data_1EAN
# 
_entry.id   1EAN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EAN         
PDBE  EBI-8189     
WWPDB D_1290008189 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CMO unspecified 'IMMUNOGLOBULIN MOTIF DNA-RECOGNITION AND HETERODIMERIZATION FOR THE PEBP2/CBF RUNT-DOMAIN' 
PDB 1CO1 unspecified 'FOLD OF THE CBFA' 
PDB 1EAO unspecified 
;AN "S-SWITCH" AND CHLORIDE IONS MODULATE THE DNA-BINDING ABILITY OF RUNX/AML1
;
PDB 1EAQ unspecified 
;AN "S-SWITCH" AND CHLORIDE IONS MODULATE THE DNA-BINDING ABILITY OF RUNX/AML1
;
PDB 1E50 unspecified 'AML1/CBF COMPLEX' 
PDB 1H9D unspecified 'AML1/CBF-BETA/DNA COMPLEX' 
PDB 1HJB unspecified 
'CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN AND C/EBPBETA BZIP DIMERIC BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER' 
PDB 1HJC unspecified 'CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER' 
PDB 1IO4 unspecified 
;CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN-CBFBETA CORE DOMAIN HETERODIMER AND C/EBPBETA BZIP DIMERIC BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EAN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2001-07-13 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Backstrom, S.'  1 
'Wolf-Watz, M.'  2 
'Grundstrom, C.' 3 
'Hard, T.'       4 
'Grundstrom, T.' 5 
'Sauer, U.H.'    6 
# 
_citation.id                        primary 
_citation.title                     
'The Runx1 Runt Domain at 1.25 A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            322 
_citation.page_first                259 
_citation.page_last                 ? 
_citation.year                      2002 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12217689 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(02)00702-7' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Backstrom, S.'  1 
primary 'Wolf-Watz, M.'  2 
primary 'Grundstrom, C.' 3 
primary 'Hard, T.'       4 
primary 'Grundstrom, T.' 5 
primary 'Sauer, U.H.'    6 
# 
_cell.entry_id           1EAN 
_cell.length_a           110.696 
_cell.length_b           110.696 
_cell.length_c           117.293 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EAN 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RUNT-RELATED TRANSCRIPTION FACTOR 1' 15523.550 1   ? YES 'RUNT DOMAIN RESIDUES 46-185' ? 
2 non-polymer syn 'CHLORIDE ION'                        35.453    2   ? ?   ?                             ? 
3 water       nat water                                 18.015    119 ? ?   ?                             ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ACUTE MYELOID LEUKEMIA 1 PROTEIN, ONCOGENE AML-1, CORE-BINDING FACTOR, ALPHA B SUBUNIT, CBF-ALPHA B, POLYOMAVIRUS ENHANCER BINDING PROTEIN 2 ALPHA B SUBUNIT, PEBP2-ALPHA B, PEA2-ALPHA B, SL3-3 ENHANCER FACTOR 1 ALPHA B SUBUNIT, SL3/AKV CORE-BINDING FACTOR ALPHA B SUBUNIT
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SGDRSMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMK
NQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SGDRSMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMK
NQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ASP n 
1 4   ARG n 
1 5   SER n 
1 6   MET n 
1 7   VAL n 
1 8   GLU n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  ASP n 
1 13  HIS n 
1 14  PRO n 
1 15  GLY n 
1 16  GLU n 
1 17  LEU n 
1 18  VAL n 
1 19  ARG n 
1 20  THR n 
1 21  ASP n 
1 22  SER n 
1 23  PRO n 
1 24  ASN n 
1 25  PHE n 
1 26  LEU n 
1 27  SER n 
1 28  SER n 
1 29  VAL n 
1 30  LEU n 
1 31  PRO n 
1 32  THR n 
1 33  HIS n 
1 34  TRP n 
1 35  ARG n 
1 36  SER n 
1 37  ASN n 
1 38  LYS n 
1 39  THR n 
1 40  LEU n 
1 41  PRO n 
1 42  ILE n 
1 43  ALA n 
1 44  PHE n 
1 45  LYS n 
1 46  VAL n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  GLY n 
1 51  ASP n 
1 52  VAL n 
1 53  PRO n 
1 54  ASP n 
1 55  GLY n 
1 56  THR n 
1 57  LEU n 
1 58  VAL n 
1 59  THR n 
1 60  VAL n 
1 61  MET n 
1 62  ALA n 
1 63  GLY n 
1 64  ASN n 
1 65  ASP n 
1 66  GLU n 
1 67  ASN n 
1 68  TYR n 
1 69  SER n 
1 70  ALA n 
1 71  GLU n 
1 72  LEU n 
1 73  ARG n 
1 74  ASN n 
1 75  ALA n 
1 76  THR n 
1 77  ALA n 
1 78  ALA n 
1 79  MET n 
1 80  LYS n 
1 81  ASN n 
1 82  GLN n 
1 83  VAL n 
1 84  ALA n 
1 85  ARG n 
1 86  PHE n 
1 87  ASN n 
1 88  ASP n 
1 89  LEU n 
1 90  ARG n 
1 91  PHE n 
1 92  VAL n 
1 93  GLY n 
1 94  ARG n 
1 95  SER n 
1 96  GLY n 
1 97  ARG n 
1 98  GLY n 
1 99  LYS n 
1 100 SER n 
1 101 PHE n 
1 102 THR n 
1 103 LEU n 
1 104 THR n 
1 105 ILE n 
1 106 THR n 
1 107 VAL n 
1 108 PHE n 
1 109 THR n 
1 110 ASN n 
1 111 PRO n 
1 112 PRO n 
1 113 GLN n 
1 114 VAL n 
1 115 ALA n 
1 116 THR n 
1 117 TYR n 
1 118 HIS n 
1 119 ARG n 
1 120 ALA n 
1 121 ILE n 
1 122 LYS n 
1 123 ILE n 
1 124 THR n 
1 125 VAL n 
1 126 ASP n 
1 127 GLY n 
1 128 PRO n 
1 129 ARG n 
1 130 GLU n 
1 131 PRO n 
1 132 ARG n 
1 133 ARG n 
1 134 HIS n 
1 135 ARG n 
1 136 GLN n 
1 137 LYS n 
1 138 LEU n 
1 139 ASP n 
1 140 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'REFOLDED FROM INCLUSION BODIES' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AML1_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q03347 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1EAN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 140 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q03347 
_struct_ref_seq.db_align_beg                  46 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  185 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       46 
_struct_ref_seq.pdbx_auth_seq_align_end       185 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EAN SER A 27 ? UNP Q03347 CYS 72 'engineered mutation' 72 1 
1 1EAN SER A 36 ? UNP Q03347 CYS 81 'engineered mutation' 81 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EAN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.46 
_exptl_crystal.density_percent_sol   72 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '30% MPEG 350, 5-10% PEG 3350, 70 MM NA CACODYLATE, PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   1999-06-06 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111), SI(113)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9315 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.9315 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1EAN 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.700 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   28866 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.04000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.3000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.74 
_reflns_shell.percent_possible_all   99.0 
_reflns_shell.Rmerge_I_obs           0.58000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.500 
_reflns_shell.pdbx_redundancy        4.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1EAN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     28868 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1519 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.B_iso_mean                               21.44 
_refine.aniso_B[1][1]                            1.56000 
_refine.aniso_B[2][2]                            1.56000 
_refine.aniso_B[3][3]                            -2.34000 
_refine.aniso_B[1][2]                            0.78000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL PLUS MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB CODE 1EAQ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.071 
_refine.pdbx_overall_ESU_R_Free                  0.072 
_refine.overall_SU_ML                            0.069 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.072 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        875 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             119 
_refine_hist.number_atoms_total               996 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 841  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.586  1.944  ? 1231 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.501  3.000  ? 1950 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.017  3.000  ? 113  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.478 15.000 ? 156  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.103  0.200  ? 148  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 994  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 185  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.206  0.300  ? 143  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.204  0.300  ? 743  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.141  0.500  ? 96   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.113  0.300  ? 1    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.217  0.300  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.812  0.500  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.433  1.500  ? 571  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.809  2.000  ? 935  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.130  3.000  ? 332  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.854  4.500  ? 296  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.74 
_refine_ls_shell.number_reflns_R_work             2114 
_refine_ls_shell.R_factor_R_work                  0.2760 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2790 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             101 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1EAN 
_struct.title                     
'THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound chloride ions modulate DNA binding' 
_struct.pdbx_descriptor           'RUNT-RELATED TRANSCRIPTION FACTOR 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EAN 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'TRANSCRIPTION-DNA COMPLEX, ACUTE MYELOID LEUKEMIA, AML, RUNX1, RUNT DOMAIN, CHLORIDE BINDING, TRANSCRIPTION FACTOR, IG FOLD' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           110 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            155 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    111 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     156 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 7 ? 
AC ? 2 ? 
AD ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
AC 1 2 ? parallel      
AD 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 18  ? ARG A 19  ? VAL A 63  ARG A 64  
AA 2 PHE A 25  ? SER A 27  ? PHE A 70  SER A 72  
AA 3 LYS A 45  ? ALA A 48  ? LYS A 90  ALA A 93  
AA 4 VAL A 83  ? ARG A 85  ? VAL A 128 ARG A 130 
AA 5 THR A 76  ? LYS A 80  ? THR A 121 LYS A 125 
AA 6 LEU A 57  ? ASN A 64  ? LEU A 102 ASN A 109 
AA 7 THR A 102 ? VAL A 107 ? THR A 147 VAL A 152 
AA 8 GLN A 113 ? THR A 116 ? GLN A 158 THR A 161 
AB 1 VAL A 18  ? ARG A 19  ? VAL A 63  ARG A 64  
AB 2 PHE A 25  ? SER A 27  ? PHE A 70  SER A 72  
AB 3 LYS A 45  ? ALA A 48  ? LYS A 90  ALA A 93  
AB 4 VAL A 83  ? ARG A 85  ? VAL A 128 ARG A 130 
AB 5 THR A 76  ? LYS A 80  ? THR A 121 LYS A 125 
AB 6 LEU A 57  ? ASN A 64  ? LEU A 102 ASN A 109 
AB 7 ASN A 67  ? ALA A 70  ? ASN A 112 ALA A 115 
AC 1 HIS A 33  ? ARG A 35  ? HIS A 78  ARG A 80  
AC 2 LYS A 122 ? THR A 124 ? LYS A 167 THR A 169 
AD 1 LEU A 72  ? ARG A 73  ? LEU A 117 ARG A 118 
AD 2 ARG A 90  ? PHE A 91  ? ARG A 135 PHE A 136 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N VAL A 18  ? N VAL A 63  O SER A 27  ? O SER A 72  
AA 2 3 N LEU A 26  ? N LEU A 71  O VAL A 47  ? O VAL A 92  
AA 3 4 N VAL A 46  ? N VAL A 91  O ALA A 84  ? O ALA A 129 
AA 4 5 N ARG A 85  ? N ARG A 130 O ALA A 78  ? O ALA A 123 
AA 5 6 N ALA A 77  ? N ALA A 122 O VAL A 58  ? O VAL A 103 
AA 6 7 N GLY A 63  ? N GLY A 108 O THR A 102 ? O THR A 147 
AA 7 8 N VAL A 107 ? N VAL A 152 O GLN A 113 ? O GLN A 158 
AB 1 2 N VAL A 18  ? N VAL A 63  O SER A 27  ? O SER A 72  
AB 2 3 N LEU A 26  ? N LEU A 71  O VAL A 47  ? O VAL A 92  
AB 3 4 N VAL A 46  ? N VAL A 91  O ALA A 84  ? O ALA A 129 
AB 4 5 N ARG A 85  ? N ARG A 130 O ALA A 78  ? O ALA A 123 
AB 5 6 N ALA A 77  ? N ALA A 122 O VAL A 58  ? O VAL A 103 
AB 6 7 N ASN A 64  ? N ASN A 109 O ASN A 67  ? O ASN A 112 
AC 1 2 N TRP A 34  ? N TRP A 79  O LYS A 122 ? O LYS A 167 
AD 1 2 N ARG A 73  ? N ARG A 118 O ARG A 90  ? O ARG A 135 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A1174' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A1175' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 ARG A 94  ? ARG A 139  . ? 1_555 ? 
2 AC1 3 THR A 124 ? THR A 169  . ? 1_555 ? 
3 AC1 3 VAL A 125 ? VAL A 170  . ? 1_555 ? 
4 AC2 3 GLU A 71  ? GLU A 116  . ? 1_555 ? 
5 AC2 3 GLY A 93  ? GLY A 138  . ? 1_555 ? 
6 AC2 3 HOH D .   ? HOH A 2064 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EAN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EAN 
_atom_sites.fract_transf_matrix[1][1]   0.009034 
_atom_sites.fract_transf_matrix[1][2]   0.005216 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010431 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008526 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 15  ? -21.650 5.827  -89.261  1.00 27.99 ? 60   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 15  ? -20.421 6.672  -89.235  1.00 27.45 ? 60   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 15  ? -20.275 7.564  -90.458  1.00 27.01 ? 60   GLY A C   1 
ATOM   4    O  O   . GLY A 1 15  ? -19.315 8.330  -90.557  1.00 27.51 ? 60   GLY A O   1 
ATOM   5    N  N   . GLU A 1 16  ? -21.199 7.441  -91.408  1.00 25.87 ? 61   GLU A N   1 
ATOM   6    C  CA  . GLU A 1 16  ? -21.260 8.340  -92.560  1.00 25.03 ? 61   GLU A CA  1 
ATOM   7    C  C   . GLU A 1 16  ? -21.466 9.813  -92.236  1.00 24.02 ? 61   GLU A C   1 
ATOM   8    O  O   . GLU A 1 16  ? -22.335 10.171 -91.449  1.00 24.00 ? 61   GLU A O   1 
ATOM   9    C  CB  . GLU A 1 16  ? -22.374 7.906  -93.511  1.00 25.06 ? 61   GLU A CB  1 
ATOM   10   C  CG  . GLU A 1 16  ? -22.297 8.599  -94.863  1.00 25.41 ? 61   GLU A CG  1 
ATOM   11   C  CD  . GLU A 1 16  ? -23.475 8.278  -95.761  1.00 26.84 ? 61   GLU A CD  1 
ATOM   12   O  OE1 . GLU A 1 16  ? -24.389 7.550  -95.316  1.00 28.43 ? 61   GLU A OE1 1 
ATOM   13   O  OE2 . GLU A 1 16  ? -23.486 8.756  -96.916  1.00 27.17 ? 61   GLU A OE2 1 
ATOM   14   N  N   . LEU A 1 17  ? -20.653 10.660 -92.861  1.00 23.03 ? 62   LEU A N   1 
ATOM   15   C  CA  . LEU A 1 17  ? -20.797 12.104 -92.721  1.00 22.72 ? 62   LEU A CA  1 
ATOM   16   C  C   . LEU A 1 17  ? -21.293 12.701 -94.037  1.00 22.19 ? 62   LEU A C   1 
ATOM   17   O  O   . LEU A 1 17  ? -20.999 12.178 -95.122  1.00 22.28 ? 62   LEU A O   1 
ATOM   18   C  CB  . LEU A 1 17  ? -19.471 12.742 -92.343  1.00 22.87 ? 62   LEU A CB  1 
ATOM   19   C  CG  . LEU A 1 17  ? -18.903 12.297 -90.996  1.00 23.85 ? 62   LEU A CG  1 
ATOM   20   C  CD1 . LEU A 1 17  ? -17.579 13.001 -90.815  1.00 24.56 ? 62   LEU A CD1 1 
ATOM   21   C  CD2 . LEU A 1 17  ? -19.839 12.576 -89.820  1.00 25.10 ? 62   LEU A CD2 1 
ATOM   22   N  N   . VAL A 1 18  ? -22.046 13.792 -93.927  1.00 21.46 ? 63   VAL A N   1 
ATOM   23   C  CA  . VAL A 1 18  ? -22.541 14.535 -95.076  1.00 21.05 ? 63   VAL A CA  1 
ATOM   24   C  C   . VAL A 1 18  ? -22.196 16.018 -94.899  1.00 20.99 ? 63   VAL A C   1 
ATOM   25   O  O   . VAL A 1 18  ? -21.908 16.470 -93.785  1.00 20.45 ? 63   VAL A O   1 
ATOM   26   C  CB  . VAL A 1 18  ? -24.062 14.387 -95.237  1.00 20.84 ? 63   VAL A CB  1 
ATOM   27   C  CG1 . VAL A 1 18  ? -24.405 13.014 -95.819  1.00 20.42 ? 63   VAL A CG1 1 
ATOM   28   C  CG2 . VAL A 1 18  ? -24.775 14.589 -93.923  1.00 21.27 ? 63   VAL A CG2 1 
ATOM   29   N  N   . ARG A 1 19  ? -22.230 16.770 -95.995  1.00 21.12 ? 64   ARG A N   1 
ATOM   30   C  CA  . ARG A 1 19  ? -21.950 18.203 -95.952  1.00 21.68 ? 64   ARG A CA  1 
ATOM   31   C  C   . ARG A 1 19  ? -23.138 18.968 -95.352  1.00 21.65 ? 64   ARG A C   1 
ATOM   32   O  O   . ARG A 1 19  ? -24.281 18.534 -95.469  1.00 21.43 ? 64   ARG A O   1 
ATOM   33   C  CB  . ARG A 1 19  ? -21.774 18.769 -97.368  1.00 21.94 ? 64   ARG A CB  1 
ATOM   34   C  CG  . ARG A 1 19  ? -20.835 18.037 -98.291  1.00 23.56 ? 64   ARG A CG  1 
ATOM   35   C  CD  . ARG A 1 19  ? -19.412 18.214 -97.926  1.00 25.03 ? 64   ARG A CD  1 
ATOM   36   N  NE  . ARG A 1 19  ? -18.511 17.358 -98.684  1.00 25.74 ? 64   ARG A NE  1 
ATOM   37   C  CZ  . ARG A 1 19  ? -17.367 17.764 -99.215  1.00 27.47 ? 64   ARG A CZ  1 
ATOM   38   N  NH1 . ARG A 1 19  ? -16.978 19.025 -99.077  1.00 28.57 ? 64   ARG A NH1 1 
ATOM   39   N  NH2 . ARG A 1 19  ? -16.607 16.913 -99.887  1.00 28.45 ? 64   ARG A NH2 1 
ATOM   40   N  N   . THR A 1 20  ? -22.869 20.099 -94.706  1.00 21.67 ? 65   THR A N   1 
ATOM   41   C  CA  . THR A 1 20  ? -23.927 21.053 -94.357  1.00 22.12 ? 65   THR A CA  1 
ATOM   42   C  C   . THR A 1 20  ? -23.757 22.191 -95.359  1.00 22.68 ? 65   THR A C   1 
ATOM   43   O  O   . THR A 1 20  ? -22.901 22.096 -96.235  1.00 22.93 ? 65   THR A O   1 
ATOM   44   C  CB  . THR A 1 20  ? -23.752 21.627 -92.946  1.00 22.35 ? 65   THR A CB  1 
ATOM   45   O  OG1 . THR A 1 20  ? -22.553 22.417 -92.902  1.00 21.57 ? 65   THR A OG1 1 
ATOM   46   C  CG2 . THR A 1 20  ? -23.569 20.542 -91.902  1.00 22.41 ? 65   THR A CG2 1 
ATOM   47   N  N   . ASP A 1 21  ? -24.531 23.275 -95.245  1.00 22.96 ? 66   ASP A N   1 
ATOM   48   C  CA  . ASP A 1 21  ? -24.377 24.385 -96.184  1.00 23.33 ? 66   ASP A CA  1 
ATOM   49   C  C   . ASP A 1 21  ? -23.230 25.301 -95.784  1.00 23.60 ? 66   ASP A C   1 
ATOM   50   O  O   . ASP A 1 21  ? -23.089 26.399 -96.325  1.00 23.76 ? 66   ASP A O   1 
ATOM   51   C  CB  . ASP A 1 21  ? -25.660 25.197 -96.371  1.00 23.24 ? 66   ASP A CB  1 
ATOM   52   C  CG  . ASP A 1 21  ? -26.002 26.069 -95.169  1.00 23.76 ? 66   ASP A CG  1 
ATOM   53   O  OD1 . ASP A 1 21  ? -25.381 25.928 -94.091  1.00 22.13 ? 66   ASP A OD1 1 
ATOM   54   O  OD2 . ASP A 1 21  ? -26.901 26.932 -95.234  1.00 23.82 ? 66   ASP A OD2 1 
ATOM   55   N  N   . SER A 1 22  ? -22.421 24.854 -94.828  1.00 23.72 ? 67   SER A N   1 
ATOM   56   C  CA  . SER A 1 22  ? -21.197 25.552 -94.491  1.00 24.14 ? 67   SER A CA  1 
ATOM   57   C  C   . SER A 1 22  ? -20.009 24.643 -94.739  1.00 24.27 ? 67   SER A C   1 
ATOM   58   O  O   . SER A 1 22  ? -19.991 23.500 -94.290  1.00 24.11 ? 67   SER A O   1 
ATOM   59   C  CB  . SER A 1 22  ? -21.181 25.982 -93.024  1.00 24.36 ? 67   SER A CB  1 
ATOM   60   O  OG  . SER A 1 22  ? -19.865 26.358 -92.633  1.00 24.58 ? 67   SER A OG  1 
ATOM   61   N  N   . PRO A 1 23  ? -19.009 25.155 -95.442  1.00 24.40 ? 68   PRO A N   1 
ATOM   62   C  CA  . PRO A 1 23  ? -17.806 24.371 -95.733  1.00 24.64 ? 68   PRO A CA  1 
ATOM   63   C  C   . PRO A 1 23  ? -16.974 24.075 -94.477  1.00 24.48 ? 68   PRO A C   1 
ATOM   64   O  O   . PRO A 1 23  ? -16.026 23.299 -94.554  1.00 25.05 ? 68   PRO A O   1 
ATOM   65   C  CB  . PRO A 1 23  ? -17.049 25.243 -96.740  1.00 24.77 ? 68   PRO A CB  1 
ATOM   66   C  CG  . PRO A 1 23  ? -17.556 26.642 -96.521  1.00 25.13 ? 68   PRO A CG  1 
ATOM   67   C  CD  . PRO A 1 23  ? -18.950 26.514 -96.005  1.00 24.81 ? 68   PRO A CD  1 
ATOM   68   N  N   . ASN A 1 24  ? -17.322 24.673 -93.344  1.00 24.06 ? 69   ASN A N   1 
ATOM   69   C  CA  . ASN A 1 24  ? -16.594 24.416 -92.103  1.00 23.82 ? 69   ASN A CA  1 
ATOM   70   C  C   . ASN A 1 24  ? -17.159 23.296 -91.211  1.00 23.23 ? 69   ASN A C   1 
ATOM   71   O  O   . ASN A 1 24  ? -16.532 22.932 -90.212  1.00 22.86 ? 69   ASN A O   1 
ATOM   72   C  CB  . ASN A 1 24  ? -16.447 25.729 -91.344  1.00 24.12 ? 69   ASN A CB  1 
ATOM   73   C  CG  . ASN A 1 24  ? -15.692 26.756 -92.163  1.00 25.33 ? 69   ASN A CG  1 
ATOM   74   O  OD1 . ASN A 1 24  ? -14.633 26.452 -92.704  1.00 27.60 ? 69   ASN A OD1 1 
ATOM   75   N  ND2 . ASN A 1 24  ? -16.233 27.962 -92.272  1.00 27.60 ? 69   ASN A ND2 1 
ATOM   76   N  N   . PHE A 1 25  ? -18.318 22.745 -91.576  1.00 22.47 ? 70   PHE A N   1 
ATOM   77   C  CA  . PHE A 1 25  ? -18.981 21.716 -90.759  1.00 22.28 ? 70   PHE A CA  1 
ATOM   78   C  C   . PHE A 1 25  ? -19.611 20.606 -91.565  1.00 21.94 ? 70   PHE A C   1 
ATOM   79   O  O   . PHE A 1 25  ? -20.193 20.840 -92.615  1.00 22.22 ? 70   PHE A O   1 
ATOM   80   C  CB  . PHE A 1 25  ? -20.038 22.363 -89.829  1.00 22.31 ? 70   PHE A CB  1 
ATOM   81   C  CG  . PHE A 1 25  ? -19.424 23.360 -88.914  1.00 21.85 ? 70   PHE A CG  1 
ATOM   82   C  CD1 . PHE A 1 25  ? -18.806 22.942 -87.754  1.00 22.54 ? 70   PHE A CD1 1 
ATOM   83   C  CD2 . PHE A 1 25  ? -19.424 24.708 -89.227  1.00 22.45 ? 70   PHE A CD2 1 
ATOM   84   C  CE1 . PHE A 1 25  ? -18.213 23.853 -86.907  1.00 22.92 ? 70   PHE A CE1 1 
ATOM   85   C  CE2 . PHE A 1 25  ? -18.832 25.618 -88.384  1.00 22.30 ? 70   PHE A CE2 1 
ATOM   86   C  CZ  . PHE A 1 25  ? -18.226 25.189 -87.226  1.00 22.56 ? 70   PHE A CZ  1 
ATOM   87   N  N   . LEU A 1 26  ? -19.478 19.395 -91.041  1.00 21.61 ? 71   LEU A N   1 
ATOM   88   C  CA  . LEU A 1 26  ? -20.138 18.222 -91.577  1.00 21.27 ? 71   LEU A CA  1 
ATOM   89   C  C   . LEU A 1 26  ? -21.092 17.743 -90.496  1.00 21.18 ? 71   LEU A C   1 
ATOM   90   O  O   . LEU A 1 26  ? -21.024 18.203 -89.357  1.00 21.21 ? 71   LEU A O   1 
ATOM   91   C  CB  . LEU A 1 26  ? -19.119 17.121 -91.832  1.00 21.11 ? 71   LEU A CB  1 
ATOM   92   C  CG  . LEU A 1 26  ? -17.950 17.475 -92.749  1.00 21.00 ? 71   LEU A CG  1 
ATOM   93   C  CD1 . LEU A 1 26  ? -17.006 16.307 -92.845  1.00 22.44 ? 71   LEU A CD1 1 
ATOM   94   C  CD2 . LEU A 1 26  ? -18.467 17.838 -94.118  1.00 20.68 ? 71   LEU A CD2 1 
ATOM   95   N  N   . SER A 1 27  ? -21.980 16.822 -90.837  1.00 20.86 ? 72   SER A N   1 
ATOM   96   C  CA  . SER A 1 27  ? -22.847 16.222 -89.837  1.00 20.75 ? 72   SER A CA  1 
ATOM   97   C  C   . SER A 1 27  ? -23.054 14.764 -90.171  1.00 20.84 ? 72   SER A C   1 
ATOM   98   O  O   . SER A 1 27  ? -22.719 14.299 -91.271  1.00 20.68 ? 72   SER A O   1 
ATOM   99   C  CB  . SER A 1 27  ? -24.216 16.913 -89.789  1.00 20.98 ? 72   SER A CB  1 
ATOM   100  O  OG  . SER A 1 27  ? -24.998 16.547 -90.921  1.00 21.84 ? 72   SER A OG  1 
ATOM   101  N  N   . SER A 1 28  ? -23.600 14.037 -89.207  1.00 20.70 ? 73   SER A N   1 
ATOM   102  C  CA  . SER A 1 28  ? -24.085 12.695 -89.459  1.00 20.69 ? 73   SER A CA  1 
ATOM   103  C  C   . SER A 1 28  ? -25.436 12.813 -90.176  1.00 20.69 ? 73   SER A C   1 
ATOM   104  O  O   . SER A 1 28  ? -25.923 13.917 -90.432  1.00 20.74 ? 73   SER A O   1 
ATOM   105  C  CB  . SER A 1 28  ? -24.246 11.940 -88.145  1.00 20.98 ? 73   SER A CB  1 
ATOM   106  O  OG  . SER A 1 28  ? -25.123 12.640 -87.285  1.00 21.99 ? 73   SER A OG  1 
ATOM   107  N  N   . VAL A 1 29  ? -26.045 11.672 -90.486  1.00 20.43 ? 74   VAL A N   1 
ATOM   108  C  CA  . VAL A 1 29  ? -27.276 11.633 -91.262  1.00 20.45 ? 74   VAL A CA  1 
ATOM   109  C  C   . VAL A 1 29  ? -28.493 11.369 -90.374  1.00 20.68 ? 74   VAL A C   1 
ATOM   110  O  O   . VAL A 1 29  ? -28.491 10.442 -89.571  1.00 21.11 ? 74   VAL A O   1 
ATOM   111  C  CB  . VAL A 1 29  ? -27.183 10.530 -92.339  1.00 20.21 ? 74   VAL A CB  1 
ATOM   112  C  CG1 . VAL A 1 29  ? -28.476 10.414 -93.104  1.00 20.97 ? 74   VAL A CG1 1 
ATOM   113  C  CG2 . VAL A 1 29  ? -26.046 10.825 -93.296  1.00 19.48 ? 74   VAL A CG2 1 
ATOM   114  N  N   . LEU A 1 30  ? -29.530 12.187 -90.532  1.00 21.01 ? 75   LEU A N   1 
ATOM   115  C  CA  . LEU A 1 30  ? -30.768 12.049 -89.769  1.00 21.30 ? 75   LEU A CA  1 
ATOM   116  C  C   . LEU A 1 30  ? -31.835 11.395 -90.644  1.00 21.34 ? 75   LEU A C   1 
ATOM   117  O  O   . LEU A 1 30  ? -31.702 11.327 -91.857  1.00 21.13 ? 75   LEU A O   1 
ATOM   118  C  CB  . LEU A 1 30  ? -31.267 13.435 -89.333  1.00 21.41 ? 75   LEU A CB  1 
ATOM   119  C  CG  . LEU A 1 30  ? -30.488 14.153 -88.228  1.00 21.78 ? 75   LEU A CG  1 
ATOM   120  C  CD1 . LEU A 1 30  ? -30.848 15.645 -88.128  1.00 22.85 ? 75   LEU A CD1 1 
ATOM   121  C  CD2 . LEU A 1 30  ? -30.742 13.444 -86.902  1.00 22.06 ? 75   LEU A CD2 1 
ATOM   122  N  N   . PRO A 1 31  ? -32.912 10.909 -90.046  1.00 21.21 ? 76   PRO A N   1 
ATOM   123  C  CA  . PRO A 1 31  ? -34.022 10.396 -90.844  1.00 21.37 ? 76   PRO A CA  1 
ATOM   124  C  C   . PRO A 1 31  ? -34.715 11.504 -91.621  1.00 21.27 ? 76   PRO A C   1 
ATOM   125  O  O   . PRO A 1 31  ? -34.658 12.654 -91.201  1.00 21.42 ? 76   PRO A O   1 
ATOM   126  C  CB  . PRO A 1 31  ? -35.002 9.876  -89.784  1.00 21.08 ? 76   PRO A CB  1 
ATOM   127  C  CG  . PRO A 1 31  ? -34.200 9.717  -88.557  1.00 21.33 ? 76   PRO A CG  1 
ATOM   128  C  CD  . PRO A 1 31  ? -33.165 10.795 -88.600  1.00 21.36 ? 76   PRO A CD  1 
ATOM   129  N  N   . THR A 1 32  ? -35.360 11.169 -92.731  1.00 21.36 ? 77   THR A N   1 
ATOM   130  C  CA  . THR A 1 32  ? -36.167 12.150 -93.455  1.00 21.82 ? 77   THR A CA  1 
ATOM   131  C  C   . THR A 1 32  ? -37.514 12.366 -92.774  1.00 21.95 ? 77   THR A C   1 
ATOM   132  O  O   . THR A 1 32  ? -38.120 13.434 -92.917  1.00 22.17 ? 77   THR A O   1 
ATOM   133  C  CB  . THR A 1 32  ? -36.439 11.691 -94.887  1.00 22.11 ? 77   THR A CB  1 
ATOM   134  O  OG1 . THR A 1 32  ? -37.023 10.383 -94.866  1.00 22.66 ? 77   THR A OG1 1 
ATOM   135  C  CG2 . THR A 1 32  ? -35.150 11.537 -95.682  1.00 22.67 ? 77   THR A CG2 1 
ATOM   136  N  N   . HIS A 1 33  ? -37.965 11.345 -92.042  1.00 21.63 ? 78   HIS A N   1 
ATOM   137  C  CA  . HIS A 1 33  ? -39.256 11.336 -91.352  1.00 21.84 ? 78   HIS A CA  1 
ATOM   138  C  C   . HIS A 1 33  ? -39.076 10.481 -90.093  1.00 21.67 ? 78   HIS A C   1 
ATOM   139  O  O   . HIS A 1 33  ? -38.598 9.349  -90.173  1.00 21.69 ? 78   HIS A O   1 
ATOM   140  C  CB  . HIS A 1 33  ? -40.318 10.755 -92.295  1.00 21.91 ? 78   HIS A CB  1 
ATOM   141  C  CG  . HIS A 1 33  ? -41.697 10.653 -91.715  1.00 22.48 ? 78   HIS A CG  1 
ATOM   142  N  ND1 . HIS A 1 33  ? -42.694 9.926  -92.328  1.00 23.32 ? 78   HIS A ND1 1 
ATOM   143  C  CD2 . HIS A 1 33  ? -42.250 11.179 -90.596  1.00 22.52 ? 78   HIS A CD2 1 
ATOM   144  C  CE1 . HIS A 1 33  ? -43.801 10.003 -91.610  1.00 23.31 ? 78   HIS A CE1 1 
ATOM   145  N  NE2 . HIS A 1 33  ? -43.559 10.760 -90.554  1.00 23.01 ? 78   HIS A NE2 1 
ATOM   146  N  N   . TRP A 1 34  ? -39.447 11.018 -88.934  1.00 21.52 ? 79   TRP A N   1 
ATOM   147  C  CA  . TRP A 1 34  ? -39.301 10.286 -87.673  1.00 21.55 ? 79   TRP A CA  1 
ATOM   148  C  C   . TRP A 1 34  ? -40.469 10.586 -86.746  1.00 21.74 ? 79   TRP A C   1 
ATOM   149  O  O   . TRP A 1 34  ? -41.166 11.586 -86.911  1.00 22.09 ? 79   TRP A O   1 
ATOM   150  C  CB  . TRP A 1 34  ? -37.983 10.648 -86.976  1.00 21.50 ? 79   TRP A CB  1 
ATOM   151  C  CG  . TRP A 1 34  ? -37.465 9.577  -86.039  1.00 21.69 ? 79   TRP A CG  1 
ATOM   152  C  CD1 . TRP A 1 34  ? -37.232 9.694  -84.693  1.00 21.73 ? 79   TRP A CD1 1 
ATOM   153  C  CD2 . TRP A 1 34  ? -37.118 8.230  -86.384  1.00 21.49 ? 79   TRP A CD2 1 
ATOM   154  N  NE1 . TRP A 1 34  ? -36.764 8.504  -84.187  1.00 21.96 ? 79   TRP A NE1 1 
ATOM   155  C  CE2 . TRP A 1 34  ? -36.683 7.589  -85.203  1.00 22.43 ? 79   TRP A CE2 1 
ATOM   156  C  CE3 . TRP A 1 34  ? -37.130 7.498  -87.575  1.00 22.48 ? 79   TRP A CE3 1 
ATOM   157  C  CZ2 . TRP A 1 34  ? -36.269 6.254  -85.181  1.00 23.01 ? 79   TRP A CZ2 1 
ATOM   158  C  CZ3 . TRP A 1 34  ? -36.717 6.175  -87.550  1.00 23.21 ? 79   TRP A CZ3 1 
ATOM   159  C  CH2 . TRP A 1 34  ? -36.294 5.568  -86.362  1.00 23.70 ? 79   TRP A CH2 1 
ATOM   160  N  N   . ARG A 1 35  ? -40.668 9.708  -85.770  1.00 21.70 ? 80   ARG A N   1 
ATOM   161  C  CA  . ARG A 1 35  ? -41.764 9.817  -84.815  1.00 21.68 ? 80   ARG A CA  1 
ATOM   162  C  C   . ARG A 1 35  ? -41.439 10.821 -83.707  1.00 21.46 ? 80   ARG A C   1 
ATOM   163  O  O   . ARG A 1 35  ? -40.333 10.808 -83.152  1.00 20.97 ? 80   ARG A O   1 
ATOM   164  C  CB  . ARG A 1 35  ? -42.018 8.448  -84.191  1.00 21.85 ? 80   ARG A CB  1 
ATOM   165  C  CG  . ARG A 1 35  ? -42.990 8.446  -83.023  1.00 22.70 ? 80   ARG A CG  1 
ATOM   166  C  CD  . ARG A 1 35  ? -43.305 7.052  -82.519  1.00 23.94 ? 80   ARG A CD  1 
ATOM   167  N  NE  . ARG A 1 35  ? -44.139 6.334  -83.476  1.00 25.00 ? 80   ARG A NE  1 
ATOM   168  C  CZ  . ARG A 1 35  ? -44.659 5.130  -83.272  1.00 25.56 ? 80   ARG A CZ  1 
ATOM   169  N  NH1 . ARG A 1 35  ? -44.434 4.489  -82.133  1.00 25.24 ? 80   ARG A NH1 1 
ATOM   170  N  NH2 . ARG A 1 35  ? -45.409 4.567  -84.214  1.00 25.88 ? 80   ARG A NH2 1 
ATOM   171  N  N   . SER A 1 36  ? -42.409 11.680 -83.395  1.00 21.15 ? 81   SER A N   1 
ATOM   172  C  CA  . SER A 1 36  ? -42.312 12.643 -82.299  1.00 21.30 ? 81   SER A CA  1 
ATOM   173  C  C   . SER A 1 36  ? -41.831 11.967 -81.001  1.00 20.91 ? 81   SER A C   1 
ATOM   174  O  O   . SER A 1 36  ? -42.421 10.986 -80.553  1.00 20.54 ? 81   SER A O   1 
ATOM   175  C  CB  . SER A 1 36  ? -43.704 13.212 -81.994  1.00 21.70 ? 81   SER A CB  1 
ATOM   176  O  OG  A SER A 1 36  ? -44.616 12.364 -82.655  0.50 22.87 ? 81   SER A OG  1 
ATOM   177  O  OG  B SER A 1 36  ? -43.499 14.207 -80.999  0.50 21.90 ? 81   SER A OG  1 
ATOM   178  N  N   . ASN A 1 37  ? -40.767 12.503 -80.413  1.00 20.95 ? 82   ASN A N   1 
ATOM   179  C  CA  . ASN A 1 37  ? -40.218 12.051 -79.126  1.00 20.81 ? 82   ASN A CA  1 
ATOM   180  C  C   . ASN A 1 37  ? -39.520 10.684 -79.117  1.00 21.18 ? 82   ASN A C   1 
ATOM   181  O  O   . ASN A 1 37  ? -39.153 10.188 -78.051  1.00 21.46 ? 82   ASN A O   1 
ATOM   182  C  CB  . ASN A 1 37  ? -41.277 12.112 -78.018  1.00 20.70 ? 82   ASN A CB  1 
ATOM   183  C  CG  . ASN A 1 37  ? -40.670 12.406 -76.648  1.00 20.43 ? 82   ASN A CG  1 
ATOM   184  O  OD1 . ASN A 1 37  ? -39.562 12.948 -76.544  1.00 19.60 ? 82   ASN A OD1 1 
ATOM   185  N  ND2 . ASN A 1 37  ? -41.390 12.054 -75.595  1.00 18.70 ? 82   ASN A ND2 1 
ATOM   186  N  N   . LYS A 1 38  ? -39.337 10.078 -80.287  1.00 21.13 ? 83   LYS A N   1 
ATOM   187  C  CA  . LYS A 1 38  ? -38.667 8.782  -80.383  1.00 21.55 ? 83   LYS A CA  1 
ATOM   188  C  C   . LYS A 1 38  ? -37.159 8.923  -80.519  1.00 21.42 ? 83   LYS A C   1 
ATOM   189  O  O   . LYS A 1 38  ? -36.672 9.747  -81.285  1.00 21.43 ? 83   LYS A O   1 
ATOM   190  C  CB  . LYS A 1 38  ? -39.194 8.014  -81.585  1.00 21.78 ? 83   LYS A CB  1 
ATOM   191  C  CG  . LYS A 1 38  ? -38.671 6.606  -81.700  1.00 22.89 ? 83   LYS A CG  1 
ATOM   192  C  CD  . LYS A 1 38  ? -39.424 5.881  -82.791  1.00 24.52 ? 83   LYS A CD  1 
ATOM   193  C  CE  . LYS A 1 38  ? -38.828 4.525  -83.090  1.00 25.44 ? 83   LYS A CE  1 
ATOM   194  N  NZ  . LYS A 1 38  ? -39.048 3.582  -81.965  1.00 27.60 ? 83   LYS A NZ  1 
ATOM   195  N  N   . THR A 1 39  ? -36.423 8.114  -79.766  1.00 21.72 ? 84   THR A N   1 
ATOM   196  C  CA  . THR A 1 39  ? -34.971 8.087  -79.873  1.00 22.18 ? 84   THR A CA  1 
ATOM   197  C  C   . THR A 1 39  ? -34.530 7.879  -81.326  1.00 22.12 ? 84   THR A C   1 
ATOM   198  O  O   . THR A 1 39  ? -35.125 7.092  -82.061  1.00 21.72 ? 84   THR A O   1 
ATOM   199  C  CB  . THR A 1 39  ? -34.419 6.942  -79.025  1.00 22.43 ? 84   THR A CB  1 
ATOM   200  O  OG1 . THR A 1 39  ? -34.849 7.087  -77.664  1.00 24.09 ? 84   THR A OG1 1 
ATOM   201  C  CG2 . THR A 1 39  ? -32.905 7.003  -78.966  1.00 22.78 ? 84   THR A CG2 1 
ATOM   202  N  N   . LEU A 1 40  ? -33.482 8.581  -81.743  1.00 22.37 ? 85   LEU A N   1 
ATOM   203  C  CA  . LEU A 1 40  ? -33.007 8.478  -83.120  1.00 22.76 ? 85   LEU A CA  1 
ATOM   204  C  C   . LEU A 1 40  ? -32.252 7.179  -83.377  1.00 23.39 ? 85   LEU A C   1 
ATOM   205  O  O   . LEU A 1 40  ? -31.627 6.632  -82.472  1.00 23.72 ? 85   LEU A O   1 
ATOM   206  C  CB  . LEU A 1 40  ? -32.066 9.641  -83.444  1.00 22.66 ? 85   LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 40  ? -32.648 11.052 -83.446  1.00 22.86 ? 85   LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 40  ? -31.507 12.063 -83.467  1.00 23.91 ? 85   LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 40  ? -33.626 11.254 -84.618  1.00 22.94 ? 85   LEU A CD2 1 
ATOM   210  N  N   . PRO A 1 41  ? -32.303 6.689  -84.613  1.00 23.83 ? 86   PRO A N   1 
ATOM   211  C  CA  . PRO A 1 41  ? -31.584 5.465  -84.979  1.00 24.17 ? 86   PRO A CA  1 
ATOM   212  C  C   . PRO A 1 41  ? -30.061 5.656  -85.003  1.00 24.29 ? 86   PRO A C   1 
ATOM   213  O  O   . PRO A 1 41  ? -29.330 4.693  -84.746  1.00 24.54 ? 86   PRO A O   1 
ATOM   214  C  CB  . PRO A 1 41  ? -32.136 5.137  -86.369  1.00 24.37 ? 86   PRO A CB  1 
ATOM   215  C  CG  . PRO A 1 41  ? -32.636 6.415  -86.913  1.00 24.39 ? 86   PRO A CG  1 
ATOM   216  C  CD  . PRO A 1 41  ? -33.048 7.258  -85.749  1.00 23.75 ? 86   PRO A CD  1 
ATOM   217  N  N   . ILE A 1 42  ? -29.606 6.872  -85.295  1.00 24.27 ? 87   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 42  ? -28.178 7.200  -85.357  1.00 24.42 ? 87   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 42  ? -27.954 8.495  -84.573  1.00 24.19 ? 87   ILE A C   1 
ATOM   220  O  O   . ILE A 1 42  ? -28.488 9.535  -84.949  1.00 24.38 ? 87   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 42  ? -27.719 7.398  -86.816  1.00 24.55 ? 87   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 42  ? -27.823 6.100  -87.621  1.00 25.21 ? 87   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 42  ? -26.281 7.861  -86.852  1.00 24.92 ? 87   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 42  ? -27.518 6.294  -89.115  1.00 25.80 ? 87   ILE A CD1 1 
ATOM   225  N  N   . ALA A 1 43  ? -27.175 8.443  -83.491  1.00 24.05 ? 88   ALA A N   1 
ATOM   226  C  CA  . ALA A 1 43  ? -26.928 9.643  -82.682  1.00 23.93 ? 88   ALA A CA  1 
ATOM   227  C  C   . ALA A 1 43  ? -26.421 10.782 -83.555  1.00 24.00 ? 88   ALA A C   1 
ATOM   228  O  O   . ALA A 1 43  ? -25.572 10.575 -84.429  1.00 23.84 ? 88   ALA A O   1 
ATOM   229  C  CB  . ALA A 1 43  ? -25.937 9.358  -81.562  1.00 24.10 ? 88   ALA A CB  1 
ATOM   230  N  N   . PHE A 1 44  ? -26.928 11.990 -83.320  1.00 23.66 ? 89   PHE A N   1 
ATOM   231  C  CA  . PHE A 1 44  ? -26.572 13.113 -84.177  1.00 23.73 ? 89   PHE A CA  1 
ATOM   232  C  C   . PHE A 1 44  ? -25.189 13.623 -83.806  1.00 24.00 ? 89   PHE A C   1 
ATOM   233  O  O   . PHE A 1 44  ? -24.832 13.711 -82.628  1.00 23.81 ? 89   PHE A O   1 
ATOM   234  C  CB  . PHE A 1 44  ? -27.586 14.264 -84.093  1.00 23.72 ? 89   PHE A CB  1 
ATOM   235  C  CG  . PHE A 1 44  ? -27.374 15.338 -85.140  1.00 23.03 ? 89   PHE A CG  1 
ATOM   236  C  CD1 . PHE A 1 44  ? -27.409 15.019 -86.483  1.00 21.64 ? 89   PHE A CD1 1 
ATOM   237  C  CD2 . PHE A 1 44  ? -27.141 16.663 -84.784  1.00 22.35 ? 89   PHE A CD2 1 
ATOM   238  C  CE1 . PHE A 1 44  ? -27.217 15.988 -87.451  1.00 22.57 ? 89   PHE A CE1 1 
ATOM   239  C  CE2 . PHE A 1 44  ? -26.950 17.635 -85.760  1.00 23.16 ? 89   PHE A CE2 1 
ATOM   240  C  CZ  . PHE A 1 44  ? -26.988 17.289 -87.089  1.00 22.62 ? 89   PHE A CZ  1 
ATOM   241  N  N   . LYS A 1 45  ? -24.413 13.965 -84.823  1.00 24.11 ? 90   LYS A N   1 
ATOM   242  C  CA  . LYS A 1 45  ? -23.074 14.471 -84.612  1.00 24.43 ? 90   LYS A CA  1 
ATOM   243  C  C   . LYS A 1 45  ? -22.867 15.691 -85.486  1.00 24.32 ? 90   LYS A C   1 
ATOM   244  O  O   . LYS A 1 45  ? -23.431 15.786 -86.580  1.00 24.47 ? 90   LYS A O   1 
ATOM   245  C  CB  . LYS A 1 45  ? -22.035 13.409 -84.979  1.00 24.96 ? 90   LYS A CB  1 
ATOM   246  C  CG  . LYS A 1 45  ? -22.142 12.131 -84.173  1.00 26.74 ? 90   LYS A CG  1 
ATOM   247  C  CD  . LYS A 1 45  ? -20.985 11.185 -84.483  1.00 28.67 ? 90   LYS A CD  1 
ATOM   248  C  CE  . LYS A 1 45  ? -21.067 9.908  -83.656  1.00 30.79 ? 90   LYS A CE  1 
ATOM   249  N  NZ  . LYS A 1 45  ? -19.929 8.977  -83.931  1.00 31.96 ? 90   LYS A NZ  1 
ATOM   250  N  N   . VAL A 1 46  ? -22.052 16.621 -85.001  1.00 23.40 ? 91   VAL A N   1 
ATOM   251  C  CA  . VAL A 1 46  ? -21.598 17.741 -85.810  1.00 22.81 ? 91   VAL A CA  1 
ATOM   252  C  C   . VAL A 1 46  ? -20.080 17.712 -85.772  1.00 22.57 ? 91   VAL A C   1 
ATOM   253  O  O   . VAL A 1 46  ? -19.489 17.609 -84.697  1.00 22.08 ? 91   VAL A O   1 
ATOM   254  C  CB  . VAL A 1 46  ? -22.134 19.091 -85.286  1.00 22.68 ? 91   VAL A CB  1 
ATOM   255  C  CG1 . VAL A 1 46  ? -21.481 20.250 -86.000  1.00 22.65 ? 91   VAL A CG1 1 
ATOM   256  C  CG2 . VAL A 1 46  ? -23.627 19.165 -85.473  1.00 23.19 ? 91   VAL A CG2 1 
ATOM   257  N  N   . VAL A 1 47  ? -19.456 17.809 -86.943  1.00 22.17 ? 92   VAL A N   1 
ATOM   258  C  CA  . VAL A 1 47  ? -18.010 17.665 -87.064  1.00 22.31 ? 92   VAL A CA  1 
ATOM   259  C  C   . VAL A 1 47  ? -17.408 18.947 -87.629  1.00 22.63 ? 92   VAL A C   1 
ATOM   260  O  O   . VAL A 1 47  ? -17.828 19.428 -88.681  1.00 22.66 ? 92   VAL A O   1 
ATOM   261  C  CB  . VAL A 1 47  ? -17.637 16.487 -87.976  1.00 22.20 ? 92   VAL A CB  1 
ATOM   262  C  CG1 . VAL A 1 47  ? -16.135 16.392 -88.101  1.00 22.04 ? 92   VAL A CG1 1 
ATOM   263  C  CG2 . VAL A 1 47  ? -18.234 15.192 -87.433  1.00 22.12 ? 92   VAL A CG2 1 
ATOM   264  N  N   . ALA A 1 48  ? -16.429 19.504 -86.921  1.00 22.98 ? 93   ALA A N   1 
ATOM   265  C  CA  . ALA A 1 48  ? -15.757 20.722 -87.365  1.00 23.51 ? 93   ALA A CA  1 
ATOM   266  C  C   . ALA A 1 48  ? -14.545 20.378 -88.223  1.00 24.23 ? 93   ALA A C   1 
ATOM   267  O  O   . ALA A 1 48  ? -13.736 19.533 -87.841  1.00 24.02 ? 93   ALA A O   1 
ATOM   268  C  CB  . ALA A 1 48  ? -15.320 21.541 -86.163  1.00 23.43 ? 93   ALA A CB  1 
ATOM   269  N  N   . LEU A 1 49  ? -14.417 21.028 -89.377  1.00 25.14 ? 94   LEU A N   1 
ATOM   270  C  CA  . LEU A 1 49  ? -13.277 20.786 -90.266  1.00 26.12 ? 94   LEU A CA  1 
ATOM   271  C  C   . LEU A 1 49  ? -12.230 21.789 -89.918  1.00 27.05 ? 94   LEU A C   1 
ATOM   272  O  O   . LEU A 1 49  ? -11.023 21.599 -90.139  1.00 27.01 ? 94   LEU A O   1 
ATOM   273  C  CB  . LEU A 1 49  ? -13.661 20.991 -91.720  1.00 26.26 ? 94   LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 49  ? -14.674 19.979 -92.220  1.00 26.28 ? 94   LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 49  ? -14.737 19.998 -93.721  1.00 27.52 ? 94   LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 49  ? -14.297 18.592 -91.712  1.00 26.82 ? 94   LEU A CD2 1 
ATOM   277  N  N   . GLY A 1 50  ? -12.727 22.881 -89.369  1.00 28.01 ? 95   GLY A N   1 
ATOM   278  C  CA  . GLY A 1 50  ? -11.897 23.969 -88.966  1.00 29.18 ? 95   GLY A CA  1 
ATOM   279  C  C   . GLY A 1 50  ? -11.478 23.580 -87.585  1.00 29.86 ? 95   GLY A C   1 
ATOM   280  O  O   . GLY A 1 50  ? -11.873 22.541 -87.049  1.00 31.13 ? 95   GLY A O   1 
ATOM   281  N  N   . ASP A 1 51  ? -10.677 24.423 -86.993  1.00 30.17 ? 96   ASP A N   1 
ATOM   282  C  CA  . ASP A 1 51  ? -10.112 24.075 -85.730  1.00 30.22 ? 96   ASP A CA  1 
ATOM   283  C  C   . ASP A 1 51  ? -10.931 24.682 -84.604  1.00 29.40 ? 96   ASP A C   1 
ATOM   284  O  O   . ASP A 1 51  ? -10.796 25.860 -84.296  1.00 29.94 ? 96   ASP A O   1 
ATOM   285  C  CB  . ASP A 1 51  ? -8.673  24.550 -85.712  1.00 30.85 ? 96   ASP A CB  1 
ATOM   286  C  CG  . ASP A 1 51  ? -7.841  23.849 -84.669  1.00 32.19 ? 96   ASP A CG  1 
ATOM   287  O  OD1 . ASP A 1 51  ? -6.611  23.782 -84.851  1.00 35.40 ? 96   ASP A OD1 1 
ATOM   288  O  OD2 . ASP A 1 51  ? -8.321  23.338 -83.636  1.00 35.41 ? 96   ASP A OD2 1 
ATOM   289  N  N   . VAL A 1 52  ? -11.777 23.865 -83.987  1.00 28.27 ? 97   VAL A N   1 
ATOM   290  C  CA  . VAL A 1 52  ? -12.671 24.338 -82.939  1.00 27.43 ? 97   VAL A CA  1 
ATOM   291  C  C   . VAL A 1 52  ? -12.244 23.722 -81.600  1.00 26.29 ? 97   VAL A C   1 
ATOM   292  O  O   . VAL A 1 52  ? -12.018 22.518 -81.507  1.00 26.53 ? 97   VAL A O   1 
ATOM   293  C  CB  . VAL A 1 52  ? -14.139 24.055 -83.317  1.00 27.49 ? 97   VAL A CB  1 
ATOM   294  C  CG1 . VAL A 1 52  ? -15.049 24.137 -82.112  1.00 28.05 ? 97   VAL A CG1 1 
ATOM   295  C  CG2 . VAL A 1 52  ? -14.587 25.046 -84.398  1.00 27.81 ? 97   VAL A CG2 1 
ATOM   296  N  N   . PRO A 1 53  ? -12.103 24.551 -80.570  1.00 24.96 ? 98   PRO A N   1 
ATOM   297  C  CA  . PRO A 1 53  ? -11.666 24.071 -79.254  1.00 24.09 ? 98   PRO A CA  1 
ATOM   298  C  C   . PRO A 1 53  ? -12.584 23.087 -78.562  1.00 23.15 ? 98   PRO A C   1 
ATOM   299  O  O   . PRO A 1 53  ? -13.799 23.158 -78.709  1.00 22.42 ? 98   PRO A O   1 
ATOM   300  C  CB  . PRO A 1 53  ? -11.604 25.352 -78.408  1.00 24.29 ? 98   PRO A CB  1 
ATOM   301  C  CG  . PRO A 1 53  ? -11.593 26.476 -79.358  1.00 24.74 ? 98   PRO A CG  1 
ATOM   302  C  CD  . PRO A 1 53  ? -12.310 26.009 -80.584  1.00 25.01 ? 98   PRO A CD  1 
ATOM   303  N  N   . ASP A 1 54  ? -11.990 22.173 -77.800  1.00 22.45 ? 99   ASP A N   1 
ATOM   304  C  CA  . ASP A 1 54  ? -12.780 21.261 -76.995  1.00 22.21 ? 99   ASP A CA  1 
ATOM   305  C  C   . ASP A 1 54  ? -13.652 22.098 -76.071  1.00 22.06 ? 99   ASP A C   1 
ATOM   306  O  O   . ASP A 1 54  ? -13.240 23.166 -75.609  1.00 21.81 ? 99   ASP A O   1 
ATOM   307  C  CB  . ASP A 1 54  ? -11.900 20.363 -76.125  1.00 22.17 ? 99   ASP A CB  1 
ATOM   308  C  CG  . ASP A 1 54  ? -11.145 19.316 -76.917  1.00 22.30 ? 99   ASP A CG  1 
ATOM   309  O  OD1 . ASP A 1 54  ? -11.439 19.104 -78.111  1.00 21.46 ? 99   ASP A OD1 1 
ATOM   310  O  OD2 . ASP A 1 54  ? -10.224 18.650 -76.403  1.00 22.79 ? 99   ASP A OD2 1 
ATOM   311  N  N   . GLY A 1 55  ? -14.851 21.601 -75.799  1.00 21.94 ? 100  GLY A N   1 
ATOM   312  C  CA  . GLY A 1 55  ? -15.794 22.287 -74.935  1.00 21.96 ? 100  GLY A CA  1 
ATOM   313  C  C   . GLY A 1 55  ? -16.670 23.310 -75.640  1.00 21.84 ? 100  GLY A C   1 
ATOM   314  O  O   . GLY A 1 55  ? -17.602 23.844 -75.032  1.00 21.95 ? 100  GLY A O   1 
ATOM   315  N  N   . THR A 1 56  ? -16.379 23.594 -76.908  1.00 21.61 ? 101  THR A N   1 
ATOM   316  C  CA  . THR A 1 56  ? -17.203 24.515 -77.685  1.00 21.25 ? 101  THR A CA  1 
ATOM   317  C  C   . THR A 1 56  ? -18.618 23.947 -77.740  1.00 21.37 ? 101  THR A C   1 
ATOM   318  O  O   . THR A 1 56  ? -18.826 22.806 -78.168  1.00 21.13 ? 101  THR A O   1 
ATOM   319  C  CB  . THR A 1 56  ? -16.650 24.680 -79.103  1.00 21.35 ? 101  THR A CB  1 
ATOM   320  O  OG1 . THR A 1 56  ? -15.364 25.312 -79.059  1.00 21.05 ? 101  THR A OG1 1 
ATOM   321  C  CG2 . THR A 1 56  ? -17.522 25.626 -79.919  1.00 20.93 ? 101  THR A CG2 1 
ATOM   322  N  N   . LEU A 1 57  ? -19.592 24.741 -77.310  1.00 21.16 ? 102  LEU A N   1 
ATOM   323  C  CA  . LEU A 1 57  ? -20.982 24.297 -77.305  1.00 21.29 ? 102  LEU A CA  1 
ATOM   324  C  C   . LEU A 1 57  ? -21.579 24.327 -78.708  1.00 21.29 ? 102  LEU A C   1 
ATOM   325  O  O   . LEU A 1 57  ? -21.202 25.149 -79.542  1.00 21.23 ? 102  LEU A O   1 
ATOM   326  C  CB  . LEU A 1 57  ? -21.813 25.182 -76.377  1.00 21.28 ? 102  LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 57  ? -21.366 25.115 -74.918  1.00 22.07 ? 102  LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 57  ? -22.181 26.072 -74.064  1.00 22.25 ? 102  LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 57  ? -21.467 23.705 -74.363  1.00 22.61 ? 102  LEU A CD2 1 
ATOM   330  N  N   . VAL A 1 58  ? -22.519 23.424 -78.953  1.00 21.31 ? 103  VAL A N   1 
ATOM   331  C  CA  . VAL A 1 58  ? -23.196 23.321 -80.237  1.00 21.40 ? 103  VAL A CA  1 
ATOM   332  C  C   . VAL A 1 58  ? -24.663 23.071 -79.928  1.00 21.84 ? 103  VAL A C   1 
ATOM   333  O  O   . VAL A 1 58  ? -24.984 22.237 -79.089  1.00 22.17 ? 103  VAL A O   1 
ATOM   334  C  CB  . VAL A 1 58  ? -22.655 22.143 -81.099  1.00 21.57 ? 103  VAL A CB  1 
ATOM   335  C  CG1 . VAL A 1 58  ? -23.302 22.147 -82.475  1.00 21.14 ? 103  VAL A CG1 1 
ATOM   336  C  CG2 . VAL A 1 58  ? -21.132 22.209 -81.233  1.00 21.04 ? 103  VAL A CG2 1 
ATOM   337  N  N   . THR A 1 59  ? -25.558 23.795 -80.591  1.00 22.30 ? 104  THR A N   1 
ATOM   338  C  CA  . THR A 1 59  ? -26.985 23.554 -80.408  1.00 22.73 ? 104  THR A CA  1 
ATOM   339  C  C   . THR A 1 59  ? -27.623 23.313 -81.752  1.00 23.25 ? 104  THR A C   1 
ATOM   340  O  O   . THR A 1 59  ? -27.090 23.700 -82.790  1.00 23.65 ? 104  THR A O   1 
ATOM   341  C  CB  . THR A 1 59  ? -27.719 24.741 -79.755  1.00 23.08 ? 104  THR A CB  1 
ATOM   342  O  OG1 . THR A 1 59  ? -27.641 25.896 -80.602  1.00 24.27 ? 104  THR A OG1 1 
ATOM   343  C  CG2 . THR A 1 59  ? -27.084 25.138 -78.435  1.00 22.82 ? 104  THR A CG2 1 
ATOM   344  N  N   . VAL A 1 60  ? -28.769 22.654 -81.717  1.00 23.21 ? 105  VAL A N   1 
ATOM   345  C  CA  . VAL A 1 60  ? -29.608 22.537 -82.885  1.00 23.36 ? 105  VAL A CA  1 
ATOM   346  C  C   . VAL A 1 60  ? -30.969 23.158 -82.575  1.00 23.21 ? 105  VAL A C   1 
ATOM   347  O  O   . VAL A 1 60  ? -31.459 23.091 -81.439  1.00 23.41 ? 105  VAL A O   1 
ATOM   348  C  CB  A VAL A 1 60  ? -29.677 21.111 -83.428  0.50 23.36 ? 105  VAL A CB  1 
ATOM   349  C  CB  B VAL A 1 60  ? -29.843 21.023 -83.200  0.50 23.41 ? 105  VAL A CB  1 
ATOM   350  C  CG1 A VAL A 1 60  ? -28.288 20.697 -83.897  0.50 23.68 ? 105  VAL A CG1 1 
ATOM   351  C  CG1 B VAL A 1 60  ? -30.905 20.800 -84.296  0.50 23.82 ? 105  VAL A CG1 1 
ATOM   352  C  CG2 A VAL A 1 60  ? -30.204 20.162 -82.398  0.50 23.38 ? 105  VAL A CG2 1 
ATOM   353  C  CG2 B VAL A 1 60  ? -28.524 20.320 -83.518  0.50 23.75 ? 105  VAL A CG2 1 
ATOM   354  N  N   . MET A 1 61  ? -31.556 23.781 -83.590  1.00 23.29 ? 106  MET A N   1 
ATOM   355  C  CA  . MET A 1 61  ? -32.916 24.282 -83.527  1.00 23.77 ? 106  MET A CA  1 
ATOM   356  C  C   . MET A 1 61  ? -33.665 23.843 -84.776  1.00 23.39 ? 106  MET A C   1 
ATOM   357  O  O   . MET A 1 61  ? -33.097 23.775 -85.865  1.00 22.81 ? 106  MET A O   1 
ATOM   358  C  CB  . MET A 1 61  ? -32.924 25.799 -83.456  1.00 24.63 ? 106  MET A CB  1 
ATOM   359  C  CG  . MET A 1 61  ? -32.215 26.351 -82.262  1.00 27.44 ? 106  MET A CG  1 
ATOM   360  S  SD  . MET A 1 61  ? -32.050 28.157 -82.398  1.00 33.30 ? 106  MET A SD  1 
ATOM   361  C  CE  . MET A 1 61  ? -33.628 28.596 -83.187  1.00 32.25 ? 106  MET A CE  1 
ATOM   362  N  N   . ALA A 1 62  ? -34.945 23.547 -84.614  1.00 22.71 ? 107  ALA A N   1 
ATOM   363  C  CA  . ALA A 1 62  ? -35.768 23.120 -85.728  1.00 23.00 ? 107  ALA A CA  1 
ATOM   364  C  C   . ALA A 1 62  ? -36.894 24.098 -85.930  1.00 23.14 ? 107  ALA A C   1 
ATOM   365  O  O   . ALA A 1 62  ? -37.494 24.562 -84.957  1.00 22.88 ? 107  ALA A O   1 
ATOM   366  C  CB  . ALA A 1 62  ? -36.359 21.744 -85.436  1.00 22.98 ? 107  ALA A CB  1 
ATOM   367  N  N   . GLY A 1 63  ? -37.204 24.411 -87.181  1.00 23.45 ? 108  GLY A N   1 
ATOM   368  C  CA  . GLY A 1 63  ? -38.308 25.304 -87.444  1.00 24.14 ? 108  GLY A CA  1 
ATOM   369  C  C   . GLY A 1 63  ? -38.781 25.359 -88.877  1.00 24.71 ? 108  GLY A C   1 
ATOM   370  O  O   . GLY A 1 63  ? -38.191 24.764 -89.778  1.00 24.46 ? 108  GLY A O   1 
ATOM   371  N  N   . ASN A 1 64  ? -39.869 26.093 -89.071  1.00 25.60 ? 109  ASN A N   1 
ATOM   372  C  CA  . ASN A 1 64  ? -40.439 26.309 -90.392  1.00 26.61 ? 109  ASN A CA  1 
ATOM   373  C  C   . ASN A 1 64  ? -41.238 27.616 -90.355  1.00 27.58 ? 109  ASN A C   1 
ATOM   374  O  O   . ASN A 1 64  ? -41.159 28.352 -89.369  1.00 27.49 ? 109  ASN A O   1 
ATOM   375  C  CB  . ASN A 1 64  ? -41.237 25.096 -90.885  1.00 26.68 ? 109  ASN A CB  1 
ATOM   376  C  CG  . ASN A 1 64  ? -42.487 24.831 -90.081  1.00 26.83 ? 109  ASN A CG  1 
ATOM   377  O  OD1 . ASN A 1 64  ? -42.979 25.696 -89.358  1.00 28.04 ? 109  ASN A OD1 1 
ATOM   378  N  ND2 . ASN A 1 64  ? -43.014 23.618 -90.207  1.00 26.60 ? 109  ASN A ND2 1 
ATOM   379  N  N   . ASP A 1 65  ? -41.991 27.913 -91.410  1.00 28.82 ? 110  ASP A N   1 
ATOM   380  C  CA  . ASP A 1 65  ? -42.729 29.179 -91.492  1.00 29.94 ? 110  ASP A CA  1 
ATOM   381  C  C   . ASP A 1 65  ? -43.828 29.318 -90.435  1.00 30.40 ? 110  ASP A C   1 
ATOM   382  O  O   . ASP A 1 65  ? -44.109 30.418 -89.951  1.00 30.84 ? 110  ASP A O   1 
ATOM   383  C  CB  . ASP A 1 65  ? -43.370 29.329 -92.873  1.00 30.30 ? 110  ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 65  ? -42.356 29.335 -94.000  1.00 31.90 ? 110  ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 65  ? -41.157 29.582 -93.741  1.00 34.86 ? 110  ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 65  ? -42.675 29.103 -95.188  1.00 34.41 ? 110  ASP A OD2 1 
ATOM   387  N  N   . GLU A 1 66  ? -44.462 28.196 -90.117  1.00 30.81 ? 111  GLU A N   1 
ATOM   388  C  CA  . GLU A 1 66  ? -45.414 28.067 -89.013  1.00 31.21 ? 111  GLU A CA  1 
ATOM   389  C  C   . GLU A 1 66  ? -44.864 27.887 -87.578  1.00 31.15 ? 111  GLU A C   1 
ATOM   390  O  O   . GLU A 1 66  ? -45.643 27.937 -86.625  1.00 31.39 ? 111  GLU A O   1 
ATOM   391  C  CB  . GLU A 1 66  ? -46.263 26.830 -89.316  1.00 31.40 ? 111  GLU A CB  1 
ATOM   392  C  CG  . GLU A 1 66  ? -47.398 26.562 -88.347  1.00 32.72 ? 111  GLU A CG  1 
ATOM   393  C  CD  . GLU A 1 66  ? -48.147 25.282 -88.673  1.00 34.38 ? 111  GLU A CD  1 
ATOM   394  O  OE1 . GLU A 1 66  ? -47.745 24.580 -89.632  1.00 35.27 ? 111  GLU A OE1 1 
ATOM   395  O  OE2 . GLU A 1 66  ? -49.138 24.981 -87.969  1.00 35.77 ? 111  GLU A OE2 1 
ATOM   396  N  N   . ASN A 1 67  ? -43.561 27.673 -87.402  1.00 30.96 ? 112  ASN A N   1 
ATOM   397  C  CA  . ASN A 1 67  ? -43.016 27.376 -86.072  1.00 30.81 ? 112  ASN A CA  1 
ATOM   398  C  C   . ASN A 1 67  ? -41.533 27.722 -86.015  1.00 30.60 ? 112  ASN A C   1 
ATOM   399  O  O   . ASN A 1 67  ? -40.700 26.930 -86.436  1.00 30.63 ? 112  ASN A O   1 
ATOM   400  C  CB  . ASN A 1 67  ? -43.217 25.881 -85.803  1.00 31.02 ? 112  ASN A CB  1 
ATOM   401  C  CG  . ASN A 1 67  ? -43.069 25.511 -84.343  1.00 31.35 ? 112  ASN A CG  1 
ATOM   402  O  OD1 . ASN A 1 67  ? -42.510 26.262 -83.544  1.00 32.52 ? 112  ASN A OD1 1 
ATOM   403  N  ND2 . ASN A 1 67  ? -43.572 24.337 -83.988  1.00 32.21 ? 112  ASN A ND2 1 
ATOM   404  N  N   . TYR A 1 68  ? -41.199 28.905 -85.510  1.00 30.28 ? 113  TYR A N   1 
ATOM   405  C  CA  . TYR A 1 68  ? -39.799 29.336 -85.409  1.00 30.12 ? 113  TYR A CA  1 
ATOM   406  C  C   . TYR A 1 68  ? -38.797 28.444 -84.643  1.00 29.19 ? 113  TYR A C   1 
ATOM   407  O  O   . TYR A 1 68  ? -37.623 28.405 -85.007  1.00 29.24 ? 113  TYR A O   1 
ATOM   408  C  CB  . TYR A 1 68  ? -39.726 30.770 -84.885  1.00 30.50 ? 113  TYR A CB  1 
ATOM   409  C  CG  . TYR A 1 68  ? -38.338 31.355 -84.966  1.00 33.13 ? 113  TYR A CG  1 
ATOM   410  C  CD1 . TYR A 1 68  ? -37.908 32.026 -86.108  1.00 35.24 ? 113  TYR A CD1 1 
ATOM   411  C  CD2 . TYR A 1 68  ? -37.453 31.236 -83.904  1.00 35.39 ? 113  TYR A CD2 1 
ATOM   412  C  CE1 . TYR A 1 68  ? -36.634 32.561 -86.184  1.00 36.69 ? 113  TYR A CE1 1 
ATOM   413  C  CE2 . TYR A 1 68  ? -36.180 31.768 -83.972  1.00 36.78 ? 113  TYR A CE2 1 
ATOM   414  C  CZ  . TYR A 1 68  ? -35.776 32.428 -85.112  1.00 37.42 ? 113  TYR A CZ  1 
ATOM   415  O  OH  . TYR A 1 68  ? -34.506 32.958 -85.175  1.00 39.95 ? 113  TYR A OH  1 
ATOM   416  N  N   . SER A 1 69  ? -39.226 27.736 -83.604  1.00 28.07 ? 114  SER A N   1 
ATOM   417  C  CA  . SER A 1 69  ? -38.316 26.843 -82.878  1.00 27.30 ? 114  SER A CA  1 
ATOM   418  C  C   . SER A 1 69  ? -39.187 25.784 -82.231  1.00 26.54 ? 114  SER A C   1 
ATOM   419  O  O   . SER A 1 69  ? -39.760 25.999 -81.155  1.00 26.54 ? 114  SER A O   1 
ATOM   420  C  CB  . SER A 1 69  ? -37.468 27.592 -81.846  1.00 27.42 ? 114  SER A CB  1 
ATOM   421  O  OG  . SER A 1 69  ? -36.409 26.772 -81.366  1.00 27.67 ? 114  SER A OG  1 
ATOM   422  N  N   . ALA A 1 70  ? -39.288 24.646 -82.912  1.00 25.22 ? 115  ALA A N   1 
ATOM   423  C  CA  . ALA A 1 70  ? -40.112 23.534 -82.470  1.00 24.25 ? 115  ALA A CA  1 
ATOM   424  C  C   . ALA A 1 70  ? -39.423 22.858 -81.292  1.00 23.65 ? 115  ALA A C   1 
ATOM   425  O  O   . ALA A 1 70  ? -38.202 22.930 -81.139  1.00 23.45 ? 115  ALA A O   1 
ATOM   426  C  CB  . ALA A 1 70  ? -40.341 22.554 -83.611  1.00 24.52 ? 115  ALA A CB  1 
ATOM   427  N  N   . GLU A 1 71  ? -40.198 22.196 -80.446  1.00 22.63 ? 116  GLU A N   1 
ATOM   428  C  CA  . GLU A 1 71  ? -39.621 21.661 -79.231  1.00 22.26 ? 116  GLU A CA  1 
ATOM   429  C  C   . GLU A 1 71  ? -38.703 20.489 -79.499  1.00 22.00 ? 116  GLU A C   1 
ATOM   430  O  O   . GLU A 1 71  ? -39.054 19.570 -80.230  1.00 22.23 ? 116  GLU A O   1 
ATOM   431  C  CB  . GLU A 1 71  ? -40.717 21.197 -78.256  1.00 22.00 ? 116  GLU A CB  1 
ATOM   432  C  CG  . GLU A 1 71  ? -40.182 20.728 -76.905  1.00 22.51 ? 116  GLU A CG  1 
ATOM   433  C  CD  . GLU A 1 71  ? -41.282 20.331 -75.928  1.00 23.10 ? 116  GLU A CD  1 
ATOM   434  O  OE1 . GLU A 1 71  ? -42.469 20.364 -76.316  1.00 23.65 ? 116  GLU A OE1 1 
ATOM   435  O  OE2 . GLU A 1 71  ? -40.969 19.987 -74.764  1.00 23.03 ? 116  GLU A OE2 1 
ATOM   436  N  N   . LEU A 1 72  ? -37.527 20.528 -78.888  1.00 22.11 ? 117  LEU A N   1 
ATOM   437  C  CA  . LEU A 1 72  ? -36.588 19.428 -78.958  1.00 22.23 ? 117  LEU A CA  1 
ATOM   438  C  C   . LEU A 1 72  ? -36.166 19.016 -77.567  1.00 22.63 ? 117  LEU A C   1 
ATOM   439  O  O   . LEU A 1 72  ? -36.418 19.717 -76.584  1.00 22.84 ? 117  LEU A O   1 
ATOM   440  C  CB  . LEU A 1 72  ? -35.318 19.858 -79.686  1.00 22.36 ? 117  LEU A CB  1 
ATOM   441  C  CG  . LEU A 1 72  ? -35.475 20.427 -81.090  1.00 21.67 ? 117  LEU A CG  1 
ATOM   442  C  CD1 . LEU A 1 72  ? -34.122 20.970 -81.557  1.00 22.96 ? 117  LEU A CD1 1 
ATOM   443  C  CD2 . LEU A 1 72  ? -36.021 19.376 -82.032  1.00 22.43 ? 117  LEU A CD2 1 
ATOM   444  N  N   . ARG A 1 73  ? -35.510 17.870 -77.496  1.00 22.90 ? 118  ARG A N   1 
ATOM   445  C  CA  . ARG A 1 73  ? -34.893 17.432 -76.269  1.00 23.50 ? 118  ARG A CA  1 
ATOM   446  C  C   . ARG A 1 73  ? -33.415 17.145 -76.455  1.00 23.35 ? 118  ARG A C   1 
ATOM   447  O  O   . ARG A 1 73  ? -33.021 16.561 -77.461  1.00 22.99 ? 118  ARG A O   1 
ATOM   448  C  CB  . ARG A 1 73  ? -35.566 16.150 -75.813  1.00 24.03 ? 118  ARG A CB  1 
ATOM   449  C  CG  . ARG A 1 73  ? -35.720 16.067 -74.372  1.00 25.87 ? 118  ARG A CG  1 
ATOM   450  C  CD  . ARG A 1 73  ? -36.757 17.001 -73.788  1.00 26.67 ? 118  ARG A CD  1 
ATOM   451  N  NE  . ARG A 1 73  ? -36.616 16.864 -72.357  1.00 27.72 ? 118  ARG A NE  1 
ATOM   452  C  CZ  . ARG A 1 73  ? -36.951 17.761 -71.448  1.00 27.73 ? 118  ARG A CZ  1 
ATOM   453  N  NH1 . ARG A 1 73  ? -37.483 18.929 -71.784  1.00 28.14 ? 118  ARG A NH1 1 
ATOM   454  N  NH2 . ARG A 1 73  ? -36.747 17.467 -70.175  1.00 29.56 ? 118  ARG A NH2 1 
ATOM   455  N  N   . ASN A 1 74  ? -32.604 17.554 -75.479  1.00 23.21 ? 119  ASN A N   1 
ATOM   456  C  CA  . ASN A 1 74  ? -31.167 17.287 -75.502  1.00 23.21 ? 119  ASN A CA  1 
ATOM   457  C  C   . ASN A 1 74  ? -30.510 17.870 -76.748  1.00 23.28 ? 119  ASN A C   1 
ATOM   458  O  O   . ASN A 1 74  ? -29.771 17.187 -77.457  1.00 23.36 ? 119  ASN A O   1 
ATOM   459  C  CB  . ASN A 1 74  ? -30.895 15.784 -75.363  1.00 23.44 ? 119  ASN A CB  1 
ATOM   460  C  CG  . ASN A 1 74  ? -31.619 15.182 -74.173  1.00 23.53 ? 119  ASN A CG  1 
ATOM   461  O  OD1 . ASN A 1 74  ? -31.563 15.724 -73.064  1.00 23.95 ? 119  ASN A OD1 1 
ATOM   462  N  ND2 . ASN A 1 74  ? -32.309 14.065 -74.390  1.00 23.24 ? 119  ASN A ND2 1 
ATOM   463  N  N   . ALA A 1 75  ? -30.788 19.148 -76.996  1.00 22.92 ? 120  ALA A N   1 
ATOM   464  C  CA  . ALA A 1 75  ? -30.329 19.823 -78.204  1.00 22.98 ? 120  ALA A CA  1 
ATOM   465  C  C   . ALA A 1 75  ? -29.049 20.636 -78.041  1.00 22.92 ? 120  ALA A C   1 
ATOM   466  O  O   . ALA A 1 75  ? -28.792 21.528 -78.842  1.00 23.17 ? 120  ALA A O   1 
ATOM   467  C  CB  . ALA A 1 75  ? -31.441 20.688 -78.779  1.00 23.10 ? 120  ALA A CB  1 
ATOM   468  N  N   . THR A 1 76  ? -28.257 20.324 -77.018  1.00 22.59 ? 121  THR A N   1 
ATOM   469  C  CA  . THR A 1 76  ? -26.940 20.927 -76.839  1.00 22.65 ? 121  THR A CA  1 
ATOM   470  C  C   . THR A 1 76  ? -25.890 19.839 -76.655  1.00 22.57 ? 121  THR A C   1 
ATOM   471  O  O   . THR A 1 76  ? -26.117 18.873 -75.936  1.00 22.94 ? 121  THR A O   1 
ATOM   472  C  CB  . THR A 1 76  ? -26.903 21.825 -75.603  1.00 22.81 ? 121  THR A CB  1 
ATOM   473  O  OG1 . THR A 1 76  ? -27.937 22.815 -75.692  1.00 23.26 ? 121  THR A OG1 1 
ATOM   474  C  CG2 . THR A 1 76  ? -25.581 22.616 -75.553  1.00 22.79 ? 121  THR A CG2 1 
ATOM   475  N  N   . ALA A 1 77  ? -24.746 20.010 -77.309  1.00 22.44 ? 122  ALA A N   1 
ATOM   476  C  CA  . ALA A 1 77  ? -23.622 19.095 -77.179  1.00 22.46 ? 122  ALA A CA  1 
ATOM   477  C  C   . ALA A 1 77  ? -22.354 19.924 -77.077  1.00 22.50 ? 122  ALA A C   1 
ATOM   478  O  O   . ALA A 1 77  ? -22.399 21.148 -77.222  1.00 23.18 ? 122  ALA A O   1 
ATOM   479  C  CB  . ALA A 1 77  ? -23.558 18.162 -78.377  1.00 22.50 ? 122  ALA A CB  1 
ATOM   480  N  N   . ALA A 1 78  ? -21.226 19.271 -76.819  1.00 22.24 ? 123  ALA A N   1 
ATOM   481  C  CA  . ALA A 1 78  ? -19.952 19.972 -76.735  1.00 22.20 ? 123  ALA A CA  1 
ATOM   482  C  C   . ALA A 1 78  ? -18.925 19.289 -77.614  1.00 22.07 ? 123  ALA A C   1 
ATOM   483  O  O   . ALA A 1 78  ? -18.915 18.063 -77.731  1.00 22.29 ? 123  ALA A O   1 
ATOM   484  C  CB  . ALA A 1 78  ? -19.457 20.021 -75.298  1.00 22.40 ? 123  ALA A CB  1 
ATOM   485  N  N   . MET A 1 79  ? -18.063 20.086 -78.232  1.00 21.78 ? 124  MET A N   1 
ATOM   486  C  CA  . MET A 1 79  ? -16.991 19.554 -79.062  1.00 21.50 ? 124  MET A CA  1 
ATOM   487  C  C   . MET A 1 79  ? -15.924 18.847 -78.245  1.00 21.70 ? 124  MET A C   1 
ATOM   488  O  O   . MET A 1 79  ? -15.514 19.319 -77.189  1.00 21.30 ? 124  MET A O   1 
ATOM   489  C  CB  . MET A 1 79  ? -16.320 20.679 -79.844  1.00 21.40 ? 124  MET A CB  1 
ATOM   490  C  CG  . MET A 1 79  ? -17.152 21.217 -80.972  1.00 21.08 ? 124  MET A CG  1 
ATOM   491  S  SD  . MET A 1 79  ? -16.966 20.113 -82.387  1.00 20.42 ? 124  MET A SD  1 
ATOM   492  C  CE  . MET A 1 79  ? -18.158 20.822 -83.512  1.00 22.33 ? 124  MET A CE  1 
ATOM   493  N  N   . LYS A 1 80  ? -15.486 17.699 -78.741  1.00 21.97 ? 125  LYS A N   1 
ATOM   494  C  CA  . LYS A 1 80  ? -14.327 17.023 -78.186  1.00 22.60 ? 125  LYS A CA  1 
ATOM   495  C  C   . LYS A 1 80  ? -13.605 16.447 -79.408  1.00 22.71 ? 125  LYS A C   1 
ATOM   496  O  O   . LYS A 1 80  ? -14.179 15.639 -80.135  1.00 22.46 ? 125  LYS A O   1 
ATOM   497  C  CB  . LYS A 1 80  ? -14.748 15.971 -77.158  1.00 22.84 ? 125  LYS A CB  1 
ATOM   498  C  CG  . LYS A 1 80  ? -13.610 15.123 -76.597  1.00 24.20 ? 125  LYS A CG  1 
ATOM   499  C  CD  . LYS A 1 80  ? -12.612 15.944 -75.794  1.00 26.15 ? 125  LYS A CD  1 
ATOM   500  C  CE  . LYS A 1 80  ? -11.479 15.066 -75.272  1.00 27.05 ? 125  LYS A CE  1 
ATOM   501  N  NZ  . LYS A 1 80  ? -10.444 15.842 -74.534  1.00 28.24 ? 125  LYS A NZ  1 
ATOM   502  N  N   . ASN A 1 81  ? -12.363 16.879 -79.641  1.00 22.97 ? 126  ASN A N   1 
ATOM   503  C  CA  . ASN A 1 81  ? -11.587 16.432 -80.802  1.00 23.44 ? 126  ASN A CA  1 
ATOM   504  C  C   . ASN A 1 81  ? -12.356 16.656 -82.106  1.00 23.34 ? 126  ASN A C   1 
ATOM   505  O  O   . ASN A 1 81  ? -12.423 15.773 -82.962  1.00 23.21 ? 126  ASN A O   1 
ATOM   506  C  CB  . ASN A 1 81  ? -11.208 14.954 -80.664  1.00 23.70 ? 126  ASN A CB  1 
ATOM   507  C  CG  . ASN A 1 81  ? -10.258 14.699 -79.510  1.00 25.02 ? 126  ASN A CG  1 
ATOM   508  O  OD1 . ASN A 1 81  ? -9.543  15.596 -79.063  1.00 27.24 ? 126  ASN A OD1 1 
ATOM   509  N  ND2 . ASN A 1 81  ? -10.245 13.464 -79.023  1.00 27.61 ? 126  ASN A ND2 1 
ATOM   510  N  N   . GLN A 1 82  ? -12.939 17.848 -82.235  1.00 23.21 ? 127  GLN A N   1 
ATOM   511  C  CA  . GLN A 1 82  ? -13.666 18.277 -83.438  1.00 23.47 ? 127  GLN A CA  1 
ATOM   512  C  C   . GLN A 1 82  ? -14.999 17.609 -83.705  1.00 22.82 ? 127  GLN A C   1 
ATOM   513  O  O   . GLN A 1 82  ? -15.592 17.830 -84.760  1.00 22.69 ? 127  GLN A O   1 
ATOM   514  C  CB  . GLN A 1 82  ? -12.797 18.135 -84.678  1.00 23.83 ? 127  GLN A CB  1 
ATOM   515  C  CG  . GLN A 1 82  ? -11.386 18.535 -84.439  1.00 25.87 ? 127  GLN A CG  1 
ATOM   516  C  CD  . GLN A 1 82  ? -11.249 19.999 -84.100  1.00 28.20 ? 127  GLN A CD  1 
ATOM   517  O  OE1 . GLN A 1 82  ? -10.552 20.358 -83.150  1.00 30.52 ? 127  GLN A OE1 1 
ATOM   518  N  NE2 . GLN A 1 82  ? -11.909 20.851 -84.875  1.00 30.48 ? 127  GLN A NE2 1 
ATOM   519  N  N   . VAL A 1 83  ? -15.474 16.801 -82.767  1.00 22.36 ? 128  VAL A N   1 
ATOM   520  C  CA  . VAL A 1 83  ? -16.792 16.203 -82.894  1.00 22.08 ? 128  VAL A CA  1 
ATOM   521  C  C   . VAL A 1 83  ? -17.690 16.541 -81.714  1.00 21.98 ? 128  VAL A C   1 
ATOM   522  O  O   . VAL A 1 83  ? -17.296 16.389 -80.556  1.00 21.72 ? 128  VAL A O   1 
ATOM   523  C  CB  . VAL A 1 83  ? -16.697 14.689 -82.974  1.00 22.05 ? 128  VAL A CB  1 
ATOM   524  C  CG1 . VAL A 1 83  ? -18.057 14.101 -83.270  1.00 22.65 ? 128  VAL A CG1 1 
ATOM   525  C  CG2 . VAL A 1 83  ? -15.695 14.302 -84.031  1.00 22.46 ? 128  VAL A CG2 1 
ATOM   526  N  N   . ALA A 1 84  ? -18.899 17.004 -82.020  1.00 21.87 ? 129  ALA A N   1 
ATOM   527  C  CA  . ALA A 1 84  ? -19.915 17.231 -81.006  1.00 22.00 ? 129  ALA A CA  1 
ATOM   528  C  C   . ALA A 1 84  ? -20.985 16.147 -81.166  1.00 22.36 ? 129  ALA A C   1 
ATOM   529  O  O   . ALA A 1 84  ? -21.762 16.174 -82.129  1.00 22.43 ? 129  ALA A O   1 
ATOM   530  C  CB  . ALA A 1 84  ? -20.524 18.610 -81.167  1.00 21.98 ? 129  ALA A CB  1 
ATOM   531  N  N   . ARG A 1 85  ? -21.031 15.205 -80.226  1.00 22.60 ? 130  ARG A N   1 
ATOM   532  C  CA  . ARG A 1 85  ? -21.995 14.114 -80.277  1.00 23.22 ? 130  ARG A CA  1 
ATOM   533  C  C   . ARG A 1 85  ? -23.161 14.397 -79.341  1.00 23.16 ? 130  ARG A C   1 
ATOM   534  O  O   . ARG A 1 85  ? -22.977 14.577 -78.136  1.00 22.90 ? 130  ARG A O   1 
ATOM   535  C  CB  . ARG A 1 85  ? -21.332 12.791 -79.896  1.00 23.62 ? 130  ARG A CB  1 
ATOM   536  C  CG  . ARG A 1 85  ? -22.209 11.572 -80.127  1.00 25.76 ? 130  ARG A CG  1 
ATOM   537  C  CD  . ARG A 1 85  ? -21.552 10.263 -79.704  1.00 27.94 ? 130  ARG A CD  1 
ATOM   538  N  NE  . ARG A 1 85  ? -22.487 9.143  -79.754  1.00 30.77 ? 130  ARG A NE  1 
ATOM   539  C  CZ  . ARG A 1 85  ? -23.446 8.929  -78.860  1.00 32.13 ? 130  ARG A CZ  1 
ATOM   540  N  NH1 . ARG A 1 85  ? -23.605 9.758  -77.838  1.00 32.96 ? 130  ARG A NH1 1 
ATOM   541  N  NH2 . ARG A 1 85  ? -24.252 7.882  -78.986  1.00 32.86 ? 130  ARG A NH2 1 
ATOM   542  N  N   . PHE A 1 86  ? -24.359 14.441 -79.912  1.00 23.32 ? 131  PHE A N   1 
ATOM   543  C  CA  . PHE A 1 86  ? -25.576 14.640 -79.140  1.00 23.93 ? 131  PHE A CA  1 
ATOM   544  C  C   . PHE A 1 86  ? -25.986 13.290 -78.590  1.00 24.51 ? 131  PHE A C   1 
ATOM   545  O  O   . PHE A 1 86  ? -26.210 12.344 -79.343  1.00 24.37 ? 131  PHE A O   1 
ATOM   546  C  CB  . PHE A 1 86  ? -26.669 15.223 -80.023  1.00 23.67 ? 131  PHE A CB  1 
ATOM   547  C  CG  . PHE A 1 86  ? -26.405 16.643 -80.445  1.00 23.37 ? 131  PHE A CG  1 
ATOM   548  C  CD1 . PHE A 1 86  ? -25.443 16.931 -81.407  1.00 22.92 ? 131  PHE A CD1 1 
ATOM   549  C  CD2 . PHE A 1 86  ? -27.112 17.689 -79.879  1.00 23.45 ? 131  PHE A CD2 1 
ATOM   550  C  CE1 . PHE A 1 86  ? -25.199 18.227 -81.794  1.00 23.57 ? 131  PHE A CE1 1 
ATOM   551  C  CE2 . PHE A 1 86  ? -26.872 18.992 -80.263  1.00 24.24 ? 131  PHE A CE2 1 
ATOM   552  C  CZ  . PHE A 1 86  ? -25.913 19.265 -81.221  1.00 23.49 ? 131  PHE A CZ  1 
ATOM   553  N  N   . ASN A 1 87  ? -26.083 13.201 -77.272  1.00 25.67 ? 132  ASN A N   1 
ATOM   554  C  CA  . ASN A 1 87  ? -26.340 11.924 -76.625  1.00 26.42 ? 132  ASN A CA  1 
ATOM   555  C  C   . ASN A 1 87  ? -27.704 11.302 -76.994  1.00 26.22 ? 132  ASN A C   1 
ATOM   556  O  O   . ASN A 1 87  ? -27.804 10.102 -77.279  1.00 27.28 ? 132  ASN A O   1 
ATOM   557  C  CB  . ASN A 1 87  ? -26.169 12.094 -75.107  1.00 27.09 ? 132  ASN A CB  1 
ATOM   558  C  CG  . ASN A 1 87  ? -26.474 10.834 -74.342  1.00 29.01 ? 132  ASN A CG  1 
ATOM   559  O  OD1 . ASN A 1 87  ? -26.156 9.727  -74.786  1.00 32.88 ? 132  ASN A OD1 1 
ATOM   560  N  ND2 . ASN A 1 87  ? -27.094 10.990 -73.180  1.00 32.04 ? 132  ASN A ND2 1 
ATOM   561  N  N   . ASP A 1 88  ? -28.747 12.118 -76.999  1.00 25.50 ? 133  ASP A N   1 
ATOM   562  C  CA  . ASP A 1 88  ? -30.104 11.625 -77.208  1.00 24.41 ? 133  ASP A CA  1 
ATOM   563  C  C   . ASP A 1 88  ? -30.943 12.786 -77.707  1.00 23.67 ? 133  ASP A C   1 
ATOM   564  O  O   . ASP A 1 88  ? -31.956 13.140 -77.113  1.00 23.28 ? 133  ASP A O   1 
ATOM   565  C  CB  . ASP A 1 88  ? -30.653 11.114 -75.871  1.00 24.49 ? 133  ASP A CB  1 
ATOM   566  C  CG  . ASP A 1 88  ? -32.024 10.471 -75.988  1.00 24.74 ? 133  ASP A CG  1 
ATOM   567  O  OD1 . ASP A 1 88  ? -32.349 9.915  -77.052  1.00 24.23 ? 133  ASP A OD1 1 
ATOM   568  O  OD2 . ASP A 1 88  ? -32.846 10.473 -75.043  1.00 26.72 ? 133  ASP A OD2 1 
ATOM   569  N  N   . LEU A 1 89  ? -30.510 13.396 -78.800  1.00 23.01 ? 134  LEU A N   1 
ATOM   570  C  CA  . LEU A 1 89  ? -31.303 14.444 -79.405  1.00 22.64 ? 134  LEU A CA  1 
ATOM   571  C  C   . LEU A 1 89  ? -32.654 13.844 -79.808  1.00 22.53 ? 134  LEU A C   1 
ATOM   572  O  O   . LEU A 1 89  ? -32.692 12.800 -80.466  1.00 22.20 ? 134  LEU A O   1 
ATOM   573  C  CB  . LEU A 1 89  ? -30.601 14.977 -80.655  1.00 22.72 ? 134  LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 89  ? -31.421 15.932 -81.525  1.00 22.84 ? 134  LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 89  ? -31.676 17.231 -80.782  1.00 23.03 ? 134  LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 89  ? -30.722 16.180 -82.861  1.00 23.34 ? 134  LEU A CD2 1 
ATOM   577  N  N   . ARG A 1 90  ? -33.758 14.481 -79.425  1.00 22.09 ? 135  ARG A N   1 
ATOM   578  C  CA  . ARG A 1 90  ? -35.074 14.031 -79.878  1.00 21.77 ? 135  ARG A CA  1 
ATOM   579  C  C   . ARG A 1 90  ? -35.909 15.197 -80.409  1.00 21.63 ? 135  ARG A C   1 
ATOM   580  O  O   . ARG A 1 90  ? -35.785 16.330 -79.932  1.00 21.72 ? 135  ARG A O   1 
ATOM   581  C  CB  . ARG A 1 90  ? -35.835 13.295 -78.765  1.00 21.79 ? 135  ARG A CB  1 
ATOM   582  C  CG  . ARG A 1 90  ? -35.070 12.127 -78.152  1.00 21.58 ? 135  ARG A CG  1 
ATOM   583  C  CD  . ARG A 1 90  ? -35.956 11.101 -77.444  1.00 22.44 ? 135  ARG A CD  1 
ATOM   584  N  NE  . ARG A 1 90  ? -36.842 11.745 -76.480  1.00 22.23 ? 135  ARG A NE  1 
ATOM   585  C  CZ  . ARG A 1 90  ? -36.479 12.145 -75.263  1.00 22.47 ? 135  ARG A CZ  1 
ATOM   586  N  NH1 . ARG A 1 90  ? -35.233 11.971 -74.840  1.00 22.91 ? 135  ARG A NH1 1 
ATOM   587  N  NH2 . ARG A 1 90  ? -37.363 12.724 -74.458  1.00 22.88 ? 135  ARG A NH2 1 
ATOM   588  N  N   . PHE A 1 91  ? -36.752 14.890 -81.394  1.00 21.51 ? 136  PHE A N   1 
ATOM   589  C  CA  . PHE A 1 91  ? -37.663 15.844 -82.027  1.00 21.64 ? 136  PHE A CA  1 
ATOM   590  C  C   . PHE A 1 91  ? -39.031 15.658 -81.387  1.00 21.45 ? 136  PHE A C   1 
ATOM   591  O  O   . PHE A 1 91  ? -39.698 14.652 -81.618  1.00 21.74 ? 136  PHE A O   1 
ATOM   592  C  CB  . PHE A 1 91  ? -37.690 15.621 -83.548  1.00 21.58 ? 136  PHE A CB  1 
ATOM   593  C  CG  . PHE A 1 91  ? -36.386 15.977 -84.193  1.00 22.32 ? 136  PHE A CG  1 
ATOM   594  C  CD1 . PHE A 1 91  ? -35.362 15.052 -84.262  1.00 23.05 ? 136  PHE A CD1 1 
ATOM   595  C  CD2 . PHE A 1 91  ? -36.176 17.242 -84.699  1.00 24.04 ? 136  PHE A CD2 1 
ATOM   596  C  CE1 . PHE A 1 91  ? -34.149 15.380 -84.838  1.00 24.01 ? 136  PHE A CE1 1 
ATOM   597  C  CE2 . PHE A 1 91  ? -34.967 17.578 -85.279  1.00 23.86 ? 136  PHE A CE2 1 
ATOM   598  C  CZ  . PHE A 1 91  ? -33.952 16.643 -85.348  1.00 24.02 ? 136  PHE A CZ  1 
ATOM   599  N  N   . VAL A 1 92  ? -39.437 16.626 -80.573  1.00 21.30 ? 137  VAL A N   1 
ATOM   600  C  CA  . VAL A 1 92  ? -40.709 16.545 -79.858  1.00 21.40 ? 137  VAL A CA  1 
ATOM   601  C  C   . VAL A 1 92  ? -41.839 17.239 -80.634  1.00 21.27 ? 137  VAL A C   1 
ATOM   602  O  O   . VAL A 1 92  ? -42.877 16.633 -80.902  1.00 21.47 ? 137  VAL A O   1 
ATOM   603  C  CB  . VAL A 1 92  ? -40.590 17.120 -78.436  1.00 21.49 ? 137  VAL A CB  1 
ATOM   604  C  CG1 . VAL A 1 92  ? -41.899 16.973 -77.703  1.00 21.52 ? 137  VAL A CG1 1 
ATOM   605  C  CG2 . VAL A 1 92  ? -39.461 16.414 -77.673  1.00 21.39 ? 137  VAL A CG2 1 
ATOM   606  N  N   . GLY A 1 93  ? -41.644 18.505 -80.990  1.00 21.46 ? 138  GLY A N   1 
ATOM   607  C  CA  . GLY A 1 93  ? -42.628 19.229 -81.778  1.00 21.12 ? 138  GLY A CA  1 
ATOM   608  C  C   . GLY A 1 93  ? -42.879 18.561 -83.120  1.00 21.18 ? 138  GLY A C   1 
ATOM   609  O  O   . GLY A 1 93  ? -41.954 18.056 -83.759  1.00 21.20 ? 138  GLY A O   1 
ATOM   610  N  N   . ARG A 1 94  ? -44.134 18.569 -83.552  1.00 21.30 ? 139  ARG A N   1 
ATOM   611  C  CA  . ARG A 1 94  ? -44.530 17.889 -84.779  1.00 21.55 ? 139  ARG A CA  1 
ATOM   612  C  C   . ARG A 1 94  ? -44.658 18.908 -85.902  1.00 22.25 ? 139  ARG A C   1 
ATOM   613  O  O   . ARG A 1 94  ? -45.170 20.006 -85.693  1.00 21.56 ? 139  ARG A O   1 
ATOM   614  C  CB  . ARG A 1 94  ? -45.843 17.153 -84.563  1.00 21.50 ? 139  ARG A CB  1 
ATOM   615  C  CG  . ARG A 1 94  ? -45.692 16.022 -83.575  1.00 21.32 ? 139  ARG A CG  1 
ATOM   616  C  CD  . ARG A 1 94  ? -46.864 15.861 -82.652  1.00 20.58 ? 139  ARG A CD  1 
ATOM   617  N  NE  . ARG A 1 94  ? -48.080 15.457 -83.342  1.00 20.47 ? 139  ARG A NE  1 
ATOM   618  C  CZ  . ARG A 1 94  ? -49.220 15.190 -82.716  1.00 19.72 ? 139  ARG A CZ  1 
ATOM   619  N  NH1 . ARG A 1 94  ? -49.279 15.292 -81.396  1.00 18.98 ? 139  ARG A NH1 1 
ATOM   620  N  NH2 . ARG A 1 94  ? -50.300 14.824 -83.395  1.00 20.21 ? 139  ARG A NH2 1 
ATOM   621  N  N   . SER A 1 95  ? -44.186 18.549 -87.089  1.00 23.12 ? 140  SER A N   1 
ATOM   622  C  CA  . SER A 1 95  ? -44.275 19.461 -88.217  1.00 24.00 ? 140  SER A CA  1 
ATOM   623  C  C   . SER A 1 95  ? -45.623 19.130 -88.795  1.00 25.56 ? 140  SER A C   1 
ATOM   624  O  O   . SER A 1 95  ? -46.282 19.954 -89.419  1.00 26.12 ? 140  SER A O   1 
ATOM   625  C  CB  . SER A 1 95  ? -43.173 19.212 -89.251  1.00 23.87 ? 140  SER A CB  1 
ATOM   626  O  OG  . SER A 1 95  ? -43.135 17.856 -89.665  1.00 22.23 ? 140  SER A OG  1 
ATOM   627  N  N   . GLY A 1 96  ? -46.011 17.883 -88.560  1.00 27.18 ? 141  GLY A N   1 
ATOM   628  C  CA  . GLY A 1 96  ? -47.265 17.344 -89.012  1.00 28.39 ? 141  GLY A CA  1 
ATOM   629  C  C   . GLY A 1 96  ? -47.587 17.575 -90.478  1.00 29.47 ? 141  GLY A C   1 
ATOM   630  O  O   . GLY A 1 96  ? -46.845 17.148 -91.373  1.00 30.30 ? 141  GLY A O   1 
ATOM   631  N  N   . ARG A 1 97  ? -48.701 18.276 -90.684  1.00 30.28 ? 142  ARG A N   1 
ATOM   632  C  CA  . ARG A 1 97  ? -49.401 18.437 -91.972  1.00 30.57 ? 142  ARG A CA  1 
ATOM   633  C  C   . ARG A 1 97  ? -48.825 19.087 -93.228  1.00 30.68 ? 142  ARG A C   1 
ATOM   634  O  O   . ARG A 1 97  ? -48.931 20.307 -93.416  1.00 30.98 ? 142  ARG A O   1 
ATOM   635  C  CB  . ARG A 1 97  ? -50.726 19.154 -91.713  1.00 30.84 ? 142  ARG A CB  1 
ATOM   636  C  CG  . ARG A 1 97  ? -51.705 18.410 -90.841  1.00 31.56 ? 142  ARG A CG  1 
ATOM   637  C  CD  . ARG A 1 97  ? -53.090 19.024 -90.886  1.00 32.17 ? 142  ARG A CD  1 
ATOM   638  N  NE  . ARG A 1 97  ? -54.042 18.339 -90.022  1.00 33.01 ? 142  ARG A NE  1 
ATOM   639  C  CZ  . ARG A 1 97  ? -55.314 18.690 -89.890  1.00 33.43 ? 142  ARG A CZ  1 
ATOM   640  N  NH1 . ARG A 1 97  ? -55.799 19.726 -90.568  1.00 33.92 ? 142  ARG A NH1 1 
ATOM   641  N  NH2 . ARG A 1 97  ? -56.109 18.005 -89.079  1.00 33.96 ? 142  ARG A NH2 1 
ATOM   642  N  N   . GLY A 1 98  ? -48.260 18.266 -94.107  1.00 30.36 ? 143  GLY A N   1 
ATOM   643  C  CA  . GLY A 1 98  ? -47.674 18.742 -95.344  1.00 29.95 ? 143  GLY A CA  1 
ATOM   644  C  C   . GLY A 1 98  ? -46.468 19.632 -95.156  1.00 29.47 ? 143  GLY A C   1 
ATOM   645  O  O   . GLY A 1 98  ? -46.091 20.368 -96.066  1.00 29.83 ? 143  GLY A O   1 
ATOM   646  N  N   . LYS A 1 99  ? -45.855 19.567 -93.978  1.00 28.76 ? 144  LYS A N   1 
ATOM   647  C  CA  . LYS A 1 99  ? -44.719 20.418 -93.684  1.00 28.04 ? 144  LYS A CA  1 
ATOM   648  C  C   . LYS A 1 99  ? -43.572 19.662 -93.046  1.00 27.02 ? 144  LYS A C   1 
ATOM   649  O  O   . LYS A 1 99  ? -43.712 18.516 -92.609  1.00 27.16 ? 144  LYS A O   1 
ATOM   650  C  CB  . LYS A 1 99  ? -45.137 21.567 -92.768  1.00 28.29 ? 144  LYS A CB  1 
ATOM   651  C  CG  . LYS A 1 99  ? -46.198 22.468 -93.364  1.00 29.32 ? 144  LYS A CG  1 
ATOM   652  C  CD  . LYS A 1 99  ? -46.091 23.884 -92.820  1.00 30.48 ? 144  LYS A CD  1 
ATOM   653  C  CE  . LYS A 1 99  ? -46.964 24.843 -93.608  1.00 31.68 ? 144  LYS A CE  1 
ATOM   654  N  NZ  . LYS A 1 99  ? -46.877 26.245 -93.098  1.00 33.06 ? 144  LYS A NZ  1 
ATOM   655  N  N   . SER A 1 100 ? -42.431 20.333 -93.000  1.00 25.59 ? 145  SER A N   1 
ATOM   656  C  CA  . SER A 1 100 ? -41.228 19.752 -92.448  1.00 24.67 ? 145  SER A CA  1 
ATOM   657  C  C   . SER A 1 100 ? -40.429 20.843 -91.765  1.00 23.94 ? 145  SER A C   1 
ATOM   658  O  O   . SER A 1 100 ? -40.792 22.018 -91.829  1.00 24.14 ? 145  SER A O   1 
ATOM   659  C  CB  A SER A 1 100 ? -40.413 19.131 -93.582  0.70 24.67 ? 145  SER A CB  1 
ATOM   660  C  CB  B SER A 1 100 ? -40.408 19.039 -93.525  0.30 24.66 ? 145  SER A CB  1 
ATOM   661  O  OG  A SER A 1 100 ? -40.135 20.100 -94.582  0.70 24.46 ? 145  SER A OG  1 
ATOM   662  O  OG  B SER A 1 100 ? -41.101 17.901 -94.007  0.30 24.36 ? 145  SER A OG  1 
ATOM   663  N  N   . PHE A 1 101 ? -39.346 20.458 -91.106  1.00 22.76 ? 146  PHE A N   1 
ATOM   664  C  CA  . PHE A 1 101 ? -38.532 21.409 -90.382  1.00 22.33 ? 146  PHE A CA  1 
ATOM   665  C  C   . PHE A 1 101 ? -37.158 21.552 -90.995  1.00 22.02 ? 146  PHE A C   1 
ATOM   666  O  O   . PHE A 1 101 ? -36.605 20.580 -91.504  1.00 21.88 ? 146  PHE A O   1 
ATOM   667  C  CB  . PHE A 1 101 ? -38.274 20.898 -88.971  1.00 22.24 ? 146  PHE A CB  1 
ATOM   668  C  CG  . PHE A 1 101 ? -39.456 20.970 -88.040  1.00 22.50 ? 146  PHE A CG  1 
ATOM   669  C  CD1 . PHE A 1 101 ? -40.329 22.040 -88.057  1.00 22.85 ? 146  PHE A CD1 1 
ATOM   670  C  CD2 . PHE A 1 101 ? -39.672 19.950 -87.131  1.00 23.18 ? 146  PHE A CD2 1 
ATOM   671  C  CE1 . PHE A 1 101 ? -41.407 22.085 -87.182  1.00 23.57 ? 146  PHE A CE1 1 
ATOM   672  C  CE2 . PHE A 1 101 ? -40.742 19.990 -86.258  1.00 23.34 ? 146  PHE A CE2 1 
ATOM   673  C  CZ  . PHE A 1 101 ? -41.608 21.053 -86.283  1.00 22.91 ? 146  PHE A CZ  1 
ATOM   674  N  N   . THR A 1 102 ? -36.620 22.765 -90.926  1.00 21.53 ? 147  THR A N   1 
ATOM   675  C  CA  . THR A 1 102 ? -35.223 23.022 -91.246  1.00 21.65 ? 147  THR A CA  1 
ATOM   676  C  C   . THR A 1 102 ? -34.440 23.031 -89.925  1.00 21.80 ? 147  THR A C   1 
ATOM   677  O  O   . THR A 1 102 ? -34.890 23.630 -88.938  1.00 21.67 ? 147  THR A O   1 
ATOM   678  C  CB  . THR A 1 102 ? -35.093 24.365 -91.930  1.00 21.75 ? 147  THR A CB  1 
ATOM   679  O  OG1 . THR A 1 102 ? -35.689 24.292 -93.233  1.00 22.79 ? 147  THR A OG1 1 
ATOM   680  C  CG2 . THR A 1 102 ? -33.614 24.714 -92.165  1.00 21.76 ? 147  THR A CG2 1 
ATOM   681  N  N   . LEU A 1 103 ? -33.284 22.372 -89.898  1.00 21.78 ? 148  LEU A N   1 
ATOM   682  C  CA  . LEU A 1 103 ? -32.463 22.276 -88.687  1.00 22.00 ? 148  LEU A CA  1 
ATOM   683  C  C   . LEU A 1 103 ? -31.256 23.194 -88.789  1.00 22.21 ? 148  LEU A C   1 
ATOM   684  O  O   . LEU A 1 103 ? -30.437 23.051 -89.689  1.00 22.40 ? 148  LEU A O   1 
ATOM   685  C  CB  A LEU A 1 103 ? -32.054 20.821 -88.403  0.50 22.38 ? 148  LEU A CB  1 
ATOM   686  C  CB  B LEU A 1 103 ? -31.951 20.859 -88.533  0.50 22.20 ? 148  LEU A CB  1 
ATOM   687  C  CG  A LEU A 1 103 ? -31.521 20.458 -87.002  0.50 22.77 ? 148  LEU A CG  1 
ATOM   688  C  CG  B LEU A 1 103 ? -33.079 19.847 -88.580  0.50 21.99 ? 148  LEU A CG  1 
ATOM   689  C  CD1 A LEU A 1 103 ? -32.597 20.376 -85.910  0.50 23.38 ? 148  LEU A CD1 1 
ATOM   690  C  CD1 B LEU A 1 103 ? -32.561 18.471 -88.282  0.50 21.95 ? 148  LEU A CD1 1 
ATOM   691  C  CD2 A LEU A 1 103 ? -30.787 19.135 -87.061  0.50 23.65 ? 148  LEU A CD2 1 
ATOM   692  C  CD2 B LEU A 1 103 ? -34.127 20.272 -87.584  0.50 22.08 ? 148  LEU A CD2 1 
ATOM   693  N  N   . THR A 1 104 ? -31.163 24.142 -87.865  1.00 22.16 ? 149  THR A N   1 
ATOM   694  C  CA  . THR A 1 104 ? -30.052 25.073 -87.816  1.00 22.44 ? 149  THR A CA  1 
ATOM   695  C  C   . THR A 1 104 ? -29.094 24.662 -86.706  1.00 22.36 ? 149  THR A C   1 
ATOM   696  O  O   . THR A 1 104 ? -29.513 24.447 -85.570  1.00 23.00 ? 149  THR A O   1 
ATOM   697  C  CB  . THR A 1 104 ? -30.568 26.480 -87.519  1.00 22.65 ? 149  THR A CB  1 
ATOM   698  O  OG1 . THR A 1 104 ? -31.458 26.903 -88.563  1.00 24.12 ? 149  THR A OG1 1 
ATOM   699  C  CG2 . THR A 1 104 ? -29.421 27.494 -87.532  1.00 23.84 ? 149  THR A CG2 1 
ATOM   700  N  N   . ILE A 1 105 ? -27.817 24.565 -87.046  1.00 22.23 ? 150  ILE A N   1 
ATOM   701  C  CA  . ILE A 1 105 ? -26.773 24.190 -86.111  1.00 22.26 ? 150  ILE A CA  1 
ATOM   702  C  C   . ILE A 1 105 ? -26.028 25.466 -85.729  1.00 22.20 ? 150  ILE A C   1 
ATOM   703  O  O   . ILE A 1 105 ? -25.590 26.199 -86.605  1.00 22.29 ? 150  ILE A O   1 
ATOM   704  C  CB  . ILE A 1 105 ? -25.782 23.224 -86.784  1.00 22.51 ? 150  ILE A CB  1 
ATOM   705  C  CG1 . ILE A 1 105 ? -26.482 21.932 -87.195  1.00 23.45 ? 150  ILE A CG1 1 
ATOM   706  C  CG2 . ILE A 1 105 ? -24.594 22.926 -85.858  1.00 23.02 ? 150  ILE A CG2 1 
ATOM   707  C  CD1 . ILE A 1 105 ? -25.758 21.184 -88.303  1.00 24.23 ? 150  ILE A CD1 1 
ATOM   708  N  N   . THR A 1 106 ? -25.883 25.731 -84.438  1.00 21.92 ? 151  THR A N   1 
ATOM   709  C  CA  . THR A 1 106 ? -25.116 26.894 -84.008  1.00 21.88 ? 151  THR A CA  1 
ATOM   710  C  C   . THR A 1 106 ? -23.921 26.412 -83.205  1.00 21.59 ? 151  THR A C   1 
ATOM   711  O  O   . THR A 1 106 ? -24.074 25.661 -82.244  1.00 21.54 ? 151  THR A O   1 
ATOM   712  C  CB  . THR A 1 106 ? -25.939 27.867 -83.175  1.00 22.25 ? 151  THR A CB  1 
ATOM   713  O  OG1 . THR A 1 106 ? -27.096 28.292 -83.909  1.00 22.22 ? 151  THR A OG1 1 
ATOM   714  C  CG2 . THR A 1 106 ? -25.136 29.140 -82.940  1.00 22.91 ? 151  THR A CG2 1 
ATOM   715  N  N   . VAL A 1 107 ? -22.737 26.851 -83.610  1.00 20.79 ? 152  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 107 ? -21.504 26.462 -82.949  1.00 20.79 ? 152  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 107 ? -20.975 27.688 -82.205  1.00 20.34 ? 152  VAL A C   1 
ATOM   718  O  O   . VAL A 1 107 ? -20.655 28.703 -82.831  1.00 20.04 ? 152  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 107 ? -20.495 25.976 -83.974  1.00 21.02 ? 152  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 107 ? -19.174 25.619 -83.303  1.00 21.60 ? 152  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 107 ? -21.075 24.787 -84.741  1.00 22.34 ? 152  VAL A CG2 1 
ATOM   722  N  N   . PHE A 1 108 ? -20.877 27.584 -80.880  1.00 19.72 ? 153  PHE A N   1 
ATOM   723  C  CA  . PHE A 1 108 ? -20.541 28.724 -80.027  1.00 19.86 ? 153  PHE A CA  1 
ATOM   724  C  C   . PHE A 1 108 ? -19.047 28.995 -79.868  1.00 19.62 ? 153  PHE A C   1 
ATOM   725  O  O   . PHE A 1 108 ? -18.510 29.035 -78.765  1.00 20.06 ? 153  PHE A O   1 
ATOM   726  C  CB  . PHE A 1 108 ? -21.314 28.639 -78.697  1.00 19.89 ? 153  PHE A CB  1 
ATOM   727  C  CG  . PHE A 1 108 ? -22.777 28.837 -78.919  1.00 19.93 ? 153  PHE A CG  1 
ATOM   728  C  CD1 . PHE A 1 108 ? -23.591 27.765 -79.203  1.00 20.86 ? 153  PHE A CD1 1 
ATOM   729  C  CD2 . PHE A 1 108 ? -23.323 30.105 -78.887  1.00 20.29 ? 153  PHE A CD2 1 
ATOM   730  C  CE1 . PHE A 1 108 ? -24.937 27.941 -79.431  1.00 20.92 ? 153  PHE A CE1 1 
ATOM   731  C  CE2 . PHE A 1 108 ? -24.670 30.294 -79.116  1.00 20.59 ? 153  PHE A CE2 1 
ATOM   732  C  CZ  . PHE A 1 108 ? -25.480 29.205 -79.388  1.00 21.07 ? 153  PHE A CZ  1 
ATOM   733  N  N   . THR A 1 109 ? -18.394 29.179 -81.012  1.00 19.80 ? 154  THR A N   1 
ATOM   734  C  CA  . THR A 1 109 ? -17.070 29.771 -81.039  1.00 19.77 ? 154  THR A CA  1 
ATOM   735  C  C   . THR A 1 109 ? -17.286 31.261 -80.767  1.00 19.82 ? 154  THR A C   1 
ATOM   736  O  O   . THR A 1 109 ? -18.428 31.720 -80.657  1.00 19.71 ? 154  THR A O   1 
ATOM   737  C  CB  . THR A 1 109 ? -16.414 29.606 -82.414  1.00 19.83 ? 154  THR A CB  1 
ATOM   738  O  OG1 . THR A 1 109 ? -17.365 29.898 -83.453  1.00 19.92 ? 154  THR A OG1 1 
ATOM   739  C  CG2 . THR A 1 109 ? -16.003 28.176 -82.646  1.00 19.84 ? 154  THR A CG2 1 
ATOM   740  N  N   . ASN A 1 110 ? -16.201 32.017 -80.659  1.00 19.51 ? 155  ASN A N   1 
ATOM   741  C  CA  . ASN A 1 110 ? -16.282 33.460 -80.479  1.00 19.74 ? 155  ASN A CA  1 
ATOM   742  C  C   . ASN A 1 110 ? -15.716 34.095 -81.748  1.00 20.20 ? 155  ASN A C   1 
ATOM   743  O  O   . ASN A 1 110 ? -14.490 34.117 -81.923  1.00 20.37 ? 155  ASN A O   1 
ATOM   744  C  CB  . ASN A 1 110 ? -15.480 33.908 -79.253  1.00 19.48 ? 155  ASN A CB  1 
ATOM   745  C  CG  . ASN A 1 110 ? -15.486 35.425 -79.065  1.00 18.92 ? 155  ASN A CG  1 
ATOM   746  O  OD1 . ASN A 1 110 ? -16.047 36.160 -79.877  1.00 18.09 ? 155  ASN A OD1 1 
ATOM   747  N  ND2 . ASN A 1 110 ? -14.858 35.895 -77.989  1.00 18.66 ? 155  ASN A ND2 1 
ATOM   748  N  N   . PRO A 1 111 ? -16.559 34.614 -82.645  1.00 20.34 ? 156  PRO A N   1 
ATOM   749  C  CA  . PRO A 1 111 ? -18.021 34.618 -82.541  1.00 20.49 ? 156  PRO A CA  1 
ATOM   750  C  C   . PRO A 1 111 ? -18.672 33.350 -83.050  1.00 20.28 ? 156  PRO A C   1 
ATOM   751  O  O   . PRO A 1 111 ? -18.016 32.538 -83.715  1.00 20.15 ? 156  PRO A O   1 
ATOM   752  C  CB  . PRO A 1 111 ? -18.409 35.780 -83.449  1.00 20.65 ? 156  PRO A CB  1 
ATOM   753  C  CG  . PRO A 1 111 ? -17.389 35.736 -84.530  1.00 21.08 ? 156  PRO A CG  1 
ATOM   754  C  CD  . PRO A 1 111 ? -16.105 35.287 -83.875  1.00 20.72 ? 156  PRO A CD  1 
ATOM   755  N  N   . PRO A 1 112 ? -19.948 33.158 -82.732  1.00 20.26 ? 157  PRO A N   1 
ATOM   756  C  CA  . PRO A 1 112 ? -20.643 31.960 -83.184  1.00 20.60 ? 157  PRO A CA  1 
ATOM   757  C  C   . PRO A 1 112 ? -20.746 31.814 -84.697  1.00 20.95 ? 157  PRO A C   1 
ATOM   758  O  O   . PRO A 1 112 ? -20.730 32.794 -85.448  1.00 21.01 ? 157  PRO A O   1 
ATOM   759  C  CB  . PRO A 1 112 ? -22.025 32.093 -82.539  1.00 20.52 ? 157  PRO A CB  1 
ATOM   760  C  CG  . PRO A 1 112 ? -21.793 32.982 -81.367  1.00 20.28 ? 157  PRO A CG  1 
ATOM   761  C  CD  . PRO A 1 112 ? -20.826 34.009 -81.906  1.00 20.23 ? 157  PRO A CD  1 
ATOM   762  N  N   . GLN A 1 113 ? -20.847 30.560 -85.114  1.00 21.70 ? 158  GLN A N   1 
ATOM   763  C  CA  . GLN A 1 113 ? -20.980 30.190 -86.514  1.00 22.20 ? 158  GLN A CA  1 
ATOM   764  C  C   . GLN A 1 113 ? -22.258 29.373 -86.666  1.00 22.43 ? 158  GLN A C   1 
ATOM   765  O  O   . GLN A 1 113 ? -22.656 28.672 -85.737  1.00 22.88 ? 158  GLN A O   1 
ATOM   766  C  CB  . GLN A 1 113 ? -19.787 29.338 -86.950  1.00 22.48 ? 158  GLN A CB  1 
ATOM   767  C  CG  . GLN A 1 113 ? -18.430 30.024 -86.853  1.00 23.24 ? 158  GLN A CG  1 
ATOM   768  C  CD  . GLN A 1 113 ? -17.287 29.054 -87.077  1.00 24.95 ? 158  GLN A CD  1 
ATOM   769  O  OE1 . GLN A 1 113 ? -17.042 28.626 -88.205  1.00 25.11 ? 158  GLN A OE1 1 
ATOM   770  N  NE2 . GLN A 1 113 ? -16.588 28.701 -86.005  1.00 26.49 ? 158  GLN A NE2 1 
ATOM   771  N  N   . VAL A 1 114 ? -22.892 29.461 -87.830  1.00 22.43 ? 159  VAL A N   1 
ATOM   772  C  CA  . VAL A 1 114 ? -24.134 28.736 -88.087  1.00 22.37 ? 159  VAL A CA  1 
ATOM   773  C  C   . VAL A 1 114 ? -23.949 27.848 -89.318  1.00 21.86 ? 159  VAL A C   1 
ATOM   774  O  O   . VAL A 1 114 ? -23.204 28.185 -90.242  1.00 21.36 ? 159  VAL A O   1 
ATOM   775  C  CB  . VAL A 1 114 ? -25.306 29.707 -88.273  1.00 22.87 ? 159  VAL A CB  1 
ATOM   776  C  CG1 . VAL A 1 114 ? -26.580 28.976 -88.634  1.00 24.15 ? 159  VAL A CG1 1 
ATOM   777  C  CG2 . VAL A 1 114 ? -25.519 30.493 -86.987  1.00 24.08 ? 159  VAL A CG2 1 
ATOM   778  N  N   . ALA A 1 115 ? -24.621 26.708 -89.317  1.00 21.38 ? 160  ALA A N   1 
ATOM   779  C  CA  . ALA A 1 115 ? -24.621 25.808 -90.460  1.00 21.63 ? 160  ALA A CA  1 
ATOM   780  C  C   . ALA A 1 115 ? -25.997 25.188 -90.506  1.00 21.79 ? 160  ALA A C   1 
ATOM   781  O  O   . ALA A 1 115 ? -26.595 24.926 -89.463  1.00 22.75 ? 160  ALA A O   1 
ATOM   782  C  CB  . ALA A 1 115 ? -23.579 24.727 -90.302  1.00 21.80 ? 160  ALA A CB  1 
ATOM   783  N  N   . THR A 1 116 ? -26.508 24.947 -91.701  1.00 21.88 ? 161  THR A N   1 
ATOM   784  C  CA  . THR A 1 116 ? -27.822 24.341 -91.813  1.00 21.45 ? 161  THR A CA  1 
ATOM   785  C  C   . THR A 1 116 ? -27.700 22.884 -92.236  1.00 21.05 ? 161  THR A C   1 
ATOM   786  O  O   . THR A 1 116 ? -26.970 22.558 -93.173  1.00 20.97 ? 161  THR A O   1 
ATOM   787  C  CB  . THR A 1 116 ? -28.677 25.101 -92.833  1.00 21.82 ? 161  THR A CB  1 
ATOM   788  O  OG1 . THR A 1 116 ? -28.802 26.475 -92.437  1.00 23.67 ? 161  THR A OG1 1 
ATOM   789  C  CG2 . THR A 1 116 ? -30.114 24.577 -92.858  1.00 22.37 ? 161  THR A CG2 1 
ATOM   790  N  N   . TYR A 1 117 ? -28.426 22.021 -91.538  1.00 20.40 ? 162  TYR A N   1 
ATOM   791  C  CA  . TYR A 1 117 ? -28.441 20.600 -91.860  1.00 20.61 ? 162  TYR A CA  1 
ATOM   792  C  C   . TYR A 1 117 ? -29.021 20.492 -93.291  1.00 20.14 ? 162  TYR A C   1 
ATOM   793  O  O   . TYR A 1 117 ? -29.929 21.234 -93.655  1.00 20.53 ? 162  TYR A O   1 
ATOM   794  C  CB  . TYR A 1 117 ? -29.262 19.793 -90.812  1.00 20.23 ? 162  TYR A CB  1 
ATOM   795  C  CG  . TYR A 1 117 ? -29.370 18.340 -91.213  1.00 19.66 ? 162  TYR A CG  1 
ATOM   796  C  CD1 . TYR A 1 117 ? -28.309 17.473 -91.028  1.00 19.96 ? 162  TYR A CD1 1 
ATOM   797  C  CD2 . TYR A 1 117 ? -30.529 17.841 -91.788  1.00 20.64 ? 162  TYR A CD2 1 
ATOM   798  C  CE1 . TYR A 1 117 ? -28.401 16.134 -91.413  1.00 20.61 ? 162  TYR A CE1 1 
ATOM   799  C  CE2 . TYR A 1 117 ? -30.627 16.508 -92.174  1.00 20.38 ? 162  TYR A CE2 1 
ATOM   800  C  CZ  . TYR A 1 117 ? -29.554 15.664 -91.980  1.00 19.97 ? 162  TYR A CZ  1 
ATOM   801  O  OH  . TYR A 1 117 ? -29.626 14.335 -92.356  1.00 20.74 ? 162  TYR A OH  1 
ATOM   802  N  N   . HIS A 1 118 ? -28.529 19.567 -94.107  1.00 20.62 ? 163  HIS A N   1 
ATOM   803  C  CA  . HIS A 1 118 ? -28.826 19.623 -95.544  1.00 20.68 ? 163  HIS A CA  1 
ATOM   804  C  C   . HIS A 1 118 ? -30.236 19.332 -96.024  1.00 20.50 ? 163  HIS A C   1 
ATOM   805  O  O   . HIS A 1 118 ? -30.601 19.693 -97.142  1.00 20.80 ? 163  HIS A O   1 
ATOM   806  C  CB  . HIS A 1 118 ? -27.891 18.684 -96.302  1.00 20.92 ? 163  HIS A CB  1 
ATOM   807  C  CG  . HIS A 1 118 ? -28.214 17.231 -96.144  1.00 21.29 ? 163  HIS A CG  1 
ATOM   808  N  ND1 . HIS A 1 118 ? -27.769 16.476 -95.078  1.00 21.39 ? 163  HIS A ND1 1 
ATOM   809  C  CD2 . HIS A 1 118 ? -28.924 16.385 -96.931  1.00 21.80 ? 163  HIS A CD2 1 
ATOM   810  C  CE1 . HIS A 1 118 ? -28.197 15.232 -95.214  1.00 22.89 ? 163  HIS A CE1 1 
ATOM   811  N  NE2 . HIS A 1 118 ? -28.907 15.153 -96.324  1.00 22.27 ? 163  HIS A NE2 1 
ATOM   812  N  N   . ARG A 1 119 ? -31.024 18.672 -95.194  1.00 20.75 ? 164  ARG A N   1 
ATOM   813  C  CA  . ARG A 1 119 ? -32.330 18.227 -95.613  1.00 20.81 ? 164  ARG A CA  1 
ATOM   814  C  C   . ARG A 1 119 ? -33.381 18.563 -94.571  1.00 21.03 ? 164  ARG A C   1 
ATOM   815  O  O   . ARG A 1 119 ? -33.081 18.643 -93.391  1.00 21.15 ? 164  ARG A O   1 
ATOM   816  C  CB  . ARG A 1 119 ? -32.264 16.710 -95.786  1.00 21.08 ? 164  ARG A CB  1 
ATOM   817  C  CG  . ARG A 1 119 ? -33.340 16.110 -96.630  1.00 21.56 ? 164  ARG A CG  1 
ATOM   818  C  CD  . ARG A 1 119 ? -33.073 14.667 -96.970  1.00 22.25 ? 164  ARG A CD  1 
ATOM   819  N  NE  . ARG A 1 119 ? -34.015 14.161 -97.954  1.00 22.81 ? 164  ARG A NE  1 
ATOM   820  C  CZ  . ARG A 1 119 ? -33.888 12.995 -98.572  1.00 23.30 ? 164  ARG A CZ  1 
ATOM   821  N  NH1 . ARG A 1 119 ? -32.853 12.212 -98.300  1.00 23.68 ? 164  ARG A NH1 1 
ATOM   822  N  NH2 . ARG A 1 119 ? -34.793 12.606 -99.461  1.00 22.85 ? 164  ARG A NH2 1 
ATOM   823  N  N   . ALA A 1 120 ? -34.617 18.751 -95.013  1.00 21.10 ? 165  ALA A N   1 
ATOM   824  C  CA  . ALA A 1 120 ? -35.694 19.023 -94.079  1.00 21.31 ? 165  ALA A CA  1 
ATOM   825  C  C   . ALA A 1 120 ? -36.041 17.703 -93.392  1.00 21.45 ? 165  ALA A C   1 
ATOM   826  O  O   . ALA A 1 120 ? -35.760 16.622 -93.926  1.00 21.19 ? 165  ALA A O   1 
ATOM   827  C  CB  . ALA A 1 120 ? -36.887 19.566 -94.798  1.00 21.34 ? 165  ALA A CB  1 
ATOM   828  N  N   . ILE A 1 121 ? -36.651 17.784 -92.215  1.00 21.70 ? 166  ILE A N   1 
ATOM   829  C  CA  . ILE A 1 121 ? -37.062 16.585 -91.490  1.00 22.00 ? 166  ILE A CA  1 
ATOM   830  C  C   . ILE A 1 121 ? -38.540 16.717 -91.131  1.00 21.85 ? 166  ILE A C   1 
ATOM   831  O  O   . ILE A 1 121 ? -38.975 17.764 -90.655  1.00 21.61 ? 166  ILE A O   1 
ATOM   832  C  CB  . ILE A 1 121 ? -36.171 16.288 -90.233  1.00 22.38 ? 166  ILE A CB  1 
ATOM   833  C  CG1 . ILE A 1 121 ? -36.610 14.970 -89.586  1.00 22.96 ? 166  ILE A CG1 1 
ATOM   834  C  CG2 . ILE A 1 121 ? -36.191 17.442 -89.224  1.00 22.91 ? 166  ILE A CG2 1 
ATOM   835  C  CD1 . ILE A 1 121 ? -35.655 14.403 -88.554  1.00 24.13 ? 166  ILE A CD1 1 
ATOM   836  N  N   . LYS A 1 122 ? -39.296 15.648 -91.368  1.00 21.28 ? 167  LYS A N   1 
ATOM   837  C  CA  . LYS A 1 122 ? -40.726 15.607 -91.073  1.00 21.35 ? 167  LYS A CA  1 
ATOM   838  C  C   . LYS A 1 122 ? -40.876 14.878 -89.740  1.00 20.84 ? 167  LYS A C   1 
ATOM   839  O  O   . LYS A 1 122 ? -40.272 13.828 -89.545  1.00 20.44 ? 167  LYS A O   1 
ATOM   840  C  CB  . LYS A 1 122 ? -41.482 14.856 -92.169  1.00 21.65 ? 167  LYS A CB  1 
ATOM   841  C  CG  . LYS A 1 122 ? -43.007 14.869 -91.986  1.00 22.80 ? 167  LYS A CG  1 
ATOM   842  C  CD  . LYS A 1 122 ? -43.780 14.381 -93.223  1.00 25.80 ? 167  LYS A CD  1 
ATOM   843  C  CE  . LYS A 1 122 ? -43.428 15.169 -94.484  1.00 27.65 ? 167  LYS A CE  1 
ATOM   844  N  NZ  . LYS A 1 122 ? -44.542 15.216 -95.482  1.00 29.86 ? 167  LYS A NZ  1 
ATOM   845  N  N   . ILE A 1 123 ? -41.673 15.427 -88.828  1.00 20.32 ? 168  ILE A N   1 
ATOM   846  C  CA  . ILE A 1 123 ? -41.865 14.818 -87.514  1.00 20.37 ? 168  ILE A CA  1 
ATOM   847  C  C   . ILE A 1 123 ? -43.357 14.667 -87.330  1.00 20.16 ? 168  ILE A C   1 
ATOM   848  O  O   . ILE A 1 123 ? -44.090 15.662 -87.358  1.00 20.19 ? 168  ILE A O   1 
ATOM   849  C  CB  . ILE A 1 123 ? -41.286 15.687 -86.378  1.00 20.26 ? 168  ILE A CB  1 
ATOM   850  C  CG1 . ILE A 1 123 ? -39.781 15.917 -86.559  1.00 20.49 ? 168  ILE A CG1 1 
ATOM   851  C  CG2 . ILE A 1 123 ? -41.543 15.025 -85.026  1.00 20.84 ? 168  ILE A CG2 1 
ATOM   852  C  CD1 . ILE A 1 123 ? -38.955 14.640 -86.550  1.00 20.63 ? 168  ILE A CD1 1 
ATOM   853  N  N   . THR A 1 124 ? -43.810 13.431 -87.141  1.00 20.21 ? 169  THR A N   1 
ATOM   854  C  CA  . THR A 1 124 ? -45.233 13.155 -86.968  1.00 20.12 ? 169  THR A CA  1 
ATOM   855  C  C   . THR A 1 124 ? -45.439 12.266 -85.752  1.00 20.14 ? 169  THR A C   1 
ATOM   856  O  O   . THR A 1 124 ? -44.503 11.652 -85.251  1.00 19.64 ? 169  THR A O   1 
ATOM   857  C  CB  . THR A 1 124 ? -45.853 12.456 -88.186  1.00 20.30 ? 169  THR A CB  1 
ATOM   858  O  OG1 . THR A 1 124 ? -45.187 11.210 -88.423  1.00 20.68 ? 169  THR A OG1 1 
ATOM   859  C  CG2 . THR A 1 124 ? -45.679 13.269 -89.470  1.00 20.31 ? 169  THR A CG2 1 
ATOM   860  N  N   . VAL A 1 125 ? -46.674 12.197 -85.289  1.00 20.18 ? 170  VAL A N   1 
ATOM   861  C  CA  . VAL A 1 125 ? -46.969 11.420 -84.090  1.00 20.70 ? 170  VAL A CA  1 
ATOM   862  C  C   . VAL A 1 125 ? -46.763 9.924  -84.319  1.00 21.30 ? 170  VAL A C   1 
ATOM   863  O  O   . VAL A 1 125 ? -46.337 9.216  -83.404  1.00 21.36 ? 170  VAL A O   1 
ATOM   864  C  CB  . VAL A 1 125 ? -48.368 11.720 -83.534  1.00 20.58 ? 170  VAL A CB  1 
ATOM   865  C  CG1 . VAL A 1 125 ? -49.449 11.242 -84.470  1.00 21.18 ? 170  VAL A CG1 1 
ATOM   866  C  CG2 . VAL A 1 125 ? -48.541 11.066 -82.175  1.00 20.63 ? 170  VAL A CG2 1 
ATOM   867  N  N   . ASP A 1 126 ? -47.058 9.432  -85.520  1.00 22.24 ? 171  ASP A N   1 
ATOM   868  C  CA  . ASP A 1 126 ? -46.803 8.022  -85.824  1.00 23.26 ? 171  ASP A CA  1 
ATOM   869  C  C   . ASP A 1 126 ? -45.441 7.728  -86.443  1.00 23.77 ? 171  ASP A C   1 
ATOM   870  O  O   . ASP A 1 126 ? -44.943 6.616  -86.320  1.00 24.24 ? 171  ASP A O   1 
ATOM   871  C  CB  . ASP A 1 126 ? -47.877 7.441  -86.746  1.00 23.77 ? 171  ASP A CB  1 
ATOM   872  C  CG  . ASP A 1 126 ? -49.072 6.907  -85.999  1.00 25.01 ? 171  ASP A CG  1 
ATOM   873  O  OD1 . ASP A 1 126 ? -48.984 6.616  -84.776  1.00 27.66 ? 171  ASP A OD1 1 
ATOM   874  O  OD2 . ASP A 1 126 ? -50.171 6.738  -86.567  1.00 27.57 ? 171  ASP A OD2 1 
ATOM   875  N  N   . GLY A 1 127 ? -44.829 8.700  -87.109  1.00 24.02 ? 172  GLY A N   1 
ATOM   876  C  CA  . GLY A 1 127 ? -43.557 8.444  -87.754  1.00 24.53 ? 172  GLY A CA  1 
ATOM   877  C  C   . GLY A 1 127 ? -43.758 7.658  -89.033  1.00 24.97 ? 172  GLY A C   1 
ATOM   878  O  O   . GLY A 1 127 ? -44.896 7.418  -89.451  1.00 24.65 ? 172  GLY A O   1 
ATOM   879  N  N   . PRO A 1 128 ? -42.663 7.245  -89.664  1.00 25.65 ? 173  PRO A N   1 
ATOM   880  C  CA  . PRO A 1 128 ? -42.765 6.458  -90.887  1.00 26.21 ? 173  PRO A CA  1 
ATOM   881  C  C   . PRO A 1 128 ? -43.240 5.054  -90.508  1.00 26.69 ? 173  PRO A C   1 
ATOM   882  O  O   . PRO A 1 128 ? -43.439 4.221  -91.384  1.00 28.12 ? 173  PRO A O   1 
ATOM   883  C  CB  . PRO A 1 128 ? -41.324 6.429  -91.395  1.00 26.21 ? 173  PRO A CB  1 
ATOM   884  C  CG  . PRO A 1 128 ? -40.530 6.479  -90.164  1.00 26.22 ? 173  PRO A CG  1 
ATOM   885  C  CD  . PRO A 1 128 ? -41.259 7.467  -89.280  1.00 25.75 ? 173  PRO A CD  1 
HETATM 886  CL CL  . CL  B 2 .   ? -48.597 14.617 -86.523  1.00 42.42 ? 1174 CL  A CL  1 
HETATM 887  CL CL  . CL  C 2 .   ? -43.313 22.617 -80.666  1.00 46.05 ? 1175 CL  A CL  1 
HETATM 888  O  O   . HOH D 3 .   ? -22.832 8.494  -87.572  1.00 41.36 ? 2001 HOH A O   1 
HETATM 889  O  O   . HOH D 3 .   ? -24.042 4.420  -89.079  1.00 58.80 ? 2002 HOH A O   1 
HETATM 890  O  O   . HOH D 3 .   ? -24.444 9.116  -90.286  1.00 32.67 ? 2003 HOH A O   1 
HETATM 891  O  O   . HOH D 3 .   ? -23.398 7.438  -99.414  1.00 45.67 ? 2004 HOH A O   1 
HETATM 892  O  O   . HOH D 3 .   ? -25.681 7.217  -92.041  1.00 44.81 ? 2005 HOH A O   1 
HETATM 893  O  O   . HOH D 3 .   ? -21.582 10.893 -97.569  1.00 30.12 ? 2006 HOH A O   1 
HETATM 894  O  O   . HOH D 3 .   ? -18.419 9.642  -94.447  1.00 33.79 ? 2007 HOH A O   1 
HETATM 895  O  O   . HOH D 3 .   ? -26.078 18.056 -93.303  1.00 24.55 ? 2008 HOH A O   1 
HETATM 896  O  O   . HOH D 3 .   ? -18.029 21.218 -97.395  1.00 39.76 ? 2009 HOH A O   1 
HETATM 897  O  O   . HOH D 3 .   ? -16.013 14.298 -99.831  1.00 50.04 ? 2010 HOH A O   1 
HETATM 898  O  O   . HOH D 3 .   ? -14.437 18.142 -102.184 1.00 51.48 ? 2011 HOH A O   1 
HETATM 899  O  O   . HOH D 3 .   ? -14.977 20.355 -100.842 1.00 59.41 ? 2012 HOH A O   1 
HETATM 900  O  O   . HOH D 3 .   ? -19.626 14.639 -99.589  1.00 47.05 ? 2013 HOH A O   1 
HETATM 901  O  O   . HOH D 3 .   ? -22.344 28.770 -95.532  1.00 47.64 ? 2014 HOH A O   1 
HETATM 902  O  O   . HOH D 3 .   ? -26.444 28.340 -92.803  1.00 53.01 ? 2015 HOH A O   1 
HETATM 903  O  O   . HOH D 3 .   ? -20.018 21.146 -95.545  1.00 30.85 ? 2016 HOH A O   1 
HETATM 904  O  O   . HOH D 3 .   ? -20.457 28.171 -90.647  1.00 43.78 ? 2017 HOH A O   1 
HETATM 905  O  O   . HOH D 3 .   ? -15.495 21.880 -96.869  1.00 41.04 ? 2018 HOH A O   1 
HETATM 906  O  O   . HOH D 3 .   ? -15.000 24.281 -88.178  1.00 34.44 ? 2019 HOH A O   1 
HETATM 907  O  O   . HOH D 3 .   ? -27.504 11.320 -87.066  1.00 28.12 ? 2020 HOH A O   1 
HETATM 908  O  O   . HOH D 3 .   ? -30.514 8.603  -89.260  1.00 33.00 ? 2021 HOH A O   1 
HETATM 909  O  O   . HOH D 3 .   ? -31.850 9.221  -93.710  1.00 38.48 ? 2022 HOH A O   1 
HETATM 910  O  O   . HOH D 3 .   ? -33.882 14.813 -92.786  1.00 28.98 ? 2023 HOH A O   1 
HETATM 911  O  O   . HOH D 3 .   ? -34.779 8.160  -93.451  1.00 43.47 ? 2024 HOH A O   1 
HETATM 912  O  O   . HOH D 3 .   ? -37.607 7.710  -92.090  1.00 40.97 ? 2025 HOH A O   1 
HETATM 913  O  O   . HOH D 3 .   ? -39.967 6.676  -86.291  1.00 35.02 ? 2026 HOH A O   1 
HETATM 914  O  O   . HOH D 3 .   ? -42.887 5.356  -79.994  1.00 49.96 ? 2027 HOH A O   1 
HETATM 915  O  O   . HOH D 3 .   ? -19.146 9.567  -97.339  1.00 38.17 ? 2028 HOH A O   1 
HETATM 916  O  O   . HOH D 3 .   ? -45.552 13.294 -79.319  1.00 34.45 ? 2029 HOH A O   1 
HETATM 917  O  O   . HOH D 3 .   ? -17.291 13.926 -96.894  1.00 43.21 ? 2030 HOH A O   1 
HETATM 918  O  O   . HOH D 3 .   ? -15.174 15.147 -96.536  1.00 58.09 ? 2031 HOH A O   1 
HETATM 919  O  O   . HOH D 3 .   ? -41.490 8.591  -77.062  1.00 45.73 ? 2032 HOH A O   1 
HETATM 920  O  O   . HOH D 3 .   ? -37.547 12.241 -82.206  1.00 28.16 ? 2033 HOH A O   1 
HETATM 921  O  O   . HOH D 3 .   ? -34.444 8.181  -75.394  1.00 40.43 ? 2034 HOH A O   1 
HETATM 922  O  O   . HOH D 3 .   ? -37.758 5.660  -78.258  1.00 42.79 ? 2035 HOH A O   1 
HETATM 923  O  O   . HOH D 3 .   ? -35.147 4.403  -82.005  1.00 44.83 ? 2036 HOH A O   1 
HETATM 924  O  O   . HOH D 3 .   ? -31.170 6.512  -90.758  1.00 52.66 ? 2037 HOH A O   1 
HETATM 925  O  O   . HOH D 3 .   ? -29.354 7.053  -81.196  1.00 40.03 ? 2038 HOH A O   1 
HETATM 926  O  O   . HOH D 3 .   ? -31.930 3.615  -81.353  1.00 56.92 ? 2039 HOH A O   1 
HETATM 927  O  O   . HOH D 3 .   ? -34.021 6.268  -90.861  1.00 54.55 ? 2040 HOH A O   1 
HETATM 928  O  O   . HOH D 3 .   ? -30.734 9.407  -86.614  1.00 31.84 ? 2041 HOH A O   1 
HETATM 929  O  O   . HOH D 3 .   ? -25.752 5.929  -82.796  1.00 46.08 ? 2042 HOH A O   1 
HETATM 930  O  O   . HOH D 3 .   ? -23.527 8.906  -84.962  1.00 42.18 ? 2043 HOH A O   1 
HETATM 931  O  O   . HOH D 3 .   ? -30.666 3.461  -89.602  1.00 50.47 ? 2044 HOH A O   1 
HETATM 932  O  O   . HOH D 3 .   ? -34.001 3.109  -89.161  1.00 57.68 ? 2045 HOH A O   1 
HETATM 933  O  O   . HOH D 3 .   ? -18.395 10.554 -81.338  1.00 58.55 ? 2046 HOH A O   1 
HETATM 934  O  O   . HOH D 3 .   ? -23.396 6.408  -82.268  1.00 51.31 ? 2047 HOH A O   1 
HETATM 935  O  O   . HOH D 3 .   ? -17.329 12.090 -79.761  1.00 56.78 ? 2048 HOH A O   1 
HETATM 936  O  O   . HOH D 3 .   ? -13.082 27.961 -85.506  1.00 52.12 ? 2049 HOH A O   1 
HETATM 937  O  O   . HOH D 3 .   ? -12.744 20.101 -80.452  1.00 32.48 ? 2050 HOH A O   1 
HETATM 938  O  O   . HOH D 3 .   ? -8.928  22.383 -77.455  1.00 51.65 ? 2051 HOH A O   1 
HETATM 939  O  O   . HOH D 3 .   ? -29.043 27.952 -79.811  1.00 36.32 ? 2052 HOH A O   1 
HETATM 940  O  O   . HOH D 3 .   ? -17.234 16.414 -74.003  1.00 57.43 ? 2053 HOH A O   1 
HETATM 941  O  O   . HOH D 3 .   ? -31.898 24.246 -78.941  1.00 41.57 ? 2054 HOH A O   1 
HETATM 942  O  O   . HOH D 3 .   ? -34.352 23.939 -79.483  1.00 48.05 ? 2055 HOH A O   1 
HETATM 943  O  O   . HOH D 3 .   ? -49.633 18.967 -82.936  1.00 62.89 ? 2056 HOH A O   1 
HETATM 944  O  O   . HOH D 3 .   ? -45.582 22.967 -88.885  1.00 48.99 ? 2057 HOH A O   1 
HETATM 945  O  O   . HOH D 3 .   ? -37.621 22.619 -96.817  1.00 45.01 ? 2058 HOH A O   1 
HETATM 946  O  O   . HOH D 3 .   ? -43.123 30.287 -83.415  1.00 51.63 ? 2059 HOH A O   1 
HETATM 947  O  O   . HOH D 3 .   ? -35.080 27.651 -85.950  1.00 52.56 ? 2060 HOH A O   1 
HETATM 948  O  O   . HOH D 3 .   ? -38.390 25.477 -78.389  1.00 59.34 ? 2061 HOH A O   1 
HETATM 949  O  O   . HOH D 3 .   ? -35.931 24.178 -81.905  1.00 27.60 ? 2062 HOH A O   1 
HETATM 950  O  O   . HOH D 3 .   ? -38.362 19.881 -74.258  1.00 47.74 ? 2063 HOH A O   1 
HETATM 951  O  O   . HOH D 3 .   ? -44.170 20.714 -78.498  1.00 44.52 ? 2064 HOH A O   1 
HETATM 952  O  O   . HOH D 3 .   ? -13.334 31.769 -84.667  1.00 56.20 ? 2065 HOH A O   1 
HETATM 953  O  O   . HOH D 3 .   ? -23.844 33.861 -87.938  1.00 53.35 ? 2066 HOH A O   1 
HETATM 954  O  O   . HOH D 3 .   ? -36.676 22.919 -77.518  1.00 35.82 ? 2067 HOH A O   1 
HETATM 955  O  O   . HOH D 3 .   ? -35.262 20.042 -68.817  1.00 60.57 ? 2068 HOH A O   1 
HETATM 956  O  O   . HOH D 3 .   ? -38.551 18.801 -67.920  1.00 62.68 ? 2069 HOH A O   1 
HETATM 957  O  O   . HOH D 3 .   ? -28.949 16.955 -72.423  1.00 46.23 ? 2070 HOH A O   1 
HETATM 958  O  O   . HOH D 3 .   ? -28.251 15.108 -76.898  1.00 40.89 ? 2071 HOH A O   1 
HETATM 959  O  O   . HOH D 3 .   ? -33.731 18.937 -73.224  1.00 35.67 ? 2072 HOH A O   1 
HETATM 960  O  O   . HOH D 3 .   ? -32.320 20.993 -75.302  1.00 39.78 ? 2073 HOH A O   1 
HETATM 961  O  O   . HOH D 3 .   ? -49.841 12.046 -88.362  1.00 57.52 ? 2074 HOH A O   1 
HETATM 962  O  O   . HOH D 3 .   ? -28.394 18.631 -74.296  1.00 35.82 ? 2075 HOH A O   1 
HETATM 963  O  O   . HOH D 3 .   ? -30.099 21.066 -73.701  1.00 60.25 ? 2076 HOH A O   1 
HETATM 964  O  O   . HOH D 3 .   ? -26.188 16.199 -76.017  1.00 44.85 ? 2077 HOH A O   1 
HETATM 965  O  O   . HOH D 3 .   ? -43.852 7.209  -94.808  1.00 59.50 ? 2078 HOH A O   1 
HETATM 966  O  O   . HOH D 3 .   ? -21.493 16.387 -76.354  1.00 39.59 ? 2079 HOH A O   1 
HETATM 967  O  O   . HOH D 3 .   ? -18.920 15.494 -76.080  1.00 55.90 ? 2080 HOH A O   1 
HETATM 968  O  O   . HOH D 3 .   ? -15.645 18.249 -74.465  1.00 50.05 ? 2081 HOH A O   1 
HETATM 969  O  O   . HOH D 3 .   ? -14.854 12.898 -80.026  1.00 47.97 ? 2082 HOH A O   1 
HETATM 970  O  O   . HOH D 3 .   ? -18.861 15.031 -78.356  1.00 42.59 ? 2083 HOH A O   1 
HETATM 971  O  O   . HOH D 3 .   ? -22.368 12.399 -76.407  1.00 52.46 ? 2084 HOH A O   1 
HETATM 972  O  O   . HOH D 3 .   ? -28.488 12.134 -80.773  1.00 29.24 ? 2085 HOH A O   1 
HETATM 973  O  O   . HOH D 3 .   ? -29.519 9.549  -80.266  1.00 31.58 ? 2086 HOH A O   1 
HETATM 974  O  O   . HOH D 3 .   ? -31.745 10.985 -72.491  1.00 51.53 ? 2087 HOH A O   1 
HETATM 975  O  O   . HOH D 3 .   ? -32.056 10.255 -79.851  1.00 32.07 ? 2088 HOH A O   1 
HETATM 976  O  O   . HOH D 3 .   ? -45.354 17.397 -79.792  1.00 35.73 ? 2089 HOH A O   1 
HETATM 977  O  O   . HOH D 3 .   ? -39.192 18.567 -83.337  1.00 30.83 ? 2090 HOH A O   1 
HETATM 978  O  O   . HOH D 3 .   ? -48.539 20.842 -86.224  1.00 60.15 ? 2091 HOH A O   1 
HETATM 979  O  O   . HOH D 3 .   ? -47.248 15.746 -79.691  1.00 35.27 ? 2092 HOH A O   1 
HETATM 980  O  O   . HOH D 3 .   ? -46.261 19.490 -81.705  1.00 39.84 ? 2093 HOH A O   1 
HETATM 981  O  O   . HOH D 3 .   ? -42.550 22.965 -94.644  1.00 49.43 ? 2094 HOH A O   1 
HETATM 982  O  O   . HOH D 3 .   ? -38.486 23.125 -94.167  1.00 49.32 ? 2095 HOH A O   1 
HETATM 983  O  O   . HOH D 3 .   ? -33.993 26.100 -87.986  1.00 32.62 ? 2096 HOH A O   1 
HETATM 984  O  O   . HOH D 3 .   ? -30.798 27.825 -91.016  1.00 39.43 ? 2097 HOH A O   1 
HETATM 985  O  O   . HOH D 3 .   ? -28.354 30.462 -84.243  1.00 42.63 ? 2098 HOH A O   1 
HETATM 986  O  O   . HOH D 3 .   ? -28.999 26.225 -83.329  1.00 30.45 ? 2099 HOH A O   1 
HETATM 987  O  O   . HOH D 3 .   ? -18.796 27.495 -76.562  1.00 28.91 ? 2100 HOH A O   1 
HETATM 988  O  O   . HOH D 3 .   ? -20.204 31.851 -78.417  0.50 39.19 ? 2101 HOH A O   1 
HETATM 989  O  O   . HOH D 3 .   ? -13.490 33.683 -76.068  1.00 25.20 ? 2102 HOH A O   1 
HETATM 990  O  O   . HOH D 3 .   ? -14.396 37.986 -81.314  1.00 38.52 ? 2103 HOH A O   1 
HETATM 991  O  O   . HOH D 3 .   ? -15.906 32.319 -85.681  1.00 51.75 ? 2104 HOH A O   1 
HETATM 992  O  O   . HOH D 3 .   ? -19.006 33.661 -87.525  1.00 47.47 ? 2105 HOH A O   1 
HETATM 993  O  O   . HOH D 3 .   ? -21.580 35.485 -85.140  1.00 40.40 ? 2106 HOH A O   1 
HETATM 994  O  O   . HOH D 3 .   ? -14.688 26.933 -88.310  1.00 39.71 ? 2107 HOH A O   1 
HETATM 995  O  O   . HOH D 3 .   ? -18.185 29.292 -90.392  1.00 42.06 ? 2108 HOH A O   1 
HETATM 996  O  O   . HOH D 3 .   ? -21.888 31.698 -89.548  1.00 35.24 ? 2109 HOH A O   1 
HETATM 997  O  O   . HOH D 3 .   ? -31.693 13.372 -93.683  1.00 27.16 ? 2110 HOH A O   1 
HETATM 998  O  O   . HOH D 3 .   ? -30.480 12.689 -96.521  1.00 42.45 ? 2111 HOH A O   1 
HETATM 999  O  O   . HOH D 3 .   ? -32.368 21.066 -92.323  1.00 27.02 ? 2112 HOH A O   1 
HETATM 1000 O  O   . HOH D 3 .   ? -31.843 9.795  -99.463  1.00 55.20 ? 2113 HOH A O   1 
HETATM 1001 O  O   . HOH D 3 .   ? -34.381 9.895  -100.528 1.00 53.14 ? 2114 HOH A O   1 
HETATM 1002 O  O   . HOH D 3 .   ? -48.384 10.144 -87.895  1.00 37.14 ? 2115 HOH A O   1 
HETATM 1003 O  O   . HOH D 3 .   ? -42.563 5.146  -86.762  1.00 50.81 ? 2116 HOH A O   1 
HETATM 1004 O  O   . HOH D 3 .   ? -49.411 4.338  -84.396  1.00 36.90 ? 2117 HOH A O   1 
HETATM 1005 O  O   . HOH D 3 .   ? -47.173 9.494  -90.299  1.00 49.83 ? 2118 HOH A O   1 
HETATM 1006 O  O   . HOH D 3 .   ? -44.863 5.744  -92.725  1.00 58.99 ? 2119 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   46  ?   ?   ?   A . n 
A 1 2   GLY 2   47  ?   ?   ?   A . n 
A 1 3   ASP 3   48  ?   ?   ?   A . n 
A 1 4   ARG 4   49  ?   ?   ?   A . n 
A 1 5   SER 5   50  ?   ?   ?   A . n 
A 1 6   MET 6   51  ?   ?   ?   A . n 
A 1 7   VAL 7   52  ?   ?   ?   A . n 
A 1 8   GLU 8   53  ?   ?   ?   A . n 
A 1 9   VAL 9   54  ?   ?   ?   A . n 
A 1 10  LEU 10  55  ?   ?   ?   A . n 
A 1 11  ALA 11  56  ?   ?   ?   A . n 
A 1 12  ASP 12  57  ?   ?   ?   A . n 
A 1 13  HIS 13  58  ?   ?   ?   A . n 
A 1 14  PRO 14  59  ?   ?   ?   A . n 
A 1 15  GLY 15  60  60  GLY GLY A . n 
A 1 16  GLU 16  61  61  GLU GLU A . n 
A 1 17  LEU 17  62  62  LEU LEU A . n 
A 1 18  VAL 18  63  63  VAL VAL A . n 
A 1 19  ARG 19  64  64  ARG ARG A . n 
A 1 20  THR 20  65  65  THR THR A . n 
A 1 21  ASP 21  66  66  ASP ASP A . n 
A 1 22  SER 22  67  67  SER SER A . n 
A 1 23  PRO 23  68  68  PRO PRO A . n 
A 1 24  ASN 24  69  69  ASN ASN A . n 
A 1 25  PHE 25  70  70  PHE PHE A . n 
A 1 26  LEU 26  71  71  LEU LEU A . n 
A 1 27  SER 27  72  72  SER SER A . n 
A 1 28  SER 28  73  73  SER SER A . n 
A 1 29  VAL 29  74  74  VAL VAL A . n 
A 1 30  LEU 30  75  75  LEU LEU A . n 
A 1 31  PRO 31  76  76  PRO PRO A . n 
A 1 32  THR 32  77  77  THR THR A . n 
A 1 33  HIS 33  78  78  HIS HIS A . n 
A 1 34  TRP 34  79  79  TRP TRP A . n 
A 1 35  ARG 35  80  80  ARG ARG A . n 
A 1 36  SER 36  81  81  SER SER A . n 
A 1 37  ASN 37  82  82  ASN ASN A . n 
A 1 38  LYS 38  83  83  LYS LYS A . n 
A 1 39  THR 39  84  84  THR THR A . n 
A 1 40  LEU 40  85  85  LEU LEU A . n 
A 1 41  PRO 41  86  86  PRO PRO A . n 
A 1 42  ILE 42  87  87  ILE ILE A . n 
A 1 43  ALA 43  88  88  ALA ALA A . n 
A 1 44  PHE 44  89  89  PHE PHE A . n 
A 1 45  LYS 45  90  90  LYS LYS A . n 
A 1 46  VAL 46  91  91  VAL VAL A . n 
A 1 47  VAL 47  92  92  VAL VAL A . n 
A 1 48  ALA 48  93  93  ALA ALA A . n 
A 1 49  LEU 49  94  94  LEU LEU A . n 
A 1 50  GLY 50  95  95  GLY GLY A . n 
A 1 51  ASP 51  96  96  ASP ASP A . n 
A 1 52  VAL 52  97  97  VAL VAL A . n 
A 1 53  PRO 53  98  98  PRO PRO A . n 
A 1 54  ASP 54  99  99  ASP ASP A . n 
A 1 55  GLY 55  100 100 GLY GLY A . n 
A 1 56  THR 56  101 101 THR THR A . n 
A 1 57  LEU 57  102 102 LEU LEU A . n 
A 1 58  VAL 58  103 103 VAL VAL A . n 
A 1 59  THR 59  104 104 THR THR A . n 
A 1 60  VAL 60  105 105 VAL VAL A . n 
A 1 61  MET 61  106 106 MET MET A . n 
A 1 62  ALA 62  107 107 ALA ALA A . n 
A 1 63  GLY 63  108 108 GLY GLY A . n 
A 1 64  ASN 64  109 109 ASN ASN A . n 
A 1 65  ASP 65  110 110 ASP ASP A . n 
A 1 66  GLU 66  111 111 GLU GLU A . n 
A 1 67  ASN 67  112 112 ASN ASN A . n 
A 1 68  TYR 68  113 113 TYR TYR A . n 
A 1 69  SER 69  114 114 SER SER A . n 
A 1 70  ALA 70  115 115 ALA ALA A . n 
A 1 71  GLU 71  116 116 GLU GLU A . n 
A 1 72  LEU 72  117 117 LEU LEU A . n 
A 1 73  ARG 73  118 118 ARG ARG A . n 
A 1 74  ASN 74  119 119 ASN ASN A . n 
A 1 75  ALA 75  120 120 ALA ALA A . n 
A 1 76  THR 76  121 121 THR THR A . n 
A 1 77  ALA 77  122 122 ALA ALA A . n 
A 1 78  ALA 78  123 123 ALA ALA A . n 
A 1 79  MET 79  124 124 MET MET A . n 
A 1 80  LYS 80  125 125 LYS LYS A . n 
A 1 81  ASN 81  126 126 ASN ASN A . n 
A 1 82  GLN 82  127 127 GLN GLN A . n 
A 1 83  VAL 83  128 128 VAL VAL A . n 
A 1 84  ALA 84  129 129 ALA ALA A . n 
A 1 85  ARG 85  130 130 ARG ARG A . n 
A 1 86  PHE 86  131 131 PHE PHE A . n 
A 1 87  ASN 87  132 132 ASN ASN A . n 
A 1 88  ASP 88  133 133 ASP ASP A . n 
A 1 89  LEU 89  134 134 LEU LEU A . n 
A 1 90  ARG 90  135 135 ARG ARG A . n 
A 1 91  PHE 91  136 136 PHE PHE A . n 
A 1 92  VAL 92  137 137 VAL VAL A . n 
A 1 93  GLY 93  138 138 GLY GLY A . n 
A 1 94  ARG 94  139 139 ARG ARG A . n 
A 1 95  SER 95  140 140 SER SER A . n 
A 1 96  GLY 96  141 141 GLY GLY A . n 
A 1 97  ARG 97  142 142 ARG ARG A . n 
A 1 98  GLY 98  143 143 GLY GLY A . n 
A 1 99  LYS 99  144 144 LYS LYS A . n 
A 1 100 SER 100 145 145 SER SER A . n 
A 1 101 PHE 101 146 146 PHE PHE A . n 
A 1 102 THR 102 147 147 THR THR A . n 
A 1 103 LEU 103 148 148 LEU LEU A . n 
A 1 104 THR 104 149 149 THR THR A . n 
A 1 105 ILE 105 150 150 ILE ILE A . n 
A 1 106 THR 106 151 151 THR THR A . n 
A 1 107 VAL 107 152 152 VAL VAL A . n 
A 1 108 PHE 108 153 153 PHE PHE A . n 
A 1 109 THR 109 154 154 THR THR A . n 
A 1 110 ASN 110 155 155 ASN ASN A . n 
A 1 111 PRO 111 156 156 PRO PRO A . n 
A 1 112 PRO 112 157 157 PRO PRO A . n 
A 1 113 GLN 113 158 158 GLN GLN A . n 
A 1 114 VAL 114 159 159 VAL VAL A . n 
A 1 115 ALA 115 160 160 ALA ALA A . n 
A 1 116 THR 116 161 161 THR THR A . n 
A 1 117 TYR 117 162 162 TYR TYR A . n 
A 1 118 HIS 118 163 163 HIS HIS A . n 
A 1 119 ARG 119 164 164 ARG ARG A . n 
A 1 120 ALA 120 165 165 ALA ALA A . n 
A 1 121 ILE 121 166 166 ILE ILE A . n 
A 1 122 LYS 122 167 167 LYS LYS A . n 
A 1 123 ILE 123 168 168 ILE ILE A . n 
A 1 124 THR 124 169 169 THR THR A . n 
A 1 125 VAL 125 170 170 VAL VAL A . n 
A 1 126 ASP 126 171 171 ASP ASP A . n 
A 1 127 GLY 127 172 172 GLY GLY A . n 
A 1 128 PRO 128 173 173 PRO PRO A . n 
A 1 129 ARG 129 174 ?   ?   ?   A . n 
A 1 130 GLU 130 175 ?   ?   ?   A . n 
A 1 131 PRO 131 176 ?   ?   ?   A . n 
A 1 132 ARG 132 177 ?   ?   ?   A . n 
A 1 133 ARG 133 178 ?   ?   ?   A . n 
A 1 134 HIS 134 179 ?   ?   ?   A . n 
A 1 135 ARG 135 180 ?   ?   ?   A . n 
A 1 136 GLN 136 181 ?   ?   ?   A . n 
A 1 137 LYS 137 182 ?   ?   ?   A . n 
A 1 138 LEU 138 183 ?   ?   ?   A . n 
A 1 139 ASP 139 184 ?   ?   ?   A . n 
A 1 140 ASP 140 185 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   1174 1174 CL  CL  A . 
C 2 CL  1   1175 1175 CL  CL  A . 
D 3 HOH 1   2001 2001 HOH HOH A . 
D 3 HOH 2   2002 2002 HOH HOH A . 
D 3 HOH 3   2003 2003 HOH HOH A . 
D 3 HOH 4   2004 2004 HOH HOH A . 
D 3 HOH 5   2005 2005 HOH HOH A . 
D 3 HOH 6   2006 2006 HOH HOH A . 
D 3 HOH 7   2007 2007 HOH HOH A . 
D 3 HOH 8   2008 2008 HOH HOH A . 
D 3 HOH 9   2009 2009 HOH HOH A . 
D 3 HOH 10  2010 2010 HOH HOH A . 
D 3 HOH 11  2011 2011 HOH HOH A . 
D 3 HOH 12  2012 2012 HOH HOH A . 
D 3 HOH 13  2013 2013 HOH HOH A . 
D 3 HOH 14  2014 2014 HOH HOH A . 
D 3 HOH 15  2015 2015 HOH HOH A . 
D 3 HOH 16  2016 2016 HOH HOH A . 
D 3 HOH 17  2017 2017 HOH HOH A . 
D 3 HOH 18  2018 2018 HOH HOH A . 
D 3 HOH 19  2019 2019 HOH HOH A . 
D 3 HOH 20  2020 2020 HOH HOH A . 
D 3 HOH 21  2021 2021 HOH HOH A . 
D 3 HOH 22  2022 2022 HOH HOH A . 
D 3 HOH 23  2023 2023 HOH HOH A . 
D 3 HOH 24  2024 2024 HOH HOH A . 
D 3 HOH 25  2025 2025 HOH HOH A . 
D 3 HOH 26  2026 2026 HOH HOH A . 
D 3 HOH 27  2027 2027 HOH HOH A . 
D 3 HOH 28  2028 2028 HOH HOH A . 
D 3 HOH 29  2029 2029 HOH HOH A . 
D 3 HOH 30  2030 2030 HOH HOH A . 
D 3 HOH 31  2031 2031 HOH HOH A . 
D 3 HOH 32  2032 2032 HOH HOH A . 
D 3 HOH 33  2033 2033 HOH HOH A . 
D 3 HOH 34  2034 2034 HOH HOH A . 
D 3 HOH 35  2035 2035 HOH HOH A . 
D 3 HOH 36  2036 2036 HOH HOH A . 
D 3 HOH 37  2037 2037 HOH HOH A . 
D 3 HOH 38  2038 2038 HOH HOH A . 
D 3 HOH 39  2039 2039 HOH HOH A . 
D 3 HOH 40  2040 2040 HOH HOH A . 
D 3 HOH 41  2041 2041 HOH HOH A . 
D 3 HOH 42  2042 2042 HOH HOH A . 
D 3 HOH 43  2043 2043 HOH HOH A . 
D 3 HOH 44  2044 2044 HOH HOH A . 
D 3 HOH 45  2045 2045 HOH HOH A . 
D 3 HOH 46  2046 2046 HOH HOH A . 
D 3 HOH 47  2047 2047 HOH HOH A . 
D 3 HOH 48  2048 2048 HOH HOH A . 
D 3 HOH 49  2049 2049 HOH HOH A . 
D 3 HOH 50  2050 2050 HOH HOH A . 
D 3 HOH 51  2051 2051 HOH HOH A . 
D 3 HOH 52  2052 2052 HOH HOH A . 
D 3 HOH 53  2053 2053 HOH HOH A . 
D 3 HOH 54  2054 2054 HOH HOH A . 
D 3 HOH 55  2055 2055 HOH HOH A . 
D 3 HOH 56  2056 2056 HOH HOH A . 
D 3 HOH 57  2057 2057 HOH HOH A . 
D 3 HOH 58  2058 2058 HOH HOH A . 
D 3 HOH 59  2059 2059 HOH HOH A . 
D 3 HOH 60  2060 2060 HOH HOH A . 
D 3 HOH 61  2061 2061 HOH HOH A . 
D 3 HOH 62  2062 2062 HOH HOH A . 
D 3 HOH 63  2063 2063 HOH HOH A . 
D 3 HOH 64  2064 2064 HOH HOH A . 
D 3 HOH 65  2065 2065 HOH HOH A . 
D 3 HOH 66  2066 2066 HOH HOH A . 
D 3 HOH 67  2067 2067 HOH HOH A . 
D 3 HOH 68  2068 2068 HOH HOH A . 
D 3 HOH 69  2069 2069 HOH HOH A . 
D 3 HOH 70  2070 2070 HOH HOH A . 
D 3 HOH 71  2071 2071 HOH HOH A . 
D 3 HOH 72  2072 2072 HOH HOH A . 
D 3 HOH 73  2073 2073 HOH HOH A . 
D 3 HOH 74  2074 2074 HOH HOH A . 
D 3 HOH 75  2075 2075 HOH HOH A . 
D 3 HOH 76  2076 2076 HOH HOH A . 
D 3 HOH 77  2077 2077 HOH HOH A . 
D 3 HOH 78  2078 2078 HOH HOH A . 
D 3 HOH 79  2079 2079 HOH HOH A . 
D 3 HOH 80  2080 2080 HOH HOH A . 
D 3 HOH 81  2081 2081 HOH HOH A . 
D 3 HOH 82  2082 2082 HOH HOH A . 
D 3 HOH 83  2083 2083 HOH HOH A . 
D 3 HOH 84  2084 2084 HOH HOH A . 
D 3 HOH 85  2085 2085 HOH HOH A . 
D 3 HOH 86  2086 2086 HOH HOH A . 
D 3 HOH 87  2087 2087 HOH HOH A . 
D 3 HOH 88  2088 2088 HOH HOH A . 
D 3 HOH 89  2089 2089 HOH HOH A . 
D 3 HOH 90  2090 2090 HOH HOH A . 
D 3 HOH 91  2091 2091 HOH HOH A . 
D 3 HOH 92  2092 2092 HOH HOH A . 
D 3 HOH 93  2093 2093 HOH HOH A . 
D 3 HOH 94  2094 2094 HOH HOH A . 
D 3 HOH 95  2095 2095 HOH HOH A . 
D 3 HOH 96  2096 2096 HOH HOH A . 
D 3 HOH 97  2097 2097 HOH HOH A . 
D 3 HOH 98  2098 2098 HOH HOH A . 
D 3 HOH 99  2099 2099 HOH HOH A . 
D 3 HOH 100 2100 2100 HOH HOH A . 
D 3 HOH 101 2101 2101 HOH HOH A . 
D 3 HOH 102 2102 2102 HOH HOH A . 
D 3 HOH 103 2103 2103 HOH HOH A . 
D 3 HOH 104 2104 2104 HOH HOH A . 
D 3 HOH 105 2105 2105 HOH HOH A . 
D 3 HOH 106 2106 2106 HOH HOH A . 
D 3 HOH 107 2107 2107 HOH HOH A . 
D 3 HOH 108 2108 2108 HOH HOH A . 
D 3 HOH 109 2109 2109 HOH HOH A . 
D 3 HOH 110 2110 2110 HOH HOH A . 
D 3 HOH 111 2111 2111 HOH HOH A . 
D 3 HOH 112 2112 2112 HOH HOH A . 
D 3 HOH 113 2113 2113 HOH HOH A . 
D 3 HOH 114 2114 2114 HOH HOH A . 
D 3 HOH 115 2115 2115 HOH HOH A . 
D 3 HOH 116 2116 2116 HOH HOH A . 
D 3 HOH 117 2117 2117 HOH HOH A . 
D 3 HOH 118 2118 2118 HOH HOH A . 
D 3 HOH 119 2119 2119 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-09-12 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-03-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Structure summary'         
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -29.6210 
_pdbx_refine_tls.origin_y         18.4820 
_pdbx_refine_tls.origin_z         -85.6960 
_pdbx_refine_tls.T[1][1]          0.0513 
_pdbx_refine_tls.T[2][2]          0.0186 
_pdbx_refine_tls.T[3][3]          0.0491 
_pdbx_refine_tls.T[1][2]          -0.0154 
_pdbx_refine_tls.T[1][3]          0.0478 
_pdbx_refine_tls.T[2][3]          -0.0133 
_pdbx_refine_tls.L[1][1]          2.3371 
_pdbx_refine_tls.L[2][2]          1.9631 
_pdbx_refine_tls.L[3][3]          2.1668 
_pdbx_refine_tls.L[1][2]          1.1573 
_pdbx_refine_tls.L[1][3]          -0.2880 
_pdbx_refine_tls.L[2][3]          0.3192 
_pdbx_refine_tls.S[1][1]          -0.0571 
_pdbx_refine_tls.S[1][2]          0.0172 
_pdbx_refine_tls.S[1][3]          -0.0083 
_pdbx_refine_tls.S[2][1]          0.0200 
_pdbx_refine_tls.S[2][2]          0.1317 
_pdbx_refine_tls.S[2][3]          -0.0617 
_pdbx_refine_tls.S[3][1]          0.0473 
_pdbx_refine_tls.S[3][2]          -0.0903 
_pdbx_refine_tls.S[3][3]          -0.0747 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     6 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     173 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.0.36 ? 1 
HKL-2000  'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
CNS       phasing          .      ? 4 
# 
_pdbx_entry_details.entry_id             1EAN 
_pdbx_entry_details.compound_details     
;CHAIN A ENGINEERED MUTATION CYS72SER, CYS81SER

 CBF BINDS TO THE CORE SITE, OF A NUMBER OF ENHANCERS AND PROMOTERS,
  INCLUDING MURINE LEUKEMIA VIRUS, POLYOMAVIRUS ENHANCER,
  T-CELL RECEPTOR ENHANCERS, LCK, IL-3 AND GM-CSF PROMOTERS.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 133 ? ? -157.51 56.16 
2 1 ARG A 142 ? ? -61.79  93.93 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2045 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.03 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 46  ? A SER 1   
2  1 Y 1 A GLY 47  ? A GLY 2   
3  1 Y 1 A ASP 48  ? A ASP 3   
4  1 Y 1 A ARG 49  ? A ARG 4   
5  1 Y 1 A SER 50  ? A SER 5   
6  1 Y 1 A MET 51  ? A MET 6   
7  1 Y 1 A VAL 52  ? A VAL 7   
8  1 Y 1 A GLU 53  ? A GLU 8   
9  1 Y 1 A VAL 54  ? A VAL 9   
10 1 Y 1 A LEU 55  ? A LEU 10  
11 1 Y 1 A ALA 56  ? A ALA 11  
12 1 Y 1 A ASP 57  ? A ASP 12  
13 1 Y 1 A HIS 58  ? A HIS 13  
14 1 Y 1 A PRO 59  ? A PRO 14  
15 1 Y 1 A ARG 174 ? A ARG 129 
16 1 Y 1 A GLU 175 ? A GLU 130 
17 1 Y 1 A PRO 176 ? A PRO 131 
18 1 Y 1 A ARG 177 ? A ARG 132 
19 1 Y 1 A ARG 178 ? A ARG 133 
20 1 Y 1 A HIS 179 ? A HIS 134 
21 1 Y 1 A ARG 180 ? A ARG 135 
22 1 Y 1 A GLN 181 ? A GLN 136 
23 1 Y 1 A LYS 182 ? A LYS 137 
24 1 Y 1 A LEU 183 ? A LEU 138 
25 1 Y 1 A ASP 184 ? A ASP 139 
26 1 Y 1 A ASP 185 ? A ASP 140 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#