? 427  TYR C OH  1 
ATOM   9775  N  N   . THR C  1 397 ? 55.999  18.546  0.310   1.00 37.56  ? 428  THR C N   1 
ATOM   9776  C  CA  . THR C  1 397 ? 56.011  17.085  0.260   1.00 37.89  ? 428  THR C CA  1 
ATOM   9777  C  C   . THR C  1 397 ? 54.568  16.640  0.082   1.00 39.26  ? 428  THR C C   1 
ATOM   9778  O  O   . THR C  1 397 ? 53.785  16.742  1.023   1.00 40.85  ? 428  THR C O   1 
ATOM   9779  C  CB  . THR C  1 397 ? 56.541  16.566  1.607   1.00 38.25  ? 428  THR C CB  1 
ATOM   9780  O  OG1 . THR C  1 397 ? 57.567  17.450  2.086   1.00 37.35  ? 428  THR C OG1 1 
ATOM   9781  C  CG2 . THR C  1 397 ? 57.085  15.161  1.438   1.00 37.89  ? 428  THR C CG2 1 
ATOM   9782  N  N   . LYS C  1 398 ? 54.194  16.281  -1.141  1.00 39.39  ? 429  LYS C N   1 
ATOM   9783  C  CA  . LYS C  1 398 ? 52.794  15.896  -1.353  1.00 38.63  ? 429  LYS C CA  1 
ATOM   9784  C  C   . LYS C  1 398 ? 52.391  14.819  -0.355  1.00 37.93  ? 429  LYS C C   1 
ATOM   9785  O  O   . LYS C  1 398 ? 51.454  14.985  0.418   1.00 37.64  ? 429  LYS C O   1 
ATOM   9786  C  CB  . LYS C  1 398 ? 52.577  15.437  -2.782  1.00 39.62  ? 429  LYS C CB  1 
ATOM   9787  C  CG  . LYS C  1 398 ? 51.381  14.529  -2.981  1.00 41.03  ? 429  LYS C CG  1 
ATOM   9788  C  CD  . LYS C  1 398 ? 50.189  15.271  -3.552  1.00 43.33  ? 429  LYS C CD  1 
ATOM   9789  C  CE  . LYS C  1 398 ? 50.439  15.743  -4.968  1.00 46.46  ? 429  LYS C CE  1 
ATOM   9790  N  NZ  . LYS C  1 398 ? 50.489  14.618  -5.936  1.00 48.94  ? 429  LYS C NZ  1 
ATOM   9791  N  N   . ASN C  1 399 ? 53.140  13.719  -0.349  1.00 37.34  ? 430  ASN C N   1 
ATOM   9792  C  CA  . ASN C  1 399 ? 52.890  12.623  0.576   1.00 35.89  ? 430  ASN C CA  1 
ATOM   9793  C  C   . ASN C  1 399 ? 53.646  12.826  1.882   1.00 36.22  ? 430  ASN C C   1 
ATOM   9794  O  O   . ASN C  1 399 ? 54.546  12.060  2.200   1.00 36.20  ? 430  ASN C O   1 
ATOM   9795  C  CB  . ASN C  1 399 ? 53.298  11.290  -0.039  1.00 34.58  ? 430  ASN C CB  1 
ATOM   9796  C  CG  . ASN C  1 399 ? 52.552  10.998  -1.321  1.00 35.98  ? 430  ASN C CG  1 
ATOM   9797  O  OD1 . ASN C  1 399 ? 52.837  10.023  -2.010  1.00 36.32  ? 430  ASN C OD1 1 
ATOM   9798  N  ND2 . ASN C  1 399 ? 51.582  11.837  -1.652  1.00 37.64  ? 430  ASN C ND2 1 
ATOM   9799  N  N   . PHE C  1 400 ? 53.241  13.850  2.621   1.00 37.58  ? 431  PHE C N   1 
ATOM   9800  C  CA  . PHE C  1 400 ? 53.871  14.181  3.876   1.00 38.29  ? 431  PHE C CA  1 
ATOM   9801  C  C   . PHE C  1 400 ? 53.887  12.998  4.838   1.00 37.77  ? 431  PHE C C   1 
ATOM   9802  O  O   . PHE C  1 400 ? 52.925  12.253  4.933   1.00 37.41  ? 431  PHE C O   1 
ATOM   9803  C  CB  . PHE C  1 400 ? 53.226  15.395  4.551   1.00 38.29  ? 431  PHE C CB  1 
ATOM   9804  C  CG  . PHE C  1 400 ? 53.833  15.695  5.896   1.00 37.92  ? 431  PHE C CG  1 
ATOM   9805  C  CD1 . PHE C  1 400 ? 55.156  16.073  5.996   1.00 37.97  ? 431  PHE C CD1 1 
ATOM   9806  C  CD2 . PHE C  1 400 ? 53.086  15.578  7.053   1.00 38.69  ? 431  PHE C CD2 1 
ATOM   9807  C  CE1 . PHE C  1 400 ? 55.721  16.334  7.225   1.00 38.79  ? 431  PHE C CE1 1 
ATOM   9808  C  CE2 . PHE C  1 400 ? 53.646  15.847  8.288   1.00 39.67  ? 431  PHE C CE2 1 
ATOM   9809  C  CZ  . PHE C  1 400 ? 54.969  16.225  8.376   1.00 39.23  ? 431  PHE C CZ  1 
ATOM   9810  N  N   . ARG C  1 401 ? 54.988  12.870  5.559   1.00 38.53  ? 432  ARG C N   1 
ATOM   9811  C  CA  . ARG C  1 401 ? 55.145  11.830  6.565   1.00 39.20  ? 432  ARG C CA  1 
ATOM   9812  C  C   . ARG C  1 401 ? 56.169  12.270  7.607   1.00 39.44  ? 432  ARG C C   1 
ATOM   9813  O  O   . ARG C  1 401 ? 57.255  12.742  7.269   1.00 39.24  ? 432  ARG C O   1 
ATOM   9814  C  CB  . ARG C  1 401 ? 55.484  10.502  5.916   1.00 39.67  ? 432  ARG C CB  1 
ATOM   9815  C  CG  . ARG C  1 401 ? 56.190  9.497   6.795   1.00 39.97  ? 432  ARG C CG  1 
ATOM   9816  C  CD  . ARG C  1 401 ? 57.225  8.694   6.041   1.00 44.33  ? 432  ARG C CD  1 
ATOM   9817  N  NE  . ARG C  1 401 ? 58.515  9.367   5.901   1.00 43.37  ? 432  ARG C NE  1 
ATOM   9818  C  CZ  . ARG C  1 401 ? 58.742  10.291  4.972   1.00 44.69  ? 432  ARG C CZ  1 
ATOM   9819  N  NH1 . ARG C  1 401 ? 57.769  10.631  4.134   1.00 45.53  ? 432  ARG C NH1 1 
ATOM   9820  N  NH2 . ARG C  1 401 ? 59.927  10.868  4.874   1.00 45.81  ? 432  ARG C NH2 1 
ATOM   9821  N  N   . LEU C  1 402 ? 55.773  12.223  8.880   1.00 37.96  ? 433  LEU C N   1 
ATOM   9822  C  CA  . LEU C  1 402 ? 56.686  12.635  9.945   1.00 37.04  ? 433  LEU C CA  1 
ATOM   9823  C  C   . LEU C  1 402 ? 57.975  11.828  9.794   1.00 37.99  ? 433  LEU C C   1 
ATOM   9824  O  O   . LEU C  1 402 ? 57.902  10.683  9.369   1.00 38.73  ? 433  LEU C O   1 
ATOM   9825  C  CB  . LEU C  1 402 ? 56.112  12.371  11.331  1.00 33.70  ? 433  LEU C CB  1 
ATOM   9826  C  CG  . LEU C  1 402 ? 55.439  13.528  12.064  1.00 32.02  ? 433  LEU C CG  1 
ATOM   9827  C  CD1 . LEU C  1 402 ? 55.086  13.120  13.490  1.00 31.76  ? 433  LEU C CD1 1 
ATOM   9828  C  CD2 . LEU C  1 402 ? 56.358  14.743  12.130  1.00 31.75  ? 433  LEU C CD2 1 
ATOM   9829  N  N   . SER C  1 403 ? 59.097  12.445  10.093  1.00 39.48  ? 434  SER C N   1 
ATOM   9830  C  CA  . SER C  1 403 ? 60.370  11.737  10.034  1.00 40.38  ? 434  SER C CA  1 
ATOM   9831  C  C   . SER C  1 403 ? 60.558  10.913  11.271  1.00 42.12  ? 434  SER C C   1 
ATOM   9832  O  O   . SER C  1 403 ? 59.947  11.185  12.305  1.00 42.19  ? 434  SER C O   1 
ATOM   9833  C  CB  . SER C  1 403 ? 61.540  12.715  9.930   1.00 39.21  ? 434  SER C CB  1 
ATOM   9834  O  OG  . SER C  1 403 ? 62.038  13.053  11.213  1.00 38.67  ? 434  SER C OG  1 
ATOM   9835  N  N   . GLN C  1 404 ? 61.382  9.907   11.143  1.00 44.94  ? 435  GLN C N   1 
ATOM   9836  C  CA  . GLN C  1 404 ? 61.693  9.118   12.327  1.00 47.21  ? 435  GLN C CA  1 
ATOM   9837  C  C   . GLN C  1 404 ? 62.344  9.978   13.405  1.00 45.14  ? 435  GLN C C   1 
ATOM   9838  O  O   . GLN C  1 404 ? 62.244  9.710   14.581  1.00 43.96  ? 435  GLN C O   1 
ATOM   9839  C  CB  . GLN C  1 404 ? 62.599  7.941   11.965  1.00 52.10  ? 435  GLN C CB  1 
ATOM   9840  C  CG  . GLN C  1 404 ? 63.008  6.919   12.628  1.00 60.45  ? 435  GLN C CG  1 
ATOM   9841  C  CD  . GLN C  1 404 ? 63.243  5.430   12.481  1.00 65.92  ? 435  GLN C CD  1 
ATOM   9842  O  OE1 . GLN C  1 404 ? 63.009  4.659   13.413  1.00 69.77  ? 435  GLN C OE1 1 
ATOM   9843  N  NE2 . GLN C  1 404 ? 63.699  4.806   11.401  1.00 67.63  ? 435  GLN C NE2 1 
ATOM   9844  N  N   . ASP C  1 405 ? 62.994  11.070  12.922  1.00 43.36  ? 436  ASP C N   1 
ATOM   9845  C  CA  . ASP C  1 405 ? 63.641  12.071  13.796  1.00 42.76  ? 436  ASP C CA  1 
ATOM   9846  C  C   . ASP C  1 405 ? 62.569  12.787  14.615  1.00 41.12  ? 436  ASP C C   1 
ATOM   9847  O  O   . ASP C  1 405 ? 62.679  12.891  15.830  1.00 40.12  ? 436  ASP C O   1 
ATOM   9848  C  CB  . ASP C  1 405 ? 64.450  13.041  12.924  1.00 44.31  ? 436  ASP C CB  1 
ATOM   9849  C  CG  . ASP C  1 405 ? 65.281  14.023  13.721  1.00 46.59  ? 436  ASP C CG  1 
ATOM   9850  O  OD1 . ASP C  1 405 ? 66.105  13.574  14.542  1.00 48.37  ? 436  ASP C OD1 1 
ATOM   9851  O  OD2 . ASP C  1 405 ? 65.110  15.244  13.517  1.00 47.16  ? 436  ASP C OD2 1 
ATOM   9852  N  N   . ASP C  1 406 ? 61.518  13.217  13.930  1.00 39.60  ? 437  ASP C N   1 
ATOM   9853  C  CA  . ASP C  1 406 ? 60.404  13.926  14.544  1.00 37.82  ? 437  ASP C CA  1 
ATOM   9854  C  C   . ASP C  1 406 ? 59.655  13.097  15.573  1.00 36.95  ? 437  ASP C C   1 
ATOM   9855  O  O   . ASP C  1 406 ? 59.403  13.474  16.711  1.00 36.63  ? 437  ASP C O   1 
ATOM   9856  C  CB  . ASP C  1 406 ? 59.398  14.321  13.449  1.00 36.36  ? 437  ASP C CB  1 
ATOM   9857  C  CG  . ASP C  1 406 ? 60.031  15.256  12.442  1.00 36.83  ? 437  ASP C CG  1 
ATOM   9858  O  OD1 . ASP C  1 406 ? 60.961  15.983  12.839  1.00 38.48  ? 437  ASP C OD1 1 
ATOM   9859  O  OD2 . ASP C  1 406 ? 59.612  15.271  11.273  1.00 36.48  ? 437  ASP C OD2 1 
ATOM   9860  N  N   . ILE C  1 407 ? 59.223  11.915  15.142  1.00 36.13  ? 438  ILE C N   1 
ATOM   9861  C  CA  . ILE C  1 407 ? 58.540  11.038  16.083  1.00 35.45  ? 438  ILE C CA  1 
ATOM   9862  C  C   . ILE C  1 407 ? 59.356  10.850  17.351  1.00 36.50  ? 438  ILE C C   1 
ATOM   9863  O  O   . ILE C  1 407 ? 58.832  10.940  18.459  1.00 35.90  ? 438  ILE C O   1 
ATOM   9864  C  CB  . ILE C  1 407 ? 58.278  9.668   15.438  1.00 33.27  ? 438  ILE C CB  1 
ATOM   9865  C  CG1 . ILE C  1 407 ? 57.499  9.869   14.137  1.00 32.23  ? 438  ILE C CG1 1 
ATOM   9866  C  CG2 . ILE C  1 407 ? 57.531  8.779   16.409  1.00 32.94  ? 438  ILE C CG2 1 
ATOM   9867  C  CD1 . ILE C  1 407 ? 56.964  8.586   13.544  1.00 30.96  ? 438  ILE C CD1 1 
ATOM   9868  N  N   . LYS C  1 408 ? 60.659  10.606  17.200  1.00 38.05  ? 439  LYS C N   1 
ATOM   9869  C  CA  . LYS C  1 408 ? 61.485  10.417  18.394  1.00 40.18  ? 439  LYS C CA  1 
ATOM   9870  C  C   . LYS C  1 408 ? 61.466  11.688  19.231  1.00 40.67  ? 439  LYS C C   1 
ATOM   9871  O  O   . LYS C  1 408 ? 61.265  11.662  20.440  1.00 41.37  ? 439  LYS C O   1 
ATOM   9872  C  CB  . LYS C  1 408 ? 62.913  10.028  18.034  1.00 41.40  ? 439  LYS C CB  1 
ATOM   9873  C  CG  . LYS C  1 408 ? 63.858  9.929   19.219  1.00 42.85  ? 439  LYS C CG  1 
ATOM   9874  C  CD  . LYS C  1 408 ? 64.666  11.196  19.427  1.00 45.42  ? 439  LYS C CD  1 
ATOM   9875  C  CE  . LYS C  1 408 ? 65.799  11.332  18.425  1.00 46.68  ? 439  LYS C CE  1 
ATOM   9876  N  NZ  . LYS C  1 408 ? 66.927  10.405  18.727  1.00 47.70  ? 439  LYS C NZ  1 
ATOM   9877  N  N   . GLY C  1 409 ? 61.653  12.820  18.563  1.00 40.08  ? 440  GLY C N   1 
ATOM   9878  C  CA  . GLY C  1 409 ? 61.733  14.094  19.252  1.00 40.09  ? 440  GLY C CA  1 
ATOM   9879  C  C   . GLY C  1 409 ? 60.476  14.418  20.037  1.00 40.21  ? 440  GLY C C   1 
ATOM   9880  O  O   . GLY C  1 409 ? 60.517  14.797  21.206  1.00 39.88  ? 440  GLY C O   1 
ATOM   9881  N  N   . ILE C  1 410 ? 59.326  14.310  19.375  1.00 40.03  ? 441  ILE C N   1 
ATOM   9882  C  CA  . ILE C  1 410 ? 58.070  14.659  20.010  1.00 40.50  ? 441  ILE C CA  1 
ATOM   9883  C  C   . ILE C  1 410 ? 57.736  13.735  21.161  1.00 42.19  ? 441  ILE C C   1 
ATOM   9884  O  O   . ILE C  1 410 ? 57.239  14.171  22.200  1.00 42.39  ? 441  ILE C O   1 
ATOM   9885  C  CB  . ILE C  1 410 ? 56.922  14.678  18.992  1.00 39.07  ? 441  ILE C CB  1 
ATOM   9886  C  CG1 . ILE C  1 410 ? 55.624  15.154  19.633  1.00 37.40  ? 441  ILE C CG1 1 
ATOM   9887  C  CG2 . ILE C  1 410 ? 56.765  13.323  18.334  1.00 38.19  ? 441  ILE C CG2 1 
ATOM   9888  C  CD1 . ILE C  1 410 ? 55.606  16.618  19.997  1.00 33.63  ? 441  ILE C CD1 1 
ATOM   9889  N  N   . GLN C  1 411 ? 58.021  12.443  21.005  1.00 44.31  ? 442  GLN C N   1 
ATOM   9890  C  CA  . GLN C  1 411 ? 57.667  11.481  22.032  1.00 46.72  ? 442  GLN C CA  1 
ATOM   9891  C  C   . GLN C  1 411 ? 58.738  11.207  23.055  1.00 48.56  ? 442  GLN C C   1 
ATOM   9892  O  O   . GLN C  1 411 ? 58.553  10.415  23.987  1.00 49.10  ? 442  GLN C O   1 
ATOM   9893  C  CB  . GLN C  1 411 ? 57.118  10.208  21.422  1.00 45.75  ? 442  GLN C CB  1 
ATOM   9894  C  CG  . GLN C  1 411 ? 58.041  9.481   20.472  1.00 42.87  ? 442  GLN C CG  1 
ATOM   9895  C  CD  . GLN C  1 411 ? 57.345  8.267   19.873  1.00 41.85  ? 442  GLN C CD  1 
ATOM   9896  O  OE1 . GLN C  1 411 ? 56.236  8.325   19.338  1.00 38.40  ? 442  GLN C OE1 1 
ATOM   9897  N  NE2 . GLN C  1 411 ? 58.018  7.130   19.984  1.00 40.83  ? 442  GLN C NE2 1 
ATOM   9898  N  N   . GLU C  1 412 ? 59.864  11.910  22.974  1.00 50.29  ? 443  GLU C N   1 
ATOM   9899  C  CA  . GLU C  1 412 ? 60.852  11.767  24.064  1.00 51.70  ? 443  GLU C CA  1 
ATOM   9900  C  C   . GLU C  1 412 ? 60.470  12.861  25.081  1.00 51.57  ? 443  GLU C C   1 
ATOM   9901  O  O   . GLU C  1 412 ? 61.104  13.059  26.099  1.00 51.52  ? 443  GLU C O   1 
ATOM   9902  C  CB  . GLU C  1 412 ? 62.260  11.985  23.544  1.00 53.67  ? 443  GLU C CB  1 
ATOM   9903  C  CG  . GLU C  1 412 ? 62.596  13.427  23.219  1.00 57.94  ? 443  GLU C CG  1 
ATOM   9904  C  CD  . GLU C  1 412 ? 64.084  13.703  23.328  1.00 61.46  ? 443  GLU C CD  1 
ATOM   9905  O  OE1 . GLU C  1 412 ? 64.869  12.944  22.716  1.00 61.63  ? 443  GLU C OE1 1 
ATOM   9906  O  OE2 . GLU C  1 412 ? 64.464  14.672  24.019  1.00 63.02  ? 443  GLU C OE2 1 
ATOM   9907  N  N   . LEU C  1 413 ? 59.439  13.586  24.687  1.00 51.03  ? 444  LEU C N   1 
ATOM   9908  C  CA  . LEU C  1 413 ? 58.841  14.695  25.377  1.00 49.69  ? 444  LEU C CA  1 
ATOM   9909  C  C   . LEU C  1 413 ? 57.597  14.281  26.181  1.00 49.23  ? 444  LEU C C   1 
ATOM   9910  O  O   . LEU C  1 413 ? 57.415  14.672  27.320  1.00 48.64  ? 444  LEU C O   1 
ATOM   9911  C  CB  . LEU C  1 413 ? 58.338  15.706  24.323  1.00 49.08  ? 444  LEU C CB  1 
ATOM   9912  C  CG  . LEU C  1 413 ? 59.304  16.806  23.924  1.00 47.82  ? 444  LEU C CG  1 
ATOM   9913  C  CD1 . LEU C  1 413 ? 59.385  17.853  25.022  1.00 46.96  ? 444  LEU C CD1 1 
ATOM   9914  C  CD2 . LEU C  1 413 ? 60.687  16.216  23.680  1.00 48.60  ? 444  LEU C CD2 1 
ATOM   9915  N  N   . TYR C  1 414 ? 56.731  13.577  25.493  1.00 48.81  ? 445  TYR C N   1 
ATOM   9916  C  CA  . TYR C  1 414 ? 55.367  13.209  25.794  1.00 48.29  ? 445  TYR C CA  1 
ATOM   9917  C  C   . TYR C  1 414 ? 55.160  11.700  25.870  1.00 48.32  ? 445  TYR C C   1 
ATOM   9918  O  O   . TYR C  1 414 ? 54.246  11.192  26.510  1.00 48.98  ? 445  TYR C O   1 
ATOM   9919  C  CB  . TYR C  1 414 ? 54.486  13.782  24.656  1.00 48.05  ? 445  TYR C CB  1 
ATOM   9920  C  CG  . TYR C  1 414 ? 54.594  15.288  24.513  1.00 46.98  ? 445  TYR C CG  1 
ATOM   9921  C  CD1 . TYR C  1 414 ? 55.538  15.897  23.707  1.00 47.55  ? 445  TYR C CD1 1 
ATOM   9922  C  CD2 . TYR C  1 414 ? 53.722  16.108  25.207  1.00 45.12  ? 445  TYR C CD2 1 
ATOM   9923  C  CE1 . TYR C  1 414 ? 55.628  17.271  23.602  1.00 45.98  ? 445  TYR C CE1 1 
ATOM   9924  C  CE2 . TYR C  1 414 ? 53.799  17.477  25.110  1.00 44.15  ? 445  TYR C CE2 1 
ATOM   9925  C  CZ  . TYR C  1 414 ? 54.747  18.057  24.307  1.00 44.94  ? 445  TYR C CZ  1 
ATOM   9926  O  OH  . TYR C  1 414 ? 54.789  19.425  24.227  1.00 42.61  ? 445  TYR C OH  1 
ATOM   9927  N  N   . GLY C  1 415 ? 56.067  10.986  25.215  1.00 47.35  ? 446  GLY C N   1 
ATOM   9928  C  CA  . GLY C  1 415 ? 55.972  9.550   25.005  1.00 45.44  ? 446  GLY C CA  1 
ATOM   9929  C  C   . GLY C  1 415 ? 55.000  9.138   23.908  1.00 44.86  ? 446  GLY C C   1 
ATOM   9930  O  O   . GLY C  1 415 ? 54.182  9.965   23.496  1.00 45.73  ? 446  GLY C O   1 
ATOM   9931  N  N   . ALA C  1 416 ? 55.001  7.922   23.393  1.00 45.07  ? 447  ALA C N   1 
ATOM   9932  C  CA  . ALA C  1 416 ? 54.161  7.469   22.283  1.00 45.12  ? 447  ALA C CA  1 
ATOM   9933  C  C   . ALA C  1 416 ? 52.669  7.275   22.511  1.00 45.80  ? 447  ALA C C   1 
ATOM   9934  O  O   . ALA C  1 416 ? 52.240  7.309   23.673  1.00 46.16  ? 447  ALA C O   1 
ATOM   9935  C  CB  . ALA C  1 416 ? 54.757  6.184   21.701  1.00 44.44  ? 447  ALA C CB  1 
ATOM   9936  N  N   . SER C  1 417 ? 51.812  7.081   21.483  1.00 46.98  ? 448  SER C N   1 
ATOM   9937  C  CA  . SER C  1 417 ? 50.373  6.897   21.479  1.00 47.10  ? 448  SER C CA  1 
ATOM   9938  C  C   . SER C  1 417 ? 49.980  5.809   22.476  1.00 47.67  ? 448  SER C C   1 
ATOM   9939  O  O   . SER C  1 417 ? 50.482  4.702   22.458  1.00 49.05  ? 448  SER C O   1 
ATOM   9940  C  CB  . SER C  1 417 ? 49.624  6.756   20.176  1.00 46.75  ? 448  SER C CB  1 
ATOM   9941  O  OG  . SER C  1 417 ? 50.247  5.921   19.238  1.00 47.51  ? 448  SER C OG  1 
ATOM   9942  N  N   . PRO C  1 418 ? 49.140  6.208   23.458  1.00 78.38  ? 449  PRO C N   1 
ATOM   9943  C  CA  . PRO C  1 418 ? 48.810  5.246   24.519  1.00 78.58  ? 449  PRO C CA  1 
ATOM   9944  C  C   . PRO C  1 418 ? 47.844  4.187   24.030  1.00 78.68  ? 449  PRO C C   1 
ATOM   9945  O  O   . PRO C  1 418 ? 48.261  3.063   23.685  1.00 72.46  ? 449  PRO C O   1 
ATOM   9946  C  CB  . PRO C  1 418 ? 48.163  6.113   25.600  1.00 77.56  ? 449  PRO C CB  1 
ATOM   9947  C  CG  . PRO C  1 418 ? 47.451  7.155   24.804  1.00 80.12  ? 449  PRO C CG  1 
ATOM   9948  C  CD  . PRO C  1 418 ? 48.421  7.512   23.716  1.00 80.55  ? 449  PRO C CD  1 
ATOM   9949  N  N   . SER D  1 1   ? 16.770  87.002  -15.429 1.00 83.99  ? 32   SER D N   1 
ATOM   9950  C  CA  . SER D  1 1   ? 16.828  87.081  -13.948 1.00 84.88  ? 32   SER D CA  1 
ATOM   9951  C  C   . SER D  1 1   ? 17.422  88.375  -13.420 1.00 85.25  ? 32   SER D C   1 
ATOM   9952  O  O   . SER D  1 1   ? 17.905  88.420  -12.283 1.00 85.45  ? 32   SER D O   1 
ATOM   9953  C  CB  . SER D  1 1   ? 17.609  85.887  -13.384 1.00 85.19  ? 32   SER D CB  1 
ATOM   9954  O  OG  . SER D  1 1   ? 18.959  85.919  -13.812 1.00 84.95  ? 32   SER D OG  1 
ATOM   9955  N  N   . PRO D  1 2   ? 17.383  89.448  -14.194 1.00 85.55  ? 33   PRO D N   1 
ATOM   9956  C  CA  . PRO D  1 2   ? 17.927  90.735  -13.807 1.00 85.34  ? 33   PRO D CA  1 
ATOM   9957  C  C   . PRO D  1 2   ? 17.136  91.399  -12.687 1.00 84.52  ? 33   PRO D C   1 
ATOM   9958  O  O   . PRO D  1 2   ? 15.914  91.513  -12.773 1.00 84.47  ? 33   PRO D O   1 
ATOM   9959  C  CB  . PRO D  1 2   ? 17.825  91.589  -15.068 1.00 84.99  ? 33   PRO D CB  1 
ATOM   9960  C  CG  . PRO D  1 2   ? 17.535  90.656  -16.179 1.00 84.99  ? 33   PRO D CG  1 
ATOM   9961  C  CD  . PRO D  1 2   ? 16.830  89.478  -15.571 1.00 85.43  ? 33   PRO D CD  1 
ATOM   9962  N  N   . ILE D  1 3   ? 17.841  91.886  -11.674 1.00 84.07  ? 34   ILE D N   1 
ATOM   9963  C  CA  . ILE D  1 3   ? 17.211  92.606  -10.574 1.00 84.44  ? 34   ILE D CA  1 
ATOM   9964  C  C   . ILE D  1 3   ? 17.059  94.079  -10.950 1.00 83.95  ? 34   ILE D C   1 
ATOM   9965  O  O   . ILE D  1 3   ? 18.018  94.844  -10.961 1.00 84.19  ? 34   ILE D O   1 
ATOM   9966  C  CB  . ILE D  1 3   ? 17.985  92.460  -9.260  1.00 84.84  ? 34   ILE D CB  1 
ATOM   9967  C  CG1 . ILE D  1 3   ? 19.378  91.884  -9.519  1.00 86.62  ? 34   ILE D CG1 1 
ATOM   9968  C  CG2 . ILE D  1 3   ? 17.222  91.574  -8.285  1.00 85.33  ? 34   ILE D CG2 1 
ATOM   9969  C  CD1 . ILE D  1 3   ? 20.280  91.872  -8.305  1.00 86.33  ? 34   ILE D CD1 1 
ATOM   9970  N  N   . ILE D  1 4   ? 15.835  94.431  -11.318 1.00 83.45  ? 35   ILE D N   1 
ATOM   9971  C  CA  . ILE D  1 4   ? 15.487  95.767  -11.767 1.00 82.87  ? 35   ILE D CA  1 
ATOM   9972  C  C   . ILE D  1 4   ? 14.927  96.616  -10.632 1.00 81.92  ? 35   ILE D C   1 
ATOM   9973  O  O   . ILE D  1 4   ? 14.665  96.125  -9.538  1.00 82.55  ? 35   ILE D O   1 
ATOM   9974  C  CB  . ILE D  1 4   ? 14.437  95.697  -12.896 1.00 83.18  ? 35   ILE D CB  1 
ATOM   9975  C  CG1 . ILE D  1 4   ? 14.404  96.994  -13.700 1.00 83.06  ? 35   ILE D CG1 1 
ATOM   9976  C  CG2 . ILE D  1 4   ? 13.060  95.366  -12.346 1.00 83.70  ? 35   ILE D CG2 1 
ATOM   9977  C  CD1 . ILE D  1 4   ? 15.179  96.940  -14.996 1.00 81.48  ? 35   ILE D CD1 1 
ATOM   9978  N  N   . LYS D  1 5   ? 14.733  97.897  -10.923 1.00 80.20  ? 36   LYS D N   1 
ATOM   9979  C  CA  . LYS D  1 5   ? 14.165  98.814  -9.940  1.00 78.11  ? 36   LYS D CA  1 
ATOM   9980  C  C   . LYS D  1 5   ? 12.713  99.111  -10.308 1.00 75.79  ? 36   LYS D C   1 
ATOM   9981  O  O   . LYS D  1 5   ? 12.444  99.488  -11.447 1.00 76.00  ? 36   LYS D O   1 
ATOM   9982  C  CB  . LYS D  1 5   ? 14.979  100.102 -9.885  1.00 79.47  ? 36   LYS D CB  1 
ATOM   9983  C  CG  . LYS D  1 5   ? 14.562  101.068 -8.792  1.00 80.40  ? 36   LYS D CG  1 
ATOM   9984  C  CD  . LYS D  1 5   ? 14.567  100.403 -7.426  1.00 80.85  ? 36   LYS D CD  1 
ATOM   9985  C  CE  . LYS D  1 5   ? 14.168  101.378 -6.330  1.00 81.50  ? 36   LYS D CE  1 
ATOM   9986  N  NZ  . LYS D  1 5   ? 14.306  100.774 -4.975  1.00 81.21  ? 36   LYS D NZ  1 
ATOM   9987  N  N   . PHE D  1 6   ? 11.800  98.871  -9.379  1.00 72.55  ? 37   PHE D N   1 
ATOM   9988  C  CA  . PHE D  1 6   ? 10.374  99.062  -9.621  1.00 68.53  ? 37   PHE D CA  1 
ATOM   9989  C  C   . PHE D  1 6   ? 9.923   100.452 -9.225  1.00 66.64  ? 37   PHE D C   1 
ATOM   9990  O  O   . PHE D  1 6   ? 10.154  100.913 -8.103  1.00 66.31  ? 37   PHE D O   1 
ATOM   9991  C  CB  . PHE D  1 6   ? 9.564   97.983  -8.880  1.00 67.41  ? 37   PHE D CB  1 
ATOM   9992  C  CG  . PHE D  1 6   ? 9.846   96.606  -9.420  1.00 65.36  ? 37   PHE D CG  1 
ATOM   9993  C  CD1 . PHE D  1 6   ? 9.264   96.186  -10.600 1.00 64.87  ? 37   PHE D CD1 1 
ATOM   9994  C  CD2 . PHE D  1 6   ? 10.707  95.748  -8.759  1.00 64.13  ? 37   PHE D CD2 1 
ATOM   9995  C  CE1 . PHE D  1 6   ? 9.529   94.931  -11.115 1.00 64.80  ? 37   PHE D CE1 1 
ATOM   9996  C  CE2 . PHE D  1 6   ? 10.970  94.497  -9.270  1.00 64.11  ? 37   PHE D CE2 1 
ATOM   9997  C  CZ  . PHE D  1 6   ? 10.385  94.081  -10.448 1.00 64.67  ? 37   PHE D CZ  1 
ATOM   9998  N  N   . PRO D  1 7   ? 9.271   101.163 -10.134 1.00 64.34  ? 38   PRO D N   1 
ATOM   9999  C  CA  . PRO D  1 7   ? 8.818   102.517 -9.878  1.00 63.17  ? 38   PRO D CA  1 
ATOM   10000 C  C   . PRO D  1 7   ? 8.034   102.674 -8.595  1.00 62.52  ? 38   PRO D C   1 
ATOM   10001 O  O   . PRO D  1 7   ? 6.960   102.082 -8.454  1.00 62.60  ? 38   PRO D O   1 
ATOM   10002 C  CB  . PRO D  1 7   ? 7.966   102.872 -11.091 1.00 62.55  ? 38   PRO D CB  1 
ATOM   10003 C  CG  . PRO D  1 7   ? 7.752   101.609 -11.836 1.00 61.99  ? 38   PRO D CG  1 
ATOM   10004 C  CD  . PRO D  1 7   ? 8.930   100.730 -11.510 1.00 62.75  ? 38   PRO D CD  1 
ATOM   10005 N  N   . GLY D  1 8   ? 8.542   103.455 -7.638  1.00 61.95  ? 39   GLY D N   1 
ATOM   10006 C  CA  . GLY D  1 8   ? 7.813   103.745 -6.426  1.00 62.23  ? 39   GLY D CA  1 
ATOM   10007 C  C   . GLY D  1 8   ? 8.307   103.149 -5.135  1.00 63.56  ? 39   GLY D C   1 
ATOM   10008 O  O   . GLY D  1 8   ? 8.407   103.841 -4.114  1.00 63.11  ? 39   GLY D O   1 
ATOM   10009 N  N   . ASP D  1 9   ? 8.554   101.843 -5.093  1.00 66.12  ? 40   ASP D N   1 
ATOM   10010 C  CA  . ASP D  1 9   ? 8.925   101.162 -3.869  1.00 67.76  ? 40   ASP D CA  1 
ATOM   10011 C  C   . ASP D  1 9   ? 9.962   101.909 -3.049  1.00 68.40  ? 40   ASP D C   1 
ATOM   10012 O  O   . ASP D  1 9   ? 10.930  102.455 -3.565  1.00 68.83  ? 40   ASP D O   1 
ATOM   10013 C  CB  . ASP D  1 9   ? 9.365   99.721  -4.099  1.00 67.21  ? 40   ASP D CB  1 
ATOM   10014 C  CG  . ASP D  1 9   ? 10.397  99.616  -5.204  1.00 67.13  ? 40   ASP D CG  1 
ATOM   10015 O  OD1 . ASP D  1 9   ? 10.644  100.651 -5.859  1.00 66.99  ? 40   ASP D OD1 1 
ATOM   10016 O  OD2 . ASP D  1 9   ? 10.949  98.519  -5.410  1.00 67.34  ? 40   ASP D OD2 1 
ATOM   10017 N  N   . VAL D  1 10  ? 9.730   101.897 -1.738  1.00 68.99  ? 41   VAL D N   1 
ATOM   10018 C  CA  . VAL D  1 10  ? 10.611  102.574 -0.807  1.00 70.88  ? 41   VAL D CA  1 
ATOM   10019 C  C   . VAL D  1 10  ? 12.005  101.964 -0.795  1.00 71.57  ? 41   VAL D C   1 
ATOM   10020 O  O   . VAL D  1 10  ? 12.239  100.819 -0.422  1.00 72.06  ? 41   VAL D O   1 
ATOM   10021 C  CB  . VAL D  1 10  ? 10.018  102.676 0.601   1.00 71.06  ? 41   VAL D CB  1 
ATOM   10022 C  CG1 . VAL D  1 10  ? 9.071   103.870 0.702   1.00 72.36  ? 41   VAL D CG1 1 
ATOM   10023 C  CG2 . VAL D  1 10  ? 9.295   101.394 0.980   1.00 70.06  ? 41   VAL D CG2 1 
ATOM   10024 N  N   . ALA D  1 11  ? 12.943  102.775 -1.284  1.00 71.36  ? 42   ALA D N   1 
ATOM   10025 C  CA  . ALA D  1 11  ? 14.345  102.411 -1.371  1.00 71.53  ? 42   ALA D CA  1 
ATOM   10026 C  C   . ALA D  1 11  ? 14.922  102.185 0.023   1.00 71.41  ? 42   ALA D C   1 
ATOM   10027 O  O   . ALA D  1 11  ? 14.700  102.975 0.940   1.00 71.41  ? 42   ALA D O   1 
ATOM   10028 C  CB  . ALA D  1 11  ? 15.130  103.465 -2.131  1.00 71.45  ? 42   ALA D CB  1 
ATOM   10029 N  N   . PRO D  1 12  ? 15.606  101.059 0.177   1.00 70.41  ? 43   PRO D N   1 
ATOM   10030 C  CA  . PRO D  1 12  ? 16.183  100.662 1.440   1.00 69.03  ? 43   PRO D CA  1 
ATOM   10031 C  C   . PRO D  1 12  ? 17.256  101.627 1.914   1.00 68.43  ? 43   PRO D C   1 
ATOM   10032 O  O   . PRO D  1 12  ? 18.000  102.212 1.137   1.00 67.35  ? 43   PRO D O   1 
ATOM   10033 C  CB  . PRO D  1 12  ? 16.760  99.282  1.179   1.00 69.21  ? 43   PRO D CB  1 
ATOM   10034 C  CG  . PRO D  1 12  ? 16.941  99.201  -0.296  1.00 69.67  ? 43   PRO D CG  1 
ATOM   10035 C  CD  . PRO D  1 12  ? 15.880  100.076 -0.900  1.00 69.64  ? 43   PRO D CD  1 
ATOM   10036 N  N   . LYS D  1 13  ? 17.294  101.790 3.236   1.00 68.36  ? 44   LYS D N   1 
ATOM   10037 C  CA  . LYS D  1 13  ? 18.331  102.649 3.811   1.00 68.72  ? 44   LYS D CA  1 
ATOM   10038 C  C   . LYS D  1 13  ? 19.675  101.955 3.590   1.00 68.19  ? 44   LYS D C   1 
ATOM   10039 O  O   . LYS D  1 13  ? 19.715  100.771 3.253   1.00 68.48  ? 44   LYS D O   1 
ATOM   10040 C  CB  . LYS D  1 13  ? 18.077  102.876 5.295   1.00 69.95  ? 44   LYS D CB  1 
ATOM   10041 C  CG  . LYS D  1 13  ? 16.821  103.674 5.607   1.00 72.16  ? 44   LYS D CG  1 
ATOM   10042 C  CD  . LYS D  1 13  ? 16.977  105.134 5.202   1.00 73.34  ? 44   LYS D CD  1 
ATOM   10043 C  CE  . LYS D  1 13  ? 15.638  105.855 5.207   1.00 74.24  ? 44   LYS D CE  1 
ATOM   10044 N  NZ  . LYS D  1 13  ? 15.686  107.112 4.410   1.00 74.69  ? 44   LYS D NZ  1 
ATOM   10045 N  N   . THR D  1 14  ? 20.755  102.707 3.738   1.00 66.74  ? 45   THR D N   1 
ATOM   10046 C  CA  . THR D  1 14  ? 22.079  102.116 3.564   1.00 65.39  ? 45   THR D CA  1 
ATOM   10047 C  C   . THR D  1 14  ? 22.475  101.344 4.819   1.00 64.05  ? 45   THR D C   1 
ATOM   10048 O  O   . THR D  1 14  ? 21.968  101.634 5.903   1.00 64.74  ? 45   THR D O   1 
ATOM   10049 C  CB  . THR D  1 14  ? 23.140  103.182 3.261   1.00 65.66  ? 45   THR D CB  1 
ATOM   10050 O  OG1 . THR D  1 14  ? 24.126  102.622 2.383   1.00 67.51  ? 45   THR D OG1 1 
ATOM   10051 C  CG2 . THR D  1 14  ? 23.826  103.660 4.530   1.00 64.77  ? 45   THR D CG2 1 
ATOM   10052 N  N   . ASP D  1 15  ? 23.404  100.413 4.692   1.00 62.02  ? 46   ASP D N   1 
ATOM   10053 C  CA  . ASP D  1 15  ? 23.860  99.607  5.810   1.00 60.69  ? 46   ASP D CA  1 
ATOM   10054 C  C   . ASP D  1 15  ? 24.253  100.416 7.027   1.00 59.01  ? 46   ASP D C   1 
ATOM   10055 O  O   . ASP D  1 15  ? 23.883  100.102 8.163   1.00 57.60  ? 46   ASP D O   1 
ATOM   10056 C  CB  . ASP D  1 15  ? 25.004  98.697  5.363   1.00 62.95  ? 46   ASP D CB  1 
ATOM   10057 C  CG  . ASP D  1 15  ? 24.567  97.280  5.058   1.00 64.18  ? 46   ASP D CG  1 
ATOM   10058 O  OD1 . ASP D  1 15  ? 23.571  97.082  4.334   1.00 64.57  ? 46   ASP D OD1 1 
ATOM   10059 O  OD2 . ASP D  1 15  ? 25.235  96.341  5.547   1.00 65.66  ? 46   ASP D OD2 1 
ATOM   10060 N  N   . LYS D  1 16  ? 25.054  101.464 6.862   1.00 57.76  ? 47   LYS D N   1 
ATOM   10061 C  CA  . LYS D  1 16  ? 25.443  102.278 8.016   1.00 56.87  ? 47   LYS D CA  1 
ATOM   10062 C  C   . LYS D  1 16  ? 24.258  103.122 8.481   1.00 56.10  ? 47   LYS D C   1 
ATOM   10063 O  O   . LYS D  1 16  ? 24.103  103.339 9.681   1.00 56.34  ? 47   LYS D O   1 
ATOM   10064 C  CB  . LYS D  1 16  ? 26.635  103.164 7.685   1.00 58.52  ? 47   LYS D CB  1 
ATOM   10065 C  CG  . LYS D  1 16  ? 27.175  103.977 8.852   1.00 60.77  ? 47   LYS D CG  1 
ATOM   10066 C  CD  . LYS D  1 16  ? 28.660  104.270 8.682   1.00 62.90  ? 47   LYS D CD  1 
ATOM   10067 C  CE  . LYS D  1 16  ? 28.965  105.754 8.749   1.00 63.50  ? 47   LYS D CE  1 
ATOM   10068 N  NZ  . LYS D  1 16  ? 28.945  106.291 10.135  1.00 63.81  ? 47   LYS D NZ  1 
ATOM   10069 N  N   . GLU D  1 17  ? 23.450  103.583 7.527   1.00 54.03  ? 48   GLU D N   1 
ATOM   10070 C  CA  . GLU D  1 17  ? 22.254  104.359 7.841   1.00 50.94  ? 48   GLU D CA  1 
ATOM   10071 C  C   . GLU D  1 17  ? 21.448  103.567 8.882   1.00 48.41  ? 48   GLU D C   1 
ATOM   10072 O  O   . GLU D  1 17  ? 21.316  103.976 10.024  1.00 47.63  ? 48   GLU D O   1 
ATOM   10073 C  CB  . GLU D  1 17  ? 21.393  104.568 6.600   1.00 51.61  ? 48   GLU D CB  1 
ATOM   10074 C  CG  . GLU D  1 17  ? 21.577  105.876 5.863   1.00 53.53  ? 48   GLU D CG  1 
ATOM   10075 C  CD  . GLU D  1 17  ? 21.152  105.795 4.410   1.00 55.18  ? 48   GLU D CD  1 
ATOM   10076 O  OE1 . GLU D  1 17  ? 20.156  105.104 4.118   1.00 55.98  ? 48   GLU D OE1 1 
ATOM   10077 O  OE2 . GLU D  1 17  ? 21.800  106.411 3.541   1.00 56.66  ? 48   GLU D OE2 1 
ATOM   10078 N  N   . LEU D  1 18  ? 21.005  102.403 8.449   1.00 45.53  ? 49   LEU D N   1 
ATOM   10079 C  CA  . LEU D  1 18  ? 20.243  101.459 9.247   1.00 43.52  ? 49   LEU D CA  1 
ATOM   10080 C  C   . LEU D  1 18  ? 20.837  101.245 10.630  1.00 42.94  ? 49   LEU D C   1 
ATOM   10081 O  O   . LEU D  1 18  ? 20.155  101.277 11.657  1.00 41.70  ? 49   LEU D O   1 
ATOM   10082 C  CB  . LEU D  1 18  ? 20.158  100.140 8.472   1.00 41.93  ? 49   LEU D CB  1 
ATOM   10083 C  CG  . LEU D  1 18  ? 19.577  98.935  9.202   1.00 40.63  ? 49   LEU D CG  1 
ATOM   10084 C  CD1 . LEU D  1 18  ? 18.099  99.146  9.468   1.00 39.36  ? 49   LEU D CD1 1 
ATOM   10085 C  CD2 . LEU D  1 18  ? 19.828  97.671  8.395   1.00 39.34  ? 49   LEU D CD2 1 
ATOM   10086 N  N   . ALA D  1 19  ? 22.136  101.007 10.699  1.00 43.08  ? 50   ALA D N   1 
ATOM   10087 C  CA  . ALA D  1 19  ? 22.880  100.843 11.928  1.00 43.09  ? 50   ALA D CA  1 
ATOM   10088 C  C   . ALA D  1 19  ? 22.693  101.986 12.920  1.00 43.03  ? 50   ALA D C   1 
ATOM   10089 O  O   . ALA D  1 19  ? 22.398  101.721 14.091  1.00 43.29  ? 50   ALA D O   1 
ATOM   10090 C  CB  . ALA D  1 19  ? 24.370  100.725 11.593  1.00 43.54  ? 50   ALA D CB  1 
ATOM   10091 N  N   . VAL D  1 20  ? 22.913  103.226 12.503  1.00 42.74  ? 51   VAL D N   1 
ATOM   10092 C  CA  . VAL D  1 20  ? 22.768  104.388 13.372  1.00 43.14  ? 51   VAL D CA  1 
ATOM   10093 C  C   . VAL D  1 20  ? 21.318  104.599 13.796  1.00 42.83  ? 51   VAL D C   1 
ATOM   10094 O  O   . VAL D  1 20  ? 21.013  105.058 14.890  1.00 42.67  ? 51   VAL D O   1 
ATOM   10095 C  CB  . VAL D  1 20  ? 23.296  105.683 12.726  1.00 44.11  ? 51   VAL D CB  1 
ATOM   10096 C  CG1 . VAL D  1 20  ? 23.596  106.729 13.792  1.00 43.54  ? 51   VAL D CG1 1 
ATOM   10097 C  CG2 . VAL D  1 20  ? 24.552  105.416 11.904  1.00 45.04  ? 51   VAL D CG2 1 
ATOM   10098 N  N   . GLN D  1 21  ? 20.391  104.275 12.896  1.00 42.81  ? 52   GLN D N   1 
ATOM   10099 C  CA  . GLN D  1 21  ? 18.969  104.387 13.200  1.00 40.69  ? 52   GLN D CA  1 
ATOM   10100 C  C   . GLN D  1 21  ? 18.664  103.427 14.356  1.00 38.99  ? 52   GLN D C   1 
ATOM   10101 O  O   . GLN D  1 21  ? 18.160  103.823 15.392  1.00 39.02  ? 52   GLN D O   1 
ATOM   10102 C  CB  . GLN D  1 21  ? 18.117  103.998 11.993  1.00 40.12  ? 52   GLN D CB  1 
ATOM   10103 C  CG  . GLN D  1 21  ? 17.476  105.167 11.277  1.00 43.61  ? 52   GLN D CG  1 
ATOM   10104 C  CD  . GLN D  1 21  ? 16.644  106.028 12.208  1.00 46.97  ? 52   GLN D CD  1 
ATOM   10105 O  OE1 . GLN D  1 21  ? 17.157  106.798 13.022  1.00 46.40  ? 52   GLN D OE1 1 
ATOM   10106 N  NE2 . GLN D  1 21  ? 15.324  105.912 12.102  1.00 47.81  ? 52   GLN D NE2 1 
ATOM   10107 N  N   . TYR D  1 22  ? 19.005  102.174 14.108  1.00 36.80  ? 53   TYR D N   1 
ATOM   10108 C  CA  . TYR D  1 22  ? 18.751  101.096 15.049  1.00 35.34  ? 53   TYR D CA  1 
ATOM   10109 C  C   . TYR D  1 22  ? 19.318  101.437 16.418  1.00 36.28  ? 53   TYR D C   1 
ATOM   10110 O  O   . TYR D  1 22  ? 18.626  101.528 17.423  1.00 37.58  ? 53   TYR D O   1 
ATOM   10111 C  CB  . TYR D  1 22  ? 19.390  99.817  14.533  1.00 33.20  ? 53   TYR D CB  1 
ATOM   10112 C  CG  . TYR D  1 22  ? 18.762  98.531  15.001  1.00 29.85  ? 53   TYR D CG  1 
ATOM   10113 C  CD1 . TYR D  1 22  ? 18.974  98.050  16.283  1.00 29.34  ? 53   TYR D CD1 1 
ATOM   10114 C  CD2 . TYR D  1 22  ? 17.967  97.783  14.137  1.00 26.61  ? 53   TYR D CD2 1 
ATOM   10115 C  CE1 . TYR D  1 22  ? 18.405  96.863  16.715  1.00 27.93  ? 53   TYR D CE1 1 
ATOM   10116 C  CE2 . TYR D  1 22  ? 17.422  96.609  14.578  1.00 26.00  ? 53   TYR D CE2 1 
ATOM   10117 C  CZ  . TYR D  1 22  ? 17.616  96.137  15.847  1.00 27.18  ? 53   TYR D CZ  1 
ATOM   10118 O  OH  . TYR D  1 22  ? 17.048  94.951  16.273  1.00 27.63  ? 53   TYR D OH  1 
ATOM   10119 N  N   . LEU D  1 23  ? 20.616  101.676 16.456  1.00 37.72  ? 54   LEU D N   1 
ATOM   10120 C  CA  . LEU D  1 23  ? 21.319  101.958 17.696  1.00 38.28  ? 54   LEU D CA  1 
ATOM   10121 C  C   . LEU D  1 23  ? 20.769  103.171 18.417  1.00 39.25  ? 54   LEU D C   1 
ATOM   10122 O  O   . LEU D  1 23  ? 20.795  103.266 19.642  1.00 38.04  ? 54   LEU D O   1 
ATOM   10123 C  CB  . LEU D  1 23  ? 22.808  102.156 17.376  1.00 37.96  ? 54   LEU D CB  1 
ATOM   10124 C  CG  . LEU D  1 23  ? 23.541  100.925 16.829  1.00 36.73  ? 54   LEU D CG  1 
ATOM   10125 C  CD1 . LEU D  1 23  ? 25.028  101.201 16.708  1.00 36.79  ? 54   LEU D CD1 1 
ATOM   10126 C  CD2 . LEU D  1 23  ? 23.301  99.727  17.736  1.00 36.77  ? 54   LEU D CD2 1 
ATOM   10127 N  N   . ASN D  1 24  ? 20.313  104.149 17.648  1.00 42.07  ? 55   ASN D N   1 
ATOM   10128 C  CA  . ASN D  1 24  ? 19.785  105.387 18.204  1.00 44.27  ? 55   ASN D CA  1 
ATOM   10129 C  C   . ASN D  1 24  ? 18.398  105.202 18.802  1.00 42.89  ? 55   ASN D C   1 
ATOM   10130 O  O   . ASN D  1 24  ? 18.062  105.775 19.837  1.00 43.08  ? 55   ASN D O   1 
ATOM   10131 C  CB  . ASN D  1 24  ? 19.723  106.476 17.120  1.00 46.92  ? 55   ASN D CB  1 
ATOM   10132 C  CG  . ASN D  1 24  ? 18.904  107.658 17.595  1.00 50.92  ? 55   ASN D CG  1 
ATOM   10133 O  OD1 . ASN D  1 24  ? 19.067  108.074 18.745  1.00 52.54  ? 55   ASN D OD1 1 
ATOM   10134 N  ND2 . ASN D  1 24  ? 18.031  108.176 16.743  1.00 54.39  ? 55   ASN D ND2 1 
ATOM   10135 N  N   . THR D  1 25  ? 17.575  104.413 18.124  1.00 41.28  ? 56   THR D N   1 
ATOM   10136 C  CA  . THR D  1 25  ? 16.225  104.172 18.594  1.00 41.17  ? 56   THR D CA  1 
ATOM   10137 C  C   . THR D  1 25  ? 16.179  103.201 19.761  1.00 41.22  ? 56   THR D C   1 
ATOM   10138 O  O   . THR D  1 25  ? 15.402  103.381 20.697  1.00 42.90  ? 56   THR D O   1 
ATOM   10139 C  CB  . THR D  1 25  ? 15.304  103.651 17.478  1.00 41.09  ? 56   THR D CB  1 
ATOM   10140 O  OG1 . THR D  1 25  ? 15.360  104.479 16.317  1.00 42.69  ? 56   THR D OG1 1 
ATOM   10141 C  CG2 . THR D  1 25  ? 13.876  103.610 17.998  1.00 40.65  ? 56   THR D CG2 1 
ATOM   10142 N  N   . PHE D  1 26  ? 16.961  102.129 19.699  1.00 41.36  ? 57   PHE D N   1 
ATOM   10143 C  CA  . PHE D  1 26  ? 16.919  101.080 20.698  1.00 40.93  ? 57   PHE D CA  1 
ATOM   10144 C  C   . PHE D  1 26  ? 18.074  101.058 21.675  1.00 43.43  ? 57   PHE D C   1 
ATOM   10145 O  O   . PHE D  1 26  ? 17.933  100.385 22.708  1.00 44.89  ? 57   PHE D O   1 
ATOM   10146 C  CB  . PHE D  1 26  ? 16.800  99.722  20.013  1.00 37.15  ? 57   PHE D CB  1 
ATOM   10147 C  CG  . PHE D  1 26  ? 15.840  99.697  18.868  1.00 36.72  ? 57   PHE D CG  1 
ATOM   10148 C  CD1 . PHE D  1 26  ? 14.485  99.883  19.073  1.00 37.53  ? 57   PHE D CD1 1 
ATOM   10149 C  CD2 . PHE D  1 26  ? 16.290  99.478  17.578  1.00 35.47  ? 57   PHE D CD2 1 
ATOM   10150 C  CE1 . PHE D  1 26  ? 13.593  99.850  18.013  1.00 35.30  ? 57   PHE D CE1 1 
ATOM   10151 C  CE2 . PHE D  1 26  ? 15.406  99.440  16.517  1.00 33.16  ? 57   PHE D CE2 1 
ATOM   10152 C  CZ  . PHE D  1 26  ? 14.069  99.627  16.737  1.00 33.39  ? 57   PHE D CZ  1 
ATOM   10153 N  N   . TYR D  1 27  ? 19.186  101.731 21.424  1.00 45.34  ? 58   TYR D N   1 
ATOM   10154 C  CA  . TYR D  1 27  ? 20.319  101.707 22.331  1.00 47.53  ? 58   TYR D CA  1 
ATOM   10155 C  C   . TYR D  1 27  ? 20.700  103.029 22.953  1.00 48.51  ? 58   TYR D C   1 
ATOM   10156 O  O   . TYR D  1 27  ? 21.586  103.106 23.817  1.00 48.52  ? 58   TYR D O   1 
ATOM   10157 C  CB  . TYR D  1 27  ? 21.561  101.139 21.587  1.00 49.56  ? 58   TYR D CB  1 
ATOM   10158 C  CG  . TYR D  1 27  ? 21.306  99.668  21.311  1.00 51.05  ? 58   TYR D CG  1 
ATOM   10159 C  CD1 . TYR D  1 27  ? 21.549  98.738  22.310  1.00 50.99  ? 58   TYR D CD1 1 
ATOM   10160 C  CD2 . TYR D  1 27  ? 20.797  99.253  20.095  1.00 52.39  ? 58   TYR D CD2 1 
ATOM   10161 C  CE1 . TYR D  1 27  ? 21.295  97.406  22.084  1.00 53.57  ? 58   TYR D CE1 1 
ATOM   10162 C  CE2 . TYR D  1 27  ? 20.531  97.916  19.865  1.00 53.98  ? 58   TYR D CE2 1 
ATOM   10163 C  CZ  . TYR D  1 27  ? 20.768  97.008  20.874  1.00 54.62  ? 58   TYR D CZ  1 
ATOM   10164 O  OH  . TYR D  1 27  ? 20.557  95.655  20.689  1.00 56.95  ? 58   TYR D OH  1 
ATOM   10165 N  N   . GLY D  1 28  ? 20.122  104.129 22.489  1.00 49.64  ? 59   GLY D N   1 
ATOM   10166 C  CA  . GLY D  1 28  ? 20.439  105.434 23.053  1.00 51.49  ? 59   GLY D CA  1 
ATOM   10167 C  C   . GLY D  1 28  ? 21.705  106.036 22.476  1.00 52.75  ? 59   GLY D C   1 
ATOM   10168 O  O   . GLY D  1 28  ? 22.360  106.847 23.144  1.00 52.02  ? 59   GLY D O   1 
ATOM   10169 N  N   . CYS D  1 29  ? 22.086  105.695 21.244  1.00 53.80  ? 60   CYS D N   1 
ATOM   10170 C  CA  . CYS D  1 29  ? 23.281  106.296 20.625  1.00 54.10  ? 60   CYS D CA  1 
ATOM   10171 C  C   . CYS D  1 29  ? 22.962  107.736 20.243  1.00 54.86  ? 60   CYS D C   1 
ATOM   10172 O  O   . CYS D  1 29  ? 21.901  108.008 19.669  1.00 54.66  ? 60   CYS D O   1 
ATOM   10173 C  CB  . CYS D  1 29  ? 23.718  105.522 19.375  1.00 53.90  ? 60   CYS D CB  1 
ATOM   10174 S  SG  . CYS D  1 29  ? 25.453  105.710 18.914  1.00 54.06  ? 60   CYS D SG  1 
ATOM   10175 N  N   . PRO D  1 30  ? 23.830  108.681 20.554  1.00 56.10  ? 61   PRO D N   1 
ATOM   10176 C  CA  . PRO D  1 30  ? 23.585  110.080 20.232  1.00 57.86  ? 61   PRO D CA  1 
ATOM   10177 C  C   . PRO D  1 30  ? 23.248  110.252 18.764  1.00 59.54  ? 61   PRO D C   1 
ATOM   10178 O  O   . PRO D  1 30  ? 24.146  110.247 17.919  1.00 61.75  ? 61   PRO D O   1 
ATOM   10179 C  CB  . PRO D  1 30  ? 24.912  110.766 20.550  1.00 56.97  ? 61   PRO D CB  1 
ATOM   10180 C  CG  . PRO D  1 30  ? 25.556  109.894 21.563  1.00 56.02  ? 61   PRO D CG  1 
ATOM   10181 C  CD  . PRO D  1 30  ? 25.119  108.490 21.246  1.00 55.98  ? 61   PRO D CD  1 
ATOM   10182 N  N   . LYS D  1 31  ? 21.981  110.483 18.451  1.00 60.32  ? 62   LYS D N   1 
ATOM   10183 C  CA  . LYS D  1 31  ? 21.564  110.711 17.072  1.00 61.49  ? 62   LYS D CA  1 
ATOM   10184 C  C   . LYS D  1 31  ? 22.482  111.705 16.370  1.00 62.05  ? 62   LYS D C   1 
ATOM   10185 O  O   . LYS D  1 31  ? 22.811  111.526 15.198  1.00 60.87  ? 62   LYS D O   1 
ATOM   10186 C  CB  . LYS D  1 31  ? 20.109  111.172 17.027  1.00 62.27  ? 62   LYS D CB  1 
ATOM   10187 C  CG  . LYS D  1 31  ? 19.671  112.037 18.194  1.00 63.56  ? 62   LYS D CG  1 
ATOM   10188 C  CD  . LYS D  1 31  ? 19.400  111.257 19.469  1.00 63.61  ? 62   LYS D CD  1 
ATOM   10189 C  CE  . LYS D  1 31  ? 19.467  112.132 20.710  1.00 63.21  ? 62   LYS D CE  1 
ATOM   10190 N  NZ  . LYS D  1 31  ? 19.760  111.344 21.940  1.00 61.68  ? 62   LYS D NZ  1 
ATOM   10191 N  N   . GLU D  1 32  ? 22.940  112.713 17.103  1.00 63.39  ? 63   GLU D N   1 
ATOM   10192 C  CA  . GLU D  1 32  ? 23.820  113.742 16.601  1.00 64.66  ? 63   GLU D CA  1 
ATOM   10193 C  C   . GLU D  1 32  ? 25.290  113.358 16.600  1.00 64.61  ? 63   GLU D C   1 
ATOM   10194 O  O   . GLU D  1 32  ? 26.096  113.958 15.875  1.00 63.85  ? 63   GLU D O   1 
ATOM   10195 C  CB  . GLU D  1 32  ? 23.610  115.036 17.394  1.00 66.44  ? 63   GLU D CB  1 
ATOM   10196 C  CG  . GLU D  1 32  ? 22.183  115.545 17.431  1.00 69.05  ? 63   GLU D CG  1 
ATOM   10197 C  CD  . GLU D  1 32  ? 21.649  115.946 16.073  1.00 71.27  ? 63   GLU D CD  1 
ATOM   10198 O  OE1 . GLU D  1 32  ? 22.236  115.543 15.048  1.00 72.53  ? 63   GLU D OE1 1 
ATOM   10199 O  OE2 . GLU D  1 32  ? 20.632  116.665 16.021  1.00 73.29  ? 63   GLU D OE2 1 
ATOM   10200 N  N   . SER D  1 33  ? 25.682  112.387 17.422  1.00 64.45  ? 64   SER D N   1 
ATOM   10201 C  CA  . SER D  1 33  ? 27.087  112.010 17.520  1.00 64.61  ? 64   SER D CA  1 
ATOM   10202 C  C   . SER D  1 33  ? 27.302  110.509 17.563  1.00 64.98  ? 64   SER D C   1 
ATOM   10203 O  O   . SER D  1 33  ? 28.090  110.007 18.370  1.00 64.46  ? 64   SER D O   1 
ATOM   10204 C  CB  . SER D  1 33  ? 27.705  112.643 18.773  1.00 64.70  ? 64   SER D CB  1 
ATOM   10205 O  OG  . SER D  1 33  ? 27.119  113.901 19.054  1.00 64.97  ? 64   SER D OG  1 
ATOM   10206 N  N   . CYS D  1 34  ? 26.615  109.776 16.689  1.00 65.86  ? 65   CYS D N   1 
ATOM   10207 C  CA  . CYS D  1 34  ? 26.773  108.323 16.684  1.00 66.89  ? 65   CYS D CA  1 
ATOM   10208 C  C   . CYS D  1 34  ? 27.660  107.876 15.529  1.00 71.28  ? 65   CYS D C   1 
ATOM   10209 O  O   . CYS D  1 34  ? 27.502  106.768 15.015  1.00 71.53  ? 65   CYS D O   1 
ATOM   10210 C  CB  . CYS D  1 34  ? 25.415  107.630 16.580  1.00 62.94  ? 65   CYS D CB  1 
ATOM   10211 S  SG  . CYS D  1 34  ? 25.497  105.852 16.903  1.00 55.57  ? 65   CYS D SG  1 
ATOM   10212 N  N   . ASN D  1 35  ? 28.569  108.751 15.116  1.00 76.50  ? 66   ASN D N   1 
ATOM   10213 C  CA  . ASN D  1 35  ? 29.456  108.473 14.002  1.00 81.42  ? 66   ASN D CA  1 
ATOM   10214 C  C   . ASN D  1 35  ? 30.338  107.275 14.259  1.00 83.70  ? 66   ASN D C   1 
ATOM   10215 O  O   . ASN D  1 35  ? 29.920  106.153 13.935  1.00 85.92  ? 66   ASN D O   1 
ATOM   10216 C  CB  . ASN D  1 35  ? 30.236  109.697 13.558  1.00 82.95  ? 66   ASN D CB  1 
ATOM   10217 C  CG  . ASN D  1 35  ? 31.460  109.984 14.399  1.00 85.45  ? 66   ASN D CG  1 
ATOM   10218 O  OD1 . ASN D  1 35  ? 31.366  110.271 15.594  1.00 86.00  ? 66   ASN D OD1 1 
ATOM   10219 N  ND2 . ASN D  1 35  ? 32.635  109.872 13.782  1.00 86.16  ? 66   ASN D ND2 1 
ATOM   10220 N  N   . LEU D  1 36  ? 31.535  107.436 14.798  1.00 84.67  ? 67   LEU D N   1 
ATOM   10221 C  CA  . LEU D  1 36  ? 32.372  106.231 14.964  1.00 84.68  ? 67   LEU D CA  1 
ATOM   10222 C  C   . LEU D  1 36  ? 33.026  106.316 16.317  1.00 84.45  ? 67   LEU D C   1 
ATOM   10223 O  O   . LEU D  1 36  ? 33.124  107.473 16.744  1.00 84.67  ? 67   LEU D O   1 
ATOM   10224 C  CB  . LEU D  1 36  ? 33.386  106.181 13.817  1.00 84.28  ? 67   LEU D CB  1 
ATOM   10225 C  CG  . LEU D  1 36  ? 32.863  105.378 12.612  1.00 83.47  ? 67   LEU D CG  1 
ATOM   10226 C  CD1 . LEU D  1 36  ? 33.079  106.131 11.318  1.00 83.47  ? 67   LEU D CD1 1 
ATOM   10227 C  CD2 . LEU D  1 36  ? 33.515  104.007 12.571  1.00 82.46  ? 67   LEU D CD2 1 
ATOM   10228 N  N   . PHE D  1 37  ? 33.294  105.230 16.978  1.00 83.90  ? 68   PHE D N   1 
ATOM   10229 C  CA  . PHE D  1 37  ? 33.945  105.107 18.254  1.00 82.56  ? 68   PHE D CA  1 
ATOM   10230 C  C   . PHE D  1 37  ? 33.013  105.409 19.380  1.00 80.07  ? 68   PHE D C   1 
ATOM   10231 O  O   . PHE D  1 37  ? 33.397  105.313 20.550  1.00 78.35  ? 68   PHE D O   1 
ATOM   10232 C  CB  . PHE D  1 37  ? 35.239  105.914 18.345  1.00 86.15  ? 68   PHE D CB  1 
ATOM   10233 C  CG  . PHE D  1 37  ? 35.031  107.397 18.469  1.00 90.09  ? 68   PHE D CG  1 
ATOM   10234 C  CD1 . PHE D  1 37  ? 34.836  107.983 19.710  1.00 92.16  ? 68   PHE D CD1 1 
ATOM   10235 C  CD2 . PHE D  1 37  ? 35.036  108.204 17.346  1.00 91.31  ? 68   PHE D CD2 1 
ATOM   10236 C  CE1 . PHE D  1 37  ? 34.644  109.348 19.825  1.00 94.51  ? 68   PHE D CE1 1 
ATOM   10237 C  CE2 . PHE D  1 37  ? 34.842  109.569 17.454  1.00 93.30  ? 68   PHE D CE2 1 
ATOM   10238 C  CZ  . PHE D  1 37  ? 34.645  110.142 18.695  1.00 94.48  ? 68   PHE D CZ  1 
ATOM   10239 N  N   . VAL D  1 38  ? 31.843  105.774 18.961  1.00 78.52  ? 69   VAL D N   1 
ATOM   10240 C  CA  . VAL D  1 38  ? 30.731  105.935 19.835  1.00 76.12  ? 69   VAL D CA  1 
ATOM   10241 C  C   . VAL D  1 38  ? 29.700  104.965 19.376  1.00 73.90  ? 69   VAL D C   1 
ATOM   10242 O  O   . VAL D  1 38  ? 28.653  104.818 19.969  1.00 73.57  ? 69   VAL D O   1 
ATOM   10243 C  CB  . VAL D  1 38  ? 30.143  107.345 19.826  1.00 76.60  ? 69   VAL D CB  1 
ATOM   10244 C  CG1 . VAL D  1 38  ? 28.901  107.385 20.711  1.00 75.98  ? 69   VAL D CG1 1 
ATOM   10245 C  CG2 . VAL D  1 38  ? 31.170  108.358 20.282  1.00 76.06  ? 69   VAL D CG2 1 
ATOM   10246 N  N   . LEU D  1 39  ? 29.999  104.308 18.288  1.00 71.40  ? 70   LEU D N   1 
ATOM   10247 C  CA  . LEU D  1 39  ? 29.041  103.422 17.717  1.00 69.57  ? 70   LEU D CA  1 
ATOM   10248 C  C   . LEU D  1 39  ? 29.525  102.022 18.001  1.00 70.09  ? 70   LEU D C   1 
ATOM   10249 O  O   . LEU D  1 39  ? 28.733  101.082 18.050  1.00 71.32  ? 70   LEU D O   1 
ATOM   10250 C  CB  . LEU D  1 39  ? 28.836  103.760 16.249  1.00 67.07  ? 70   LEU D CB  1 
ATOM   10251 C  CG  . LEU D  1 39  ? 28.492  102.608 15.324  1.00 65.40  ? 70   LEU D CG  1 
ATOM   10252 C  CD1 . LEU D  1 39  ? 27.026  102.664 14.931  1.00 65.84  ? 70   LEU D CD1 1 
ATOM   10253 C  CD2 . LEU D  1 39  ? 29.384  102.640 14.094  1.00 64.32  ? 70   LEU D CD2 1 
ATOM   10254 N  N   . LYS D  1 40  ? 30.834  101.932 18.196  1.00 69.00  ? 71   LYS D N   1 
ATOM   10255 C  CA  . LYS D  1 40  ? 31.475  100.674 18.510  1.00 67.43  ? 71   LYS D CA  1 
ATOM   10256 C  C   . LYS D  1 40  ? 30.954  100.135 19.833  1.00 67.70  ? 71   LYS D C   1 
ATOM   10257 O  O   . LYS D  1 40  ? 30.468  99.008  19.905  1.00 69.23  ? 71   LYS D O   1 
ATOM   10258 C  CB  . LYS D  1 40  ? 32.992  100.859 18.542  1.00 66.35  ? 71   LYS D CB  1 
ATOM   10259 C  CG  . LYS D  1 40  ? 33.754  99.657  19.068  1.00 65.89  ? 71   LYS D CG  1 
ATOM   10260 C  CD  . LYS D  1 40  ? 35.217  99.713  18.662  1.00 64.21  ? 71   LYS D CD  1 
ATOM   10261 C  CE  . LYS D  1 40  ? 35.380  99.532  17.162  1.00 62.98  ? 71   LYS D CE  1 
ATOM   10262 N  NZ  . LYS D  1 40  ? 36.799  99.283  16.785  1.00 60.64  ? 71   LYS D NZ  1 
ATOM   10263 N  N   . ASP D  1 41  ? 31.055  100.950 20.881  1.00 66.00  ? 72   ASP D N   1 
ATOM   10264 C  CA  . ASP D  1 41  ? 30.566  100.554 22.195  1.00 65.07  ? 72   ASP D CA  1 
ATOM   10265 C  C   . ASP D  1 41  ? 29.101  100.153 22.114  1.00 63.51  ? 72   ASP D C   1 
ATOM   10266 O  O   . ASP D  1 41  ? 28.730  99.040  22.489  1.00 62.54  ? 72   ASP D O   1 
ATOM   10267 C  CB  . ASP D  1 41  ? 30.752  101.684 23.212  1.00 67.76  ? 72   ASP D CB  1 
ATOM   10268 C  CG  . ASP D  1 41  ? 31.920  102.591 22.881  1.00 70.82  ? 72   ASP D CG  1 
ATOM   10269 O  OD1 . ASP D  1 41  ? 32.033  103.012 21.711  1.00 71.96  ? 72   ASP D OD1 1 
ATOM   10270 O  OD2 . ASP D  1 41  ? 32.722  102.884 23.794  1.00 72.97  ? 72   ASP D OD2 1 
ATOM   10271 N  N   . THR D  1 42  ? 28.279  101.071 21.618  1.00 60.98  ? 73   THR D N   1 
ATOM   10272 C  CA  . THR D  1 42  ? 26.855  100.813 21.472  1.00 57.46  ? 73   THR D CA  1 
ATOM   10273 C  C   . THR D  1 42  ? 26.611  99.620  20.558  1.00 55.92  ? 73   THR D C   1 
ATOM   10274 O  O   . THR D  1 42  ? 25.892  98.687  20.918  1.00 55.88  ? 73   THR D O   1 
ATOM   10275 C  CB  . THR D  1 42  ? 26.122  102.034 20.909  1.00 57.41  ? 73   THR D CB  1 
ATOM   10276 O  OG1 . THR D  1 42  ? 26.104  103.079 21.889  1.00 55.43  ? 73   THR D OG1 1 
ATOM   10277 C  CG2 . THR D  1 42  ? 24.697  101.668 20.522  1.00 56.88  ? 73   THR D CG2 1 
ATOM   10278 N  N   . LEU D  1 43  ? 27.218  99.660  19.376  1.00 53.15  ? 74   LEU D N   1 
ATOM   10279 C  CA  . LEU D  1 43  ? 27.064  98.583  18.406  1.00 51.80  ? 74   LEU D CA  1 
ATOM   10280 C  C   . LEU D  1 43  ? 27.248  97.216  19.055  1.00 52.54  ? 74   LEU D C   1 
ATOM   10281 O  O   . LEU D  1 43  ? 26.487  96.285  18.788  1.00 53.69  ? 74   LEU D O   1 
ATOM   10282 C  CB  . LEU D  1 43  ? 28.048  98.756  17.248  1.00 49.29  ? 74   LEU D CB  1 
ATOM   10283 C  CG  . LEU D  1 43  ? 27.955  97.722  16.124  1.00 48.34  ? 74   LEU D CG  1 
ATOM   10284 C  CD1 . LEU D  1 43  ? 26.503  97.432  15.778  1.00 47.48  ? 74   LEU D CD1 1 
ATOM   10285 C  CD2 . LEU D  1 43  ? 28.714  98.196  14.894  1.00 48.25  ? 74   LEU D CD2 1 
ATOM   10286 N  N   . LYS D  1 44  ? 28.264  97.088  19.906  1.00 52.31  ? 75   LYS D N   1 
ATOM   10287 C  CA  . LYS D  1 44  ? 28.503  95.819  20.585  1.00 51.95  ? 75   LYS D CA  1 
ATOM   10288 C  C   . LYS D  1 44  ? 27.489  95.623  21.706  1.00 51.07  ? 75   LYS D C   1 
ATOM   10289 O  O   . LYS D  1 44  ? 27.019  94.510  21.942  1.00 50.06  ? 75   LYS D O   1 
ATOM   10290 C  CB  . LYS D  1 44  ? 29.943  95.727  21.093  1.00 53.55  ? 75   LYS D CB  1 
ATOM   10291 C  CG  . LYS D  1 44  ? 30.448  96.975  21.791  1.00 55.04  ? 75   LYS D CG  1 
ATOM   10292 C  CD  . LYS D  1 44  ? 31.888  96.801  22.246  1.00 56.03  ? 75   LYS D CD  1 
ATOM   10293 C  CE  . LYS D  1 44  ? 32.827  96.642  21.060  1.00 55.75  ? 75   LYS D CE  1 
ATOM   10294 N  NZ  . LYS D  1 44  ? 32.880  95.234  20.575  1.00 56.38  ? 75   LYS D NZ  1 
ATOM   10295 N  N   . LYS D  1 45  ? 27.149  96.710  22.404  1.00 50.31  ? 76   LYS D N   1 
ATOM   10296 C  CA  . LYS D  1 45  ? 26.127  96.629  23.444  1.00 49.52  ? 76   LYS D CA  1 
ATOM   10297 C  C   . LYS D  1 45  ? 24.893  95.880  22.901  1.00 46.97  ? 76   LYS D C   1 
ATOM   10298 O  O   . LYS D  1 45  ? 24.211  95.197  23.650  1.00 44.47  ? 76   LYS D O   1 
ATOM   10299 C  CB  . LYS D  1 45  ? 25.645  98.022  23.874  1.00 51.55  ? 76   LYS D CB  1 
ATOM   10300 C  CG  . LYS D  1 45  ? 26.669  98.895  24.574  1.00 54.55  ? 76   LYS D CG  1 
ATOM   10301 C  CD  . LYS D  1 45  ? 25.989  100.088 25.235  1.00 56.28  ? 76   LYS D CD  1 
ATOM   10302 C  CE  . LYS D  1 45  ? 26.999  101.050 25.833  1.00 57.75  ? 76   LYS D CE  1 
ATOM   10303 N  NZ  . LYS D  1 45  ? 26.625  101.459 27.215  1.00 56.53  ? 76   LYS D NZ  1 
ATOM   10304 N  N   . MET D  1 46  ? 24.624  96.115  21.631  1.00 45.19  ? 77   MET D N   1 
ATOM   10305 C  CA  . MET D  1 46  ? 23.515  95.551  20.908  1.00 44.12  ? 77   MET D CA  1 
ATOM   10306 C  C   . MET D  1 46  ? 23.719  94.112  20.490  1.00 45.13  ? 77   MET D C   1 
ATOM   10307 O  O   . MET D  1 46  ? 22.845  93.258  20.650  1.00 45.45  ? 77   MET D O   1 
ATOM   10308 C  CB  . MET D  1 46  ? 23.271  96.393  19.646  1.00 41.89  ? 77   MET D CB  1 
ATOM   10309 C  CG  . MET D  1 46  ? 22.265  95.718  18.710  1.00 39.91  ? 77   MET D CG  1 
ATOM   10310 S  SD  . MET D  1 46  ? 23.097  94.748  17.489  1.00 39.51  ? 77   MET D SD  1 
ATOM   10311 C  CE  . MET D  1 46  ? 21.753  93.954  16.631  1.00 37.98  ? 77   MET D CE  1 
ATOM   10312 N  N   . GLN D  1 47  ? 24.896  93.857  19.897  1.00 46.65  ? 78   GLN D N   1 
ATOM   10313 C  CA  . GLN D  1 47  ? 25.163  92.481  19.453  1.00 47.17  ? 78   GLN D CA  1 
ATOM   10314 C  C   . GLN D  1 47  ? 25.308  91.577  20.675  1.00 45.57  ? 78   GLN D C   1 
ATOM   10315 O  O   . GLN D  1 47  ? 24.961  90.408  20.624  1.00 44.67  ? 78   GLN D O   1 
ATOM   10316 C  CB  . GLN D  1 47  ? 26.360  92.368  18.533  1.00 47.56  ? 78   GLN D CB  1 
ATOM   10317 C  CG  . GLN D  1 47  ? 27.481  93.357  18.767  1.00 46.78  ? 78   GLN D CG  1 
ATOM   10318 C  CD  . GLN D  1 47  ? 28.376  93.551  17.563  1.00 46.58  ? 78   GLN D CD  1 
ATOM   10319 O  OE1 . GLN D  1 47  ? 29.428  94.190  17.638  1.00 45.94  ? 78   GLN D OE1 1 
ATOM   10320 N  NE2 . GLN D  1 47  ? 27.969  93.000  16.422  1.00 46.51  ? 78   GLN D NE2 1 
ATOM   10321 N  N   . LYS D  1 48  ? 25.813  92.167  21.756  1.00 44.50  ? 79   LYS D N   1 
ATOM   10322 C  CA  . LYS D  1 48  ? 25.949  91.436  23.010  1.00 44.01  ? 79   LYS D CA  1 
ATOM   10323 C  C   . LYS D  1 48  ? 24.567  90.933  23.428  1.00 44.74  ? 79   LYS D C   1 
ATOM   10324 O  O   . LYS D  1 48  ? 24.335  89.737  23.502  1.00 46.49  ? 79   LYS D O   1 
ATOM   10325 C  CB  . LYS D  1 48  ? 26.506  92.343  24.099  1.00 43.91  ? 79   LYS D CB  1 
ATOM   10326 C  CG  . LYS D  1 48  ? 26.303  91.819  25.512  1.00 45.46  ? 79   LYS D CG  1 
ATOM   10327 C  CD  . LYS D  1 48  ? 27.211  92.569  26.489  1.00 48.49  ? 79   LYS D CD  1 
ATOM   10328 C  CE  . LYS D  1 48  ? 26.785  92.293  27.923  1.00 50.91  ? 79   LYS D CE  1 
ATOM   10329 N  NZ  . LYS D  1 48  ? 26.526  90.845  28.150  1.00 51.52  ? 79   LYS D NZ  1 
ATOM   10330 N  N   . PHE D  1 49  ? 23.656  91.876  23.619  1.00 44.54  ? 80   PHE D N   1 
ATOM   10331 C  CA  . PHE D  1 49  ? 22.278  91.607  23.978  1.00 42.92  ? 80   PHE D CA  1 
ATOM   10332 C  C   . PHE D  1 49  ? 21.673  90.525  23.101  1.00 42.91  ? 80   PHE D C   1 
ATOM   10333 O  O   . PHE D  1 49  ? 21.071  89.588  23.620  1.00 42.20  ? 80   PHE D O   1 
ATOM   10334 C  CB  . PHE D  1 49  ? 21.451  92.892  23.888  1.00 43.05  ? 80   PHE D CB  1 
ATOM   10335 C  CG  . PHE D  1 49  ? 19.970  92.708  24.067  1.00 42.85  ? 80   PHE D CG  1 
ATOM   10336 C  CD1 . PHE D  1 49  ? 19.194  92.081  23.110  1.00 42.55  ? 80   PHE D CD1 1 
ATOM   10337 C  CD2 . PHE D  1 49  ? 19.345  93.195  25.208  1.00 41.58  ? 80   PHE D CD2 1 
ATOM   10338 C  CE1 . PHE D  1 49  ? 17.834  91.907  23.272  1.00 41.32  ? 80   PHE D CE1 1 
ATOM   10339 C  CE2 . PHE D  1 49  ? 17.988  93.033  25.378  1.00 42.17  ? 80   PHE D CE2 1 
ATOM   10340 C  CZ  . PHE D  1 49  ? 17.234  92.389  24.416  1.00 42.48  ? 80   PHE D CZ  1 
ATOM   10341 N  N   . PHE D  1 50  ? 21.810  90.621  21.781  1.00 43.46  ? 81   PHE D N   1 
ATOM   10342 C  CA  . PHE D  1 50  ? 21.241  89.624  20.878  1.00 44.44  ? 81   PHE D CA  1 
ATOM   10343 C  C   . PHE D  1 50  ? 22.126  88.395  20.756  1.00 44.75  ? 81   PHE D C   1 
ATOM   10344 O  O   . PHE D  1 50  ? 22.011  87.600  19.823  1.00 44.70  ? 81   PHE D O   1 
ATOM   10345 C  CB  . PHE D  1 50  ? 21.010  90.219  19.482  1.00 45.82  ? 81   PHE D CB  1 
ATOM   10346 C  CG  . PHE D  1 50  ? 19.816  91.130  19.433  1.00 47.06  ? 81   PHE D CG  1 
ATOM   10347 C  CD1 . PHE D  1 50  ? 18.543  90.585  19.383  1.00 47.58  ? 81   PHE D CD1 1 
ATOM   10348 C  CD2 . PHE D  1 50  ? 19.960  92.505  19.447  1.00 46.46  ? 81   PHE D CD2 1 
ATOM   10349 C  CE1 . PHE D  1 50  ? 17.430  91.401  19.341  1.00 47.65  ? 81   PHE D CE1 1 
ATOM   10350 C  CE2 . PHE D  1 50  ? 18.856  93.332  19.406  1.00 45.76  ? 81   PHE D CE2 1 
ATOM   10351 C  CZ  . PHE D  1 50  ? 17.599  92.771  19.354  1.00 48.71  ? 81   PHE D CZ  1 
ATOM   10352 N  N   . GLY D  1 51  ? 23.070  88.237  21.668  1.00 44.91  ? 82   GLY D N   1 
ATOM   10353 C  CA  . GLY D  1 51  ? 23.958  87.090  21.651  1.00 46.97  ? 82   GLY D CA  1 
ATOM   10354 C  C   . GLY D  1 51  ? 24.709  86.949  20.332  1.00 47.41  ? 82   GLY D C   1 
ATOM   10355 O  O   . GLY D  1 51  ? 24.791  85.870  19.738  1.00 47.51  ? 82   GLY D O   1 
ATOM   10356 N  N   . LEU D  1 52  ? 25.306  88.048  19.905  1.00 47.32  ? 83   LEU D N   1 
ATOM   10357 C  CA  . LEU D  1 52  ? 26.087  88.083  18.674  1.00 46.82  ? 83   LEU D CA  1 
ATOM   10358 C  C   . LEU D  1 52  ? 27.535  88.423  19.016  1.00 47.09  ? 83   LEU D C   1 
ATOM   10359 O  O   . LEU D  1 52  ? 27.789  89.130  19.999  1.00 47.75  ? 83   LEU D O   1 
ATOM   10360 C  CB  . LEU D  1 52  ? 25.521  89.164  17.747  1.00 44.30  ? 83   LEU D CB  1 
ATOM   10361 C  CG  . LEU D  1 52  ? 24.314  88.784  16.894  1.00 42.20  ? 83   LEU D CG  1 
ATOM   10362 C  CD1 . LEU D  1 52  ? 23.923  89.944  15.992  1.00 40.64  ? 83   LEU D CD1 1 
ATOM   10363 C  CD2 . LEU D  1 52  ? 24.586  87.527  16.085  1.00 38.64  ? 83   LEU D CD2 1 
ATOM   10364 N  N   . PRO D  1 53  ? 28.481  87.941  18.229  1.00 46.27  ? 84   PRO D N   1 
ATOM   10365 C  CA  . PRO D  1 53  ? 29.878  88.269  18.489  1.00 45.64  ? 84   PRO D CA  1 
ATOM   10366 C  C   . PRO D  1 53  ? 30.034  89.778  18.571  1.00 46.20  ? 84   PRO D C   1 
ATOM   10367 O  O   . PRO D  1 53  ? 29.874  90.484  17.574  1.00 46.84  ? 84   PRO D O   1 
ATOM   10368 C  CB  . PRO D  1 53  ? 30.627  87.689  17.305  1.00 45.75  ? 84   PRO D CB  1 
ATOM   10369 C  CG  . PRO D  1 53  ? 29.616  87.356  16.273  1.00 45.43  ? 84   PRO D CG  1 
ATOM   10370 C  CD  . PRO D  1 53  ? 28.331  87.108  17.019  1.00 45.12  ? 84   PRO D CD  1 
ATOM   10371 N  N   . GLN D  1 54  ? 30.349  90.292  19.747  1.00 45.76  ? 85   GLN D N   1 
ATOM   10372 C  CA  . GLN D  1 54  ? 30.552  91.715  19.962  1.00 44.83  ? 85   GLN D CA  1 
ATOM   10373 C  C   . GLN D  1 54  ? 31.775  92.221  19.211  1.00 45.39  ? 85   GLN D C   1 
ATOM   10374 O  O   . GLN D  1 54  ? 32.725  92.727  19.812  1.00 43.87  ? 85   GLN D O   1 
ATOM   10375 C  CB  . GLN D  1 54  ? 30.749  91.960  21.470  1.00 44.56  ? 85   GLN D CB  1 
ATOM   10376 C  CG  . GLN D  1 54  ? 29.806  91.110  22.302  1.00 47.05  ? 85   GLN D CG  1 
ATOM   10377 C  CD  . GLN D  1 54  ? 29.882  91.400  23.785  1.00 49.08  ? 85   GLN D CD  1 
ATOM   10378 O  OE1 . GLN D  1 54  ? 29.297  90.643  24.570  1.00 49.84  ? 85   GLN D OE1 1 
ATOM   10379 N  NE2 . GLN D  1 54  ? 30.581  92.464  24.160  1.00 47.09  ? 85   GLN D NE2 1 
ATOM   10380 N  N   . THR D  1 55  ? 31.736  92.123  17.887  1.00 46.73  ? 86   THR D N   1 
ATOM   10381 C  CA  . THR D  1 55  ? 32.825  92.562  17.030  1.00 48.42  ? 86   THR D CA  1 
ATOM   10382 C  C   . THR D  1 55  ? 33.038  94.066  17.156  1.00 49.89  ? 86   THR D C   1 
ATOM   10383 O  O   . THR D  1 55  ? 34.152  94.566  17.098  1.00 50.43  ? 86   THR D O   1 
ATOM   10384 C  CB  . THR D  1 55  ? 32.575  92.224  15.548  1.00 47.66  ? 86   THR D CB  1 
ATOM   10385 O  OG1 . THR D  1 55  ? 31.542  93.047  15.014  1.00 49.54  ? 86   THR D OG1 1 
ATOM   10386 C  CG2 . THR D  1 55  ? 32.189  90.764  15.389  1.00 47.45  ? 86   THR D CG2 1 
ATOM   10387 N  N   . GLY D  1 56  ? 31.934  94.802  17.260  1.00 51.95  ? 87   GLY D N   1 
ATOM   10388 C  CA  . GLY D  1 56  ? 31.990  96.261  17.355  1.00 53.35  ? 87   GLY D CA  1 
ATOM   10389 C  C   . GLY D  1 56  ? 32.047  96.835  15.939  1.00 54.60  ? 87   GLY D C   1 
ATOM   10390 O  O   . GLY D  1 56  ? 32.578  97.908  15.695  1.00 54.02  ? 87   GLY D O   1 
ATOM   10391 N  N   . ASP D  1 57  ? 31.692  95.968  14.994  1.00 56.09  ? 88   ASP D N   1 
ATOM   10392 C  CA  . ASP D  1 57  ? 31.751  96.276  13.566  1.00 57.27  ? 88   ASP D CA  1 
ATOM   10393 C  C   . ASP D  1 57  ? 30.443  95.817  12.928  1.00 56.26  ? 88   ASP D C   1 
ATOM   10394 O  O   . ASP D  1 57  ? 29.805  94.916  13.483  1.00 56.34  ? 88   ASP D O   1 
ATOM   10395 C  CB  . ASP D  1 57  ? 32.949  95.570  12.927  1.00 60.74  ? 88   ASP D CB  1 
ATOM   10396 C  CG  . ASP D  1 57  ? 34.271  95.800  13.624  1.00 64.27  ? 88   ASP D CG  1 
ATOM   10397 O  OD1 . ASP D  1 57  ? 34.373  95.663  14.865  1.00 64.88  ? 88   ASP D OD1 1 
ATOM   10398 O  OD2 . ASP D  1 57  ? 35.281  96.125  12.949  1.00 64.51  ? 88   ASP D OD2 1 
ATOM   10399 N  N   . LEU D  1 58  ? 30.004  96.427  11.843  1.00 55.32  ? 89   LEU D N   1 
ATOM   10400 C  CA  . LEU D  1 58  ? 28.746  96.099  11.190  1.00 54.44  ? 89   LEU D CA  1 
ATOM   10401 C  C   . LEU D  1 58  ? 28.812  94.798  10.395  1.00 53.55  ? 89   LEU D C   1 
ATOM   10402 O  O   . LEU D  1 58  ? 28.476  94.766  9.204   1.00 52.56  ? 89   LEU D O   1 
ATOM   10403 C  CB  . LEU D  1 58  ? 28.290  97.229  10.272  1.00 54.31  ? 89   LEU D CB  1 
ATOM   10404 C  CG  . LEU D  1 58  ? 27.378  98.316  10.814  1.00 54.37  ? 89   LEU D CG  1 
ATOM   10405 C  CD1 . LEU D  1 58  ? 26.535  98.912  9.688   1.00 55.61  ? 89   LEU D CD1 1 
ATOM   10406 C  CD2 . LEU D  1 58  ? 26.476  97.809  11.920  1.00 54.14  ? 89   LEU D CD2 1 
ATOM   10407 N  N   . ASP D  1 59  ? 29.186  93.711  11.056  1.00 53.44  ? 90   ASP D N   1 
ATOM   10408 C  CA  . ASP D  1 59  ? 29.301  92.415  10.411  1.00 53.95  ? 90   ASP D CA  1 
ATOM   10409 C  C   . ASP D  1 59  ? 27.975  91.936  9.847   1.00 54.56  ? 90   ASP D C   1 
ATOM   10410 O  O   . ASP D  1 59  ? 26.891  92.266  10.324  1.00 54.90  ? 90   ASP D O   1 
ATOM   10411 C  CB  . ASP D  1 59  ? 29.916  91.390  11.355  1.00 52.98  ? 90   ASP D CB  1 
ATOM   10412 C  CG  . ASP D  1 59  ? 29.394  91.514  12.773  1.00 52.19  ? 90   ASP D CG  1 
ATOM   10413 O  OD1 . ASP D  1 59  ? 28.189  91.281  12.993  1.00 51.42  ? 90   ASP D OD1 1 
ATOM   10414 O  OD2 . ASP D  1 59  ? 30.189  91.841  13.675  1.00 52.38  ? 90   ASP D OD2 1 
ATOM   10415 N  N   . GLN D  1 60  ? 28.055  91.090  8.823   1.00 54.62  ? 91   GLN D N   1 
ATOM   10416 C  CA  . GLN D  1 60  ? 26.919  90.541  8.118   1.00 54.94  ? 91   GLN D CA  1 
ATOM   10417 C  C   . GLN D  1 60  ? 25.809  90.094  9.059   1.00 54.39  ? 91   GLN D C   1 
ATOM   10418 O  O   . GLN D  1 60  ? 24.628  90.180  8.737   1.00 55.12  ? 91   GLN D O   1 
ATOM   10419 C  CB  . GLN D  1 60  ? 27.316  89.395  7.191   1.00 56.37  ? 91   GLN D CB  1 
ATOM   10420 C  CG  . GLN D  1 60  ? 28.568  89.592  6.378   1.00 60.46  ? 91   GLN D CG  1 
ATOM   10421 C  CD  . GLN D  1 60  ? 28.574  90.784  5.455   1.00 62.68  ? 91   GLN D CD  1 
ATOM   10422 O  OE1 . GLN D  1 60  ? 27.761  90.888  4.534   1.00 64.10  ? 91   GLN D OE1 1 
ATOM   10423 N  NE2 . GLN D  1 60  ? 29.510  91.711  5.676   1.00 62.52  ? 91   GLN D NE2 1 
ATOM   10424 N  N   . ASN D  1 61  ? 26.189  89.602  10.226  1.00 53.81  ? 92   ASN D N   1 
ATOM   10425 C  CA  . ASN D  1 61  ? 25.258  89.125  11.223  1.00 52.62  ? 92   ASN D CA  1 
ATOM   10426 C  C   . ASN D  1 61  ? 24.478  90.240  11.897  1.00 50.88  ? 92   ASN D C   1 
ATOM   10427 O  O   . ASN D  1 61  ? 23.252  90.174  12.010  1.00 49.67  ? 92   ASN D O   1 
ATOM   10428 C  CB  . ASN D  1 61  ? 26.023  88.339  12.299  1.00 54.16  ? 92   ASN D CB  1 
ATOM   10429 C  CG  . ASN D  1 61  ? 25.921  86.846  12.052  1.00 54.80  ? 92   ASN D CG  1 
ATOM   10430 O  OD1 . ASN D  1 61  ? 26.674  86.087  12.655  1.00 56.64  ? 92   ASN D OD1 1 
ATOM   10431 N  ND2 . ASN D  1 61  ? 25.005  86.445  11.185  1.00 53.46  ? 92   ASN D ND2 1 
ATOM   10432 N  N   . THR D  1 62  ? 25.205  91.234  12.404  1.00 48.76  ? 93   THR D N   1 
ATOM   10433 C  CA  . THR D  1 62  ? 24.542  92.355  13.062  1.00 47.09  ? 93   THR D CA  1 
ATOM   10434 C  C   . THR D  1 62  ? 23.491  92.929  12.114  1.00 46.81  ? 93   THR D C   1 
ATOM   10435 O  O   . THR D  1 62  ? 22.323  93.076  12.479  1.00 47.92  ? 93   THR D O   1 
ATOM   10436 C  CB  . THR D  1 62  ? 25.512  93.466  13.465  1.00 45.96  ? 93   THR D CB  1 
ATOM   10437 O  OG1 . THR D  1 62  ? 26.440  92.994  14.450  1.00 44.40  ? 93   THR D OG1 1 
ATOM   10438 C  CG2 . THR D  1 62  ? 24.742  94.652  14.026  1.00 46.71  ? 93   THR D CG2 1 
ATOM   10439 N  N   . ILE D  1 63  ? 23.921  93.222  10.897  1.00 45.37  ? 94   ILE D N   1 
ATOM   10440 C  CA  . ILE D  1 63  ? 23.020  93.742  9.881   1.00 43.95  ? 94   ILE D CA  1 
ATOM   10441 C  C   . ILE D  1 63  ? 21.803  92.852  9.691   1.00 44.15  ? 94   ILE D C   1 
ATOM   10442 O  O   . ILE D  1 63  ? 20.681  93.352  9.780   1.00 46.02  ? 94   ILE D O   1 
ATOM   10443 C  CB  . ILE D  1 63  ? 23.728  93.917  8.528   1.00 43.17  ? 94   ILE D CB  1 
ATOM   10444 C  CG1 . ILE D  1 63  ? 25.067  94.625  8.699   1.00 42.75  ? 94   ILE D CG1 1 
ATOM   10445 C  CG2 . ILE D  1 63  ? 22.821  94.613  7.530   1.00 40.42  ? 94   ILE D CG2 1 
ATOM   10446 C  CD1 . ILE D  1 63  ? 25.029  95.910  9.487   1.00 41.40  ? 94   ILE D CD1 1 
ATOM   10447 N  N   . GLU D  1 64  ? 21.988  91.558  9.480   1.00 44.25  ? 95   GLU D N   1 
ATOM   10448 C  CA  . GLU D  1 64  ? 20.878  90.631  9.291   1.00 44.62  ? 95   GLU D CA  1 
ATOM   10449 C  C   . GLU D  1 64  ? 19.865  90.768  10.422  1.00 43.05  ? 95   GLU D C   1 
ATOM   10450 O  O   . GLU D  1 64  ? 18.654  90.716  10.216  1.00 41.05  ? 95   GLU D O   1 
ATOM   10451 C  CB  . GLU D  1 64  ? 21.368  89.191  9.202   1.00 48.78  ? 95   GLU D CB  1 
ATOM   10452 C  CG  . GLU D  1 64  ? 20.294  88.131  9.039   1.00 53.04  ? 95   GLU D CG  1 
ATOM   10453 C  CD  . GLU D  1 64  ? 20.638  86.811  9.706   1.00 56.02  ? 95   GLU D CD  1 
ATOM   10454 O  OE1 . GLU D  1 64  ? 21.740  86.271  9.450   1.00 58.95  ? 95   GLU D OE1 1 
ATOM   10455 O  OE2 . GLU D  1 64  ? 19.811  86.301  10.493  1.00 55.39  ? 95   GLU D OE2 1 
ATOM   10456 N  N   . THR D  1 65  ? 20.372  90.942  11.636  1.00 41.49  ? 96   THR D N   1 
ATOM   10457 C  CA  . THR D  1 65  ? 19.512  91.117  12.800  1.00 41.17  ? 96   THR D CA  1 
ATOM   10458 C  C   . THR D  1 65  ? 18.790  92.454  12.760  1.00 41.58  ? 96   THR D C   1 
ATOM   10459 O  O   . THR D  1 65  ? 17.583  92.539  12.980  1.00 43.07  ? 96   THR D O   1 
ATOM   10460 C  CB  . THR D  1 65  ? 20.362  91.077  14.092  1.00 40.84  ? 96   THR D CB  1 
ATOM   10461 O  OG1 . THR D  1 65  ? 20.732  89.713  14.333  1.00 42.64  ? 96   THR D OG1 1 
ATOM   10462 C  CG2 . THR D  1 65  ? 19.573  91.628  15.265  1.00 38.55  ? 96   THR D CG2 1 
ATOM   10463 N  N   . MET D  1 66  ? 19.538  93.521  12.482  1.00 40.67  ? 97   MET D N   1 
ATOM   10464 C  CA  . MET D  1 66  ? 18.976  94.853  12.450  1.00 39.35  ? 97   MET D CA  1 
ATOM   10465 C  C   . MET D  1 66  ? 17.806  95.017  11.498  1.00 39.13  ? 97   MET D C   1 
ATOM   10466 O  O   . MET D  1 66  ? 16.977  95.916  11.678  1.00 37.98  ? 97   MET D O   1 
ATOM   10467 C  CB  . MET D  1 66  ? 20.082  95.864  12.120  1.00 38.37  ? 97   MET D CB  1 
ATOM   10468 C  CG  . MET D  1 66  ? 20.868  96.335  13.333  1.00 37.82  ? 97   MET D CG  1 
ATOM   10469 S  SD  . MET D  1 66  ? 22.155  97.493  12.869  1.00 42.90  ? 97   MET D SD  1 
ATOM   10470 C  CE  . MET D  1 66  ? 23.044  97.699  14.412  1.00 37.25  ? 97   MET D CE  1 
ATOM   10471 N  N   . ARG D  1 67  ? 17.738  94.214  10.451  1.00 39.84  ? 98   ARG D N   1 
ATOM   10472 C  CA  . ARG D  1 67  ? 16.693  94.305  9.451   1.00 40.81  ? 98   ARG D CA  1 
ATOM   10473 C  C   . ARG D  1 67  ? 15.436  93.547  9.836   1.00 40.54  ? 98   ARG D C   1 
ATOM   10474 O  O   . ARG D  1 67  ? 14.464  93.574  9.079   1.00 40.14  ? 98   ARG D O   1 
ATOM   10475 C  CB  . ARG D  1 67  ? 17.207  93.765  8.107   1.00 43.51  ? 98   ARG D CB  1 
ATOM   10476 C  CG  . ARG D  1 67  ? 18.471  94.441  7.611   1.00 49.39  ? 98   ARG D CG  1 
ATOM   10477 C  CD  . ARG D  1 67  ? 18.854  93.947  6.224   1.00 53.78  ? 98   ARG D CD  1 
ATOM   10478 N  NE  . ARG D  1 67  ? 19.857  94.799  5.598   1.00 57.06  ? 98   ARG D NE  1 
ATOM   10479 C  CZ  . ARG D  1 67  ? 19.670  96.056  5.222   1.00 57.59  ? 98   ARG D CZ  1 
ATOM   10480 N  NH1 . ARG D  1 67  ? 18.505  96.666  5.389   1.00 56.44  ? 98   ARG D NH1 1 
ATOM   10481 N  NH2 . ARG D  1 67  ? 20.675  96.722  4.661   1.00 58.95  ? 98   ARG D NH2 1 
ATOM   10482 N  N   . LYS D  1 68  ? 15.442  92.833  10.950  1.00 41.53  ? 99   LYS D N   1 
ATOM   10483 C  CA  . LYS D  1 68  ? 14.303  91.999  11.321  1.00 41.14  ? 99   LYS D CA  1 
ATOM   10484 C  C   . LYS D  1 68  ? 13.177  92.787  11.955  1.00 39.62  ? 99   LYS D C   1 
ATOM   10485 O  O   . LYS D  1 68  ? 13.404  93.554  12.887  1.00 38.79  ? 99   LYS D O   1 
ATOM   10486 C  CB  . LYS D  1 68  ? 14.769  90.877  12.260  1.00 44.19  ? 99   LYS D CB  1 
ATOM   10487 C  CG  . LYS D  1 68  ? 14.690  89.489  11.651  1.00 47.38  ? 99   LYS D CG  1 
ATOM   10488 C  CD  . LYS D  1 68  ? 15.875  89.222  10.736  1.00 52.49  ? 99   LYS D CD  1 
ATOM   10489 C  CE  . LYS D  1 68  ? 15.617  89.712  9.319   1.00 55.11  ? 99   LYS D CE  1 
ATOM   10490 N  NZ  . LYS D  1 68  ? 16.857  89.729  8.488   1.00 56.17  ? 99   LYS D NZ  1 
ATOM   10491 N  N   . PRO D  1 69  ? 11.955  92.603  11.484  1.00 39.17  ? 100  PRO D N   1 
ATOM   10492 C  CA  . PRO D  1 69  ? 10.798  93.251  12.086  1.00 38.90  ? 100  PRO D CA  1 
ATOM   10493 C  C   . PRO D  1 69  ? 10.843  93.067  13.593  1.00 38.48  ? 100  PRO D C   1 
ATOM   10494 O  O   . PRO D  1 69  ? 10.846  91.939  14.086  1.00 40.10  ? 100  PRO D O   1 
ATOM   10495 C  CB  . PRO D  1 69  ? 9.613   92.481  11.498  1.00 37.98  ? 100  PRO D CB  1 
ATOM   10496 C  CG  . PRO D  1 69  ? 10.103  92.004  10.178  1.00 38.05  ? 100  PRO D CG  1 
ATOM   10497 C  CD  . PRO D  1 69  ? 11.563  91.712  10.376  1.00 39.97  ? 100  PRO D CD  1 
ATOM   10498 N  N   . ARG D  1 70  ? 10.949  94.153  14.334  1.00 37.14  ? 101  ARG D N   1 
ATOM   10499 C  CA  . ARG D  1 70  ? 10.977  94.027  15.790  1.00 36.72  ? 101  ARG D CA  1 
ATOM   10500 C  C   . ARG D  1 70  ? 9.935   94.940  16.430  1.00 38.34  ? 101  ARG D C   1 
ATOM   10501 O  O   . ARG D  1 70  ? 8.854   95.174  15.897  1.00 38.62  ? 101  ARG D O   1 
ATOM   10502 C  CB  . ARG D  1 70  ? 12.369  94.371  16.296  1.00 35.57  ? 101  ARG D CB  1 
ATOM   10503 C  CG  . ARG D  1 70  ? 12.884  95.740  15.895  1.00 31.08  ? 101  ARG D CG  1 
ATOM   10504 C  CD  . ARG D  1 70  ? 14.053  96.147  16.746  1.00 29.61  ? 101  ARG D CD  1 
ATOM   10505 N  NE  . ARG D  1 70  ? 13.736  96.390  18.139  1.00 29.27  ? 101  ARG D NE  1 
ATOM   10506 C  CZ  . ARG D  1 70  ? 14.509  96.045  19.166  1.00 30.00  ? 101  ARG D CZ  1 
ATOM   10507 N  NH1 . ARG D  1 70  ? 15.665  95.417  18.987  1.00 29.21  ? 101  ARG D NH1 1 
ATOM   10508 N  NH2 . ARG D  1 70  ? 14.128  96.316  20.410  1.00 30.66  ? 101  ARG D NH2 1 
ATOM   10509 N  N   . CYS D  1 71  ? 10.307  95.464  17.591  1.00 39.09  ? 102  CYS D N   1 
ATOM   10510 C  CA  . CYS D  1 71  ? 9.454   96.365  18.330  1.00 40.46  ? 102  CYS D CA  1 
ATOM   10511 C  C   . CYS D  1 71  ? 10.115  97.732  18.474  1.00 40.36  ? 102  CYS D C   1 
ATOM   10512 O  O   . CYS D  1 71  ? 11.342  97.828  18.468  1.00 41.53  ? 102  CYS D O   1 
ATOM   10513 C  CB  . CYS D  1 71  ? 9.180   95.788  19.724  1.00 40.71  ? 102  CYS D CB  1 
ATOM   10514 S  SG  . CYS D  1 71  ? 8.562   97.082  20.837  1.00 49.96  ? 102  CYS D SG  1 
ATOM   10515 N  N   . GLY D  1 72  ? 9.313   98.773  18.654  1.00 39.64  ? 103  GLY D N   1 
ATOM   10516 C  CA  . GLY D  1 72  ? 9.809   100.121 18.784  1.00 38.82  ? 103  GLY D CA  1 
ATOM   10517 C  C   . GLY D  1 72  ? 10.381  100.458 20.143  1.00 39.01  ? 103  GLY D C   1 
ATOM   10518 O  O   . GLY D  1 72  ? 11.028  101.495 20.302  1.00 38.64  ? 103  GLY D O   1 
ATOM   10519 N  N   . ASN D  1 73  ? 10.130  99.633  21.151  1.00 39.95  ? 104  ASN D N   1 
ATOM   10520 C  CA  . ASN D  1 73  ? 10.657  99.880  22.500  1.00 42.21  ? 104  ASN D CA  1 
ATOM   10521 C  C   . ASN D  1 73  ? 12.158  99.642  22.548  1.00 42.80  ? 104  ASN D C   1 
ATOM   10522 O  O   . ASN D  1 73  ? 12.685  98.744  21.879  1.00 41.59  ? 104  ASN D O   1 
ATOM   10523 C  CB  . ASN D  1 73  ? 9.924   99.003  23.512  1.00 44.44  ? 104  ASN D CB  1 
ATOM   10524 C  CG  . ASN D  1 73  ? 8.567   99.522  23.927  1.00 44.91  ? 104  ASN D CG  1 
ATOM   10525 O  OD1 . ASN D  1 73  ? 7.620   99.503  23.140  1.00 45.20  ? 104  ASN D OD1 1 
ATOM   10526 N  ND2 . ASN D  1 73  ? 8.429   99.988  25.165  1.00 43.52  ? 104  ASN D ND2 1 
ATOM   10527 N  N   . PRO D  1 74  ? 12.902  100.436 23.303  1.00 44.19  ? 105  PRO D N   1 
ATOM   10528 C  CA  . PRO D  1 74  ? 14.358  100.323 23.336  1.00 45.63  ? 105  PRO D CA  1 
ATOM   10529 C  C   . PRO D  1 74  ? 14.800  99.056  24.032  1.00 47.57  ? 105  PRO D C   1 
ATOM   10530 O  O   . PRO D  1 74  ? 13.991  98.293  24.551  1.00 47.28  ? 105  PRO D O   1 
ATOM   10531 C  CB  . PRO D  1 74  ? 14.812  101.559 24.094  1.00 43.78  ? 105  PRO D CB  1 
ATOM   10532 C  CG  . PRO D  1 74  ? 13.662  101.887 24.980  1.00 43.53  ? 105  PRO D CG  1 
ATOM   10533 C  CD  . PRO D  1 74  ? 12.431  101.536 24.173  1.00 44.04  ? 105  PRO D CD  1 
ATOM   10534 N  N   . ASP D  1 75  ? 16.101  98.771  23.987  1.00 50.09  ? 106  ASP D N   1 
ATOM   10535 C  CA  . ASP D  1 75  ? 16.593  97.547  24.625  1.00 52.57  ? 106  ASP D CA  1 
ATOM   10536 C  C   . ASP D  1 75  ? 17.444  97.889  25.835  1.00 56.10  ? 106  ASP D C   1 
ATOM   10537 O  O   . ASP D  1 75  ? 17.757  97.043  26.662  1.00 56.08  ? 106  ASP D O   1 
ATOM   10538 C  CB  . ASP D  1 75  ? 17.365  96.713  23.614  1.00 49.98  ? 106  ASP D CB  1 
ATOM   10539 C  CG  . ASP D  1 75  ? 16.460  96.181  22.519  1.00 47.84  ? 106  ASP D CG  1 
ATOM   10540 O  OD1 . ASP D  1 75  ? 15.233  96.194  22.723  1.00 45.44  ? 106  ASP D OD1 1 
ATOM   10541 O  OD2 . ASP D  1 75  ? 16.937  95.746  21.456  1.00 47.54  ? 106  ASP D OD2 1 
ATOM   10542 N  N   . VAL D  1 76  ? 17.791  99.168  25.944  1.00 61.29  ? 107  VAL D N   1 
ATOM   10543 C  CA  . VAL D  1 76  ? 18.549  99.654  27.086  1.00 66.63  ? 107  VAL D CA  1 
ATOM   10544 C  C   . VAL D  1 76  ? 17.590  100.302 28.089  1.00 71.08  ? 107  VAL D C   1 
ATOM   10545 O  O   . VAL D  1 76  ? 16.480  100.691 27.737  1.00 72.05  ? 107  VAL D O   1 
ATOM   10546 C  CB  . VAL D  1 76  ? 19.600  100.709 26.698  1.00 65.96  ? 107  VAL D CB  1 
ATOM   10547 C  CG1 . VAL D  1 76  ? 20.575  100.159 25.670  1.00 65.95  ? 107  VAL D CG1 1 
ATOM   10548 C  CG2 . VAL D  1 76  ? 18.939  101.981 26.199  1.00 65.68  ? 107  VAL D CG2 1 
ATOM   10549 N  N   . ALA D  1 77  ? 18.055  100.405 29.326  1.00 75.58  ? 108  ALA D N   1 
ATOM   10550 C  CA  . ALA D  1 77  ? 17.264  101.103 30.346  1.00 80.13  ? 108  ALA D CA  1 
ATOM   10551 C  C   . ALA D  1 77  ? 17.558  102.598 30.188  1.00 83.65  ? 108  ALA D C   1 
ATOM   10552 O  O   . ALA D  1 77  ? 18.719  103.003 30.292  1.00 84.31  ? 108  ALA D O   1 
ATOM   10553 C  CB  . ALA D  1 77  ? 17.672  100.618 31.722  1.00 78.66  ? 108  ALA D CB  1 
ATOM   10554 N  N   . ASN D  1 78  ? 16.533  103.379 29.889  1.00 87.71  ? 109  ASN D N   1 
ATOM   10555 C  CA  . ASN D  1 78  ? 16.645  104.815 29.690  1.00 91.70  ? 109  ASN D CA  1 
ATOM   10556 C  C   . ASN D  1 78  ? 16.835  105.546 31.025  1.00 93.96  ? 109  ASN D C   1 
ATOM   10557 O  O   . ASN D  1 78  ? 16.047  106.399 31.419  1.00 93.79  ? 109  ASN D O   1 
ATOM   10558 C  CB  . ASN D  1 78  ? 15.425  105.371 28.964  1.00 91.86  ? 109  ASN D CB  1 
ATOM   10559 C  CG  . ASN D  1 78  ? 15.671  105.595 27.485  1.00 93.41  ? 109  ASN D CG  1 
ATOM   10560 O  OD1 . ASN D  1 78  ? 16.129  104.696 26.777  1.00 93.56  ? 109  ASN D OD1 1 
ATOM   10561 N  ND2 . ASN D  1 78  ? 15.368  106.800 27.014  1.00 93.84  ? 109  ASN D ND2 1 
ATOM   10562 N  N   . TYR D  1 79  ? 17.914  105.156 31.679  1.00 96.93  ? 110  TYR D N   1 
ATOM   10563 C  CA  . TYR D  1 79  ? 18.396  105.647 32.949  1.00 98.96  ? 110  TYR D CA  1 
ATOM   10564 C  C   . TYR D  1 79  ? 17.585  105.195 34.158  1.00 99.82  ? 110  TYR D C   1 
ATOM   10565 O  O   . TYR D  1 79  ? 16.545  105.777 34.472  1.00 100.00 ? 110  TYR D O   1 
ATOM   10566 C  CB  . TYR D  1 79  ? 18.554  107.145 32.902  1.00 99.35  ? 110  TYR D CB  1 
ATOM   10567 C  CG  . TYR D  1 79  ? 19.018  107.856 34.157  1.00 99.70  ? 110  TYR D CG  1 
ATOM   10568 C  CD1 . TYR D  1 79  ? 18.125  108.186 35.168  1.00 99.68  ? 110  TYR D CD1 1 
ATOM   10569 C  CD2 . TYR D  1 79  ? 20.346  108.229 34.312  1.00 99.69  ? 110  TYR D CD2 1 
ATOM   10570 C  CE1 . TYR D  1 79  ? 18.541  108.867 36.297  1.00 99.52  ? 110  TYR D CE1 1 
ATOM   10571 C  CE2 . TYR D  1 79  ? 20.772  108.908 35.438  1.00 100.00 ? 110  TYR D CE2 1 
ATOM   10572 C  CZ  . TYR D