data_1EEJ
# 
_entry.id   1EEJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EEJ         
RCSB  RCSB010496   
WWPDB D_1000010496 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2TRX 
;CRYSTAL STRUCTURE OF THIOREDOXIN  
FROM ESCHERICHIA COLI
;
unspecified 
PDB 1DSB 
;CRYSTAL STRUCTURE OF THE DSBA 
PROTEIN REQUIRED FOR DISULPHIDE  
BOND FORMATION IN VIVO
;
unspecified 
PDB 1A2J 
;CRYSTAL STRUCTURES OF REDUCED  
AND OXIDIZED DSBA: INVESTIGATION  
OF DOMAIN MOTION AND THIOLATE  
STABILIZATION
;
unspecified 
PDB 1A2M 
;CRYSTAL STRUCTURES OF REDUCED  
AND OXIDIZED DSBA: INVESTIGATION  
OF DOMAIN MOTION AND THIOLATE  
STABILIZATION
;
unspecified 
PDB 1A2L 
;CRYSTAL STRUCTURES OF REDUCED  
AND OXIDIZED DSBA: INVESTIGATION  
OF DOMAIN MOTION AND THIOLATE  
STABILIZATION
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EEJ 
_pdbx_database_status.recvd_initial_deposition_date   2000-01-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'McCarthy, A.A.' 1 
'Haebel, P.W.'   2 
'Torronen, A.'   3 
'Rybin, V.'      4 
'Baker, E.N.'    5 
'Metcalf, P.'    6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of the protein disulfide bond isomerase, DsbC, from Escherichia coli.' Nat.Struct.Biol.           7  
196  199 2000 NSBIEW US 1072-8368 2024 ? 10700276 10.1038/73295             
1       'CRYSTALLIZATION OF DSBC, THE DISULFIDE BOND ISOMERASE FROM ESCHERICHIA COLI'             'Acta Crystallogr.,Sect.D' 52 
1219 ?   1996 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444996008967 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'McCarthy, A.A.' 1  
primary 'Haebel, P.W.'   2  
primary 'Torronen, A.'   3  
primary 'Rybin, V.'      4  
primary 'Baker, E.N.'    5  
primary 'Metcalf, P.'    6  
1       'RYBIN, V.'      7  
1       'ZAPUN, A.'      8  
1       'TORRONEN, A.'   9  
1       'RAINA, S.'      10 
1       'MISSIAKAS, D.'  11 
1       'CREIGHTON, T.'  12 
1       'METCALF, P.'    13 
# 
_cell.entry_id           1EEJ 
_cell.length_a           59.336 
_cell.length_b           78.149 
_cell.length_c           94.489 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EEJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'THIOL:DISULFIDE INTERCHANGE PROTEIN'  23488.016 2   5.3.4.1 ? ? ? 
2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   1   ?       ? ? ? 
3 water       nat water                                  18.015    208 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROTEIN DISULFIDE-ISOMERASE, DSBC' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIV
YKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIV
YKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   ALA n 
1 4   ALA n 
1 5   ILE n 
1 6   GLN n 
1 7   GLN n 
1 8   THR n 
1 9   LEU n 
1 10  ALA n 
1 11  LYS n 
1 12  MET n 
1 13  GLY n 
1 14  ILE n 
1 15  LYS n 
1 16  SER n 
1 17  SER n 
1 18  ASP n 
1 19  ILE n 
1 20  GLN n 
1 21  PRO n 
1 22  ALA n 
1 23  PRO n 
1 24  VAL n 
1 25  ALA n 
1 26  GLY n 
1 27  MET n 
1 28  LYS n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  THR n 
1 33  ASN n 
1 34  SER n 
1 35  GLY n 
1 36  VAL n 
1 37  LEU n 
1 38  TYR n 
1 39  ILE n 
1 40  THR n 
1 41  ASP n 
1 42  ASP n 
1 43  GLY n 
1 44  LYS n 
1 45  HIS n 
1 46  ILE n 
1 47  ILE n 
1 48  GLN n 
1 49  GLY n 
1 50  PRO n 
1 51  MET n 
1 52  TYR n 
1 53  ASP n 
1 54  VAL n 
1 55  SER n 
1 56  GLY n 
1 57  THR n 
1 58  ALA n 
1 59  PRO n 
1 60  VAL n 
1 61  ASN n 
1 62  VAL n 
1 63  THR n 
1 64  ASN n 
1 65  LYS n 
1 66  MET n 
1 67  LEU n 
1 68  LEU n 
1 69  LYS n 
1 70  GLN n 
1 71  LEU n 
1 72  ASN n 
1 73  ALA n 
1 74  LEU n 
1 75  GLU n 
1 76  LYS n 
1 77  GLU n 
1 78  MET n 
1 79  ILE n 
1 80  VAL n 
1 81  TYR n 
1 82  LYS n 
1 83  ALA n 
1 84  PRO n 
1 85  GLN n 
1 86  GLU n 
1 87  LYS n 
1 88  HIS n 
1 89  VAL n 
1 90  ILE n 
1 91  THR n 
1 92  VAL n 
1 93  PHE n 
1 94  THR n 
1 95  ASP n 
1 96  ILE n 
1 97  THR n 
1 98  CYS n 
1 99  GLY n 
1 100 TYR n 
1 101 CYS n 
1 102 HIS n 
1 103 LYS n 
1 104 LEU n 
1 105 HIS n 
1 106 GLU n 
1 107 GLN n 
1 108 MET n 
1 109 ALA n 
1 110 ASP n 
1 111 TYR n 
1 112 ASN n 
1 113 ALA n 
1 114 LEU n 
1 115 GLY n 
1 116 ILE n 
1 117 THR n 
1 118 VAL n 
1 119 ARG n 
1 120 TYR n 
1 121 LEU n 
1 122 ALA n 
1 123 PHE n 
1 124 PRO n 
1 125 ARG n 
1 126 GLN n 
1 127 GLY n 
1 128 LEU n 
1 129 ASP n 
1 130 SER n 
1 131 ASP n 
1 132 ALA n 
1 133 GLU n 
1 134 LYS n 
1 135 GLU n 
1 136 MET n 
1 137 LYS n 
1 138 ALA n 
1 139 ILE n 
1 140 TRP n 
1 141 CYS n 
1 142 ALA n 
1 143 LYS n 
1 144 ASP n 
1 145 LYS n 
1 146 ASN n 
1 147 LYS n 
1 148 ALA n 
1 149 PHE n 
1 150 ASP n 
1 151 ASP n 
1 152 VAL n 
1 153 MET n 
1 154 ALA n 
1 155 GLY n 
1 156 LYS n 
1 157 SER n 
1 158 VAL n 
1 159 ALA n 
1 160 PRO n 
1 161 ALA n 
1 162 SER n 
1 163 CYS n 
1 164 ASP n 
1 165 VAL n 
1 166 ASP n 
1 167 ILE n 
1 168 ALA n 
1 169 ASP n 
1 170 HIS n 
1 171 TYR n 
1 172 ALA n 
1 173 LEU n 
1 174 GLY n 
1 175 VAL n 
1 176 GLN n 
1 177 LEU n 
1 178 GLY n 
1 179 VAL n 
1 180 SER n 
1 181 GLY n 
1 182 THR n 
1 183 PRO n 
1 184 ALA n 
1 185 VAL n 
1 186 VAL n 
1 187 LEU n 
1 188 SER n 
1 189 ASN n 
1 190 GLY n 
1 191 THR n 
1 192 LEU n 
1 193 VAL n 
1 194 PRO n 
1 195 GLY n 
1 196 TYR n 
1 197 GLN n 
1 198 PRO n 
1 199 PRO n 
1 200 LYS n 
1 201 GLU n 
1 202 MET n 
1 203 LYS n 
1 204 GLU n 
1 205 PHE n 
1 206 LEU n 
1 207 ASP n 
1 208 GLU n 
1 209 HIS n 
1 210 GLN n 
1 211 LYS n 
1 212 MET n 
1 213 THR n 
1 214 SER n 
1 215 GLY n 
1 216 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    PERIPLASM 
_entity_src_gen.host_org_common_name               eubacteria 
_entity_src_gen.pdbx_host_org_scientific_name      Bacteria 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     2 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DSBC_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P21892 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EEJ A 1 ? 216 ? P21892 21 ? 236 ? 1 216 
2 1 1EEJ B 1 ? 216 ? P21892 21 ? 236 ? 1 216 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE                             ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EEJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47.23 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG 550 (MME), MES , pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1EEJ 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   35436 
_reflns.number_all                   561577 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.6 
_reflns.B_iso_Wilson_estimate        22.9 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.322 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3468 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1EEJ 
_refine.ls_number_reflns_obs                     34017 
_refine.ls_number_reflns_all                     35330 
_refine.pdbx_ls_sigma_I                          3.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               865666.60 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             29.21 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    96.3 
_refine.ls_R_factor_obs                          0.214 
_refine.ls_R_factor_all                          0.214 
_refine.ls_R_factor_R_work                       0.214 
_refine.ls_R_factor_R_free                       0.247 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  3394 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               36.4 
_refine.aniso_B[1][1]                            -6.91 
_refine.aniso_B[2][2]                            6.84 
_refine.aniso_B[3][3]                            0.07 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.430 
_refine.solvent_model_param_bsol                 79.08 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1EEJ 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.15 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3280 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               3509 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        29.21 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.81  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             2.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.90  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             3.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            4.32  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             4806 
_refine_ls_shell.R_factor_R_work                  0.245 
_refine_ls_shell.percent_reflns_obs               92.0 
_refine_ls_shell.R_factor_R_free                  0.265 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            9.7 
_refine_ls_shell.number_reflns_R_free             515 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PAR PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM ?           'X-RAY DIFFRACTION' 
3 ION.PARAM       ?           'X-RAY DIFFRACTION' 
4 CIS_PEPTIDE.P   ?           'X-RAY DIFFRACTION' 
5 MES.PAR         ?           'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1EEJ 
_struct.title                     'CRYSTAL STRUCTURE OF THE PROTEIN DISULFIDE BOND ISOMERASE, DSBC, FROM ESCHERICHIA COLI' 
_struct.pdbx_descriptor           'DISULFIDE BOND ISOMERASE (E.C.5.3.4.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EEJ 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
'OXIDOREDUCTASE, PROTEIN DISULFIDE ISOMERASE, PROTEIN FOLDING, REDOX PROTEIN, REDOX-ACTIVE CENTER, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a dimer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 1   ? MET A 12  ? ASP A 1   MET A 12  1 ? 12 
HELX_P HELX_P2  2  VAL A 62  ? ALA A 73  ? VAL A 62  ALA A 73  1 ? 12 
HELX_P HELX_P3  3  LEU A 74  ? MET A 78  ? LEU A 74  MET A 78  5 ? 5  
HELX_P HELX_P4  4  CYS A 98  ? GLU A 106 ? CYS A 98  GLU A 106 1 ? 9  
HELX_P HELX_P5  5  GLN A 107 ? LEU A 114 ? GLN A 107 LEU A 114 1 ? 8  
HELX_P HELX_P6  6  SER A 130 ? CYS A 141 ? SER A 130 CYS A 141 1 ? 12 
HELX_P HELX_P7  7  ASP A 144 ? ALA A 154 ? ASP A 144 ALA A 154 1 ? 11 
HELX_P HELX_P8  8  ASP A 166 ? GLY A 178 ? ASP A 166 GLY A 178 1 ? 13 
HELX_P HELX_P9  9  PRO A 198 ? GLY A 215 ? PRO A 198 GLY A 215 1 ? 18 
HELX_P HELX_P10 10 ASP B 1   ? GLY B 13  ? ASP B 1   GLY B 13  1 ? 13 
HELX_P HELX_P11 11 VAL B 62  ? LEU B 74  ? VAL B 62  LEU B 74  1 ? 13 
HELX_P HELX_P12 12 GLU B 75  ? MET B 78  ? GLU B 75  MET B 78  5 ? 4  
HELX_P HELX_P13 13 CYS B 98  ? GLN B 107 ? CYS B 98  GLN B 107 1 ? 10 
HELX_P HELX_P14 14 GLN B 107 ? LEU B 114 ? GLN B 107 LEU B 114 1 ? 8  
HELX_P HELX_P15 15 SER B 130 ? CYS B 141 ? SER B 130 CYS B 141 1 ? 12 
HELX_P HELX_P16 16 ASP B 144 ? ALA B 154 ? ASP B 144 ALA B 154 1 ? 11 
HELX_P HELX_P17 17 ASP B 166 ? GLY B 178 ? ASP B 166 GLY B 178 1 ? 13 
HELX_P HELX_P18 18 PRO B 198 ? SER B 214 ? PRO B 198 SER B 214 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 98  SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 98  A CYS 101 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf2 disulf ? ? A CYS 141 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 141 A CYS 163 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? B CYS 98  SG ? ? ? 1_555 B CYS 101 SG ? ? B CYS 98  B CYS 101 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf4 disulf ? ? B CYS 141 SG ? ? ? 1_555 B CYS 163 SG ? ? B CYS 141 B CYS 163 1_555 ? ? ? ? ? ? ? 2.027 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 49  A . ? GLY 49  A PRO 50  A ? PRO 50  A 1 -0.07 
2 THR 182 A . ? THR 182 A PRO 183 A ? PRO 183 A 1 -0.29 
3 GLY 49  B . ? GLY 49  B PRO 50  B ? PRO 50  B 1 0.24  
4 THR 182 B . ? THR 182 B PRO 183 B ? PRO 183 B 1 -0.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
C ? 5 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 16  ? PRO A 21  ? SER A 16  PRO A 21  
A 2 MET A 27  ? THR A 32  ? MET A 27  THR A 32  
A 3 GLY A 35  ? THR A 40  ? GLY A 35  THR A 40  
A 4 HIS A 45  ? GLN A 48  ? HIS A 45  GLN A 48  
A 5 MET B 51  ? ASP B 53  ? MET B 51  ASP B 53  
A 6 VAL B 60  ? ASN B 61  ? VAL B 60  ASN B 61  
B 1 VAL A 60  ? ASN A 61  ? VAL A 60  ASN A 61  
B 2 MET A 51  ? ASP A 53  ? MET A 51  ASP A 53  
B 3 HIS B 45  ? ILE B 47  ? HIS B 45  ILE B 47  
B 4 GLY B 35  ? THR B 40  ? GLY B 35  THR B 40  
B 5 MET B 27  ? THR B 32  ? MET B 27  THR B 32  
B 6 SER B 16  ? PRO B 21  ? SER B 16  PRO B 21  
C 1 ILE A 79  ? TYR A 81  ? ILE A 79  TYR A 81  
C 2 ILE A 116 ? ALA A 122 ? ILE A 116 ALA A 122 
C 3 HIS A 88  ? THR A 94  ? HIS A 88  THR A 94  
C 4 ALA A 184 ? VAL A 186 ? ALA A 184 VAL A 186 
C 5 LEU A 192 ? PRO A 194 ? LEU A 192 PRO A 194 
D 1 ILE B 79  ? TYR B 81  ? ILE B 79  TYR B 81  
D 2 ILE B 116 ? ALA B 122 ? ILE B 116 ALA B 122 
D 3 HIS B 88  ? THR B 94  ? HIS B 88  THR B 94  
D 4 ALA B 184 ? VAL B 186 ? ALA B 184 VAL B 186 
D 5 LEU B 192 ? PRO B 194 ? LEU B 192 PRO B 194 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 20  ? N GLN A 20  O THR A 29  ? O THR A 29  
A 2 3 N THR A 32  ? N THR A 32  O GLY A 35  ? O GLY A 35  
A 3 4 N THR A 40  ? N THR A 40  O HIS A 45  ? O HIS A 45  
A 4 5 O ILE A 46  ? O ILE A 46  N TYR B 52  ? N TYR B 52  
A 5 6 N ASP B 53  ? N ASP B 53  O VAL B 60  ? O VAL B 60  
B 1 2 O VAL A 60  ? O VAL A 60  N ASP A 53  ? N ASP A 53  
B 2 3 N TYR A 52  ? N TYR A 52  O ILE B 46  ? O ILE B 46  
B 3 4 N ILE B 47  ? N ILE B 47  O TYR B 38  ? O TYR B 38  
B 4 5 O ILE B 39  ? O ILE B 39  N LYS B 28  ? N LYS B 28  
B 5 6 O LEU B 31  ? O LEU B 31  N SER B 17  ? N SER B 17  
C 1 2 N TYR A 81  ? N TYR A 81  O VAL A 118 ? O VAL A 118 
C 2 3 N THR A 117 ? N THR A 117 O HIS A 88  ? O HIS A 88  
C 3 4 N PHE A 93  ? N PHE A 93  O ALA A 184 ? O ALA A 184 
C 4 5 O VAL A 185 ? O VAL A 185 N VAL A 193 ? N VAL A 193 
D 1 2 N TYR B 81  ? N TYR B 81  O VAL B 118 ? O VAL B 118 
D 2 3 N THR B 117 ? N THR B 117 O HIS B 88  ? O HIS B 88  
D 3 4 N PHE B 93  ? N PHE B 93  O ALA B 184 ? O ALA B 184 
D 4 5 O VAL B 185 ? O VAL B 185 N VAL B 193 ? N VAL B 193 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'BINDING SITE FOR RESIDUE MES B 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 SER B 17  ? SER B 17   . ? 1_555 ? 
2 AC1 8 LYS B 82  ? LYS B 82   . ? 4_465 ? 
3 AC1 8 PRO B 84  ? PRO B 84   . ? 4_465 ? 
4 AC1 8 GLN B 85  ? GLN B 85   . ? 4_465 ? 
5 AC1 8 GLU B 86  ? GLU B 86   . ? 4_465 ? 
6 AC1 8 ASP B 166 ? ASP B 166  . ? 1_555 ? 
7 AC1 8 ASP B 169 ? ASP B 169  . ? 1_555 ? 
8 AC1 8 HOH E .   ? HOH B 1111 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1EEJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EEJ 
_atom_sites.fract_transf_matrix[1][1]   0.016853 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012796 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010583 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 7.301   25.012 -16.896 1.00 37.63 ? 1    ASP A N   1 
ATOM   2    C CA  . ASP A 1 1   ? 6.977   23.565 -16.969 1.00 37.48 ? 1    ASP A CA  1 
ATOM   3    C C   . ASP A 1 1   ? 8.040   22.767 -16.220 1.00 36.50 ? 1    ASP A C   1 
ATOM   4    O O   . ASP A 1 1   ? 9.009   23.334 -15.716 1.00 33.32 ? 1    ASP A O   1 
ATOM   5    C CB  . ASP A 1 1   ? 6.904   23.126 -18.434 1.00 37.88 ? 1    ASP A CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 8.249   23.192 -19.136 1.00 41.36 ? 1    ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 9.027   24.135 -18.879 1.00 37.70 ? 1    ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 8.519   22.300 -19.962 1.00 42.74 ? 1    ASP A OD2 1 
ATOM   9    N N   . ASP A 1 2   ? 7.854   21.455 -16.143 1.00 34.66 ? 2    ASP A N   1 
ATOM   10   C CA  . ASP A 1 2   ? 8.801   20.598 -15.439 1.00 36.42 ? 2    ASP A CA  1 
ATOM   11   C C   . ASP A 1 2   ? 10.237  20.770 -15.919 1.00 35.41 ? 2    ASP A C   1 
ATOM   12   O O   . ASP A 1 2   ? 11.158  20.866 -15.110 1.00 32.31 ? 2    ASP A O   1 
ATOM   13   C CB  . ASP A 1 2   ? 8.390   19.129 -15.574 1.00 38.93 ? 2    ASP A CB  1 
ATOM   14   C CG  . ASP A 1 2   ? 7.185   18.778 -14.719 1.00 44.37 ? 2    ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 2   ? 6.588   19.695 -14.113 1.00 43.84 ? 2    ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 2   ? 6.834   17.579 -14.654 1.00 44.65 ? 2    ASP A OD2 1 
ATOM   17   N N   . ALA A 1 3   ? 10.422  20.820 -17.235 1.00 33.79 ? 3    ALA A N   1 
ATOM   18   C CA  . ALA A 1 3   ? 11.752  20.958 -17.815 1.00 32.06 ? 3    ALA A CA  1 
ATOM   19   C C   . ALA A 1 3   ? 12.496  22.205 -17.348 1.00 28.73 ? 3    ALA A C   1 
ATOM   20   O O   . ALA A 1 3   ? 13.668  22.129 -16.993 1.00 29.64 ? 3    ALA A O   1 
ATOM   21   C CB  . ALA A 1 3   ? 11.661  20.945 -19.349 1.00 32.38 ? 3    ALA A CB  1 
ATOM   22   N N   . ALA A 1 4   ? 11.824  23.352 -17.360 1.00 28.36 ? 4    ALA A N   1 
ATOM   23   C CA  . ALA A 1 4   ? 12.467  24.594 -16.943 1.00 28.42 ? 4    ALA A CA  1 
ATOM   24   C C   . ALA A 1 4   ? 12.877  24.522 -15.476 1.00 28.96 ? 4    ALA A C   1 
ATOM   25   O O   . ALA A 1 4   ? 13.992  24.898 -15.115 1.00 27.96 ? 4    ALA A O   1 
ATOM   26   C CB  . ALA A 1 4   ? 11.531  25.779 -17.172 1.00 30.57 ? 4    ALA A CB  1 
ATOM   27   N N   . ILE A 1 5   ? 11.978  24.029 -14.633 1.00 30.27 ? 5    ILE A N   1 
ATOM   28   C CA  . ILE A 1 5   ? 12.277  23.917 -13.209 1.00 29.30 ? 5    ILE A CA  1 
ATOM   29   C C   . ILE A 1 5   ? 13.413  22.933 -12.957 1.00 30.09 ? 5    ILE A C   1 
ATOM   30   O O   . ILE A 1 5   ? 14.285  23.183 -12.121 1.00 28.95 ? 5    ILE A O   1 
ATOM   31   C CB  . ILE A 1 5   ? 11.033  23.476 -12.411 1.00 27.31 ? 5    ILE A CB  1 
ATOM   32   C CG1 . ILE A 1 5   ? 9.937   24.538 -12.536 1.00 29.41 ? 5    ILE A CG1 1 
ATOM   33   C CG2 . ILE A 1 5   ? 11.407  23.257 -10.954 1.00 29.83 ? 5    ILE A CG2 1 
ATOM   34   C CD1 . ILE A 1 5   ? 8.648   24.200 -11.791 1.00 25.62 ? 5    ILE A CD1 1 
ATOM   35   N N   . GLN A 1 6   ? 13.410  21.818 -13.683 1.00 30.75 ? 6    GLN A N   1 
ATOM   36   C CA  . GLN A 1 6   ? 14.454  20.807 -13.526 1.00 33.05 ? 6    GLN A CA  1 
ATOM   37   C C   . GLN A 1 6   ? 15.819  21.311 -13.982 1.00 30.03 ? 6    GLN A C   1 
ATOM   38   O O   . GLN A 1 6   ? 16.839  20.986 -13.382 1.00 29.61 ? 6    GLN A O   1 
ATOM   39   C CB  . GLN A 1 6   ? 14.087  19.536 -14.300 1.00 39.13 ? 6    GLN A CB  1 
ATOM   40   C CG  . GLN A 1 6   ? 12.898  18.787 -13.720 1.00 47.15 ? 6    GLN A CG  1 
ATOM   41   C CD  . GLN A 1 6   ? 12.575  17.519 -14.487 1.00 53.50 ? 6    GLN A CD  1 
ATOM   42   O OE1 . GLN A 1 6   ? 13.447  16.677 -14.716 1.00 59.97 ? 6    GLN A OE1 1 
ATOM   43   N NE2 . GLN A 1 6   ? 11.316  17.371 -14.881 1.00 55.19 ? 6    GLN A NE2 1 
ATOM   44   N N   . GLN A 1 7   ? 15.841  22.113 -15.039 1.00 29.35 ? 7    GLN A N   1 
ATOM   45   C CA  . GLN A 1 7   ? 17.101  22.642 -15.537 1.00 31.48 ? 7    GLN A CA  1 
ATOM   46   C C   . GLN A 1 7   ? 17.686  23.661 -14.566 1.00 28.11 ? 7    GLN A C   1 
ATOM   47   O O   . GLN A 1 7   ? 18.899  23.725 -14.381 1.00 26.85 ? 7    GLN A O   1 
ATOM   48   C CB  . GLN A 1 7   ? 16.907  23.276 -16.915 1.00 36.71 ? 7    GLN A CB  1 
ATOM   49   C CG  . GLN A 1 7   ? 16.667  22.266 -18.016 1.00 44.03 ? 7    GLN A CG  1 
ATOM   50   C CD  . GLN A 1 7   ? 16.477  22.919 -19.370 1.00 50.13 ? 7    GLN A CD  1 
ATOM   51   O OE1 . GLN A 1 7   ? 15.523  23.670 -19.584 1.00 52.90 ? 7    GLN A OE1 1 
ATOM   52   N NE2 . GLN A 1 7   ? 17.389  22.640 -20.292 1.00 53.12 ? 7    GLN A NE2 1 
ATOM   53   N N   . THR A 1 8   ? 16.822  24.454 -13.945 1.00 28.04 ? 8    THR A N   1 
ATOM   54   C CA  . THR A 1 8   ? 17.282  25.448 -12.980 1.00 28.81 ? 8    THR A CA  1 
ATOM   55   C C   . THR A 1 8   ? 17.849  24.753 -11.747 1.00 28.63 ? 8    THR A C   1 
ATOM   56   O O   . THR A 1 8   ? 18.908  25.129 -11.241 1.00 30.02 ? 8    THR A O   1 
ATOM   57   C CB  . THR A 1 8   ? 16.131  26.387 -12.571 1.00 29.36 ? 8    THR A CB  1 
ATOM   58   O OG1 . THR A 1 8   ? 15.901  27.324 -13.628 1.00 29.48 ? 8    THR A OG1 1 
ATOM   59   C CG2 . THR A 1 8   ? 16.459  27.130 -11.289 1.00 29.52 ? 8    THR A CG2 1 
ATOM   60   N N   . LEU A 1 9   ? 17.148  23.734 -11.268 1.00 28.30 ? 9    LEU A N   1 
ATOM   61   C CA  . LEU A 1 9   ? 17.608  22.990 -10.102 1.00 28.80 ? 9    LEU A CA  1 
ATOM   62   C C   . LEU A 1 9   ? 18.934  22.316 -10.425 1.00 29.07 ? 9    LEU A C   1 
ATOM   63   O O   . LEU A 1 9   ? 19.819  22.224 -9.574  1.00 28.28 ? 9    LEU A O   1 
ATOM   64   C CB  . LEU A 1 9   ? 16.570  21.938 -9.696  1.00 31.84 ? 9    LEU A CB  1 
ATOM   65   C CG  . LEU A 1 9   ? 15.269  22.501 -9.115  1.00 33.03 ? 9    LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 9   ? 14.296  21.373 -8.827  1.00 39.12 ? 9    LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 9   ? 15.577  23.275 -7.847  1.00 35.03 ? 9    LEU A CD2 1 
ATOM   68   N N   . ALA A 1 10  ? 19.072  21.857 -11.664 1.00 30.87 ? 10   ALA A N   1 
ATOM   69   C CA  . ALA A 1 10  ? 20.301  21.202 -12.092 1.00 31.64 ? 10   ALA A CA  1 
ATOM   70   C C   . ALA A 1 10  ? 21.464  22.183 -12.046 1.00 31.21 ? 10   ALA A C   1 
ATOM   71   O O   . ALA A 1 10  ? 22.569  21.822 -11.642 1.00 31.17 ? 10   ALA A O   1 
ATOM   72   C CB  . ALA A 1 10  ? 20.135  20.639 -13.497 1.00 32.98 ? 10   ALA A CB  1 
ATOM   73   N N   . LYS A 1 11  ? 21.214  23.428 -12.446 1.00 29.86 ? 11   LYS A N   1 
ATOM   74   C CA  . LYS A 1 11  ? 22.258  24.448 -12.434 1.00 33.57 ? 11   LYS A CA  1 
ATOM   75   C C   . LYS A 1 11  ? 22.826  24.640 -11.034 1.00 35.24 ? 11   LYS A C   1 
ATOM   76   O O   . LYS A 1 11  ? 23.992  24.996 -10.872 1.00 34.14 ? 11   LYS A O   1 
ATOM   77   C CB  . LYS A 1 11  ? 21.716  25.793 -12.927 1.00 34.95 ? 11   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 11  ? 21.313  25.827 -14.384 1.00 39.55 ? 11   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 11  ? 20.869  27.230 -14.778 1.00 43.56 ? 11   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 11  ? 20.344  27.278 -16.205 1.00 44.85 ? 11   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 11  ? 19.932  28.662 -16.584 1.00 46.33 ? 11   LYS A NZ  1 
ATOM   82   N N   . MET A 1 12  ? 21.993  24.407 -10.025 1.00 37.44 ? 12   MET A N   1 
ATOM   83   C CA  . MET A 1 12  ? 22.410  24.572 -8.640  1.00 40.95 ? 12   MET A CA  1 
ATOM   84   C C   . MET A 1 12  ? 22.869  23.251 -8.035  1.00 40.08 ? 12   MET A C   1 
ATOM   85   O O   . MET A 1 12  ? 23.112  23.161 -6.832  1.00 41.82 ? 12   MET A O   1 
ATOM   86   C CB  . MET A 1 12  ? 21.255  25.147 -7.817  1.00 42.54 ? 12   MET A CB  1 
ATOM   87   C CG  . MET A 1 12  ? 20.648  26.398 -8.423  1.00 47.44 ? 12   MET A CG  1 
ATOM   88   S SD  . MET A 1 12  ? 19.329  27.071 -7.412  1.00 54.44 ? 12   MET A SD  1 
ATOM   89   C CE  . MET A 1 12  ? 18.035  25.853 -7.704  1.00 50.10 ? 12   MET A CE  1 
ATOM   90   N N   . GLY A 1 13  ? 22.992  22.232 -8.876  1.00 41.02 ? 13   GLY A N   1 
ATOM   91   C CA  . GLY A 1 13  ? 23.418  20.929 -8.401  1.00 44.41 ? 13   GLY A CA  1 
ATOM   92   C C   . GLY A 1 13  ? 22.394  20.335 -7.457  1.00 46.68 ? 13   GLY A C   1 
ATOM   93   O O   . GLY A 1 13  ? 22.697  19.415 -6.695  1.00 46.54 ? 13   GLY A O   1 
ATOM   94   N N   . ILE A 1 14  ? 21.176  20.867 -7.516  1.00 47.89 ? 14   ILE A N   1 
ATOM   95   C CA  . ILE A 1 14  ? 20.082  20.411 -6.664  1.00 52.49 ? 14   ILE A CA  1 
ATOM   96   C C   . ILE A 1 14  ? 19.220  19.376 -7.375  1.00 53.49 ? 14   ILE A C   1 
ATOM   97   O O   . ILE A 1 14  ? 18.945  19.493 -8.571  1.00 52.02 ? 14   ILE A O   1 
ATOM   98   C CB  . ILE A 1 14  ? 19.171  21.588 -6.243  1.00 51.77 ? 14   ILE A CB  1 
ATOM   99   C CG1 . ILE A 1 14  ? 20.005  22.683 -5.576  1.00 54.59 ? 14   ILE A CG1 1 
ATOM   100  C CG2 . ILE A 1 14  ? 18.096  21.097 -5.284  1.00 54.03 ? 14   ILE A CG2 1 
ATOM   101  C CD1 . ILE A 1 14  ? 19.209  23.919 -5.196  1.00 52.77 ? 14   ILE A CD1 1 
ATOM   102  N N   . LYS A 1 15  ? 18.800  18.362 -6.625  1.00 56.93 ? 15   LYS A N   1 
ATOM   103  C CA  . LYS A 1 15  ? 17.959  17.301 -7.160  1.00 60.64 ? 15   LYS A CA  1 
ATOM   104  C C   . LYS A 1 15  ? 16.540  17.468 -6.620  1.00 61.71 ? 15   LYS A C   1 
ATOM   105  O O   . LYS A 1 15  ? 16.335  17.590 -5.410  1.00 61.05 ? 15   LYS A O   1 
ATOM   106  C CB  . LYS A 1 15  ? 18.512  15.930 -6.756  1.00 62.06 ? 15   LYS A CB  1 
ATOM   107  C CG  . LYS A 1 15  ? 18.626  15.731 -5.253  1.00 64.64 ? 15   LYS A CG  1 
ATOM   108  C CD  . LYS A 1 15  ? 19.084  14.327 -4.896  1.00 67.55 ? 15   LYS A CD  1 
ATOM   109  C CE  . LYS A 1 15  ? 19.081  14.124 -3.384  1.00 69.50 ? 15   LYS A CE  1 
ATOM   110  N NZ  . LYS A 1 15  ? 19.479  12.745 -2.985  1.00 68.84 ? 15   LYS A NZ  1 
ATOM   111  N N   . SER A 1 16  ? 15.564  17.484 -7.521  1.00 63.22 ? 16   SER A N   1 
ATOM   112  C CA  . SER A 1 16  ? 14.172  17.639 -7.123  1.00 64.44 ? 16   SER A CA  1 
ATOM   113  C C   . SER A 1 16  ? 13.579  16.298 -6.726  1.00 65.05 ? 16   SER A C   1 
ATOM   114  O O   . SER A 1 16  ? 13.808  15.285 -7.387  1.00 64.72 ? 16   SER A O   1 
ATOM   115  C CB  . SER A 1 16  ? 13.351  18.238 -8.265  1.00 64.63 ? 16   SER A CB  1 
ATOM   116  O OG  . SER A 1 16  ? 12.001  18.416 -7.875  1.00 65.45 ? 16   SER A OG  1 
ATOM   117  N N   . SER A 1 17  ? 12.813  16.301 -5.641  1.00 65.26 ? 17   SER A N   1 
ATOM   118  C CA  . SER A 1 17  ? 12.179  15.091 -5.143  1.00 64.42 ? 17   SER A CA  1 
ATOM   119  C C   . SER A 1 17  ? 10.720  15.020 -5.580  1.00 62.87 ? 17   SER A C   1 
ATOM   120  O O   . SER A 1 17  ? 10.140  13.935 -5.653  1.00 64.34 ? 17   SER A O   1 
ATOM   121  C CB  . SER A 1 17  ? 12.263  15.049 -3.615  1.00 65.61 ? 17   SER A CB  1 
ATOM   122  O OG  . SER A 1 17  ? 11.604  13.908 -3.097  1.00 67.98 ? 17   SER A OG  1 
ATOM   123  N N   . ASP A 1 18  ? 10.131  16.176 -5.876  1.00 58.28 ? 18   ASP A N   1 
ATOM   124  C CA  . ASP A 1 18  ? 8.734   16.226 -6.294  1.00 53.82 ? 18   ASP A CA  1 
ATOM   125  C C   . ASP A 1 18  ? 8.257   17.646 -6.604  1.00 49.75 ? 18   ASP A C   1 
ATOM   126  O O   . ASP A 1 18  ? 8.418   18.555 -5.791  1.00 49.52 ? 18   ASP A O   1 
ATOM   127  C CB  . ASP A 1 18  ? 7.860   15.600 -5.200  1.00 54.49 ? 18   ASP A CB  1 
ATOM   128  C CG  . ASP A 1 18  ? 6.380   15.714 -5.492  1.00 54.63 ? 18   ASP A CG  1 
ATOM   129  O OD1 . ASP A 1 18  ? 5.987   15.544 -6.664  1.00 55.69 ? 18   ASP A OD1 1 
ATOM   130  O OD2 . ASP A 1 18  ? 5.608   15.960 -4.542  1.00 56.40 ? 18   ASP A OD2 1 
ATOM   131  N N   . ILE A 1 19  ? 7.681   17.829 -7.790  1.00 46.51 ? 19   ILE A N   1 
ATOM   132  C CA  . ILE A 1 19  ? 7.157   19.128 -8.210  1.00 43.69 ? 19   ILE A CA  1 
ATOM   133  C C   . ILE A 1 19  ? 5.635   19.108 -8.081  1.00 43.98 ? 19   ILE A C   1 
ATOM   134  O O   . ILE A 1 19  ? 4.955   18.364 -8.786  1.00 45.36 ? 19   ILE A O   1 
ATOM   135  C CB  . ILE A 1 19  ? 7.526   19.443 -9.683  1.00 44.13 ? 19   ILE A CB  1 
ATOM   136  C CG1 . ILE A 1 19  ? 9.043   19.599 -9.821  1.00 43.22 ? 19   ILE A CG1 1 
ATOM   137  C CG2 . ILE A 1 19  ? 6.816   20.712 -10.145 1.00 42.35 ? 19   ILE A CG2 1 
ATOM   138  C CD1 . ILE A 1 19  ? 9.512   19.845 -11.242 1.00 44.58 ? 19   ILE A CD1 1 
ATOM   139  N N   . GLN A 1 20  ? 5.107   19.922 -7.173  1.00 42.40 ? 20   GLN A N   1 
ATOM   140  C CA  . GLN A 1 20  ? 3.666   19.989 -6.949  1.00 39.71 ? 20   GLN A CA  1 
ATOM   141  C C   . GLN A 1 20  ? 3.122   21.384 -7.245  1.00 38.57 ? 20   GLN A C   1 
ATOM   142  O O   . GLN A 1 20  ? 3.881   22.346 -7.382  1.00 33.90 ? 20   GLN A O   1 
ATOM   143  C CB  . GLN A 1 20  ? 3.339   19.628 -5.497  1.00 41.31 ? 20   GLN A CB  1 
ATOM   144  C CG  . GLN A 1 20  ? 3.629   18.185 -5.098  1.00 41.90 ? 20   GLN A CG  1 
ATOM   145  C CD  . GLN A 1 20  ? 2.721   17.192 -5.797  1.00 46.42 ? 20   GLN A CD  1 
ATOM   146  O OE1 . GLN A 1 20  ? 1.546   17.471 -6.035  1.00 46.49 ? 20   GLN A OE1 1 
ATOM   147  N NE2 . GLN A 1 20  ? 3.258   16.017 -6.113  1.00 46.65 ? 20   GLN A NE2 1 
ATOM   148  N N   . PRO A 1 21  ? 1.791   21.506 -7.359  1.00 36.42 ? 21   PRO A N   1 
ATOM   149  C CA  . PRO A 1 21  ? 1.175   22.807 -7.635  1.00 34.68 ? 21   PRO A CA  1 
ATOM   150  C C   . PRO A 1 21  ? 1.343   23.758 -6.451  1.00 33.52 ? 21   PRO A C   1 
ATOM   151  O O   . PRO A 1 21  ? 1.654   23.334 -5.336  1.00 29.88 ? 21   PRO A O   1 
ATOM   152  C CB  . PRO A 1 21  ? -0.291  22.453 -7.869  1.00 36.72 ? 21   PRO A CB  1 
ATOM   153  C CG  . PRO A 1 21  ? -0.215  21.062 -8.431  1.00 40.07 ? 21   PRO A CG  1 
ATOM   154  C CD  . PRO A 1 21  ? 0.810   20.420 -7.529  1.00 37.39 ? 21   PRO A CD  1 
ATOM   155  N N   . ALA A 1 22  ? 1.137   25.045 -6.705  1.00 30.59 ? 22   ALA A N   1 
ATOM   156  C CA  . ALA A 1 22  ? 1.234   26.061 -5.668  1.00 32.05 ? 22   ALA A CA  1 
ATOM   157  C C   . ALA A 1 22  ? -0.044  26.892 -5.749  1.00 30.10 ? 22   ALA A C   1 
ATOM   158  O O   . ALA A 1 22  ? -0.623  27.040 -6.823  1.00 30.23 ? 22   ALA A O   1 
ATOM   159  C CB  . ALA A 1 22  ? 2.462   26.940 -5.904  1.00 32.31 ? 22   ALA A CB  1 
ATOM   160  N N   . PRO A 1 23  ? -0.510  27.433 -4.614  1.00 31.80 ? 23   PRO A N   1 
ATOM   161  C CA  . PRO A 1 23  ? -1.733  28.238 -4.639  1.00 33.93 ? 23   PRO A CA  1 
ATOM   162  C C   . PRO A 1 23  ? -1.541  29.599 -5.309  1.00 35.60 ? 23   PRO A C   1 
ATOM   163  O O   . PRO A 1 23  ? -2.440  30.441 -5.298  1.00 37.82 ? 23   PRO A O   1 
ATOM   164  C CB  . PRO A 1 23  ? -2.097  28.352 -3.162  1.00 35.73 ? 23   PRO A CB  1 
ATOM   165  C CG  . PRO A 1 23  ? -0.757  28.365 -2.499  1.00 34.84 ? 23   PRO A CG  1 
ATOM   166  C CD  . PRO A 1 23  ? -0.013  27.273 -3.237  1.00 32.72 ? 23   PRO A CD  1 
ATOM   167  N N   . VAL A 1 24  ? -0.362  29.810 -5.887  1.00 36.25 ? 24   VAL A N   1 
ATOM   168  C CA  . VAL A 1 24  ? -0.058  31.061 -6.576  1.00 35.29 ? 24   VAL A CA  1 
ATOM   169  C C   . VAL A 1 24  ? 0.241   30.750 -8.039  1.00 35.23 ? 24   VAL A C   1 
ATOM   170  O O   . VAL A 1 24  ? 1.109   29.932 -8.349  1.00 33.54 ? 24   VAL A O   1 
ATOM   171  C CB  . VAL A 1 24  ? 1.160   31.774 -5.940  1.00 35.34 ? 24   VAL A CB  1 
ATOM   172  C CG1 . VAL A 1 24  ? 1.513   33.022 -6.735  1.00 33.40 ? 24   VAL A CG1 1 
ATOM   173  C CG2 . VAL A 1 24  ? 0.847   32.144 -4.502  1.00 34.44 ? 24   VAL A CG2 1 
ATOM   174  N N   . ALA A 1 25  ? -0.489  31.399 -8.937  1.00 35.92 ? 25   ALA A N   1 
ATOM   175  C CA  . ALA A 1 25  ? -0.302  31.178 -10.366 1.00 36.79 ? 25   ALA A CA  1 
ATOM   176  C C   . ALA A 1 25  ? 1.116   31.526 -10.813 1.00 36.06 ? 25   ALA A C   1 
ATOM   177  O O   . ALA A 1 25  ? 1.738   32.446 -10.280 1.00 36.75 ? 25   ALA A O   1 
ATOM   178  C CB  . ALA A 1 25  ? -1.319  32.001 -11.159 1.00 40.34 ? 25   ALA A CB  1 
ATOM   179  N N   . GLY A 1 26  ? 1.625   30.773 -11.782 1.00 31.84 ? 26   GLY A N   1 
ATOM   180  C CA  . GLY A 1 26  ? 2.956   31.030 -12.300 1.00 33.39 ? 26   GLY A CA  1 
ATOM   181  C C   . GLY A 1 26  ? 4.121   30.396 -11.565 1.00 31.95 ? 26   GLY A C   1 
ATOM   182  O O   . GLY A 1 26  ? 5.276   30.645 -11.911 1.00 32.54 ? 26   GLY A O   1 
ATOM   183  N N   . MET A 1 27  ? 3.840   29.592 -10.545 1.00 31.93 ? 27   MET A N   1 
ATOM   184  C CA  . MET A 1 27  ? 4.910   28.934 -9.805  1.00 30.35 ? 27   MET A CA  1 
ATOM   185  C C   . MET A 1 27  ? 4.482   27.576 -9.278  1.00 29.36 ? 27   MET A C   1 
ATOM   186  O O   . MET A 1 27  ? 3.295   27.248 -9.270  1.00 27.85 ? 27   MET A O   1 
ATOM   187  C CB  . MET A 1 27  ? 5.386   29.806 -8.643  1.00 33.82 ? 27   MET A CB  1 
ATOM   188  C CG  . MET A 1 27  ? 4.345   30.049 -7.573  1.00 31.45 ? 27   MET A CG  1 
ATOM   189  S SD  . MET A 1 27  ? 5.036   31.011 -6.216  1.00 34.84 ? 27   MET A SD  1 
ATOM   190  C CE  . MET A 1 27  ? 5.301   32.599 -7.025  1.00 32.68 ? 27   MET A CE  1 
ATOM   191  N N   . LYS A 1 28  ? 5.466   26.797 -8.837  1.00 28.05 ? 28   LYS A N   1 
ATOM   192  C CA  . LYS A 1 28  ? 5.233   25.457 -8.319  1.00 30.72 ? 28   LYS A CA  1 
ATOM   193  C C   . LYS A 1 28  ? 5.909   25.240 -6.974  1.00 31.54 ? 28   LYS A C   1 
ATOM   194  O O   . LYS A 1 28  ? 6.886   25.914 -6.638  1.00 31.20 ? 28   LYS A O   1 
ATOM   195  C CB  . LYS A 1 28  ? 5.767   24.416 -9.310  1.00 28.75 ? 28   LYS A CB  1 
ATOM   196  C CG  . LYS A 1 28  ? 5.066   24.405 -10.652 1.00 27.92 ? 28   LYS A CG  1 
ATOM   197  C CD  . LYS A 1 28  ? 3.644   23.881 -10.521 1.00 31.75 ? 28   LYS A CD  1 
ATOM   198  C CE  . LYS A 1 28  ? 2.855   24.124 -11.794 1.00 28.68 ? 28   LYS A CE  1 
ATOM   199  N NZ  . LYS A 1 28  ? 2.668   25.584 -12.018 1.00 28.01 ? 28   LYS A NZ  1 
ATOM   200  N N   . THR A 1 29  ? 5.375   24.292 -6.212  1.00 30.59 ? 29   THR A N   1 
ATOM   201  C CA  . THR A 1 29  ? 5.924   23.928 -4.914  1.00 29.68 ? 29   THR A CA  1 
ATOM   202  C C   . THR A 1 29  ? 6.916   22.822 -5.227  1.00 28.80 ? 29   THR A C   1 
ATOM   203  O O   . THR A 1 29  ? 6.535   21.776 -5.753  1.00 28.15 ? 29   THR A O   1 
ATOM   204  C CB  . THR A 1 29  ? 4.832   23.370 -3.979  1.00 30.88 ? 29   THR A CB  1 
ATOM   205  O OG1 . THR A 1 29  ? 3.773   24.326 -3.855  1.00 29.24 ? 29   THR A OG1 1 
ATOM   206  C CG2 . THR A 1 29  ? 5.415   23.076 -2.602  1.00 30.74 ? 29   THR A CG2 1 
ATOM   207  N N   . VAL A 1 30  ? 8.186   23.043 -4.913  1.00 26.57 ? 30   VAL A N   1 
ATOM   208  C CA  . VAL A 1 30  ? 9.204   22.049 -5.225  1.00 29.43 ? 30   VAL A CA  1 
ATOM   209  C C   . VAL A 1 30  ? 9.956   21.539 -3.999  1.00 31.21 ? 30   VAL A C   1 
ATOM   210  O O   . VAL A 1 30  ? 10.621  22.304 -3.304  1.00 30.07 ? 30   VAL A O   1 
ATOM   211  C CB  . VAL A 1 30  ? 10.222  22.635 -6.243  1.00 32.56 ? 30   VAL A CB  1 
ATOM   212  C CG1 . VAL A 1 30  ? 11.183  21.562 -6.712  1.00 31.96 ? 30   VAL A CG1 1 
ATOM   213  C CG2 . VAL A 1 30  ? 9.478   23.249 -7.424  1.00 33.66 ? 30   VAL A CG2 1 
ATOM   214  N N   . LEU A 1 31  ? 9.842   20.243 -3.728  1.00 33.72 ? 31   LEU A N   1 
ATOM   215  C CA  . LEU A 1 31  ? 10.540  19.653 -2.591  1.00 36.28 ? 31   LEU A CA  1 
ATOM   216  C C   . LEU A 1 31  ? 11.866  19.103 -3.088  1.00 37.81 ? 31   LEU A C   1 
ATOM   217  O O   . LEU A 1 31  ? 11.905  18.221 -3.944  1.00 39.46 ? 31   LEU A O   1 
ATOM   218  C CB  . LEU A 1 31  ? 9.716   18.526 -1.961  1.00 37.50 ? 31   LEU A CB  1 
ATOM   219  C CG  . LEU A 1 31  ? 10.396  17.769 -0.810  1.00 41.85 ? 31   LEU A CG  1 
ATOM   220  C CD1 . LEU A 1 31  ? 10.868  18.739 0.266   1.00 39.16 ? 31   LEU A CD1 1 
ATOM   221  C CD2 . LEU A 1 31  ? 9.422   16.753 -0.223  1.00 43.44 ? 31   LEU A CD2 1 
ATOM   222  N N   . THR A 1 32  ? 12.956  19.631 -2.547  1.00 41.12 ? 32   THR A N   1 
ATOM   223  C CA  . THR A 1 32  ? 14.283  19.199 -2.960  1.00 43.72 ? 32   THR A CA  1 
ATOM   224  C C   . THR A 1 32  ? 15.091  18.739 -1.758  1.00 48.75 ? 32   THR A C   1 
ATOM   225  O O   . THR A 1 32  ? 14.615  18.782 -0.624  1.00 50.57 ? 32   THR A O   1 
ATOM   226  C CB  . THR A 1 32  ? 15.046  20.347 -3.631  1.00 42.52 ? 32   THR A CB  1 
ATOM   227  O OG1 . THR A 1 32  ? 15.493  21.266 -2.628  1.00 40.31 ? 32   THR A OG1 1 
ATOM   228  C CG2 . THR A 1 32  ? 14.138  21.089 -4.611  1.00 36.96 ? 32   THR A CG2 1 
ATOM   229  N N   . ASN A 1 33  ? 16.320  18.303 -2.019  1.00 52.24 ? 33   ASN A N   1 
ATOM   230  C CA  . ASN A 1 33  ? 17.220  17.845 -0.969  1.00 54.78 ? 33   ASN A CA  1 
ATOM   231  C C   . ASN A 1 33  ? 17.791  19.050 -0.229  1.00 55.53 ? 33   ASN A C   1 
ATOM   232  O O   . ASN A 1 33  ? 18.641  18.911 0.649   1.00 56.41 ? 33   ASN A O   1 
ATOM   233  C CB  . ASN A 1 33  ? 18.352  17.012 -1.578  1.00 56.67 ? 33   ASN A CB  1 
ATOM   234  C CG  . ASN A 1 33  ? 19.081  17.741 -2.694  1.00 59.23 ? 33   ASN A CG  1 
ATOM   235  O OD1 . ASN A 1 33  ? 18.459  18.252 -3.628  1.00 58.85 ? 33   ASN A OD1 1 
ATOM   236  N ND2 . ASN A 1 33  ? 20.407  17.785 -2.607  1.00 60.74 ? 33   ASN A ND2 1 
ATOM   237  N N   . SER A 1 34  ? 17.310  20.234 -0.597  1.00 56.01 ? 34   SER A N   1 
ATOM   238  C CA  . SER A 1 34  ? 17.746  21.482 0.018   1.00 55.41 ? 34   SER A CA  1 
ATOM   239  C C   . SER A 1 34  ? 16.551  22.152 0.685   1.00 54.75 ? 34   SER A C   1 
ATOM   240  O O   . SER A 1 34  ? 16.627  23.307 1.109   1.00 54.86 ? 34   SER A O   1 
ATOM   241  C CB  . SER A 1 34  ? 18.330  22.422 -1.042  1.00 57.11 ? 34   SER A CB  1 
ATOM   242  O OG  . SER A 1 34  ? 19.420  21.822 -1.720  1.00 60.90 ? 34   SER A OG  1 
ATOM   243  N N   . GLY A 1 35  ? 15.443  21.420 0.768   1.00 52.48 ? 35   GLY A N   1 
ATOM   244  C CA  . GLY A 1 35  ? 14.243  21.961 1.380   1.00 49.23 ? 35   GLY A CA  1 
ATOM   245  C C   . GLY A 1 35  ? 13.167  22.288 0.361   1.00 46.98 ? 35   GLY A C   1 
ATOM   246  O O   . GLY A 1 35  ? 13.309  21.987 -0.827  1.00 47.32 ? 35   GLY A O   1 
ATOM   247  N N   . VAL A 1 36  ? 12.089  22.911 0.825   1.00 43.95 ? 36   VAL A N   1 
ATOM   248  C CA  . VAL A 1 36  ? 10.982  23.275 -0.048  1.00 39.00 ? 36   VAL A CA  1 
ATOM   249  C C   . VAL A 1 36  ? 11.184  24.649 -0.671  1.00 38.00 ? 36   VAL A C   1 
ATOM   250  O O   . VAL A 1 36  ? 11.353  25.650 0.027   1.00 40.23 ? 36   VAL A O   1 
ATOM   251  C CB  . VAL A 1 36  ? 9.638   23.271 0.713   1.00 37.88 ? 36   VAL A CB  1 
ATOM   252  C CG1 . VAL A 1 36  ? 8.510   23.724 -0.216  1.00 33.01 ? 36   VAL A CG1 1 
ATOM   253  C CG2 . VAL A 1 36  ? 9.352   21.872 1.243   1.00 35.69 ? 36   VAL A CG2 1 
ATOM   254  N N   . LEU A 1 37  ? 11.158  24.689 -1.996  1.00 32.94 ? 37   LEU A N   1 
ATOM   255  C CA  . LEU A 1 37  ? 11.338  25.940 -2.716  1.00 30.81 ? 37   LEU A CA  1 
ATOM   256  C C   . LEU A 1 37  ? 10.148  26.212 -3.615  1.00 29.71 ? 37   LEU A C   1 
ATOM   257  O O   . LEU A 1 37  ? 9.476   25.290 -4.076  1.00 27.88 ? 37   LEU A O   1 
ATOM   258  C CB  . LEU A 1 37  ? 12.589  25.878 -3.597  1.00 29.74 ? 37   LEU A CB  1 
ATOM   259  C CG  . LEU A 1 37  ? 13.956  25.589 -2.981  1.00 30.72 ? 37   LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 37  ? 14.980  25.489 -4.109  1.00 28.16 ? 37   LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 37  ? 14.340  26.690 -1.999  1.00 33.44 ? 37   LEU A CD2 1 
ATOM   262  N N   . TYR A 1 38  ? 9.885   27.488 -3.848  1.00 25.91 ? 38   TYR A N   1 
ATOM   263  C CA  . TYR A 1 38  ? 8.823   27.880 -4.751  1.00 26.71 ? 38   TYR A CA  1 
ATOM   264  C C   . TYR A 1 38  ? 9.568   28.382 -5.971  1.00 28.45 ? 38   TYR A C   1 
ATOM   265  O O   . TYR A 1 38  ? 10.395  29.287 -5.869  1.00 26.71 ? 38   TYR A O   1 
ATOM   266  C CB  . TYR A 1 38  ? 7.950   28.970 -4.131  1.00 24.27 ? 38   TYR A CB  1 
ATOM   267  C CG  . TYR A 1 38  ? 7.092   28.404 -3.029  1.00 24.84 ? 38   TYR A CG  1 
ATOM   268  C CD1 . TYR A 1 38  ? 7.581   28.284 -1.729  1.00 27.56 ? 38   TYR A CD1 1 
ATOM   269  C CD2 . TYR A 1 38  ? 5.833   27.873 -3.312  1.00 28.21 ? 38   TYR A CD2 1 
ATOM   270  C CE1 . TYR A 1 38  ? 6.840   27.639 -0.736  1.00 28.71 ? 38   TYR A CE1 1 
ATOM   271  C CE2 . TYR A 1 38  ? 5.087   27.226 -2.327  1.00 31.30 ? 38   TYR A CE2 1 
ATOM   272  C CZ  . TYR A 1 38  ? 5.599   27.111 -1.045  1.00 28.98 ? 38   TYR A CZ  1 
ATOM   273  O OH  . TYR A 1 38  ? 4.879   26.441 -0.080  1.00 34.31 ? 38   TYR A OH  1 
ATOM   274  N N   . ILE A 1 39  ? 9.305   27.759 -7.115  1.00 26.54 ? 39   ILE A N   1 
ATOM   275  C CA  . ILE A 1 39  ? 9.980   28.128 -8.348  1.00 27.59 ? 39   ILE A CA  1 
ATOM   276  C C   . ILE A 1 39  ? 8.972   28.490 -9.426  1.00 27.77 ? 39   ILE A C   1 
ATOM   277  O O   . ILE A 1 39  ? 7.997   27.768 -9.646  1.00 28.30 ? 39   ILE A O   1 
ATOM   278  C CB  . ILE A 1 39  ? 10.870  26.965 -8.841  1.00 29.58 ? 39   ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 39  ? 11.756  26.477 -7.685  1.00 28.87 ? 39   ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 39  ? 11.734  27.426 -10.013 1.00 29.78 ? 39   ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 39  ? 12.696  25.334 -8.041  1.00 30.41 ? 39   ILE A CD1 1 
ATOM   282  N N   . THR A 1 40  ? 9.191   29.625 -10.081 1.00 25.23 ? 40   THR A N   1 
ATOM   283  C CA  . THR A 1 40  ? 8.286   30.050 -11.134 1.00 28.03 ? 40   THR A CA  1 
ATOM   284  C C   . THR A 1 40  ? 8.305   29.031 -12.270 1.00 27.47 ? 40   THR A C   1 
ATOM   285  O O   . THR A 1 40  ? 9.296   28.327 -12.471 1.00 26.92 ? 40   THR A O   1 
ATOM   286  C CB  . THR A 1 40  ? 8.668   31.445 -11.667 1.00 27.00 ? 40   THR A CB  1 
ATOM   287  O OG1 . THR A 1 40  ? 10.017  31.427 -12.144 1.00 28.25 ? 40   THR A OG1 1 
ATOM   288  C CG2 . THR A 1 40  ? 8.547   32.474 -10.553 1.00 27.61 ? 40   THR A CG2 1 
ATOM   289  N N   . ASP A 1 41  ? 7.198   28.952 -13.002 1.00 30.80 ? 41   ASP A N   1 
ATOM   290  C CA  . ASP A 1 41  ? 7.060   28.005 -14.106 1.00 28.91 ? 41   ASP A CA  1 
ATOM   291  C C   . ASP A 1 41  ? 8.137   28.108 -15.171 1.00 31.22 ? 41   ASP A C   1 
ATOM   292  O O   . ASP A 1 41  ? 8.422   27.126 -15.861 1.00 31.43 ? 41   ASP A O   1 
ATOM   293  C CB  . ASP A 1 41  ? 5.694   28.161 -14.770 1.00 29.03 ? 41   ASP A CB  1 
ATOM   294  C CG  . ASP A 1 41  ? 4.556   27.799 -13.849 1.00 31.13 ? 41   ASP A CG  1 
ATOM   295  O OD1 . ASP A 1 41  ? 4.739   26.891 -13.013 1.00 30.70 ? 41   ASP A OD1 1 
ATOM   296  O OD2 . ASP A 1 41  ? 3.473   28.409 -13.972 1.00 33.42 ? 41   ASP A OD2 1 
ATOM   297  N N   . ASP A 1 42  ? 8.727   29.293 -15.312 1.00 28.79 ? 42   ASP A N   1 
ATOM   298  C CA  . ASP A 1 42  ? 9.781   29.515 -16.299 1.00 31.88 ? 42   ASP A CA  1 
ATOM   299  C C   . ASP A 1 42  ? 11.170  29.196 -15.742 1.00 31.18 ? 42   ASP A C   1 
ATOM   300  O O   . ASP A 1 42  ? 12.168  29.299 -16.456 1.00 31.22 ? 42   ASP A O   1 
ATOM   301  C CB  . ASP A 1 42  ? 9.754   30.967 -16.789 1.00 32.97 ? 42   ASP A CB  1 
ATOM   302  C CG  . ASP A 1 42  ? 9.949   31.964 -15.664 1.00 36.51 ? 42   ASP A CG  1 
ATOM   303  O OD1 . ASP A 1 42  ? 10.517  31.582 -14.622 1.00 34.24 ? 42   ASP A OD1 1 
ATOM   304  O OD2 . ASP A 1 42  ? 9.546   33.134 -15.823 1.00 38.91 ? 42   ASP A OD2 1 
ATOM   305  N N   . GLY A 1 43  ? 11.227  28.824 -14.465 1.00 27.99 ? 43   GLY A N   1 
ATOM   306  C CA  . GLY A 1 43  ? 12.493  28.486 -13.831 1.00 25.21 ? 43   GLY A CA  1 
ATOM   307  C C   . GLY A 1 43  ? 13.432  29.659 -13.601 1.00 26.22 ? 43   GLY A C   1 
ATOM   308  O O   . GLY A 1 43  ? 14.585  29.468 -13.208 1.00 25.92 ? 43   GLY A O   1 
ATOM   309  N N   . LYS A 1 44  ? 12.941  30.875 -13.823 1.00 24.60 ? 44   LYS A N   1 
ATOM   310  C CA  . LYS A 1 44  ? 13.762  32.069 -13.666 1.00 31.59 ? 44   LYS A CA  1 
ATOM   311  C C   . LYS A 1 44  ? 13.901  32.603 -12.241 1.00 30.56 ? 44   LYS A C   1 
ATOM   312  O O   . LYS A 1 44  ? 14.871  33.301 -11.930 1.00 30.94 ? 44   LYS A O   1 
ATOM   313  C CB  . LYS A 1 44  ? 13.235  33.178 -14.586 1.00 33.13 ? 44   LYS A CB  1 
ATOM   314  C CG  . LYS A 1 44  ? 13.361  32.836 -16.068 1.00 39.51 ? 44   LYS A CG  1 
ATOM   315  C CD  . LYS A 1 44  ? 12.896  33.973 -16.971 1.00 43.92 ? 44   LYS A CD  1 
ATOM   316  C CE  . LYS A 1 44  ? 13.032  33.577 -18.437 1.00 48.68 ? 44   LYS A CE  1 
ATOM   317  N NZ  . LYS A 1 44  ? 12.578  34.646 -19.370 1.00 53.98 ? 44   LYS A NZ  1 
ATOM   318  N N   . HIS A 1 45  ? 12.944  32.284 -11.375 1.00 29.94 ? 45   HIS A N   1 
ATOM   319  C CA  . HIS A 1 45  ? 13.008  32.758 -10.000 1.00 30.49 ? 45   HIS A CA  1 
ATOM   320  C C   . HIS A 1 45  ? 12.721  31.678 -8.972  1.00 31.78 ? 45   HIS A C   1 
ATOM   321  O O   . HIS A 1 45  ? 11.867  30.816 -9.176  1.00 29.30 ? 45   HIS A O   1 
ATOM   322  C CB  . HIS A 1 45  ? 12.043  33.926 -9.790  1.00 28.95 ? 45   HIS A CB  1 
ATOM   323  C CG  . HIS A 1 45  ? 12.386  35.138 -10.598 1.00 30.94 ? 45   HIS A CG  1 
ATOM   324  N ND1 . HIS A 1 45  ? 11.979  35.301 -11.904 1.00 31.73 ? 45   HIS A ND1 1 
ATOM   325  C CD2 . HIS A 1 45  ? 13.144  36.221 -10.301 1.00 31.63 ? 45   HIS A CD2 1 
ATOM   326  C CE1 . HIS A 1 45  ? 12.472  36.431 -12.379 1.00 33.10 ? 45   HIS A CE1 1 
ATOM   327  N NE2 . HIS A 1 45  ? 13.183  37.008 -11.427 1.00 33.38 ? 45   HIS A NE2 1 
ATOM   328  N N   . ILE A 1 46  ? 13.454  31.742 -7.867  1.00 29.63 ? 46   ILE A N   1 
ATOM   329  C CA  . ILE A 1 46  ? 13.309  30.798 -6.768  1.00 30.39 ? 46   ILE A CA  1 
ATOM   330  C C   . ILE A 1 46  ? 13.058  31.598 -5.496  1.00 31.28 ? 46   ILE A C   1 
ATOM   331  O O   . ILE A 1 46  ? 13.729  32.600 -5.242  1.00 29.70 ? 46   ILE A O   1 
ATOM   332  C CB  . ILE A 1 46  ? 14.593  29.963 -6.579  1.00 32.57 ? 46   ILE A CB  1 
ATOM   333  C CG1 . ILE A 1 46  ? 14.810  29.067 -7.796  1.00 33.86 ? 46   ILE A CG1 1 
ATOM   334  C CG2 . ILE A 1 46  ? 14.493  29.133 -5.309  1.00 37.65 ? 46   ILE A CG2 1 
ATOM   335  C CD1 . ILE A 1 46  ? 16.168  28.415 -7.832  1.00 39.25 ? 46   ILE A CD1 1 
ATOM   336  N N   . ILE A 1 47  ? 12.080  31.166 -4.709  1.00 27.56 ? 47   ILE A N   1 
ATOM   337  C CA  . ILE A 1 47  ? 11.765  31.847 -3.462  1.00 25.55 ? 47   ILE A CA  1 
ATOM   338  C C   . ILE A 1 47  ? 11.788  30.813 -2.345  1.00 26.40 ? 47   ILE A C   1 
ATOM   339  O O   . ILE A 1 47  ? 11.078  29.804 -2.405  1.00 25.95 ? 47   ILE A O   1 
ATOM   340  C CB  . ILE A 1 47  ? 10.368  32.486 -3.505  1.00 25.19 ? 47   ILE A CB  1 
ATOM   341  C CG1 . ILE A 1 47  ? 10.146  33.160 -4.863  1.00 26.67 ? 47   ILE A CG1 1 
ATOM   342  C CG2 . ILE A 1 47  ? 10.234  33.510 -2.381  1.00 27.00 ? 47   ILE A CG2 1 
ATOM   343  C CD1 . ILE A 1 47  ? 8.716   33.573 -5.120  1.00 34.00 ? 47   ILE A CD1 1 
ATOM   344  N N   . GLN A 1 48  ? 12.624  31.046 -1.341  1.00 25.48 ? 48   GLN A N   1 
ATOM   345  C CA  . GLN A 1 48  ? 12.696  30.127 -0.221  1.00 30.11 ? 48   GLN A CA  1 
ATOM   346  C C   . GLN A 1 48  ? 11.387  30.228 0.544   1.00 29.75 ? 48   GLN A C   1 
ATOM   347  O O   . GLN A 1 48  ? 10.827  31.315 0.703   1.00 29.95 ? 48   GLN A O   1 
ATOM   348  C CB  . GLN A 1 48  ? 13.866  30.478 0.703   1.00 33.86 ? 48   GLN A CB  1 
ATOM   349  C CG  . GLN A 1 48  ? 15.236  30.256 0.075   1.00 45.21 ? 48   GLN A CG  1 
ATOM   350  C CD  . GLN A 1 48  ? 16.355  30.289 1.096   1.00 49.64 ? 48   GLN A CD  1 
ATOM   351  O OE1 . GLN A 1 48  ? 16.634  31.327 1.697   1.00 56.75 ? 48   GLN A OE1 1 
ATOM   352  N NE2 . GLN A 1 48  ? 16.998  29.145 1.306   1.00 54.12 ? 48   GLN A NE2 1 
ATOM   353  N N   . GLY A 1 49  ? 10.892  29.092 1.008   1.00 31.04 ? 49   GLY A N   1 
ATOM   354  C CA  . GLY A 1 49  ? 9.654   29.106 1.757   1.00 32.02 ? 49   GLY A CA  1 
ATOM   355  C C   . GLY A 1 49  ? 9.887   29.586 3.177   1.00 31.30 ? 49   GLY A C   1 
ATOM   356  O O   . GLY A 1 49  ? 10.969  30.073 3.505   1.00 32.37 ? 49   GLY A O   1 
ATOM   357  N N   . PRO A 1 50  ? 8.881   29.458 4.049   1.00 29.67 ? 50   PRO A N   1 
ATOM   358  C CA  . PRO A 1 50  ? 7.594   28.879 3.663   1.00 28.42 ? 50   PRO A CA  1 
ATOM   359  C C   . PRO A 1 50  ? 6.652   29.911 3.066   1.00 28.89 ? 50   PRO A C   1 
ATOM   360  O O   . PRO A 1 50  ? 6.942   31.109 3.066   1.00 25.56 ? 50   PRO A O   1 
ATOM   361  C CB  . PRO A 1 50  ? 7.067   28.324 4.980   1.00 31.61 ? 50   PRO A CB  1 
ATOM   362  C CG  . PRO A 1 50  ? 7.560   29.326 5.966   1.00 28.24 ? 50   PRO A CG  1 
ATOM   363  C CD  . PRO A 1 50  ? 8.988   29.572 5.514   1.00 29.03 ? 50   PRO A CD  1 
ATOM   364  N N   . MET A 1 51  ? 5.530   29.425 2.549   1.00 26.75 ? 51   MET A N   1 
ATOM   365  C CA  . MET A 1 51  ? 4.497   30.279 1.986   1.00 29.29 ? 51   MET A CA  1 
ATOM   366  C C   . MET A 1 51  ? 3.311   30.221 2.944   1.00 30.90 ? 51   MET A C   1 
ATOM   367  O O   . MET A 1 51  ? 3.015   29.165 3.511   1.00 29.77 ? 51   MET A O   1 
ATOM   368  C CB  . MET A 1 51  ? 4.048   29.772 0.614   1.00 29.49 ? 51   MET A CB  1 
ATOM   369  C CG  . MET A 1 51  ? 2.839   30.516 0.067   1.00 31.42 ? 51   MET A CG  1 
ATOM   370  S SD  . MET A 1 51  ? 2.154   29.781 -1.416  1.00 34.40 ? 51   MET A SD  1 
ATOM   371  C CE  . MET A 1 51  ? 3.325   30.369 -2.651  1.00 33.42 ? 51   MET A CE  1 
ATOM   372  N N   . TYR A 1 52  ? 2.639   31.349 3.131   1.00 28.40 ? 52   TYR A N   1 
ATOM   373  C CA  . TYR A 1 52  ? 1.487   31.382 4.015   1.00 31.47 ? 52   TYR A CA  1 
ATOM   374  C C   . TYR A 1 52  ? 0.249   31.859 3.277   1.00 32.35 ? 52   TYR A C   1 
ATOM   375  O O   . TYR A 1 52  ? 0.327   32.701 2.381   1.00 33.03 ? 52   TYR A O   1 
ATOM   376  C CB  . TYR A 1 52  ? 1.727   32.315 5.207   1.00 34.09 ? 52   TYR A CB  1 
ATOM   377  C CG  . TYR A 1 52  ? 2.947   31.991 6.038   1.00 39.13 ? 52   TYR A CG  1 
ATOM   378  C CD1 . TYR A 1 52  ? 4.225   32.329 5.596   1.00 39.24 ? 52   TYR A CD1 1 
ATOM   379  C CD2 . TYR A 1 52  ? 2.823   31.359 7.274   1.00 39.11 ? 52   TYR A CD2 1 
ATOM   380  C CE1 . TYR A 1 52  ? 5.352   32.049 6.369   1.00 41.01 ? 52   TYR A CE1 1 
ATOM   381  C CE2 . TYR A 1 52  ? 3.942   31.074 8.052   1.00 40.45 ? 52   TYR A CE2 1 
ATOM   382  C CZ  . TYR A 1 52  ? 5.202   31.422 7.593   1.00 40.94 ? 52   TYR A CZ  1 
ATOM   383  O OH  . TYR A 1 52  ? 6.311   31.142 8.356   1.00 46.86 ? 52   TYR A OH  1 
ATOM   384  N N   . ASP A 1 53  ? -0.891  31.290 3.644   1.00 32.83 ? 53   ASP A N   1 
ATOM   385  C CA  . ASP A 1 53  ? -2.165  31.696 3.071   1.00 32.20 ? 53   ASP A CA  1 
ATOM   386  C C   . ASP A 1 53  ? -2.718  32.596 4.167   1.00 33.09 ? 53   ASP A C   1 
ATOM   387  O O   . ASP A 1 53  ? -2.977  32.137 5.282   1.00 31.56 ? 53   ASP A O   1 
ATOM   388  C CB  . ASP A 1 53  ? -3.087  30.493 2.873   1.00 36.46 ? 53   ASP A CB  1 
ATOM   389  C CG  . ASP A 1 53  ? -4.466  30.889 2.372   1.00 36.96 ? 53   ASP A CG  1 
ATOM   390  O OD1 . ASP A 1 53  ? -5.040  31.860 2.910   1.00 42.15 ? 53   ASP A OD1 1 
ATOM   391  O OD2 . ASP A 1 53  ? -4.981  30.224 1.449   1.00 39.20 ? 53   ASP A OD2 1 
ATOM   392  N N   . VAL A 1 54  ? -2.862  33.881 3.866   1.00 33.80 ? 54   VAL A N   1 
ATOM   393  C CA  . VAL A 1 54  ? -3.369  34.827 4.850   1.00 37.05 ? 54   VAL A CA  1 
ATOM   394  C C   . VAL A 1 54  ? -4.671  35.467 4.388   1.00 41.61 ? 54   VAL A C   1 
ATOM   395  O O   . VAL A 1 54  ? -4.951  36.627 4.694   1.00 43.21 ? 54   VAL A O   1 
ATOM   396  C CB  . VAL A 1 54  ? -2.333  35.931 5.133   1.00 34.45 ? 54   VAL A CB  1 
ATOM   397  C CG1 . VAL A 1 54  ? -1.112  35.327 5.801   1.00 35.79 ? 54   VAL A CG1 1 
ATOM   398  C CG2 . VAL A 1 54  ? -1.937  36.618 3.834   1.00 31.86 ? 54   VAL A CG2 1 
ATOM   399  N N   . SER A 1 55  ? -5.464  34.700 3.650   1.00 46.21 ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -6.741  35.186 3.148   1.00 48.99 ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -7.845  34.921 4.167   1.00 52.11 ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -8.952  35.449 4.047   1.00 52.74 ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -7.084  34.497 1.823   1.00 49.25 ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -7.202  33.095 1.987   1.00 47.82 ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -7.534  34.112 5.176   1.00 53.04 ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -8.518  33.787 6.192   1.00 55.90 ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -8.267  34.390 7.563   1.00 57.56 ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -7.432  35.282 7.725   1.00 57.23 ? 56   GLY A O   1 
ATOM   409  N N   . THR A 1 57  ? -9.003  33.888 8.552   1.00 58.31 ? 57   THR A N   1 
ATOM   410  C CA  . THR A 1 57  ? -8.908  34.348 9.935   1.00 59.68 ? 57   THR A CA  1 
ATOM   411  C C   . THR A 1 57  ? -7.471  34.478 10.430  1.00 58.72 ? 57   THR A C   1 
ATOM   412  O O   . THR A 1 57  ? -7.024  35.569 10.786  1.00 60.17 ? 57   THR A O   1 
ATOM   413  C CB  . THR A 1 57  ? -9.661  33.388 10.882  1.00 60.54 ? 57   THR A CB  1 
ATOM   414  O OG1 . THR A 1 57  ? -11.031 33.293 10.474  1.00 62.51 ? 57   THR A OG1 1 
ATOM   415  C CG2 . THR A 1 57  ? -9.597  33.891 12.316  1.00 61.62 ? 57   THR A CG2 1 
ATOM   416  N N   . ALA A 1 58  ? -6.758  33.358 10.467  1.00 57.40 ? 58   ALA A N   1 
ATOM   417  C CA  . ALA A 1 58  ? -5.371  33.344 10.918  1.00 55.85 ? 58   ALA A CA  1 
ATOM   418  C C   . ALA A 1 58  ? -4.477  32.789 9.816   1.00 52.92 ? 58   ALA A C   1 
ATOM   419  O O   . ALA A 1 58  ? -4.942  32.083 8.923   1.00 50.44 ? 58   ALA A O   1 
ATOM   420  C CB  . ALA A 1 58  ? -5.236  32.496 12.181  1.00 55.19 ? 58   ALA A CB  1 
ATOM   421  N N   . PRO A 1 59  ? -3.176  33.107 9.863   1.00 52.31 ? 59   PRO A N   1 
ATOM   422  C CA  . PRO A 1 59  ? -2.257  32.610 8.837   1.00 50.99 ? 59   PRO A CA  1 
ATOM   423  C C   . PRO A 1 59  ? -2.094  31.094 8.890   1.00 50.00 ? 59   PRO A C   1 
ATOM   424  O O   . PRO A 1 59  ? -2.082  30.497 9.967   1.00 50.64 ? 59   PRO A O   1 
ATOM   425  C CB  . PRO A 1 59  ? -0.960  33.346 9.157   1.00 51.27 ? 59   PRO A CB  1 
ATOM   426  C CG  . PRO A 1 59  ? -1.020  33.476 10.649  1.00 53.15 ? 59   PRO A CG  1 
ATOM   427  C CD  . PRO A 1 59  ? -2.454  33.901 10.873  1.00 52.77 ? 59   PRO A CD  1 
ATOM   428  N N   . VAL A 1 60  ? -1.982  30.479 7.717   1.00 46.73 ? 60   VAL A N   1 
ATOM   429  C CA  . VAL A 1 60  ? -1.801  29.038 7.617   1.00 42.33 ? 60   VAL A CA  1 
ATOM   430  C C   . VAL A 1 60  ? -0.561  28.730 6.780   1.00 39.01 ? 60   VAL A C   1 
ATOM   431  O O   . VAL A 1 60  ? -0.445  29.168 5.636   1.00 39.04 ? 60   VAL A O   1 
ATOM   432  C CB  . VAL A 1 60  ? -3.032  28.361 6.972   1.00 43.40 ? 60   VAL A CB  1 
ATOM   433  C CG1 . VAL A 1 60  ? -3.463  29.130 5.745   1.00 45.35 ? 60   VAL A CG1 1 
ATOM   434  C CG2 . VAL A 1 60  ? -2.698  26.918 6.598   1.00 44.36 ? 60   VAL A CG2 1 
ATOM   435  N N   . ASN A 1 61  ? 0.371   27.986 7.363   1.00 35.13 ? 61   ASN A N   1 
ATOM   436  C CA  . ASN A 1 61  ? 1.598   27.624 6.667   1.00 33.49 ? 61   ASN A CA  1 
ATOM   437  C C   . ASN A 1 61  ? 1.269   26.579 5.606   1.00 34.03 ? 61   ASN A C   1 
ATOM   438  O O   . ASN A 1 61  ? 1.157   25.391 5.909   1.00 35.19 ? 61   ASN A O   1 
ATOM   439  C CB  . ASN A 1 61  ? 2.614   27.057 7.658   1.00 32.25 ? 61   ASN A CB  1 
ATOM   440  C CG  . ASN A 1 61  ? 3.997   26.941 7.066   1.00 28.28 ? 61   ASN A CG  1 
ATOM   441  O OD1 . ASN A 1 61  ? 4.158   26.526 5.920   1.00 26.87 ? 61   ASN A OD1 1 
ATOM   442  N ND2 . ASN A 1 61  ? 5.009   27.296 7.850   1.00 28.68 ? 61   ASN A ND2 1 
ATOM   443  N N   . VAL A 1 62  ? 1.114   27.018 4.362   1.00 34.67 ? 62   VAL A N   1 
ATOM   444  C CA  . VAL A 1 62  ? 0.782   26.097 3.285   1.00 35.48 ? 62   VAL A CA  1 
ATOM   445  C C   . VAL A 1 62  ? 1.935   25.148 2.975   1.00 34.10 ? 62   VAL A C   1 
ATOM   446  O O   . VAL A 1 62  ? 1.720   24.035 2.495   1.00 33.28 ? 62   VAL A O   1 
ATOM   447  C CB  . VAL A 1 62  ? 0.360   26.853 1.998   1.00 38.83 ? 62   VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 62  ? -0.857  27.713 2.284   1.00 40.65 ? 62   VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 62  ? 1.503   27.702 1.481   1.00 40.01 ? 62   VAL A CG2 1 
ATOM   450  N N   . THR A 1 63  ? 3.157   25.583 3.259   1.00 32.11 ? 63   THR A N   1 
ATOM   451  C CA  . THR A 1 63  ? 4.326   24.751 3.019   1.00 31.43 ? 63   THR A CA  1 
ATOM   452  C C   . THR A 1 63  ? 4.267   23.532 3.940   1.00 32.73 ? 63   THR A C   1 
ATOM   453  O O   . THR A 1 63  ? 4.474   22.392 3.505   1.00 31.13 ? 63   THR A O   1 
ATOM   454  C CB  . THR A 1 63  ? 5.620   25.533 3.294   1.00 32.54 ? 63   THR A CB  1 
ATOM   455  O OG1 . THR A 1 63  ? 5.695   26.651 2.399   1.00 31.95 ? 63   THR A OG1 1 
ATOM   456  C CG2 . THR A 1 63  ? 6.839   24.645 3.091   1.00 28.67 ? 63   THR A CG2 1 
ATOM   457  N N   . ASN A 1 64  ? 3.987   23.783 5.216   1.00 29.20 ? 64   ASN A N   1 
ATOM   458  C CA  . ASN A 1 64  ? 3.883   22.715 6.207   1.00 32.02 ? 64   ASN A CA  1 
ATOM   459  C C   . ASN A 1 64  ? 2.688   21.827 5.872   1.00 34.06 ? 64   ASN A C   1 
ATOM   460  O O   . ASN A 1 64  ? 2.716   20.617 6.086   1.00 32.33 ? 64   ASN A O   1 
ATOM   461  C CB  . ASN A 1 64  ? 3.720   23.318 7.606   1.00 31.14 ? 64   ASN A CB  1 
ATOM   462  C CG  . ASN A 1 64  ? 5.047   23.718 8.229   1.00 32.17 ? 64   ASN A CG  1 
ATOM   463  O OD1 . ASN A 1 64  ? 6.039   23.925 7.531   1.00 32.66 ? 64   ASN A OD1 1 
ATOM   464  N ND2 . ASN A 1 64  ? 5.067   23.833 9.550   1.00 33.17 ? 64   ASN A ND2 1 
ATOM   465  N N   . LYS A 1 65  ? 1.636   22.441 5.344   1.00 36.06 ? 65   LYS A N   1 
ATOM   466  C CA  . LYS A 1 65  ? 0.437   21.708 4.964   1.00 39.56 ? 65   LYS A CA  1 
ATOM   467  C C   . LYS A 1 65  ? 0.804   20.649 3.926   1.00 40.64 ? 65   LYS A C   1 
ATOM   468  O O   . LYS A 1 65  ? 0.359   19.503 4.008   1.00 39.52 ? 65   LYS A O   1 
ATOM   469  C CB  . LYS A 1 65  ? -0.601  22.672 4.390   1.00 44.10 ? 65   LYS A CB  1 
ATOM   470  C CG  . LYS A 1 65  ? -1.905  22.018 3.967   1.00 49.75 ? 65   LYS A CG  1 
ATOM   471  C CD  . LYS A 1 65  ? -2.883  23.051 3.424   1.00 53.63 ? 65   LYS A CD  1 
ATOM   472  C CE  . LYS A 1 65  ? -3.268  24.068 4.491   1.00 56.62 ? 65   LYS A CE  1 
ATOM   473  N NZ  . LYS A 1 65  ? -4.212  25.100 3.971   1.00 60.54 ? 65   LYS A NZ  1 
ATOM   474  N N   . MET A 1 66  ? 1.617   21.044 2.950   1.00 41.01 ? 66   MET A N   1 
ATOM   475  C CA  . MET A 1 66  ? 2.060   20.132 1.900   1.00 43.07 ? 66   MET A CA  1 
ATOM   476  C C   . MET A 1 66  ? 2.954   19.050 2.494   1.00 42.50 ? 66   MET A C   1 
ATOM   477  O O   . MET A 1 66  ? 2.789   17.864 2.204   1.00 43.90 ? 66   MET A O   1 
ATOM   478  C CB  . MET A 1 66  ? 2.844   20.892 0.827   1.00 47.51 ? 66   MET A CB  1 
ATOM   479  C CG  . MET A 1 66  ? 2.025   21.886 0.015   1.00 56.88 ? 66   MET A CG  1 
ATOM   480  S SD  . MET A 1 66  ? 0.834   21.104 -1.097  1.00 62.17 ? 66   MET A SD  1 
ATOM   481  C CE  . MET A 1 66  ? 1.894   20.669 -2.475  1.00 60.15 ? 66   MET A CE  1 
ATOM   482  N N   . LEU A 1 67  ? 3.900   19.470 3.329   1.00 39.02 ? 67   LEU A N   1 
ATOM   483  C CA  . LEU A 1 67  ? 4.836   18.554 3.970   1.00 36.92 ? 67   LEU A CA  1 
ATOM   484  C C   . LEU A 1 67  ? 4.145   17.463 4.784   1.00 37.82 ? 67   LEU A C   1 
ATOM   485  O O   . LEU A 1 67  ? 4.780   16.478 5.162   1.00 35.13 ? 67   LEU A O   1 
ATOM   486  C CB  . LEU A 1 67  ? 5.812   19.333 4.862   1.00 36.93 ? 67   LEU A CB  1 
ATOM   487  C CG  . LEU A 1 67  ? 6.885   20.146 4.126   1.00 32.65 ? 67   LEU A CG  1 
ATOM   488  C CD1 . LEU A 1 67  ? 7.623   21.040 5.100   1.00 33.62 ? 67   LEU A CD1 1 
ATOM   489  C CD2 . LEU A 1 67  ? 7.852   19.200 3.422   1.00 35.32 ? 67   LEU A CD2 1 
ATOM   490  N N   . LEU A 1 68  ? 2.855   17.636 5.066   1.00 33.80 ? 68   LEU A N   1 
ATOM   491  C CA  . LEU A 1 68  ? 2.117   16.621 5.813   1.00 38.25 ? 68   LEU A CA  1 
ATOM   492  C C   . LEU A 1 68  ? 2.197   15.312 5.037   1.00 37.66 ? 68   LEU A C   1 
ATOM   493  O O   . LEU A 1 68  ? 2.074   14.226 5.599   1.00 37.02 ? 68   LEU A O   1 
ATOM   494  C CB  . LEU A 1 68  ? 0.656   17.033 5.989   1.00 36.65 ? 68   LEU A CB  1 
ATOM   495  C CG  . LEU A 1 68  ? 0.395   18.110 7.045   1.00 38.39 ? 68   LEU A CG  1 
ATOM   496  C CD1 . LEU A 1 68  ? -1.080  18.457 7.069   1.00 38.11 ? 68   LEU A CD1 1 
ATOM   497  C CD2 . LEU A 1 68  ? 0.844   17.603 8.409   1.00 39.72 ? 68   LEU A CD2 1 
ATOM   498  N N   . LYS A 1 69  ? 2.409   15.437 3.732   1.00 40.35 ? 69   LYS A N   1 
ATOM   499  C CA  . LYS A 1 69  ? 2.537   14.287 2.851   1.00 41.53 ? 69   LYS A CA  1 
ATOM   500  C C   . LYS A 1 69  ? 3.770   13.504 3.288   1.00 38.61 ? 69   LYS A C   1 
ATOM   501  O O   . LYS A 1 69  ? 3.737   12.277 3.405   1.00 36.73 ? 69   LYS A O   1 
ATOM   502  C CB  . LYS A 1 69  ? 2.702   14.764 1.406   1.00 43.56 ? 69   LYS A CB  1 
ATOM   503  C CG  . LYS A 1 69  ? 2.819   13.657 0.371   1.00 51.19 ? 69   LYS A CG  1 
ATOM   504  C CD  . LYS A 1 69  ? 3.072   14.250 -1.011  1.00 54.98 ? 69   LYS A CD  1 
ATOM   505  C CE  . LYS A 1 69  ? 3.180   13.173 -2.078  1.00 56.73 ? 69   LYS A CE  1 
ATOM   506  N NZ  . LYS A 1 69  ? 3.435   13.764 -3.421  1.00 59.05 ? 69   LYS A NZ  1 
ATOM   507  N N   . GLN A 1 70  ? 4.859   14.228 3.528   1.00 36.60 ? 70   GLN A N   1 
ATOM   508  C CA  . GLN A 1 70  ? 6.109   13.618 3.962   1.00 37.12 ? 70   GLN A CA  1 
ATOM   509  C C   . GLN A 1 70  ? 5.948   13.069 5.371   1.00 35.48 ? 70   GLN A C   1 
ATOM   510  O O   . GLN A 1 70  ? 6.460   11.998 5.693   1.00 35.15 ? 70   GLN A O   1 
ATOM   511  C CB  . GLN A 1 70  ? 7.241   14.649 3.947   1.00 39.60 ? 70   GLN A CB  1 
ATOM   512  C CG  . GLN A 1 70  ? 7.551   15.228 2.577   1.00 47.21 ? 70   GLN A CG  1 
ATOM   513  C CD  . GLN A 1 70  ? 8.101   14.191 1.617   1.00 51.36 ? 70   GLN A CD  1 
ATOM   514  O OE1 . GLN A 1 70  ? 9.118   13.549 1.892   1.00 51.43 ? 70   GLN A OE1 1 
ATOM   515  N NE2 . GLN A 1 70  ? 7.430   14.022 0.481   1.00 52.00 ? 70   GLN A NE2 1 
ATOM   516  N N   . LEU A 1 71  ? 5.233   13.812 6.210   1.00 32.75 ? 71   LEU A N   1 
ATOM   517  C CA  . LEU A 1 71  ? 5.006   13.397 7.587   1.00 32.80 ? 71   LEU A CA  1 
ATOM   518  C C   . LEU A 1 71  ? 4.253   12.070 7.618   1.00 34.89 ? 71   LEU A C   1 
ATOM   519  O O   . LEU A 1 71  ? 4.664   11.127 8.291   1.00 33.18 ? 71   LEU A O   1 
ATOM   520  C CB  . LEU A 1 71  ? 4.196   14.459 8.340   1.00 36.02 ? 71   LEU A CB  1 
ATOM   521  C CG  . LEU A 1 71  ? 3.981   14.216 9.840   1.00 37.21 ? 71   LEU A CG  1 
ATOM   522  C CD1 . LEU A 1 71  ? 5.299   14.387 10.565  1.00 41.41 ? 71   LEU A CD1 1 
ATOM   523  C CD2 . LEU A 1 71  ? 2.952   15.190 10.396  1.00 43.02 ? 71   LEU A CD2 1 
ATOM   524  N N   . ASN A 1 72  ? 3.153   11.992 6.880   1.00 34.12 ? 72   ASN A N   1 
ATOM   525  C CA  . ASN A 1 72  ? 2.368   10.766 6.866   1.00 38.99 ? 72   ASN A CA  1 
ATOM   526  C C   . ASN A 1 72  ? 3.132   9.582  6.273   1.00 34.93 ? 72   ASN A C   1 
ATOM   527  O O   . ASN A 1 72  ? 2.838   8.431  6.588   1.00 36.37 ? 72   ASN A O   1 
ATOM   528  C CB  . ASN A 1 72  ? 1.048   10.990 6.125   1.00 44.08 ? 72   ASN A CB  1 
ATOM   529  C CG  . ASN A 1 72  ? 0.118   11.930 6.873   1.00 47.74 ? 72   ASN A CG  1 
ATOM   530  O OD1 . ASN A 1 72  ? -0.051  11.816 8.091   1.00 47.57 ? 72   ASN A OD1 1 
ATOM   531  N ND2 . ASN A 1 72  ? -0.498  12.858 6.148   1.00 50.98 ? 72   ASN A ND2 1 
ATOM   532  N N   . ALA A 1 73  ? 4.116   9.869  5.427   1.00 34.88 ? 73   ALA A N   1 
ATOM   533  C CA  . ALA A 1 73  ? 4.929   8.819  4.816   1.00 36.67 ? 73   ALA A CA  1 
ATOM   534  C C   . ALA A 1 73  ? 5.821   8.160  5.872   1.00 37.66 ? 73   ALA A C   1 
ATOM   535  O O   . ALA A 1 73  ? 6.373   7.082  5.648   1.00 37.92 ? 73   ALA A O   1 
ATOM   536  C CB  . ALA A 1 73  ? 5.790   9.403  3.699   1.00 33.45 ? 73   ALA A CB  1 
ATOM   537  N N   . LEU A 1 74  ? 5.953   8.815  7.023   1.00 36.12 ? 74   LEU A N   1 
ATOM   538  C CA  . LEU A 1 74  ? 6.774   8.299  8.116   1.00 34.82 ? 74   LEU A CA  1 
ATOM   539  C C   . LEU A 1 74  ? 5.909   7.742  9.240   1.00 35.24 ? 74   LEU A C   1 
ATOM   540  O O   . LEU A 1 74  ? 6.413   7.414  10.319  1.00 32.18 ? 74   LEU A O   1 
ATOM   541  C CB  . LEU A 1 74  ? 7.658   9.413  8.681   1.00 34.54 ? 74   LEU A CB  1 
ATOM   542  C CG  . LEU A 1 74  ? 8.725   10.024 7.775   1.00 34.63 ? 74   LEU A CG  1 
ATOM   543  C CD1 . LEU A 1 74  ? 9.440   11.141 8.525   1.00 35.86 ? 74   LEU A CD1 1 
ATOM   544  C CD2 . LEU A 1 74  ? 9.713   8.950  7.347   1.00 37.28 ? 74   LEU A CD2 1 
ATOM   545  N N   . GLU A 1 75  ? 4.610   7.634  8.982   1.00 32.36 ? 75   GLU A N   1 
ATOM   546  C CA  . GLU A 1 75  ? 3.662   7.138  9.973   1.00 37.03 ? 75   GLU A CA  1 
ATOM   547  C C   . GLU A 1 75  ? 4.095   5.847  10.665  1.00 36.56 ? 75   GLU A C   1 
ATOM   548  O O   . GLU A 1 75  ? 3.969   5.718  11.881  1.00 33.52 ? 75   GLU A O   1 
ATOM   549  C CB  . GLU A 1 75  ? 2.289   6.929  9.326   1.00 41.21 ? 75   GLU A CB  1 
ATOM   550  C CG  . GLU A 1 75  ? 1.229   6.422  10.285  1.00 51.82 ? 75   GLU A CG  1 
ATOM   551  C CD  . GLU A 1 75  ? -0.119  6.237  9.620   1.00 57.91 ? 75   GLU A CD  1 
ATOM   552  O OE1 . GLU A 1 75  ? -0.202  5.450  8.652   1.00 61.33 ? 75   GLU A OE1 1 
ATOM   553  O OE2 . GLU A 1 75  ? -1.094  6.879  10.066  1.00 62.42 ? 75   GLU A OE2 1 
ATOM   554  N N   . LYS A 1 76  ? 4.594   4.889  9.892   1.00 36.56 ? 76   LYS A N   1 
ATOM   555  C CA  . LYS A 1 76  ? 5.024   3.617  10.463  1.00 37.76 ? 76   LYS A CA  1 
ATOM   556  C C   . LYS A 1 76  ? 6.289   3.765  11.311  1.00 36.70 ? 76   LYS A C   1 
ATOM   557  O O   . LYS A 1 76  ? 6.535   2.961  12.211  1.00 38.22 ? 76   LYS A O   1 
ATOM   558  C CB  . LYS A 1 76  ? 5.262   2.591  9.347   1.00 39.84 ? 76   LYS A CB  1 
ATOM   559  C CG  . LYS A 1 76  ? 4.093   2.448  8.376   1.00 45.77 ? 76   LYS A CG  1 
ATOM   560  C CD  . LYS A 1 76  ? 2.801   2.073  9.086   1.00 50.57 ? 76   LYS A CD  1 
ATOM   561  C CE  . LYS A 1 76  ? 1.637   1.988  8.104   1.00 56.30 ? 76   LYS A CE  1 
ATOM   562  N NZ  . LYS A 1 76  ? 0.345   1.673  8.785   1.00 57.67 ? 76   LYS A NZ  1 
ATOM   563  N N   . GLU A 1 77  ? 7.093   4.786  11.028  1.00 33.54 ? 77   GLU A N   1 
ATOM   564  C CA  . GLU A 1 77  ? 8.315   4.998  11.794  1.00 33.93 ? 77   GLU A CA  1 
ATOM   565  C C   . GLU A 1 77  ? 8.048   5.770  13.082  1.00 32.93 ? 77   GLU A C   1 
ATOM   566  O O   . GLU A 1 77  ? 8.949   5.963  13.890  1.00 33.57 ? 77   GLU A O   1 
ATOM   567  C CB  . GLU A 1 77  ? 9.358   5.760  10.970  1.00 35.69 ? 77   GLU A CB  1 
ATOM   568  C CG  . GLU A 1 77  ? 9.654   5.168  9.610   1.00 38.51 ? 77   GLU A CG  1 
ATOM   569  C CD  . GLU A 1 77  ? 10.971  5.659  9.041   1.00 42.26 ? 77   GLU A CD  1 
ATOM   570  O OE1 . GLU A 1 77  ? 11.378  6.801  9.350   1.00 37.40 ? 77   GLU A OE1 1 
ATOM   571  O OE2 . GLU A 1 77  ? 11.599  4.901  8.273   1.00 46.65 ? 77   GLU A OE2 1 
ATOM   572  N N   . MET A 1 78  ? 6.814   6.220  13.274  1.00 31.93 ? 78   MET A N   1 
ATOM   573  C CA  . MET A 1 78  ? 6.481   6.963  14.483  1.00 29.57 ? 78   MET A CA  1 
ATOM   574  C C   . MET A 1 78  ? 6.264   6.027  15.658  1.00 30.11 ? 78   MET A C   1 
ATOM   575  O O   . MET A 1 78  ? 5.868   4.872  15.481  1.00 28.64 ? 78   MET A O   1 
ATOM   576  C CB  . MET A 1 78  ? 5.204   7.785  14.279  1.00 28.37 ? 78   MET A CB  1 
ATOM   577  C CG  . MET A 1 78  ? 5.331   8.893  13.251  1.00 23.93 ? 78   MET A CG  1 
ATOM   578  S SD  . MET A 1 78  ? 3.758   9.708  12.935  1.00 29.68 ? 78   MET A SD  1 
ATOM   579  C CE  . MET A 1 78  ? 4.280   10.892 11.687  1.00 27.40 ? 78   MET A CE  1 
ATOM   580  N N   . ILE A 1 79  ? 6.543   6.523  16.857  1.00 26.10 ? 79   ILE A N   1 
ATOM   581  C CA  . ILE A 1 79  ? 6.306   5.745  18.064  1.00 26.48 ? 79   ILE A CA  1 
ATOM   582  C C   . ILE A 1 79  ? 4.986   6.323  18.543  1.00 28.61 ? 79   ILE A C   1 
ATOM   583  O O   . ILE A 1 79  ? 4.912   7.498  18.919  1.00 28.72 ? 79   ILE A O   1 
ATOM   584  C CB  . ILE A 1 79  ? 7.402   5.961  19.123  1.00 28.40 ? 79   ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 79  ? 8.762   5.548  18.546  1.00 30.42 ? 79   ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 79  ? 7.071   5.149  20.377  1.00 25.03 ? 79   ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 79  ? 9.917   5.638  19.527  1.00 31.36 ? 79   ILE A CD1 1 
ATOM   588  N N   . VAL A 1 80  ? 3.944   5.498  18.515  1.00 26.05 ? 80   VAL A N   1 
ATOM   589  C CA  . VAL A 1 80  ? 2.604   5.944  18.874  1.00 26.19 ? 80   VAL A CA  1 
ATOM   590  C C   . VAL A 1 80  ? 2.069   5.578  20.248  1.00 27.17 ? 80   VAL A C   1 
ATOM   591  O O   . VAL A 1 80  ? 2.102   4.419  20.662  1.00 28.71 ? 80   VAL A O   1 
ATOM   592  C CB  . VAL A 1 80  ? 1.575   5.450  17.816  1.00 28.97 ? 80   VAL A CB  1 
ATOM   593  C CG1 . VAL A 1 80  ? 0.194   6.010  18.119  1.00 30.45 ? 80   VAL A CG1 1 
ATOM   594  C CG2 . VAL A 1 80  ? 2.021   5.867  16.425  1.00 32.44 ? 80   VAL A CG2 1 
ATOM   595  N N   . TYR A 1 81  ? 1.562   6.591  20.942  1.00 25.22 ? 81   TYR A N   1 
ATOM   596  C CA  . TYR A 1 81  ? 0.956   6.423  22.257  1.00 29.98 ? 81   TYR A CA  1 
ATOM   597  C C   . TYR A 1 81  ? -0.487  6.863  22.074  1.00 28.80 ? 81   TYR A C   1 
ATOM   598  O O   . TYR A 1 81  ? -0.839  8.030  22.254  1.00 32.37 ? 81   TYR A O   1 
ATOM   599  C CB  . TYR A 1 81  ? 1.687   7.279  23.289  1.00 27.62 ? 81   TYR A CB  1 
ATOM   600  C CG  . TYR A 1 81  ? 3.075   6.754  23.569  1.00 27.93 ? 81   TYR A CG  1 
ATOM   601  C CD1 . TYR A 1 81  ? 3.271   5.684  24.442  1.00 29.90 ? 81   TYR A CD1 1 
ATOM   602  C CD2 . TYR A 1 81  ? 4.189   7.299  22.934  1.00 27.31 ? 81   TYR A CD2 1 
ATOM   603  C CE1 . TYR A 1 81  ? 4.545   5.168  24.679  1.00 31.50 ? 81   TYR A CE1 1 
ATOM   604  C CE2 . TYR A 1 81  ? 5.472   6.789  23.162  1.00 30.06 ? 81   TYR A CE2 1 
ATOM   605  C CZ  . TYR A 1 81  ? 5.639   5.725  24.037  1.00 31.02 ? 81   TYR A CZ  1 
ATOM   606  O OH  . TYR A 1 81  ? 6.899   5.229  24.281  1.00 32.91 ? 81   TYR A OH  1 
ATOM   607  N N   . LYS A 1 82  ? -1.306  5.891  21.690  1.00 31.86 ? 82   LYS A N   1 
ATOM   608  C CA  . LYS A 1 82  ? -2.722  6.077  21.400  1.00 34.04 ? 82   LYS A CA  1 
ATOM   609  C C   . LYS A 1 82  ? -3.626  6.391  22.585  1.00 34.17 ? 82   LYS A C   1 
ATOM   610  O O   . LYS A 1 82  ? -3.601  5.698  23.602  1.00 33.16 ? 82   LYS A O   1 
ATOM   611  C CB  . LYS A 1 82  ? -3.242  4.821  20.691  1.00 36.42 ? 82   LYS A CB  1 
ATOM   612  C CG  . LYS A 1 82  ? -4.731  4.821  20.372  1.00 42.19 ? 82   LYS A CG  1 
ATOM   613  C CD  . LYS A 1 82  ? -5.063  5.751  19.219  1.00 46.36 ? 82   LYS A CD  1 
ATOM   614  C CE  . LYS A 1 82  ? -6.500  5.555  18.762  1.00 47.22 ? 82   LYS A CE  1 
ATOM   615  N NZ  . LYS A 1 82  ? -6.840  6.414  17.595  1.00 52.39 ? 82   LYS A NZ  1 
ATOM   616  N N   . ALA A 1 83  ? -4.432  7.439  22.437  1.00 31.20 ? 83   ALA A N   1 
ATOM   617  C CA  . ALA A 1 83  ? -5.381  7.832  23.467  1.00 32.53 ? 83   ALA A CA  1 
ATOM   618  C C   . ALA A 1 83  ? -6.610  6.939  23.298  1.00 35.59 ? 83   ALA A C   1 
ATOM   619  O O   . ALA A 1 83  ? -7.089  6.744  22.182  1.00 34.77 ? 83   ALA A O   1 
ATOM   620  C CB  . ALA A 1 83  ? -5.772  9.285  23.292  1.00 32.36 ? 83   ALA A CB  1 
ATOM   621  N N   . PRO A 1 84  ? -7.124  6.371  24.402  1.00 37.63 ? 84   PRO A N   1 
ATOM   622  C CA  . PRO A 1 84  ? -8.304  5.502  24.327  1.00 39.48 ? 84   PRO A CA  1 
ATOM   623  C C   . PRO A 1 84  ? -9.464  6.202  23.624  1.00 40.04 ? 84   PRO A C   1 
ATOM   624  O O   . PRO A 1 84  ? -10.089 5.640  22.725  1.00 40.75 ? 84   PRO A O   1 
ATOM   625  C CB  . PRO A 1 84  ? -8.603  5.207  25.793  1.00 39.69 ? 84   PRO A CB  1 
ATOM   626  C CG  . PRO A 1 84  ? -7.234  5.205  26.411  1.00 41.59 ? 84   PRO A CG  1 
ATOM   627  C CD  . PRO A 1 84  ? -6.596  6.424  25.777  1.00 37.11 ? 84   PRO A CD  1 
ATOM   628  N N   . GLN A 1 85  ? -9.748  7.429  24.050  1.00 40.98 ? 85   GLN A N   1 
ATOM   629  C CA  . GLN A 1 85  ? -10.814 8.230  23.454  1.00 42.96 ? 85   GLN A CA  1 
ATOM   630  C C   . GLN A 1 85  ? -10.114 9.364  22.710  1.00 41.62 ? 85   GLN A C   1 
ATOM   631  O O   . GLN A 1 85  ? -10.095 10.509 23.166  1.00 41.55 ? 85   GLN A O   1 
ATOM   632  C CB  . GLN A 1 85  ? -11.723 8.811  24.542  1.00 45.60 ? 85   GLN A CB  1 
ATOM   633  C CG  . GLN A 1 85  ? -12.167 7.808  25.601  1.00 52.11 ? 85   GLN A CG  1 
ATOM   634  C CD  . GLN A 1 85  ? -12.885 6.612  25.015  1.00 54.14 ? 85   GLN A CD  1 
ATOM   635  O OE1 . GLN A 1 85  ? -13.902 6.754  24.335  1.00 55.18 ? 85   GLN A OE1 1 
ATOM   636  N NE2 . GLN A 1 85  ? -12.360 5.421  25.279  1.00 56.43 ? 85   GLN A NE2 1 
ATOM   637  N N   . GLU A 1 86  ? -9.537  9.032  21.560  1.00 41.45 ? 86   GLU A N   1 
ATOM   638  C CA  . GLU A 1 86  ? -8.793  9.995  20.755  1.00 39.96 ? 86   GLU A CA  1 
ATOM   639  C C   . GLU A 1 86  ? -9.583  11.186 20.210  1.00 39.77 ? 86   GLU A C   1 
ATOM   640  O O   . GLU A 1 86  ? -10.444 11.034 19.343  1.00 40.37 ? 86   GLU A O   1 
ATOM   641  C CB  . GLU A 1 86  ? -8.110  9.259  19.606  1.00 39.60 ? 86   GLU A CB  1 
ATOM   642  C CG  . GLU A 1 86  ? -7.310  10.150 18.682  1.00 39.52 ? 86   GLU A CG  1 
ATOM   643  C CD  . GLU A 1 86  ? -6.669  9.370  17.558  1.00 40.54 ? 86   GLU A CD  1 
ATOM   644  O OE1 . GLU A 1 86  ? -5.623  8.729  17.795  1.00 34.94 ? 86   GLU A OE1 1 
ATOM   645  O OE2 . GLU A 1 86  ? -7.223  9.385  16.439  1.00 43.99 ? 86   GLU A OE2 1 
ATOM   646  N N   . LYS A 1 87  ? -9.268  12.377 20.716  1.00 37.07 ? 87   LYS A N   1 
ATOM   647  C CA  . LYS A 1 87  ? -9.931  13.601 20.277  1.00 38.25 ? 87   LYS A CA  1 
ATOM   648  C C   . LYS A 1 87  ? -8.976  14.494 19.483  1.00 37.54 ? 87   LYS A C   1 
ATOM   649  O O   . LYS A 1 87  ? -9.401  15.280 18.635  1.00 33.58 ? 87   LYS A O   1 
ATOM   650  C CB  . LYS A 1 87  ? -10.468 14.374 21.485  1.00 41.58 ? 87   LYS A CB  1 
ATOM   651  C CG  . LYS A 1 87  ? -11.505 13.609 22.298  1.00 46.64 ? 87   LYS A CG  1 
ATOM   652  C CD  . LYS A 1 87  ? -12.690 13.199 21.432  1.00 51.18 ? 87   LYS A CD  1 
ATOM   653  C CE  . LYS A 1 87  ? -13.753 12.469 22.237  1.00 52.76 ? 87   LYS A CE  1 
ATOM   654  N NZ  . LYS A 1 87  ? -14.921 12.107 21.382  1.00 56.76 ? 87   LYS A NZ  1 
ATOM   655  N N   . HIS A 1 88  ? -7.684  14.358 19.770  1.00 34.45 ? 88   HIS A N   1 
ATOM   656  C CA  . HIS A 1 88  ? -6.639  15.135 19.109  1.00 31.17 ? 88   HIS A CA  1 
ATOM   657  C C   . HIS A 1 88  ? -5.474  14.219 18.767  1.00 31.20 ? 88   HIS A C   1 
ATOM   658  O O   . HIS A 1 88  ? -5.184  13.270 19.494  1.00 28.83 ? 88   HIS A O   1 
ATOM   659  C CB  . HIS A 1 88  ? -6.106  16.229 20.039  1.00 31.56 ? 88   HIS A CB  1 
ATOM   660  C CG  . HIS A 1 88  ? -7.068  17.344 20.293  1.00 35.90 ? 88   HIS A CG  1 
ATOM   661  N ND1 . HIS A 1 88  ? -7.385  18.285 19.338  1.00 34.00 ? 88   HIS A ND1 1 
ATOM   662  C CD2 . HIS A 1 88  ? -7.769  17.681 21.401  1.00 35.73 ? 88   HIS A CD2 1 
ATOM   663  C CE1 . HIS A 1 88  ? -8.239  19.154 19.848  1.00 37.03 ? 88   HIS A CE1 1 
ATOM   664  N NE2 . HIS A 1 88  ? -8.487  18.810 21.098  1.00 35.90 ? 88   HIS A NE2 1 
ATOM   665  N N   . VAL A 1 89  ? -4.804  14.508 17.661  1.00 29.74 ? 89   VAL A N   1 
ATOM   666  C CA  . VAL A 1 89  ? -3.648  13.726 17.260  1.00 28.39 ? 89   VAL A CA  1 
ATOM   667  C C   . VAL A 1 89  ? -2.538  14.725 16.966  1.00 27.50 ? 89   VAL A C   1 
ATOM   668  O O   . VAL A 1 89  ? -2.674  15.569 16.078  1.00 28.05 ? 89   VAL A O   1 
ATOM   669  C CB  . VAL A 1 89  ? -3.919  12.882 15.990  1.00 32.45 ? 89   VAL A CB  1 
ATOM   670  C CG1 . VAL A 1 89  ? -2.641  12.172 15.557  1.00 32.60 ? 89   VAL A CG1 1 
ATOM   671  C CG2 . VAL A 1 89  ? -5.017  11.858 16.260  1.00 30.75 ? 89   VAL A CG2 1 
ATOM   672  N N   . ILE A 1 90  ? -1.458  14.646 17.733  1.00 25.29 ? 90   ILE A N   1 
ATOM   673  C CA  . ILE A 1 90  ? -0.327  15.539 17.530  1.00 23.91 ? 90   ILE A CA  1 
ATOM   674  C C   . ILE A 1 90  ? 0.931   14.721 17.267  1.00 23.97 ? 90   ILE A C   1 
ATOM   675  O O   . ILE A 1 90  ? 1.057   13.585 17.728  1.00 22.84 ? 90   ILE A O   1 
ATOM   676  C CB  . ILE A 1 90  ? -0.093  16.455 18.764  1.00 25.08 ? 90   ILE A CB  1 
ATOM   677  C CG1 . ILE A 1 90  ? 0.241   15.618 20.003  1.00 27.10 ? 90   ILE A CG1 1 
ATOM   678  C CG2 . ILE A 1 90  ? -1.340  17.298 19.027  1.00 26.24 ? 90   ILE A CG2 1 
ATOM   679  C CD1 . ILE A 1 90  ? 0.549   16.455 21.250  1.00 22.63 ? 90   ILE A CD1 1 
ATOM   680  N N   . THR A 1 91  ? 1.852   15.295 16.502  1.00 23.26 ? 91   THR A N   1 
ATOM   681  C CA  . THR A 1 91  ? 3.104   14.627 16.185  1.00 21.15 ? 91   THR A CA  1 
ATOM   682  C C   . THR A 1 91  ? 4.163   15.455 16.885  1.00 25.51 ? 91   THR A C   1 
ATOM   683  O O   . THR A 1 91  ? 4.230   16.669 16.702  1.00 25.50 ? 91   THR A O   1 
ATOM   684  C CB  . THR A 1 91  ? 3.351   14.601 14.669  1.00 24.70 ? 91   THR A CB  1 
ATOM   685  O OG1 . THR A 1 91  ? 2.251   13.943 14.027  1.00 24.07 ? 91   THR A OG1 1 
ATOM   686  C CG2 . THR A 1 91  ? 4.646   13.850 14.348  1.00 21.15 ? 91   THR A CG2 1 
ATOM   687  N N   . VAL A 1 92  ? 4.972   14.803 17.711  1.00 23.30 ? 92   VAL A N   1 
ATOM   688  C CA  . VAL A 1 92  ? 5.988   15.514 18.469  1.00 20.01 ? 92   VAL A CA  1 
ATOM   689  C C   . VAL A 1 92  ? 7.412   15.133 18.119  1.00 22.37 ? 92   VAL A C   1 
ATOM   690  O O   . VAL A 1 92  ? 7.775   13.952 18.138  1.00 19.01 ? 92   VAL A O   1 
ATOM   691  C CB  . VAL A 1 92  ? 5.797   15.288 19.996  1.00 20.98 ? 92   VAL A CB  1 
ATOM   692  C CG1 . VAL A 1 92  ? 6.901   16.008 20.788  1.00 16.67 ? 92   VAL A CG1 1 
ATOM   693  C CG2 . VAL A 1 92  ? 4.412   15.772 20.430  1.00 20.12 ? 92   VAL A CG2 1 
ATOM   694  N N   . PHE A 1 93  ? 8.215   16.139 17.784  1.00 19.96 ? 93   PHE A N   1 
ATOM   695  C CA  . PHE A 1 93  ? 9.617   15.904 17.498  1.00 20.10 ? 93   PHE A CA  1 
ATOM   696  C C   . PHE A 1 93  ? 10.250  15.977 18.876  1.00 22.35 ? 93   PHE A C   1 
ATOM   697  O O   . PHE A 1 93  ? 10.179  17.008 19.558  1.00 20.99 ? 93   PHE A O   1 
ATOM   698  C CB  . PHE A 1 93  ? 10.183  16.977 16.564  1.00 20.76 ? 93   PHE A CB  1 
ATOM   699  C CG  . PHE A 1 93  ? 9.720   16.836 15.144  1.00 22.33 ? 93   PHE A CG  1 
ATOM   700  C CD1 . PHE A 1 93  ? 8.497   17.366 14.737  1.00 25.92 ? 93   PHE A CD1 1 
ATOM   701  C CD2 . PHE A 1 93  ? 10.489  16.138 14.216  1.00 22.96 ? 93   PHE A CD2 1 
ATOM   702  C CE1 . PHE A 1 93  ? 8.048   17.201 13.424  1.00 28.36 ? 93   PHE A CE1 1 
ATOM   703  C CE2 . PHE A 1 93  ? 10.048  15.971 12.905  1.00 25.58 ? 93   PHE A CE2 1 
ATOM   704  C CZ  . PHE A 1 93  ? 8.825   16.503 12.508  1.00 24.42 ? 93   PHE A CZ  1 
ATOM   705  N N   . THR A 1 94  ? 10.850  14.869 19.292  1.00 19.19 ? 94   THR A N   1 
ATOM   706  C CA  . THR A 1 94  ? 11.434  14.771 20.617  1.00 18.32 ? 94   THR A CA  1 
ATOM   707  C C   . THR A 1 94  ? 12.908  14.361 20.586  1.00 22.22 ? 94   THR A C   1 
ATOM   708  O O   . THR A 1 94  ? 13.402  13.872 19.573  1.00 21.90 ? 94   THR A O   1 
ATOM   709  C CB  . THR A 1 94  ? 10.612  13.766 21.466  1.00 20.85 ? 94   THR A CB  1 
ATOM   710  O OG1 . THR A 1 94  ? 11.028  13.829 22.832  1.00 25.46 ? 94   THR A OG1 1 
ATOM   711  C CG2 . THR A 1 94  ? 10.796  12.327 20.934  1.00 18.57 ? 94   THR A CG2 1 
ATOM   712  N N   . ASP A 1 95  ? 13.598  14.589 21.702  1.00 21.79 ? 95   ASP A N   1 
ATOM   713  C CA  . ASP A 1 95  ? 15.020  14.263 21.853  1.00 23.79 ? 95   ASP A CA  1 
ATOM   714  C C   . ASP A 1 95  ? 15.123  13.572 23.216  1.00 24.54 ? 95   ASP A C   1 
ATOM   715  O O   . ASP A 1 95  ? 14.785  14.162 24.243  1.00 22.13 ? 95   ASP A O   1 
ATOM   716  C CB  . ASP A 1 95  ? 15.847  15.563 21.838  1.00 21.48 ? 95   ASP A CB  1 
ATOM   717  C CG  . ASP A 1 95  ? 17.358  15.328 21.872  1.00 22.53 ? 95   ASP A CG  1 
ATOM   718  O OD1 . ASP A 1 95  ? 17.808  14.255 22.317  1.00 22.84 ? 95   ASP A OD1 1 
ATOM   719  O OD2 . ASP A 1 95  ? 18.102  16.247 21.469  1.00 22.31 ? 95   ASP A OD2 1 
ATOM   720  N N   . ILE A 1 96  ? 15.562  12.316 23.236  1.00 24.85 ? 96   ILE A N   1 
ATOM   721  C CA  . ILE A 1 96  ? 15.664  11.600 24.506  1.00 24.91 ? 96   ILE A CA  1 
ATOM   722  C C   . ILE A 1 96  ? 16.675  12.235 25.479  1.00 24.33 ? 96   ILE A C   1 
ATOM   723  O O   . ILE A 1 96  ? 16.717  11.875 26.653  1.00 23.29 ? 96   ILE A O   1 
ATOM   724  C CB  . ILE A 1 96  ? 16.008  10.094 24.278  1.00 30.10 ? 96   ILE A CB  1 
ATOM   725  C CG1 . ILE A 1 96  ? 17.323  9.955  23.503  1.00 25.20 ? 96   ILE A CG1 1 
ATOM   726  C CG2 . ILE A 1 96  ? 14.874  9.407  23.515  1.00 27.79 ? 96   ILE A CG2 1 
ATOM   727  C CD1 . ILE A 1 96  ? 18.550  9.996  24.384  1.00 32.26 ? 96   ILE A CD1 1 
ATOM   728  N N   . THR A 1 97  ? 17.473  13.185 24.997  1.00 24.62 ? 97   THR A N   1 
ATOM   729  C CA  . THR A 1 97  ? 18.459  13.863 25.848  1.00 24.98 ? 97   THR A CA  1 
ATOM   730  C C   . THR A 1 97  ? 17.942  15.227 26.323  1.00 25.73 ? 97   THR A C   1 
ATOM   731  O O   . THR A 1 97  ? 18.688  16.017 26.907  1.00 24.36 ? 97   THR A O   1 
ATOM   732  C CB  . THR A 1 97  ? 19.790  14.113 25.101  1.00 24.82 ? 97   THR A CB  1 
ATOM   733  O OG1 . THR A 1 97  ? 19.578  15.056 24.042  1.00 21.75 ? 97   THR A OG1 1 
ATOM   734  C CG2 . THR A 1 97  ? 20.333  12.819 24.520  1.00 24.17 ? 97   THR A CG2 1 
ATOM   735  N N   . CYS A 1 98  ? 16.666  15.494 26.065  1.00 23.43 ? 98   CYS A N   1 
ATOM   736  C CA  . CYS A 1 98  ? 16.040  16.760 26.440  1.00 25.33 ? 98   CYS A CA  1 
ATOM   737  C C   . CYS A 1 98  ? 15.157  16.639 27.701  1.00 26.11 ? 98   CYS A C   1 
ATOM   738  O O   . CYS A 1 98  ? 14.268  15.784 27.789  1.00 24.64 ? 98   CYS A O   1 
ATOM   739  C CB  . CYS A 1 98  ? 15.281  17.292 25.208  1.00 25.49 ? 98   CYS A CB  1 
ATOM   740  S SG  . CYS A 1 98  ? 13.656  18.063 25.425  1.00 25.92 ? 98   CYS A SG  1 
ATOM   741  N N   . GLY A 1 99  ? 15.444  17.488 28.687  1.00 23.42 ? 99   GLY A N   1 
ATOM   742  C CA  . GLY A 1 99  ? 14.715  17.473 29.948  1.00 24.52 ? 99   GLY A CA  1 
ATOM   743  C C   . GLY A 1 99  ? 13.221  17.710 29.840  1.00 25.07 ? 99   GLY A C   1 
ATOM   744  O O   . GLY A 1 99  ? 12.430  17.048 30.515  1.00 27.14 ? 99   GLY A O   1 
ATOM   745  N N   . TYR A 1 100 ? 12.829  18.666 29.007  1.00 23.39 ? 100  TYR A N   1 
ATOM   746  C CA  . TYR A 1 100 ? 11.413  18.968 28.811  1.00 25.48 ? 100  TYR A CA  1 
ATOM   747  C C   . TYR A 1 100 ? 10.708  17.813 28.111  1.00 24.77 ? 100  TYR A C   1 
ATOM   748  O O   . TYR A 1 100 ? 9.520   17.562 28.328  1.00 24.89 ? 100  TYR A O   1 
ATOM   749  C CB  . TYR A 1 100 ? 11.266  20.244 27.983  1.00 26.78 ? 100  TYR A CB  1 
ATOM   750  C CG  . TYR A 1 100 ? 11.294  21.494 28.824  1.00 31.01 ? 100  TYR A CG  1 
ATOM   751  C CD1 . TYR A 1 100 ? 10.212  21.826 29.638  1.00 31.89 ? 100  TYR A CD1 1 
ATOM   752  C CD2 . TYR A 1 100 ? 12.405  22.335 28.826  1.00 31.77 ? 100  TYR A CD2 1 
ATOM   753  C CE1 . TYR A 1 100 ? 10.234  22.965 30.434  1.00 35.55 ? 100  TYR A CE1 1 
ATOM   754  C CE2 . TYR A 1 100 ? 12.437  23.480 29.623  1.00 35.10 ? 100  TYR A CE2 1 
ATOM   755  C CZ  . TYR A 1 100 ? 11.346  23.785 30.424  1.00 36.56 ? 100  TYR A CZ  1 
ATOM   756  O OH  . TYR A 1 100 ? 11.369  24.899 31.233  1.00 42.17 ? 100  TYR A OH  1 
ATOM   757  N N   . CYS A 1 101 ? 11.448  17.117 27.259  1.00 25.36 ? 101  CYS A N   1 
ATOM   758  C CA  . CYS A 1 101 ? 10.899  15.980 26.530  1.00 23.37 ? 101  CYS A CA  1 
ATOM   759  C C   . CYS A 1 101 ? 10.638  14.849 27.524  1.00 23.37 ? 101  CYS A C   1 
ATOM   760  O O   . CYS A 1 101 ? 9.665   14.106 27.395  1.00 23.61 ? 101  CYS A O   1 
ATOM   761  C CB  . CYS A 1 101 ? 11.891  15.539 25.452  1.00 26.41 ? 101  CYS A CB  1 
ATOM   762  S SG  . CYS A 1 101 ? 12.404  16.871 24.306  1.00 27.31 ? 101  CYS A SG  1 
ATOM   763  N N   . HIS A 1 102 ? 11.504  14.733 28.524  1.00 24.39 ? 102  HIS A N   1 
ATOM   764  C CA  . HIS A 1 102 ? 11.351  13.710 29.546  1.00 25.71 ? 102  HIS A CA  1 
ATOM   765  C C   . HIS A 1 102 ? 10.125  14.018 30.397  1.00 26.87 ? 102  HIS A C   1 
ATOM   766  O O   . HIS A 1 102 ? 9.357   13.123 30.754  1.00 23.60 ? 102  HIS A O   1 
ATOM   767  C CB  . HIS A 1 102 ? 12.581  13.666 30.450  1.00 28.77 ? 102  HIS A CB  1 
ATOM   768  C CG  . HIS A 1 102 ? 12.476  12.660 31.551  1.00 26.98 ? 102  HIS A CG  1 
ATOM   769  N ND1 . HIS A 1 102 ? 12.866  11.348 31.399  1.00 30.48 ? 102  HIS A ND1 1 
ATOM   770  C CD2 . HIS A 1 102 ? 11.964  12.758 32.800  1.00 30.67 ? 102  HIS A CD2 1 
ATOM   771  C CE1 . HIS A 1 102 ? 12.597  10.679 32.506  1.00 28.80 ? 102  HIS A CE1 1 
ATOM   772  N NE2 . HIS A 1 102 ? 12.048  11.511 33.372  1.00 32.79 ? 102  HIS A NE2 1 
ATOM   773  N N   . LYS A 1 103 ? 9.959   15.296 30.726  1.00 25.17 ? 103  LYS A N   1 
ATOM   774  C CA  . LYS A 1 103 ? 8.840   15.749 31.535  1.00 29.16 ? 103  LYS A CA  1 
ATOM   775  C C   . LYS A 1 103 ? 7.522   15.522 30.801  1.00 28.42 ? 103  LYS A C   1 
ATOM   776  O O   . LYS A 1 103 ? 6.500   15.228 31.420  1.00 26.85 ? 103  LYS A O   1 
ATOM   777  C CB  . LYS A 1 103 ? 9.010   17.234 31.869  1.00 28.44 ? 103  LYS A CB  1 
ATOM   778  C CG  . LYS A 1 103 ? 7.988   17.779 32.849  1.00 33.91 ? 103  LYS A CG  1 
ATOM   779  C CD  . LYS A 1 103 ? 8.543   18.986 33.603  1.00 36.64 ? 103  LYS A CD  1 
ATOM   780  C CE  . LYS A 1 103 ? 9.697   18.573 34.517  1.00 40.03 ? 103  LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 103 ? 10.329  19.718 35.237  1.00 41.80 ? 103  LYS A NZ  1 
ATOM   782  N N   . LEU A 1 104 ? 7.549   15.664 29.480  1.00 27.97 ? 104  LEU A N   1 
ATOM   783  C CA  . LEU A 1 104 ? 6.351   15.451 28.680  1.00 23.85 ? 104  LEU A CA  1 
ATOM   784  C C   . LEU A 1 104 ? 6.049   13.956 28.672  1.00 25.08 ? 104  LEU A C   1 
ATOM   785  O O   . LEU A 1 104 ? 4.933   13.535 28.979  1.00 25.83 ? 104  LEU A O   1 
ATOM   786  C CB  . LEU A 1 104 ? 6.566   15.952 27.244  1.00 23.50 ? 104  LEU A CB  1 
ATOM   787  C CG  . LEU A 1 104 ? 5.372   15.862 26.280  1.00 25.02 ? 104  LEU A CG  1 
ATOM   788  C CD1 . LEU A 1 104 ? 5.593   16.817 25.104  1.00 29.99 ? 104  LEU A CD1 1 
ATOM   789  C CD2 . LEU A 1 104 ? 5.185   14.429 25.784  1.00 26.25 ? 104  LEU A CD2 1 
ATOM   790  N N   . HIS A 1 105 ? 7.055   13.152 28.348  1.00 23.79 ? 105  HIS A N   1 
ATOM   791  C CA  . HIS A 1 105 ? 6.859   11.709 28.287  1.00 24.48 ? 105  HIS A CA  1 
ATOM   792  C C   . HIS A 1 105 ? 6.384   11.091 29.595  1.00 28.23 ? 105  HIS A C   1 
ATOM   793  O O   . HIS A 1 105 ? 5.572   10.162 29.589  1.00 26.90 ? 105  HIS A O   1 
ATOM   794  C CB  . HIS A 1 105 ? 8.138   11.001 27.844  1.00 23.80 ? 105  HIS A CB  1 
ATOM   795  C CG  . HIS A 1 105 ? 7.906   9.582  27.433  1.00 25.14 ? 105  HIS A CG  1 
ATOM   796  N ND1 . HIS A 1 105 ? 7.074   9.244  26.386  1.00 25.15 ? 105  HIS A ND1 1 
ATOM   797  C CD2 . HIS A 1 105 ? 8.330   8.413  27.968  1.00 26.92 ? 105  HIS A CD2 1 
ATOM   798  C CE1 . HIS A 1 105 ? 6.993   7.929  26.298  1.00 27.62 ? 105  HIS A CE1 1 
ATOM   799  N NE2 . HIS A 1 105 ? 7.746   7.401  27.246  1.00 26.22 ? 105  HIS A NE2 1 
ATOM   800  N N   . GLU A 1 106 ? 6.897   11.600 30.711  1.00 26.46 ? 106  GLU A N   1 
ATOM   801  C CA  . GLU A 1 106 ? 6.528   11.095 32.028  1.00 30.98 ? 106  GLU A CA  1 
ATOM   802  C C   . GLU A 1 106 ? 5.032   11.271 32.289  1.00 32.11 ? 106  GLU A C   1 
ATOM   803  O O   . GLU A 1 106 ? 4.448   10.574 33.124  1.00 27.48 ? 106  GLU A O   1 
ATOM   804  C CB  . GLU A 1 106 ? 7.342   11.822 33.104  1.00 37.36 ? 106  GLU A CB  1 
ATOM   805  C CG  . GLU A 1 106 ? 7.169   11.284 34.511  1.00 46.62 ? 106  GLU A CG  1 
ATOM   806  C CD  . GLU A 1 106 ? 8.081   11.981 35.508  1.00 50.34 ? 106  GLU A CD  1 
ATOM   807  O OE1 . GLU A 1 106 ? 9.314   11.943 35.317  1.00 54.31 ? 106  GLU A OE1 1 
ATOM   808  O OE2 . GLU A 1 106 ? 7.565   12.566 36.483  1.00 55.31 ? 106  GLU A OE2 1 
ATOM   809  N N   . GLN A 1 107 ? 4.413   12.202 31.570  1.00 29.16 ? 107  GLN A N   1 
ATOM   810  C CA  . GLN A 1 107 ? 2.986   12.461 31.733  1.00 30.39 ? 107  GLN A CA  1 
ATOM   811  C C   . GLN A 1 107 ? 2.181   11.941 30.544  1.00 27.97 ? 107  GLN A C   1 
ATOM   812  O O   . GLN A 1 107 ? 1.042   12.351 30.341  1.00 29.10 ? 107  GLN A O   1 
ATOM   813  C CB  . GLN A 1 107 ? 2.736   13.967 31.893  1.00 30.28 ? 107  GLN A CB  1 
ATOM   814  C CG  . GLN A 1 107 ? 3.487   14.600 33.064  1.00 33.73 ? 107  GLN A CG  1 
ATOM   815  C CD  . GLN A 1 107 ? 3.358   16.110 33.100  1.00 37.15 ? 107  GLN A CD  1 
ATOM   816  O OE1 . GLN A 1 107 ? 2.467   16.656 33.750  1.00 36.77 ? 107  GLN A OE1 1 
ATOM   817  N NE2 . GLN A 1 107 ? 4.247   16.796 32.386  1.00 37.11 ? 107  GLN A NE2 1 
ATOM   818  N N   . MET A 1 108 ? 2.764   11.032 29.769  1.00 27.46 ? 108  MET A N   1 
ATOM   819  C CA  . MET A 1 108 ? 2.075   10.495 28.597  1.00 27.85 ? 108  MET A CA  1 
ATOM   820  C C   . MET A 1 108 ? 0.671   9.983  28.919  1.00 28.42 ? 108  MET A C   1 
ATOM   821  O O   . MET A 1 108 ? -0.283  10.306 28.215  1.00 28.00 ? 108  MET A O   1 
ATOM   822  C CB  . MET A 1 108 ? 2.894   9.373  27.952  1.00 25.66 ? 108  MET A CB  1 
ATOM   823  C CG  . MET A 1 108 ? 2.330   8.896  26.609  1.00 23.91 ? 108  MET A CG  1 
ATOM   824  S SD  . MET A 1 108 ? 2.142   10.248 25.406  1.00 25.70 ? 108  MET A SD  1 
ATOM   825  C CE  . MET A 1 108 ? 3.854   10.456 24.901  1.00 26.83 ? 108  MET A CE  1 
ATOM   826  N N   . ALA A 1 109 ? 0.545   9.189  29.979  1.00 29.57 ? 109  ALA A N   1 
ATOM   827  C CA  . ALA A 1 109 ? -0.756  8.648  30.372  1.00 30.86 ? 109  ALA A CA  1 
ATOM   828  C C   . ALA A 1 109 ? -1.783  9.764  30.594  1.00 31.01 ? 109  ALA A C   1 
ATOM   829  O O   . ALA A 1 109 ? -2.976  9.581  30.344  1.00 31.92 ? 109  ALA A O   1 
ATOM   830  C CB  . ALA A 1 109 ? -0.615  7.806  31.639  1.00 33.16 ? 109  ALA A CB  1 
ATOM   831  N N   . ASP A 1 110 ? -1.318  10.917 31.063  1.00 31.86 ? 110  ASP A N   1 
ATOM   832  C CA  . ASP A 1 110 ? -2.206  12.053 31.296  1.00 33.74 ? 110  ASP A CA  1 
ATOM   833  C C   . ASP A 1 110 ? -2.670  12.690 29.981  1.00 34.49 ? 110  ASP A C   1 
ATOM   834  O O   . ASP A 1 110 ? -3.830  13.096 29.858  1.00 31.39 ? 110  ASP A O   1 
ATOM   835  C CB  . ASP A 1 110 ? -1.512  13.091 32.182  1.00 39.14 ? 110  ASP A CB  1 
ATOM   836  C CG  . ASP A 1 110 ? -1.512  12.694 33.650  1.00 43.95 ? 110  ASP A CG  1 
ATOM   837  O OD1 . ASP A 1 110 ? -1.218  11.519 33.950  1.00 48.47 ? 110  ASP A OD1 1 
ATOM   838  O OD2 . ASP A 1 110 ? -1.803  13.557 34.504  1.00 46.66 ? 110  ASP A OD2 1 
ATOM   839  N N   . TYR A 1 111 ? -1.767  12.789 29.008  1.00 31.44 ? 111  TYR A N   1 
ATOM   840  C CA  . TYR A 1 111 ? -2.129  13.342 27.703  1.00 30.35 ? 111  TYR A CA  1 
ATOM   841  C C   . TYR A 1 111 ? -3.155  12.394 27.076  1.00 29.45 ? 111  TYR A C   1 
ATOM   842  O O   . TYR A 1 111 ? -4.173  12.826 26.531  1.00 30.84 ? 111  TYR A O   1 
ATOM   843  C CB  . TYR A 1 111 ? -0.899  13.430 26.785  1.00 28.01 ? 111  TYR A CB  1 
ATOM   844  C CG  . TYR A 1 111 ? 0.102   14.506 27.161  1.00 24.82 ? 111  TYR A CG  1 
ATOM   845  C CD1 . TYR A 1 111 ? -0.155  15.855 26.903  1.00 26.38 ? 111  TYR A CD1 1 
ATOM   846  C CD2 . TYR A 1 111 ? 1.304   14.174 27.774  1.00 24.52 ? 111  TYR A CD2 1 
ATOM   847  C CE1 . TYR A 1 111 ? 0.774   16.847 27.248  1.00 25.93 ? 111  TYR A CE1 1 
ATOM   848  C CE2 . TYR A 1 111 ? 2.236   15.154 28.125  1.00 24.77 ? 111  TYR A CE2 1 
ATOM   849  C CZ  . TYR A 1 111 ? 1.968   16.481 27.861  1.00 25.68 ? 111  TYR A CZ  1 
ATOM   850  O OH  . TYR A 1 111 ? 2.905   17.435 28.208  1.00 26.46 ? 111  TYR A OH  1 
ATOM   851  N N   . ASN A 1 112 ? -2.870  11.097 27.160  1.00 29.42 ? 112  ASN A N   1 
ATOM   852  C CA  . ASN A 1 112 ? -3.744  10.062 26.614  1.00 30.61 ? 112  ASN A CA  1 
ATOM   853  C C   . ASN A 1 112 ? -5.120  10.096 27.286  1.00 33.89 ? 112  ASN A C   1 
ATOM   854  O O   . ASN A 1 112 ? -6.147  9.916  26.629  1.00 31.88 ? 112  ASN A O   1 
ATOM   855  C CB  . ASN A 1 112 ? -3.114  8.678  26.820  1.00 30.43 ? 112  ASN A CB  1 
ATOM   856  C CG  . ASN A 1 112 ? -1.893  8.441  25.937  1.00 30.40 ? 112  ASN A CG  1 
ATOM   857  O OD1 . ASN A 1 112 ? -1.100  7.535  26.193  1.00 31.85 ? 112  ASN A OD1 1 
ATOM   858  N ND2 . ASN A 1 112 ? -1.749  9.240  24.886  1.00 31.08 ? 112  ASN A ND2 1 
ATOM   859  N N   . ALA A 1 113 ? -5.128  10.324 28.597  1.00 32.98 ? 113  ALA A N   1 
ATOM   860  C CA  . ALA A 1 113 ? -6.366  10.384 29.362  1.00 34.65 ? 113  ALA A CA  1 
ATOM   861  C C   . ALA A 1 113 ? -7.199  11.588 28.942  1.00 33.86 ? 113  ALA A C   1 
ATOM   862  O O   . ALA A 1 113 ? -8.424  11.573 29.063  1.00 36.59 ? 113  ALA A O   1 
ATOM   863  C CB  . ALA A 1 113 ? -6.059  10.449 30.859  1.00 33.78 ? 113  ALA A CB  1 
ATOM   864  N N   . LEU A 1 114 ? -6.536  12.630 28.451  1.00 32.25 ? 114  LEU A N   1 
ATOM   865  C CA  . LEU A 1 114 ? -7.242  13.828 28.002  1.00 32.70 ? 114  LEU A CA  1 
ATOM   866  C C   . LEU A 1 114 ? -7.615  13.728 26.526  1.00 31.10 ? 114  LEU A C   1 
ATOM   867  O O   . LEU A 1 114 ? -7.964  14.726 25.898  1.00 33.83 ? 114  LEU A O   1 
ATOM   868  C CB  . LEU A 1 114 ? -6.396  15.084 28.240  1.00 32.02 ? 114  LEU A CB  1 
ATOM   869  C CG  . LEU A 1 114 ? -6.179  15.461 29.711  1.00 35.88 ? 114  LEU A CG  1 
ATOM   870  C CD1 . LEU A 1 114 ? -5.405  16.764 29.807  1.00 36.00 ? 114  LEU A CD1 1 
ATOM   871  C CD2 . LEU A 1 114 ? -7.527  15.597 30.406  1.00 38.96 ? 114  LEU A CD2 1 
ATOM   872  N N   . GLY A 1 115 ? -7.529  12.520 25.978  1.00 29.93 ? 115  GLY A N   1 
ATOM   873  C CA  . GLY A 1 115 ? -7.884  12.301 24.585  1.00 30.56 ? 115  GLY A CA  1 
ATOM   874  C C   . GLY A 1 115 ? -6.837  12.686 23.555  1.00 32.83 ? 115  GLY A C   1 
ATOM   875  O O   . GLY A 1 115 ? -7.137  12.767 22.361  1.00 29.25 ? 115  GLY A O   1 
ATOM   876  N N   . ILE A 1 116 ? -5.607  12.915 24.001  1.00 30.34 ? 116  ILE A N   1 
ATOM   877  C CA  . ILE A 1 116 ? -4.540  13.299 23.081  1.00 28.13 ? 116  ILE A CA  1 
ATOM   878  C C   . ILE A 1 116 ? -3.618  12.145 22.713  1.00 28.72 ? 116  ILE A C   1 
ATOM   879  O O   . ILE A 1 116 ? -2.945  11.570 23.575  1.00 28.59 ? 116  ILE A O   1 
ATOM   880  C CB  . ILE A 1 116 ? -3.666  14.416 23.675  1.00 26.93 ? 116  ILE A CB  1 
ATOM   881  C CG1 . ILE A 1 116 ? -4.535  15.625 24.027  1.00 25.24 ? 116  ILE A CG1 1 
ATOM   882  C CG2 . ILE A 1 116 ? -2.571  14.810 22.674  1.00 28.30 ? 116  ILE A CG2 1 
ATOM   883  C CD1 . ILE A 1 116 ? -3.820  16.670 24.848  1.00 28.47 ? 116  ILE A CD1 1 
ATOM   884  N N   . THR A 1 117 ? -3.595  11.806 21.429  1.00 26.32 ? 117  THR A N   1 
ATOM   885  C CA  . THR A 1 117 ? -2.718  10.757 20.931  1.00 26.65 ? 117  THR A CA  1 
ATOM   886  C C   . THR A 1 117 ? -1.404  11.432 20.557  1.00 25.55 ? 117  THR A C   1 
ATOM   887  O O   . THR A 1 117 ? -1.399  12.462 19.880  1.00 24.19 ? 117  THR A O   1 
ATOM   888  C CB  . THR A 1 117 ? -3.296  10.068 19.673  1.00 26.74 ? 117  THR A CB  1 
ATOM   889  O OG1 . THR A 1 117 ? -4.336  9.163  20.062  1.00 31.30 ? 117  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 117 ? -2.202  9.294  18.926  1.00 26.80 ? 117  THR A CG2 1 
ATOM   891  N N   . VAL A 1 118 ? -0.292  10.854 21.001  1.00 26.93 ? 118  VAL A N   1 
ATOM   892  C CA  . VAL A 1 118 ? 1.019   11.417 20.703  1.00 25.57 ? 118  VAL A CA  1 
ATOM   893  C C   . VAL A 1 118 ? 1.840   10.476 19.829  1.00 24.84 ? 118  VAL A C   1 
ATOM   894  O O   . VAL A 1 118 ? 1.977   9.291  20.136  1.00 27.52 ? 118  VAL A O   1 
ATOM   895  C CB  . VAL A 1 118 ? 1.817   11.708 22.005  1.00 23.75 ? 118  VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 118 ? 3.181   12.295 21.664  1.00 24.65 ? 118  VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 118 ? 1.046   12.660 22.884  1.00 24.49 ? 118  VAL A CG2 1 
ATOM   898  N N   . ARG A 1 119 ? 2.365   11.008 18.730  1.00 23.12 ? 119  ARG A N   1 
ATOM   899  C CA  . ARG A 1 119 ? 3.203   10.239 17.814  1.00 25.62 ? 119  ARG A CA  1 
ATOM   900  C C   . ARG A 1 119 ? 4.566   10.930 17.792  1.00 25.78 ? 119  ARG A C   1 
ATOM   901  O O   . ARG A 1 119 ? 4.649   12.130 17.533  1.00 27.89 ? 119  ARG A O   1 
ATOM   902  C CB  . ARG A 1 119 ? 2.601   10.234 16.406  1.00 25.55 ? 119  ARG A CB  1 
ATOM   903  C CG  . ARG A 1 119 ? 1.127   9.859  16.368  1.00 30.59 ? 119  ARG A CG  1 
ATOM   904  C CD  . ARG A 1 119 ? 0.607   9.773  14.942  1.00 37.00 ? 119  ARG A CD  1 
ATOM   905  N NE  . ARG A 1 119 ? 0.803   11.013 14.196  1.00 35.00 ? 119  ARG A NE  1 
ATOM   906  C CZ  . ARG A 1 119 ? 0.543   11.141 12.901  1.00 35.59 ? 119  ARG A CZ  1 
ATOM   907  N NH1 . ARG A 1 119 ? 0.077   10.108 12.213  1.00 40.48 ? 119  ARG A NH1 1 
ATOM   908  N NH2 . ARG A 1 119 ? 0.762   12.290 12.289  1.00 31.33 ? 119  ARG A NH2 1 
ATOM   909  N N   . TYR A 1 120 ? 5.625   10.179 18.074  1.00 22.80 ? 120  TYR A N   1 
ATOM   910  C CA  . TYR A 1 120 ? 6.976   10.741 18.095  1.00 22.96 ? 120  TYR A CA  1 
ATOM   911  C C   . TYR A 1 120 ? 7.805   10.519 16.838  1.00 24.89 ? 120  TYR A C   1 
ATOM   912  O O   . TYR A 1 120 ? 7.743   9.458  16.214  1.00 22.13 ? 120  TYR A O   1 
ATOM   913  C CB  . TYR A 1 120 ? 7.821   10.135 19.229  1.00 20.91 ? 120  TYR A CB  1 
ATOM   914  C CG  . TYR A 1 120 ? 7.478   10.516 20.651  1.00 23.05 ? 120  TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 120 ? 7.378   11.852 21.038  1.00 21.27 ? 120  TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 120 ? 7.360   9.532  21.636  1.00 24.15 ? 120  TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 120 ? 7.178   12.202 22.379  1.00 22.37 ? 120  TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 120 ? 7.159   9.869  22.978  1.00 26.85 ? 120  TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 120 ? 7.074   11.204 23.342  1.00 26.27 ? 120  TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 120 ? 6.926   11.528 24.672  1.00 24.47 ? 120  TYR A OH  1 
ATOM   921  N N   . LEU A 1 121 ? 8.596   11.533 16.496  1.00 21.20 ? 121  LEU A N   1 
ATOM   922  C CA  . LEU A 1 121 ? 9.563   11.450 15.411  1.00 21.01 ? 121  LEU A CA  1 
ATOM   923  C C   . LEU A 1 121 ? 10.839  11.893 16.125  1.00 22.15 ? 121  LEU A C   1 
ATOM   924  O O   . LEU A 1 121 ? 10.780  12.712 17.047  1.00 21.78 ? 121  LEU A O   1 
ATOM   925  C CB  . LEU A 1 121 ? 9.218   12.382 14.248  1.00 22.54 ? 121  LEU A CB  1 
ATOM   926  C CG  . LEU A 1 121 ? 8.105   11.840 13.340  1.00 23.42 ? 121  LEU A CG  1 
ATOM   927  C CD1 . LEU A 1 121 ? 7.914   12.769 12.147  1.00 22.73 ? 121  LEU A CD1 1 
ATOM   928  C CD2 . LEU A 1 121 ? 8.472   10.430 12.855  1.00 21.42 ? 121  LEU A CD2 1 
ATOM   929  N N   . ALA A 1 122 ? 11.981  11.343 15.730  1.00 22.63 ? 122  ALA A N   1 
ATOM   930  C CA  . ALA A 1 122 ? 13.250  11.668 16.382  1.00 24.46 ? 122  ALA A CA  1 
ATOM   931  C C   . ALA A 1 122 ? 13.894  12.969 15.911  1.00 25.88 ? 122  ALA A C   1 
ATOM   932  O O   . ALA A 1 122 ? 14.062  13.192 14.714  1.00 31.44 ? 122  ALA A O   1 
ATOM   933  C CB  . ALA A 1 122 ? 14.229  10.514 16.197  1.00 28.39 ? 122  ALA A CB  1 
ATOM   934  N N   . PHE A 1 123 ? 14.258  13.830 16.854  1.00 24.51 ? 123  PHE A N   1 
ATOM   935  C CA  . PHE A 1 123 ? 14.898  15.086 16.494  1.00 23.74 ? 123  PHE A CA  1 
ATOM   936  C C   . PHE A 1 123 ? 16.085  15.380 17.406  1.00 25.94 ? 123  PHE A C   1 
ATOM   937  O O   . PHE A 1 123 ? 15.927  15.962 18.479  1.00 25.89 ? 123  PHE A O   1 
ATOM   938  C CB  . PHE A 1 123 ? 13.903  16.248 16.562  1.00 24.97 ? 123  PHE A CB  1 
ATOM   939  C CG  . PHE A 1 123 ? 14.412  17.502 15.912  1.00 27.10 ? 123  PHE A CG  1 
ATOM   940  C CD1 . PHE A 1 123 ? 14.219  17.721 14.552  1.00 28.29 ? 123  PHE A CD1 1 
ATOM   941  C CD2 . PHE A 1 123 ? 15.142  18.430 16.645  1.00 28.91 ? 123  PHE A CD2 1 
ATOM   942  C CE1 . PHE A 1 123 ? 14.750  18.849 13.928  1.00 34.06 ? 123  PHE A CE1 1 
ATOM   943  C CE2 . PHE A 1 123 ? 15.681  19.562 16.035  1.00 28.67 ? 123  PHE A CE2 1 
ATOM   944  C CZ  . PHE A 1 123 ? 15.485  19.772 14.672  1.00 31.69 ? 123  PHE A CZ  1 
ATOM   945  N N   . PRO A 1 124 ? 17.293  14.961 16.997  1.00 26.09 ? 124  PRO A N   1 
ATOM   946  C CA  . PRO A 1 124 ? 18.496  15.198 17.800  1.00 28.10 ? 124  PRO A CA  1 
ATOM   947  C C   . PRO A 1 124 ? 18.923  16.653 17.676  1.00 27.76 ? 124  PRO A C   1 
ATOM   948  O O   . PRO A 1 124 ? 19.400  17.083 16.625  1.00 31.12 ? 124  PRO A O   1 
ATOM   949  C CB  . PRO A 1 124 ? 19.512  14.244 17.181  1.00 29.23 ? 124  PRO A CB  1 
ATOM   950  C CG  . PRO A 1 124 ? 19.136  14.285 15.727  1.00 28.94 ? 124  PRO A CG  1 
ATOM   951  C CD  . PRO A 1 124 ? 17.614  14.183 15.787  1.00 27.75 ? 124  PRO A CD  1 
ATOM   952  N N   . ARG A 1 125 ? 18.744  17.414 18.749  1.00 28.32 ? 125  ARG A N   1 
ATOM   953  C CA  . ARG A 1 125 ? 19.105  18.825 18.740  1.00 28.59 ? 125  ARG A CA  1 
ATOM   954  C C   . ARG A 1 125 ? 20.563  19.024 18.333  1.00 28.49 ? 125  ARG A C   1 
ATOM   955  O O   . ARG A 1 125 ? 20.887  19.959 17.601  1.00 31.14 ? 125  ARG A O   1 
ATOM   956  C CB  . ARG A 1 125 ? 18.852  19.437 20.123  1.00 27.69 ? 125  ARG A CB  1 
ATOM   957  C CG  . ARG A 1 125 ? 17.375  19.465 20.525  1.00 26.20 ? 125  ARG A CG  1 
ATOM   958  C CD  . ARG A 1 125 ? 17.235  19.790 22.000  1.00 28.08 ? 125  ARG A CD  1 
ATOM   959  N NE  . ARG A 1 125 ? 17.839  18.746 22.823  1.00 25.28 ? 125  ARG A NE  1 
ATOM   960  C CZ  . ARG A 1 125 ? 18.200  18.903 24.091  1.00 23.43 ? 125  ARG A CZ  1 
ATOM   961  N NH1 . ARG A 1 125 ? 18.025  20.066 24.699  1.00 23.99 ? 125  ARG A NH1 1 
ATOM   962  N NH2 . ARG A 1 125 ? 18.737  17.892 24.753  1.00 19.06 ? 125  ARG A NH2 1 
ATOM   963  N N   . GLN A 1 126 ? 21.428  18.128 18.796  1.00 31.36 ? 126  GLN A N   1 
ATOM   964  C CA  . GLN A 1 126 ? 22.855  18.193 18.499  1.00 34.63 ? 126  GLN A CA  1 
ATOM   965  C C   . GLN A 1 126 ? 23.226  17.702 17.096  1.00 38.08 ? 126  GLN A C   1 
ATOM   966  O O   . GLN A 1 126 ? 24.409  17.576 16.773  1.00 40.76 ? 126  GLN A O   1 
ATOM   967  C CB  . GLN A 1 126 ? 23.632  17.392 19.545  1.00 34.53 ? 126  GLN A CB  1 
ATOM   968  C CG  . GLN A 1 126 ? 23.637  18.018 20.931  1.00 40.58 ? 126  GLN A CG  1 
ATOM   969  C CD  . GLN A 1 126 ? 24.595  19.191 21.042  1.00 42.68 ? 126  GLN A CD  1 
ATOM   970  O OE1 . GLN A 1 126 ? 25.809  19.024 20.938  1.00 40.81 ? 126  GLN A OE1 1 
ATOM   971  N NE2 . GLN A 1 126 ? 24.052  20.385 21.254  1.00 47.50 ? 126  GLN A NE2 1 
ATOM   972  N N   . GLY A 1 127 ? 22.226  17.427 16.265  1.00 38.81 ? 127  GLY A N   1 
ATOM   973  C CA  . GLY A 1 127 ? 22.508  16.966 14.915  1.00 37.45 ? 127  GLY A CA  1 
ATOM   974  C C   . GLY A 1 127 ? 22.662  15.462 14.785  1.00 37.51 ? 127  GLY A C   1 
ATOM   975  O O   . GLY A 1 127 ? 22.626  14.735 15.774  1.00 36.14 ? 127  GLY A O   1 
ATOM   976  N N   . LEU A 1 128 ? 22.853  15.001 13.551  1.00 39.40 ? 128  LEU A N   1 
ATOM   977  C CA  . LEU A 1 128 ? 22.986  13.576 13.255  1.00 39.50 ? 128  LEU A CA  1 
ATOM   978  C C   . LEU A 1 128 ? 24.251  12.930 13.806  1.00 40.25 ? 128  LEU A C   1 
ATOM   979  O O   . LEU A 1 128 ? 24.307  11.711 13.983  1.00 39.57 ? 128  LEU A O   1 
ATOM   980  C CB  . LEU A 1 128 ? 22.921  13.355 11.742  1.00 38.75 ? 128  LEU A CB  1 
ATOM   981  C CG  . LEU A 1 128 ? 21.655  13.871 11.051  1.00 40.13 ? 128  LEU A CG  1 
ATOM   982  C CD1 . LEU A 1 128 ? 21.743  13.598 9.559   1.00 42.62 ? 128  LEU A CD1 1 
ATOM   983  C CD2 . LEU A 1 128 ? 20.429  13.196 11.650  1.00 41.21 ? 128  LEU A CD2 1 
ATOM   984  N N   . ASP A 1 129 ? 25.263  13.747 14.075  1.00 39.00 ? 129  ASP A N   1 
ATOM   985  C CA  . ASP A 1 129 ? 26.522  13.245 14.603  1.00 41.37 ? 129  ASP A CA  1 
ATOM   986  C C   . ASP A 1 129 ? 26.569  13.532 16.105  1.00 40.58 ? 129  ASP A C   1 
ATOM   987  O O   . ASP A 1 129 ? 27.358  14.360 16.564  1.00 42.59 ? 129  ASP A O   1 
ATOM   988  C CB  . ASP A 1 129 ? 27.678  13.936 13.867  1.00 44.31 ? 129  ASP A CB  1 
ATOM   989  C CG  . ASP A 1 129 ? 28.973  13.154 13.942  1.00 46.81 ? 129  ASP A CG  1 
ATOM   990  O OD1 . ASP A 1 129 ? 28.918  11.905 13.889  1.00 47.78 ? 129  ASP A OD1 1 
ATOM   991  O OD2 . ASP A 1 129 ? 30.046  13.790 14.034  1.00 48.22 ? 129  ASP A OD2 1 
ATOM   992  N N   . SER A 1 130 ? 25.715  12.841 16.863  1.00 36.94 ? 130  SER A N   1 
ATOM   993  C CA  . SER A 1 130 ? 25.623  13.032 18.311  1.00 33.55 ? 130  SER A CA  1 
ATOM   994  C C   . SER A 1 130 ? 25.181  11.762 19.042  1.00 31.84 ? 130  SER A C   1 
ATOM   995  O O   . SER A 1 130 ? 24.747  10.808 18.408  1.00 34.08 ? 130  SER A O   1 
ATOM   996  C CB  . SER A 1 130 ? 24.620  14.147 18.608  1.00 37.20 ? 130  SER A CB  1 
ATOM   997  O OG  . SER A 1 130 ? 23.321  13.791 18.154  1.00 35.15 ? 130  SER A OG  1 
ATOM   998  N N   . ASP A 1 131 ? 25.290  11.752 20.373  1.00 30.11 ? 131  ASP A N   1 
ATOM   999  C CA  . ASP A 1 131 ? 24.862  10.589 21.160  1.00 29.26 ? 131  ASP A CA  1 
ATOM   1000 C C   . ASP A 1 131 ? 23.346  10.432 21.019  1.00 29.34 ? 131  ASP A C   1 
ATOM   1001 O O   . ASP A 1 131 ? 22.820  9.317  20.970  1.00 27.46 ? 131  ASP A O   1 
ATOM   1002 C CB  . ASP A 1 131 ? 25.178  10.760 22.655  1.00 29.49 ? 131  ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 131 ? 26.668  10.864 22.947  1.00 33.95 ? 131  ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 131 ? 27.481  10.235 22.233  1.00 30.56 ? 131  ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 131 ? 27.020  11.566 23.917  1.00 33.80 ? 131  ASP A OD2 1 
ATOM   1006 N N   . ALA A 1 132 ? 22.653  11.565 20.978  1.00 28.03 ? 132  ALA A N   1 
ATOM   1007 C CA  . ALA A 1 132 ? 21.197  11.589 20.848  1.00 27.78 ? 132  ALA A CA  1 
ATOM   1008 C C   . ALA A 1 132 ? 20.723  10.804 19.626  1.00 28.06 ? 132  ALA A C   1 
ATOM   1009 O O   . ALA A 1 132 ? 19.762  10.037 19.706  1.00 28.83 ? 132  ALA A O   1 
ATOM   1010 C CB  . ALA A 1 132 ? 20.708  13.037 20.755  1.00 25.16 ? 132  ALA A CB  1 
ATOM   1011 N N   . GLU A 1 133 ? 21.396  11.008 18.497  1.00 27.59 ? 133  GLU A N   1 
ATOM   1012 C CA  . GLU A 1 133 ? 21.045  10.328 17.254  1.00 31.04 ? 133  GLU A CA  1 
ATOM   1013 C C   . GLU A 1 133 ? 21.292  8.826  17.380  1.00 31.28 ? 133  GLU A C   1 
ATOM   1014 O O   . GLU A 1 133 ? 20.473  8.015  16.942  1.00 27.74 ? 133  GLU A O   1 
ATOM   1015 C CB  . GLU A 1 133 ? 21.861  10.915 16.094  1.00 34.89 ? 133  GLU A CB  1 
ATOM   1016 C CG  . GLU A 1 133 ? 21.386  10.533 14.693  1.00 43.23 ? 133  GLU A CG  1 
ATOM   1017 C CD  . GLU A 1 133 ? 21.979  9.229  14.188  1.00 51.49 ? 133  GLU A CD  1 
ATOM   1018 O OE1 . GLU A 1 133 ? 21.614  8.154  14.710  1.00 57.19 ? 133  GLU A OE1 1 
ATOM   1019 O OE2 . GLU A 1 133 ? 22.820  9.281  13.265  1.00 55.31 ? 133  GLU A OE2 1 
ATOM   1020 N N   . LYS A 1 134 ? 22.415  8.458  17.994  1.00 31.49 ? 134  LYS A N   1 
ATOM   1021 C CA  . LYS A 1 134 ? 22.761  7.051  18.181  1.00 31.48 ? 134  LYS A CA  1 
ATOM   1022 C C   . LYS A 1 134 ? 21.766  6.358  19.101  1.00 32.05 ? 134  LYS A C   1 
ATOM   1023 O O   . LYS A 1 134 ? 21.335  5.236  18.832  1.00 32.48 ? 134  LYS A O   1 
ATOM   1024 C CB  . LYS A 1 134 ? 24.170  6.923  18.772  1.00 37.44 ? 134  LYS A CB  1 
ATOM   1025 C CG  . LYS A 1 134 ? 25.269  7.551  17.923  1.00 46.40 ? 134  LYS A CG  1 
ATOM   1026 C CD  . LYS A 1 134 ? 26.632  7.406  18.589  1.00 50.60 ? 134  LYS A CD  1 
ATOM   1027 C CE  . LYS A 1 134 ? 27.749  7.950  17.708  1.00 54.55 ? 134  LYS A CE  1 
ATOM   1028 N NZ  . LYS A 1 134 ? 27.582  9.400  17.412  1.00 59.23 ? 134  LYS A NZ  1 
ATOM   1029 N N   . GLU A 1 135 ? 21.407  7.029  20.195  1.00 30.47 ? 135  GLU A N   1 
ATOM   1030 C CA  . GLU A 1 135 ? 20.460  6.479  21.154  1.00 27.43 ? 135  GLU A CA  1 
ATOM   1031 C C   . GLU A 1 135 ? 19.051  6.329  20.588  1.00 28.01 ? 135  GLU A C   1 
ATOM   1032 O O   . GLU A 1 135 ? 18.379  5.335  20.860  1.00 28.91 ? 135  GLU A O   1 
ATOM   1033 C CB  . GLU A 1 135 ? 20.419  7.345  22.416  1.00 31.99 ? 135  GLU A CB  1 
ATOM   1034 C CG  . GLU A 1 135 ? 21.615  7.146  23.328  1.00 38.15 ? 135  GLU A CG  1 
ATOM   1035 C CD  . GLU A 1 135 ? 21.660  5.748  23.920  1.00 42.80 ? 135  GLU A CD  1 
ATOM   1036 O OE1 . GLU A 1 135 ? 20.817  5.436  24.787  1.00 45.79 ? 135  GLU A OE1 1 
ATOM   1037 O OE2 . GLU A 1 135 ? 22.532  4.957  23.511  1.00 46.57 ? 135  GLU A OE2 1 
ATOM   1038 N N   . MET A 1 136 ? 18.598  7.302  19.803  1.00 26.70 ? 136  MET A N   1 
ATOM   1039 C CA  . MET A 1 136 ? 17.251  7.213  19.241  1.00 27.52 ? 136  MET A CA  1 
ATOM   1040 C C   . MET A 1 136 ? 17.218  6.246  18.054  1.00 28.03 ? 136  MET A C   1 
ATOM   1041 O O   . MET A 1 136 ? 16.185  5.639  17.763  1.00 30.26 ? 136  MET A O   1 
ATOM   1042 C CB  . MET A 1 136 ? 16.741  8.604  18.851  1.00 28.45 ? 136  MET A CB  1 
ATOM   1043 C CG  . MET A 1 136 ? 16.555  9.527  20.069  1.00 25.77 ? 136  MET A CG  1 
ATOM   1044 S SD  . MET A 1 136 ? 15.633  11.058 19.752  1.00 25.92 ? 136  MET A SD  1 
ATOM   1045 C CE  . MET A 1 136 ? 16.943  12.140 19.139  1.00 22.07 ? 136  MET A CE  1 
ATOM   1046 N N   . LYS A 1 137 ? 18.353  6.087  17.383  1.00 28.87 ? 137  LYS A N   1 
ATOM   1047 C CA  . LYS A 1 137 ? 18.427  5.148  16.267  1.00 34.62 ? 137  LYS A CA  1 
ATOM   1048 C C   . LYS A 1 137 ? 18.200  3.738  16.819  1.00 32.98 ? 137  LYS A C   1 
ATOM   1049 O O   . LYS A 1 137 ? 17.538  2.910  16.191  1.00 35.34 ? 137  LYS A O   1 
ATOM   1050 C CB  . LYS A 1 137 ? 19.794  5.233  15.580  1.00 33.38 ? 137  LYS A CB  1 
ATOM   1051 C CG  . LYS A 1 137 ? 20.043  4.142  14.536  1.00 41.50 ? 137  LYS A CG  1 
ATOM   1052 C CD  . LYS A 1 137 ? 18.945  4.105  13.479  1.00 43.80 ? 137  LYS A CD  1 
ATOM   1053 C CE  . LYS A 1 137 ? 19.189  3.002  12.455  1.00 48.76 ? 137  LYS A CE  1 
ATOM   1054 N NZ  . LYS A 1 137 ? 20.412  3.232  11.638  1.00 47.21 ? 137  LYS A NZ  1 
ATOM   1055 N N   . ALA A 1 138 ? 18.738  3.475  18.006  1.00 33.21 ? 138  ALA A N   1 
ATOM   1056 C CA  . ALA A 1 138 ? 18.584  2.170  18.641  1.00 34.06 ? 138  ALA A CA  1 
ATOM   1057 C C   . ALA A 1 138 ? 17.149  1.975  19.116  1.00 35.37 ? 138  ALA A C   1 
ATOM   1058 O O   . ALA A 1 138 ? 16.612  0.867  19.066  1.00 33.00 ? 138  ALA A O   1 
ATOM   1059 C CB  . ALA A 1 138 ? 19.545  2.038  19.819  1.00 34.33 ? 138  ALA A CB  1 
ATOM   1060 N N   . ILE A 1 139 ? 16.533  3.060  19.581  1.00 31.95 ? 139  ILE A N   1 
ATOM   1061 C CA  . ILE A 1 139 ? 15.157  3.017  20.067  1.00 32.74 ? 139  ILE A CA  1 
ATOM   1062 C C   . ILE A 1 139 ? 14.197  2.690  18.932  1.00 33.30 ? 139  ILE A C   1 
ATOM   1063 O O   . ILE A 1 139 ? 13.372  1.781  19.037  1.00 34.34 ? 139  ILE A O   1 
ATOM   1064 C CB  . ILE A 1 139 ? 14.726  4.383  20.662  1.00 31.13 ? 139  ILE A CB  1 
ATOM   1065 C CG1 . ILE A 1 139 ? 15.519  4.685  21.933  1.00 32.61 ? 139  ILE A CG1 1 
ATOM   1066 C CG2 . ILE A 1 139 ? 13.228  4.379  20.950  1.00 33.34 ? 139  ILE A CG2 1 
ATOM   1067 C CD1 . ILE A 1 139 ? 15.256  6.080  22.501  1.00 34.18 ? 139  ILE A CD1 1 
ATOM   1068 N N   . TRP A 1 140 ? 14.306  3.456  17.855  1.00 35.55 ? 140  TRP A N   1 
ATOM   1069 C CA  . TRP A 1 140 ? 13.449  3.291  16.692  1.00 38.65 ? 140  TRP A CA  1 
ATOM   1070 C C   . TRP A 1 140 ? 13.670  1.969  15.959  1.00 41.86 ? 140  TRP A C   1 
ATOM   1071 O O   . TRP A 1 140 ? 12.830  1.551  15.161  1.00 40.96 ? 140  TRP A O   1 
ATOM   1072 C CB  . TRP A 1 140 ? 13.643  4.477  15.741  1.00 35.87 ? 140  TRP A CB  1 
ATOM   1073 C CG  . TRP A 1 140 ? 12.587  5.538  15.898  1.00 33.32 ? 140  TRP A CG  1 
ATOM   1074 C CD1 . TRP A 1 140 ? 11.451  5.670  15.159  1.00 30.19 ? 140  TRP A CD1 1 
ATOM   1075 C CD2 . TRP A 1 140 ? 12.547  6.581  16.882  1.00 31.59 ? 140  TRP A CD2 1 
ATOM   1076 N NE1 . TRP A 1 140 ? 10.702  6.728  15.617  1.00 32.31 ? 140  TRP A NE1 1 
ATOM   1077 C CE2 . TRP A 1 140 ? 11.351  7.305  16.676  1.00 32.06 ? 140  TRP A CE2 1 
ATOM   1078 C CE3 . TRP A 1 140 ? 13.403  6.972  17.921  1.00 30.91 ? 140  TRP A CE3 1 
ATOM   1079 C CZ2 . TRP A 1 140 ? 10.989  8.401  17.469  1.00 28.36 ? 140  TRP A CZ2 1 
ATOM   1080 C CZ3 . TRP A 1 140 ? 13.041  8.061  18.711  1.00 30.78 ? 140  TRP A CZ3 1 
ATOM   1081 C CH2 . TRP A 1 140 ? 11.843  8.761  18.478  1.00 29.27 ? 140  TRP A CH2 1 
ATOM   1082 N N   . CYS A 1 141 ? 14.794  1.314  16.245  1.00 43.78 ? 141  CYS A N   1 
ATOM   1083 C CA  . CYS A 1 141 ? 15.124  0.034  15.622  1.00 44.26 ? 141  CYS A CA  1 
ATOM   1084 C C   . CYS A 1 141 ? 14.803  -1.152 16.520  1.00 44.15 ? 141  CYS A C   1 
ATOM   1085 O O   . CYS A 1 141 ? 15.058  -2.299 16.154  1.00 45.35 ? 141  CYS A O   1 
ATOM   1086 C CB  . CYS A 1 141 ? 16.609  -0.024 15.261  1.00 41.13 ? 141  CYS A CB  1 
ATOM   1087 S SG  . CYS A 1 141 ? 17.091  0.939  13.800  1.00 50.87 ? 141  CYS A SG  1 
ATOM   1088 N N   . ALA A 1 142 ? 14.249  -0.874 17.693  1.00 44.74 ? 142  ALA A N   1 
ATOM   1089 C CA  . ALA A 1 142 ? 13.907  -1.920 18.647  1.00 46.70 ? 142  ALA A CA  1 
ATOM   1090 C C   . ALA A 1 142 ? 12.652  -2.689 18.252  1.00 49.36 ? 142  ALA A C   1 
ATOM   1091 O O   . ALA A 1 142 ? 11.753  -2.146 17.607  1.00 49.21 ? 142  ALA A O   1 
ATOM   1092 C CB  . ALA A 1 142 ? 13.725  -1.315 20.032  1.00 45.53 ? 142  ALA A CB  1 
ATOM   1093 N N   . LYS A 1 143 ? 12.599  -3.957 18.650  1.00 51.70 ? 143  LYS A N   1 
ATOM   1094 C CA  . LYS A 1 143 ? 11.454  -4.808 18.357  1.00 52.03 ? 143  LYS A CA  1 
ATOM   1095 C C   . LYS A 1 143 ? 10.199  -4.073 18.804  1.00 49.88 ? 143  LYS A C   1 
ATOM   1096 O O   . LYS A 1 143 ? 9.218   -3.996 18.070  1.00 49.93 ? 143  LYS A O   1 
ATOM   1097 C CB  . LYS A 1 143 ? 11.578  -6.136 19.112  1.00 55.62 ? 143  LYS A CB  1 
ATOM   1098 C CG  . LYS A 1 143 ? 10.438  -7.116 18.869  1.00 58.73 ? 143  LYS A CG  1 
ATOM   1099 C CD  . LYS A 1 143 ? 10.414  -7.602 17.427  1.00 61.26 ? 143  LYS A CD  1 
ATOM   1100 C CE  . LYS A 1 143 ? 9.351   -8.673 17.223  1.00 61.41 ? 143  LYS A CE  1 
ATOM   1101 N NZ  . LYS A 1 143 ? 9.322   -9.175 15.819  1.00 63.15 ? 143  LYS A NZ  1 
ATOM   1102 N N   . ASP A 1 144 ? 10.246  -3.531 20.017  1.00 47.92 ? 144  ASP A N   1 
ATOM   1103 C CA  . ASP A 1 144 ? 9.127   -2.780 20.575  1.00 46.38 ? 144  ASP A CA  1 
ATOM   1104 C C   . ASP A 1 144 ? 9.582   -1.338 20.804  1.00 45.13 ? 144  ASP A C   1 
ATOM   1105 O O   . ASP A 1 144 ? 10.217  -1.038 21.816  1.00 42.98 ? 144  ASP A O   1 
ATOM   1106 C CB  . ASP A 1 144 ? 8.688   -3.392 21.906  1.00 45.81 ? 144  ASP A CB  1 
ATOM   1107 C CG  . ASP A 1 144 ? 7.429   -2.748 22.458  1.00 48.20 ? 144  ASP A CG  1 
ATOM   1108 O OD1 . ASP A 1 144 ? 7.305   -1.507 22.391  1.00 51.18 ? 144  ASP A OD1 1 
ATOM   1109 O OD2 . ASP A 1 144 ? 6.563   -3.484 22.972  1.00 51.17 ? 144  ASP A OD2 1 
ATOM   1110 N N   . LYS A 1 145 ? 9.254   -0.456 19.863  1.00 43.43 ? 145  LYS A N   1 
ATOM   1111 C CA  . LYS A 1 145 ? 9.640   0.953  19.953  1.00 43.94 ? 145  LYS A CA  1 
ATOM   1112 C C   . LYS A 1 145 ? 9.168   1.634  21.233  1.00 41.04 ? 145  LYS A C   1 
ATOM   1113 O O   . LYS A 1 145 ? 9.943   2.320  21.903  1.00 41.92 ? 145  LYS A O   1 
ATOM   1114 C CB  . LYS A 1 145 ? 9.093   1.738  18.756  1.00 45.44 ? 145  LYS A CB  1 
ATOM   1115 C CG  . LYS A 1 145 ? 9.526   1.220  17.396  1.00 48.57 ? 145  LYS A CG  1 
ATOM   1116 C CD  . LYS A 1 145 ? 9.036   2.131  16.271  1.00 49.42 ? 145  LYS A CD  1 
ATOM   1117 C CE  . LYS A 1 145 ? 7.528   2.341  16.327  1.00 52.55 ? 145  LYS A CE  1 
ATOM   1118 N NZ  . LYS A 1 145 ? 6.776   1.058  16.297  1.00 55.48 ? 145  LYS A NZ  1 
ATOM   1119 N N   . ASN A 1 146 ? 7.895   1.453  21.567  1.00 38.62 ? 146  ASN A N   1 
ATOM   1120 C CA  . ASN A 1 146 ? 7.329   2.075  22.756  1.00 36.41 ? 146  ASN A CA  1 
ATOM   1121 C C   . ASN A 1 146 ? 8.062   1.726  24.045  1.00 39.20 ? 146  ASN A C   1 
ATOM   1122 O O   . ASN A 1 146 ? 8.432   2.619  24.814  1.00 35.08 ? 146  ASN A O   1 
ATOM   1123 C CB  . ASN A 1 146 ? 5.847   1.717  22.881  1.00 36.39 ? 146  ASN A CB  1 
ATOM   1124 C CG  . ASN A 1 146 ? 5.027   2.248  21.723  1.00 33.71 ? 146  ASN A CG  1 
ATOM   1125 O OD1 . ASN A 1 146 ? 5.196   1.817  20.584  1.00 34.14 ? 146  ASN A OD1 1 
ATOM   1126 N ND2 . ASN A 1 146 ? 4.146   3.198  22.006  1.00 30.23 ? 146  ASN A ND2 1 
ATOM   1127 N N   . LYS A 1 147 ? 8.274   0.434  24.286  1.00 37.67 ? 147  LYS A N   1 
ATOM   1128 C CA  . LYS A 1 147 ? 8.972   0.005  25.495  1.00 37.64 ? 147  LYS A CA  1 
ATOM   1129 C C   . LYS A 1 147 ? 10.402  0.531  25.506  1.00 33.75 ? 147  LYS A C   1 
ATOM   1130 O O   . LYS A 1 147 ? 10.898  0.970  26.541  1.00 35.17 ? 147  LYS A O   1 
ATOM   1131 C CB  . LYS A 1 147 ? 8.998   -1.524 25.600  1.00 39.66 ? 147  LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 147 ? 9.837   -2.031 26.770  1.00 47.61 ? 147  LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 147 ? 9.931   -3.549 26.797  1.00 53.23 ? 147  LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 147 ? 10.808  -4.025 27.951  1.00 55.35 ? 147  LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 147 ? 10.947  -5.511 27.980  1.00 58.84 ? 147  LYS A NZ  1 
ATOM   1136 N N   . ALA A 1 148 ? 11.059  0.476  24.351  1.00 33.09 ? 148  ALA A N   1 
ATOM   1137 C CA  . ALA A 1 148 ? 12.434  0.944  24.221  1.00 33.74 ? 148  ALA A CA  1 
ATOM   1138 C C   . ALA A 1 148 ? 12.543  2.438  24.529  1.00 34.80 ? 148  ALA A C   1 
ATOM   1139 O O   . ALA A 1 148 ? 13.494  2.881  25.174  1.00 32.09 ? 148  ALA A O   1 
ATOM   1140 C CB  . ALA A 1 148 ? 12.951  0.660  22.812  1.00 30.04 ? 148  ALA A CB  1 
ATOM   1141 N N   . PHE A 1 149 ? 11.570  3.216  24.066  1.00 34.16 ? 149  PHE A N   1 
ATOM   1142 C CA  . PHE A 1 149 ? 11.592  4.653  24.317  1.00 31.50 ? 149  PHE A CA  1 
ATOM   1143 C C   . PHE A 1 149 ? 11.387  4.904  25.812  1.00 32.45 ? 149  PHE A C   1 
ATOM   1144 O O   . PHE A 1 149 ? 12.110  5.701  26.417  1.00 31.58 ? 149  PHE A O   1 
ATOM   1145 C CB  . PHE A 1 149 ? 10.508  5.352  23.479  1.00 30.79 ? 149  PHE A CB  1 
ATOM   1146 C CG  . PHE A 1 149 ? 10.579  6.865  23.512  1.00 27.02 ? 149  PHE A CG  1 
ATOM   1147 C CD1 . PHE A 1 149 ? 10.026  7.581  24.568  1.00 26.51 ? 149  PHE A CD1 1 
ATOM   1148 C CD2 . PHE A 1 149 ? 11.189  7.569  22.474  1.00 25.53 ? 149  PHE A CD2 1 
ATOM   1149 C CE1 . PHE A 1 149 ? 10.074  8.978  24.593  1.00 28.14 ? 149  PHE A CE1 1 
ATOM   1150 C CE2 . PHE A 1 149 ? 11.247  8.971  22.485  1.00 24.33 ? 149  PHE A CE2 1 
ATOM   1151 C CZ  . PHE A 1 149 ? 10.686  9.675  23.549  1.00 22.89 ? 149  PHE A CZ  1 
ATOM   1152 N N   . ASP A 1 150 ? 10.425  4.212  26.420  1.00 33.33 ? 150  ASP A N   1 
ATOM   1153 C CA  . ASP A 1 150 ? 10.169  4.391  27.848  1.00 35.62 ? 150  ASP A CA  1 
ATOM   1154 C C   . ASP A 1 150 ? 11.424  4.072  28.659  1.00 39.09 ? 150  ASP A C   1 
ATOM   1155 O O   . ASP A 1 150 ? 11.809  4.832  29.549  1.00 40.24 ? 150  ASP A O   1 
ATOM   1156 C CB  . ASP A 1 150 ? 9.031   3.487  28.337  1.00 35.01 ? 150  ASP A CB  1 
ATOM   1157 C CG  . ASP A 1 150 ? 7.723   3.728  27.606  1.00 39.91 ? 150  ASP A CG  1 
ATOM   1158 O OD1 . ASP A 1 150 ? 7.448   4.879  27.200  1.00 34.78 ? 150  ASP A OD1 1 
ATOM   1159 O OD2 . ASP A 1 150 ? 6.955   2.756  27.455  1.00 39.34 ? 150  ASP A OD2 1 
ATOM   1160 N N   . ASP A 1 151 ? 12.054  2.942  28.349  1.00 39.21 ? 151  ASP A N   1 
ATOM   1161 C CA  . ASP A 1 151 ? 13.261  2.522  29.054  1.00 41.05 ? 151  ASP A CA  1 
ATOM   1162 C C   . ASP A 1 151 ? 14.374  3.561  28.989  1.00 42.08 ? 151  ASP A C   1 
ATOM   1163 O O   . ASP A 1 151 ? 14.960  3.914  30.014  1.00 43.42 ? 151  ASP A O   1 
ATOM   1164 C CB  . ASP A 1 151 ? 13.783  1.194  28.493  1.00 39.39 ? 151  ASP A CB  1 
ATOM   1165 C CG  . ASP A 1 151 ? 12.891  0.021  28.841  1.00 39.87 ? 151  ASP A CG  1 
ATOM   1166 O OD1 . ASP A 1 151 ? 12.168  0.100  29.859  1.00 39.53 ? 151  ASP A OD1 1 
ATOM   1167 O OD2 . ASP A 1 151 ? 12.928  -0.987 28.104  1.00 42.98 ? 151  ASP A OD2 1 
ATOM   1168 N N   . VAL A 1 152 ? 14.672  4.038  27.785  1.00 41.05 ? 152  VAL A N   1 
ATOM   1169 C CA  . VAL A 1 152 ? 15.720  5.034  27.605  1.00 43.45 ? 152  VAL A CA  1 
ATOM   1170 C C   . VAL A 1 152 ? 15.453  6.267  28.456  1.00 43.41 ? 152  VAL A C   1 
ATOM   1171 O O   . VAL A 1 152 ? 16.351  6.769  29.130  1.00 43.93 ? 152  VAL A O   1 
ATOM   1172 C CB  . VAL A 1 152 ? 15.844  5.459  26.131  1.00 44.63 ? 152  VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 152 ? 16.808  6.635  26.004  1.00 48.24 ? 152  VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 152 ? 16.336  4.287  25.298  1.00 43.91 ? 152  VAL A CG2 1 
ATOM   1175 N N   . MET A 1 153 ? 14.217  6.752  28.432  1.00 41.15 ? 153  MET A N   1 
ATOM   1176 C CA  . MET A 1 153 ? 13.862  7.928  29.214  1.00 42.25 ? 153  MET A CA  1 
ATOM   1177 C C   . MET A 1 153 ? 14.000  7.668  30.711  1.00 43.32 ? 153  MET A C   1 
ATOM   1178 O O   . MET A 1 153 ? 14.481  8.525  31.455  1.00 43.08 ? 153  MET A O   1 
ATOM   1179 C CB  . MET A 1 153 ? 12.431  8.365  28.894  1.00 37.82 ? 153  MET A CB  1 
ATOM   1180 C CG  . MET A 1 153 ? 12.299  9.055  27.554  1.00 38.20 ? 153  MET A CG  1 
ATOM   1181 S SD  . MET A 1 153 ? 13.113  10.671 27.559  1.00 33.50 ? 153  MET A SD  1 
ATOM   1182 C CE  . MET A 1 153 ? 12.060  11.597 26.467  1.00 33.33 ? 153  MET A CE  1 
ATOM   1183 N N   . ALA A 1 154 ? 13.590  6.478  31.143  1.00 42.11 ? 154  ALA A N   1 
ATOM   1184 C CA  . ALA A 1 154 ? 13.648  6.103  32.551  1.00 41.41 ? 154  ALA A CA  1 
ATOM   1185 C C   . ALA A 1 154 ? 15.058  5.768  33.038  1.00 41.76 ? 154  ALA A C   1 
ATOM   1186 O O   . ALA A 1 154 ? 15.249  5.425  34.205  1.00 41.52 ? 154  ALA A O   1 
ATOM   1187 C CB  . ALA A 1 154 ? 12.713  4.929  32.809  1.00 43.00 ? 154  ALA A CB  1 
ATOM   1188 N N   . GLY A 1 155 ? 16.038  5.855  32.145  1.00 42.44 ? 155  GLY A N   1 
ATOM   1189 C CA  . GLY A 1 155 ? 17.410  5.570  32.530  1.00 44.49 ? 155  GLY A CA  1 
ATOM   1190 C C   . GLY A 1 155 ? 17.808  4.108  32.463  1.00 49.28 ? 155  GLY A C   1 
ATOM   1191 O O   . GLY A 1 155 ? 18.645  3.648  33.245  1.00 48.43 ? 155  GLY A O   1 
ATOM   1192 N N   . LYS A 1 156 ? 17.213  3.370  31.532  1.00 52.21 ? 156  LYS A N   1 
ATOM   1193 C CA  . LYS A 1 156 ? 17.530  1.956  31.372  1.00 57.36 ? 156  LYS A CA  1 
ATOM   1194 C C   . LYS A 1 156 ? 18.383  1.736  30.129  1.00 60.38 ? 156  LYS A C   1 
ATOM   1195 O O   . LYS A 1 156 ? 18.246  2.447  29.134  1.00 62.25 ? 156  LYS A O   1 
ATOM   1196 C CB  . LYS A 1 156 ? 16.243  1.133  31.289  1.00 57.22 ? 156  LYS A CB  1 
ATOM   1197 C CG  . LYS A 1 156 ? 15.430  1.165  32.574  1.00 59.33 ? 156  LYS A CG  1 
ATOM   1198 C CD  . LYS A 1 156 ? 14.140  0.376  32.447  1.00 62.85 ? 156  LYS A CD  1 
ATOM   1199 C CE  . LYS A 1 156 ? 13.344  0.415  33.744  1.00 64.80 ? 156  LYS A CE  1 
ATOM   1200 N NZ  . LYS A 1 156 ? 12.994  1.808  34.145  1.00 65.99 ? 156  LYS A NZ  1 
ATOM   1201 N N   . SER A 1 157 ? 19.273  0.752  30.196  1.00 64.92 ? 157  SER A N   1 
ATOM   1202 C CA  . SER A 1 157 ? 20.161  0.444  29.082  1.00 69.01 ? 157  SER A CA  1 
ATOM   1203 C C   . SER A 1 157 ? 19.407  -0.149 27.895  1.00 70.53 ? 157  SER A C   1 
ATOM   1204 O O   . SER A 1 157 ? 18.918  -1.279 27.958  1.00 72.34 ? 157  SER A O   1 
ATOM   1205 C CB  . SER A 1 157 ? 21.256  -0.529 29.535  1.00 70.15 ? 157  SER A CB  1 
ATOM   1206 O OG  . SER A 1 157 ? 22.063  0.044  30.551  1.00 71.49 ? 157  SER A OG  1 
ATOM   1207 N N   . VAL A 1 158 ? 19.314  0.621  26.815  1.00 70.51 ? 158  VAL A N   1 
ATOM   1208 C CA  . VAL A 1 158 ? 18.628  0.163  25.615  1.00 69.49 ? 158  VAL A CA  1 
ATOM   1209 C C   . VAL A 1 158 ? 19.565  -0.708 24.787  1.00 69.91 ? 158  VAL A C   1 
ATOM   1210 O O   . VAL A 1 158 ? 20.717  -0.341 24.544  1.00 68.90 ? 158  VAL A O   1 
ATOM   1211 C CB  . VAL A 1 158 ? 18.154  1.349  24.750  1.00 69.63 ? 158  VAL A CB  1 
ATOM   1212 C CG1 . VAL A 1 158 ? 19.343  2.202  24.332  1.00 68.66 ? 158  VAL A CG1 1 
ATOM   1213 C CG2 . VAL A 1 158 ? 17.407  0.834  23.529  1.00 68.28 ? 158  VAL A CG2 1 
ATOM   1214 N N   . ALA A 1 159 ? 19.065  -1.862 24.359  1.00 69.94 ? 159  ALA A N   1 
ATOM   1215 C CA  . ALA A 1 159 ? 19.855  -2.792 23.560  1.00 70.22 ? 159  ALA A CA  1 
ATOM   1216 C C   . ALA A 1 159 ? 20.213  -2.185 22.207  1.00 70.43 ? 159  ALA A C   1 
ATOM   1217 O O   . ALA A 1 159 ? 19.337  -1.748 21.462  1.00 70.66 ? 159  ALA A O   1 
ATOM   1218 C CB  . ALA A 1 159 ? 19.085  -4.091 23.363  1.00 69.72 ? 159  ALA A CB  1 
ATOM   1219 N N   . PRO A 1 160 ? 21.514  -2.145 21.875  1.00 70.54 ? 160  PRO A N   1 
ATOM   1220 C CA  . PRO A 1 160 ? 21.977  -1.587 20.600  1.00 70.45 ? 160  PRO A CA  1 
ATOM   1221 C C   . PRO A 1 160 ? 21.368  -2.325 19.410  1.00 70.29 ? 160  PRO A C   1 
ATOM   1222 O O   . PRO A 1 160 ? 21.025  -3.504 19.513  1.00 70.45 ? 160  PRO A O   1 
ATOM   1223 C CB  . PRO A 1 160 ? 23.491  -1.769 20.676  1.00 70.50 ? 160  PRO A CB  1 
ATOM   1224 C CG  . PRO A 1 160 ? 23.765  -1.662 22.147  1.00 70.80 ? 160  PRO A CG  1 
ATOM   1225 C CD  . PRO A 1 160 ? 22.658  -2.504 22.732  1.00 70.45 ? 160  PRO A CD  1 
ATOM   1226 N N   . ALA A 1 161 ? 21.235  -1.628 18.285  1.00 69.53 ? 161  ALA A N   1 
ATOM   1227 C CA  . ALA A 1 161 ? 20.665  -2.225 17.084  1.00 68.03 ? 161  ALA A CA  1 
ATOM   1228 C C   . ALA A 1 161 ? 20.650  -1.239 15.922  1.00 67.62 ? 161  ALA A C   1 
ATOM   1229 O O   . ALA A 1 161 ? 20.907  -0.047 16.098  1.00 67.62 ? 161  ALA A O   1 
ATOM   1230 C CB  . ALA A 1 161 ? 19.249  -2.712 17.367  1.00 68.20 ? 161  ALA A CB  1 
ATOM   1231 N N   . SER A 1 162 ? 20.349  -1.749 14.732  1.00 65.87 ? 162  SER A N   1 
ATOM   1232 C CA  . SER A 1 162 ? 20.288  -0.923 13.533  1.00 64.64 ? 162  SER A CA  1 
ATOM   1233 C C   . SER A 1 162 ? 19.142  -1.397 12.649  1.00 62.92 ? 162  SER A C   1 
ATOM   1234 O O   . SER A 1 162 ? 18.636  -2.507 12.821  1.00 62.94 ? 162  SER A O   1 
ATOM   1235 C CB  . SER A 1 162 ? 21.612  -0.998 12.764  1.00 64.99 ? 162  SER A CB  1 
ATOM   1236 O OG  . SER A 1 162 ? 21.883  -2.319 12.329  1.00 65.64 ? 162  SER A OG  1 
ATOM   1237 N N   . CYS A 1 163 ? 18.729  -0.555 11.707  1.00 62.04 ? 163  CYS A N   1 
ATOM   1238 C CA  . CYS A 1 163 ? 17.634  -0.909 10.813  1.00 61.33 ? 163  CYS A CA  1 
ATOM   1239 C C   . CYS A 1 163 ? 17.435  0.111  9.695   1.00 62.29 ? 163  CYS A C   1 
ATOM   1240 O O   . CYS A 1 163 ? 18.217  1.049  9.549   1.00 63.20 ? 163  CYS A O   1 
ATOM   1241 C CB  . CYS A 1 163 ? 16.341  -1.069 11.618  1.00 58.22 ? 163  CYS A CB  1 
ATOM   1242 S SG  . CYS A 1 163 ? 15.695  0.444  12.410  1.00 53.54 ? 163  CYS A SG  1 
ATOM   1243 N N   . ASP A 1 164 ? 16.379  -0.084 8.911   1.00 63.92 ? 164  ASP A N   1 
ATOM   1244 C CA  . ASP A 1 164 ? 16.064  0.795  7.789   1.00 64.42 ? 164  ASP A CA  1 
ATOM   1245 C C   . ASP A 1 164 ? 15.623  2.189  8.245   1.00 62.94 ? 164  ASP A C   1 
ATOM   1246 O O   . ASP A 1 164 ? 15.418  3.085  7.424   1.00 61.90 ? 164  ASP A O   1 
ATOM   1247 C CB  . ASP A 1 164 ? 14.973  0.146  6.924   1.00 67.71 ? 164  ASP A CB  1 
ATOM   1248 C CG  . ASP A 1 164 ? 14.739  0.880  5.615   1.00 70.87 ? 164  ASP A CG  1 
ATOM   1249 O OD1 . ASP A 1 164 ? 14.198  2.006  5.642   1.00 73.41 ? 164  ASP A OD1 1 
ATOM   1250 O OD2 . ASP A 1 164 ? 15.099  0.324  4.555   1.00 72.63 ? 164  ASP A OD2 1 
ATOM   1251 N N   . VAL A 1 165 ? 15.482  2.374  9.554   1.00 60.44 ? 165  VAL A N   1 
ATOM   1252 C CA  . VAL A 1 165 ? 15.073  3.670  10.082  1.00 58.28 ? 165  VAL A CA  1 
ATOM   1253 C C   . VAL A 1 165 ? 16.220  4.666  9.986   1.00 56.37 ? 165  VAL A C   1 
ATOM   1254 O O   . VAL A 1 165 ? 17.312  4.420  10.494  1.00 56.04 ? 165  VAL A O   1 
ATOM   1255 C CB  . VAL A 1 165 ? 14.632  3.571  11.557  1.00 58.14 ? 165  VAL A CB  1 
ATOM   1256 C CG1 . VAL A 1 165 ? 14.327  4.960  12.101  1.00 57.88 ? 165  VAL A CG1 1 
ATOM   1257 C CG2 . VAL A 1 165 ? 13.406  2.681  11.672  1.00 57.09 ? 165  VAL A CG2 1 
ATOM   1258 N N   . ASP A 1 166 ? 15.964  5.794  9.334   1.00 55.01 ? 166  ASP A N   1 
ATOM   1259 C CA  . ASP A 1 166 ? 16.982  6.817  9.175   1.00 54.14 ? 166  ASP A CA  1 
ATOM   1260 C C   . ASP A 1 166 ? 16.580  8.075  9.936   1.00 53.18 ? 166  ASP A C   1 
ATOM   1261 O O   . ASP A 1 166 ? 15.800  8.889  9.441   1.00 53.16 ? 166  ASP A O   1 
ATOM   1262 C CB  . ASP A 1 166 ? 17.169  7.143  7.693   1.00 56.12 ? 166  ASP A CB  1 
ATOM   1263 C CG  . ASP A 1 166 ? 18.580  7.588  7.369   1.00 58.29 ? 166  ASP A CG  1 
ATOM   1264 O OD1 . ASP A 1 166 ? 19.104  8.474  8.075   1.00 60.67 ? 166  ASP A OD1 1 
ATOM   1265 O OD2 . ASP A 1 166 ? 19.166  7.051  6.404   1.00 60.55 ? 166  ASP A OD2 1 
ATOM   1266 N N   . ILE A 1 167 ? 17.114  8.223  11.144  1.00 51.29 ? 167  ILE A N   1 
ATOM   1267 C CA  . ILE A 1 167 ? 16.821  9.381  11.981  1.00 49.64 ? 167  ILE A CA  1 
ATOM   1268 C C   . ILE A 1 167 ? 17.039  10.662 11.185  1.00 47.43 ? 167  ILE A C   1 
ATOM   1269 O O   . ILE A 1 167 ? 16.404  11.683 11.444  1.00 45.57 ? 167  ILE A O   1 
ATOM   1270 C CB  . ILE A 1 167 ? 17.731  9.406  13.236  1.00 48.75 ? 167  ILE A CB  1 
ATOM   1271 C CG1 . ILE A 1 167 ? 17.496  8.147  14.076  1.00 47.84 ? 167  ILE A CG1 1 
ATOM   1272 C CG2 . ILE A 1 167 ? 17.465  10.662 14.060  1.00 50.06 ? 167  ILE A CG2 1 
ATOM   1273 C CD1 . ILE A 1 167 ? 16.079  7.991  14.584  1.00 46.61 ? 167  ILE A CD1 1 
ATOM   1274 N N   . ALA A 1 168 ? 17.939  10.595 10.209  1.00 45.43 ? 168  ALA A N   1 
ATOM   1275 C CA  . ALA A 1 168 ? 18.250  11.746 9.375   1.00 42.13 ? 168  ALA A CA  1 
ATOM   1276 C C   . ALA A 1 168 ? 16.993  12.314 8.726   1.00 39.53 ? 168  ALA A C   1 
ATOM   1277 O O   . ALA A 1 168 ? 16.860  13.528 8.574   1.00 39.09 ? 168  ALA A O   1 
ATOM   1278 C CB  . ALA A 1 168 ? 19.266  11.355 8.303   1.00 44.57 ? 168  ALA A CB  1 
ATOM   1279 N N   . ASP A 1 169 ? 16.073  11.435 8.342   1.00 37.04 ? 169  ASP A N   1 
ATOM   1280 C CA  . ASP A 1 169 ? 14.836  11.876 7.705   1.00 35.62 ? 169  ASP A CA  1 
ATOM   1281 C C   . ASP A 1 169 ? 13.918  12.605 8.678   1.00 32.59 ? 169  ASP A C   1 
ATOM   1282 O O   . ASP A 1 169 ? 13.250  13.569 8.302   1.00 28.71 ? 169  ASP A O   1 
ATOM   1283 C CB  . ASP A 1 169 ? 14.094  10.687 7.091   1.00 40.83 ? 169  ASP A CB  1 
ATOM   1284 C CG  . ASP A 1 169 ? 14.847  10.069 5.938   1.00 45.90 ? 169  ASP A CG  1 
ATOM   1285 O OD1 . ASP A 1 169 ? 15.212  10.818 5.008   1.00 50.11 ? 169  ASP A OD1 1 
ATOM   1286 O OD2 . ASP A 1 169 ? 15.072  8.840  5.956   1.00 49.74 ? 169  ASP A OD2 1 
ATOM   1287 N N   . HIS A 1 170 ? 13.877  12.142 9.924   1.00 29.45 ? 170  HIS A N   1 
ATOM   1288 C CA  . HIS A 1 170 ? 13.036  12.788 10.929  1.00 28.71 ? 170  HIS A CA  1 
ATOM   1289 C C   . HIS A 1 170 ? 13.605  14.179 11.198  1.00 25.42 ? 170  HIS A C   1 
ATOM   1290 O O   . HIS A 1 170 ? 12.872  15.154 11.327  1.00 27.64 ? 170  HIS A O   1 
ATOM   1291 C CB  . HIS A 1 170 ? 13.029  11.986 12.236  1.00 27.57 ? 170  HIS A CB  1 
ATOM   1292 C CG  . HIS A 1 170 ? 12.499  10.591 12.099  1.00 27.91 ? 170  HIS A CG  1 
ATOM   1293 N ND1 . HIS A 1 170 ? 12.136  9.829  13.188  1.00 26.10 ? 170  HIS A ND1 1 
ATOM   1294 C CD2 . HIS A 1 170 ? 12.279  9.817  11.009  1.00 28.66 ? 170  HIS A CD2 1 
ATOM   1295 C CE1 . HIS A 1 170 ? 11.714  8.646  12.775  1.00 31.76 ? 170  HIS A CE1 1 
ATOM   1296 N NE2 . HIS A 1 170 ? 11.791  8.613  11.457  1.00 28.18 ? 170  HIS A NE2 1 
ATOM   1297 N N   . TYR A 1 171 ? 14.928  14.247 11.276  1.00 26.85 ? 171  TYR A N   1 
ATOM   1298 C CA  . TYR A 1 171 ? 15.631  15.492 11.530  1.00 28.63 ? 171  TYR A CA  1 
ATOM   1299 C C   . TYR A 1 171 ? 15.420  16.465 10.370  1.00 30.57 ? 171  TYR A C   1 
ATOM   1300 O O   . TYR A 1 171 ? 15.084  17.632 10.577  1.00 31.53 ? 171  TYR A O   1 
ATOM   1301 C CB  . TYR A 1 171 ? 17.122  15.199 11.728  1.00 29.29 ? 171  TYR A CB  1 
ATOM   1302 C CG  . TYR A 1 171 ? 17.954  16.413 12.069  1.00 32.10 ? 171  TYR A CG  1 
ATOM   1303 C CD1 . TYR A 1 171 ? 17.805  17.066 13.293  1.00 33.13 ? 171  TYR A CD1 1 
ATOM   1304 C CD2 . TYR A 1 171 ? 18.890  16.915 11.163  1.00 38.16 ? 171  TYR A CD2 1 
ATOM   1305 C CE1 . TYR A 1 171 ? 18.568  18.188 13.609  1.00 34.49 ? 171  TYR A CE1 1 
ATOM   1306 C CE2 . TYR A 1 171 ? 19.657  18.036 11.466  1.00 37.15 ? 171  TYR A CE2 1 
ATOM   1307 C CZ  . TYR A 1 171 ? 19.491  18.668 12.689  1.00 38.39 ? 171  TYR A CZ  1 
ATOM   1308 O OH  . TYR A 1 171 ? 20.244  19.780 12.989  1.00 37.23 ? 171  TYR A OH  1 
ATOM   1309 N N   . ALA A 1 172 ? 15.610  15.975 9.148   1.00 31.61 ? 172  ALA A N   1 
ATOM   1310 C CA  . ALA A 1 172 ? 15.436  16.794 7.953   1.00 33.54 ? 172  ALA A CA  1 
ATOM   1311 C C   . ALA A 1 172 ? 14.025  17.376 7.882   1.00 32.38 ? 172  ALA A C   1 
ATOM   1312 O O   . ALA A 1 172 ? 13.849  18.568 7.633   1.00 31.13 ? 172  ALA A O   1 
ATOM   1313 C CB  . ALA A 1 172 ? 15.722  15.963 6.709   1.00 32.75 ? 172  ALA A CB  1 
ATOM   1314 N N   . LEU A 1 173 ? 13.020  16.532 8.098   1.00 32.24 ? 173  LEU A N   1 
ATOM   1315 C CA  . LEU A 1 173 ? 11.633  16.983 8.060   1.00 30.39 ? 173  LEU A CA  1 
ATOM   1316 C C   . LEU A 1 173 ? 11.370  18.027 9.146   1.00 30.12 ? 173  LEU A C   1 
ATOM   1317 O O   . LEU A 1 173 ? 10.748  19.064 8.894   1.00 30.59 ? 173  LEU A O   1 
ATOM   1318 C CB  . LEU A 1 173 ? 10.687  15.795 8.248   1.00 31.00 ? 173  LEU A CB  1 
ATOM   1319 C CG  . LEU A 1 173 ? 9.195   16.133 8.288   1.00 30.57 ? 173  LEU A CG  1 
ATOM   1320 C CD1 . LEU A 1 173 ? 8.793   16.841 7.003   1.00 30.99 ? 173  LEU A CD1 1 
ATOM   1321 C CD2 . LEU A 1 173 ? 8.387   14.855 8.474   1.00 30.33 ? 173  LEU A CD2 1 
ATOM   1322 N N   . GLY A 1 174 ? 11.839  17.746 10.358  1.00 32.02 ? 174  GLY A N   1 
ATOM   1323 C CA  . GLY A 1 174 ? 11.645  18.685 11.449  1.00 33.04 ? 174  GLY A CA  1 
ATOM   1324 C C   . GLY A 1 174 ? 12.199  20.049 11.088  1.00 31.79 ? 174  GLY A C   1 
ATOM   1325 O O   . GLY A 1 174 ? 11.514  21.065 11.219  1.00 30.24 ? 174  GLY A O   1 
ATOM   1326 N N   . VAL A 1 175 ? 13.444  20.070 10.623  1.00 35.70 ? 175  VAL A N   1 
ATOM   1327 C CA  . VAL A 1 175 ? 14.095  21.318 10.233  1.00 37.83 ? 175  VAL A CA  1 
ATOM   1328 C C   . VAL A 1 175 ? 13.243  22.079 9.219   1.00 38.35 ? 175  VAL A C   1 
ATOM   1329 O O   . VAL A 1 175 ? 13.011  23.278 9.368   1.00 41.97 ? 175  VAL A O   1 
ATOM   1330 C CB  . VAL A 1 175 ? 15.490  21.055 9.617   1.00 38.34 ? 175  VAL A CB  1 
ATOM   1331 C CG1 . VAL A 1 175 ? 16.131  22.369 9.196   1.00 33.46 ? 175  VAL A CG1 1 
ATOM   1332 C CG2 . VAL A 1 175 ? 16.375  20.346 10.625  1.00 36.69 ? 175  VAL A CG2 1 
ATOM   1333 N N   . GLN A 1 176 ? 12.772  21.375 8.196   1.00 37.46 ? 176  GLN A N   1 
ATOM   1334 C CA  . GLN A 1 176 ? 11.942  21.987 7.164   1.00 40.36 ? 176  GLN A CA  1 
ATOM   1335 C C   . GLN A 1 176 ? 10.652  22.571 7.737   1.00 39.94 ? 176  GLN A C   1 
ATOM   1336 O O   . GLN A 1 176 ? 10.234  23.665 7.353   1.00 39.87 ? 176  GLN A O   1 
ATOM   1337 C CB  . GLN A 1 176 ? 11.620  20.955 6.079   1.00 43.23 ? 176  GLN A CB  1 
ATOM   1338 C CG  . GLN A 1 176 ? 12.848  20.479 5.313   1.00 50.22 ? 176  GLN A CG  1 
ATOM   1339 C CD  . GLN A 1 176 ? 12.574  19.263 4.445   1.00 54.94 ? 176  GLN A CD  1 
ATOM   1340 O OE1 . GLN A 1 176 ? 13.445  18.808 3.706   1.00 57.99 ? 176  GLN A OE1 1 
ATOM   1341 N NE2 . GLN A 1 176 ? 11.362  18.729 4.537   1.00 58.87 ? 176  GLN A NE2 1 
ATOM   1342 N N   . LEU A 1 177 ? 10.024  21.843 8.658   1.00 37.21 ? 177  LEU A N   1 
ATOM   1343 C CA  . LEU A 1 177 ? 8.787   22.307 9.280   1.00 33.51 ? 177  LEU A CA  1 
ATOM   1344 C C   . LEU A 1 177 ? 9.049   23.496 10.203  1.00 32.91 ? 177  LEU A C   1 
ATOM   1345 O O   . LEU A 1 177 ? 8.116   24.165 10.652  1.00 31.59 ? 177  LEU A O   1 
ATOM   1346 C CB  . LEU A 1 177 ? 8.138   21.166 10.067  1.00 32.78 ? 177  LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 177 ? 7.630   20.009 9.202   1.00 33.64 ? 177  LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 177 ? 7.292   18.795 10.070  1.00 30.97 ? 177  LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 177 ? 6.410   20.483 8.419   1.00 31.12 ? 177  LEU A CD2 1 
ATOM   1350 N N   . GLY A 1 178 ? 10.324  23.746 10.487  1.00 33.46 ? 178  GLY A N   1 
ATOM   1351 C CA  . GLY A 1 178 ? 10.692  24.864 11.338  1.00 35.98 ? 178  GLY A CA  1 
ATOM   1352 C C   . GLY A 1 178 ? 11.019  24.531 12.783  1.00 35.60 ? 178  GLY A C   1 
ATOM   1353 O O   . GLY A 1 178 ? 11.017  25.423 13.628  1.00 36.36 ? 178  GLY A O   1 
ATOM   1354 N N   . VAL A 1 179 ? 11.292  23.264 13.082  1.00 33.81 ? 179  VAL A N   1 
ATOM   1355 C CA  . VAL A 1 179 ? 11.620  22.867 14.453  1.00 34.84 ? 179  VAL A CA  1 
ATOM   1356 C C   . VAL A 1 179 ? 12.888  23.566 14.941  1.00 38.78 ? 179  VAL A C   1 
ATOM   1357 O O   . VAL A 1 179 ? 13.979  23.337 14.417  1.00 39.97 ? 179  VAL A O   1 
ATOM   1358 C CB  . VAL A 1 179 ? 11.816  21.338 14.569  1.00 33.10 ? 179  VAL A CB  1 
ATOM   1359 C CG1 . VAL A 1 179 ? 12.296  20.976 15.972  1.00 27.91 ? 179  VAL A CG1 1 
ATOM   1360 C CG2 . VAL A 1 179 ? 10.500  20.622 14.253  1.00 31.78 ? 179  VAL A CG2 1 
ATOM   1361 N N   . SER A 1 180 ? 12.732  24.407 15.960  1.00 41.88 ? 180  SER A N   1 
ATOM   1362 C CA  . SER A 1 180 ? 13.846  25.168 16.520  1.00 43.67 ? 180  SER A CA  1 
ATOM   1363 C C   . SER A 1 180 ? 14.118  24.808 17.977  1.00 44.36 ? 180  SER A C   1 
ATOM   1364 O O   . SER A 1 180 ? 14.580  25.647 18.753  1.00 44.31 ? 180  SER A O   1 
ATOM   1365 C CB  . SER A 1 180 ? 13.534  26.659 16.432  1.00 41.21 ? 180  SER A CB  1 
ATOM   1366 O OG  . SER A 1 180 ? 12.353  26.952 17.162  1.00 42.90 ? 180  SER A OG  1 
ATOM   1367 N N   . GLY A 1 181 ? 13.829  23.563 18.341  1.00 41.56 ? 181  GLY A N   1 
ATOM   1368 C CA  . GLY A 1 181 ? 14.032  23.115 19.707  1.00 35.98 ? 181  GLY A CA  1 
ATOM   1369 C C   . GLY A 1 181 ? 13.056  21.993 20.012  1.00 33.16 ? 181  GLY A C   1 
ATOM   1370 O O   . GLY A 1 181 ? 12.149  21.734 19.220  1.00 31.04 ? 181  GLY A O   1 
ATOM   1371 N N   . THR A 1 182 ? 13.228  21.327 21.150  1.00 29.61 ? 182  THR A N   1 
ATOM   1372 C CA  . THR A 1 182 ? 12.342  20.225 21.514  1.00 27.91 ? 182  THR A CA  1 
ATOM   1373 C C   . THR A 1 182 ? 11.825  20.345 22.942  1.00 27.46 ? 182  THR A C   1 
ATOM   1374 O O   . THR A 1 182 ? 12.501  20.901 23.812  1.00 28.25 ? 182  THR A O   1 
ATOM   1375 C CB  . THR A 1 182 ? 13.065  18.865 21.366  1.00 21.95 ? 182  THR A CB  1 
ATOM   1376 O OG1 . THR A 1 182 ? 14.224  18.842 22.210  1.00 24.45 ? 182  THR A OG1 1 
ATOM   1377 C CG2 . THR A 1 182 ? 13.502  18.651 19.930  1.00 24.36 ? 182  THR A CG2 1 
ATOM   1378 N N   . PRO A 1 183 ? 10.605  19.839 23.200  1.00 24.64 ? 183  PRO A N   1 
ATOM   1379 C CA  . PRO A 1 183 ? 9.737   19.189 22.213  1.00 24.44 ? 183  PRO A CA  1 
ATOM   1380 C C   . PRO A 1 183 ? 9.032   20.206 21.323  1.00 23.73 ? 183  PRO A C   1 
ATOM   1381 O O   . PRO A 1 183 ? 8.780   21.341 21.733  1.00 28.36 ? 183  PRO A O   1 
ATOM   1382 C CB  . PRO A 1 183 ? 8.750   18.414 23.081  1.00 24.54 ? 183  PRO A CB  1 
ATOM   1383 C CG  . PRO A 1 183 ? 8.597   19.314 24.262  1.00 27.57 ? 183  PRO A CG  1 
ATOM   1384 C CD  . PRO A 1 183 ? 10.027  19.726 24.551  1.00 21.51 ? 183  PRO A CD  1 
ATOM   1385 N N   . ALA A 1 184 ? 8.730   19.791 20.100  1.00 24.37 ? 184  ALA A N   1 
ATOM   1386 C CA  . ALA A 1 184 ? 8.037   20.641 19.142  1.00 23.08 ? 184  ALA A CA  1 
ATOM   1387 C C   . ALA A 1 184 ? 6.837   19.857 18.634  1.00 23.14 ? 184  ALA A C   1 
ATOM   1388 O O   . ALA A 1 184 ? 6.960   18.713 18.178  1.00 23.94 ? 184  ALA A O   1 
ATOM   1389 C CB  . ALA A 1 184 ? 8.963   21.019 17.986  1.00 22.95 ? 184  ALA A CB  1 
ATOM   1390 N N   . VAL A 1 185 ? 5.675   20.485 18.719  1.00 23.48 ? 185  VAL A N   1 
ATOM   1391 C CA  . VAL A 1 185 ? 4.429   19.865 18.307  1.00 24.62 ? 185  VAL A CA  1 
ATOM   1392 C C   . VAL A 1 185 ? 3.994   20.261 16.901  1.00 27.95 ? 185  VAL A C   1 
ATOM   1393 O O   . VAL A 1 185 ? 4.025   21.435 16.543  1.00 26.39 ? 185  VAL A O   1 
ATOM   1394 C CB  . VAL A 1 185 ? 3.299   20.249 19.292  1.00 23.60 ? 185  VAL A CB  1 
ATOM   1395 C CG1 . VAL A 1 185 ? 2.000   19.561 18.900  1.00 26.29 ? 185  VAL A CG1 1 
ATOM   1396 C CG2 . VAL A 1 185 ? 3.705   19.883 20.714  1.00 26.54 ? 185  VAL A CG2 1 
ATOM   1397 N N   . VAL A 1 186 ? 3.606   19.274 16.099  1.00 26.06 ? 186  VAL A N   1 
ATOM   1398 C CA  . VAL A 1 186 ? 3.106   19.554 14.761  1.00 26.68 ? 186  VAL A CA  1 
ATOM   1399 C C   . VAL A 1 186 ? 1.631   19.182 14.797  1.00 28.37 ? 186  VAL A C   1 
ATOM   1400 O O   . VAL A 1 186 ? 1.277   18.032 15.071  1.00 24.66 ? 186  VAL A O   1 
ATOM   1401 C CB  . VAL A 1 186 ? 3.809   18.721 13.662  1.00 26.05 ? 186  VAL A CB  1 
ATOM   1402 C CG1 . VAL A 1 186 ? 3.152   18.996 12.306  1.00 30.01 ? 186  VAL A CG1 1 
ATOM   1403 C CG2 . VAL A 1 186 ? 5.276   19.082 13.591  1.00 31.11 ? 186  VAL A CG2 1 
ATOM   1404 N N   . LEU A 1 187 ? 0.771   20.162 14.541  1.00 27.67 ? 187  LEU A N   1 
ATOM   1405 C CA  . LEU A 1 187 ? -0.667  19.928 14.556  1.00 30.78 ? 187  LEU A CA  1 
ATOM   1406 C C   . LEU A 1 187 ? -1.111  19.192 13.301  1.00 31.88 ? 187  LEU A C   1 
ATOM   1407 O O   . LEU A 1 187 ? -0.386  19.150 12.305  1.00 29.90 ? 187  LEU A O   1 
ATOM   1408 C CB  . LEU A 1 187 ? -1.406  21.263 14.691  1.00 29.48 ? 187  LEU A CB  1 
ATOM   1409 C CG  . LEU A 1 187 ? -0.993  22.056 15.937  1.00 33.52 ? 187  LEU A CG  1 
ATOM   1410 C CD1 . LEU A 1 187 ? -1.722  23.387 15.978  1.00 32.14 ? 187  LEU A CD1 1 
ATOM   1411 C CD2 . LEU A 1 187 ? -1.294  21.245 17.187  1.00 29.63 ? 187  LEU A CD2 1 
ATOM   1412 N N   . SER A 1 188 ? -2.306  18.609 13.356  1.00 31.93 ? 188  SER A N   1 
ATOM   1413 C CA  . SER A 1 188 ? -2.848  17.853 12.234  1.00 34.98 ? 188  SER A CA  1 
ATOM   1414 C C   . SER A 1 188 ? -3.009  18.668 10.950  1.00 35.76 ? 188  SER A C   1 
ATOM   1415 O O   . SER A 1 188 ? -3.294  18.105 9.893   1.00 37.78 ? 188  SER A O   1 
ATOM   1416 C CB  . SER A 1 188 ? -4.195  17.230 12.623  1.00 37.50 ? 188  SER A CB  1 
ATOM   1417 O OG  . SER A 1 188 ? -5.167  18.227 12.881  1.00 42.18 ? 188  SER A OG  1 
ATOM   1418 N N   . ASN A 1 189 ? -2.825  19.984 11.040  1.00 35.28 ? 189  ASN A N   1 
ATOM   1419 C CA  . ASN A 1 189 ? -2.942  20.862 9.877   1.00 37.69 ? 189  ASN A CA  1 
ATOM   1420 C C   . ASN A 1 189 ? -1.574  21.380 9.423   1.00 37.38 ? 189  ASN A C   1 
ATOM   1421 O O   . ASN A 1 189 ? -1.479  22.158 8.469   1.00 37.57 ? 189  ASN A O   1 
ATOM   1422 C CB  . ASN A 1 189 ? -3.857  22.052 10.197  1.00 42.07 ? 189  ASN A CB  1 
ATOM   1423 C CG  . ASN A 1 189 ? -3.183  23.092 11.078  1.00 43.51 ? 189  ASN A CG  1 
ATOM   1424 O OD1 . ASN A 1 189 ? -2.483  22.757 12.031  1.00 42.89 ? 189  ASN A OD1 1 
ATOM   1425 N ND2 . ASN A 1 189 ? -3.406  24.362 10.767  1.00 46.33 ? 189  ASN A ND2 1 
ATOM   1426 N N   . GLY A 1 190 ? -0.519  20.960 10.117  1.00 32.62 ? 190  GLY A N   1 
ATOM   1427 C CA  . GLY A 1 190 ? 0.819   21.391 9.747   1.00 32.70 ? 190  GLY A CA  1 
ATOM   1428 C C   . GLY A 1 190 ? 1.407   22.500 10.602  1.00 32.04 ? 190  GLY A C   1 
ATOM   1429 O O   . GLY A 1 190 ? 2.601   22.778 10.517  1.00 32.26 ? 190  GLY A O   1 
ATOM   1430 N N   . THR A 1 191 ? 0.578   23.136 11.426  1.00 29.86 ? 191  THR A N   1 
ATOM   1431 C CA  . THR A 1 191 ? 1.050   24.208 12.294  1.00 32.90 ? 191  THR A CA  1 
ATOM   1432 C C   . THR A 1 191 ? 2.091   23.691 13.284  1.00 31.17 ? 191  THR A C   1 
ATOM   1433 O O   . THR A 1 191 ? 1.847   22.720 13.999  1.00 30.53 ? 191  THR A O   1 
ATOM   1434 C CB  . THR A 1 191 ? -0.101  24.816 13.117  1.00 34.31 ? 191  THR A CB  1 
ATOM   1435 O OG1 . THR A 1 191 ? -1.155  25.225 12.239  1.00 40.22 ? 191  THR A OG1 1 
ATOM   1436 C CG2 . THR A 1 191 ? 0.396   26.023 13.912  1.00 36.23 ? 191  THR A CG2 1 
ATOM   1437 N N   . LEU A 1 192 ? 3.247   24.341 13.328  1.00 29.52 ? 192  LEU A N   1 
ATOM   1438 C CA  . LEU A 1 192 ? 4.302   23.943 14.251  1.00 32.05 ? 192  LEU A CA  1 
ATOM   1439 C C   . LEU A 1 192 ? 4.208   24.782 15.524  1.00 33.55 ? 192  LEU A C   1 
ATOM   1440 O O   . LEU A 1 192 ? 4.213   26.013 15.468  1.00 33.99 ? 192  LEU A O   1 
ATOM   1441 C CB  . LEU A 1 192 ? 5.683   24.135 13.613  1.00 34.08 ? 192  LEU A CB  1 
ATOM   1442 C CG  . LEU A 1 192 ? 6.890   23.715 14.465  1.00 36.81 ? 192  LEU A CG  1 
ATOM   1443 C CD1 . LEU A 1 192 ? 6.887   22.207 14.677  1.00 36.05 ? 192  LEU A CD1 1 
ATOM   1444 C CD2 . LEU A 1 192 ? 8.166   24.132 13.776  1.00 39.83 ? 192  LEU A CD2 1 
ATOM   1445 N N   . VAL A 1 193 ? 4.111   24.111 16.668  1.00 31.51 ? 193  VAL A N   1 
ATOM   1446 C CA  . VAL A 1 193 ? 4.027   24.800 17.954  1.00 32.44 ? 193  VAL A CA  1 
ATOM   1447 C C   . VAL A 1 193 ? 5.177   24.330 18.838  1.00 32.31 ? 193  VAL A C   1 
ATOM   1448 O O   . VAL A 1 193 ? 5.063   23.335 19.555  1.00 32.23 ? 193  VAL A O   1 
ATOM   1449 C CB  . VAL A 1 193 ? 2.690   24.506 18.665  1.00 31.85 ? 193  VAL A CB  1 
ATOM   1450 C CG1 . VAL A 1 193 ? 2.613   25.283 19.981  1.00 32.46 ? 193  VAL A CG1 1 
ATOM   1451 C CG2 . VAL A 1 193 ? 1.529   24.875 17.756  1.00 31.63 ? 193  VAL A CG2 1 
ATOM   1452 N N   . PRO A 1 194 ? 6.311   25.040 18.787  1.00 33.98 ? 194  PRO A N   1 
ATOM   1453 C CA  . PRO A 1 194 ? 7.479   24.676 19.592  1.00 35.14 ? 194  PRO A CA  1 
ATOM   1454 C C   . PRO A 1 194 ? 7.241   24.825 21.087  1.00 33.42 ? 194  PRO A C   1 
ATOM   1455 O O   . PRO A 1 194 ? 6.520   25.728 21.523  1.00 33.54 ? 194  PRO A O   1 
ATOM   1456 C CB  . PRO A 1 194 ? 8.557   25.642 19.097  1.00 34.88 ? 194  PRO A CB  1 
ATOM   1457 C CG  . PRO A 1 194 ? 8.125   25.959 17.694  1.00 35.33 ? 194  PRO A CG  1 
ATOM   1458 C CD  . PRO A 1 194 ? 6.642   26.135 17.858  1.00 35.54 ? 194  PRO A CD  1 
ATOM   1459 N N   . GLY A 1 195 ? 7.836   23.929 21.867  1.00 28.50 ? 195  GLY A N   1 
ATOM   1460 C CA  . GLY A 1 195 ? 7.708   24.026 23.307  1.00 30.94 ? 195  GLY A CA  1 
ATOM   1461 C C   . GLY A 1 195 ? 6.893   22.991 24.055  1.00 31.27 ? 195  GLY A C   1 
ATOM   1462 O O   . GLY A 1 195 ? 6.027   22.308 23.505  1.00 32.12 ? 195  GLY A O   1 
ATOM   1463 N N   . TYR A 1 196 ? 7.187   22.902 25.345  1.00 31.58 ? 196  TYR A N   1 
ATOM   1464 C CA  . TYR A 1 196 ? 6.519   21.987 26.246  1.00 29.43 ? 196  TYR A CA  1 
ATOM   1465 C C   . TYR A 1 196 ? 5.275   22.625 26.862  1.00 33.97 ? 196  TYR A C   1 
ATOM   1466 O O   . TYR A 1 196 ? 5.287   23.793 27.258  1.00 31.60 ? 196  TYR A O   1 
ATOM   1467 C CB  . TYR A 1 196 ? 7.474   21.581 27.370  1.00 30.37 ? 196  TYR A CB  1 
ATOM   1468 C CG  . TYR A 1 196 ? 6.778   21.007 28.582  1.00 31.14 ? 196  TYR A CG  1 
ATOM   1469 C CD1 . TYR A 1 196 ? 6.217   19.730 28.553  1.00 31.65 ? 196  TYR A CD1 1 
ATOM   1470 C CD2 . TYR A 1 196 ? 6.649   21.757 29.751  1.00 34.17 ? 196  TYR A CD2 1 
ATOM   1471 C CE1 . TYR A 1 196 ? 5.544   19.217 29.655  1.00 30.55 ? 196  TYR A CE1 1 
ATOM   1472 C CE2 . TYR A 1 196 ? 5.975   21.254 30.857  1.00 32.43 ? 196  TYR A CE2 1 
ATOM   1473 C CZ  . TYR A 1 196 ? 5.425   19.985 30.804  1.00 33.20 ? 196  TYR A CZ  1 
ATOM   1474 O OH  . TYR A 1 196 ? 4.755   19.489 31.896  1.00 31.91 ? 196  TYR A OH  1 
ATOM   1475 N N   . GLN A 1 197 ? 4.208   21.839 26.939  1.00 34.11 ? 197  GLN A N   1 
ATOM   1476 C CA  . GLN A 1 197 ? 2.956   22.273 27.541  1.00 36.07 ? 197  GLN A CA  1 
ATOM   1477 C C   . GLN A 1 197 ? 2.437   21.094 28.350  1.00 34.68 ? 197  GLN A C   1 
ATOM   1478 O O   . GLN A 1 197 ? 2.375   19.973 27.846  1.00 33.44 ? 197  GLN A O   1 
ATOM   1479 C CB  . GLN A 1 197 ? 1.926   22.642 26.473  1.00 36.39 ? 197  GLN A CB  1 
ATOM   1480 C CG  . GLN A 1 197 ? 2.339   23.780 25.558  1.00 39.30 ? 197  GLN A CG  1 
ATOM   1481 C CD  . GLN A 1 197 ? 1.224   24.180 24.610  1.00 41.91 ? 197  GLN A CD  1 
ATOM   1482 O OE1 . GLN A 1 197 ? 0.154   24.611 25.043  1.00 43.56 ? 197  GLN A OE1 1 
ATOM   1483 N NE2 . GLN A 1 197 ? 1.466   24.034 23.310  1.00 39.77 ? 197  GLN A NE2 1 
ATOM   1484 N N   . PRO A 1 198 ? 2.084   21.325 29.624  1.00 36.20 ? 198  PRO A N   1 
ATOM   1485 C CA  . PRO A 1 198 ? 1.568   20.255 30.482  1.00 35.38 ? 198  PRO A CA  1 
ATOM   1486 C C   . PRO A 1 198 ? 0.259   19.760 29.882  1.00 33.54 ? 198  PRO A C   1 
ATOM   1487 O O   . PRO A 1 198 ? -0.401  20.494 29.149  1.00 32.11 ? 198  PRO A O   1 
ATOM   1488 C CB  . PRO A 1 198 ? 1.358   20.955 31.825  1.00 35.64 ? 198  PRO A CB  1 
ATOM   1489 C CG  . PRO A 1 198 ? 2.365   22.063 31.797  1.00 37.50 ? 198  PRO A CG  1 
ATOM   1490 C CD  . PRO A 1 198 ? 2.240   22.575 30.386  1.00 37.43 ? 198  PRO A CD  1 
ATOM   1491 N N   . PRO A 1 199 ? -0.133  18.514 30.188  1.00 34.20 ? 199  PRO A N   1 
ATOM   1492 C CA  . PRO A 1 199 ? -1.365  17.906 29.681  1.00 35.40 ? 199  PRO A CA  1 
ATOM   1493 C C   . PRO A 1 199 ? -2.595  18.814 29.685  1.00 37.52 ? 199  PRO A C   1 
ATOM   1494 O O   . PRO A 1 199 ? -3.265  18.961 28.661  1.00 36.13 ? 199  PRO A O   1 
ATOM   1495 C CB  . PRO A 1 199 ? -1.533  16.688 30.581  1.00 36.33 ? 199  PRO A CB  1 
ATOM   1496 C CG  . PRO A 1 199 ? -0.110  16.269 30.807  1.00 34.37 ? 199  PRO A CG  1 
ATOM   1497 C CD  . PRO A 1 199 ? 0.559   17.592 31.108  1.00 34.69 ? 199  PRO A CD  1 
ATOM   1498 N N   . LYS A 1 200 ? -2.893  19.420 30.830  1.00 39.15 ? 200  LYS A N   1 
ATOM   1499 C CA  . LYS A 1 200 ? -4.057  20.296 30.930  1.00 42.15 ? 200  LYS A CA  1 
ATOM   1500 C C   . LYS A 1 200 ? -3.970  21.468 29.964  1.00 40.56 ? 200  LYS A C   1 
ATOM   1501 O O   . LYS A 1 200 ? -4.901  21.723 29.198  1.00 40.54 ? 200  LYS A O   1 
ATOM   1502 C CB  . LYS A 1 200 ? -4.212  20.822 32.362  1.00 42.61 ? 200  LYS A CB  1 
ATOM   1503 C CG  . LYS A 1 200 ? -4.589  19.761 33.381  1.00 46.14 ? 200  LYS A CG  1 
ATOM   1504 C CD  . LYS A 1 200 ? -4.638  20.339 34.789  1.00 50.26 ? 200  LYS A CD  1 
ATOM   1505 C CE  . LYS A 1 200 ? -5.611  21.507 34.887  1.00 50.68 ? 200  LYS A CE  1 
ATOM   1506 N NZ  . LYS A 1 200 ? -5.650  22.083 36.262  1.00 53.09 ? 200  LYS A NZ  1 
ATOM   1507 N N   . GLU A 1 201 ? -2.852  22.183 30.005  1.00 39.88 ? 201  GLU A N   1 
ATOM   1508 C CA  . GLU A 1 201 ? -2.657  23.332 29.131  1.00 40.90 ? 201  GLU A CA  1 
ATOM   1509 C C   . GLU A 1 201 ? -2.660  22.916 27.663  1.00 38.86 ? 201  GLU A C   1 
ATOM   1510 O O   . GLU A 1 201 ? -3.278  23.574 26.822  1.00 39.00 ? 201  GLU A O   1 
ATOM   1511 C CB  . GLU A 1 201 ? -1.342  24.047 29.475  1.00 45.22 ? 201  GLU A CB  1 
ATOM   1512 C CG  . GLU A 1 201 ? -1.337  24.737 30.841  1.00 52.12 ? 201  GLU A CG  1 
ATOM   1513 C CD  . GLU A 1 201 ? -1.023  23.794 31.996  1.00 56.48 ? 201  GLU A CD  1 
ATOM   1514 O OE1 . GLU A 1 201 ? -1.697  22.753 32.134  1.00 57.72 ? 201  GLU A OE1 1 
ATOM   1515 O OE2 . GLU A 1 201 ? -0.099  24.103 32.777  1.00 61.16 ? 201  GLU A OE2 1 
ATOM   1516 N N   . MET A 1 202 ? -1.968  21.821 27.362  1.00 34.61 ? 202  MET A N   1 
ATOM   1517 C CA  . MET A 1 202 ? -1.892  21.301 25.999  1.00 34.59 ? 202  MET A CA  1 
ATOM   1518 C C   . MET A 1 202 ? -3.297  21.057 25.455  1.00 34.01 ? 202  MET A C   1 
ATOM   1519 O O   . MET A 1 202 ? -3.626  21.467 24.337  1.00 32.76 ? 202  MET A O   1 
ATOM   1520 C CB  . MET A 1 202 ? -1.103  19.984 25.981  1.00 32.60 ? 202  MET A CB  1 
ATOM   1521 C CG  . MET A 1 202 ? -0.901  19.384 24.597  1.00 34.10 ? 202  MET A CG  1 
ATOM   1522 S SD  . MET A 1 202 ? 0.201   20.358 23.547  1.00 38.81 ? 202  MET A SD  1 
ATOM   1523 C CE  . MET A 1 202 ? 1.798   19.720 24.072  1.00 36.04 ? 202  MET A CE  1 
ATOM   1524 N N   . LYS A 1 203 ? -4.117  20.380 26.254  1.00 32.65 ? 203  LYS A N   1 
ATOM   1525 C CA  . LYS A 1 203 ? -5.489  20.072 25.866  1.00 34.52 ? 203  LYS A CA  1 
ATOM   1526 C C   . LYS A 1 203 ? -6.277  21.345 25.574  1.00 35.50 ? 203  LYS A C   1 
ATOM   1527 O O   . LYS A 1 203 ? -6.986  21.432 24.571  1.00 34.93 ? 203  LYS A O   1 
ATOM   1528 C CB  . LYS A 1 203 ? -6.193  19.283 26.973  1.00 32.97 ? 203  LYS A CB  1 
ATOM   1529 C CG  . LYS A 1 203 ? -7.669  19.021 26.692  1.00 34.02 ? 203  LYS A CG  1 
ATOM   1530 C CD  . LYS A 1 203 ? -7.856  18.198 25.433  1.00 36.10 ? 203  LYS A CD  1 
ATOM   1531 C CE  . LYS A 1 203 ? -9.296  18.243 24.943  1.00 42.07 ? 203  LYS A CE  1 
ATOM   1532 N NZ  . LYS A 1 203 ? -10.286 17.939 26.011  1.00 43.36 ? 203  LYS A NZ  1 
ATOM   1533 N N   . GLU A 1 204 ? -6.153  22.330 26.456  1.00 37.52 ? 204  GLU A N   1 
ATOM   1534 C CA  . GLU A 1 204 ? -6.859  23.589 26.278  1.00 38.78 ? 204  GLU A CA  1 
ATOM   1535 C C   . GLU A 1 204 ? -6.379  24.282 25.009  1.00 37.96 ? 204  GLU A C   1 
ATOM   1536 O O   . GLU A 1 204 ? -7.176  24.857 24.265  1.00 36.36 ? 204  GLU A O   1 
ATOM   1537 C CB  . GLU A 1 204 ? -6.638  24.498 27.489  1.00 41.78 ? 204  GLU A CB  1 
ATOM   1538 C CG  . GLU A 1 204 ? -7.401  25.807 27.409  1.00 49.13 ? 204  GLU A CG  1 
ATOM   1539 C CD  . GLU A 1 204 ? -8.883  25.594 27.171  1.00 52.45 ? 204  GLU A CD  1 
ATOM   1540 O OE1 . GLU A 1 204 ? -9.536  24.942 28.014  1.00 55.08 ? 204  GLU A OE1 1 
ATOM   1541 O OE2 . GLU A 1 204 ? -9.394  26.074 26.137  1.00 56.48 ? 204  GLU A OE2 1 
ATOM   1542 N N   . PHE A 1 205 ? -5.074  24.223 24.761  1.00 36.74 ? 205  PHE A N   1 
ATOM   1543 C CA  . PHE A 1 205 ? -4.504  24.841 23.572  1.00 34.65 ? 205  PHE A CA  1 
ATOM   1544 C C   . PHE A 1 205 ? -5.068  24.207 22.302  1.00 34.47 ? 205  PHE A C   1 
ATOM   1545 O O   . PHE A 1 205 ? -5.469  24.902 21.368  1.00 35.68 ? 205  PHE A O   1 
ATOM   1546 C CB  . PHE A 1 205 ? -2.982  24.702 23.568  1.00 36.95 ? 205  PHE A CB  1 
ATOM   1547 C CG  . PHE A 1 205 ? -2.344  25.189 22.303  1.00 39.54 ? 205  PHE A CG  1 
ATOM   1548 C CD1 . PHE A 1 205 ? -2.238  26.552 22.041  1.00 41.07 ? 205  PHE A CD1 1 
ATOM   1549 C CD2 . PHE A 1 205 ? -1.901  24.286 21.342  1.00 38.94 ? 205  PHE A CD2 1 
ATOM   1550 C CE1 . PHE A 1 205 ? -1.704  27.009 20.838  1.00 42.50 ? 205  PHE A CE1 1 
ATOM   1551 C CE2 . PHE A 1 205 ? -1.366  24.732 20.137  1.00 40.89 ? 205  PHE A CE2 1 
ATOM   1552 C CZ  . PHE A 1 205 ? -1.268  26.097 19.885  1.00 42.02 ? 205  PHE A CZ  1 
ATOM   1553 N N   . LEU A 1 206 ? -5.091  22.882 22.264  1.00 31.86 ? 206  LEU A N   1 
ATOM   1554 C CA  . LEU A 1 206 ? -5.605  22.180 21.102  1.00 32.43 ? 206  LEU A CA  1 
ATOM   1555 C C   . LEU A 1 206 ? -7.079  22.505 20.873  1.00 34.71 ? 206  LEU A C   1 
ATOM   1556 O O   . LEU A 1 206 ? -7.496  22.757 19.743  1.00 34.88 ? 206  LEU A O   1 
ATOM   1557 C CB  . LEU A 1 206 ? -5.410  20.671 21.276  1.00 31.50 ? 206  LEU A CB  1 
ATOM   1558 C CG  . LEU A 1 206 ? -3.939  20.232 21.321  1.00 30.91 ? 206  LEU A CG  1 
ATOM   1559 C CD1 . LEU A 1 206 ? -3.841  18.753 21.671  1.00 27.83 ? 206  LEU A CD1 1 
ATOM   1560 C CD2 . LEU A 1 206 ? -3.289  20.515 19.972  1.00 29.06 ? 206  LEU A CD2 1 
ATOM   1561 N N   . ASP A 1 207 ? -7.867  22.505 21.943  1.00 37.65 ? 207  ASP A N   1 
ATOM   1562 C CA  . ASP A 1 207 ? -9.289  22.810 21.824  1.00 40.78 ? 207  ASP A CA  1 
ATOM   1563 C C   . ASP A 1 207 ? -9.521  24.201 21.255  1.00 41.66 ? 207  ASP A C   1 
ATOM   1564 O O   . ASP A 1 207 ? -10.327 24.379 20.344  1.00 43.81 ? 207  ASP A O   1 
ATOM   1565 C CB  . ASP A 1 207 ? -9.984  22.704 23.181  1.00 39.23 ? 207  ASP A CB  1 
ATOM   1566 C CG  . ASP A 1 207 ? -10.013 21.290 23.709  1.00 40.47 ? 207  ASP A CG  1 
ATOM   1567 O OD1 . ASP A 1 207 ? -10.000 20.350 22.884  1.00 36.66 ? 207  ASP A OD1 1 
ATOM   1568 O OD2 . ASP A 1 207 ? -10.065 21.121 24.946  1.00 41.98 ? 207  ASP A OD2 1 
ATOM   1569 N N   . GLU A 1 208 ? -8.819  25.188 21.797  1.00 45.32 ? 208  GLU A N   1 
ATOM   1570 C CA  . GLU A 1 208 ? -8.974  26.557 21.324  1.00 48.73 ? 208  GLU A CA  1 
ATOM   1571 C C   . GLU A 1 208 ? -8.461  26.702 19.901  1.00 50.16 ? 208  GLU A C   1 
ATOM   1572 O O   . GLU A 1 208 ? -8.986  27.502 19.124  1.00 48.80 ? 208  GLU A O   1 
ATOM   1573 C CB  . GLU A 1 208 ? -8.241  27.531 22.250  1.00 50.99 ? 208  GLU A CB  1 
ATOM   1574 C CG  . GLU A 1 208 ? -8.876  27.667 23.626  1.00 56.20 ? 208  GLU A CG  1 
ATOM   1575 C CD  . GLU A 1 208 ? -10.348 28.044 23.553  1.00 60.25 ? 208  GLU A CD  1 
ATOM   1576 O OE1 . GLU A 1 208 ? -10.672 29.066 22.908  1.00 61.60 ? 208  GLU A OE1 1 
ATOM   1577 O OE2 . GLU A 1 208 ? -11.181 27.321 24.143  1.00 62.04 ? 208  GLU A OE2 1 
ATOM   1578 N N   . HIS A 1 209 ? -7.437  25.929 19.557  1.00 50.40 ? 209  HIS A N   1 
ATOM   1579 C CA  . HIS A 1 209 ? -6.884  25.991 18.212  1.00 52.34 ? 209  HIS A CA  1 
ATOM   1580 C C   . HIS A 1 209 ? -7.916  25.504 17.204  1.00 54.46 ? 209  HIS A C   1 
ATOM   1581 O O   . HIS A 1 209 ? -8.024  26.045 16.104  1.00 55.69 ? 209  HIS A O   1 
ATOM   1582 C CB  . HIS A 1 209 ? -5.611  25.147 18.110  1.00 52.25 ? 209  HIS A CB  1 
ATOM   1583 C CG  . HIS A 1 209 ? -5.077  25.035 16.718  1.00 52.60 ? 209  HIS A CG  1 
ATOM   1584 N ND1 . HIS A 1 209 ? -5.599  24.160 15.789  1.00 52.77 ? 209  HIS A ND1 1 
ATOM   1585 C CD2 . HIS A 1 209 ? -4.094  25.715 16.083  1.00 52.31 ? 209  HIS A CD2 1 
ATOM   1586 C CE1 . HIS A 1 209 ? -4.961  24.307 14.642  1.00 53.07 ? 209  HIS A CE1 1 
ATOM   1587 N NE2 . HIS A 1 209 ? -4.043  25.244 14.794  1.00 52.15 ? 209  HIS A NE2 1 
ATOM   1588 N N   . GLN A 1 210 ? -8.675  24.482 17.587  1.00 56.08 ? 210  GLN A N   1 
ATOM   1589 C CA  . GLN A 1 210 ? -9.713  23.932 16.723  1.00 60.07 ? 210  GLN A CA  1 
ATOM   1590 C C   . GLN A 1 210 ? -10.752 25.008 16.426  1.00 62.18 ? 210  GLN A C   1 
ATOM   1591 O O   . GLN A 1 210 ? -11.063 25.291 15.269  1.00 61.77 ? 210  GLN A O   1 
ATOM   1592 C CB  . GLN A 1 210 ? -10.397 22.747 17.406  1.00 61.29 ? 210  GLN A CB  1 
ATOM   1593 C CG  . GLN A 1 210 ? -9.499  21.545 17.629  1.00 64.81 ? 210  GLN A CG  1 
ATOM   1594 C CD  . GLN A 1 210 ? -9.313  20.716 16.375  1.00 65.90 ? 210  GLN A CD  1 
ATOM   1595 O OE1 . GLN A 1 210 ? -8.900  21.225 15.332  1.00 67.22 ? 210  GLN A OE1 1 
ATOM   1596 N NE2 . GLN A 1 210 ? -9.615  19.427 16.473  1.00 66.24 ? 210  GLN A NE2 1 
ATOM   1597 N N   . LYS A 1 211 ? -11.281 25.610 17.485  1.00 64.34 ? 211  LYS A N   1 
ATOM   1598 C CA  . LYS A 1 211 ? -12.293 26.650 17.356  1.00 66.74 ? 211  LYS A CA  1 
ATOM   1599 C C   . LYS A 1 211 ? -11.793 27.878 16.598  1.00 68.03 ? 211  LYS A C   1 
ATOM   1600 O O   . LYS A 1 211 ? -12.480 28.391 15.715  1.00 68.74 ? 211  LYS A O   1 
ATOM   1601 C CB  . LYS A 1 211 ? -12.789 27.060 18.743  1.00 67.16 ? 211  LYS A CB  1 
ATOM   1602 C CG  . LYS A 1 211 ? -13.398 25.914 19.532  1.00 68.03 ? 211  LYS A CG  1 
ATOM   1603 C CD  . LYS A 1 211 ? -13.735 26.329 20.953  1.00 70.42 ? 211  LYS A CD  1 
ATOM   1604 C CE  . LYS A 1 211 ? -14.270 25.153 21.757  1.00 71.41 ? 211  LYS A CE  1 
ATOM   1605 N NZ  . LYS A 1 211 ? -14.533 25.524 23.176  1.00 72.16 ? 211  LYS A NZ  1 
ATOM   1606 N N   . MET A 1 212 ? -10.597 28.346 16.938  1.00 69.93 ? 212  MET A N   1 
ATOM   1607 C CA  . MET A 1 212 ? -10.032 29.519 16.282  1.00 73.03 ? 212  MET A CA  1 
ATOM   1608 C C   . MET A 1 212 ? -9.663  29.258 14.824  1.00 74.46 ? 212  MET A C   1 
ATOM   1609 O O   . MET A 1 212 ? -9.552  30.192 14.029  1.00 75.28 ? 212  MET A O   1 
ATOM   1610 C CB  . MET A 1 212 ? -8.800  30.011 17.046  1.00 74.54 ? 212  MET A CB  1 
ATOM   1611 C CG  . MET A 1 212 ? -9.097  30.468 18.466  1.00 76.96 ? 212  MET A CG  1 
ATOM   1612 S SD  . MET A 1 212 ? -7.667  31.226 19.268  1.00 81.35 ? 212  MET A SD  1 
ATOM   1613 C CE  . MET A 1 212 ? -6.848  29.784 19.944  1.00 80.00 ? 212  MET A CE  1 
ATOM   1614 N N   . THR A 1 213 ? -9.474  27.989 14.476  1.00 75.39 ? 213  THR A N   1 
ATOM   1615 C CA  . THR A 1 213 ? -9.120  27.615 13.110  1.00 76.57 ? 213  THR A CA  1 
ATOM   1616 C C   . THR A 1 213 ? -10.371 27.209 12.334  1.00 77.28 ? 213  THR A C   1 
ATOM   1617 O O   . THR A 1 213 ? -10.385 27.225 11.103  1.00 77.41 ? 213  THR A O   1 
ATOM   1618 C CB  . THR A 1 213 ? -8.115  26.441 13.097  1.00 77.08 ? 213  THR A CB  1 
ATOM   1619 O OG1 . THR A 1 213 ? -6.937  26.813 13.823  1.00 78.01 ? 213  THR A OG1 1 
ATOM   1620 C CG2 . THR A 1 213 ? -7.724  26.085 11.670  1.00 77.53 ? 213  THR A CG2 1 
ATOM   1621 N N   . SER A 1 214 ? -11.420 26.849 13.066  1.00 77.71 ? 214  SER A N   1 
ATOM   1622 C CA  . SER A 1 214 ? -12.680 26.443 12.457  1.00 77.87 ? 214  SER A CA  1 
ATOM   1623 C C   . SER A 1 214 ? -13.575 27.666 12.274  1.00 78.04 ? 214  SER A C   1 
ATOM   1624 O O   . SER A 1 214 ? -13.607 28.266 11.199  1.00 77.94 ? 214  SER A O   1 
ATOM   1625 C CB  . SER A 1 214 ? -13.381 25.406 13.341  1.00 77.99 ? 214  SER A CB  1 
ATOM   1626 O OG  . SER A 1 214 ? -14.553 24.907 12.721  1.00 78.98 ? 214  SER A OG  1 
ATOM   1627 N N   . GLY A 1 215 ? -14.295 28.034 13.329  1.00 78.24 ? 215  GLY A N   1 
ATOM   1628 C CA  . GLY A 1 215 ? -15.170 29.190 13.254  1.00 78.85 ? 215  GLY A CA  1 
ATOM   1629 C C   . GLY A 1 215 ? -16.512 28.992 13.933  1.00 79.37 ? 215  GLY A C   1 
ATOM   1630 O O   . GLY A 1 215 ? -17.541 29.436 13.424  1.00 79.45 ? 215  GLY A O   1 
ATOM   1631 N N   . LYS A 1 216 ? -16.504 28.328 15.085  1.00 79.91 ? 216  LYS A N   1 
ATOM   1632 C CA  . LYS A 1 216 ? -17.732 28.079 15.833  1.00 80.02 ? 216  LYS A CA  1 
ATOM   1633 C C   . LYS A 1 216 ? -17.503 28.201 17.337  1.00 80.31 ? 216  LYS A C   1 
ATOM   1634 O O   . LYS A 1 216 ? -16.369 28.539 17.735  1.00 80.45 ? 216  LYS A O   1 
ATOM   1635 C CB  . LYS A 1 216 ? -18.282 26.687 15.506  1.00 79.58 ? 216  LYS A CB  1 
ATOM   1636 C CG  . LYS A 1 216 ? -18.717 26.517 14.057  1.00 78.60 ? 216  LYS A CG  1 
ATOM   1637 C CD  . LYS A 1 216 ? -19.298 25.133 13.806  1.00 77.61 ? 216  LYS A CD  1 
ATOM   1638 C CE  . LYS A 1 216 ? -19.742 24.980 12.358  1.00 77.66 ? 216  LYS A CE  1 
ATOM   1639 N NZ  . LYS A 1 216 ? -20.317 23.633 12.083  1.00 77.75 ? 216  LYS A NZ  1 
ATOM   1640 O OXT . LYS A 1 216 ? -18.463 27.960 18.099  1.00 81.87 ? 216  LYS A OXT 1 
ATOM   1641 N N   . ASP B 1 1   ? -2.010  45.240 -5.701  1.00 47.92 ? 1    ASP B N   1 
ATOM   1642 C CA  . ASP B 1 1   ? -2.801  46.284 -4.991  1.00 49.44 ? 1    ASP B CA  1 
ATOM   1643 C C   . ASP B 1 1   ? -2.218  46.576 -3.609  1.00 49.22 ? 1    ASP B C   1 
ATOM   1644 O O   . ASP B 1 1   ? -2.456  45.839 -2.650  1.00 48.44 ? 1    ASP B O   1 
ATOM   1645 C CB  . ASP B 1 1   ? -4.256  45.833 -4.855  1.00 52.66 ? 1    ASP B CB  1 
ATOM   1646 C CG  . ASP B 1 1   ? -5.160  46.929 -4.333  1.00 55.74 ? 1    ASP B CG  1 
ATOM   1647 O OD1 . ASP B 1 1   ? -5.036  47.297 -3.146  1.00 56.60 ? 1    ASP B OD1 1 
ATOM   1648 O OD2 . ASP B 1 1   ? -5.994  47.427 -5.119  1.00 59.91 ? 1    ASP B OD2 1 
ATOM   1649 N N   . ASP B 1 2   ? -1.456  47.662 -3.521  1.00 47.26 ? 2    ASP B N   1 
ATOM   1650 C CA  . ASP B 1 2   ? -0.823  48.074 -2.274  1.00 47.07 ? 2    ASP B CA  1 
ATOM   1651 C C   . ASP B 1 2   ? -1.805  48.161 -1.107  1.00 45.77 ? 2    ASP B C   1 
ATOM   1652 O O   . ASP B 1 2   ? -1.449  47.865 0.035   1.00 42.88 ? 2    ASP B O   1 
ATOM   1653 C CB  . ASP B 1 2   ? -0.123  49.424 -2.475  1.00 48.61 ? 2    ASP B CB  1 
ATOM   1654 C CG  . ASP B 1 2   ? 1.092   49.322 -3.385  1.00 51.91 ? 2    ASP B CG  1 
ATOM   1655 O OD1 . ASP B 1 2   ? 1.139   48.389 -4.217  1.00 54.27 ? 2    ASP B OD1 1 
ATOM   1656 O OD2 . ASP B 1 2   ? 1.996   50.177 -3.279  1.00 51.65 ? 2    ASP B OD2 1 
ATOM   1657 N N   . ALA B 1 3   ? -3.042  48.556 -1.393  1.00 45.15 ? 3    ALA B N   1 
ATOM   1658 C CA  . ALA B 1 3   ? -4.057  48.681 -0.350  1.00 44.40 ? 3    ALA B CA  1 
ATOM   1659 C C   . ALA B 1 3   ? -4.389  47.340 0.300   1.00 43.00 ? 3    ALA B C   1 
ATOM   1660 O O   . ALA B 1 3   ? -4.451  47.232 1.523   1.00 41.55 ? 3    ALA B O   1 
ATOM   1661 C CB  . ALA B 1 3   ? -5.323  49.306 -0.925  1.00 47.91 ? 3    ALA B CB  1 
ATOM   1662 N N   . ALA B 1 4   ? -4.615  46.322 -0.520  1.00 40.13 ? 4    ALA B N   1 
ATOM   1663 C CA  . ALA B 1 4   ? -4.938  44.996 -0.007  1.00 40.11 ? 4    ALA B CA  1 
ATOM   1664 C C   . ALA B 1 4   ? -3.766  44.441 0.801   1.00 37.11 ? 4    ALA B C   1 
ATOM   1665 O O   . ALA B 1 4   ? -3.956  43.799 1.831   1.00 35.83 ? 4    ALA B O   1 
ATOM   1666 C CB  . ALA B 1 4   ? -5.273  44.057 -1.163  1.00 39.01 ? 4    ALA B CB  1 
ATOM   1667 N N   . ILE B 1 5   ? -2.552  44.698 0.328   1.00 36.86 ? 5    ILE B N   1 
ATOM   1668 C CA  . ILE B 1 5   ? -1.353  44.216 1.003   1.00 36.23 ? 5    ILE B CA  1 
ATOM   1669 C C   . ILE B 1 5   ? -1.201  44.825 2.398   1.00 38.46 ? 5    ILE B C   1 
ATOM   1670 O O   . ILE B 1 5   ? -0.900  44.120 3.362   1.00 35.21 ? 5    ILE B O   1 
ATOM   1671 C CB  . ILE B 1 5   ? -0.098  44.509 0.143   1.00 36.79 ? 5    ILE B CB  1 
ATOM   1672 C CG1 . ILE B 1 5   ? -0.164  43.676 -1.146  1.00 34.84 ? 5    ILE B CG1 1 
ATOM   1673 C CG2 . ILE B 1 5   ? 1.169   44.194 0.926   1.00 33.57 ? 5    ILE B CG2 1 
ATOM   1674 C CD1 . ILE B 1 5   ? 0.965   43.932 -2.132  1.00 35.83 ? 5    ILE B CD1 1 
ATOM   1675 N N   . GLN B 1 6   ? -1.432  46.129 2.514   1.00 38.02 ? 6    GLN B N   1 
ATOM   1676 C CA  . GLN B 1 6   ? -1.308  46.792 3.806   1.00 40.63 ? 6    GLN B CA  1 
ATOM   1677 C C   . GLN B 1 6   ? -2.362  46.346 4.814   1.00 36.97 ? 6    GLN B C   1 
ATOM   1678 O O   . GLN B 1 6   ? -2.103  46.318 6.015   1.00 36.90 ? 6    GLN B O   1 
ATOM   1679 C CB  . GLN B 1 6   ? -1.357  48.311 3.631   1.00 43.68 ? 6    GLN B CB  1 
ATOM   1680 C CG  . GLN B 1 6   ? -0.062  48.888 3.094   1.00 49.21 ? 6    GLN B CG  1 
ATOM   1681 C CD  . GLN B 1 6   ? -0.091  50.396 2.992   1.00 54.80 ? 6    GLN B CD  1 
ATOM   1682 O OE1 . GLN B 1 6   ? 0.929   51.029 2.720   1.00 58.09 ? 6    GLN B OE1 1 
ATOM   1683 N NE2 . GLN B 1 6   ? -1.264  50.984 3.206   1.00 56.69 ? 6    GLN B NE2 1 
ATOM   1684 N N   . GLN B 1 7   ? -3.547  45.995 4.328   1.00 37.50 ? 7    GLN B N   1 
ATOM   1685 C CA  . GLN B 1 7   ? -4.617  45.546 5.210   1.00 38.31 ? 7    GLN B CA  1 
ATOM   1686 C C   . GLN B 1 7   ? -4.239  44.197 5.815   1.00 34.66 ? 7    GLN B C   1 
ATOM   1687 O O   . GLN B 1 7   ? -4.421  43.967 7.009   1.00 34.30 ? 7    GLN B O   1 
ATOM   1688 C CB  . GLN B 1 7   ? -5.929  45.409 4.434   1.00 43.20 ? 7    GLN B CB  1 
ATOM   1689 C CG  . GLN B 1 7   ? -6.347  46.672 3.691   1.00 52.08 ? 7    GLN B CG  1 
ATOM   1690 C CD  . GLN B 1 7   ? -6.631  47.843 4.616   1.00 55.96 ? 7    GLN B CD  1 
ATOM   1691 O OE1 . GLN B 1 7   ? -6.837  48.970 4.161   1.00 58.85 ? 7    GLN B OE1 1 
ATOM   1692 N NE2 . GLN B 1 7   ? -6.650  47.582 5.919   1.00 59.30 ? 7    GLN B NE2 1 
ATOM   1693 N N   . THR B 1 8   ? -3.710  43.307 4.984   1.00 33.67 ? 8    THR B N   1 
ATOM   1694 C CA  . THR B 1 8   ? -3.306  41.991 5.460   1.00 33.74 ? 8    THR B CA  1 
ATOM   1695 C C   . THR B 1 8   ? -2.212  42.137 6.511   1.00 30.68 ? 8    THR B C   1 
ATOM   1696 O O   . THR B 1 8   ? -2.278  41.535 7.582   1.00 26.92 ? 8    THR B O   1 
ATOM   1697 C CB  . THR B 1 8   ? -2.790  41.119 4.305   1.00 36.13 ? 8    THR B CB  1 
ATOM   1698 O OG1 . THR B 1 8   ? -3.862  40.858 3.390   1.00 34.89 ? 8    THR B OG1 1 
ATOM   1699 C CG2 . THR B 1 8   ? -2.249  39.802 4.836   1.00 38.30 ? 8    THR B CG2 1 
ATOM   1700 N N   . LEU B 1 9   ? -1.208  42.953 6.208   1.00 30.34 ? 9    LEU B N   1 
ATOM   1701 C CA  . LEU B 1 9   ? -0.116  43.164 7.146   1.00 32.81 ? 9    LEU B CA  1 
ATOM   1702 C C   . LEU B 1 9   ? -0.659  43.752 8.443   1.00 32.45 ? 9    LEU B C   1 
ATOM   1703 O O   . LEU B 1 9   ? -0.209  43.394 9.533   1.00 34.11 ? 9    LEU B O   1 
ATOM   1704 C CB  . LEU B 1 9   ? 0.933   44.099 6.537   1.00 31.51 ? 9    LEU B CB  1 
ATOM   1705 C CG  . LEU B 1 9   ? 1.661   43.588 5.290   1.00 34.84 ? 9    LEU B CG  1 
ATOM   1706 C CD1 . LEU B 1 9   ? 2.668   44.632 4.831   1.00 36.50 ? 9    LEU B CD1 1 
ATOM   1707 C CD2 . LEU B 1 9   ? 2.369   42.276 5.601   1.00 34.90 ? 9    LEU B CD2 1 
ATOM   1708 N N   . ALA B 1 10  ? -1.632  44.651 8.321   1.00 33.63 ? 10   ALA B N   1 
ATOM   1709 C CA  . ALA B 1 10  ? -2.242  45.286 9.486   1.00 35.55 ? 10   ALA B CA  1 
ATOM   1710 C C   . ALA B 1 10  ? -2.900  44.242 10.383  1.00 36.76 ? 10   ALA B C   1 
ATOM   1711 O O   . ALA B 1 10  ? -2.720  44.250 11.600  1.00 36.57 ? 10   ALA B O   1 
ATOM   1712 C CB  . ALA B 1 10  ? -3.276  46.318 9.039   1.00 36.45 ? 10   ALA B CB  1 
ATOM   1713 N N   . LYS B 1 11  ? -3.668  43.343 9.780   1.00 38.43 ? 11   LYS B N   1 
ATOM   1714 C CA  . LYS B 1 11  ? -4.338  42.299 10.544  1.00 41.37 ? 11   LYS B CA  1 
ATOM   1715 C C   . LYS B 1 11  ? -3.322  41.459 11.304  1.00 41.33 ? 11   LYS B C   1 
ATOM   1716 O O   . LYS B 1 11  ? -3.629  40.897 12.357  1.00 43.95 ? 11   LYS B O   1 
ATOM   1717 C CB  . LYS B 1 11  ? -5.156  41.399 9.615   1.00 42.85 ? 11   LYS B CB  1 
ATOM   1718 C CG  . LYS B 1 11  ? -6.429  42.039 9.086   1.00 50.16 ? 11   LYS B CG  1 
ATOM   1719 C CD  . LYS B 1 11  ? -7.378  42.386 10.229  1.00 56.25 ? 11   LYS B CD  1 
ATOM   1720 C CE  . LYS B 1 11  ? -8.709  42.909 9.713   1.00 59.75 ? 11   LYS B CE  1 
ATOM   1721 N NZ  . LYS B 1 11  ? -9.654  43.221 10.825  1.00 62.57 ? 11   LYS B NZ  1 
ATOM   1722 N N   . MET B 1 12  ? -2.107  41.386 10.771  1.00 40.19 ? 12   MET B N   1 
ATOM   1723 C CA  . MET B 1 12  ? -1.042  40.601 11.387  1.00 40.11 ? 12   MET B CA  1 
ATOM   1724 C C   . MET B 1 12  ? -0.141  41.401 12.322  1.00 36.59 ? 12   MET B C   1 
ATOM   1725 O O   . MET B 1 12  ? 0.735   40.840 12.976  1.00 37.82 ? 12   MET B O   1 
ATOM   1726 C CB  . MET B 1 12  ? -0.195  39.942 10.298  1.00 42.21 ? 12   MET B CB  1 
ATOM   1727 C CG  . MET B 1 12  ? -0.968  38.938 9.464   1.00 46.67 ? 12   MET B CG  1 
ATOM   1728 S SD  . MET B 1 12  ? 0.008   38.259 8.120   1.00 50.31 ? 12   MET B SD  1 
ATOM   1729 C CE  . MET B 1 12  ? 1.038   37.099 9.011   1.00 46.41 ? 12   MET B CE  1 
ATOM   1730 N N   . GLY B 1 13  ? -0.359  42.708 12.387  1.00 35.01 ? 13   GLY B N   1 
ATOM   1731 C CA  . GLY B 1 13  ? 0.458   43.538 13.252  1.00 34.63 ? 13   GLY B CA  1 
ATOM   1732 C C   . GLY B 1 13  ? 1.823   43.811 12.649  1.00 33.36 ? 13   GLY B C   1 
ATOM   1733 O O   . GLY B 1 13  ? 2.751   44.205 13.352  1.00 33.41 ? 13   GLY B O   1 
ATOM   1734 N N   . ILE B 1 14  ? 1.940   43.595 11.342  1.00 33.49 ? 14   ILE B N   1 
ATOM   1735 C CA  . ILE B 1 14  ? 3.188   43.824 10.615  1.00 31.48 ? 14   ILE B CA  1 
ATOM   1736 C C   . ILE B 1 14  ? 3.129   45.174 9.904   1.00 31.10 ? 14   ILE B C   1 
ATOM   1737 O O   . ILE B 1 14  ? 2.125   45.502 9.270   1.00 30.37 ? 14   ILE B O   1 
ATOM   1738 C CB  . ILE B 1 14  ? 3.415   42.723 9.562   1.00 32.38 ? 14   ILE B CB  1 
ATOM   1739 C CG1 . ILE B 1 14  ? 3.560   41.367 10.260  1.00 32.39 ? 14   ILE B CG1 1 
ATOM   1740 C CG2 . ILE B 1 14  ? 4.652   43.039 8.729   1.00 32.03 ? 14   ILE B CG2 1 
ATOM   1741 C CD1 . ILE B 1 14  ? 3.523   40.183 9.310   1.00 35.77 ? 14   ILE B CD1 1 
ATOM   1742 N N   . LYS B 1 15  ? 4.217   45.936 9.995   1.00 28.76 ? 15   LYS B N   1 
ATOM   1743 C CA  . LYS B 1 15  ? 4.297   47.261 9.381   1.00 30.44 ? 15   LYS B CA  1 
ATOM   1744 C C   . LYS B 1 15  ? 5.290   47.307 8.216   1.00 29.40 ? 15   LYS B C   1 
ATOM   1745 O O   . LYS B 1 15  ? 6.446   46.908 8.361   1.00 26.85 ? 15   LYS B O   1 
ATOM   1746 C CB  . LYS B 1 15  ? 4.716   48.286 10.436  1.00 33.74 ? 15   LYS B CB  1 
ATOM   1747 C CG  . LYS B 1 15  ? 4.737   49.729 9.957   1.00 39.95 ? 15   LYS B CG  1 
ATOM   1748 C CD  . LYS B 1 15  ? 3.342   50.326 9.925   1.00 45.45 ? 15   LYS B CD  1 
ATOM   1749 C CE  . LYS B 1 15  ? 3.403   51.839 9.761   1.00 48.24 ? 15   LYS B CE  1 
ATOM   1750 N NZ  . LYS B 1 15  ? 2.060   52.474 9.890   1.00 50.12 ? 15   LYS B NZ  1 
ATOM   1751 N N   . SER B 1 16  ? 4.835   47.803 7.069   1.00 26.86 ? 16   SER B N   1 
ATOM   1752 C CA  . SER B 1 16  ? 5.682   47.908 5.883   1.00 26.28 ? 16   SER B CA  1 
ATOM   1753 C C   . SER B 1 16  ? 6.221   49.327 5.751   1.00 27.46 ? 16   SER B C   1 
ATOM   1754 O O   . SER B 1 16  ? 5.631   50.272 6.280   1.00 25.39 ? 16   SER B O   1 
ATOM   1755 C CB  . SER B 1 16  ? 4.883   47.558 4.627   1.00 29.34 ? 16   SER B CB  1 
ATOM   1756 O OG  . SER B 1 16  ? 3.848   48.504 4.406   1.00 33.95 ? 16   SER B OG  1 
ATOM   1757 N N   . SER B 1 17  ? 7.338   49.471 5.042   1.00 27.02 ? 17   SER B N   1 
ATOM   1758 C CA  . SER B 1 17  ? 7.950   50.783 4.832   1.00 26.74 ? 17   SER B CA  1 
ATOM   1759 C C   . SER B 1 17  ? 8.244   51.012 3.355   1.00 27.72 ? 17   SER B C   1 
ATOM   1760 O O   . SER B 1 17  ? 8.460   52.149 2.924   1.00 25.75 ? 17   SER B O   1 
ATOM   1761 C CB  . SER B 1 17  ? 9.252   50.905 5.636   1.00 25.56 ? 17   SER B CB  1 
ATOM   1762 O OG  . SER B 1 17  ? 10.204  49.934 5.227   1.00 25.50 ? 17   SER B OG  1 
ATOM   1763 N N   . ASP B 1 18  ? 8.255   49.930 2.581   1.00 26.34 ? 18   ASP B N   1 
ATOM   1764 C CA  . ASP B 1 18  ? 8.533   50.024 1.156   1.00 24.74 ? 18   ASP B CA  1 
ATOM   1765 C C   . ASP B 1 18  ? 7.943   48.830 0.418   1.00 28.25 ? 18   ASP B C   1 
ATOM   1766 O O   . ASP B 1 18  ? 8.079   47.680 0.851   1.00 29.53 ? 18   ASP B O   1 
ATOM   1767 C CB  . ASP B 1 18  ? 10.050  50.103 0.926   1.00 23.88 ? 18   ASP B CB  1 
ATOM   1768 C CG  . ASP B 1 18  ? 10.411  50.589 -0.470  1.00 29.00 ? 18   ASP B CG  1 
ATOM   1769 O OD1 . ASP B 1 18  ? 9.543   51.167 -1.151  1.00 29.71 ? 18   ASP B OD1 1 
ATOM   1770 O OD2 . ASP B 1 18  ? 11.570  50.405 -0.887  1.00 30.41 ? 18   ASP B OD2 1 
ATOM   1771 N N   . ILE B 1 19  ? 7.261   49.118 -0.685  1.00 26.58 ? 19   ILE B N   1 
ATOM   1772 C CA  . ILE B 1 19  ? 6.644   48.090 -1.510  1.00 27.68 ? 19   ILE B CA  1 
ATOM   1773 C C   . ILE B 1 19  ? 7.036   48.356 -2.959  1.00 29.62 ? 19   ILE B C   1 
ATOM   1774 O O   . ILE B 1 19  ? 6.927   49.486 -3.447  1.00 28.98 ? 19   ILE B O   1 
ATOM   1775 C CB  . ILE B 1 19  ? 5.100   48.119 -1.388  1.00 30.25 ? 19   ILE B CB  1 
ATOM   1776 C CG1 . ILE B 1 19  ? 4.692   47.922 0.075   1.00 32.09 ? 19   ILE B CG1 1 
ATOM   1777 C CG2 . ILE B 1 19  ? 4.486   47.034 -2.268  1.00 32.86 ? 19   ILE B CG2 1 
ATOM   1778 C CD1 . ILE B 1 19  ? 3.198   48.011 0.315   1.00 35.72 ? 19   ILE B CD1 1 
ATOM   1779 N N   . GLN B 1 20  ? 7.510   47.314 -3.635  1.00 30.54 ? 20   GLN B N   1 
ATOM   1780 C CA  . GLN B 1 20  ? 7.928   47.421 -5.028  1.00 33.51 ? 20   GLN B CA  1 
ATOM   1781 C C   . GLN B 1 20  ? 7.444   46.221 -5.822  1.00 34.17 ? 20   GLN B C   1 
ATOM   1782 O O   . GLN B 1 20  ? 7.196   45.156 -5.260  1.00 31.93 ? 20   GLN B O   1 
ATOM   1783 C CB  . GLN B 1 20  ? 9.456   47.469 -5.130  1.00 33.63 ? 20   GLN B CB  1 
ATOM   1784 C CG  . GLN B 1 20  ? 10.099  48.747 -4.620  1.00 40.38 ? 20   GLN B CG  1 
ATOM   1785 C CD  . GLN B 1 20  ? 9.668   49.958 -5.419  1.00 41.16 ? 20   GLN B CD  1 
ATOM   1786 O OE1 . GLN B 1 20  ? 9.686   49.937 -6.649  1.00 42.34 ? 20   GLN B OE1 1 
ATOM   1787 N NE2 . GLN B 1 20  ? 9.285   51.024 -4.725  1.00 43.25 ? 20   GLN B NE2 1 
ATOM   1788 N N   . PRO B 1 21  ? 7.288   46.382 -7.143  1.00 36.06 ? 21   PRO B N   1 
ATOM   1789 C CA  . PRO B 1 21  ? 6.839   45.239 -7.941  1.00 35.28 ? 21   PRO B CA  1 
ATOM   1790 C C   . PRO B 1 21  ? 7.964   44.203 -7.926  1.00 34.76 ? 21   PRO B C   1 
ATOM   1791 O O   . PRO B 1 21  ? 9.134   44.550 -8.088  1.00 35.53 ? 21   PRO B O   1 
ATOM   1792 C CB  . PRO B 1 21  ? 6.635   45.846 -9.328  1.00 36.51 ? 21   PRO B CB  1 
ATOM   1793 C CG  . PRO B 1 21  ? 6.235   47.264 -9.018  1.00 38.06 ? 21   PRO B CG  1 
ATOM   1794 C CD  . PRO B 1 21  ? 7.220   47.630 -7.926  1.00 36.67 ? 21   PRO B CD  1 
ATOM   1795 N N   . ALA B 1 22  ? 7.617   42.939 -7.708  1.00 33.12 ? 22   ALA B N   1 
ATOM   1796 C CA  . ALA B 1 22  ? 8.613   41.878 -7.685  1.00 31.61 ? 22   ALA B CA  1 
ATOM   1797 C C   . ALA B 1 22  ? 8.921   41.422 -9.112  1.00 32.39 ? 22   ALA B C   1 
ATOM   1798 O O   . ALA B 1 22  ? 8.155   41.689 -10.037 1.00 29.75 ? 22   ALA B O   1 
ATOM   1799 C CB  . ALA B 1 22  ? 8.101   40.694 -6.849  1.00 29.27 ? 22   ALA B CB  1 
ATOM   1800 N N   . PRO B 1 23  ? 10.060  40.745 -9.311  1.00 35.33 ? 23   PRO B N   1 
ATOM   1801 C CA  . PRO B 1 23  ? 10.420  40.268 -10.652 1.00 36.17 ? 23   PRO B CA  1 
ATOM   1802 C C   . PRO B 1 23  ? 9.453   39.167 -11.084 1.00 35.42 ? 23   PRO B C   1 
ATOM   1803 O O   . PRO B 1 23  ? 9.402   38.785 -12.252 1.00 36.28 ? 23   PRO B O   1 
ATOM   1804 C CB  . PRO B 1 23  ? 11.838  39.733 -10.462 1.00 33.30 ? 23   PRO B CB  1 
ATOM   1805 C CG  . PRO B 1 23  ? 12.360  40.532 -9.301  1.00 39.41 ? 23   PRO B CG  1 
ATOM   1806 C CD  . PRO B 1 23  ? 11.179  40.564 -8.371  1.00 36.22 ? 23   PRO B CD  1 
ATOM   1807 N N   . VAL B 1 24  ? 8.695   38.659 -10.120 1.00 35.09 ? 24   VAL B N   1 
ATOM   1808 C CA  . VAL B 1 24  ? 7.724   37.598 -10.369 1.00 33.93 ? 24   VAL B CA  1 
ATOM   1809 C C   . VAL B 1 24  ? 6.333   38.185 -10.578 1.00 34.78 ? 24   VAL B C   1 
ATOM   1810 O O   . VAL B 1 24  ? 5.826   38.925 -9.738  1.00 31.40 ? 24   VAL B O   1 
ATOM   1811 C CB  . VAL B 1 24  ? 7.675   36.608 -9.184  1.00 34.85 ? 24   VAL B CB  1 
ATOM   1812 C CG1 . VAL B 1 24  ? 6.565   35.588 -9.394  1.00 33.35 ? 24   VAL B CG1 1 
ATOM   1813 C CG2 . VAL B 1 24  ? 9.025   35.916 -9.037  1.00 32.13 ? 24   VAL B CG2 1 
ATOM   1814 N N   . ALA B 1 25  ? 5.720   37.843 -11.705 1.00 36.27 ? 25   ALA B N   1 
ATOM   1815 C CA  . ALA B 1 25  ? 4.388   38.333 -12.039 1.00 35.81 ? 25   ALA B CA  1 
ATOM   1816 C C   . ALA B 1 25  ? 3.370   38.141 -10.917 1.00 35.05 ? 25   ALA B C   1 
ATOM   1817 O O   . ALA B 1 25  ? 3.323   37.089 -10.274 1.00 33.92 ? 25   ALA B O   1 
ATOM   1818 C CB  . ALA B 1 25  ? 3.895   37.646 -13.308 1.00 39.61 ? 25   ALA B CB  1 
ATOM   1819 N N   . GLY B 1 26  ? 2.561   39.173 -10.685 1.00 32.95 ? 26   GLY B N   1 
ATOM   1820 C CA  . GLY B 1 26  ? 1.531   39.108 -9.666  1.00 31.35 ? 26   GLY B CA  1 
ATOM   1821 C C   . GLY B 1 26  ? 2.024   39.213 -8.236  1.00 32.35 ? 26   GLY B C   1 
ATOM   1822 O O   . GLY B 1 26  ? 1.251   39.038 -7.296  1.00 33.20 ? 26   GLY B O   1 
ATOM   1823 N N   . MET B 1 27  ? 3.308   39.503 -8.064  1.00 31.15 ? 27   MET B N   1 
ATOM   1824 C CA  . MET B 1 27  ? 3.860   39.625 -6.727  1.00 31.50 ? 27   MET B CA  1 
ATOM   1825 C C   . MET B 1 27  ? 4.599   40.933 -6.513  1.00 31.80 ? 27   MET B C   1 
ATOM   1826 O O   . MET B 1 27  ? 4.949   41.626 -7.466  1.00 32.87 ? 27   MET B O   1 
ATOM   1827 C CB  . MET B 1 27  ? 4.793   38.454 -6.434  1.00 29.27 ? 27   MET B CB  1 
ATOM   1828 C CG  . MET B 1 27  ? 4.072   37.122 -6.379  1.00 30.16 ? 27   MET B CG  1 
ATOM   1829 S SD  . MET B 1 27  ? 5.073   35.921 -5.531  1.00 34.41 ? 27   MET B SD  1 
ATOM   1830 C CE  . MET B 1 27  ? 4.727   36.378 -3.841  1.00 32.68 ? 27   MET B CE  1 
ATOM   1831 N N   . LYS B 1 28  ? 4.831   41.260 -5.248  1.00 30.66 ? 28   LYS B N   1 
ATOM   1832 C CA  . LYS B 1 28  ? 5.527   42.486 -4.897  1.00 29.52 ? 28   LYS B CA  1 
ATOM   1833 C C   . LYS B 1 28  ? 6.514   42.226 -3.770  1.00 29.64 ? 28   LYS B C   1 
ATOM   1834 O O   . LYS B 1 28  ? 6.311   41.338 -2.935  1.00 26.07 ? 28   LYS B O   1 
ATOM   1835 C CB  . LYS B 1 28  ? 4.520   43.565 -4.477  1.00 30.26 ? 28   LYS B CB  1 
ATOM   1836 C CG  . LYS B 1 28  ? 3.373   43.736 -5.464  1.00 34.99 ? 28   LYS B CG  1 
ATOM   1837 C CD  . LYS B 1 28  ? 2.637   45.068 -5.307  1.00 38.03 ? 28   LYS B CD  1 
ATOM   1838 C CE  . LYS B 1 28  ? 3.432   46.217 -5.920  1.00 38.02 ? 28   LYS B CE  1 
ATOM   1839 N NZ  . LYS B 1 28  ? 2.593   47.437 -6.120  1.00 34.65 ? 28   LYS B NZ  1 
ATOM   1840 N N   . THR B 1 29  ? 7.597   42.993 -3.767  1.00 28.98 ? 29   THR B N   1 
ATOM   1841 C CA  . THR B 1 29  ? 8.624   42.880 -2.742  1.00 27.93 ? 29   THR B CA  1 
ATOM   1842 C C   . THR B 1 29  ? 8.251   43.911 -1.687  1.00 28.51 ? 29   THR B C   1 
ATOM   1843 O O   . THR B 1 29  ? 8.148   45.108 -1.979  1.00 27.50 ? 29   THR B O   1 
ATOM   1844 C CB  . THR B 1 29  ? 10.008  43.182 -3.327  1.00 29.72 ? 29   THR B CB  1 
ATOM   1845 O OG1 . THR B 1 29  ? 10.234  42.325 -4.456  1.00 27.13 ? 29   THR B OG1 1 
ATOM   1846 C CG2 . THR B 1 29  ? 11.095  42.940 -2.289  1.00 27.00 ? 29   THR B CG2 1 
ATOM   1847 N N   . VAL B 1 30  ? 8.045   43.438 -0.463  1.00 25.37 ? 30   VAL B N   1 
ATOM   1848 C CA  . VAL B 1 30  ? 7.617   44.303 0.626   1.00 27.21 ? 30   VAL B CA  1 
ATOM   1849 C C   . VAL B 1 30  ? 8.559   44.294 1.822   1.00 28.01 ? 30   VAL B C   1 
ATOM   1850 O O   . VAL B 1 30  ? 8.781   43.252 2.447   1.00 23.36 ? 30   VAL B O   1 
ATOM   1851 C CB  . VAL B 1 30  ? 6.211   43.886 1.118   1.00 28.85 ? 30   VAL B CB  1 
ATOM   1852 C CG1 . VAL B 1 30  ? 5.657   44.928 2.075   1.00 29.39 ? 30   VAL B CG1 1 
ATOM   1853 C CG2 . VAL B 1 30  ? 5.280   43.675 -0.070  1.00 29.19 ? 30   VAL B CG2 1 
ATOM   1854 N N   . LEU B 1 31  ? 9.119   45.458 2.133   1.00 24.69 ? 31   LEU B N   1 
ATOM   1855 C CA  . LEU B 1 31  ? 10.005  45.580 3.279   1.00 23.93 ? 31   LEU B CA  1 
ATOM   1856 C C   . LEU B 1 31  ? 9.141   45.862 4.504   1.00 25.09 ? 31   LEU B C   1 
ATOM   1857 O O   . LEU B 1 31  ? 8.364   46.821 4.516   1.00 24.52 ? 31   LEU B O   1 
ATOM   1858 C CB  . LEU B 1 31  ? 11.006  46.720 3.069   1.00 25.30 ? 31   LEU B CB  1 
ATOM   1859 C CG  . LEU B 1 31  ? 11.859  47.064 4.293   1.00 28.63 ? 31   LEU B CG  1 
ATOM   1860 C CD1 . LEU B 1 31  ? 12.634  45.837 4.763   1.00 26.60 ? 31   LEU B CD1 1 
ATOM   1861 C CD2 . LEU B 1 31  ? 12.805  48.196 3.935   1.00 21.87 ? 31   LEU B CD2 1 
ATOM   1862 N N   . THR B 1 32  ? 9.260   45.016 5.525   1.00 22.08 ? 32   THR B N   1 
ATOM   1863 C CA  . THR B 1 32  ? 8.480   45.182 6.746   1.00 22.44 ? 32   THR B CA  1 
ATOM   1864 C C   . THR B 1 32  ? 9.373   45.063 7.970   1.00 25.64 ? 32   THR B C   1 
ATOM   1865 O O   . THR B 1 32  ? 10.562  44.755 7.851   1.00 25.78 ? 32   THR B O   1 
ATOM   1866 C CB  . THR B 1 32  ? 7.392   44.097 6.872   1.00 26.72 ? 32   THR B CB  1 
ATOM   1867 O OG1 . THR B 1 32  ? 8.006   42.849 7.237   1.00 25.51 ? 32   THR B OG1 1 
ATOM   1868 C CG2 . THR B 1 32  ? 6.657   43.926 5.551   1.00 22.87 ? 32   THR B CG2 1 
ATOM   1869 N N   . ASN B 1 33  ? 8.795   45.300 9.145   1.00 23.70 ? 33   ASN B N   1 
ATOM   1870 C CA  . ASN B 1 33  ? 9.546   45.195 10.387  1.00 27.84 ? 33   ASN B CA  1 
ATOM   1871 C C   . ASN B 1 33  ? 9.766   43.729 10.761  1.00 29.38 ? 33   ASN B C   1 
ATOM   1872 O O   . ASN B 1 33  ? 10.305  43.419 11.822  1.00 31.99 ? 33   ASN B O   1 
ATOM   1873 C CB  . ASN B 1 33  ? 8.836   45.959 11.512  1.00 29.50 ? 33   ASN B CB  1 
ATOM   1874 C CG  . ASN B 1 33  ? 7.422   45.466 11.767  1.00 32.86 ? 33   ASN B CG  1 
ATOM   1875 O OD1 . ASN B 1 33  ? 6.739   44.982 10.865  1.00 31.41 ? 33   ASN B OD1 1 
ATOM   1876 N ND2 . ASN B 1 33  ? 6.970   45.615 13.005  1.00 35.83 ? 33   ASN B ND2 1 
ATOM   1877 N N   . SER B 1 34  ? 9.340   42.835 9.872   1.00 27.39 ? 34   SER B N   1 
ATOM   1878 C CA  . SER B 1 34  ? 9.534   41.400 10.055  1.00 31.51 ? 34   SER B CA  1 
ATOM   1879 C C   . SER B 1 34  ? 10.451  40.920 8.931   1.00 31.60 ? 34   SER B C   1 
ATOM   1880 O O   . SER B 1 34  ? 10.608  39.717 8.709   1.00 31.17 ? 34   SER B O   1 
ATOM   1881 C CB  . SER B 1 34  ? 8.200   40.648 9.984   1.00 32.84 ? 34   SER B CB  1 
ATOM   1882 O OG  . SER B 1 34  ? 7.410   40.889 11.134  1.00 38.15 ? 34   SER B OG  1 
ATOM   1883 N N   . GLY B 1 35  ? 11.050  41.875 8.221   1.00 28.88 ? 35   GLY B N   1 
ATOM   1884 C CA  . GLY B 1 35  ? 11.939  41.543 7.119   1.00 26.94 ? 35   GLY B CA  1 
ATOM   1885 C C   . GLY B 1 35  ? 11.285  41.723 5.758   1.00 27.86 ? 35   GLY B C   1 
ATOM   1886 O O   . GLY B 1 35  ? 10.131  42.146 5.660   1.00 26.76 ? 35   GLY B O   1 
ATOM   1887 N N   . VAL B 1 36  ? 12.028  41.416 4.699   1.00 26.12 ? 36   VAL B N   1 
ATOM   1888 C CA  . VAL B 1 36  ? 11.500  41.534 3.343   1.00 26.43 ? 36   VAL B CA  1 
ATOM   1889 C C   . VAL B 1 36  ? 10.648  40.314 3.017   1.00 28.55 ? 36   VAL B C   1 
ATOM   1890 O O   . VAL B 1 36  ? 11.126  39.177 3.081   1.00 26.25 ? 36   VAL B O   1 
ATOM   1891 C CB  . VAL B 1 36  ? 12.630  41.625 2.295   1.00 26.33 ? 36   VAL B CB  1 
ATOM   1892 C CG1 . VAL B 1 36  ? 12.039  41.610 0.889   1.00 26.62 ? 36   VAL B CG1 1 
ATOM   1893 C CG2 . VAL B 1 36  ? 13.439  42.890 2.516   1.00 26.42 ? 36   VAL B CG2 1 
ATOM   1894 N N   . LEU B 1 37  ? 9.387   40.558 2.675   1.00 24.10 ? 37   LEU B N   1 
ATOM   1895 C CA  . LEU B 1 37  ? 8.469   39.480 2.334   1.00 26.68 ? 37   LEU B CA  1 
ATOM   1896 C C   . LEU B 1 37  ? 8.014   39.633 0.893   1.00 25.91 ? 37   LEU B C   1 
ATOM   1897 O O   . LEU B 1 37  ? 8.099   40.716 0.310   1.00 25.22 ? 37   LEU B O   1 
ATOM   1898 C CB  . LEU B 1 37  ? 7.244   39.519 3.252   1.00 29.51 ? 37   LEU B CB  1 
ATOM   1899 C CG  . LEU B 1 37  ? 7.507   39.490 4.758   1.00 31.74 ? 37   LEU B CG  1 
ATOM   1900 C CD1 . LEU B 1 37  ? 6.207   39.726 5.511   1.00 33.86 ? 37   LEU B CD1 1 
ATOM   1901 C CD2 . LEU B 1 37  ? 8.137   38.159 5.139   1.00 33.46 ? 37   LEU B CD2 1 
ATOM   1902 N N   . TYR B 1 38  ? 7.530   38.538 0.323   1.00 23.12 ? 38   TYR B N   1 
ATOM   1903 C CA  . TYR B 1 38  ? 7.027   38.539 -1.037  1.00 22.40 ? 38   TYR B CA  1 
ATOM   1904 C C   . TYR B 1 38  ? 5.541   38.237 -0.915  1.00 27.56 ? 38   TYR B C   1 
ATOM   1905 O O   . TYR B 1 38  ? 5.143   37.185 -0.415  1.00 24.79 ? 38   TYR B O   1 
ATOM   1906 C CB  . TYR B 1 38  ? 7.785   37.494 -1.850  1.00 25.50 ? 38   TYR B CB  1 
ATOM   1907 C CG  . TYR B 1 38  ? 9.239   37.877 -1.955  1.00 25.08 ? 38   TYR B CG  1 
ATOM   1908 C CD1 . TYR B 1 38  ? 9.654   38.827 -2.884  1.00 27.08 ? 38   TYR B CD1 1 
ATOM   1909 C CD2 . TYR B 1 38  ? 10.182  37.384 -1.047  1.00 25.17 ? 38   TYR B CD2 1 
ATOM   1910 C CE1 . TYR B 1 38  ? 10.957  39.290 -2.907  1.00 26.14 ? 38   TYR B CE1 1 
ATOM   1911 C CE2 . TYR B 1 38  ? 11.497  37.841 -1.063  1.00 26.32 ? 38   TYR B CE2 1 
ATOM   1912 C CZ  . TYR B 1 38  ? 11.874  38.801 -1.997  1.00 28.37 ? 38   TYR B CZ  1 
ATOM   1913 O OH  . TYR B 1 38  ? 13.153  39.305 -2.006  1.00 28.01 ? 38   TYR B OH  1 
ATOM   1914 N N   . ILE B 1 39  ? 4.724   39.188 -1.352  1.00 29.09 ? 39   ILE B N   1 
ATOM   1915 C CA  . ILE B 1 39  ? 3.279   39.060 -1.240  1.00 29.40 ? 39   ILE B CA  1 
ATOM   1916 C C   . ILE B 1 39  ? 2.581   39.196 -2.591  1.00 31.10 ? 39   ILE B C   1 
ATOM   1917 O O   . ILE B 1 39  ? 2.985   39.997 -3.432  1.00 29.77 ? 39   ILE B O   1 
ATOM   1918 C CB  . ILE B 1 39  ? 2.744   40.134 -0.250  1.00 31.15 ? 39   ILE B CB  1 
ATOM   1919 C CG1 . ILE B 1 39  ? 3.584   40.093 1.035   1.00 33.44 ? 39   ILE B CG1 1 
ATOM   1920 C CG2 . ILE B 1 39  ? 1.269   39.882 0.079   1.00 24.94 ? 39   ILE B CG2 1 
ATOM   1921 C CD1 . ILE B 1 39  ? 3.305   41.208 2.019   1.00 36.29 ? 39   ILE B CD1 1 
ATOM   1922 N N   . THR B 1 40  ? 1.540   38.396 -2.804  1.00 29.93 ? 40   THR B N   1 
ATOM   1923 C CA  . THR B 1 40  ? 0.795   38.460 -4.057  1.00 31.84 ? 40   THR B CA  1 
ATOM   1924 C C   . THR B 1 40  ? -0.014  39.764 -4.106  1.00 32.52 ? 40   THR B C   1 
ATOM   1925 O O   . THR B 1 40  ? -0.375  40.316 -3.068  1.00 30.99 ? 40   THR B O   1 
ATOM   1926 C CB  . THR B 1 40  ? -0.147  37.245 -4.204  1.00 31.12 ? 40   THR B CB  1 
ATOM   1927 O OG1 . THR B 1 40  ? -0.950  37.119 -3.028  1.00 26.85 ? 40   THR B OG1 1 
ATOM   1928 C CG2 . THR B 1 40  ? 0.670   35.962 -4.393  1.00 30.14 ? 40   THR B CG2 1 
ATOM   1929 N N   . ASP B 1 41  ? -0.285  40.251 -5.313  1.00 34.56 ? 41   ASP B N   1 
ATOM   1930 C CA  . ASP B 1 41  ? -1.024  41.497 -5.494  1.00 38.37 ? 41   ASP B CA  1 
ATOM   1931 C C   . ASP B 1 41  ? -2.337  41.597 -4.724  1.00 39.69 ? 41   ASP B C   1 
ATOM   1932 O O   . ASP B 1 41  ? -2.760  42.698 -4.367  1.00 42.82 ? 41   ASP B O   1 
ATOM   1933 C CB  . ASP B 1 41  ? -1.293  41.750 -6.982  1.00 40.47 ? 41   ASP B CB  1 
ATOM   1934 C CG  . ASP B 1 41  ? -0.024  41.979 -7.774  1.00 41.16 ? 41   ASP B CG  1 
ATOM   1935 O OD1 . ASP B 1 41  ? 0.948   42.513 -7.201  1.00 47.17 ? 41   ASP B OD1 1 
ATOM   1936 O OD2 . ASP B 1 41  ? -0.001  41.641 -8.975  1.00 44.23 ? 41   ASP B OD2 1 
ATOM   1937 N N   . ASP B 1 42  ? -2.980  40.462 -4.463  1.00 38.60 ? 42   ASP B N   1 
ATOM   1938 C CA  . ASP B 1 42  ? -4.247  40.463 -3.736  1.00 37.75 ? 42   ASP B CA  1 
ATOM   1939 C C   . ASP B 1 42  ? -4.069  40.421 -2.225  1.00 36.35 ? 42   ASP B C   1 
ATOM   1940 O O   . ASP B 1 42  ? -5.048  40.467 -1.479  1.00 36.22 ? 42   ASP B O   1 
ATOM   1941 C CB  . ASP B 1 42  ? -5.124  39.283 -4.170  1.00 40.18 ? 42   ASP B CB  1 
ATOM   1942 C CG  . ASP B 1 42  ? -4.402  37.949 -4.076  1.00 42.69 ? 42   ASP B CG  1 
ATOM   1943 O OD1 . ASP B 1 42  ? -3.479  37.820 -3.239  1.00 38.51 ? 42   ASP B OD1 1 
ATOM   1944 O OD2 . ASP B 1 42  ? -4.769  37.023 -4.831  1.00 42.35 ? 42   ASP B OD2 1 
ATOM   1945 N N   . GLY B 1 43  ? -2.820  40.326 -1.778  1.00 34.99 ? 43   GLY B N   1 
ATOM   1946 C CA  . GLY B 1 43  ? -2.538  40.281 -0.356  1.00 33.76 ? 43   GLY B CA  1 
ATOM   1947 C C   . GLY B 1 43  ? -3.008  39.013 0.333   1.00 34.75 ? 43   GLY B C   1 
ATOM   1948 O O   . GLY B 1 43  ? -3.173  38.992 1.556   1.00 34.78 ? 43   GLY B O   1 
ATOM   1949 N N   . LYS B 1 44  ? -3.210  37.946 -0.434  1.00 31.66 ? 44   LYS B N   1 
ATOM   1950 C CA  . LYS B 1 44  ? -3.683  36.695 0.145   1.00 33.49 ? 44   LYS B CA  1 
ATOM   1951 C C   . LYS B 1 44  ? -2.607  35.646 0.417   1.00 31.94 ? 44   LYS B C   1 
ATOM   1952 O O   . LYS B 1 44  ? -2.837  34.707 1.178   1.00 33.75 ? 44   LYS B O   1 
ATOM   1953 C CB  . LYS B 1 44  ? -4.788  36.104 -0.734  1.00 34.79 ? 44   LYS B CB  1 
ATOM   1954 C CG  . LYS B 1 44  ? -5.999  37.022 -0.839  1.00 38.84 ? 44   LYS B CG  1 
ATOM   1955 C CD  . LYS B 1 44  ? -7.242  36.289 -1.317  1.00 45.74 ? 44   LYS B CD  1 
ATOM   1956 C CE  . LYS B 1 44  ? -7.101  35.782 -2.738  1.00 50.63 ? 44   LYS B CE  1 
ATOM   1957 N NZ  . LYS B 1 44  ? -8.387  35.195 -3.219  1.00 54.62 ? 44   LYS B NZ  1 
ATOM   1958 N N   . HIS B 1 45  ? -1.442  35.793 -0.204  1.00 31.07 ? 45   HIS B N   1 
ATOM   1959 C CA  . HIS B 1 45  ? -0.351  34.849 0.024   1.00 28.82 ? 45   HIS B CA  1 
ATOM   1960 C C   . HIS B 1 45  ? 0.963   35.576 0.263   1.00 29.40 ? 45   HIS B C   1 
ATOM   1961 O O   . HIS B 1 45  ? 1.277   36.553 -0.416  1.00 31.21 ? 45   HIS B O   1 
ATOM   1962 C CB  . HIS B 1 45  ? -0.180  33.890 -1.160  1.00 28.99 ? 45   HIS B CB  1 
ATOM   1963 C CG  . HIS B 1 45  ? -1.340  32.965 -1.361  1.00 31.86 ? 45   HIS B CG  1 
ATOM   1964 N ND1 . HIS B 1 45  ? -2.430  33.297 -2.135  1.00 30.98 ? 45   HIS B ND1 1 
ATOM   1965 C CD2 . HIS B 1 45  ? -1.598  31.736 -0.853  1.00 32.72 ? 45   HIS B CD2 1 
ATOM   1966 C CE1 . HIS B 1 45  ? -3.312  32.313 -2.095  1.00 31.89 ? 45   HIS B CE1 1 
ATOM   1967 N NE2 . HIS B 1 45  ? -2.831  31.354 -1.324  1.00 31.98 ? 45   HIS B NE2 1 
ATOM   1968 N N   . ILE B 1 46  ? 1.717   35.091 1.241   1.00 27.34 ? 46   ILE B N   1 
ATOM   1969 C CA  . ILE B 1 46  ? 3.014   35.660 1.593   1.00 29.43 ? 46   ILE B CA  1 
ATOM   1970 C C   . ILE B 1 46  ? 4.073   34.563 1.556   1.00 30.33 ? 46   ILE B C   1 
ATOM   1971 O O   . ILE B 1 46  ? 3.865   33.481 2.105   1.00 27.86 ? 46   ILE B O   1 
ATOM   1972 C CB  . ILE B 1 46  ? 2.997   36.251 3.027   1.00 28.49 ? 46   ILE B CB  1 
ATOM   1973 C CG1 . ILE B 1 46  ? 2.090   37.483 3.083   1.00 29.26 ? 46   ILE B CG1 1 
ATOM   1974 C CG2 . ILE B 1 46  ? 4.416   36.616 3.465   1.00 28.76 ? 46   ILE B CG2 1 
ATOM   1975 C CD1 . ILE B 1 46  ? 1.909   38.039 4.489   1.00 29.90 ? 46   ILE B CD1 1 
ATOM   1976 N N   . ILE B 1 47  ? 5.196   34.833 0.896   1.00 30.49 ? 47   ILE B N   1 
ATOM   1977 C CA  . ILE B 1 47  ? 6.295   33.875 0.849   1.00 27.40 ? 47   ILE B CA  1 
ATOM   1978 C C   . ILE B 1 47  ? 7.467   34.535 1.578   1.00 29.58 ? 47   ILE B C   1 
ATOM   1979 O O   . ILE B 1 47  ? 7.851   35.664 1.256   1.00 28.19 ? 47   ILE B O   1 
ATOM   1980 C CB  . ILE B 1 47  ? 6.720   33.541 -0.592  1.00 26.42 ? 47   ILE B CB  1 
ATOM   1981 C CG1 . ILE B 1 47  ? 5.495   33.175 -1.435  1.00 26.13 ? 47   ILE B CG1 1 
ATOM   1982 C CG2 . ILE B 1 47  ? 7.698   32.363 -0.575  1.00 27.05 ? 47   ILE B CG2 1 
ATOM   1983 C CD1 . ILE B 1 47  ? 5.817   32.928 -2.890  1.00 26.44 ? 47   ILE B CD1 1 
ATOM   1984 N N   . GLN B 1 48  ? 8.022   33.832 2.561   1.00 29.85 ? 48   GLN B N   1 
ATOM   1985 C CA  . GLN B 1 48  ? 9.128   34.345 3.369   1.00 34.00 ? 48   GLN B CA  1 
ATOM   1986 C C   . GLN B 1 48  ? 10.329  34.881 2.595   1.00 34.14 ? 48   GLN B C   1 
ATOM   1987 O O   . GLN B 1 48  ? 10.795  35.989 2.853   1.00 39.84 ? 48   GLN B O   1 
ATOM   1988 C CB  . GLN B 1 48  ? 9.603   33.260 4.340   1.00 34.69 ? 48   GLN B CB  1 
ATOM   1989 C CG  . GLN B 1 48  ? 8.570   32.880 5.391   1.00 47.38 ? 48   GLN B CG  1 
ATOM   1990 C CD  . GLN B 1 48  ? 8.419   33.933 6.472   1.00 51.99 ? 48   GLN B CD  1 
ATOM   1991 O OE1 . GLN B 1 48  ? 9.275   34.064 7.351   1.00 53.89 ? 48   GLN B OE1 1 
ATOM   1992 N NE2 . GLN B 1 48  ? 7.332   34.698 6.407   1.00 53.57 ? 48   GLN B NE2 1 
ATOM   1993 N N   . GLY B 1 49  ? 10.842  34.098 1.657   1.00 30.86 ? 49   GLY B N   1 
ATOM   1994 C CA  . GLY B 1 49  ? 12.004  34.552 0.915   1.00 32.68 ? 49   GLY B CA  1 
ATOM   1995 C C   . GLY B 1 49  ? 13.282  34.187 1.653   1.00 31.79 ? 49   GLY B C   1 
ATOM   1996 O O   . GLY B 1 49  ? 13.232  33.482 2.660   1.00 29.67 ? 49   GLY B O   1 
ATOM   1997 N N   . PRO B 1 50  ? 14.444  34.682 1.209   1.00 31.11 ? 50   PRO B N   1 
ATOM   1998 C CA  . PRO B 1 50  ? 14.621  35.567 0.058   1.00 31.62 ? 50   PRO B CA  1 
ATOM   1999 C C   . PRO B 1 50  ? 14.267  34.983 -1.305  1.00 29.25 ? 50   PRO B C   1 
ATOM   2000 O O   . PRO B 1 50  ? 14.088  33.773 -1.466  1.00 27.86 ? 50   PRO B O   1 
ATOM   2001 C CB  . PRO B 1 50  ? 16.092  35.964 0.156   1.00 33.03 ? 50   PRO B CB  1 
ATOM   2002 C CG  . PRO B 1 50  ? 16.722  34.767 0.780   1.00 33.95 ? 50   PRO B CG  1 
ATOM   2003 C CD  . PRO B 1 50  ? 15.738  34.394 1.852   1.00 33.88 ? 50   PRO B CD  1 
ATOM   2004 N N   . MET B 1 51  ? 14.151  35.878 -2.276  1.00 29.45 ? 51   MET B N   1 
ATOM   2005 C CA  . MET B 1 51  ? 13.853  35.521 -3.655  1.00 27.12 ? 51   MET B CA  1 
ATOM   2006 C C   . MET B 1 51  ? 15.164  35.668 -4.412  1.00 28.38 ? 51   MET B C   1 
ATOM   2007 O O   . MET B 1 51  ? 15.915  36.620 -4.176  1.00 25.68 ? 51   MET B O   1 
ATOM   2008 C CB  . MET B 1 51  ? 12.825  36.488 -4.250  1.00 27.36 ? 51   MET B CB  1 
ATOM   2009 C CG  . MET B 1 51  ? 12.510  36.239 -5.722  1.00 29.17 ? 51   MET B CG  1 
ATOM   2010 S SD  . MET B 1 51  ? 11.475  37.512 -6.485  1.00 29.66 ? 51   MET B SD  1 
ATOM   2011 C CE  . MET B 1 51  ? 9.866   37.045 -5.881  1.00 27.73 ? 51   MET B CE  1 
ATOM   2012 N N   . TYR B 1 52  ? 15.452  34.718 -5.296  1.00 26.88 ? 52   TYR B N   1 
ATOM   2013 C CA  . TYR B 1 52  ? 16.664  34.783 -6.098  1.00 28.48 ? 52   TYR B CA  1 
ATOM   2014 C C   . TYR B 1 52  ? 16.316  34.738 -7.572  1.00 30.70 ? 52   TYR B C   1 
ATOM   2015 O O   . TYR B 1 52  ? 15.495  33.923 -8.003  1.00 27.27 ? 52   TYR B O   1 
ATOM   2016 C CB  . TYR B 1 52  ? 17.606  33.609 -5.813  1.00 27.58 ? 52   TYR B CB  1 
ATOM   2017 C CG  . TYR B 1 52  ? 18.029  33.457 -4.377  1.00 30.40 ? 52   TYR B CG  1 
ATOM   2018 C CD1 . TYR B 1 52  ? 17.227  32.776 -3.462  1.00 33.87 ? 52   TYR B CD1 1 
ATOM   2019 C CD2 . TYR B 1 52  ? 19.241  33.981 -3.932  1.00 33.97 ? 52   TYR B CD2 1 
ATOM   2020 C CE1 . TYR B 1 52  ? 17.623  32.616 -2.140  1.00 39.61 ? 52   TYR B CE1 1 
ATOM   2021 C CE2 . TYR B 1 52  ? 19.646  33.828 -2.610  1.00 37.60 ? 52   TYR B CE2 1 
ATOM   2022 C CZ  . TYR B 1 52  ? 18.834  33.144 -1.722  1.00 38.44 ? 52   TYR B CZ  1 
ATOM   2023 O OH  . TYR B 1 52  ? 19.234  32.978 -0.417  1.00 46.60 ? 52   TYR B OH  1 
ATOM   2024 N N   . ASP B 1 53  ? 16.926  35.630 -8.341  1.00 30.60 ? 53   ASP B N   1 
ATOM   2025 C CA  . ASP B 1 53  ? 16.727  35.622 -9.776  1.00 35.68 ? 53   ASP B CA  1 
ATOM   2026 C C   . ASP B 1 53  ? 17.833  34.698 -10.265 1.00 39.04 ? 53   ASP B C   1 
ATOM   2027 O O   . ASP B 1 53  ? 19.016  34.994 -10.093 1.00 37.78 ? 53   ASP B O   1 
ATOM   2028 C CB  . ASP B 1 53  ? 16.928  37.007 -10.384 1.00 38.88 ? 53   ASP B CB  1 
ATOM   2029 C CG  . ASP B 1 53  ? 16.906  36.977 -11.906 1.00 41.27 ? 53   ASP B CG  1 
ATOM   2030 O OD1 . ASP B 1 53  ? 17.697  36.219 -12.505 1.00 45.21 ? 53   ASP B OD1 1 
ATOM   2031 O OD2 . ASP B 1 53  ? 16.098  37.704 -12.510 1.00 45.98 ? 53   ASP B OD2 1 
ATOM   2032 N N   . VAL B 1 54  ? 17.447  33.567 -10.839 1.00 42.11 ? 54   VAL B N   1 
ATOM   2033 C CA  . VAL B 1 54  ? 18.413  32.609 -11.352 1.00 46.91 ? 54   VAL B CA  1 
ATOM   2034 C C   . VAL B 1 54  ? 18.330  32.593 -12.871 1.00 51.04 ? 54   VAL B C   1 
ATOM   2035 O O   . VAL B 1 54  ? 18.598  31.579 -13.511 1.00 54.51 ? 54   VAL B O   1 
ATOM   2036 C CB  . VAL B 1 54  ? 18.147  31.191 -10.794 1.00 46.43 ? 54   VAL B CB  1 
ATOM   2037 C CG1 . VAL B 1 54  ? 18.451  31.156 -9.302  1.00 45.13 ? 54   VAL B CG1 1 
ATOM   2038 C CG2 . VAL B 1 54  ? 16.701  30.793 -11.042 1.00 45.29 ? 54   VAL B CG2 1 
ATOM   2039 N N   . SER B 1 55  ? 17.950  33.734 -13.436 1.00 56.48 ? 55   SER B N   1 
ATOM   2040 C CA  . SER B 1 55  ? 17.828  33.896 -14.880 1.00 61.65 ? 55   SER B CA  1 
ATOM   2041 C C   . SER B 1 55  ? 18.597  35.141 -15.303 1.00 65.06 ? 55   SER B C   1 
ATOM   2042 O O   . SER B 1 55  ? 18.018  36.208 -15.497 1.00 66.00 ? 55   SER B O   1 
ATOM   2043 C CB  . SER B 1 55  ? 16.359  34.044 -15.277 1.00 63.35 ? 55   SER B CB  1 
ATOM   2044 O OG  . SER B 1 55  ? 15.777  35.189 -14.674 1.00 68.22 ? 55   SER B OG  1 
ATOM   2045 N N   . GLY B 1 56  ? 19.909  34.995 -15.438 1.00 68.54 ? 56   GLY B N   1 
ATOM   2046 C CA  . GLY B 1 56  ? 20.742  36.115 -15.831 1.00 71.08 ? 56   GLY B CA  1 
ATOM   2047 C C   . GLY B 1 56  ? 22.203  35.727 -15.772 1.00 73.20 ? 56   GLY B C   1 
ATOM   2048 O O   . GLY B 1 56  ? 22.538  34.543 -15.814 1.00 74.76 ? 56   GLY B O   1 
ATOM   2049 N N   . THR B 1 57  ? 23.077  36.720 -15.666 1.00 73.53 ? 57   THR B N   1 
ATOM   2050 C CA  . THR B 1 57  ? 24.508  36.465 -15.609 1.00 73.18 ? 57   THR B CA  1 
ATOM   2051 C C   . THR B 1 57  ? 24.930  35.742 -14.331 1.00 72.19 ? 57   THR B C   1 
ATOM   2052 O O   . THR B 1 57  ? 26.009  35.152 -14.278 1.00 73.55 ? 57   THR B O   1 
ATOM   2053 C CB  . THR B 1 57  ? 25.303  37.778 -15.722 1.00 74.64 ? 57   THR B CB  1 
ATOM   2054 O OG1 . THR B 1 57  ? 24.979  38.633 -14.618 1.00 75.65 ? 57   THR B OG1 1 
ATOM   2055 C CG2 . THR B 1 57  ? 24.959  38.490 -17.023 1.00 74.49 ? 57   THR B CG2 1 
ATOM   2056 N N   . ALA B 1 58  ? 24.082  35.784 -13.305 1.00 69.55 ? 58   ALA B N   1 
ATOM   2057 C CA  . ALA B 1 58  ? 24.392  35.125 -12.035 1.00 67.08 ? 58   ALA B CA  1 
ATOM   2058 C C   . ALA B 1 58  ? 23.226  35.190 -11.047 1.00 63.82 ? 58   ALA B C   1 
ATOM   2059 O O   . ALA B 1 58  ? 22.324  36.013 -11.193 1.00 65.17 ? 58   ALA B O   1 
ATOM   2060 C CB  . ALA B 1 58  ? 25.635  35.759 -11.413 1.00 66.54 ? 58   ALA B CB  1 
ATOM   2061 N N   . PRO B 1 59  ? 23.232  34.312 -10.028 1.00 60.67 ? 59   PRO B N   1 
ATOM   2062 C CA  . PRO B 1 59  ? 22.177  34.269 -9.007  1.00 57.38 ? 59   PRO B CA  1 
ATOM   2063 C C   . PRO B 1 59  ? 22.118  35.571 -8.212  1.00 54.29 ? 59   PRO B C   1 
ATOM   2064 O O   . PRO B 1 59  ? 23.053  35.900 -7.478  1.00 54.14 ? 59   PRO B O   1 
ATOM   2065 C CB  . PRO B 1 59  ? 22.592  33.088 -8.131  1.00 59.17 ? 59   PRO B CB  1 
ATOM   2066 C CG  . PRO B 1 59  ? 23.331  32.202 -9.085  1.00 61.22 ? 59   PRO B CG  1 
ATOM   2067 C CD  . PRO B 1 59  ? 24.170  33.191 -9.849  1.00 61.03 ? 59   PRO B CD  1 
ATOM   2068 N N   . VAL B 1 60  ? 21.019  36.305 -8.353  1.00 47.58 ? 60   VAL B N   1 
ATOM   2069 C CA  . VAL B 1 60  ? 20.854  37.574 -7.656  1.00 42.51 ? 60   VAL B CA  1 
ATOM   2070 C C   . VAL B 1 60  ? 19.830  37.500 -6.528  1.00 37.31 ? 60   VAL B C   1 
ATOM   2071 O O   . VAL B 1 60  ? 18.694  37.077 -6.736  1.00 31.54 ? 60   VAL B O   1 
ATOM   2072 C CB  . VAL B 1 60  ? 20.418  38.687 -8.631  1.00 42.73 ? 60   VAL B CB  1 
ATOM   2073 C CG1 . VAL B 1 60  ? 20.220  39.993 -7.876  1.00 46.08 ? 60   VAL B CG1 1 
ATOM   2074 C CG2 . VAL B 1 60  ? 21.455  38.850 -9.727  1.00 45.15 ? 60   VAL B CG2 1 
ATOM   2075 N N   . ASN B 1 61  ? 20.242  37.923 -5.335  1.00 33.81 ? 61   ASN B N   1 
ATOM   2076 C CA  . ASN B 1 61  ? 19.359  37.923 -4.175  1.00 31.57 ? 61   ASN B CA  1 
ATOM   2077 C C   . ASN B 1 61  ? 18.520  39.199 -4.195  1.00 32.21 ? 61   ASN B C   1 
ATOM   2078 O O   . ASN B 1 61  ? 19.026  40.290 -3.918  1.00 30.09 ? 61   ASN B O   1 
ATOM   2079 C CB  . ASN B 1 61  ? 20.177  37.870 -2.881  1.00 32.49 ? 61   ASN B CB  1 
ATOM   2080 C CG  . ASN B 1 61  ? 19.305  37.734 -1.644  1.00 34.14 ? 61   ASN B CG  1 
ATOM   2081 O OD1 . ASN B 1 61  ? 18.318  38.454 -1.481  1.00 33.02 ? 61   ASN B OD1 1 
ATOM   2082 N ND2 . ASN B 1 61  ? 19.675  36.813 -0.757  1.00 32.46 ? 61   ASN B ND2 1 
ATOM   2083 N N   . VAL B 1 62  ? 17.240  39.053 -4.521  1.00 28.13 ? 62   VAL B N   1 
ATOM   2084 C CA  . VAL B 1 62  ? 16.317  40.183 -4.591  1.00 30.52 ? 62   VAL B CA  1 
ATOM   2085 C C   . VAL B 1 62  ? 16.100  40.844 -3.229  1.00 28.91 ? 62   VAL B C   1 
ATOM   2086 O O   . VAL B 1 62  ? 15.878  42.058 -3.144  1.00 30.93 ? 62   VAL B O   1 
ATOM   2087 C CB  . VAL B 1 62  ? 14.957  39.738 -5.168  1.00 27.36 ? 62   VAL B CB  1 
ATOM   2088 C CG1 . VAL B 1 62  ? 13.968  40.895 -5.148  1.00 29.70 ? 62   VAL B CG1 1 
ATOM   2089 C CG2 . VAL B 1 62  ? 15.149  39.232 -6.587  1.00 29.80 ? 62   VAL B CG2 1 
ATOM   2090 N N   . THR B 1 63  ? 16.161  40.052 -2.166  1.00 26.99 ? 63   THR B N   1 
ATOM   2091 C CA  . THR B 1 63  ? 15.987  40.593 -0.825  1.00 29.58 ? 63   THR B CA  1 
ATOM   2092 C C   . THR B 1 63  ? 17.144  41.528 -0.494  1.00 29.22 ? 63   THR B C   1 
ATOM   2093 O O   . THR B 1 63  ? 16.941  42.624 0.027   1.00 25.18 ? 63   THR B O   1 
ATOM   2094 C CB  . THR B 1 63  ? 15.928  39.475 0.231   1.00 30.00 ? 63   THR B CB  1 
ATOM   2095 O OG1 . THR B 1 63  ? 14.682  38.773 0.114   1.00 32.75 ? 63   THR B OG1 1 
ATOM   2096 C CG2 . THR B 1 63  ? 16.054  40.052 1.636   1.00 33.26 ? 63   THR B CG2 1 
ATOM   2097 N N   . ASN B 1 64  ? 18.360  41.092 -0.798  1.00 30.04 ? 64   ASN B N   1 
ATOM   2098 C CA  . ASN B 1 64  ? 19.525  41.915 -0.525  1.00 33.04 ? 64   ASN B CA  1 
ATOM   2099 C C   . ASN B 1 64  ? 19.435  43.191 -1.350  1.00 32.54 ? 64   ASN B C   1 
ATOM   2100 O O   . ASN B 1 64  ? 19.795  44.271 -0.881  1.00 32.24 ? 64   ASN B O   1 
ATOM   2101 C CB  . ASN B 1 64  ? 20.813  41.154 -0.853  1.00 36.50 ? 64   ASN B CB  1 
ATOM   2102 C CG  . ASN B 1 64  ? 21.006  39.932 0.028   1.00 42.31 ? 64   ASN B CG  1 
ATOM   2103 O OD1 . ASN B 1 64  ? 20.617  39.927 1.198   1.00 43.40 ? 64   ASN B OD1 1 
ATOM   2104 N ND2 . ASN B 1 64  ? 21.625  38.893 -0.526  1.00 46.70 ? 64   ASN B ND2 1 
ATOM   2105 N N   . LYS B 1 65  ? 18.935  43.067 -2.576  1.00 30.94 ? 65   LYS B N   1 
ATOM   2106 C CA  . LYS B 1 65  ? 18.794  44.219 -3.458  1.00 31.19 ? 65   LYS B CA  1 
ATOM   2107 C C   . LYS B 1 65  ? 17.770  45.202 -2.886  1.00 30.04 ? 65   LYS B C   1 
ATOM   2108 O O   . LYS B 1 65  ? 17.954  46.418 -2.949  1.00 26.67 ? 65   LYS B O   1 
ATOM   2109 C CB  . LYS B 1 65  ? 18.370  43.754 -4.856  1.00 34.77 ? 65   LYS B CB  1 
ATOM   2110 C CG  . LYS B 1 65  ? 18.351  44.855 -5.896  1.00 40.53 ? 65   LYS B CG  1 
ATOM   2111 C CD  . LYS B 1 65  ? 18.197  44.290 -7.299  1.00 45.39 ? 65   LYS B CD  1 
ATOM   2112 C CE  . LYS B 1 65  ? 18.233  45.397 -8.342  1.00 47.87 ? 65   LYS B CE  1 
ATOM   2113 N NZ  . LYS B 1 65  ? 18.132  44.865 -9.728  1.00 51.89 ? 65   LYS B NZ  1 
ATOM   2114 N N   . MET B 1 66  ? 16.688  44.675 -2.323  1.00 27.88 ? 66   MET B N   1 
ATOM   2115 C CA  . MET B 1 66  ? 15.666  45.530 -1.733  1.00 24.91 ? 66   MET B CA  1 
ATOM   2116 C C   . MET B 1 66  ? 16.261  46.321 -0.566  1.00 25.73 ? 66   MET B C   1 
ATOM   2117 O O   . MET B 1 66  ? 15.977  47.509 -0.401  1.00 25.93 ? 66   MET B O   1 
ATOM   2118 C CB  . MET B 1 66  ? 14.488  44.690 -1.237  1.00 27.94 ? 66   MET B CB  1 
ATOM   2119 C CG  . MET B 1 66  ? 13.364  45.524 -0.642  1.00 26.44 ? 66   MET B CG  1 
ATOM   2120 S SD  . MET B 1 66  ? 12.666  46.677 -1.855  1.00 30.61 ? 66   MET B SD  1 
ATOM   2121 C CE  . MET B 1 66  ? 11.044  46.978 -1.144  1.00 29.94 ? 66   MET B CE  1 
ATOM   2122 N N   . LEU B 1 67  ? 17.089  45.661 0.240   1.00 24.58 ? 67   LEU B N   1 
ATOM   2123 C CA  . LEU B 1 67  ? 17.717  46.320 1.384   1.00 29.08 ? 67   LEU B CA  1 
ATOM   2124 C C   . LEU B 1 67  ? 18.734  47.371 0.935   1.00 28.45 ? 67   LEU B C   1 
ATOM   2125 O O   . LEU B 1 67  ? 18.869  48.428 1.562   1.00 27.73 ? 67   LEU B O   1 
ATOM   2126 C CB  . LEU B 1 67  ? 18.395  45.282 2.289   1.00 29.25 ? 67   LEU B CB  1 
ATOM   2127 C CG  . LEU B 1 67  ? 17.467  44.273 2.979   1.00 30.59 ? 67   LEU B CG  1 
ATOM   2128 C CD1 . LEU B 1 67  ? 18.287  43.257 3.766   1.00 32.85 ? 67   LEU B CD1 1 
ATOM   2129 C CD2 . LEU B 1 67  ? 16.512  45.006 3.908   1.00 33.18 ? 67   LEU B CD2 1 
ATOM   2130 N N   . LEU B 1 68  ? 19.445  47.083 -0.153  1.00 30.14 ? 68   LEU B N   1 
ATOM   2131 C CA  . LEU B 1 68  ? 20.438  48.013 -0.685  1.00 30.30 ? 68   LEU B CA  1 
ATOM   2132 C C   . LEU B 1 68  ? 19.743  49.250 -1.243  1.00 28.42 ? 68   LEU B C   1 
ATOM   2133 O O   . LEU B 1 68  ? 20.329  50.329 -1.313  1.00 26.33 ? 68   LEU B O   1 
ATOM   2134 C CB  . LEU B 1 68  ? 21.275  47.342 -1.778  1.00 33.30 ? 68   LEU B CB  1 
ATOM   2135 C CG  . LEU B 1 68  ? 22.104  46.134 -1.337  1.00 37.24 ? 68   LEU B CG  1 
ATOM   2136 C CD1 . LEU B 1 68  ? 22.894  45.614 -2.527  1.00 37.68 ? 68   LEU B CD1 1 
ATOM   2137 C CD2 . LEU B 1 68  ? 23.042  46.521 -0.195  1.00 38.76 ? 68   LEU B CD2 1 
ATOM   2138 N N   . LYS B 1 69  ? 18.492  49.087 -1.654  1.00 25.93 ? 69   LYS B N   1 
ATOM   2139 C CA  . LYS B 1 69  ? 17.717  50.212 -2.164  1.00 26.54 ? 69   LYS B CA  1 
ATOM   2140 C C   . LYS B 1 69  ? 17.452  51.174 -1.001  1.00 26.17 ? 69   LYS B C   1 
ATOM   2141 O O   . LYS B 1 69  ? 17.426  52.393 -1.184  1.00 25.11 ? 69   LYS B O   1 
ATOM   2142 C CB  . LYS B 1 69  ? 16.391  49.717 -2.745  1.00 28.61 ? 69   LYS B CB  1 
ATOM   2143 C CG  . LYS B 1 69  ? 15.403  50.816 -3.106  1.00 27.28 ? 69   LYS B CG  1 
ATOM   2144 C CD  . LYS B 1 69  ? 14.151  50.223 -3.747  1.00 27.15 ? 69   LYS B CD  1 
ATOM   2145 C CE  . LYS B 1 69  ? 13.140  51.294 -4.125  1.00 29.93 ? 69   LYS B CE  1 
ATOM   2146 N NZ  . LYS B 1 69  ? 12.583  51.973 -2.928  1.00 33.19 ? 69   LYS B NZ  1 
ATOM   2147 N N   . GLN B 1 70  ? 17.240  50.618 0.191   1.00 23.95 ? 70   GLN B N   1 
ATOM   2148 C CA  . GLN B 1 70  ? 16.996  51.439 1.379   1.00 25.58 ? 70   GLN B CA  1 
ATOM   2149 C C   . GLN B 1 70  ? 18.273  52.201 1.735   1.00 23.65 ? 70   GLN B C   1 
ATOM   2150 O O   . GLN B 1 70  ? 18.227  53.374 2.115   1.00 21.44 ? 70   GLN B O   1 
ATOM   2151 C CB  . GLN B 1 70  ? 16.594  50.569 2.577   1.00 25.40 ? 70   GLN B CB  1 
ATOM   2152 C CG  . GLN B 1 70  ? 15.517  49.530 2.299   1.00 24.23 ? 70   GLN B CG  1 
ATOM   2153 C CD  . GLN B 1 70  ? 14.270  50.116 1.668   1.00 24.83 ? 70   GLN B CD  1 
ATOM   2154 O OE1 . GLN B 1 70  ? 13.678  51.065 2.186   1.00 29.57 ? 70   GLN B OE1 1 
ATOM   2155 N NE2 . GLN B 1 70  ? 13.861  49.548 0.542   1.00 25.10 ? 70   GLN B NE2 1 
ATOM   2156 N N   . LEU B 1 71  ? 19.411  51.522 1.611   1.00 23.14 ? 71   LEU B N   1 
ATOM   2157 C CA  . LEU B 1 71  ? 20.712  52.117 1.916   1.00 22.92 ? 71   LEU B CA  1 
ATOM   2158 C C   . LEU B 1 71  ? 20.981  53.284 0.973   1.00 25.28 ? 71   LEU B C   1 
ATOM   2159 O O   . LEU B 1 71  ? 21.519  54.316 1.378   1.00 24.53 ? 71   LEU B O   1 
ATOM   2160 C CB  . LEU B 1 71  ? 21.817  51.067 1.763   1.00 24.66 ? 71   LEU B CB  1 
ATOM   2161 C CG  . LEU B 1 71  ? 23.233  51.453 2.200   1.00 26.76 ? 71   LEU B CG  1 
ATOM   2162 C CD1 . LEU B 1 71  ? 23.229  51.809 3.684   1.00 30.44 ? 71   LEU B CD1 1 
ATOM   2163 C CD2 . LEU B 1 71  ? 24.187  50.296 1.929   1.00 31.14 ? 71   LEU B CD2 1 
ATOM   2164 N N   . ASN B 1 72  ? 20.611  53.104 -0.291  1.00 22.75 ? 72   ASN B N   1 
ATOM   2165 C CA  . ASN B 1 72  ? 20.789  54.145 -1.291  1.00 24.80 ? 72   ASN B CA  1 
ATOM   2166 C C   . ASN B 1 72  ? 19.997  55.382 -0.907  1.00 23.84 ? 72   ASN B C   1 
ATOM   2167 O O   . ASN B 1 72  ? 20.495  56.500 -1.006  1.00 24.85 ? 72   ASN B O   1 
ATOM   2168 C CB  . ASN B 1 72  ? 20.340  53.652 -2.668  1.00 28.67 ? 72   ASN B CB  1 
ATOM   2169 C CG  . ASN B 1 72  ? 20.384  54.747 -3.715  1.00 35.42 ? 72   ASN B CG  1 
ATOM   2170 O OD1 . ASN B 1 72  ? 19.366  55.375 -4.023  1.00 40.01 ? 72   ASN B OD1 1 
ATOM   2171 N ND2 . ASN B 1 72  ? 21.573  55.000 -4.255  1.00 36.54 ? 72   ASN B ND2 1 
ATOM   2172 N N   . ALA B 1 73  ? 18.762  55.186 -0.457  1.00 23.82 ? 73   ALA B N   1 
ATOM   2173 C CA  . ALA B 1 73  ? 17.934  56.315 -0.065  1.00 22.66 ? 73   ALA B CA  1 
ATOM   2174 C C   . ALA B 1 73  ? 18.507  57.040 1.153   1.00 23.27 ? 73   ALA B C   1 
ATOM   2175 O O   . ALA B 1 73  ? 18.230  58.219 1.363   1.00 20.90 ? 73   ALA B O   1 
ATOM   2176 C CB  . ALA B 1 73  ? 16.509  55.849 0.214   1.00 21.03 ? 73   ALA B CB  1 
ATOM   2177 N N   . LEU B 1 74  ? 19.316  56.344 1.950   1.00 22.01 ? 74   LEU B N   1 
ATOM   2178 C CA  . LEU B 1 74  ? 19.909  56.959 3.138   1.00 24.97 ? 74   LEU B CA  1 
ATOM   2179 C C   . LEU B 1 74  ? 21.222  57.696 2.865   1.00 23.19 ? 74   LEU B C   1 
ATOM   2180 O O   . LEU B 1 74  ? 21.841  58.235 3.785   1.00 25.16 ? 74   LEU B O   1 
ATOM   2181 C CB  . LEU B 1 74  ? 20.131  55.904 4.231   1.00 22.99 ? 74   LEU B CB  1 
ATOM   2182 C CG  . LEU B 1 74  ? 18.860  55.427 4.941   1.00 23.09 ? 74   LEU B CG  1 
ATOM   2183 C CD1 . LEU B 1 74  ? 19.191  54.246 5.840   1.00 25.53 ? 74   LEU B CD1 1 
ATOM   2184 C CD2 . LEU B 1 74  ? 18.259  56.575 5.758   1.00 20.04 ? 74   LEU B CD2 1 
ATOM   2185 N N   . GLU B 1 75  ? 21.651  57.723 1.610   1.00 22.16 ? 75   GLU B N   1 
ATOM   2186 C CA  . GLU B 1 75  ? 22.890  58.416 1.277   1.00 26.60 ? 75   GLU B CA  1 
ATOM   2187 C C   . GLU B 1 75  ? 22.815  59.892 1.669   1.00 25.11 ? 75   GLU B C   1 
ATOM   2188 O O   . GLU B 1 75  ? 23.811  60.473 2.103   1.00 22.70 ? 75   GLU B O   1 
ATOM   2189 C CB  . GLU B 1 75  ? 23.202  58.278 -0.217  1.00 26.95 ? 75   GLU B CB  1 
ATOM   2190 C CG  . GLU B 1 75  ? 23.487  56.849 -0.640  1.00 34.54 ? 75   GLU B CG  1 
ATOM   2191 C CD  . GLU B 1 75  ? 24.197  56.761 -1.977  1.00 41.16 ? 75   GLU B CD  1 
ATOM   2192 O OE1 . GLU B 1 75  ? 23.704  57.356 -2.958  1.00 43.55 ? 75   GLU B OE1 1 
ATOM   2193 O OE2 . GLU B 1 75  ? 25.248  56.090 -2.045  1.00 45.71 ? 75   GLU B OE2 1 
ATOM   2194 N N   . LYS B 1 76  ? 21.638  60.498 1.525   1.00 24.13 ? 76   LYS B N   1 
ATOM   2195 C CA  . LYS B 1 76  ? 21.474  61.904 1.889   1.00 23.75 ? 76   LYS B CA  1 
ATOM   2196 C C   . LYS B 1 76  ? 21.621  62.122 3.398   1.00 25.31 ? 76   LYS B C   1 
ATOM   2197 O O   . LYS B 1 76  ? 21.756  63.260 3.861   1.00 22.87 ? 76   LYS B O   1 
ATOM   2198 C CB  . LYS B 1 76  ? 20.109  62.430 1.417   1.00 25.35 ? 76   LYS B CB  1 
ATOM   2199 C CG  . LYS B 1 76  ? 18.901  61.743 2.043   1.00 21.80 ? 76   LYS B CG  1 
ATOM   2200 C CD  . LYS B 1 76  ? 17.595  62.326 1.496   1.00 26.05 ? 76   LYS B CD  1 
ATOM   2201 C CE  . LYS B 1 76  ? 16.393  61.510 1.945   1.00 24.55 ? 76   LYS B CE  1 
ATOM   2202 N NZ  . LYS B 1 76  ? 16.454  60.114 1.397   1.00 26.15 ? 76   LYS B NZ  1 
ATOM   2203 N N   . GLU B 1 77  ? 21.603  61.037 4.169   1.00 20.99 ? 77   GLU B N   1 
ATOM   2204 C CA  . GLU B 1 77  ? 21.747  61.150 5.616   1.00 22.92 ? 77   GLU B CA  1 
ATOM   2205 C C   . GLU B 1 77  ? 23.091  60.633 6.130   1.00 21.66 ? 77   GLU B C   1 
ATOM   2206 O O   . GLU B 1 77  ? 23.313  60.561 7.331   1.00 25.36 ? 77   GLU B O   1 
ATOM   2207 C CB  . GLU B 1 77  ? 20.599  60.422 6.324   1.00 24.32 ? 77   GLU B CB  1 
ATOM   2208 C CG  . GLU B 1 77  ? 19.282  61.182 6.266   1.00 25.45 ? 77   GLU B CG  1 
ATOM   2209 C CD  . GLU B 1 77  ? 18.102  60.444 6.899   1.00 23.88 ? 77   GLU B CD  1 
ATOM   2210 O OE1 . GLU B 1 77  ? 18.299  59.541 7.745   1.00 21.48 ? 77   GLU B OE1 1 
ATOM   2211 O OE2 . GLU B 1 77  ? 16.959  60.795 6.554   1.00 22.62 ? 77   GLU B OE2 1 
ATOM   2212 N N   . MET B 1 78  ? 23.987  60.276 5.221   1.00 19.96 ? 78   MET B N   1 
ATOM   2213 C CA  . MET B 1 78  ? 25.296  59.776 5.617   1.00 21.00 ? 78   MET B CA  1 
ATOM   2214 C C   . MET B 1 78  ? 26.293  60.898 5.882   1.00 22.66 ? 78   MET B C   1 
ATOM   2215 O O   . MET B 1 78  ? 26.241  61.947 5.240   1.00 22.24 ? 78   MET B O   1 
ATOM   2216 C CB  . MET B 1 78  ? 25.871  58.879 4.520   1.00 20.46 ? 78   MET B CB  1 
ATOM   2217 C CG  . MET B 1 78  ? 25.132  57.568 4.339   1.00 20.38 ? 78   MET B CG  1 
ATOM   2218 S SD  . MET B 1 78  ? 25.758  56.646 2.925   1.00 22.92 ? 78   MET B SD  1 
ATOM   2219 C CE  . MET B 1 78  ? 24.468  55.370 2.803   1.00 20.95 ? 78   MET B CE  1 
ATOM   2220 N N   . ILE B 1 79  ? 27.191  60.681 6.838   1.00 19.95 ? 79   ILE B N   1 
ATOM   2221 C CA  . ILE B 1 79  ? 28.235  61.667 7.100   1.00 19.88 ? 79   ILE B CA  1 
ATOM   2222 C C   . ILE B 1 79  ? 29.413  61.107 6.305   1.00 22.43 ? 79   ILE B C   1 
ATOM   2223 O O   . ILE B 1 79  ? 29.908  60.015 6.588   1.00 21.50 ? 79   ILE B O   1 
ATOM   2224 C CB  . ILE B 1 79  ? 28.580  61.771 8.588   1.00 17.30 ? 79   ILE B CB  1 
ATOM   2225 C CG1 . ILE B 1 79  ? 27.317  62.135 9.383   1.00 18.70 ? 79   ILE B CG1 1 
ATOM   2226 C CG2 . ILE B 1 79  ? 29.676  62.821 8.784   1.00 24.16 ? 79   ILE B CG2 1 
ATOM   2227 C CD1 . ILE B 1 79  ? 27.532  62.298 10.882  1.00 20.02 ? 79   ILE B CD1 1 
ATOM   2228 N N   . VAL B 1 80  ? 29.838  61.851 5.291   1.00 22.12 ? 80   VAL B N   1 
ATOM   2229 C CA  . VAL B 1 80  ? 30.903  61.399 4.407   1.00 22.99 ? 80   VAL B CA  1 
ATOM   2230 C C   . VAL B 1 80  ? 32.279  62.017 4.606   1.00 22.07 ? 80   VAL B C   1 
ATOM   2231 O O   . VAL B 1 80  ? 32.438  63.238 4.613   1.00 19.57 ? 80   VAL B O   1 
ATOM   2232 C CB  . VAL B 1 80  ? 30.499  61.623 2.925   1.00 24.96 ? 80   VAL B CB  1 
ATOM   2233 C CG1 . VAL B 1 80  ? 31.595  61.118 1.995   1.00 27.05 ? 80   VAL B CG1 1 
ATOM   2234 C CG2 . VAL B 1 80  ? 29.175  60.921 2.629   1.00 27.64 ? 80   VAL B CG2 1 
ATOM   2235 N N   . TYR B 1 81  ? 33.278  61.160 4.773   1.00 18.89 ? 81   TYR B N   1 
ATOM   2236 C CA  . TYR B 1 81  ? 34.652  61.629 4.904   1.00 18.82 ? 81   TYR B CA  1 
ATOM   2237 C C   . TYR B 1 81  ? 35.347  61.073 3.677   1.00 21.23 ? 81   TYR B C   1 
ATOM   2238 O O   . TYR B 1 81  ? 35.794  59.923 3.661   1.00 19.52 ? 81   TYR B O   1 
ATOM   2239 C CB  . TYR B 1 81  ? 35.303  61.113 6.194   1.00 22.19 ? 81   TYR B CB  1 
ATOM   2240 C CG  . TYR B 1 81  ? 34.734  61.754 7.441   1.00 21.93 ? 81   TYR B CG  1 
ATOM   2241 C CD1 . TYR B 1 81  ? 33.546  61.289 8.008   1.00 19.50 ? 81   TYR B CD1 1 
ATOM   2242 C CD2 . TYR B 1 81  ? 35.364  62.848 8.033   1.00 21.98 ? 81   TYR B CD2 1 
ATOM   2243 C CE1 . TYR B 1 81  ? 32.999  61.895 9.137   1.00 21.18 ? 81   TYR B CE1 1 
ATOM   2244 C CE2 . TYR B 1 81  ? 34.820  63.470 9.160   1.00 20.19 ? 81   TYR B CE2 1 
ATOM   2245 C CZ  . TYR B 1 81  ? 33.640  62.989 9.706   1.00 23.79 ? 81   TYR B CZ  1 
ATOM   2246 O OH  . TYR B 1 81  ? 33.089  63.604 10.807  1.00 24.29 ? 81   TYR B OH  1 
ATOM   2247 N N   . LYS B 1 82  ? 35.417  61.897 2.638   1.00 22.30 ? 82   LYS B N   1 
ATOM   2248 C CA  . LYS B 1 82  ? 36.015  61.482 1.377   1.00 22.53 ? 82   LYS B CA  1 
ATOM   2249 C C   . LYS B 1 82  ? 37.533  61.486 1.324   1.00 24.05 ? 82   LYS B C   1 
ATOM   2250 O O   . LYS B 1 82  ? 38.181  62.411 1.801   1.00 23.07 ? 82   LYS B O   1 
ATOM   2251 C CB  . LYS B 1 82  ? 35.480  62.344 0.225   1.00 24.91 ? 82   LYS B CB  1 
ATOM   2252 C CG  . LYS B 1 82  ? 35.997  61.895 -1.148  1.00 23.64 ? 82   LYS B CG  1 
ATOM   2253 C CD  . LYS B 1 82  ? 35.536  62.799 -2.274  1.00 25.60 ? 82   LYS B CD  1 
ATOM   2254 C CE  . LYS B 1 82  ? 36.218  62.417 -3.581  1.00 24.16 ? 82   LYS B CE  1 
ATOM   2255 N NZ  . LYS B 1 82  ? 37.706  62.561 -3.486  1.00 21.65 ? 82   LYS B NZ  1 
ATOM   2256 N N   . ALA B 1 83  ? 38.090  60.433 0.735   1.00 18.58 ? 83   ALA B N   1 
ATOM   2257 C CA  . ALA B 1 83  ? 39.530  60.324 0.550   1.00 21.64 ? 83   ALA B CA  1 
ATOM   2258 C C   . ALA B 1 83  ? 39.896  61.233 -0.639  1.00 22.33 ? 83   ALA B C   1 
ATOM   2259 O O   . ALA B 1 83  ? 39.163  61.300 -1.624  1.00 23.87 ? 83   ALA B O   1 
ATOM   2260 C CB  . ALA B 1 83  ? 39.904  58.884 0.233   1.00 24.97 ? 83   ALA B CB  1 
ATOM   2261 N N   . PRO B 1 84  ? 41.029  61.947 -0.553  1.00 23.21 ? 84   PRO B N   1 
ATOM   2262 C CA  . PRO B 1 84  ? 41.511  62.855 -1.604  1.00 23.79 ? 84   PRO B CA  1 
ATOM   2263 C C   . PRO B 1 84  ? 41.386  62.265 -3.012  1.00 24.52 ? 84   PRO B C   1 
ATOM   2264 O O   . PRO B 1 84  ? 40.880  62.914 -3.933  1.00 24.41 ? 84   PRO B O   1 
ATOM   2265 C CB  . PRO B 1 84  ? 42.959  63.093 -1.193  1.00 22.09 ? 84   PRO B CB  1 
ATOM   2266 C CG  . PRO B 1 84  ? 42.851  63.162 0.272   1.00 21.00 ? 84   PRO B CG  1 
ATOM   2267 C CD  . PRO B 1 84  ? 41.910  62.013 0.627   1.00 20.73 ? 84   PRO B CD  1 
ATOM   2268 N N   . GLN B 1 85  ? 41.879  61.041 -3.169  1.00 23.17 ? 85   GLN B N   1 
ATOM   2269 C CA  . GLN B 1 85  ? 41.796  60.316 -4.431  1.00 22.57 ? 85   GLN B CA  1 
ATOM   2270 C C   . GLN B 1 85  ? 41.093  59.025 -4.020  1.00 24.60 ? 85   GLN B C   1 
ATOM   2271 O O   . GLN B 1 85  ? 41.707  58.108 -3.473  1.00 23.19 ? 85   GLN B O   1 
ATOM   2272 C CB  . GLN B 1 85  ? 43.194  60.033 -5.005  1.00 21.97 ? 85   GLN B CB  1 
ATOM   2273 C CG  . GLN B 1 85  ? 44.009  61.294 -5.281  1.00 21.03 ? 85   GLN B CG  1 
ATOM   2274 C CD  . GLN B 1 85  ? 44.910  61.680 -4.120  1.00 25.29 ? 85   GLN B CD  1 
ATOM   2275 O OE1 . GLN B 1 85  ? 45.250  62.853 -3.933  1.00 25.58 ? 85   GLN B OE1 1 
ATOM   2276 N NE2 . GLN B 1 85  ? 45.322  60.689 -3.350  1.00 18.40 ? 85   GLN B NE2 1 
ATOM   2277 N N   . GLU B 1 86  ? 39.792  58.980 -4.282  1.00 23.85 ? 86   GLU B N   1 
ATOM   2278 C CA  . GLU B 1 86  ? 38.956  57.856 -3.887  1.00 25.87 ? 86   GLU B CA  1 
ATOM   2279 C C   . GLU B 1 86  ? 39.233  56.534 -4.595  1.00 24.06 ? 86   GLU B C   1 
ATOM   2280 O O   . GLU B 1 86  ? 39.117  56.431 -5.818  1.00 26.07 ? 86   GLU B O   1 
ATOM   2281 C CB  . GLU B 1 86  ? 37.491  58.263 -4.051  1.00 23.85 ? 86   GLU B CB  1 
ATOM   2282 C CG  . GLU B 1 86  ? 36.486  57.291 -3.474  1.00 24.97 ? 86   GLU B CG  1 
ATOM   2283 C CD  . GLU B 1 86  ? 35.084  57.861 -3.489  1.00 23.96 ? 86   GLU B CD  1 
ATOM   2284 O OE1 . GLU B 1 86  ? 34.717  58.577 -2.535  1.00 23.73 ? 86   GLU B OE1 1 
ATOM   2285 O OE2 . GLU B 1 86  ? 34.355  57.604 -4.466  1.00 27.98 ? 86   GLU B OE2 1 
ATOM   2286 N N   . LYS B 1 87  ? 39.597  55.527 -3.803  1.00 24.60 ? 87   LYS B N   1 
ATOM   2287 C CA  . LYS B 1 87  ? 39.895  54.188 -4.306  1.00 26.17 ? 87   LYS B CA  1 
ATOM   2288 C C   . LYS B 1 87  ? 38.835  53.183 -3.841  1.00 29.05 ? 87   LYS B C   1 
ATOM   2289 O O   . LYS B 1 87  ? 38.538  52.211 -4.537  1.00 26.47 ? 87   LYS B O   1 
ATOM   2290 C CB  . LYS B 1 87  ? 41.273  53.731 -3.811  1.00 24.43 ? 87   LYS B CB  1 
ATOM   2291 C CG  . LYS B 1 87  ? 42.424  54.711 -4.107  1.00 28.64 ? 87   LYS B CG  1 
ATOM   2292 C CD  . LYS B 1 87  ? 42.572  55.020 -5.597  1.00 24.35 ? 87   LYS B CD  1 
ATOM   2293 C CE  . LYS B 1 87  ? 43.729  56.007 -5.837  1.00 27.14 ? 87   LYS B CE  1 
ATOM   2294 N NZ  . LYS B 1 87  ? 43.840  56.438 -7.265  1.00 24.94 ? 87   LYS B NZ  1 
ATOM   2295 N N   . HIS B 1 88  ? 38.285  53.416 -2.652  1.00 27.09 ? 88   HIS B N   1 
ATOM   2296 C CA  . HIS B 1 88  ? 37.256  52.547 -2.077  1.00 24.45 ? 88   HIS B CA  1 
ATOM   2297 C C   . HIS B 1 88  ? 36.244  53.405 -1.330  1.00 25.41 ? 88   HIS B C   1 
ATOM   2298 O O   . HIS B 1 88  ? 36.589  54.456 -0.793  1.00 23.71 ? 88   HIS B O   1 
ATOM   2299 C CB  . HIS B 1 88  ? 37.865  51.576 -1.067  1.00 26.76 ? 88   HIS B CB  1 
ATOM   2300 C CG  . HIS B 1 88  ? 38.842  50.609 -1.657  1.00 27.20 ? 88   HIS B CG  1 
ATOM   2301 N ND1 . HIS B 1 88  ? 38.467  49.610 -2.527  1.00 30.46 ? 88   HIS B ND1 1 
ATOM   2302 C CD2 . HIS B 1 88  ? 40.180  50.481 -1.489  1.00 27.01 ? 88   HIS B CD2 1 
ATOM   2303 C CE1 . HIS B 1 88  ? 39.532  48.905 -2.869  1.00 29.95 ? 88   HIS B CE1 1 
ATOM   2304 N NE2 . HIS B 1 88  ? 40.584  49.413 -2.253  1.00 29.90 ? 88   HIS B NE2 1 
ATOM   2305 N N   . VAL B 1 89  ? 35.000  52.953 -1.289  1.00 24.95 ? 89   VAL B N   1 
ATOM   2306 C CA  . VAL B 1 89  ? 33.960  53.667 -0.558  1.00 24.69 ? 89   VAL B CA  1 
ATOM   2307 C C   . VAL B 1 89  ? 33.293  52.641 0.349   1.00 27.51 ? 89   VAL B C   1 
ATOM   2308 O O   . VAL B 1 89  ? 32.777  51.631 -0.129  1.00 25.26 ? 89   VAL B O   1 
ATOM   2309 C CB  . VAL B 1 89  ? 32.884  54.255 -1.491  1.00 26.49 ? 89   VAL B CB  1 
ATOM   2310 C CG1 . VAL B 1 89  ? 31.772  54.905 -0.660  1.00 27.37 ? 89   VAL B CG1 1 
ATOM   2311 C CG2 . VAL B 1 89  ? 33.507  55.261 -2.440  1.00 24.89 ? 89   VAL B CG2 1 
ATOM   2312 N N   . ILE B 1 90  ? 33.331  52.879 1.654   1.00 24.11 ? 90   ILE B N   1 
ATOM   2313 C CA  . ILE B 1 90  ? 32.695  51.961 2.590   1.00 25.91 ? 90   ILE B CA  1 
ATOM   2314 C C   . ILE B 1 90  ? 31.667  52.702 3.422   1.00 25.16 ? 90   ILE B C   1 
ATOM   2315 O O   . ILE B 1 90  ? 31.817  53.891 3.708   1.00 23.38 ? 90   ILE B O   1 
ATOM   2316 C CB  . ILE B 1 90  ? 33.709  51.294 3.554   1.00 24.86 ? 90   ILE B CB  1 
ATOM   2317 C CG1 . ILE B 1 90  ? 34.490  52.368 4.320   1.00 21.90 ? 90   ILE B CG1 1 
ATOM   2318 C CG2 . ILE B 1 90  ? 34.645  50.359 2.769   1.00 26.02 ? 90   ILE B CG2 1 
ATOM   2319 C CD1 . ILE B 1 90  ? 35.410  51.816 5.392   1.00 26.79 ? 90   ILE B CD1 1 
ATOM   2320 N N   . THR B 1 91  ? 30.610  51.995 3.795   1.00 24.77 ? 91   THR B N   1 
ATOM   2321 C CA  . THR B 1 91  ? 29.562  52.584 4.614   1.00 23.34 ? 91   THR B CA  1 
ATOM   2322 C C   . THR B 1 91  ? 29.722  51.928 5.969   1.00 25.14 ? 91   THR B C   1 
ATOM   2323 O O   . THR B 1 91  ? 29.728  50.700 6.075   1.00 24.10 ? 91   THR B O   1 
ATOM   2324 C CB  . THR B 1 91  ? 28.174  52.299 4.016   1.00 21.47 ? 91   THR B CB  1 
ATOM   2325 O OG1 . THR B 1 91  ? 28.141  52.778 2.666   1.00 25.92 ? 91   THR B OG1 1 
ATOM   2326 C CG2 . THR B 1 91  ? 27.090  53.004 4.820   1.00 23.28 ? 91   THR B CG2 1 
ATOM   2327 N N   . VAL B 1 92  ? 29.868  52.749 7.001   1.00 21.02 ? 92   VAL B N   1 
ATOM   2328 C CA  . VAL B 1 92  ? 30.088  52.249 8.347   1.00 21.05 ? 92   VAL B CA  1 
ATOM   2329 C C   . VAL B 1 92  ? 29.008  52.616 9.355   1.00 22.07 ? 92   VAL B C   1 
ATOM   2330 O O   . VAL B 1 92  ? 28.681  53.792 9.541   1.00 19.50 ? 92   VAL B O   1 
ATOM   2331 C CB  . VAL B 1 92  ? 31.449  52.760 8.883   1.00 24.07 ? 92   VAL B CB  1 
ATOM   2332 C CG1 . VAL B 1 92  ? 31.707  52.232 10.292  1.00 21.96 ? 92   VAL B CG1 1 
ATOM   2333 C CG2 . VAL B 1 92  ? 32.567  52.340 7.934   1.00 21.57 ? 92   VAL B CG2 1 
ATOM   2334 N N   . PHE B 1 93  ? 28.446  51.593 9.989   1.00 19.51 ? 93   PHE B N   1 
ATOM   2335 C CA  . PHE B 1 93  ? 27.449  51.792 11.033  1.00 20.16 ? 93   PHE B CA  1 
ATOM   2336 C C   . PHE B 1 93  ? 28.288  52.056 12.271  1.00 20.79 ? 93   PHE B C   1 
ATOM   2337 O O   . PHE B 1 93  ? 29.065  51.199 12.697  1.00 20.61 ? 93   PHE B O   1 
ATOM   2338 C CB  . PHE B 1 93  ? 26.592  50.530 11.200  1.00 19.46 ? 93   PHE B CB  1 
ATOM   2339 C CG  . PHE B 1 93  ? 25.547  50.372 10.131  1.00 20.91 ? 93   PHE B CG  1 
ATOM   2340 C CD1 . PHE B 1 93  ? 24.359  51.095 10.192  1.00 21.82 ? 93   PHE B CD1 1 
ATOM   2341 C CD2 . PHE B 1 93  ? 25.766  49.537 9.040   1.00 23.39 ? 93   PHE B CD2 1 
ATOM   2342 C CE1 . PHE B 1 93  ? 23.404  50.995 9.184   1.00 19.50 ? 93   PHE B CE1 1 
ATOM   2343 C CE2 . PHE B 1 93  ? 24.822  49.429 8.025   1.00 24.26 ? 93   PHE B CE2 1 
ATOM   2344 C CZ  . PHE B 1 93  ? 23.633  50.162 8.096   1.00 24.18 ? 93   PHE B CZ  1 
ATOM   2345 N N   . THR B 1 94  ? 28.147  53.252 12.837  1.00 17.94 ? 94   THR B N   1 
ATOM   2346 C CA  . THR B 1 94  ? 28.940  53.638 13.992  1.00 17.66 ? 94   THR B CA  1 
ATOM   2347 C C   . THR B 1 94  ? 28.104  54.099 15.193  1.00 18.26 ? 94   THR B C   1 
ATOM   2348 O O   . THR B 1 94  ? 26.942  54.489 15.050  1.00 19.33 ? 94   THR B O   1 
ATOM   2349 C CB  . THR B 1 94  ? 29.947  54.752 13.585  1.00 21.20 ? 94   THR B CB  1 
ATOM   2350 O OG1 . THR B 1 94  ? 30.861  54.993 14.661  1.00 22.70 ? 94   THR B OG1 1 
ATOM   2351 C CG2 . THR B 1 94  ? 29.206  56.054 13.241  1.00 16.90 ? 94   THR B CG2 1 
ATOM   2352 N N   . ASP B 1 95  ? 28.714  54.045 16.376  1.00 20.34 ? 95   ASP B N   1 
ATOM   2353 C CA  . ASP B 1 95  ? 28.078  54.440 17.636  1.00 19.40 ? 95   ASP B CA  1 
ATOM   2354 C C   . ASP B 1 95  ? 29.053  55.384 18.343  1.00 20.26 ? 95   ASP B C   1 
ATOM   2355 O O   . ASP B 1 95  ? 30.201  55.019 18.592  1.00 19.81 ? 95   ASP B O   1 
ATOM   2356 C CB  . ASP B 1 95  ? 27.833  53.180 18.488  1.00 19.83 ? 95   ASP B CB  1 
ATOM   2357 C CG  . ASP B 1 95  ? 27.092  53.460 19.789  1.00 23.61 ? 95   ASP B CG  1 
ATOM   2358 O OD1 . ASP B 1 95  ? 27.086  54.616 20.274  1.00 23.01 ? 95   ASP B OD1 1 
ATOM   2359 O OD2 . ASP B 1 95  ? 26.519  52.491 20.345  1.00 26.92 ? 95   ASP B OD2 1 
ATOM   2360 N N   . ILE B 1 96  ? 28.616  56.596 18.669  1.00 20.95 ? 96   ILE B N   1 
ATOM   2361 C CA  . ILE B 1 96  ? 29.517  57.544 19.322  1.00 24.03 ? 96   ILE B CA  1 
ATOM   2362 C C   . ILE B 1 96  ? 29.976  57.146 20.726  1.00 23.65 ? 96   ILE B C   1 
ATOM   2363 O O   . ILE B 1 96  ? 30.875  57.772 21.286  1.00 26.17 ? 96   ILE B O   1 
ATOM   2364 C CB  . ILE B 1 96  ? 28.906  58.976 19.361  1.00 27.24 ? 96   ILE B CB  1 
ATOM   2365 C CG1 . ILE B 1 96  ? 27.552  58.971 20.074  1.00 26.89 ? 96   ILE B CG1 1 
ATOM   2366 C CG2 . ILE B 1 96  ? 28.752  59.506 17.945  1.00 34.73 ? 96   ILE B CG2 1 
ATOM   2367 C CD1 . ILE B 1 96  ? 27.651  58.992 21.573  1.00 38.18 ? 96   ILE B CD1 1 
ATOM   2368 N N   . THR B 1 97  ? 29.377  56.102 21.290  1.00 24.97 ? 97   THR B N   1 
ATOM   2369 C CA  . THR B 1 97  ? 29.760  55.638 22.627  1.00 24.22 ? 97   THR B CA  1 
ATOM   2370 C C   . THR B 1 97  ? 30.643  54.400 22.515  1.00 25.40 ? 97   THR B C   1 
ATOM   2371 O O   . THR B 1 97  ? 31.092  53.850 23.523  1.00 26.41 ? 97   THR B O   1 
ATOM   2372 C CB  . THR B 1 97  ? 28.520  55.264 23.488  1.00 27.28 ? 97   THR B CB  1 
ATOM   2373 O OG1 . THR B 1 97  ? 27.864  54.120 22.924  1.00 29.96 ? 97   THR B OG1 1 
ATOM   2374 C CG2 . THR B 1 97  ? 27.541  56.422 23.546  1.00 28.52 ? 97   THR B CG2 1 
ATOM   2375 N N   . CYS B 1 98  ? 30.894  53.970 21.282  1.00 24.77 ? 98   CYS B N   1 
ATOM   2376 C CA  . CYS B 1 98  ? 31.697  52.778 21.024  1.00 23.84 ? 98   CYS B CA  1 
ATOM   2377 C C   . CYS B 1 98  ? 33.205  53.044 20.913  1.00 24.34 ? 98   CYS B C   1 
ATOM   2378 O O   . CYS B 1 98  ? 33.658  53.857 20.100  1.00 25.64 ? 98   CYS B O   1 
ATOM   2379 C CB  . CYS B 1 98  ? 31.114  52.068 19.782  1.00 24.88 ? 98   CYS B CB  1 
ATOM   2380 S SG  . CYS B 1 98  ? 32.234  51.305 18.566  1.00 27.70 ? 98   CYS B SG  1 
ATOM   2381 N N   . GLY B 1 99  ? 33.970  52.358 21.766  1.00 23.47 ? 99   GLY B N   1 
ATOM   2382 C CA  . GLY B 1 99  ? 35.417  52.510 21.804  1.00 20.34 ? 99   GLY B CA  1 
ATOM   2383 C C   . GLY B 1 99  ? 36.148  52.326 20.485  1.00 23.81 ? 99   GLY B C   1 
ATOM   2384 O O   . GLY B 1 99  ? 36.994  53.146 20.128  1.00 22.38 ? 99   GLY B O   1 
ATOM   2385 N N   . TYR B 1 100 ? 35.850  51.247 19.767  1.00 20.47 ? 100  TYR B N   1 
ATOM   2386 C CA  . TYR B 1 100 ? 36.489  51.009 18.478  1.00 23.21 ? 100  TYR B CA  1 
ATOM   2387 C C   . TYR B 1 100 ? 36.062  52.059 17.459  1.00 23.39 ? 100  TYR B C   1 
ATOM   2388 O O   . TYR B 1 100 ? 36.785  52.343 16.500  1.00 23.11 ? 100  TYR B O   1 
ATOM   2389 C CB  . TYR B 1 100 ? 36.135  49.617 17.960  1.00 26.62 ? 100  TYR B CB  1 
ATOM   2390 C CG  . TYR B 1 100 ? 37.019  48.529 18.525  1.00 28.44 ? 100  TYR B CG  1 
ATOM   2391 C CD1 . TYR B 1 100 ? 38.386  48.503 18.241  1.00 30.07 ? 100  TYR B CD1 1 
ATOM   2392 C CD2 . TYR B 1 100 ? 36.495  47.528 19.339  1.00 31.18 ? 100  TYR B CD2 1 
ATOM   2393 C CE1 . TYR B 1 100 ? 39.213  47.503 18.755  1.00 30.62 ? 100  TYR B CE1 1 
ATOM   2394 C CE2 . TYR B 1 100 ? 37.315  46.520 19.863  1.00 32.53 ? 100  TYR B CE2 1 
ATOM   2395 C CZ  . TYR B 1 100 ? 38.669  46.517 19.565  1.00 32.83 ? 100  TYR B CZ  1 
ATOM   2396 O OH  . TYR B 1 100 ? 39.486  45.532 20.077  1.00 33.94 ? 100  TYR B OH  1 
ATOM   2397 N N   . CYS B 1 101 ? 34.874  52.620 17.668  1.00 25.36 ? 101  CYS B N   1 
ATOM   2398 C CA  . CYS B 1 101 ? 34.358  53.647 16.779  1.00 20.64 ? 101  CYS B CA  1 
ATOM   2399 C C   . CYS B 1 101 ? 35.148  54.928 17.023  1.00 21.58 ? 101  CYS B C   1 
ATOM   2400 O O   . CYS B 1 101 ? 35.427  55.676 16.083  1.00 21.25 ? 101  CYS B O   1 
ATOM   2401 C CB  . CYS B 1 101 ? 32.879  53.880 17.052  1.00 23.93 ? 101  CYS B CB  1 
ATOM   2402 S SG  . CYS B 1 101 ? 31.842  52.391 16.871  1.00 25.87 ? 101  CYS B SG  1 
ATOM   2403 N N   . HIS B 1 102 ? 35.497  55.183 18.284  1.00 21.65 ? 102  HIS B N   1 
ATOM   2404 C CA  . HIS B 1 102 ? 36.295  56.365 18.616  1.00 22.12 ? 102  HIS B CA  1 
ATOM   2405 C C   . HIS B 1 102 ? 37.622  56.225 17.883  1.00 23.05 ? 102  HIS B C   1 
ATOM   2406 O O   . HIS B 1 102 ? 38.110  57.168 17.247  1.00 22.46 ? 102  HIS B O   1 
ATOM   2407 C CB  . HIS B 1 102 ? 36.580  56.435 20.121  1.00 23.87 ? 102  HIS B CB  1 
ATOM   2408 C CG  . HIS B 1 102 ? 35.356  56.593 20.966  1.00 24.77 ? 102  HIS B CG  1 
ATOM   2409 N ND1 . HIS B 1 102 ? 35.334  56.274 22.306  1.00 27.50 ? 102  HIS B ND1 1 
ATOM   2410 C CD2 . HIS B 1 102 ? 34.112  57.037 20.664  1.00 26.32 ? 102  HIS B CD2 1 
ATOM   2411 C CE1 . HIS B 1 102 ? 34.129  56.510 22.794  1.00 29.23 ? 102  HIS B CE1 1 
ATOM   2412 N NE2 . HIS B 1 102 ? 33.368  56.973 21.818  1.00 24.25 ? 102  HIS B NE2 1 
ATOM   2413 N N   . LYS B 1 103 ? 38.201  55.030 17.969  1.00 20.62 ? 103  LYS B N   1 
ATOM   2414 C CA  . LYS B 1 103 ? 39.484  54.756 17.332  1.00 18.88 ? 103  LYS B CA  1 
ATOM   2415 C C   . LYS B 1 103 ? 39.410  54.932 15.825  1.00 20.48 ? 103  LYS B C   1 
ATOM   2416 O O   . LYS B 1 103 ? 40.263  55.589 15.226  1.00 19.83 ? 103  LYS B O   1 
ATOM   2417 C CB  . LYS B 1 103 ? 39.959  53.333 17.649  1.00 20.18 ? 103  LYS B CB  1 
ATOM   2418 C CG  . LYS B 1 103 ? 41.456  53.142 17.409  1.00 21.69 ? 103  LYS B CG  1 
ATOM   2419 C CD  . LYS B 1 103 ? 41.882  51.681 17.492  1.00 28.84 ? 103  LYS B CD  1 
ATOM   2420 C CE  . LYS B 1 103 ? 43.378  51.556 17.223  1.00 29.44 ? 103  LYS B CE  1 
ATOM   2421 N NZ  . LYS B 1 103 ? 43.817  50.148 17.011  1.00 34.03 ? 103  LYS B NZ  1 
ATOM   2422 N N   . LEU B 1 104 ? 38.384  54.355 15.206  1.00 20.28 ? 104  LEU B N   1 
ATOM   2423 C CA  . LEU B 1 104 ? 38.239  54.466 13.765  1.00 19.10 ? 104  LEU B CA  1 
ATOM   2424 C C   . LEU B 1 104 ? 38.225  55.947 13.366  1.00 19.20 ? 104  LEU B C   1 
ATOM   2425 O O   . LEU B 1 104 ? 38.937  56.360 12.448  1.00 20.14 ? 104  LEU B O   1 
ATOM   2426 C CB  . LEU B 1 104 ? 36.948  53.774 13.312  1.00 20.05 ? 104  LEU B CB  1 
ATOM   2427 C CG  . LEU B 1 104 ? 36.732  53.518 11.812  1.00 23.56 ? 104  LEU B CG  1 
ATOM   2428 C CD1 . LEU B 1 104 ? 35.623  52.491 11.641  1.00 24.64 ? 104  LEU B CD1 1 
ATOM   2429 C CD2 . LEU B 1 104 ? 36.383  54.805 11.084  1.00 22.88 ? 104  LEU B CD2 1 
ATOM   2430 N N   . HIS B 1 105 ? 37.431  56.746 14.066  1.00 18.68 ? 105  HIS B N   1 
ATOM   2431 C CA  . HIS B 1 105 ? 37.360  58.161 13.729  1.00 20.18 ? 105  HIS B CA  1 
ATOM   2432 C C   . HIS B 1 105 ? 38.680  58.896 13.932  1.00 23.09 ? 105  HIS B C   1 
ATOM   2433 O O   . HIS B 1 105 ? 39.052  59.758 13.130  1.00 22.23 ? 105  HIS B O   1 
ATOM   2434 C CB  . HIS B 1 105 ? 36.260  58.864 14.522  1.00 21.40 ? 105  HIS B CB  1 
ATOM   2435 C CG  . HIS B 1 105 ? 35.801  60.134 13.878  1.00 26.70 ? 105  HIS B CG  1 
ATOM   2436 N ND1 . HIS B 1 105 ? 35.253  60.160 12.613  1.00 28.34 ? 105  HIS B ND1 1 
ATOM   2437 C CD2 . HIS B 1 105 ? 35.881  61.423 14.281  1.00 23.62 ? 105  HIS B CD2 1 
ATOM   2438 C CE1 . HIS B 1 105 ? 35.020  61.412 12.263  1.00 29.08 ? 105  HIS B CE1 1 
ATOM   2439 N NE2 . HIS B 1 105 ? 35.393  62.198 13.257  1.00 26.51 ? 105  HIS B NE2 1 
ATOM   2440 N N   . GLU B 1 106 ? 39.391  58.567 15.002  1.00 21.91 ? 106  GLU B N   1 
ATOM   2441 C CA  . GLU B 1 106 ? 40.672  59.212 15.263  1.00 25.23 ? 106  GLU B CA  1 
ATOM   2442 C C   . GLU B 1 106 ? 41.690  58.904 14.167  1.00 25.32 ? 106  GLU B C   1 
ATOM   2443 O O   . GLU B 1 106 ? 42.634  59.667 13.959  1.00 24.30 ? 106  GLU B O   1 
ATOM   2444 C CB  . GLU B 1 106 ? 41.201  58.789 16.637  1.00 24.17 ? 106  GLU B CB  1 
ATOM   2445 C CG  . GLU B 1 106 ? 40.407  59.410 17.776  1.00 25.68 ? 106  GLU B CG  1 
ATOM   2446 C CD  . GLU B 1 106 ? 40.886  58.984 19.148  1.00 26.72 ? 106  GLU B CD  1 
ATOM   2447 O OE1 . GLU B 1 106 ? 42.047  58.537 19.278  1.00 27.32 ? 106  GLU B OE1 1 
ATOM   2448 O OE2 . GLU B 1 106 ? 40.095  59.107 20.101  1.00 28.64 ? 106  GLU B OE2 1 
ATOM   2449 N N   . GLN B 1 107 ? 41.485  57.795 13.455  1.00 20.68 ? 107  GLN B N   1 
ATOM   2450 C CA  . GLN B 1 107 ? 42.374  57.402 12.364  1.00 23.61 ? 107  GLN B CA  1 
ATOM   2451 C C   . GLN B 1 107 ? 41.791  57.753 10.988  1.00 22.12 ? 107  GLN B C   1 
ATOM   2452 O O   . GLN B 1 107 ? 42.268  57.257 9.971   1.00 22.80 ? 107  GLN B O   1 
ATOM   2453 C CB  . GLN B 1 107 ? 42.641  55.891 12.412  1.00 23.30 ? 107  GLN B CB  1 
ATOM   2454 C CG  . GLN B 1 107 ? 43.340  55.418 13.673  1.00 22.59 ? 107  GLN B CG  1 
ATOM   2455 C CD  . GLN B 1 107 ? 43.449  53.901 13.740  1.00 27.39 ? 107  GLN B CD  1 
ATOM   2456 O OE1 . GLN B 1 107 ? 42.452  53.187 13.592  1.00 24.74 ? 107  GLN B OE1 1 
ATOM   2457 N NE2 . GLN B 1 107 ? 44.660  53.403 13.965  1.00 23.63 ? 107  GLN B NE2 1 
ATOM   2458 N N   . MET B 1 108 ? 40.773  58.608 10.948  1.00 20.71 ? 108  MET B N   1 
ATOM   2459 C CA  . MET B 1 108 ? 40.151  58.960 9.671   1.00 21.76 ? 108  MET B CA  1 
ATOM   2460 C C   . MET B 1 108 ? 41.121  59.547 8.658   1.00 21.92 ? 108  MET B C   1 
ATOM   2461 O O   . MET B 1 108 ? 41.003  59.283 7.464   1.00 20.01 ? 108  MET B O   1 
ATOM   2462 C CB  . MET B 1 108 ? 38.991  59.936 9.873   1.00 21.77 ? 108  MET B CB  1 
ATOM   2463 C CG  . MET B 1 108 ? 38.135  60.127 8.619   1.00 22.20 ? 108  MET B CG  1 
ATOM   2464 S SD  . MET B 1 108 ? 37.345  58.575 8.047   1.00 22.34 ? 108  MET B SD  1 
ATOM   2465 C CE  . MET B 1 108 ? 36.057  58.365 9.302   1.00 24.72 ? 108  MET B CE  1 
ATOM   2466 N N   . ALA B 1 109 ? 42.077  60.346 9.121   1.00 22.71 ? 109  ALA B N   1 
ATOM   2467 C CA  . ALA B 1 109 ? 43.045  60.936 8.205   1.00 25.29 ? 109  ALA B CA  1 
ATOM   2468 C C   . ALA B 1 109 ? 43.819  59.824 7.505   1.00 25.39 ? 109  ALA B C   1 
ATOM   2469 O O   . ALA B 1 109 ? 44.156  59.939 6.325   1.00 24.00 ? 109  ALA B O   1 
ATOM   2470 C CB  . ALA B 1 109 ? 44.015  61.851 8.961   1.00 23.68 ? 109  ALA B CB  1 
ATOM   2471 N N   . ASP B 1 110 ? 44.093  58.750 8.240   1.00 25.07 ? 110  ASP B N   1 
ATOM   2472 C CA  . ASP B 1 110 ? 44.840  57.619 7.693   1.00 26.75 ? 110  ASP B CA  1 
ATOM   2473 C C   . ASP B 1 110 ? 44.030  56.826 6.674   1.00 21.10 ? 110  ASP B C   1 
ATOM   2474 O O   . ASP B 1 110 ? 44.544  56.473 5.616   1.00 24.58 ? 110  ASP B O   1 
ATOM   2475 C CB  . ASP B 1 110 ? 45.309  56.692 8.817   1.00 27.37 ? 110  ASP B CB  1 
ATOM   2476 C CG  . ASP B 1 110 ? 46.057  57.431 9.909   1.00 36.06 ? 110  ASP B CG  1 
ATOM   2477 O OD1 . ASP B 1 110 ? 45.399  58.067 10.760  1.00 44.85 ? 110  ASP B OD1 1 
ATOM   2478 O OD2 . ASP B 1 110 ? 47.303  57.383 9.917   1.00 37.46 ? 110  ASP B OD2 1 
ATOM   2479 N N   . TYR B 1 111 ? 42.775  56.523 6.993   1.00 21.75 ? 111  TYR B N   1 
ATOM   2480 C CA  . TYR B 1 111 ? 41.928  55.802 6.042   1.00 20.36 ? 111  TYR B CA  1 
ATOM   2481 C C   . TYR B 1 111 ? 41.823  56.639 4.769   1.00 20.52 ? 111  TYR B C   1 
ATOM   2482 O O   . TYR B 1 111 ? 41.953  56.118 3.660   1.00 19.17 ? 111  TYR B O   1 
ATOM   2483 C CB  . TYR B 1 111 ? 40.511  55.598 6.594   1.00 24.59 ? 111  TYR B CB  1 
ATOM   2484 C CG  . TYR B 1 111 ? 40.407  54.630 7.747   1.00 20.71 ? 111  TYR B CG  1 
ATOM   2485 C CD1 . TYR B 1 111 ? 40.635  53.263 7.563   1.00 23.15 ? 111  TYR B CD1 1 
ATOM   2486 C CD2 . TYR B 1 111 ? 40.071  55.077 9.021   1.00 23.10 ? 111  TYR B CD2 1 
ATOM   2487 C CE1 . TYR B 1 111 ? 40.527  52.371 8.626   1.00 22.91 ? 111  TYR B CE1 1 
ATOM   2488 C CE2 . TYR B 1 111 ? 39.965  54.198 10.089  1.00 22.51 ? 111  TYR B CE2 1 
ATOM   2489 C CZ  . TYR B 1 111 ? 40.192  52.846 9.885   1.00 25.34 ? 111  TYR B CZ  1 
ATOM   2490 O OH  . TYR B 1 111 ? 40.074  51.980 10.946  1.00 22.68 ? 111  TYR B OH  1 
ATOM   2491 N N   . ASN B 1 112 ? 41.575  57.941 4.940   1.00 19.09 ? 112  ASN B N   1 
ATOM   2492 C CA  . ASN B 1 112 ? 41.443  58.850 3.805   1.00 17.09 ? 112  ASN B CA  1 
ATOM   2493 C C   . ASN B 1 112 ? 42.739  58.893 2.984   1.00 20.70 ? 112  ASN B C   1 
ATOM   2494 O O   . ASN B 1 112 ? 42.705  58.894 1.749   1.00 19.11 ? 112  ASN B O   1 
ATOM   2495 C CB  . ASN B 1 112 ? 41.105  60.274 4.286   1.00 19.12 ? 112  ASN B CB  1 
ATOM   2496 C CG  . ASN B 1 112 ? 39.645  60.437 4.732   1.00 21.68 ? 112  ASN B CG  1 
ATOM   2497 O OD1 . ASN B 1 112 ? 39.286  61.463 5.312   1.00 20.93 ? 112  ASN B OD1 1 
ATOM   2498 N ND2 . ASN B 1 112 ? 38.804  59.444 4.450   1.00 18.86 ? 112  ASN B ND2 1 
ATOM   2499 N N   . ALA B 1 113 ? 43.876  58.934 3.675   1.00 21.97 ? 113  ALA B N   1 
ATOM   2500 C CA  . ALA B 1 113 ? 45.180  58.985 3.012   1.00 23.72 ? 113  ALA B CA  1 
ATOM   2501 C C   . ALA B 1 113 ? 45.437  57.719 2.201   1.00 25.44 ? 113  ALA B C   1 
ATOM   2502 O O   . ALA B 1 113 ? 46.174  57.741 1.208   1.00 25.27 ? 113  ALA B O   1 
ATOM   2503 C CB  . ALA B 1 113 ? 46.290  59.179 4.046   1.00 25.73 ? 113  ALA B CB  1 
ATOM   2504 N N   . LEU B 1 114 ? 44.832  56.618 2.633   1.00 24.13 ? 114  LEU B N   1 
ATOM   2505 C CA  . LEU B 1 114 ? 44.978  55.347 1.940   1.00 23.77 ? 114  LEU B CA  1 
ATOM   2506 C C   . LEU B 1 114 ? 43.907  55.166 0.872   1.00 24.72 ? 114  LEU B C   1 
ATOM   2507 O O   . LEU B 1 114 ? 43.702  54.062 0.363   1.00 27.02 ? 114  LEU B O   1 
ATOM   2508 C CB  . LEU B 1 114 ? 44.938  54.190 2.940   1.00 26.72 ? 114  LEU B CB  1 
ATOM   2509 C CG  . LEU B 1 114 ? 46.172  54.092 3.844   1.00 31.07 ? 114  LEU B CG  1 
ATOM   2510 C CD1 . LEU B 1 114 ? 46.007  52.937 4.819   1.00 27.30 ? 114  LEU B CD1 1 
ATOM   2511 C CD2 . LEU B 1 114 ? 47.417  53.891 2.992   1.00 33.01 ? 114  LEU B CD2 1 
ATOM   2512 N N   . GLY B 1 115 ? 43.212  56.253 0.551   1.00 20.23 ? 115  GLY B N   1 
ATOM   2513 C CA  . GLY B 1 115 ? 42.199  56.213 -0.491  1.00 18.31 ? 115  GLY B CA  1 
ATOM   2514 C C   . GLY B 1 115 ? 40.833  55.674 -0.106  1.00 18.49 ? 115  GLY B C   1 
ATOM   2515 O O   . GLY B 1 115 ? 40.016  55.368 -0.978  1.00 21.26 ? 115  GLY B O   1 
ATOM   2516 N N   . ILE B 1 116 ? 40.572  55.568 1.188   1.00 19.90 ? 116  ILE B N   1 
ATOM   2517 C CA  . ILE B 1 116 ? 39.286  55.055 1.643   1.00 20.62 ? 116  ILE B CA  1 
ATOM   2518 C C   . ILE B 1 116 ? 38.327  56.142 2.100   1.00 20.84 ? 116  ILE B C   1 
ATOM   2519 O O   . ILE B 1 116 ? 38.600  56.870 3.055   1.00 20.34 ? 116  ILE B O   1 
ATOM   2520 C CB  . ILE B 1 116 ? 39.455  54.075 2.813   1.00 20.93 ? 116  ILE B CB  1 
ATOM   2521 C CG1 . ILE B 1 116 ? 40.372  52.923 2.401   1.00 22.41 ? 116  ILE B CG1 1 
ATOM   2522 C CG2 . ILE B 1 116 ? 38.086  53.536 3.249   1.00 22.54 ? 116  ILE B CG2 1 
ATOM   2523 C CD1 . ILE B 1 116 ? 40.752  52.031 3.564   1.00 23.67 ? 116  ILE B CD1 1 
ATOM   2524 N N   . THR B 1 117 ? 37.202  56.236 1.405   1.00 19.06 ? 117  THR B N   1 
ATOM   2525 C CA  . THR B 1 117 ? 36.161  57.183 1.755   1.00 20.62 ? 117  THR B CA  1 
ATOM   2526 C C   . THR B 1 117 ? 35.248  56.450 2.729   1.00 22.36 ? 117  THR B C   1 
ATOM   2527 O O   . THR B 1 117 ? 34.839  55.311 2.468   1.00 22.38 ? 117  THR B O   1 
ATOM   2528 C CB  . THR B 1 117 ? 35.363  57.605 0.512   1.00 19.33 ? 117  THR B CB  1 
ATOM   2529 O OG1 . THR B 1 117 ? 36.135  58.544 -0.247  1.00 22.14 ? 117  THR B OG1 1 
ATOM   2530 C CG2 . THR B 1 117 ? 34.025  58.224 0.904   1.00 17.87 ? 117  THR B CG2 1 
ATOM   2531 N N   . VAL B 1 118 ? 34.948  57.089 3.857   1.00 20.19 ? 118  VAL B N   1 
ATOM   2532 C CA  . VAL B 1 118 ? 34.083  56.491 4.874   1.00 17.81 ? 118  VAL B CA  1 
ATOM   2533 C C   . VAL B 1 118 ? 32.779  57.266 4.974   1.00 21.55 ? 118  VAL B C   1 
ATOM   2534 O O   . VAL B 1 118 ? 32.786  58.492 5.123   1.00 18.53 ? 118  VAL B O   1 
ATOM   2535 C CB  . VAL B 1 118 ? 34.753  56.496 6.276   1.00 18.30 ? 118  VAL B CB  1 
ATOM   2536 C CG1 . VAL B 1 118 ? 33.802  55.890 7.317   1.00 18.82 ? 118  VAL B CG1 1 
ATOM   2537 C CG2 . VAL B 1 118 ? 36.070  55.704 6.239   1.00 23.80 ? 118  VAL B CG2 1 
ATOM   2538 N N   . ARG B 1 119 ? 31.663  56.549 4.883   1.00 20.28 ? 119  ARG B N   1 
ATOM   2539 C CA  . ARG B 1 119 ? 30.342  57.166 4.978   1.00 19.31 ? 119  ARG B CA  1 
ATOM   2540 C C   . ARG B 1 119 ? 29.651  56.589 6.215   1.00 22.79 ? 119  ARG B C   1 
ATOM   2541 O O   . ARG B 1 119 ? 29.448  55.379 6.310   1.00 22.29 ? 119  ARG B O   1 
ATOM   2542 C CB  . ARG B 1 119 ? 29.533  56.859 3.718   1.00 24.78 ? 119  ARG B CB  1 
ATOM   2543 C CG  . ARG B 1 119 ? 30.335  57.046 2.431   1.00 24.10 ? 119  ARG B CG  1 
ATOM   2544 C CD  . ARG B 1 119 ? 29.469  56.885 1.209   1.00 29.10 ? 119  ARG B CD  1 
ATOM   2545 N NE  . ARG B 1 119 ? 28.707  55.641 1.229   1.00 27.38 ? 119  ARG B NE  1 
ATOM   2546 C CZ  . ARG B 1 119 ? 27.786  55.327 0.326   1.00 29.67 ? 119  ARG B CZ  1 
ATOM   2547 N NH1 . ARG B 1 119 ? 27.524  56.164 -0.671  1.00 32.00 ? 119  ARG B NH1 1 
ATOM   2548 N NH2 . ARG B 1 119 ? 27.109  54.194 0.429   1.00 28.23 ? 119  ARG B NH2 1 
ATOM   2549 N N   . TYR B 1 120 ? 29.284  57.449 7.162   1.00 18.38 ? 120  TYR B N   1 
ATOM   2550 C CA  . TYR B 1 120 ? 28.654  56.976 8.395   1.00 18.87 ? 120  TYR B CA  1 
ATOM   2551 C C   . TYR B 1 120 ? 27.130  56.984 8.440   1.00 18.41 ? 120  TYR B C   1 
ATOM   2552 O O   . TYR B 1 120 ? 26.487  57.878 7.904   1.00 18.37 ? 120  TYR B O   1 
ATOM   2553 C CB  . TYR B 1 120 ? 29.097  57.820 9.600   1.00 17.64 ? 120  TYR B CB  1 
ATOM   2554 C CG  . TYR B 1 120 ? 30.537  57.716 10.063  1.00 21.29 ? 120  TYR B CG  1 
ATOM   2555 C CD1 . TYR B 1 120 ? 31.119  56.482 10.366  1.00 22.68 ? 120  TYR B CD1 1 
ATOM   2556 C CD2 . TYR B 1 120 ? 31.264  58.871 10.352  1.00 22.06 ? 120  TYR B CD2 1 
ATOM   2557 C CE1 . TYR B 1 120 ? 32.386  56.408 10.966  1.00 19.32 ? 120  TYR B CE1 1 
ATOM   2558 C CE2 . TYR B 1 120 ? 32.522  58.809 10.946  1.00 23.85 ? 120  TYR B CE2 1 
ATOM   2559 C CZ  . TYR B 1 120 ? 33.076  57.579 11.257  1.00 24.09 ? 120  TYR B CZ  1 
ATOM   2560 O OH  . TYR B 1 120 ? 34.294  57.535 11.900  1.00 21.39 ? 120  TYR B OH  1 
ATOM   2561 N N   . LEU B 1 121 ? 26.577  55.973 9.104   1.00 20.04 ? 121  LEU B N   1 
ATOM   2562 C CA  . LEU B 1 121 ? 25.148  55.874 9.381   1.00 20.33 ? 121  LEU B CA  1 
ATOM   2563 C C   . LEU B 1 121 ? 25.183  55.594 10.884  1.00 22.55 ? 121  LEU B C   1 
ATOM   2564 O O   . LEU B 1 121 ? 26.144  54.990 11.379  1.00 21.61 ? 121  LEU B O   1 
ATOM   2565 C CB  . LEU B 1 121 ? 24.478  54.720 8.633   1.00 21.90 ? 121  LEU B CB  1 
ATOM   2566 C CG  . LEU B 1 121 ? 24.093  54.967 7.171   1.00 23.41 ? 121  LEU B CG  1 
ATOM   2567 C CD1 . LEU B 1 121 ? 23.484  53.691 6.604   1.00 21.78 ? 121  LEU B CD1 1 
ATOM   2568 C CD2 . LEU B 1 121 ? 23.105  56.134 7.064   1.00 22.65 ? 121  LEU B CD2 1 
ATOM   2569 N N   . ALA B 1 122 ? 24.159  56.031 11.611  1.00 18.50 ? 122  ALA B N   1 
ATOM   2570 C CA  . ALA B 1 122 ? 24.133  55.859 13.057  1.00 21.68 ? 122  ALA B CA  1 
ATOM   2571 C C   . ALA B 1 122 ? 23.578  54.519 13.520  1.00 21.75 ? 122  ALA B C   1 
ATOM   2572 O O   . ALA B 1 122 ? 22.562  54.047 13.020  1.00 24.10 ? 122  ALA B O   1 
ATOM   2573 C CB  . ALA B 1 122 ? 23.338  57.000 13.695  1.00 24.52 ? 122  ALA B CB  1 
ATOM   2574 N N   . PHE B 1 123 ? 24.256  53.901 14.478  1.00 19.16 ? 123  PHE B N   1 
ATOM   2575 C CA  . PHE B 1 123 ? 23.783  52.631 15.001  1.00 21.86 ? 123  PHE B CA  1 
ATOM   2576 C C   . PHE B 1 123 ? 24.032  52.563 16.496  1.00 23.08 ? 123  PHE B C   1 
ATOM   2577 O O   . PHE B 1 123 ? 25.081  52.102 16.954  1.00 21.60 ? 123  PHE B O   1 
ATOM   2578 C CB  . PHE B 1 123 ? 24.460  51.453 14.291  1.00 21.95 ? 123  PHE B CB  1 
ATOM   2579 C CG  . PHE B 1 123 ? 23.809  50.129 14.578  1.00 24.41 ? 123  PHE B CG  1 
ATOM   2580 C CD1 . PHE B 1 123 ? 24.088  49.438 15.756  1.00 24.75 ? 123  PHE B CD1 1 
ATOM   2581 C CD2 . PHE B 1 123 ? 22.876  49.597 13.691  1.00 22.91 ? 123  PHE B CD2 1 
ATOM   2582 C CE1 . PHE B 1 123 ? 23.444  48.233 16.045  1.00 25.96 ? 123  PHE B CE1 1 
ATOM   2583 C CE2 . PHE B 1 123 ? 22.225  48.395 13.968  1.00 23.11 ? 123  PHE B CE2 1 
ATOM   2584 C CZ  . PHE B 1 123 ? 22.510  47.712 15.148  1.00 21.30 ? 123  PHE B CZ  1 
ATOM   2585 N N   . PRO B 1 124 ? 23.071  53.059 17.281  1.00 22.58 ? 124  PRO B N   1 
ATOM   2586 C CA  . PRO B 1 124 ? 23.178  53.053 18.740  1.00 24.59 ? 124  PRO B CA  1 
ATOM   2587 C C   . PRO B 1 124 ? 22.999  51.627 19.259  1.00 26.21 ? 124  PRO B C   1 
ATOM   2588 O O   . PRO B 1 124 ? 21.900  51.074 19.224  1.00 29.54 ? 124  PRO B O   1 
ATOM   2589 C CB  . PRO B 1 124 ? 22.047  53.984 19.162  1.00 22.55 ? 124  PRO B CB  1 
ATOM   2590 C CG  . PRO B 1 124 ? 20.991  53.694 18.116  1.00 24.61 ? 124  PRO B CG  1 
ATOM   2591 C CD  . PRO B 1 124 ? 21.812  53.693 16.844  1.00 21.43 ? 124  PRO B CD  1 
ATOM   2592 N N   . ARG B 1 125 ? 24.089  51.022 19.716  1.00 28.17 ? 125  ARG B N   1 
ATOM   2593 C CA  . ARG B 1 125 ? 24.036  49.657 20.235  1.00 29.73 ? 125  ARG B CA  1 
ATOM   2594 C C   . ARG B 1 125 ? 23.020  49.523 21.362  1.00 28.31 ? 125  ARG B C   1 
ATOM   2595 O O   . ARG B 1 125 ? 22.424  48.465 21.547  1.00 31.81 ? 125  ARG B O   1 
ATOM   2596 C CB  . ARG B 1 125 ? 25.411  49.233 20.757  1.00 28.10 ? 125  ARG B CB  1 
ATOM   2597 C CG  . ARG B 1 125 ? 26.487  49.112 19.692  1.00 23.94 ? 125  ARG B CG  1 
ATOM   2598 C CD  . ARG B 1 125 ? 27.838  48.974 20.362  1.00 24.28 ? 125  ARG B CD  1 
ATOM   2599 N NE  . ARG B 1 125 ? 28.117  50.128 21.217  1.00 29.02 ? 125  ARG B NE  1 
ATOM   2600 C CZ  . ARG B 1 125 ? 29.141  50.210 22.061  1.00 29.24 ? 125  ARG B CZ  1 
ATOM   2601 N NH1 . ARG B 1 125 ? 29.995  49.202 22.172  1.00 30.76 ? 125  ARG B NH1 1 
ATOM   2602 N NH2 . ARG B 1 125 ? 29.307  51.300 22.798  1.00 29.23 ? 125  ARG B NH2 1 
ATOM   2603 N N   . GLN B 1 126 ? 22.837  50.599 22.117  1.00 31.47 ? 126  GLN B N   1 
ATOM   2604 C CA  . GLN B 1 126 ? 21.907  50.615 23.240  1.00 35.29 ? 126  GLN B CA  1 
ATOM   2605 C C   . GLN B 1 126 ? 20.456  50.702 22.774  1.00 36.18 ? 126  GLN B C   1 
ATOM   2606 O O   . GLN B 1 126 ? 19.534  50.706 23.590  1.00 36.50 ? 126  GLN B O   1 
ATOM   2607 C CB  . GLN B 1 126 ? 22.236  51.795 24.160  1.00 38.31 ? 126  GLN B CB  1 
ATOM   2608 C CG  . GLN B 1 126 ? 23.627  51.715 24.789  1.00 44.01 ? 126  GLN B CG  1 
ATOM   2609 C CD  . GLN B 1 126 ? 24.160  53.066 25.250  1.00 48.24 ? 126  GLN B CD  1 
ATOM   2610 O OE1 . GLN B 1 126 ? 25.208  53.143 25.889  1.00 54.01 ? 126  GLN B OE1 1 
ATOM   2611 N NE2 . GLN B 1 126 ? 23.444  54.136 24.917  1.00 48.20 ? 126  GLN B NE2 1 
ATOM   2612 N N   . GLY B 1 127 ? 20.260  50.775 21.462  1.00 35.00 ? 127  GLY B N   1 
ATOM   2613 C CA  . GLY B 1 127 ? 18.914  50.862 20.920  1.00 31.92 ? 127  GLY B CA  1 
ATOM   2614 C C   . GLY B 1 127 ? 18.393  52.283 20.814  1.00 30.15 ? 127  GLY B C   1 
ATOM   2615 O O   . GLY B 1 127 ? 19.110  53.245 21.084  1.00 30.35 ? 127  GLY B O   1 
ATOM   2616 N N   . LEU B 1 128 ? 17.131  52.418 20.424  1.00 29.70 ? 128  LEU B N   1 
ATOM   2617 C CA  . LEU B 1 128 ? 16.515  53.732 20.273  1.00 29.25 ? 128  LEU B CA  1 
ATOM   2618 C C   . LEU B 1 128 ? 16.106  54.322 21.624  1.00 30.22 ? 128  LEU B C   1 
ATOM   2619 O O   . LEU B 1 128 ? 15.889  53.592 22.596  1.00 29.89 ? 128  LEU B O   1 
ATOM   2620 C CB  . LEU B 1 128 ? 15.301  53.625 19.346  1.00 30.70 ? 128  LEU B CB  1 
ATOM   2621 C CG  . LEU B 1 128 ? 15.641  53.023 17.973  1.00 30.54 ? 128  LEU B CG  1 
ATOM   2622 C CD1 . LEU B 1 128 ? 14.374  52.795 17.169  1.00 34.54 ? 128  LEU B CD1 1 
ATOM   2623 C CD2 . LEU B 1 128 ? 16.591  53.948 17.230  1.00 34.70 ? 128  LEU B CD2 1 
ATOM   2624 N N   . ASP B 1 129 ? 16.019  55.648 21.670  1.00 32.50 ? 129  ASP B N   1 
ATOM   2625 C CA  . ASP B 1 129 ? 15.655  56.379 22.883  1.00 37.19 ? 129  ASP B CA  1 
ATOM   2626 C C   . ASP B 1 129 ? 16.792  56.382 23.899  1.00 36.37 ? 129  ASP B C   1 
ATOM   2627 O O   . ASP B 1 129 ? 16.619  56.809 25.042  1.00 38.61 ? 129  ASP B O   1 
ATOM   2628 C CB  . ASP B 1 129 ? 14.396  55.784 23.518  1.00 38.74 ? 129  ASP B CB  1 
ATOM   2629 C CG  . ASP B 1 129 ? 13.207  55.813 22.580  1.00 42.47 ? 129  ASP B CG  1 
ATOM   2630 O OD1 . ASP B 1 129 ? 12.918  56.892 22.024  1.00 41.44 ? 129  ASP B OD1 1 
ATOM   2631 O OD2 . ASP B 1 129 ? 12.565  54.759 22.401  1.00 45.04 ? 129  ASP B OD2 1 
ATOM   2632 N N   . SER B 1 130 ? 17.956  55.906 23.474  1.00 32.34 ? 130  SER B N   1 
ATOM   2633 C CA  . SER B 1 130 ? 19.127  55.862 24.340  1.00 30.72 ? 130  SER B CA  1 
ATOM   2634 C C   . SER B 1 130 ? 19.857  57.202 24.288  1.00 30.83 ? 130  SER B C   1 
ATOM   2635 O O   . SER B 1 130 ? 19.600  58.030 23.406  1.00 27.67 ? 130  SER B O   1 
ATOM   2636 C CB  . SER B 1 130 ? 20.070  54.748 23.883  1.00 32.74 ? 130  SER B CB  1 
ATOM   2637 O OG  . SER B 1 130 ? 20.450  54.938 22.529  1.00 32.87 ? 130  SER B OG  1 
ATOM   2638 N N   . ASP B 1 131 ? 20.765  57.427 25.232  1.00 29.56 ? 131  ASP B N   1 
ATOM   2639 C CA  . ASP B 1 131 ? 21.516  58.675 25.233  1.00 30.44 ? 131  ASP B CA  1 
ATOM   2640 C C   . ASP B 1 131 ? 22.301  58.749 23.924  1.00 29.06 ? 131  ASP B C   1 
ATOM   2641 O O   . ASP B 1 131 ? 22.426  59.813 23.321  1.00 27.02 ? 131  ASP B O   1 
ATOM   2642 C CB  . ASP B 1 131 ? 22.496  58.735 26.412  1.00 33.93 ? 131  ASP B CB  1 
ATOM   2643 C CG  . ASP B 1 131 ? 21.818  58.536 27.757  1.00 36.47 ? 131  ASP B CG  1 
ATOM   2644 O OD1 . ASP B 1 131 ? 20.706  59.067 27.962  1.00 39.31 ? 131  ASP B OD1 1 
ATOM   2645 O OD2 . ASP B 1 131 ? 22.415  57.857 28.615  1.00 39.58 ? 131  ASP B OD2 1 
ATOM   2646 N N   . ALA B 1 132 ? 22.823  57.602 23.495  1.00 28.49 ? 132  ALA B N   1 
ATOM   2647 C CA  . ALA B 1 132 ? 23.607  57.518 22.267  1.00 28.75 ? 132  ALA B CA  1 
ATOM   2648 C C   . ALA B 1 132 ? 22.782  57.919 21.048  1.00 28.92 ? 132  ALA B C   1 
ATOM   2649 O O   . ALA B 1 132 ? 23.262  58.634 20.172  1.00 28.17 ? 132  ALA B O   1 
ATOM   2650 C CB  . ALA B 1 132 ? 24.148  56.098 22.086  1.00 29.92 ? 132  ALA B CB  1 
ATOM   2651 N N   . GLU B 1 133 ? 21.537  57.461 20.998  1.00 26.54 ? 133  GLU B N   1 
ATOM   2652 C CA  . GLU B 1 133 ? 20.667  57.786 19.879  1.00 26.65 ? 133  GLU B CA  1 
ATOM   2653 C C   . GLU B 1 133 ? 20.349  59.279 19.870  1.00 25.25 ? 133  GLU B C   1 
ATOM   2654 O O   . GLU B 1 133 ? 20.343  59.919 18.818  1.00 27.30 ? 133  GLU B O   1 
ATOM   2655 C CB  . GLU B 1 133 ? 19.379  56.970 19.967  1.00 25.96 ? 133  GLU B CB  1 
ATOM   2656 C CG  . GLU B 1 133 ? 18.524  57.014 18.713  1.00 27.89 ? 133  GLU B CG  1 
ATOM   2657 C CD  . GLU B 1 133 ? 17.220  57.753 18.920  1.00 37.45 ? 133  GLU B CD  1 
ATOM   2658 O OE1 . GLU B 1 133 ? 16.504  57.433 19.897  1.00 39.15 ? 133  GLU B OE1 1 
ATOM   2659 O OE2 . GLU B 1 133 ? 16.906  58.644 18.103  1.00 39.01 ? 133  GLU B OE2 1 
ATOM   2660 N N   . LYS B 1 134 ? 20.095  59.830 21.051  1.00 28.46 ? 134  LYS B N   1 
ATOM   2661 C CA  . LYS B 1 134 ? 19.775  61.248 21.182  1.00 30.23 ? 134  LYS B CA  1 
ATOM   2662 C C   . LYS B 1 134 ? 20.961  62.098 20.747  1.00 28.25 ? 134  LYS B C   1 
ATOM   2663 O O   . LYS B 1 134 ? 20.804  63.107 20.068  1.00 27.31 ? 134  LYS B O   1 
ATOM   2664 C CB  . LYS B 1 134 ? 19.425  61.574 22.636  1.00 34.08 ? 134  LYS B CB  1 
ATOM   2665 C CG  . LYS B 1 134 ? 18.242  60.799 23.195  1.00 40.24 ? 134  LYS B CG  1 
ATOM   2666 C CD  . LYS B 1 134 ? 18.066  61.076 24.685  1.00 44.26 ? 134  LYS B CD  1 
ATOM   2667 C CE  . LYS B 1 134 ? 16.958  60.224 25.289  1.00 48.70 ? 134  LYS B CE  1 
ATOM   2668 N NZ  . LYS B 1 134 ? 16.842  60.430 26.763  1.00 49.98 ? 134  LYS B NZ  1 
ATOM   2669 N N   . GLU B 1 135 ? 22.153  61.675 21.148  1.00 29.78 ? 135  GLU B N   1 
ATOM   2670 C CA  . GLU B 1 135 ? 23.374  62.389 20.814  1.00 29.61 ? 135  GLU B CA  1 
ATOM   2671 C C   . GLU B 1 135 ? 23.657  62.367 19.312  1.00 27.18 ? 135  GLU B C   1 
ATOM   2672 O O   . GLU B 1 135 ? 24.056  63.380 18.738  1.00 25.04 ? 135  GLU B O   1 
ATOM   2673 C CB  . GLU B 1 135 ? 24.553  61.773 21.571  1.00 36.48 ? 135  GLU B CB  1 
ATOM   2674 C CG  . GLU B 1 135 ? 25.807  62.628 21.581  1.00 47.40 ? 135  GLU B CG  1 
ATOM   2675 C CD  . GLU B 1 135 ? 25.587  63.959 22.273  1.00 54.05 ? 135  GLU B CD  1 
ATOM   2676 O OE1 . GLU B 1 135 ? 24.955  63.968 23.353  1.00 58.52 ? 135  GLU B OE1 1 
ATOM   2677 O OE2 . GLU B 1 135 ? 26.050  64.992 21.747  1.00 58.55 ? 135  GLU B OE2 1 
ATOM   2678 N N   . MET B 1 136 ? 23.458  61.218 18.673  1.00 24.90 ? 136  MET B N   1 
ATOM   2679 C CA  . MET B 1 136 ? 23.717  61.126 17.242  1.00 24.39 ? 136  MET B CA  1 
ATOM   2680 C C   . MET B 1 136 ? 22.649  61.855 16.430  1.00 22.16 ? 136  MET B C   1 
ATOM   2681 O O   . MET B 1 136 ? 22.921  62.354 15.341  1.00 22.76 ? 136  MET B O   1 
ATOM   2682 C CB  . MET B 1 136 ? 23.854  59.658 16.820  1.00 21.38 ? 136  MET B CB  1 
ATOM   2683 C CG  . MET B 1 136 ? 25.060  58.986 17.489  1.00 22.61 ? 136  MET B CG  1 
ATOM   2684 S SD  . MET B 1 136 ? 25.511  57.361 16.844  1.00 25.13 ? 136  MET B SD  1 
ATOM   2685 C CE  . MET B 1 136 ? 24.433  56.318 17.779  1.00 26.72 ? 136  MET B CE  1 
ATOM   2686 N N   . LYS B 1 137 ? 21.437  61.931 16.966  1.00 24.04 ? 137  LYS B N   1 
ATOM   2687 C CA  . LYS B 1 137 ? 20.369  62.657 16.289  1.00 27.06 ? 137  LYS B CA  1 
ATOM   2688 C C   . LYS B 1 137 ? 20.841  64.111 16.158  1.00 25.38 ? 137  LYS B C   1 
ATOM   2689 O O   . LYS B 1 137 ? 20.724  64.727 15.096  1.00 26.98 ? 137  LYS B O   1 
ATOM   2690 C CB  . LYS B 1 137 ? 19.089  62.599 17.128  1.00 30.51 ? 137  LYS B CB  1 
ATOM   2691 C CG  . LYS B 1 137 ? 17.918  63.393 16.575  1.00 36.59 ? 137  LYS B CG  1 
ATOM   2692 C CD  . LYS B 1 137 ? 17.487  62.894 15.204  1.00 41.00 ? 137  LYS B CD  1 
ATOM   2693 C CE  . LYS B 1 137 ? 16.125  63.466 14.812  1.00 46.27 ? 137  LYS B CE  1 
ATOM   2694 N NZ  . LYS B 1 137 ? 16.131  64.950 14.774  1.00 51.78 ? 137  LYS B NZ  1 
ATOM   2695 N N   . ALA B 1 138 ? 21.391  64.642 17.247  1.00 25.83 ? 138  ALA B N   1 
ATOM   2696 C CA  . ALA B 1 138 ? 21.887  66.019 17.276  1.00 28.64 ? 138  ALA B CA  1 
ATOM   2697 C C   . ALA B 1 138 ? 23.007  66.226 16.263  1.00 26.98 ? 138  ALA B C   1 
ATOM   2698 O O   . ALA B 1 138 ? 23.021  67.217 15.536  1.00 27.65 ? 138  ALA B O   1 
ATOM   2699 C CB  . ALA B 1 138 ? 22.378  66.368 18.679  1.00 28.85 ? 138  ALA B CB  1 
ATOM   2700 N N   . ILE B 1 139 ? 23.947  65.284 16.221  1.00 24.06 ? 139  ILE B N   1 
ATOM   2701 C CA  . ILE B 1 139 ? 25.069  65.350 15.284  1.00 23.07 ? 139  ILE B CA  1 
ATOM   2702 C C   . ILE B 1 139 ? 24.602  65.338 13.833  1.00 25.02 ? 139  ILE B C   1 
ATOM   2703 O O   . ILE B 1 139 ? 25.006  66.182 13.026  1.00 25.58 ? 139  ILE B O   1 
ATOM   2704 C CB  . ILE B 1 139 ? 26.033  64.144 15.484  1.00 23.01 ? 139  ILE B CB  1 
ATOM   2705 C CG1 . ILE B 1 139 ? 26.758  64.282 16.827  1.00 26.69 ? 139  ILE B CG1 1 
ATOM   2706 C CG2 . ILE B 1 139 ? 27.011  64.043 14.295  1.00 16.45 ? 139  ILE B CG2 1 
ATOM   2707 C CD1 . ILE B 1 139 ? 27.515  63.026 17.270  1.00 27.66 ? 139  ILE B CD1 1 
ATOM   2708 N N   . TRP B 1 140 ? 23.766  64.362 13.502  1.00 24.86 ? 140  TRP B N   1 
ATOM   2709 C CA  . TRP B 1 140 ? 23.258  64.211 12.145  1.00 26.94 ? 140  TRP B CA  1 
ATOM   2710 C C   . TRP B 1 140 ? 22.379  65.376 11.693  1.00 29.96 ? 140  TRP B C   1 
ATOM   2711 O O   . TRP B 1 140 ? 22.135  65.554 10.501  1.00 29.29 ? 140  TRP B O   1 
ATOM   2712 C CB  . TRP B 1 140 ? 22.497  62.886 12.032  1.00 25.15 ? 140  TRP B CB  1 
ATOM   2713 C CG  . TRP B 1 140 ? 23.314  61.781 11.394  1.00 23.38 ? 140  TRP B CG  1 
ATOM   2714 C CD1 . TRP B 1 140 ? 23.238  61.361 10.099  1.00 23.91 ? 140  TRP B CD1 1 
ATOM   2715 C CD2 . TRP B 1 140 ? 24.344  60.988 12.011  1.00 20.74 ? 140  TRP B CD2 1 
ATOM   2716 N NE1 . TRP B 1 140 ? 24.150  60.362 9.866   1.00 18.76 ? 140  TRP B NE1 1 
ATOM   2717 C CE2 . TRP B 1 140 ? 24.844  60.111 11.018  1.00 20.50 ? 140  TRP B CE2 1 
ATOM   2718 C CE3 . TRP B 1 140 ? 24.892  60.934 13.299  1.00 22.54 ? 140  TRP B CE3 1 
ATOM   2719 C CZ2 . TRP B 1 140 ? 25.869  59.188 11.271  1.00 19.62 ? 140  TRP B CZ2 1 
ATOM   2720 C CZ3 . TRP B 1 140 ? 25.921  60.009 13.556  1.00 24.71 ? 140  TRP B CZ3 1 
ATOM   2721 C CH2 . TRP B 1 140 ? 26.395  59.151 12.542  1.00 19.84 ? 140  TRP B CH2 1 
ATOM   2722 N N   . CYS B 1 141 ? 21.918  66.174 12.649  1.00 30.47 ? 141  CYS B N   1 
ATOM   2723 C CA  . CYS B 1 141 ? 21.074  67.320 12.341  1.00 34.89 ? 141  CYS B CA  1 
ATOM   2724 C C   . CYS B 1 141 ? 21.831  68.644 12.375  1.00 37.98 ? 141  CYS B C   1 
ATOM   2725 O O   . CYS B 1 141 ? 21.247  69.709 12.162  1.00 38.67 ? 141  CYS B O   1 
ATOM   2726 C CB  . CYS B 1 141 ? 19.906  67.382 13.321  1.00 33.42 ? 141  CYS B CB  1 
ATOM   2727 S SG  . CYS B 1 141 ? 18.581  66.177 13.005  1.00 35.40 ? 141  CYS B SG  1 
ATOM   2728 N N   . ALA B 1 142 ? 23.132  68.578 12.629  1.00 36.50 ? 142  ALA B N   1 
ATOM   2729 C CA  . ALA B 1 142 ? 23.942  69.785 12.703  1.00 37.86 ? 142  ALA B CA  1 
ATOM   2730 C C   . ALA B 1 142 ? 24.106  70.511 11.368  1.00 39.25 ? 142  ALA B C   1 
ATOM   2731 O O   . ALA B 1 142 ? 23.911  69.938 10.294  1.00 38.05 ? 142  ALA B O   1 
ATOM   2732 C CB  . ALA B 1 142 ? 25.313  69.452 13.284  1.00 34.80 ? 142  ALA B CB  1 
ATOM   2733 N N   . LYS B 1 143 ? 24.465  71.788 11.463  1.00 39.63 ? 143  LYS B N   1 
ATOM   2734 C CA  . LYS B 1 143 ? 24.698  72.651 10.310  1.00 41.46 ? 143  LYS B CA  1 
ATOM   2735 C C   . LYS B 1 143 ? 25.815  72.045 9.462   1.00 39.57 ? 143  LYS B C   1 
ATOM   2736 O O   . LYS B 1 143 ? 25.853  72.210 8.240   1.00 40.86 ? 143  LYS B O   1 
ATOM   2737 C CB  . LYS B 1 143 ? 25.100  74.042 10.812  1.00 44.84 ? 143  LYS B CB  1 
ATOM   2738 C CG  . LYS B 1 143 ? 25.542  75.030 9.753   1.00 49.43 ? 143  LYS B CG  1 
ATOM   2739 C CD  . LYS B 1 143 ? 26.017  76.314 10.424  1.00 54.96 ? 143  LYS B CD  1 
ATOM   2740 C CE  . LYS B 1 143 ? 26.559  77.320 9.426   1.00 56.26 ? 143  LYS B CE  1 
ATOM   2741 N NZ  . LYS B 1 143 ? 27.078  78.529 10.122  1.00 57.81 ? 143  LYS B NZ  1 
ATOM   2742 N N   . ASP B 1 144 ? 26.727  71.350 10.134  1.00 36.74 ? 144  ASP B N   1 
ATOM   2743 C CA  . ASP B 1 144 ? 27.853  70.681 9.489   1.00 34.83 ? 144  ASP B CA  1 
ATOM   2744 C C   . ASP B 1 144 ? 27.991  69.341 10.209  1.00 31.38 ? 144  ASP B C   1 
ATOM   2745 O O   . ASP B 1 144 ? 28.591  69.268 11.279  1.00 26.22 ? 144  ASP B O   1 
ATOM   2746 C CB  . ASP B 1 144 ? 29.138  71.498 9.664   1.00 38.99 ? 144  ASP B CB  1 
ATOM   2747 C CG  . ASP B 1 144 ? 30.304  70.947 8.852   1.00 46.16 ? 144  ASP B CG  1 
ATOM   2748 O OD1 . ASP B 1 144 ? 30.478  69.710 8.794   1.00 42.28 ? 144  ASP B OD1 1 
ATOM   2749 O OD2 . ASP B 1 144 ? 31.063  71.760 8.280   1.00 52.67 ? 144  ASP B OD2 1 
ATOM   2750 N N   . LYS B 1 145 ? 27.413  68.295 9.625   1.00 29.79 ? 145  LYS B N   1 
ATOM   2751 C CA  . LYS B 1 145 ? 27.451  66.956 10.209  1.00 29.29 ? 145  LYS B CA  1 
ATOM   2752 C C   . LYS B 1 145 ? 28.874  66.514 10.539  1.00 24.86 ? 145  LYS B C   1 
ATOM   2753 O O   . LYS B 1 145 ? 29.126  65.964 11.611  1.00 28.14 ? 145  LYS B O   1 
ATOM   2754 C CB  . LYS B 1 145 ? 26.837  65.935 9.249   1.00 29.81 ? 145  LYS B CB  1 
ATOM   2755 C CG  . LYS B 1 145 ? 25.406  66.191 8.830   1.00 37.80 ? 145  LYS B CG  1 
ATOM   2756 C CD  . LYS B 1 145 ? 25.039  65.204 7.729   1.00 39.94 ? 145  LYS B CD  1 
ATOM   2757 C CE  . LYS B 1 145 ? 23.720  65.541 7.068   1.00 46.45 ? 145  LYS B CE  1 
ATOM   2758 N NZ  . LYS B 1 145 ? 23.446  64.574 5.966   1.00 47.70 ? 145  LYS B NZ  1 
ATOM   2759 N N   . ASN B 1 146 ? 29.800  66.737 9.611   1.00 27.57 ? 146  ASN B N   1 
ATOM   2760 C CA  . ASN B 1 146 ? 31.187  66.343 9.830   1.00 26.33 ? 146  ASN B CA  1 
ATOM   2761 C C   . ASN B 1 146 ? 31.807  67.024 11.044  1.00 28.80 ? 146  ASN B C   1 
ATOM   2762 O O   . ASN B 1 146 ? 32.361  66.359 11.922  1.00 23.64 ? 146  ASN B O   1 
ATOM   2763 C CB  . ASN B 1 146 ? 32.037  66.631 8.586   1.00 27.69 ? 146  ASN B CB  1 
ATOM   2764 C CG  . ASN B 1 146 ? 31.616  65.800 7.383   1.00 26.28 ? 146  ASN B CG  1 
ATOM   2765 O OD1 . ASN B 1 146 ? 30.500  65.938 6.874   1.00 25.59 ? 146  ASN B OD1 1 
ATOM   2766 N ND2 . ASN B 1 146 ? 32.509  64.929 6.926   1.00 23.69 ? 146  ASN B ND2 1 
ATOM   2767 N N   . LYS B 1 147 ? 31.721  68.351 11.102  1.00 27.63 ? 147  LYS B N   1 
ATOM   2768 C CA  . LYS B 1 147 ? 32.298  69.066 12.232  1.00 30.04 ? 147  LYS B CA  1 
ATOM   2769 C C   . LYS B 1 147 ? 31.661  68.627 13.546  1.00 27.70 ? 147  LYS B C   1 
ATOM   2770 O O   . LYS B 1 147 ? 32.353  68.456 14.546  1.00 31.07 ? 147  LYS B O   1 
ATOM   2771 C CB  . LYS B 1 147 ? 32.136  70.581 12.068  1.00 32.91 ? 147  LYS B CB  1 
ATOM   2772 C CG  . LYS B 1 147 ? 32.742  71.358 13.232  1.00 42.73 ? 147  LYS B CG  1 
ATOM   2773 C CD  . LYS B 1 147 ? 32.576  72.864 13.092  1.00 49.40 ? 147  LYS B CD  1 
ATOM   2774 C CE  . LYS B 1 147 ? 33.189  73.583 14.292  1.00 52.50 ? 147  LYS B CE  1 
ATOM   2775 N NZ  . LYS B 1 147 ? 33.046  75.067 14.218  1.00 55.68 ? 147  LYS B NZ  1 
ATOM   2776 N N   . ALA B 1 148 ? 30.346  68.434 13.540  1.00 24.98 ? 148  ALA B N   1 
ATOM   2777 C CA  . ALA B 1 148 ? 29.639  68.021 14.745  1.00 26.58 ? 148  ALA B CA  1 
ATOM   2778 C C   . ALA B 1 148 ? 30.111  66.648 15.215  1.00 27.18 ? 148  ALA B C   1 
ATOM   2779 O O   . ALA B 1 148 ? 30.321  66.436 16.409  1.00 25.15 ? 148  ALA B O   1 
ATOM   2780 C CB  . ALA B 1 148 ? 28.138  67.998 14.494  1.00 27.12 ? 148  ALA B CB  1 
ATOM   2781 N N   . PHE B 1 149 ? 30.269  65.714 14.280  1.00 25.33 ? 149  PHE B N   1 
ATOM   2782 C CA  . PHE B 1 149 ? 30.723  64.376 14.643  1.00 26.22 ? 149  PHE B CA  1 
ATOM   2783 C C   . PHE B 1 149 ? 32.150  64.507 15.185  1.00 26.26 ? 149  PHE B C   1 
ATOM   2784 O O   . PHE B 1 149 ? 32.489  63.912 16.206  1.00 25.67 ? 149  PHE B O   1 
ATOM   2785 C CB  . PHE B 1 149 ? 30.677  63.450 13.421  1.00 23.35 ? 149  PHE B CB  1 
ATOM   2786 C CG  . PHE B 1 149 ? 30.848  61.983 13.751  1.00 24.27 ? 149  PHE B CG  1 
ATOM   2787 C CD1 . PHE B 1 149 ? 32.116  61.431 13.912  1.00 28.08 ? 149  PHE B CD1 1 
ATOM   2788 C CD2 . PHE B 1 149 ? 29.738  61.158 13.910  1.00 20.96 ? 149  PHE B CD2 1 
ATOM   2789 C CE1 . PHE B 1 149 ? 32.277  60.074 14.227  1.00 28.50 ? 149  PHE B CE1 1 
ATOM   2790 C CE2 . PHE B 1 149 ? 29.885  59.798 14.225  1.00 25.37 ? 149  PHE B CE2 1 
ATOM   2791 C CZ  . PHE B 1 149 ? 31.157  59.257 14.384  1.00 27.79 ? 149  PHE B CZ  1 
ATOM   2792 N N   . ASP B 1 150 ? 32.969  65.311 14.508  1.00 27.39 ? 150  ASP B N   1 
ATOM   2793 C CA  . ASP B 1 150 ? 34.350  65.535 14.926  1.00 28.82 ? 150  ASP B CA  1 
ATOM   2794 C C   . ASP B 1 150 ? 34.396  66.094 16.346  1.00 30.92 ? 150  ASP B C   1 
ATOM   2795 O O   . ASP B 1 150 ? 35.177  65.629 17.176  1.00 32.75 ? 150  ASP B O   1 
ATOM   2796 C CB  . ASP B 1 150 ? 35.060  66.522 13.986  1.00 25.05 ? 150  ASP B CB  1 
ATOM   2797 C CG  . ASP B 1 150 ? 35.304  65.954 12.593  1.00 25.49 ? 150  ASP B CG  1 
ATOM   2798 O OD1 . ASP B 1 150 ? 35.171  64.726 12.388  1.00 24.53 ? 150  ASP B OD1 1 
ATOM   2799 O OD2 . ASP B 1 150 ? 35.649  66.751 11.695  1.00 23.46 ? 150  ASP B OD2 1 
ATOM   2800 N N   . ASP B 1 151 ? 33.562  67.096 16.617  1.00 32.92 ? 151  ASP B N   1 
ATOM   2801 C CA  . ASP B 1 151 ? 33.519  67.720 17.938  1.00 34.84 ? 151  ASP B CA  1 
ATOM   2802 C C   . ASP B 1 151 ? 33.177  66.717 19.039  1.00 36.19 ? 151  ASP B C   1 
ATOM   2803 O O   . ASP B 1 151 ? 33.900  66.607 20.030  1.00 36.27 ? 151  ASP B O   1 
ATOM   2804 C CB  . ASP B 1 151 ? 32.508  68.881 17.965  1.00 34.26 ? 151  ASP B CB  1 
ATOM   2805 C CG  . ASP B 1 151 ? 32.942  70.064 17.104  1.00 36.11 ? 151  ASP B CG  1 
ATOM   2806 O OD1 . ASP B 1 151 ? 34.159  70.246 16.897  1.00 36.30 ? 151  ASP B OD1 1 
ATOM   2807 O OD2 . ASP B 1 151 ? 32.064  70.826 16.643  1.00 38.29 ? 151  ASP B OD2 1 
ATOM   2808 N N   . VAL B 1 152 ? 32.079  65.987 18.867  1.00 36.07 ? 152  VAL B N   1 
ATOM   2809 C CA  . VAL B 1 152 ? 31.664  64.998 19.862  1.00 36.15 ? 152  VAL B CA  1 
ATOM   2810 C C   . VAL B 1 152 ? 32.751  63.947 20.085  1.00 39.97 ? 152  VAL B C   1 
ATOM   2811 O O   . VAL B 1 152 ? 33.127  63.663 21.226  1.00 42.09 ? 152  VAL B O   1 
ATOM   2812 C CB  . VAL B 1 152 ? 30.344  64.295 19.440  1.00 34.71 ? 152  VAL B CB  1 
ATOM   2813 C CG1 . VAL B 1 152 ? 30.090  63.068 20.311  1.00 34.56 ? 152  VAL B CG1 1 
ATOM   2814 C CG2 . VAL B 1 152 ? 29.179  65.271 19.570  1.00 28.61 ? 152  VAL B CG2 1 
ATOM   2815 N N   . MET B 1 153 ? 33.261  63.374 18.999  1.00 40.13 ? 153  MET B N   1 
ATOM   2816 C CA  . MET B 1 153 ? 34.308  62.362 19.103  1.00 41.35 ? 153  MET B CA  1 
ATOM   2817 C C   . MET B 1 153 ? 35.558  62.937 19.751  1.00 43.28 ? 153  MET B C   1 
ATOM   2818 O O   . MET B 1 153 ? 36.398  62.196 20.259  1.00 43.96 ? 153  MET B O   1 
ATOM   2819 C CB  . MET B 1 153 ? 34.651  61.799 17.721  1.00 40.14 ? 153  MET B CB  1 
ATOM   2820 C CG  . MET B 1 153 ? 33.556  60.928 17.136  1.00 42.34 ? 153  MET B CG  1 
ATOM   2821 S SD  . MET B 1 153 ? 33.210  59.471 18.158  1.00 43.57 ? 153  MET B SD  1 
ATOM   2822 C CE  . MET B 1 153 ? 33.300  58.157 16.940  1.00 39.83 ? 153  MET B CE  1 
ATOM   2823 N N   . ALA B 1 154 ? 35.669  64.262 19.736  1.00 46.03 ? 154  ALA B N   1 
ATOM   2824 C CA  . ALA B 1 154 ? 36.811  64.947 20.325  1.00 47.77 ? 154  ALA B CA  1 
ATOM   2825 C C   . ALA B 1 154 ? 36.577  65.207 21.809  1.00 50.79 ? 154  ALA B C   1 
ATOM   2826 O O   . ALA B 1 154 ? 37.440  65.756 22.493  1.00 49.25 ? 154  ALA B O   1 
ATOM   2827 C CB  . ALA B 1 154 ? 37.062  66.260 19.600  1.00 48.71 ? 154  ALA B CB  1 
ATOM   2828 N N   . GLY B 1 155 ? 35.405  64.814 22.301  1.00 51.14 ? 155  GLY B N   1 
ATOM   2829 C CA  . GLY B 1 155 ? 35.094  65.009 23.706  1.00 52.65 ? 155  GLY B CA  1 
ATOM   2830 C C   . GLY B 1 155 ? 34.351  66.296 24.010  1.00 53.35 ? 155  GLY B C   1 
ATOM   2831 O O   . GLY B 1 155 ? 34.129  66.628 25.173  1.00 52.69 ? 155  GLY B O   1 
ATOM   2832 N N   . LYS B 1 156 ? 33.970  67.029 22.971  1.00 53.81 ? 156  LYS B N   1 
ATOM   2833 C CA  . LYS B 1 156 ? 33.238  68.272 23.160  1.00 56.83 ? 156  LYS B CA  1 
ATOM   2834 C C   . LYS B 1 156 ? 31.745  67.972 23.158  1.00 58.00 ? 156  LYS B C   1 
ATOM   2835 O O   . LYS B 1 156 ? 31.333  66.838 22.906  1.00 57.25 ? 156  LYS B O   1 
ATOM   2836 C CB  . LYS B 1 156 ? 33.573  69.264 22.045  1.00 58.62 ? 156  LYS B CB  1 
ATOM   2837 C CG  . LYS B 1 156 ? 35.053  69.594 21.942  1.00 61.84 ? 156  LYS B CG  1 
ATOM   2838 C CD  . LYS B 1 156 ? 35.320  70.614 20.848  1.00 63.80 ? 156  LYS B CD  1 
ATOM   2839 C CE  . LYS B 1 156 ? 36.810  70.881 20.696  1.00 66.14 ? 156  LYS B CE  1 
ATOM   2840 N NZ  . LYS B 1 156 ? 37.426  71.381 21.959  1.00 68.24 ? 156  LYS B NZ  1 
ATOM   2841 N N   . SER B 1 157 ? 30.935  68.985 23.444  1.00 59.39 ? 157  SER B N   1 
ATOM   2842 C CA  . SER B 1 157 ? 29.487  68.814 23.472  1.00 60.67 ? 157  SER B CA  1 
ATOM   2843 C C   . SER B 1 157 ? 28.843  69.472 22.258  1.00 59.85 ? 157  SER B C   1 
ATOM   2844 O O   . SER B 1 157 ? 29.104  70.638 21.962  1.00 60.43 ? 157  SER B O   1 
ATOM   2845 C CB  . SER B 1 157 ? 28.905  69.419 24.755  1.00 61.74 ? 157  SER B CB  1 
ATOM   2846 O OG  . SER B 1 157 ? 29.381  68.740 25.907  1.00 62.34 ? 157  SER B OG  1 
ATOM   2847 N N   . VAL B 1 158 ? 28.004  68.717 21.557  1.00 58.62 ? 158  VAL B N   1 
ATOM   2848 C CA  . VAL B 1 158 ? 27.323  69.238 20.379  1.00 57.37 ? 158  VAL B CA  1 
ATOM   2849 C C   . VAL B 1 158 ? 26.011  69.899 20.784  1.00 57.81 ? 158  VAL B C   1 
ATOM   2850 O O   . VAL B 1 158 ? 25.369  69.487 21.752  1.00 56.80 ? 158  VAL B O   1 
ATOM   2851 C CB  . VAL B 1 158 ? 27.015  68.117 19.359  1.00 56.48 ? 158  VAL B CB  1 
ATOM   2852 C CG1 . VAL B 1 158 ? 25.990  67.158 19.931  1.00 55.90 ? 158  VAL B CG1 1 
ATOM   2853 C CG2 . VAL B 1 158 ? 26.507  68.720 18.062  1.00 54.97 ? 158  VAL B CG2 1 
ATOM   2854 N N   . ALA B 1 159 ? 25.618  70.924 20.039  1.00 57.36 ? 159  ALA B N   1 
ATOM   2855 C CA  . ALA B 1 159 ? 24.380  71.635 20.322  1.00 58.09 ? 159  ALA B CA  1 
ATOM   2856 C C   . ALA B 1 159 ? 23.183  70.778 19.931  1.00 58.80 ? 159  ALA B C   1 
ATOM   2857 O O   . ALA B 1 159 ? 23.169  70.169 18.861  1.00 59.22 ? 159  ALA B O   1 
ATOM   2858 C CB  . ALA B 1 159 ? 24.350  72.952 19.556  1.00 58.52 ? 159  ALA B CB  1 
ATOM   2859 N N   . PRO B 1 160 ? 22.165  70.705 20.804  1.00 58.80 ? 160  PRO B N   1 
ATOM   2860 C CA  . PRO B 1 160 ? 20.978  69.905 20.491  1.00 58.82 ? 160  PRO B CA  1 
ATOM   2861 C C   . PRO B 1 160 ? 20.401  70.383 19.162  1.00 57.65 ? 160  PRO B C   1 
ATOM   2862 O O   . PRO B 1 160 ? 20.324  71.586 18.913  1.00 59.44 ? 160  PRO B O   1 
ATOM   2863 C CB  . PRO B 1 160 ? 20.049  70.196 21.666  1.00 58.87 ? 160  PRO B CB  1 
ATOM   2864 C CG  . PRO B 1 160 ? 21.009  70.420 22.796  1.00 59.34 ? 160  PRO B CG  1 
ATOM   2865 C CD  . PRO B 1 160 ? 22.064  71.288 22.154  1.00 59.45 ? 160  PRO B CD  1 
ATOM   2866 N N   . ALA B 1 161 ? 20.006  69.450 18.306  1.00 56.38 ? 161  ALA B N   1 
ATOM   2867 C CA  . ALA B 1 161 ? 19.457  69.823 17.011  1.00 53.61 ? 161  ALA B CA  1 
ATOM   2868 C C   . ALA B 1 161 ? 18.333  68.896 16.568  1.00 52.96 ? 161  ALA B C   1 
ATOM   2869 O O   . ALA B 1 161 ? 18.297  67.722 16.937  1.00 51.75 ? 161  ALA B O   1 
ATOM   2870 C CB  . ALA B 1 161 ? 20.565  69.841 15.967  1.00 52.24 ? 161  ALA B CB  1 
ATOM   2871 N N   . SER B 1 162 ? 17.416  69.441 15.775  1.00 52.01 ? 162  SER B N   1 
ATOM   2872 C CA  . SER B 1 162 ? 16.284  68.680 15.265  1.00 50.49 ? 162  SER B CA  1 
ATOM   2873 C C   . SER B 1 162 ? 16.161  68.853 13.753  1.00 47.76 ? 162  SER B C   1 
ATOM   2874 O O   . SER B 1 162 ? 16.351  69.951 13.225  1.00 45.79 ? 162  SER B O   1 
ATOM   2875 C CB  . SER B 1 162 ? 14.990  69.138 15.944  1.00 54.53 ? 162  SER B CB  1 
ATOM   2876 O OG  . SER B 1 162 ? 13.874  68.416 15.451  1.00 58.67 ? 162  SER B OG  1 
ATOM   2877 N N   . CYS B 1 163 ? 15.856  67.756 13.066  1.00 42.47 ? 163  CYS B N   1 
ATOM   2878 C CA  . CYS B 1 163 ? 15.690  67.758 11.619  1.00 38.85 ? 163  CYS B CA  1 
ATOM   2879 C C   . CYS B 1 163 ? 14.926  66.504 11.216  1.00 37.11 ? 163  CYS B C   1 
ATOM   2880 O O   . CYS B 1 163 ? 14.480  65.758 12.085  1.00 35.57 ? 163  CYS B O   1 
ATOM   2881 C CB  . CYS B 1 163 ? 17.052  67.836 10.919  1.00 39.33 ? 163  CYS B CB  1 
ATOM   2882 S SG  . CYS B 1 163 ? 18.184  66.408 11.031  1.00 34.93 ? 163  CYS B SG  1 
ATOM   2883 N N   . ASP B 1 164 ? 14.770  66.257 9.918   1.00 35.62 ? 164  ASP B N   1 
ATOM   2884 C CA  . ASP B 1 164 ? 14.001  65.090 9.493   1.00 35.81 ? 164  ASP B CA  1 
ATOM   2885 C C   . ASP B 1 164 ? 14.756  63.768 9.487   1.00 35.93 ? 164  ASP B C   1 
ATOM   2886 O O   . ASP B 1 164 ? 14.197  62.731 9.113   1.00 31.50 ? 164  ASP B O   1 
ATOM   2887 C CB  . ASP B 1 164 ? 13.362  65.324 8.118   1.00 37.30 ? 164  ASP B CB  1 
ATOM   2888 C CG  . ASP B 1 164 ? 14.380  65.437 7.008   1.00 39.53 ? 164  ASP B CG  1 
ATOM   2889 O OD1 . ASP B 1 164 ? 15.550  65.068 7.231   1.00 42.40 ? 164  ASP B OD1 1 
ATOM   2890 O OD2 . ASP B 1 164 ? 14.003  65.885 5.904   1.00 43.00 ? 164  ASP B OD2 1 
ATOM   2891 N N   . VAL B 1 165 ? 16.020  63.791 9.894   1.00 34.64 ? 165  VAL B N   1 
ATOM   2892 C CA  . VAL B 1 165 ? 16.786  62.550 9.944   1.00 31.43 ? 165  VAL B CA  1 
ATOM   2893 C C   . VAL B 1 165 ? 16.157  61.679 11.025  1.00 30.31 ? 165  VAL B C   1 
ATOM   2894 O O   . VAL B 1 165 ? 15.802  62.166 12.099  1.00 30.51 ? 165  VAL B O   1 
ATOM   2895 C CB  . VAL B 1 165 ? 18.271  62.806 10.304  1.00 30.93 ? 165  VAL B CB  1 
ATOM   2896 C CG1 . VAL B 1 165 ? 18.958  61.491 10.678  1.00 31.58 ? 165  VAL B CG1 1 
ATOM   2897 C CG2 . VAL B 1 165 ? 18.986  63.439 9.128   1.00 29.22 ? 165  VAL B CG2 1 
ATOM   2898 N N   . ASP B 1 166 ? 15.990  60.396 10.737  1.00 29.07 ? 166  ASP B N   1 
ATOM   2899 C CA  . ASP B 1 166 ? 15.422  59.490 11.724  1.00 28.54 ? 166  ASP B CA  1 
ATOM   2900 C C   . ASP B 1 166 ? 16.436  58.379 11.975  1.00 28.23 ? 166  ASP B C   1 
ATOM   2901 O O   . ASP B 1 166 ? 16.601  57.490 11.141  1.00 24.91 ? 166  ASP B O   1 
ATOM   2902 C CB  . ASP B 1 166 ? 14.109  58.890 11.220  1.00 31.61 ? 166  ASP B CB  1 
ATOM   2903 C CG  . ASP B 1 166 ? 13.390  58.097 12.291  1.00 35.65 ? 166  ASP B CG  1 
ATOM   2904 O OD1 . ASP B 1 166 ? 13.973  57.908 13.382  1.00 37.15 ? 166  ASP B OD1 1 
ATOM   2905 O OD2 . ASP B 1 166 ? 12.248  57.658 12.047  1.00 40.09 ? 166  ASP B OD2 1 
ATOM   2906 N N   . ILE B 1 167 ? 17.115  58.440 13.120  1.00 26.15 ? 167  ILE B N   1 
ATOM   2907 C CA  . ILE B 1 167 ? 18.126  57.444 13.474  1.00 25.87 ? 167  ILE B CA  1 
ATOM   2908 C C   . ILE B 1 167 ? 17.544  56.033 13.485  1.00 25.80 ? 167  ILE B C   1 
ATOM   2909 O O   . ILE B 1 167 ? 18.259  55.054 13.271  1.00 23.59 ? 167  ILE B O   1 
ATOM   2910 C CB  . ILE B 1 167 ? 18.748  57.752 14.862  1.00 28.44 ? 167  ILE B CB  1 
ATOM   2911 C CG1 . ILE B 1 167 ? 19.399  59.140 14.840  1.00 25.06 ? 167  ILE B CG1 1 
ATOM   2912 C CG2 . ILE B 1 167 ? 19.789  56.682 15.237  1.00 24.49 ? 167  ILE B CG2 1 
ATOM   2913 C CD1 . ILE B 1 167 ? 20.431  59.322 13.751  1.00 25.24 ? 167  ILE B CD1 1 
ATOM   2914 N N   . ALA B 1 168 ? 16.242  55.933 13.736  1.00 23.28 ? 168  ALA B N   1 
ATOM   2915 C CA  . ALA B 1 168 ? 15.575  54.636 13.765  1.00 23.71 ? 168  ALA B CA  1 
ATOM   2916 C C   . ALA B 1 168 ? 15.721  53.933 12.421  1.00 21.98 ? 168  ALA B C   1 
ATOM   2917 O O   . ALA B 1 168 ? 15.761  52.702 12.359  1.00 22.70 ? 168  ALA B O   1 
ATOM   2918 C CB  . ALA B 1 168 ? 14.085  54.808 14.128  1.00 20.89 ? 168  ALA B CB  1 
ATOM   2919 N N   . ASP B 1 169 ? 15.805  54.705 11.338  1.00 22.43 ? 169  ASP B N   1 
ATOM   2920 C CA  . ASP B 1 169 ? 15.971  54.107 10.019  1.00 23.21 ? 169  ASP B CA  1 
ATOM   2921 C C   . ASP B 1 169 ? 17.362  53.505 9.858   1.00 23.76 ? 169  ASP B C   1 
ATOM   2922 O O   . ASP B 1 169 ? 17.516  52.425 9.277   1.00 21.25 ? 169  ASP B O   1 
ATOM   2923 C CB  . ASP B 1 169 ? 15.732  55.139 8.914   1.00 20.25 ? 169  ASP B CB  1 
ATOM   2924 C CG  . ASP B 1 169 ? 14.272  55.493 8.769   1.00 25.30 ? 169  ASP B CG  1 
ATOM   2925 O OD1 . ASP B 1 169 ? 13.445  54.557 8.788   1.00 24.60 ? 169  ASP B OD1 1 
ATOM   2926 O OD2 . ASP B 1 169 ? 13.954  56.692 8.635   1.00 26.04 ? 169  ASP B OD2 1 
ATOM   2927 N N   . HIS B 1 170 ? 18.372  54.212 10.358  1.00 22.10 ? 170  HIS B N   1 
ATOM   2928 C CA  . HIS B 1 170 ? 19.746  53.730 10.270  1.00 20.20 ? 170  HIS B CA  1 
ATOM   2929 C C   . HIS B 1 170 ? 19.846  52.449 11.093  1.00 22.37 ? 170  HIS B C   1 
ATOM   2930 O O   . HIS B 1 170 ? 20.365  51.436 10.630  1.00 22.41 ? 170  HIS B O   1 
ATOM   2931 C CB  . HIS B 1 170 ? 20.727  54.763 10.836  1.00 23.04 ? 170  HIS B CB  1 
ATOM   2932 C CG  . HIS B 1 170 ? 20.667  56.103 10.168  1.00 19.22 ? 170  HIS B CG  1 
ATOM   2933 N ND1 . HIS B 1 170 ? 21.655  57.052 10.327  1.00 19.13 ? 170  HIS B ND1 1 
ATOM   2934 C CD2 . HIS B 1 170 ? 19.733  56.665 9.363   1.00 23.13 ? 170  HIS B CD2 1 
ATOM   2935 C CE1 . HIS B 1 170 ? 21.333  58.140 9.650   1.00 23.48 ? 170  HIS B CE1 1 
ATOM   2936 N NE2 . HIS B 1 170 ? 20.172  57.933 9.056   1.00 19.70 ? 170  HIS B NE2 1 
ATOM   2937 N N   . TYR B 1 171 ? 19.339  52.511 12.319  1.00 22.41 ? 171  TYR B N   1 
ATOM   2938 C CA  . TYR B 1 171 ? 19.366  51.370 13.233  1.00 25.46 ? 171  TYR B CA  1 
ATOM   2939 C C   . TYR B 1 171 ? 18.601  50.181 12.647  1.00 23.14 ? 171  TYR B C   1 
ATOM   2940 O O   . TYR B 1 171 ? 19.129  49.070 12.564  1.00 24.60 ? 171  TYR B O   1 
ATOM   2941 C CB  . TYR B 1 171 ? 18.753  51.780 14.576  1.00 22.92 ? 171  TYR B CB  1 
ATOM   2942 C CG  . TYR B 1 171 ? 18.738  50.685 15.620  1.00 25.80 ? 171  TYR B CG  1 
ATOM   2943 C CD1 . TYR B 1 171 ? 19.891  50.354 16.336  1.00 25.64 ? 171  TYR B CD1 1 
ATOM   2944 C CD2 . TYR B 1 171 ? 17.570  49.974 15.885  1.00 28.98 ? 171  TYR B CD2 1 
ATOM   2945 C CE1 . TYR B 1 171 ? 19.877  49.341 17.295  1.00 26.77 ? 171  TYR B CE1 1 
ATOM   2946 C CE2 . TYR B 1 171 ? 17.545  48.959 16.838  1.00 30.31 ? 171  TYR B CE2 1 
ATOM   2947 C CZ  . TYR B 1 171 ? 18.699  48.649 17.540  1.00 31.66 ? 171  TYR B CZ  1 
ATOM   2948 O OH  . TYR B 1 171 ? 18.669  47.655 18.491  1.00 30.13 ? 171  TYR B OH  1 
ATOM   2949 N N   . ALA B 1 172 ? 17.361  50.422 12.233  1.00 23.41 ? 172  ALA B N   1 
ATOM   2950 C CA  . ALA B 1 172 ? 16.528  49.372 11.658  1.00 23.79 ? 172  ALA B CA  1 
ATOM   2951 C C   . ALA B 1 172 ? 17.181  48.724 10.437  1.00 24.18 ? 172  ALA B C   1 
ATOM   2952 O O   . ALA B 1 172 ? 17.204  47.500 10.322  1.00 23.43 ? 172  ALA B O   1 
ATOM   2953 C CB  . ALA B 1 172 ? 15.161  49.936 11.286  1.00 25.74 ? 172  ALA B CB  1 
ATOM   2954 N N   . LEU B 1 173 ? 17.714  49.540 9.527   1.00 22.32 ? 173  LEU B N   1 
ATOM   2955 C CA  . LEU B 1 173 ? 18.367  49.003 8.336   1.00 23.00 ? 173  LEU B CA  1 
ATOM   2956 C C   . LEU B 1 173 ? 19.583  48.164 8.722   1.00 21.93 ? 173  LEU B C   1 
ATOM   2957 O O   . LEU B 1 173 ? 19.819  47.096 8.151   1.00 23.13 ? 173  LEU B O   1 
ATOM   2958 C CB  . LEU B 1 173 ? 18.810  50.124 7.385   1.00 22.80 ? 173  LEU B CB  1 
ATOM   2959 C CG  . LEU B 1 173 ? 19.428  49.600 6.078   1.00 26.55 ? 173  LEU B CG  1 
ATOM   2960 C CD1 . LEU B 1 173 ? 18.415  48.716 5.361   1.00 26.75 ? 173  LEU B CD1 1 
ATOM   2961 C CD2 . LEU B 1 173 ? 19.848  50.754 5.174   1.00 23.10 ? 173  LEU B CD2 1 
ATOM   2962 N N   . GLY B 1 174 ? 20.361  48.651 9.683   1.00 22.84 ? 174  GLY B N   1 
ATOM   2963 C CA  . GLY B 1 174 ? 21.522  47.897 10.127  1.00 24.41 ? 174  GLY B CA  1 
ATOM   2964 C C   . GLY B 1 174 ? 21.090  46.528 10.639  1.00 25.57 ? 174  GLY B C   1 
ATOM   2965 O O   . GLY B 1 174 ? 21.696  45.504 10.313  1.00 24.93 ? 174  GLY B O   1 
ATOM   2966 N N   . VAL B 1 175 ? 20.036  46.512 11.448  1.00 24.67 ? 175  VAL B N   1 
ATOM   2967 C CA  . VAL B 1 175 ? 19.520  45.264 11.995  1.00 26.97 ? 175  VAL B CA  1 
ATOM   2968 C C   . VAL B 1 175 ? 19.093  44.317 10.872  1.00 25.66 ? 175  VAL B C   1 
ATOM   2969 O O   . VAL B 1 175 ? 19.449  43.139 10.879  1.00 28.97 ? 175  VAL B O   1 
ATOM   2970 C CB  . VAL B 1 175 ? 18.329  45.534 12.944  1.00 29.51 ? 175  VAL B CB  1 
ATOM   2971 C CG1 . VAL B 1 175 ? 17.651  44.222 13.332  1.00 28.95 ? 175  VAL B CG1 1 
ATOM   2972 C CG2 . VAL B 1 175 ? 18.824  46.263 14.195  1.00 28.13 ? 175  VAL B CG2 1 
ATOM   2973 N N   . GLN B 1 176 ? 18.345  44.837 9.901   1.00 24.56 ? 176  GLN B N   1 
ATOM   2974 C CA  . GLN B 1 176 ? 17.887  44.032 8.768   1.00 27.76 ? 176  GLN B CA  1 
ATOM   2975 C C   . GLN B 1 176 ? 19.069  43.467 7.978   1.00 28.81 ? 176  GLN B C   1 
ATOM   2976 O O   . GLN B 1 176 ? 18.983  42.371 7.428   1.00 28.33 ? 176  GLN B O   1 
ATOM   2977 C CB  . GLN B 1 176 ? 17.023  44.877 7.826   1.00 28.57 ? 176  GLN B CB  1 
ATOM   2978 C CG  . GLN B 1 176 ? 15.764  45.454 8.456   1.00 35.05 ? 176  GLN B CG  1 
ATOM   2979 C CD  . GLN B 1 176 ? 14.514  44.690 8.072   1.00 32.94 ? 176  GLN B CD  1 
ATOM   2980 O OE1 . GLN B 1 176 ? 14.559  43.782 7.242   1.00 31.21 ? 176  GLN B OE1 1 
ATOM   2981 N NE2 . GLN B 1 176 ? 13.387  45.064 8.665   1.00 33.05 ? 176  GLN B NE2 1 
ATOM   2982 N N   . LEU B 1 177 ? 20.165  44.224 7.920   1.00 27.64 ? 177  LEU B N   1 
ATOM   2983 C CA  . LEU B 1 177 ? 21.357  43.800 7.190   1.00 28.79 ? 177  LEU B CA  1 
ATOM   2984 C C   . LEU B 1 177 ? 22.200  42.779 7.956   1.00 28.25 ? 177  LEU B C   1 
ATOM   2985 O O   . LEU B 1 177 ? 23.048  42.108 7.371   1.00 31.74 ? 177  LEU B O   1 
ATOM   2986 C CB  . LEU B 1 177 ? 22.225  45.017 6.831   1.00 27.49 ? 177  LEU B CB  1 
ATOM   2987 C CG  . LEU B 1 177 ? 21.693  45.954 5.738   1.00 29.05 ? 177  LEU B CG  1 
ATOM   2988 C CD1 . LEU B 1 177 ? 22.575  47.197 5.640   1.00 27.39 ? 177  LEU B CD1 1 
ATOM   2989 C CD2 . LEU B 1 177 ? 21.663  45.220 4.396   1.00 28.06 ? 177  LEU B CD2 1 
ATOM   2990 N N   . GLY B 1 178 ? 21.972  42.666 9.259   1.00 28.46 ? 178  GLY B N   1 
ATOM   2991 C CA  . GLY B 1 178 ? 22.725  41.709 10.049  1.00 30.41 ? 178  GLY B CA  1 
ATOM   2992 C C   . GLY B 1 178 ? 23.729  42.332 11.002  1.00 30.33 ? 178  GLY B C   1 
ATOM   2993 O O   . GLY B 1 178 ? 24.565  41.632 11.567  1.00 28.67 ? 178  GLY B O   1 
ATOM   2994 N N   . VAL B 1 179 ? 23.658  43.648 11.188  1.00 28.78 ? 179  VAL B N   1 
ATOM   2995 C CA  . VAL B 1 179 ? 24.580  44.322 12.097  1.00 28.71 ? 179  VAL B CA  1 
ATOM   2996 C C   . VAL B 1 179 ? 24.359  43.810 13.521  1.00 32.47 ? 179  VAL B C   1 
ATOM   2997 O O   . VAL B 1 179 ? 23.239  43.845 14.030  1.00 34.27 ? 179  VAL B O   1 
ATOM   2998 C CB  . VAL B 1 179 ? 24.370  45.861 12.077  1.00 25.65 ? 179  VAL B CB  1 
ATOM   2999 C CG1 . VAL B 1 179 ? 25.273  46.515 13.107  1.00 25.07 ? 179  VAL B CG1 1 
ATOM   3000 C CG2 . VAL B 1 179 ? 24.664  46.411 10.684  1.00 21.78 ? 179  VAL B CG2 1 
ATOM   3001 N N   . SER B 1 180 ? 25.427  43.336 14.159  1.00 36.62 ? 180  SER B N   1 
ATOM   3002 C CA  . SER B 1 180 ? 25.346  42.811 15.524  1.00 41.03 ? 180  SER B CA  1 
ATOM   3003 C C   . SER B 1 180 ? 26.416  43.422 16.424  1.00 41.69 ? 180  SER B C   1 
ATOM   3004 O O   . SER B 1 180 ? 26.744  42.875 17.478  1.00 44.75 ? 180  SER B O   1 
ATOM   3005 C CB  . SER B 1 180 ? 25.526  41.294 15.521  1.00 41.19 ? 180  SER B CB  1 
ATOM   3006 O OG  . SER B 1 180 ? 26.861  40.953 15.191  1.00 47.82 ? 180  SER B OG  1 
ATOM   3007 N N   . GLY B 1 181 ? 26.961  44.553 16.002  1.00 39.19 ? 181  GLY B N   1 
ATOM   3008 C CA  . GLY B 1 181 ? 27.990  45.213 16.780  1.00 34.20 ? 181  GLY B CA  1 
ATOM   3009 C C   . GLY B 1 181 ? 28.567  46.339 15.950  1.00 30.99 ? 181  GLY B C   1 
ATOM   3010 O O   . GLY B 1 181 ? 28.373  46.369 14.737  1.00 26.57 ? 181  GLY B O   1 
ATOM   3011 N N   . THR B 1 182 ? 29.273  47.258 16.599  1.00 25.46 ? 182  THR B N   1 
ATOM   3012 C CA  . THR B 1 182 ? 29.869  48.393 15.907  1.00 25.68 ? 182  THR B CA  1 
ATOM   3013 C C   . THR B 1 182 ? 31.371  48.464 16.181  1.00 24.77 ? 182  THR B C   1 
ATOM   3014 O O   . THR B 1 182 ? 31.834  48.054 17.245  1.00 25.95 ? 182  THR B O   1 
ATOM   3015 C CB  . THR B 1 182 ? 29.229  49.716 16.368  1.00 23.39 ? 182  THR B CB  1 
ATOM   3016 O OG1 . THR B 1 182 ? 29.355  49.831 17.788  1.00 24.07 ? 182  THR B OG1 1 
ATOM   3017 C CG2 . THR B 1 182 ? 27.754  49.768 15.990  1.00 22.59 ? 182  THR B CG2 1 
ATOM   3018 N N   . PRO B 1 183 ? 32.156  48.951 15.207  1.00 23.76 ? 183  PRO B N   1 
ATOM   3019 C CA  . PRO B 1 183 ? 31.691  49.413 13.897  1.00 25.13 ? 183  PRO B CA  1 
ATOM   3020 C C   . PRO B 1 183 ? 31.405  48.231 12.972  1.00 25.31 ? 183  PRO B C   1 
ATOM   3021 O O   . PRO B 1 183 ? 32.004  47.164 13.109  1.00 27.85 ? 183  PRO B O   1 
ATOM   3022 C CB  . PRO B 1 183 ? 32.858  50.264 13.398  1.00 26.14 ? 183  PRO B CB  1 
ATOM   3023 C CG  . PRO B 1 183 ? 34.044  49.551 13.979  1.00 29.25 ? 183  PRO B CG  1 
ATOM   3024 C CD  . PRO B 1 183 ? 33.586  49.265 15.395  1.00 25.67 ? 183  PRO B CD  1 
ATOM   3025 N N   . ALA B 1 184 ? 30.464  48.418 12.054  1.00 25.56 ? 184  ALA B N   1 
ATOM   3026 C CA  . ALA B 1 184 ? 30.104  47.381 11.093  1.00 23.83 ? 184  ALA B CA  1 
ATOM   3027 C C   . ALA B 1 184 ? 30.240  48.015 9.717   1.00 26.10 ? 184  ALA B C   1 
ATOM   3028 O O   . ALA B 1 184 ? 29.707  49.104 9.460   1.00 21.71 ? 184  ALA B O   1 
ATOM   3029 C CB  . ALA B 1 184 ? 28.670  46.903 11.328  1.00 22.11 ? 184  ALA B CB  1 
ATOM   3030 N N   . VAL B 1 185 ? 30.955  47.326 8.836   1.00 21.60 ? 185  VAL B N   1 
ATOM   3031 C CA  . VAL B 1 185 ? 31.217  47.828 7.497   1.00 24.59 ? 185  VAL B CA  1 
ATOM   3032 C C   . VAL B 1 185 ? 30.397  47.191 6.386   1.00 28.48 ? 185  VAL B C   1 
ATOM   3033 O O   . VAL B 1 185 ? 30.245  45.970 6.324   1.00 27.70 ? 185  VAL B O   1 
ATOM   3034 C CB  . VAL B 1 185 ? 32.712  47.650 7.146   1.00 24.84 ? 185  VAL B CB  1 
ATOM   3035 C CG1 . VAL B 1 185 ? 33.002  48.235 5.771   1.00 28.39 ? 185  VAL B CG1 1 
ATOM   3036 C CG2 . VAL B 1 185 ? 33.579  48.307 8.217   1.00 24.83 ? 185  VAL B CG2 1 
ATOM   3037 N N   . VAL B 1 186 ? 29.858  48.033 5.514   1.00 25.83 ? 186  VAL B N   1 
ATOM   3038 C CA  . VAL B 1 186 ? 29.100  47.552 4.365   1.00 28.01 ? 186  VAL B CA  1 
ATOM   3039 C C   . VAL B 1 186 ? 29.925  47.933 3.139   1.00 31.83 ? 186  VAL B C   1 
ATOM   3040 O O   . VAL B 1 186 ? 30.198  49.114 2.903   1.00 28.47 ? 186  VAL B O   1 
ATOM   3041 C CB  . VAL B 1 186 ? 27.708  48.206 4.267   1.00 30.96 ? 186  VAL B CB  1 
ATOM   3042 C CG1 . VAL B 1 186 ? 27.009  47.746 2.994   1.00 29.64 ? 186  VAL B CG1 1 
ATOM   3043 C CG2 . VAL B 1 186 ? 26.874  47.836 5.481   1.00 28.71 ? 186  VAL B CG2 1 
ATOM   3044 N N   . LEU B 1 187 ? 30.338  46.926 2.374   1.00 31.86 ? 187  LEU B N   1 
ATOM   3045 C CA  . LEU B 1 187 ? 31.153  47.146 1.185   1.00 33.97 ? 187  LEU B CA  1 
ATOM   3046 C C   . LEU B 1 187 ? 30.346  47.698 0.010   1.00 35.25 ? 187  LEU B C   1 
ATOM   3047 O O   . LEU B 1 187 ? 29.117  47.634 0.006   1.00 34.22 ? 187  LEU B O   1 
ATOM   3048 C CB  . LEU B 1 187 ? 31.841  45.837 0.789   1.00 31.85 ? 187  LEU B CB  1 
ATOM   3049 C CG  . LEU B 1 187 ? 32.645  45.178 1.911   1.00 33.55 ? 187  LEU B CG  1 
ATOM   3050 C CD1 . LEU B 1 187 ? 33.244  43.877 1.409   1.00 36.25 ? 187  LEU B CD1 1 
ATOM   3051 C CD2 . LEU B 1 187 ? 33.748  46.124 2.394   1.00 37.07 ? 187  LEU B CD2 1 
ATOM   3052 N N   . SER B 1 188 ? 31.048  48.241 -0.982  1.00 37.35 ? 188  SER B N   1 
ATOM   3053 C CA  . SER B 1 188 ? 30.410  48.827 -2.159  1.00 42.39 ? 188  SER B CA  1 
ATOM   3054 C C   . SER B 1 188 ? 29.537  47.852 -2.942  1.00 44.85 ? 188  SER B C   1 
ATOM   3055 O O   . SER B 1 188 ? 28.661  48.268 -3.701  1.00 46.01 ? 188  SER B O   1 
ATOM   3056 C CB  . SER B 1 188 ? 31.470  49.427 -3.092  1.00 43.82 ? 188  SER B CB  1 
ATOM   3057 O OG  . SER B 1 188 ? 32.398  48.443 -3.515  1.00 46.52 ? 188  SER B OG  1 
ATOM   3058 N N   . ASN B 1 189 ? 29.774  46.556 -2.763  1.00 46.11 ? 189  ASN B N   1 
ATOM   3059 C CA  . ASN B 1 189 ? 28.988  45.551 -3.464  1.00 46.80 ? 189  ASN B CA  1 
ATOM   3060 C C   . ASN B 1 189 ? 27.805  45.124 -2.601  1.00 47.07 ? 189  ASN B C   1 
ATOM   3061 O O   . ASN B 1 189 ? 26.961  44.343 -3.037  1.00 49.64 ? 189  ASN B O   1 
ATOM   3062 C CB  . ASN B 1 189 ? 29.861  44.340 -3.817  1.00 47.96 ? 189  ASN B CB  1 
ATOM   3063 C CG  . ASN B 1 189 ? 30.148  43.454 -2.622  1.00 49.56 ? 189  ASN B CG  1 
ATOM   3064 O OD1 . ASN B 1 189 ? 30.329  43.936 -1.504  1.00 48.78 ? 189  ASN B OD1 1 
ATOM   3065 N ND2 . ASN B 1 189 ? 30.209  42.148 -2.858  1.00 48.38 ? 189  ASN B ND2 1 
ATOM   3066 N N   . GLY B 1 190 ? 27.751  45.636 -1.374  1.00 45.37 ? 190  GLY B N   1 
ATOM   3067 C CA  . GLY B 1 190 ? 26.651  45.308 -0.481  1.00 41.52 ? 190  GLY B CA  1 
ATOM   3068 C C   . GLY B 1 190 ? 26.964  44.369 0.672   1.00 39.81 ? 190  GLY B C   1 
ATOM   3069 O O   . GLY B 1 190 ? 26.152  44.205 1.581   1.00 39.77 ? 190  GLY B O   1 
ATOM   3070 N N   . THR B 1 191 ? 28.141  43.758 0.648   1.00 38.36 ? 191  THR B N   1 
ATOM   3071 C CA  . THR B 1 191 ? 28.541  42.821 1.696   1.00 34.86 ? 191  THR B CA  1 
ATOM   3072 C C   . THR B 1 191 ? 28.762  43.456 3.069   1.00 35.16 ? 191  THR B C   1 
ATOM   3073 O O   . THR B 1 191 ? 29.399  44.505 3.187   1.00 30.29 ? 191  THR B O   1 
ATOM   3074 C CB  . THR B 1 191 ? 29.834  42.092 1.301   1.00 35.14 ? 191  THR B CB  1 
ATOM   3075 O OG1 . THR B 1 191 ? 29.629  41.397 0.066   1.00 39.86 ? 191  THR B OG1 1 
ATOM   3076 C CG2 . THR B 1 191 ? 30.240  41.102 2.379   1.00 37.59 ? 191  THR B CG2 1 
ATOM   3077 N N   . LEU B 1 192 ? 28.238  42.810 4.107   1.00 32.15 ? 192  LEU B N   1 
ATOM   3078 C CA  . LEU B 1 192 ? 28.402  43.298 5.472   1.00 33.83 ? 192  LEU B CA  1 
ATOM   3079 C C   . LEU B 1 192 ? 29.596  42.612 6.125   1.00 32.60 ? 192  LEU B C   1 
ATOM   3080 O O   . LEU B 1 192 ? 29.698  41.384 6.123   1.00 31.71 ? 192  LEU B O   1 
ATOM   3081 C CB  . LEU B 1 192 ? 27.151  43.024 6.313   1.00 32.31 ? 192  LEU B CB  1 
ATOM   3082 C CG  . LEU B 1 192 ? 27.289  43.413 7.791   1.00 33.64 ? 192  LEU B CG  1 
ATOM   3083 C CD1 . LEU B 1 192 ? 27.459  44.924 7.911   1.00 37.22 ? 192  LEU B CD1 1 
ATOM   3084 C CD2 . LEU B 1 192 ? 26.064  42.957 8.570   1.00 37.17 ? 192  LEU B CD2 1 
ATOM   3085 N N   . VAL B 1 193 ? 30.500  43.410 6.676   1.00 27.84 ? 193  VAL B N   1 
ATOM   3086 C CA  . VAL B 1 193 ? 31.681  42.879 7.347   1.00 31.13 ? 193  VAL B CA  1 
ATOM   3087 C C   . VAL B 1 193 ? 31.784  43.554 8.702   1.00 31.42 ? 193  VAL B C   1 
ATOM   3088 O O   . VAL B 1 193 ? 32.305  44.665 8.819   1.00 30.96 ? 193  VAL B O   1 
ATOM   3089 C CB  . VAL B 1 193 ? 32.970  43.161 6.549   1.00 34.35 ? 193  VAL B CB  1 
ATOM   3090 C CG1 . VAL B 1 193 ? 34.165  42.508 7.243   1.00 32.87 ? 193  VAL B CG1 1 
ATOM   3091 C CG2 . VAL B 1 193 ? 32.823  42.643 5.126   1.00 32.82 ? 193  VAL B CG2 1 
ATOM   3092 N N   . PRO B 1 194 ? 31.265  42.897 9.747   1.00 33.24 ? 194  PRO B N   1 
ATOM   3093 C CA  . PRO B 1 194 ? 31.307  43.457 11.097  1.00 31.80 ? 194  PRO B CA  1 
ATOM   3094 C C   . PRO B 1 194 ? 32.722  43.546 11.643  1.00 33.16 ? 194  PRO B C   1 
ATOM   3095 O O   . PRO B 1 194 ? 33.555  42.680 11.372  1.00 33.88 ? 194  PRO B O   1 
ATOM   3096 C CB  . PRO B 1 194 ? 30.453  42.482 11.905  1.00 34.85 ? 194  PRO B CB  1 
ATOM   3097 C CG  . PRO B 1 194 ? 29.512  41.907 10.879  1.00 33.49 ? 194  PRO B CG  1 
ATOM   3098 C CD  . PRO B 1 194 ? 30.432  41.682 9.713   1.00 34.41 ? 194  PRO B CD  1 
ATOM   3099 N N   . GLY B 1 195 ? 32.993  44.603 12.401  1.00 30.08 ? 195  GLY B N   1 
ATOM   3100 C CA  . GLY B 1 195 ? 34.302  44.742 13.005  1.00 30.45 ? 195  GLY B CA  1 
ATOM   3101 C C   . GLY B 1 195 ? 35.180  45.900 12.581  1.00 30.28 ? 195  GLY B C   1 
ATOM   3102 O O   . GLY B 1 195 ? 35.029  46.479 11.503  1.00 27.54 ? 195  GLY B O   1 
ATOM   3103 N N   . TYR B 1 196 ? 36.120  46.222 13.461  1.00 28.37 ? 196  TYR B N   1 
ATOM   3104 C CA  . TYR B 1 196 ? 37.084  47.286 13.232  1.00 29.29 ? 196  TYR B CA  1 
ATOM   3105 C C   . TYR B 1 196 ? 38.355  46.721 12.610  1.00 31.25 ? 196  TYR B C   1 
ATOM   3106 O O   . TYR B 1 196 ? 38.784  45.612 12.932  1.00 32.29 ? 196  TYR B O   1 
ATOM   3107 C CB  . TYR B 1 196 ? 37.452  47.957 14.556  1.00 30.66 ? 196  TYR B CB  1 
ATOM   3108 C CG  . TYR B 1 196 ? 38.761  48.717 14.504  1.00 28.25 ? 196  TYR B CG  1 
ATOM   3109 C CD1 . TYR B 1 196 ? 38.816  50.022 14.016  1.00 27.31 ? 196  TYR B CD1 1 
ATOM   3110 C CD2 . TYR B 1 196 ? 39.954  48.115 14.910  1.00 28.24 ? 196  TYR B CD2 1 
ATOM   3111 C CE1 . TYR B 1 196 ? 40.027  50.709 13.933  1.00 23.46 ? 196  TYR B CE1 1 
ATOM   3112 C CE2 . TYR B 1 196 ? 41.169  48.791 14.832  1.00 25.21 ? 196  TYR B CE2 1 
ATOM   3113 C CZ  . TYR B 1 196 ? 41.200  50.086 14.343  1.00 26.88 ? 196  TYR B CZ  1 
ATOM   3114 O OH  . TYR B 1 196 ? 42.400  50.751 14.264  1.00 25.32 ? 196  TYR B OH  1 
ATOM   3115 N N   . GLN B 1 197 ? 38.954  47.502 11.721  1.00 27.41 ? 197  GLN B N   1 
ATOM   3116 C CA  . GLN B 1 197 ? 40.202  47.133 11.084  1.00 29.19 ? 197  GLN B CA  1 
ATOM   3117 C C   . GLN B 1 197 ? 40.988  48.430 10.964  1.00 29.77 ? 197  GLN B C   1 
ATOM   3118 O O   . GLN B 1 197 ? 40.432  49.459 10.587  1.00 28.54 ? 197  GLN B O   1 
ATOM   3119 C CB  . GLN B 1 197 ? 39.961  46.560 9.688   1.00 31.01 ? 197  GLN B CB  1 
ATOM   3120 C CG  . GLN B 1 197 ? 39.010  45.372 9.640   1.00 34.75 ? 197  GLN B CG  1 
ATOM   3121 C CD  . GLN B 1 197 ? 38.807  44.864 8.226   1.00 38.74 ? 197  GLN B CD  1 
ATOM   3122 O OE1 . GLN B 1 197 ? 39.768  44.500 7.544   1.00 39.23 ? 197  GLN B OE1 1 
ATOM   3123 N NE2 . GLN B 1 197 ? 37.553  44.839 7.774   1.00 39.68 ? 197  GLN B NE2 1 
ATOM   3124 N N   . PRO B 1 198 ? 42.281  48.409 11.321  1.00 29.64 ? 198  PRO B N   1 
ATOM   3125 C CA  . PRO B 1 198 ? 43.101  49.622 11.221  1.00 27.19 ? 198  PRO B CA  1 
ATOM   3126 C C   . PRO B 1 198 ? 43.270  50.010 9.750   1.00 27.37 ? 198  PRO B C   1 
ATOM   3127 O O   . PRO B 1 198 ? 43.053  49.192 8.856   1.00 27.35 ? 198  PRO B O   1 
ATOM   3128 C CB  . PRO B 1 198 ? 44.423  49.203 11.861  1.00 28.28 ? 198  PRO B CB  1 
ATOM   3129 C CG  . PRO B 1 198 ? 44.018  48.141 12.828  1.00 30.71 ? 198  PRO B CG  1 
ATOM   3130 C CD  . PRO B 1 198 ? 42.995  47.350 12.054  1.00 28.55 ? 198  PRO B CD  1 
ATOM   3131 N N   . PRO B 1 199 ? 43.667  51.265 9.483   1.00 26.74 ? 199  PRO B N   1 
ATOM   3132 C CA  . PRO B 1 199 ? 43.870  51.789 8.129   1.00 27.70 ? 199  PRO B CA  1 
ATOM   3133 C C   . PRO B 1 199 ? 44.624  50.882 7.148   1.00 29.65 ? 199  PRO B C   1 
ATOM   3134 O O   . PRO B 1 199 ? 44.098  50.526 6.096   1.00 28.52 ? 199  PRO B O   1 
ATOM   3135 C CB  . PRO B 1 199 ? 44.602  53.102 8.385   1.00 26.24 ? 199  PRO B CB  1 
ATOM   3136 C CG  . PRO B 1 199 ? 43.960  53.575 9.653   1.00 28.39 ? 199  PRO B CG  1 
ATOM   3137 C CD  . PRO B 1 199 ? 43.951  52.303 10.490  1.00 28.46 ? 199  PRO B CD  1 
ATOM   3138 N N   . LYS B 1 200 ? 45.859  50.523 7.485   1.00 31.02 ? 200  LYS B N   1 
ATOM   3139 C CA  . LYS B 1 200 ? 46.653  49.671 6.605   1.00 35.02 ? 200  LYS B CA  1 
ATOM   3140 C C   . LYS B 1 200 ? 45.972  48.334 6.335   1.00 32.88 ? 200  LYS B C   1 
ATOM   3141 O O   . LYS B 1 200 ? 45.868  47.909 5.186   1.00 32.62 ? 200  LYS B O   1 
ATOM   3142 C CB  . LYS B 1 200 ? 48.045  49.439 7.200   1.00 38.84 ? 200  LYS B CB  1 
ATOM   3143 C CG  . LYS B 1 200 ? 48.899  50.698 7.276   1.00 43.31 ? 200  LYS B CG  1 
ATOM   3144 C CD  . LYS B 1 200 ? 50.277  50.404 7.855   1.00 46.02 ? 200  LYS B CD  1 
ATOM   3145 C CE  . LYS B 1 200 ? 51.171  51.636 7.811   1.00 47.64 ? 200  LYS B CE  1 
ATOM   3146 N NZ  . LYS B 1 200 ? 50.639  52.757 8.632   1.00 48.49 ? 200  LYS B NZ  1 
ATOM   3147 N N   . GLU B 1 201 ? 45.508  47.675 7.391   1.00 33.32 ? 201  GLU B N   1 
ATOM   3148 C CA  . GLU B 1 201 ? 44.827  46.389 7.245   1.00 33.09 ? 201  GLU B CA  1 
ATOM   3149 C C   . GLU B 1 201 ? 43.551  46.549 6.419   1.00 33.33 ? 201  GLU B C   1 
ATOM   3150 O O   . GLU B 1 201 ? 43.274  45.748 5.522   1.00 31.30 ? 201  GLU B O   1 
ATOM   3151 C CB  . GLU B 1 201 ? 44.485  45.806 8.620   1.00 37.01 ? 201  GLU B CB  1 
ATOM   3152 C CG  . GLU B 1 201 ? 45.691  45.331 9.432   1.00 43.46 ? 201  GLU B CG  1 
ATOM   3153 C CD  . GLU B 1 201 ? 46.664  46.448 9.764   1.00 49.09 ? 201  GLU B CD  1 
ATOM   3154 O OE1 . GLU B 1 201 ? 46.234  47.464 10.347  1.00 47.55 ? 201  GLU B OE1 1 
ATOM   3155 O OE2 . GLU B 1 201 ? 47.864  46.310 9.445   1.00 55.92 ? 201  GLU B OE2 1 
ATOM   3156 N N   . MET B 1 202 ? 42.776  47.589 6.717   1.00 29.96 ? 202  MET B N   1 
ATOM   3157 C CA  . MET B 1 202 ? 41.537  47.839 5.985   1.00 28.63 ? 202  MET B CA  1 
ATOM   3158 C C   . MET B 1 202 ? 41.816  48.041 4.495   1.00 27.71 ? 202  MET B C   1 
ATOM   3159 O O   . MET B 1 202 ? 41.087  47.533 3.645   1.00 27.00 ? 202  MET B O   1 
ATOM   3160 C CB  . MET B 1 202 ? 40.832  49.075 6.550   1.00 27.56 ? 202  MET B CB  1 
ATOM   3161 C CG  . MET B 1 202 ? 39.508  49.412 5.875   1.00 30.02 ? 202  MET B CG  1 
ATOM   3162 S SD  . MET B 1 202 ? 38.194  48.230 6.266   1.00 35.63 ? 202  MET B SD  1 
ATOM   3163 C CE  . MET B 1 202 ? 37.622  48.884 7.842   1.00 29.92 ? 202  MET B CE  1 
ATOM   3164 N N   . LYS B 1 203 ? 42.873  48.785 4.183   1.00 27.57 ? 203  LYS B N   1 
ATOM   3165 C CA  . LYS B 1 203 ? 43.233  49.049 2.791   1.00 28.64 ? 203  LYS B CA  1 
ATOM   3166 C C   . LYS B 1 203 ? 43.590  47.741 2.078   1.00 29.43 ? 203  LYS B C   1 
ATOM   3167 O O   . LYS B 1 203 ? 43.175  47.502 0.941   1.00 27.08 ? 203  LYS B O   1 
ATOM   3168 C CB  . LYS B 1 203 ? 44.416  50.027 2.731   1.00 27.31 ? 203  LYS B CB  1 
ATOM   3169 C CG  . LYS B 1 203 ? 44.941  50.327 1.325   1.00 29.33 ? 203  LYS B CG  1 
ATOM   3170 C CD  . LYS B 1 203 ? 43.832  50.796 0.392   1.00 28.55 ? 203  LYS B CD  1 
ATOM   3171 C CE  . LYS B 1 203 ? 44.397  51.485 -0.845  1.00 32.56 ? 203  LYS B CE  1 
ATOM   3172 N NZ  . LYS B 1 203 ? 45.387  50.662 -1.601  1.00 33.30 ? 203  LYS B NZ  1 
ATOM   3173 N N   . GLU B 1 204 ? 44.355  46.896 2.756   1.00 30.88 ? 204  GLU B N   1 
ATOM   3174 C CA  . GLU B 1 204 ? 44.750  45.615 2.183   1.00 35.88 ? 204  GLU B CA  1 
ATOM   3175 C C   . GLU B 1 204 ? 43.497  44.776 1.955   1.00 34.55 ? 204  GLU B C   1 
ATOM   3176 O O   . GLU B 1 204 ? 43.296  44.221 0.874   1.00 36.81 ? 204  GLU B O   1 
ATOM   3177 C CB  . GLU B 1 204 ? 45.707  44.885 3.131   1.00 37.70 ? 204  GLU B CB  1 
ATOM   3178 C CG  . GLU B 1 204 ? 46.188  43.549 2.604   1.00 44.04 ? 204  GLU B CG  1 
ATOM   3179 C CD  . GLU B 1 204 ? 46.748  43.656 1.201   1.00 48.75 ? 204  GLU B CD  1 
ATOM   3180 O OE1 . GLU B 1 204 ? 47.739  44.391 1.005   1.00 50.36 ? 204  GLU B OE1 1 
ATOM   3181 O OE2 . GLU B 1 204 ? 46.193  43.007 0.291   1.00 53.10 ? 204  GLU B OE2 1 
ATOM   3182 N N   . PHE B 1 205 ? 42.654  44.701 2.980   1.00 34.22 ? 205  PHE B N   1 
ATOM   3183 C CA  . PHE B 1 205 ? 41.404  43.946 2.915   1.00 33.20 ? 205  PHE B CA  1 
ATOM   3184 C C   . PHE B 1 205 ? 40.536  44.390 1.740   1.00 31.60 ? 205  PHE B C   1 
ATOM   3185 O O   . PHE B 1 205 ? 40.027  43.563 0.984   1.00 30.26 ? 205  PHE B O   1 
ATOM   3186 C CB  . PHE B 1 205 ? 40.613  44.128 4.214   1.00 34.54 ? 205  PHE B CB  1 
ATOM   3187 C CG  . PHE B 1 205 ? 39.250  43.484 4.191   1.00 37.46 ? 205  PHE B CG  1 
ATOM   3188 C CD1 . PHE B 1 205 ? 39.105  42.115 4.405   1.00 39.49 ? 205  PHE B CD1 1 
ATOM   3189 C CD2 . PHE B 1 205 ? 38.110  44.246 3.935   1.00 39.21 ? 205  PHE B CD2 1 
ATOM   3190 C CE1 . PHE B 1 205 ? 37.846  41.512 4.365   1.00 38.86 ? 205  PHE B CE1 1 
ATOM   3191 C CE2 . PHE B 1 205 ? 36.846  43.653 3.892   1.00 39.03 ? 205  PHE B CE2 1 
ATOM   3192 C CZ  . PHE B 1 205 ? 36.715  42.284 4.107   1.00 40.79 ? 205  PHE B CZ  1 
ATOM   3193 N N   . LEU B 1 206 ? 40.362  45.700 1.597   1.00 29.44 ? 206  LEU B N   1 
ATOM   3194 C CA  . LEU B 1 206 ? 39.542  46.246 0.521   1.00 26.83 ? 206  LEU B CA  1 
ATOM   3195 C C   . LEU B 1 206 ? 40.176  46.017 -0.850  1.00 27.34 ? 206  LEU B C   1 
ATOM   3196 O O   . LEU B 1 206 ? 39.470  45.763 -1.826  1.00 25.96 ? 206  LEU B O   1 
ATOM   3197 C CB  . LEU B 1 206 ? 39.297  47.743 0.748   1.00 27.57 ? 206  LEU B CB  1 
ATOM   3198 C CG  . LEU B 1 206 ? 38.535  48.103 2.031   1.00 26.71 ? 206  LEU B CG  1 
ATOM   3199 C CD1 . LEU B 1 206 ? 38.393  49.629 2.155   1.00 24.52 ? 206  LEU B CD1 1 
ATOM   3200 C CD2 . LEU B 1 206 ? 37.162  47.459 1.999   1.00 25.23 ? 206  LEU B CD2 1 
ATOM   3201 N N   . ASP B 1 207 ? 41.500  46.106 -0.938  1.00 29.08 ? 207  ASP B N   1 
ATOM   3202 C CA  . ASP B 1 207 ? 42.149  45.873 -2.227  1.00 32.86 ? 207  ASP B CA  1 
ATOM   3203 C C   . ASP B 1 207 ? 41.885  44.429 -2.643  1.00 34.19 ? 207  ASP B C   1 
ATOM   3204 O O   . ASP B 1 207 ? 41.560  44.152 -3.799  1.00 34.77 ? 207  ASP B O   1 
ATOM   3205 C CB  . ASP B 1 207 ? 43.661  46.112 -2.150  1.00 31.31 ? 207  ASP B CB  1 
ATOM   3206 C CG  . ASP B 1 207 ? 44.023  47.584 -2.153  1.00 36.72 ? 207  ASP B CG  1 
ATOM   3207 O OD1 . ASP B 1 207 ? 43.155  48.422 -2.489  1.00 34.40 ? 207  ASP B OD1 1 
ATOM   3208 O OD2 . ASP B 1 207 ? 45.186  47.901 -1.829  1.00 35.60 ? 207  ASP B OD2 1 
ATOM   3209 N N   . GLU B 1 208 ? 42.018  43.517 -1.688  1.00 35.94 ? 208  GLU B N   1 
ATOM   3210 C CA  . GLU B 1 208 ? 41.791  42.098 -1.949  1.00 40.50 ? 208  GLU B CA  1 
ATOM   3211 C C   . GLU B 1 208 ? 40.337  41.828 -2.306  1.00 39.42 ? 208  GLU B C   1 
ATOM   3212 O O   . GLU B 1 208 ? 40.052  41.105 -3.258  1.00 40.54 ? 208  GLU B O   1 
ATOM   3213 C CB  . GLU B 1 208 ? 42.187  41.267 -0.730  1.00 41.41 ? 208  GLU B CB  1 
ATOM   3214 C CG  . GLU B 1 208 ? 43.642  41.426 -0.347  1.00 49.00 ? 208  GLU B CG  1 
ATOM   3215 C CD  . GLU B 1 208 ? 44.569  41.194 -1.521  1.00 55.03 ? 208  GLU B CD  1 
ATOM   3216 O OE1 . GLU B 1 208 ? 44.563  40.071 -2.068  1.00 57.67 ? 208  GLU B OE1 1 
ATOM   3217 O OE2 . GLU B 1 208 ? 45.299  42.135 -1.901  1.00 57.57 ? 208  GLU B OE2 1 
ATOM   3218 N N   . HIS B 1 209 ? 39.417  42.406 -1.541  1.00 38.70 ? 209  HIS B N   1 
ATOM   3219 C CA  . HIS B 1 209 ? 37.998  42.217 -1.811  1.00 38.43 ? 209  HIS B CA  1 
ATOM   3220 C C   . HIS B 1 209 ? 37.662  42.720 -3.210  1.00 39.04 ? 209  HIS B C   1 
ATOM   3221 O O   . HIS B 1 209 ? 36.943  42.061 -3.959  1.00 37.19 ? 209  HIS B O   1 
ATOM   3222 C CB  . HIS B 1 209 ? 37.144  42.972 -0.795  1.00 39.54 ? 209  HIS B CB  1 
ATOM   3223 C CG  . HIS B 1 209 ? 35.675  42.866 -1.057  1.00 44.22 ? 209  HIS B CG  1 
ATOM   3224 N ND1 . HIS B 1 209 ? 34.941  41.744 -0.739  1.00 47.80 ? 209  HIS B ND1 1 
ATOM   3225 C CD2 . HIS B 1 209 ? 34.815  43.720 -1.662  1.00 43.39 ? 209  HIS B CD2 1 
ATOM   3226 C CE1 . HIS B 1 209 ? 33.692  41.910 -1.137  1.00 46.03 ? 209  HIS B CE1 1 
ATOM   3227 N NE2 . HIS B 1 209 ? 33.590  43.101 -1.701  1.00 48.01 ? 209  HIS B NE2 1 
ATOM   3228 N N   . GLN B 1 210 ? 38.178  43.896 -3.557  1.00 39.32 ? 210  GLN B N   1 
ATOM   3229 C CA  . GLN B 1 210 ? 37.926  44.474 -4.873  1.00 41.90 ? 210  GLN B CA  1 
ATOM   3230 C C   . GLN B 1 210 ? 38.471  43.554 -5.964  1.00 42.53 ? 210  GLN B C   1 
ATOM   3231 O O   . GLN B 1 210 ? 37.843  43.365 -7.003  1.00 39.44 ? 210  GLN B O   1 
ATOM   3232 C CB  . GLN B 1 210 ? 38.587  45.849 -4.995  1.00 45.11 ? 210  GLN B CB  1 
ATOM   3233 C CG  . GLN B 1 210 ? 38.381  46.503 -6.355  1.00 50.77 ? 210  GLN B CG  1 
ATOM   3234 C CD  . GLN B 1 210 ? 39.123  47.817 -6.498  1.00 53.74 ? 210  GLN B CD  1 
ATOM   3235 O OE1 . GLN B 1 210 ? 38.809  48.799 -5.826  1.00 57.55 ? 210  GLN B OE1 1 
ATOM   3236 N NE2 . GLN B 1 210 ? 40.120  47.840 -7.377  1.00 56.47 ? 210  GLN B NE2 1 
ATOM   3237 N N   . LYS B 1 211 ? 39.646  42.987 -5.724  1.00 42.68 ? 211  LYS B N   1 
ATOM   3238 C CA  . LYS B 1 211 ? 40.248  42.088 -6.696  1.00 48.07 ? 211  LYS B CA  1 
ATOM   3239 C C   . LYS B 1 211 ? 39.470  40.772 -6.764  1.00 48.27 ? 211  LYS B C   1 
ATOM   3240 O O   . LYS B 1 211 ? 39.238  40.242 -7.847  1.00 48.89 ? 211  LYS B O   1 
ATOM   3241 C CB  . LYS B 1 211 ? 41.719  41.838 -6.343  1.00 47.00 ? 211  LYS B CB  1 
ATOM   3242 C CG  . LYS B 1 211 ? 42.587  43.082 -6.510  1.00 48.35 ? 211  LYS B CG  1 
ATOM   3243 C CD  . LYS B 1 211 ? 44.064  42.823 -6.231  1.00 49.35 ? 211  LYS B CD  1 
ATOM   3244 C CE  . LYS B 1 211 ? 44.325  42.527 -4.763  1.00 50.26 ? 211  LYS B CE  1 
ATOM   3245 N NZ  . LYS B 1 211 ? 45.786  42.430 -4.481  1.00 51.67 ? 211  LYS B NZ  1 
ATOM   3246 N N   . MET B 1 212 ? 39.055  40.259 -5.610  1.00 50.98 ? 212  MET B N   1 
ATOM   3247 C CA  . MET B 1 212 ? 38.300  39.010 -5.564  1.00 53.44 ? 212  MET B CA  1 
ATOM   3248 C C   . MET B 1 212 ? 36.921  39.191 -6.189  1.00 53.36 ? 212  MET B C   1 
ATOM   3249 O O   . MET B 1 212 ? 36.409  38.293 -6.857  1.00 52.96 ? 212  MET B O   1 
ATOM   3250 C CB  . MET B 1 212 ? 38.147  38.526 -4.120  1.00 56.66 ? 212  MET B CB  1 
ATOM   3251 C CG  . MET B 1 212 ? 39.458  38.169 -3.439  1.00 61.54 ? 212  MET B CG  1 
ATOM   3252 S SD  . MET B 1 212 ? 39.216  37.462 -1.796  1.00 68.67 ? 212  MET B SD  1 
ATOM   3253 C CE  . MET B 1 212 ? 39.058  38.953 -0.799  1.00 68.55 ? 212  MET B CE  1 
ATOM   3254 N N   . THR B 1 213 ? 36.326  40.359 -5.964  1.00 52.46 ? 213  THR B N   1 
ATOM   3255 C CA  . THR B 1 213 ? 35.008  40.675 -6.503  1.00 51.02 ? 213  THR B CA  1 
ATOM   3256 C C   . THR B 1 213 ? 35.074  40.853 -8.018  1.00 49.91 ? 213  THR B C   1 
ATOM   3257 O O   . THR B 1 213 ? 34.076  40.681 -8.717  1.00 48.43 ? 213  THR B O   1 
ATOM   3258 C CB  . THR B 1 213 ? 34.445  41.971 -5.868  1.00 50.67 ? 213  THR B CB  1 
ATOM   3259 O OG1 . THR B 1 213 ? 34.247  41.765 -4.464  1.00 52.40 ? 213  THR B OG1 1 
ATOM   3260 C CG2 . THR B 1 213 ? 33.116  42.357 -6.509  1.00 51.58 ? 213  THR B CG2 1 
ATOM   3261 N N   . SER B 1 214 ? 36.255  41.195 -8.518  1.00 49.75 ? 214  SER B N   1 
ATOM   3262 C CA  . SER B 1 214 ? 36.451  41.403 -9.947  1.00 51.21 ? 214  SER B CA  1 
ATOM   3263 C C   . SER B 1 214 ? 37.195  40.237 -10.592 1.00 51.16 ? 214  SER B C   1 
ATOM   3264 O O   . SER B 1 214 ? 37.586  40.308 -11.759 1.00 50.82 ? 214  SER B O   1 
ATOM   3265 C CB  . SER B 1 214 ? 37.223  42.703 -10.181 1.00 51.56 ? 214  SER B CB  1 
ATOM   3266 O OG  . SER B 1 214 ? 38.471  42.672 -9.512  1.00 56.70 ? 214  SER B OG  1 
ATOM   3267 N N   . GLY B 1 215 ? 37.392  39.170 -9.822  1.00 51.99 ? 215  GLY B N   1 
ATOM   3268 C CA  . GLY B 1 215 ? 38.081  37.994 -10.327 1.00 52.36 ? 215  GLY B CA  1 
ATOM   3269 C C   . GLY B 1 215 ? 39.537  38.228 -10.677 1.00 53.10 ? 215  GLY B C   1 
ATOM   3270 O O   . GLY B 1 215 ? 40.157  37.413 -11.362 1.00 53.41 ? 215  GLY B O   1 
ATOM   3271 N N   . LYS B 1 216 ? 40.091  39.339 -10.206 1.00 53.68 ? 216  LYS B N   1 
ATOM   3272 C CA  . LYS B 1 216 ? 41.483  39.669 -10.483 1.00 54.37 ? 216  LYS B CA  1 
ATOM   3273 C C   . LYS B 1 216 ? 42.374  39.506 -9.260  1.00 53.53 ? 216  LYS B C   1 
ATOM   3274 O O   . LYS B 1 216 ? 41.916  38.902 -8.265  1.00 52.04 ? 216  LYS B O   1 
ATOM   3275 C CB  . LYS B 1 216 ? 41.588  41.100 -11.018 1.00 54.57 ? 216  LYS B CB  1 
ATOM   3276 C CG  . LYS B 1 216 ? 41.052  41.266 -12.432 1.00 56.14 ? 216  LYS B CG  1 
ATOM   3277 C CD  . LYS B 1 216 ? 41.858  40.435 -13.422 1.00 58.85 ? 216  LYS B CD  1 
ATOM   3278 C CE  . LYS B 1 216 ? 41.310  40.557 -14.836 1.00 57.98 ? 216  LYS B CE  1 
ATOM   3279 N NZ  . LYS B 1 216 ? 39.922  40.034 -14.956 1.00 58.52 ? 216  LYS B NZ  1 
ATOM   3280 O OXT . LYS B 1 216 ? 43.529  39.976 -9.323  1.00 54.80 ? 216  LYS B OXT 1 
HETATM 3281 O O1  . MES C 2 .   ? 11.553  53.008 12.087  1.00 28.51 ? 1001 MES B O1  1 
HETATM 3282 C C2  . MES C 2 .   ? 11.310  54.387 11.644  1.00 27.56 ? 1001 MES B C2  1 
HETATM 3283 C C3  . MES C 2 .   ? 10.484  54.351 10.516  1.00 27.38 ? 1001 MES B C3  1 
HETATM 3284 N N4  . MES C 2 .   ? 11.092  53.577 9.458   1.00 28.22 ? 1001 MES B N4  1 
HETATM 3285 C C5  . MES C 2 .   ? 11.248  52.233 9.889   1.00 27.37 ? 1001 MES B C5  1 
HETATM 3286 C C6  . MES C 2 .   ? 12.070  52.146 11.020  1.00 25.07 ? 1001 MES B C6  1 
HETATM 3287 C C7  . MES C 2 .   ? 10.266  53.544 8.297   1.00 31.48 ? 1001 MES B C7  1 
HETATM 3288 C C8  . MES C 2 .   ? 9.973   54.751 7.643   1.00 35.73 ? 1001 MES B C8  1 
HETATM 3289 S S   . MES C 2 .   ? 8.691   55.113 7.079   1.00 29.73 ? 1001 MES B S   1 
HETATM 3290 O O1S . MES C 2 .   ? 7.573   55.792 8.299   1.00 40.12 ? 1001 MES B O1S 1 
HETATM 3291 O O2S . MES C 2 .   ? 8.905   56.394 5.860   1.00 27.70 ? 1001 MES B O2S 1 
HETATM 3292 O O3S . MES C 2 .   ? 7.827   53.798 6.249   1.00 33.41 ? 1001 MES B O3S 1 
HETATM 3293 O O   . HOH D 3 .   ? 3.637   27.198 11.494  1.00 38.13 ? 217  HOH A O   1 
HETATM 3294 O O   . HOH D 3 .   ? 23.705  14.130 21.899  1.00 26.10 ? 218  HOH A O   1 
HETATM 3295 O O   . HOH D 3 .   ? 9.007   13.352 24.826  1.00 25.12 ? 219  HOH A O   1 
HETATM 3296 O O   . HOH D 3 .   ? 21.810  20.096 23.398  1.00 41.42 ? 220  HOH A O   1 
HETATM 3297 O O   . HOH D 3 .   ? 4.336   2.770  18.307  1.00 28.97 ? 221  HOH A O   1 
HETATM 3298 O O   . HOH D 3 .   ? 20.825  16.340 20.902  1.00 25.79 ? 222  HOH A O   1 
HETATM 3299 O O   . HOH D 3 .   ? 11.053  12.562 4.580   1.00 51.69 ? 223  HOH A O   1 
HETATM 3300 O O   . HOH D 3 .   ? 0.095   15.675 13.606  1.00 36.31 ? 224  HOH A O   1 
HETATM 3301 O O   . HOH D 3 .   ? -2.527  15.023 9.608   1.00 53.91 ? 225  HOH A O   1 
HETATM 3302 O O   . HOH D 3 .   ? -1.534  18.824 33.889  1.00 41.35 ? 226  HOH A O   1 
HETATM 3303 O O   . HOH D 3 .   ? -6.213  16.255 15.884  1.00 31.85 ? 227  HOH A O   1 
HETATM 3304 O O   . HOH D 3 .   ? 3.747   22.952 22.183  1.00 35.14 ? 228  HOH A O   1 
HETATM 3305 O O   . HOH D 3 .   ? 23.510  17.491 11.612  1.00 44.83 ? 229  HOH A O   1 
HETATM 3306 O O   . HOH D 3 .   ? 6.219   5.145  7.795   1.00 36.38 ? 230  HOH A O   1 
HETATM 3307 O O   . HOH D 3 .   ? 9.997   8.014  32.692  1.00 61.56 ? 231  HOH A O   1 
HETATM 3308 O O   . HOH D 3 .   ? 26.260  10.372 8.574   1.00 55.24 ? 232  HOH A O   1 
HETATM 3309 O O   . HOH D 3 .   ? 5.365   33.349 -12.523 1.00 42.10 ? 233  HOH A O   1 
HETATM 3310 O O   . HOH D 3 .   ? -7.714  20.347 37.934  1.00 48.57 ? 234  HOH A O   1 
HETATM 3311 O O   . HOH D 3 .   ? 4.842   13.567 36.905  1.00 52.58 ? 235  HOH A O   1 
HETATM 3312 O O   . HOH D 3 .   ? -3.357  18.239 16.069  1.00 31.36 ? 236  HOH A O   1 
HETATM 3313 O O   . HOH D 3 .   ? -2.748  14.533 6.971   1.00 51.02 ? 237  HOH A O   1 
HETATM 3314 O O   . HOH D 3 .   ? -0.389  3.096  21.909  1.00 42.42 ? 238  HOH A O   1 
HETATM 3315 O O   . HOH D 3 .   ? -8.813  16.125 16.158  1.00 32.69 ? 239  HOH A O   1 
HETATM 3316 O O   . HOH D 3 .   ? 12.435  29.486 -19.461 1.00 47.89 ? 240  HOH A O   1 
HETATM 3317 O O   . HOH D 3 .   ? 25.172  9.644  10.831  1.00 60.52 ? 241  HOH A O   1 
HETATM 3318 O O   . HOH D 3 .   ? 9.799   34.366 -13.381 1.00 43.69 ? 242  HOH A O   1 
HETATM 3319 O O   . HOH D 3 .   ? 0.430   25.523 -9.760  1.00 41.09 ? 243  HOH A O   1 
HETATM 3320 O O   . HOH D 3 .   ? -3.578  28.822 -0.387  1.00 41.72 ? 244  HOH A O   1 
HETATM 3321 O O   . HOH D 3 .   ? 11.769  23.326 3.875   1.00 43.97 ? 245  HOH A O   1 
HETATM 3322 O O   . HOH D 3 .   ? 5.178   26.550 -18.026 1.00 45.51 ? 246  HOH A O   1 
HETATM 3323 O O   . HOH D 3 .   ? 7.817   25.821 7.415   1.00 39.65 ? 247  HOH A O   1 
HETATM 3324 O O   . HOH D 3 .   ? 5.125   6.791  29.976  1.00 50.67 ? 248  HOH A O   1 
HETATM 3325 O O   . HOH D 3 .   ? -8.703  9.148  26.048  1.00 39.35 ? 249  HOH A O   1 
HETATM 3326 O O   . HOH D 3 .   ? 14.109  21.940 25.583  1.00 29.12 ? 250  HOH A O   1 
HETATM 3327 O O   . HOH D 3 .   ? 2.580   8.569  31.935  1.00 35.23 ? 251  HOH A O   1 
HETATM 3328 O O   . HOH D 3 .   ? 5.034   21.487 34.158  1.00 44.71 ? 252  HOH A O   1 
HETATM 3329 O O   . HOH D 3 .   ? 11.196  10.123 35.926  1.00 43.75 ? 253  HOH A O   1 
HETATM 3330 O O   . HOH D 3 .   ? 1.834   5.340  28.848  1.00 49.77 ? 254  HOH A O   1 
HETATM 3331 O O   . HOH D 3 .   ? -7.076  39.483 5.106   1.00 58.27 ? 255  HOH A O   1 
HETATM 3332 O O   . HOH D 3 .   ? 10.538  36.758 -17.885 1.00 56.41 ? 256  HOH A O   1 
HETATM 3333 O O   . HOH D 3 .   ? 17.862  23.099 16.044  1.00 51.26 ? 257  HOH A O   1 
HETATM 3334 O O   . HOH D 3 .   ? -7.729  21.900 11.776  1.00 52.73 ? 258  HOH A O   1 
HETATM 3335 O O   . HOH D 3 .   ? 13.084  -5.045 25.640  1.00 68.94 ? 259  HOH A O   1 
HETATM 3336 O O   . HOH D 3 .   ? 1.240   28.150 -12.525 1.00 45.78 ? 260  HOH A O   1 
HETATM 3337 O O   . HOH D 3 .   ? 22.381  -4.949 14.287  1.00 58.06 ? 261  HOH A O   1 
HETATM 3338 O O   . HOH D 3 .   ? 5.694   22.059 -13.869 1.00 47.58 ? 262  HOH A O   1 
HETATM 3339 O O   . HOH D 3 .   ? 11.459  26.431 3.959   1.00 65.19 ? 263  HOH A O   1 
HETATM 3340 O O   . HOH D 3 .   ? 17.989  23.678 13.402  1.00 52.77 ? 264  HOH A O   1 
HETATM 3341 O O   . HOH D 3 .   ? -6.201  20.983 13.890  1.00 61.01 ? 265  HOH A O   1 
HETATM 3342 O O   . HOH D 3 .   ? 19.608  20.819 15.328  1.00 52.99 ? 266  HOH A O   1 
HETATM 3343 O O   . HOH D 3 .   ? 23.647  1.602  12.295  1.00 60.32 ? 267  HOH A O   1 
HETATM 3344 O O   . HOH D 3 .   ? 0.894   16.671 -2.673  1.00 53.85 ? 268  HOH A O   1 
HETATM 3345 O O   . HOH D 3 .   ? 12.782  26.312 7.381   1.00 63.93 ? 269  HOH A O   1 
HETATM 3346 O O   . HOH D 3 .   ? -2.816  24.096 -10.406 1.00 62.74 ? 270  HOH A O   1 
HETATM 3347 O O   . HOH D 3 .   ? 8.883   25.450 32.052  1.00 53.03 ? 271  HOH A O   1 
HETATM 3348 O O   . HOH D 3 .   ? 5.641   28.376 20.669  1.00 58.29 ? 272  HOH A O   1 
HETATM 3349 O O   . HOH D 3 .   ? 13.464  27.106 2.175   1.00 69.16 ? 273  HOH A O   1 
HETATM 3350 O O   . HOH D 3 .   ? -12.936 21.882 21.047  1.00 69.41 ? 274  HOH A O   1 
HETATM 3351 O O   . HOH D 3 .   ? 16.910  31.601 4.608   1.00 63.01 ? 275  HOH A O   1 
HETATM 3352 O O   . HOH D 3 .   ? -3.620  32.855 -5.748  1.00 56.01 ? 276  HOH A O   1 
HETATM 3353 O O   . HOH D 3 .   ? 5.122   14.022 -8.720  1.00 62.21 ? 277  HOH A O   1 
HETATM 3354 O O   . HOH D 3 .   ? -6.281  25.090 8.578   1.00 59.61 ? 278  HOH A O   1 
HETATM 3355 O O   . HOH D 3 .   ? 11.035  24.225 24.844  1.00 32.62 ? 279  HOH A O   1 
HETATM 3356 O O   . HOH D 3 .   ? 22.205  15.986 23.237  1.00 28.13 ? 280  HOH A O   1 
HETATM 3357 O O   . HOH D 3 .   ? 12.172  25.738 21.713  1.00 37.98 ? 281  HOH A O   1 
HETATM 3358 O O   . HOH D 3 .   ? 4.966   24.195 33.199  1.00 55.20 ? 282  HOH A O   1 
HETATM 3359 O O   . HOH D 3 .   ? 8.773   22.980 34.604  1.00 63.51 ? 283  HOH A O   1 
HETATM 3360 O O   . HOH D 3 .   ? -5.820  19.040 16.943  1.00 43.70 ? 284  HOH A O   1 
HETATM 3361 O O   . HOH D 3 .   ? 1.083   10.197 34.718  1.00 68.87 ? 285  HOH A O   1 
HETATM 3362 O O   . HOH D 3 .   ? -0.053  24.522 8.503   1.00 52.34 ? 286  HOH A O   1 
HETATM 3363 O O   . HOH D 3 .   ? 10.603  27.672 7.951   1.00 62.47 ? 287  HOH A O   1 
HETATM 3364 O O   . HOH D 3 .   ? 27.363  10.442 12.437  1.00 68.07 ? 288  HOH A O   1 
HETATM 3365 O O   . HOH D 3 .   ? 2.746   20.963 -15.634 1.00 60.86 ? 289  HOH A O   1 
HETATM 3366 O O   . HOH D 3 .   ? 7.612   26.786 26.843  1.00 60.95 ? 290  HOH A O   1 
HETATM 3367 O O   . HOH D 3 .   ? 9.251   24.696 26.573  1.00 37.04 ? 291  HOH A O   1 
HETATM 3368 O O   . HOH D 3 .   ? -11.559 17.139 28.613  1.00 56.40 ? 292  HOH A O   1 
HETATM 3369 O O   . HOH D 3 .   ? -0.036  14.624 -3.875  1.00 55.37 ? 293  HOH A O   1 
HETATM 3370 O O   . HOH D 3 .   ? 0.880   21.026 35.177  1.00 57.96 ? 294  HOH A O   1 
HETATM 3371 O O   . HOH D 3 .   ? 2.927   24.600 -1.193  1.00 51.66 ? 295  HOH A O   1 
HETATM 3372 O O   . HOH D 3 .   ? -3.844  25.830 0.180   1.00 57.70 ? 296  HOH A O   1 
HETATM 3373 O O   . HOH D 3 .   ? 21.835  22.221 0.599   1.00 61.52 ? 297  HOH A O   1 
HETATM 3374 O O   . HOH D 3 .   ? 9.726   27.737 23.977  1.00 52.95 ? 298  HOH A O   1 
HETATM 3375 O O   . HOH D 3 .   ? 9.807   6.099  30.675  1.00 50.84 ? 299  HOH A O   1 
HETATM 3376 O O   . HOH E 3 .   ? 16.526  59.394 4.276   1.00 27.84 ? 1002 HOH B O   1 
HETATM 3377 O O   . HOH E 3 .   ? 43.826  62.586 5.129   1.00 29.16 ? 1003 HOH B O   1 
HETATM 3378 O O   . HOH E 3 .   ? 23.214  38.676 -4.647  1.00 41.23 ? 1004 HOH B O   1 
HETATM 3379 O O   . HOH E 3 .   ? 36.251  44.725 16.348  1.00 37.22 ? 1005 HOH B O   1 
HETATM 3380 O O   . HOH E 3 .   ? 48.360  50.885 -0.599  1.00 47.38 ? 1006 HOH B O   1 
HETATM 3381 O O   . HOH E 3 .   ? 46.115  58.956 14.505  1.00 48.35 ? 1007 HOH B O   1 
HETATM 3382 O O   . HOH E 3 .   ? 16.145  41.625 6.797   1.00 32.94 ? 1008 HOH B O   1 
HETATM 3383 O O   . HOH E 3 .   ? 11.736  43.659 -6.309  1.00 29.26 ? 1009 HOH B O   1 
HETATM 3384 O O   . HOH E 3 .   ? 24.561  52.855 22.248  1.00 34.26 ? 1010 HOH B O   1 
HETATM 3385 O O   . HOH E 3 .   ? 34.415  51.023 -3.320  1.00 31.16 ? 1011 HOH B O   1 
HETATM 3386 O O   . HOH E 3 .   ? 19.574  59.714 -0.760  1.00 29.18 ? 1012 HOH B O   1 
HETATM 3387 O O   . HOH E 3 .   ? 11.582  57.537 9.317   1.00 32.20 ? 1013 HOH B O   1 
HETATM 3388 O O   . HOH E 3 .   ? 15.754  58.843 8.161   1.00 33.20 ? 1014 HOH B O   1 
HETATM 3389 O O   . HOH E 3 .   ? 35.227  45.496 9.035   1.00 36.45 ? 1015 HOH B O   1 
HETATM 3390 O O   . HOH E 3 .   ? 39.062  63.566 11.361  1.00 48.19 ? 1016 HOH B O   1 
HETATM 3391 O O   . HOH E 3 .   ? 7.444   52.246 -1.350  1.00 39.61 ? 1017 HOH B O   1 
HETATM 3392 O O   . HOH E 3 .   ? 14.435  44.497 -5.383  1.00 42.22 ? 1018 HOH B O   1 
HETATM 3393 O O   . HOH E 3 .   ? 35.286  64.560 3.266   1.00 32.35 ? 1019 HOH B O   1 
HETATM 3394 O O   . HOH E 3 .   ? 35.816  48.636 -2.512  1.00 35.05 ? 1020 HOH B O   1 
HETATM 3395 O O   . HOH E 3 .   ? 39.415  63.723 8.830   1.00 50.51 ? 1021 HOH B O   1 
HETATM 3396 O O   . HOH E 3 .   ? 29.175  64.626 4.985   1.00 27.88 ? 1022 HOH B O   1 
HETATM 3397 O O   . HOH E 3 .   ? 33.388  44.591 16.290  1.00 36.46 ? 1023 HOH B O   1 
HETATM 3398 O O   . HOH E 3 .   ? 32.652  60.183 -2.241  1.00 40.18 ? 1024 HOH B O   1 
HETATM 3399 O O   . HOH E 3 .   ? 16.316  42.060 -9.432  1.00 50.65 ? 1025 HOH B O   1 
HETATM 3400 O O   . HOH E 3 .   ? 44.491  59.476 19.529  1.00 33.77 ? 1026 HOH B O   1 
HETATM 3401 O O   . HOH E 3 .   ? 36.968  66.635 9.318   1.00 37.96 ? 1027 HOH B O   1 
HETATM 3402 O O   . HOH E 3 .   ? 46.992  51.214 10.130  1.00 32.54 ? 1028 HOH B O   1 
HETATM 3403 O O   . HOH E 3 .   ? 46.740  55.215 13.695  1.00 37.13 ? 1029 HOH B O   1 
HETATM 3404 O O   . HOH E 3 .   ? 2.841   41.508 -11.805 1.00 40.55 ? 1030 HOH B O   1 
HETATM 3405 O O   . HOH E 3 .   ? 15.475  65.020 3.753   1.00 45.60 ? 1031 HOH B O   1 
HETATM 3406 O O   . HOH E 3 .   ? 13.108  46.602 10.992  1.00 41.38 ? 1032 HOH B O   1 
HETATM 3407 O O   . HOH E 3 .   ? 5.581   41.486 14.341  1.00 47.14 ? 1033 HOH B O   1 
HETATM 3408 O O   . HOH E 3 .   ? 16.990  63.402 5.775   1.00 32.95 ? 1034 HOH B O   1 
HETATM 3409 O O   . HOH E 3 .   ? 37.289  63.825 16.144  1.00 36.50 ? 1035 HOH B O   1 
HETATM 3410 O O   . HOH E 3 .   ? 41.406  57.785 -7.514  1.00 32.51 ? 1036 HOH B O   1 
HETATM 3411 O O   . HOH E 3 .   ? 29.052  51.056 1.019   1.00 42.58 ? 1037 HOH B O   1 
HETATM 3412 O O   . HOH E 3 .   ? 20.947  46.842 19.430  1.00 45.61 ? 1038 HOH B O   1 
HETATM 3413 O O   . HOH E 3 .   ? 2.120   48.879 6.528   1.00 45.54 ? 1039 HOH B O   1 
HETATM 3414 O O   . HOH E 3 .   ? 17.005  54.329 -3.274  1.00 32.67 ? 1040 HOH B O   1 
HETATM 3415 O O   . HOH E 3 .   ? 0.445   47.459 11.559  1.00 53.07 ? 1041 HOH B O   1 
HETATM 3416 O O   . HOH E 3 .   ? 48.360  48.660 3.111   1.00 46.52 ? 1042 HOH B O   1 
HETATM 3417 O O   . HOH E 3 .   ? 4.362   49.949 -4.810  1.00 39.04 ? 1043 HOH B O   1 
HETATM 3418 O O   . HOH E 3 .   ? 33.925  48.927 -0.473  1.00 44.29 ? 1044 HOH B O   1 
HETATM 3419 O O   . HOH E 3 .   ? -2.513  41.897 15.734  1.00 51.12 ? 1045 HOH B O   1 
HETATM 3420 O O   . HOH E 3 .   ? 12.085  51.724 4.199   1.00 29.77 ? 1046 HOH B O   1 
HETATM 3421 O O   . HOH E 3 .   ? 26.511  50.752 -0.874  1.00 48.24 ? 1047 HOH B O   1 
HETATM 3422 O O   . HOH E 3 .   ? 13.369  50.209 7.561   1.00 32.03 ? 1048 HOH B O   1 
HETATM 3423 O O   . HOH E 3 .   ? 14.682  52.058 5.449   1.00 33.89 ? 1049 HOH B O   1 
HETATM 3424 O O   . HOH E 3 .   ? 14.158  58.333 1.805   1.00 22.85 ? 1050 HOH B O   1 
HETATM 3425 O O   . HOH E 3 .   ? 33.904  44.058 20.036  1.00 45.90 ? 1051 HOH B O   1 
HETATM 3426 O O   . HOH E 3 .   ? 29.558  45.860 20.047  1.00 42.91 ? 1052 HOH B O   1 
HETATM 3427 O O   . HOH E 3 .   ? -0.946  48.902 -6.195  1.00 39.69 ? 1053 HOH B O   1 
HETATM 3428 O O   . HOH E 3 .   ? 41.393  64.821 7.875   1.00 54.99 ? 1054 HOH B O   1 
HETATM 3429 O O   . HOH E 3 .   ? 42.682  61.472 11.593  1.00 47.68 ? 1055 HOH B O   1 
HETATM 3430 O O   . HOH E 3 .   ? 31.053  43.431 16.098  1.00 46.24 ? 1056 HOH B O   1 
HETATM 3431 O O   . HOH E 3 .   ? 14.854  40.369 5.007   1.00 38.46 ? 1057 HOH B O   1 
HETATM 3432 O O   . HOH E 3 .   ? 32.748  47.273 19.689  1.00 46.77 ? 1058 HOH B O   1 
HETATM 3433 O O   . HOH E 3 .   ? 14.582  63.701 17.480  1.00 62.15 ? 1059 HOH B O   1 
HETATM 3434 O O   . HOH E 3 .   ? 37.584  63.859 5.132   1.00 42.67 ? 1060 HOH B O   1 
HETATM 3435 O O   . HOH E 3 .   ? 39.067  61.769 20.218  1.00 51.66 ? 1061 HOH B O   1 
HETATM 3436 O O   . HOH E 3 .   ? 22.772  65.500 2.340   1.00 51.96 ? 1062 HOH B O   1 
HETATM 3437 O O   . HOH E 3 .   ? 13.263  37.821 2.173   1.00 29.16 ? 1063 HOH B O   1 
HETATM 3438 O O   . HOH E 3 .   ? 9.232   49.159 13.643  1.00 50.96 ? 1064 HOH B O   1 
HETATM 3439 O O   . HOH E 3 .   ? 18.052  38.268 5.622   1.00 53.20 ? 1065 HOH B O   1 
HETATM 3440 O O   . HOH E 3 .   ? 4.189   51.408 3.057   1.00 50.74 ? 1066 HOH B O   1 
HETATM 3441 O O   . HOH E 3 .   ? -2.274  39.454 16.394  1.00 69.16 ? 1067 HOH B O   1 
HETATM 3442 O O   . HOH E 3 .   ? 42.914  62.624 17.743  1.00 52.11 ? 1068 HOH B O   1 
HETATM 3443 O O   . HOH E 3 .   ? 29.640  52.074 26.668  1.00 60.56 ? 1069 HOH B O   1 
HETATM 3444 O O   . HOH E 3 .   ? 26.551  56.235 -4.960  1.00 54.18 ? 1070 HOH B O   1 
HETATM 3445 O O   . HOH E 3 .   ? 27.251  51.322 25.998  1.00 55.14 ? 1071 HOH B O   1 
HETATM 3446 O O   . HOH E 3 .   ? 27.748  59.232 -1.041  1.00 51.70 ? 1072 HOH B O   1 
HETATM 3447 O O   . HOH E 3 .   ? 4.852   35.680 8.456   1.00 59.49 ? 1073 HOH B O   1 
HETATM 3448 O O   . HOH E 3 .   ? 44.263  65.743 7.587   1.00 51.60 ? 1074 HOH B O   1 
HETATM 3449 O O   . HOH E 3 .   ? 10.385  62.226 9.162   1.00 52.88 ? 1075 HOH B O   1 
HETATM 3450 O O   . HOH E 3 .   ? 5.521   42.393 -10.698 1.00 46.90 ? 1076 HOH B O   1 
HETATM 3451 O O   . HOH E 3 .   ? 41.355  63.279 5.596   1.00 49.88 ? 1077 HOH B O   1 
HETATM 3452 O O   . HOH E 3 .   ? 7.241   36.598 9.145   1.00 54.15 ? 1078 HOH B O   1 
HETATM 3453 O O   . HOH E 3 .   ? 26.199  40.496 -1.014  1.00 69.19 ? 1079 HOH B O   1 
HETATM 3454 O O   . HOH E 3 .   ? -0.674  36.683 -8.736  1.00 52.67 ? 1080 HOH B O   1 
HETATM 3455 O O   . HOH E 3 .   ? 48.425  54.876 7.044   1.00 50.68 ? 1081 HOH B O   1 
HETATM 3456 O O   . HOH E 3 .   ? -9.438  46.374 -8.814  1.00 50.70 ? 1082 HOH B O   1 
HETATM 3457 O O   . HOH E 3 .   ? 8.644   37.060 11.282  1.00 61.99 ? 1083 HOH B O   1 
HETATM 3458 O O   . HOH E 3 .   ? 15.484  49.682 20.358  1.00 51.01 ? 1084 HOH B O   1 
HETATM 3459 O O   . HOH E 3 .   ? 20.298  59.060 -3.150  1.00 50.03 ? 1085 HOH B O   1 
HETATM 3460 O O   . HOH E 3 .   ? 22.906  51.262 -2.317  1.00 45.25 ? 1086 HOH B O   1 
HETATM 3461 O O   . HOH E 3 .   ? 22.467  35.217 -1.219  1.00 53.35 ? 1087 HOH B O   1 
HETATM 3462 O O   . HOH E 3 .   ? 11.690  67.798 12.759  1.00 59.91 ? 1088 HOH B O   1 
HETATM 3463 O O   . HOH E 3 .   ? -7.423  45.320 11.365  1.00 62.08 ? 1089 HOH B O   1 
HETATM 3464 O O   . HOH E 3 .   ? 25.538  68.750 7.385   1.00 50.36 ? 1090 HOH B O   1 
HETATM 3465 O O   . HOH E 3 .   ? 26.887  79.746 7.679   1.00 56.35 ? 1091 HOH B O   1 
HETATM 3466 O O   . HOH E 3 .   ? 33.391  45.942 -3.078  1.00 70.14 ? 1092 HOH B O   1 
HETATM 3467 O O   . HOH E 3 .   ? 11.195  49.058 8.496   1.00 30.52 ? 1093 HOH B O   1 
HETATM 3468 O O   . HOH E 3 .   ? 8.843   49.682 10.680  1.00 38.79 ? 1094 HOH B O   1 
HETATM 3469 O O   . HOH E 3 .   ? 32.830  53.390 25.758  1.00 39.60 ? 1095 HOH B O   1 
HETATM 3470 O O   . HOH E 3 .   ? 34.056  49.189 20.966  1.00 31.75 ? 1096 HOH B O   1 
HETATM 3471 O O   . HOH E 3 .   ? 11.259  50.416 15.170  1.00 50.68 ? 1097 HOH B O   1 
HETATM 3472 O O   . HOH E 3 .   ? 9.451   47.115 15.159  1.00 47.60 ? 1098 HOH B O   1 
HETATM 3473 O O   . HOH E 3 .   ? 23.780  57.059 -6.141  1.00 69.66 ? 1099 HOH B O   1 
HETATM 3474 O O   . HOH E 3 .   ? 22.256  41.139 -4.722  1.00 59.89 ? 1100 HOH B O   1 
HETATM 3475 O O   . HOH E 3 .   ? -6.817  33.592 -4.873  1.00 55.96 ? 1101 HOH B O   1 
HETATM 3476 O O   . HOH E 3 .   ? -7.260  42.743 -5.697  1.00 72.56 ? 1102 HOH B O   1 
HETATM 3477 O O   . HOH E 3 .   ? 40.633  50.720 -6.326  1.00 40.72 ? 1103 HOH B O   1 
HETATM 3478 O O   . HOH E 3 .   ? 28.101  71.796 13.361  1.00 48.69 ? 1104 HOH B O   1 
HETATM 3479 O O   . HOH E 3 .   ? 13.801  48.827 14.886  1.00 52.21 ? 1105 HOH B O   1 
HETATM 3480 O O   . HOH E 3 .   ? 20.493  44.063 17.598  1.00 52.07 ? 1106 HOH B O   1 
HETATM 3481 O O   . HOH E 3 .   ? 19.901  39.774 4.739   1.00 61.92 ? 1107 HOH B O   1 
HETATM 3482 O O   . HOH E 3 .   ? 24.810  39.256 7.456   1.00 57.49 ? 1108 HOH B O   1 
HETATM 3483 O O   . HOH E 3 .   ? 39.353  63.019 17.385  1.00 46.79 ? 1109 HOH B O   1 
HETATM 3484 O O   . HOH E 3 .   ? 17.090  51.182 24.238  1.00 45.97 ? 1110 HOH B O   1 
HETATM 3485 O O   . HOH E 3 .   ? 6.097   52.580 7.605   1.00 41.90 ? 1111 HOH B O   1 
HETATM 3486 O O   . HOH E 3 .   ? 24.647  53.108 -1.150  1.00 50.76 ? 1112 HOH B O   1 
HETATM 3487 O O   . HOH E 3 .   ? 14.701  39.309 -11.675 1.00 37.91 ? 1113 HOH B O   1 
HETATM 3488 O O   . HOH E 3 .   ? 33.478  55.944 13.947  1.00 20.89 ? 1114 HOH B O   1 
HETATM 3489 O O   . HOH E 3 .   ? 26.625  48.927 24.894  1.00 55.78 ? 1115 HOH B O   1 
HETATM 3490 O O   . HOH E 3 .   ? 21.597  64.963 23.962  1.00 57.92 ? 1116 HOH B O   1 
HETATM 3491 O O   . HOH E 3 .   ? 47.983  53.644 10.894  1.00 52.36 ? 1117 HOH B O   1 
HETATM 3492 O O   . HOH E 3 .   ? -8.101  45.628 -6.745  1.00 54.98 ? 1118 HOH B O   1 
HETATM 3493 O O   . HOH E 3 .   ? 21.331  38.847 6.795   1.00 72.66 ? 1119 HOH B O   1 
HETATM 3494 O O   . HOH E 3 .   ? 17.087  52.036 -6.203  1.00 55.50 ? 1120 HOH B O   1 
HETATM 3495 O O   . HOH E 3 .   ? 26.378  40.474 4.028   1.00 46.93 ? 1121 HOH B O   1 
HETATM 3496 O O   . HOH E 3 .   ? 13.978  65.969 16.359  1.00 49.30 ? 1122 HOH B O   1 
HETATM 3497 O O   . HOH E 3 .   ? 30.409  40.848 16.989  1.00 54.36 ? 1123 HOH B O   1 
HETATM 3498 O O   . HOH E 3 .   ? 23.828  32.811 -14.324 1.00 50.98 ? 1124 HOH B O   1 
HETATM 3499 O O   . HOH E 3 .   ? 14.678  43.831 -8.314  1.00 54.75 ? 1125 HOH B O   1 
HETATM 3500 O O   . HOH E 3 .   ? 2.991   42.681 -9.332  1.00 46.33 ? 1126 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   ALA 4   4   4   ALA ALA A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  MET 12  12  12  MET MET A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  GLN 20  20  20  GLN GLN A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  MET 27  27  27  MET MET A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  TYR 38  38  38  TYR TYR A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  HIS 45  45  45  HIS HIS A . n 
A 1 46  ILE 46  46  46  ILE ILE A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  TYR 52  52  52  TYR TYR A . n 
A 1 53  ASP 53  53  53  ASP ASP A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  MET 66  66  66  MET MET A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  LYS 69  69  69  LYS LYS A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  HIS 88  88  88  HIS HIS A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  THR 91  91  91  THR THR A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  CYS 98  98  98  CYS CYS A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 MET 108 108 108 MET MET A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 SER 130 130 130 SER SER A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 ALA 138 138 138 ALA ALA A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 CYS 141 141 141 CYS CYS A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 LYS 143 143 143 LYS LYS A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 ASN 146 146 146 ASN ASN A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 MET 153 153 153 MET MET A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 LYS 156 156 156 LYS LYS A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 CYS 163 163 163 CYS CYS A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 SER 188 188 188 SER SER A . n 
A 1 189 ASN 189 189 189 ASN ASN A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 PHE 205 205 205 PHE PHE A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 MET 212 212 212 MET MET A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 LYS 216 216 216 LYS LYS A . n 
B 1 1   ASP 1   1   1   ASP ASP B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   ALA 3   3   3   ALA ALA B . n 
B 1 4   ALA 4   4   4   ALA ALA B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   THR 8   8   8   THR THR B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  MET 12  12  12  MET MET B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  ILE 14  14  14  ILE ILE B . n 
B 1 15  LYS 15  15  15  LYS LYS B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  SER 17  17  17  SER SER B . n 
B 1 18  ASP 18  18  18  ASP ASP B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  GLN 20  20  20  GLN GLN B . n 
B 1 21  PRO 21  21  21  PRO PRO B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  PRO 23  23  23  PRO PRO B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  MET 27  27  27  MET MET B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  SER 34  34  34  SER SER B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  TYR 38  38  38  TYR TYR B . n 
B 1 39  ILE 39  39  39  ILE ILE B . n 
B 1 40  THR 40  40  40  THR THR B . n 
B 1 41  ASP 41  41  41  ASP ASP B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  HIS 45  45  45  HIS HIS B . n 
B 1 46  ILE 46  46  46  ILE ILE B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  GLN 48  48  48  GLN GLN B . n 
B 1 49  GLY 49  49  49  GLY GLY B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  MET 51  51  51  MET MET B . n 
B 1 52  TYR 52  52  52  TYR TYR B . n 
B 1 53  ASP 53  53  53  ASP ASP B . n 
B 1 54  VAL 54  54  54  VAL VAL B . n 
B 1 55  SER 55  55  55  SER SER B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  ASN 61  61  61  ASN ASN B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  ASN 64  64  64  ASN ASN B . n 
B 1 65  LYS 65  65  65  LYS LYS B . n 
B 1 66  MET 66  66  66  MET MET B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  LYS 69  69  69  LYS LYS B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  GLU 75  75  75  GLU GLU B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  MET 78  78  78  MET MET B . n 
B 1 79  ILE 79  79  79  ILE ILE B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  TYR 81  81  81  TYR TYR B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  PRO 84  84  84  PRO PRO B . n 
B 1 85  GLN 85  85  85  GLN GLN B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  HIS 88  88  88  HIS HIS B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ILE 90  90  90  ILE ILE B . n 
B 1 91  THR 91  91  91  THR THR B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  PHE 93  93  93  PHE PHE B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  CYS 98  98  98  CYS CYS B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 CYS 101 101 101 CYS CYS B . n 
B 1 102 HIS 102 102 102 HIS HIS B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 HIS 105 105 105 HIS HIS B . n 
B 1 106 GLU 106 106 106 GLU GLU B . n 
B 1 107 GLN 107 107 107 GLN GLN B . n 
B 1 108 MET 108 108 108 MET MET B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 ASP 110 110 110 ASP ASP B . n 
B 1 111 TYR 111 111 111 TYR TYR B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 LEU 114 114 114 LEU LEU B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 THR 117 117 117 THR THR B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 TYR 120 120 120 TYR TYR B . n 
B 1 121 LEU 121 121 121 LEU LEU B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 ARG 125 125 125 ARG ARG B . n 
B 1 126 GLN 126 126 126 GLN GLN B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 SER 130 130 130 SER SER B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 LYS 134 134 134 LYS LYS B . n 
B 1 135 GLU 135 135 135 GLU GLU B . n 
B 1 136 MET 136 136 136 MET MET B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 ALA 138 138 138 ALA ALA B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 CYS 141 141 141 CYS CYS B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 LYS 143 143 143 LYS LYS B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 LYS 145 145 145 LYS LYS B . n 
B 1 146 ASN 146 146 146 ASN ASN B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 PHE 149 149 149 PHE PHE B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 ASP 151 151 151 ASP ASP B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 MET 153 153 153 MET MET B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 LYS 156 156 156 LYS LYS B . n 
B 1 157 SER 157 157 157 SER SER B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 ALA 159 159 159 ALA ALA B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 SER 162 162 162 SER SER B . n 
B 1 163 CYS 163 163 163 CYS CYS B . n 
B 1 164 ASP 164 164 164 ASP ASP B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 ILE 167 167 167 ILE ILE B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 HIS 170 170 170 HIS HIS B . n 
B 1 171 TYR 171 171 171 TYR TYR B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 VAL 179 179 179 VAL VAL B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 GLY 181 181 181 GLY GLY B . n 
B 1 182 THR 182 182 182 THR THR B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 ALA 184 184 184 ALA ALA B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 SER 188 188 188 SER SER B . n 
B 1 189 ASN 189 189 189 ASN ASN B . n 
B 1 190 GLY 190 190 190 GLY GLY B . n 
B 1 191 THR 191 191 191 THR THR B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 VAL 193 193 193 VAL VAL B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 TYR 196 196 196 TYR TYR B . n 
B 1 197 GLN 197 197 197 GLN GLN B . n 
B 1 198 PRO 198 198 198 PRO PRO B . n 
B 1 199 PRO 199 199 199 PRO PRO B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 GLU 201 201 201 GLU GLU B . n 
B 1 202 MET 202 202 202 MET MET B . n 
B 1 203 LYS 203 203 203 LYS LYS B . n 
B 1 204 GLU 204 204 204 GLU GLU B . n 
B 1 205 PHE 205 205 205 PHE PHE B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 ASP 207 207 207 ASP ASP B . n 
B 1 208 GLU 208 208 208 GLU GLU B . n 
B 1 209 HIS 209 209 209 HIS HIS B . n 
B 1 210 GLN 210 210 210 GLN GLN B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 MET 212 212 212 MET MET B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 LYS 216 216 216 LYS LYS B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1710  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  21350 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-08-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
SHARP     phasing          .   ? 3 
CNS       refinement       0.9 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 18  ? ? -179.25 127.44  
2 1 GLN A 85  ? ? -110.63 75.35   
3 1 ASP A 129 ? ? -102.27 68.69   
4 1 CYS A 163 ? ? -172.57 -174.25 
5 1 SER A 188 ? ? -59.73  -9.11   
6 1 SER A 214 ? ? -90.25  -83.97  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
3 water                                  HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MES 1   1001 1   MES MES B . 
D 3 HOH 1   217  1   HOH HOH A . 
D 3 HOH 2   218  4   HOH HOH A . 
D 3 HOH 3   219  6   HOH HOH A . 
D 3 HOH 4   220  11  HOH HOH A . 
D 3 HOH 5   221  12  HOH HOH A . 
D 3 HOH 6   222  15  HOH HOH A . 
D 3 HOH 7   223  18  HOH HOH A . 
D 3 HOH 8   224  20  HOH HOH A . 
D 3 HOH 9   225  26  HOH HOH A . 
D 3 HOH 10  226  29  HOH HOH A . 
D 3 HOH 11  227  31  HOH HOH A . 
D 3 HOH 12  228  35  HOH HOH A . 
D 3 HOH 13  229  36  HOH HOH A . 
D 3 HOH 14  230  50  HOH HOH A . 
D 3 HOH 15  231  52  HOH HOH A . 
D 3 HOH 16  232  54  HOH HOH A . 
D 3 HOH 17  233  57  HOH HOH A . 
D 3 HOH 18  234  59  HOH HOH A . 
D 3 HOH 19  235  60  HOH HOH A . 
D 3 HOH 20  236  61  HOH HOH A . 
D 3 HOH 21  237  62  HOH HOH A . 
D 3 HOH 22  238  63  HOH HOH A . 
D 3 HOH 23  239  64  HOH HOH A . 
D 3 HOH 24  240  66  HOH HOH A . 
D 3 HOH 25  241  70  HOH HOH A . 
D 3 HOH 26  242  71  HOH HOH A . 
D 3 HOH 27  243  79  HOH HOH A . 
D 3 HOH 28  244  80  HOH HOH A . 
D 3 HOH 29  245  83  HOH HOH A . 
D 3 HOH 30  246  87  HOH HOH A . 
D 3 HOH 31  247  90  HOH HOH A . 
D 3 HOH 32  248  93  HOH HOH A . 
D 3 HOH 33  249  95  HOH HOH A . 
D 3 HOH 34  250  97  HOH HOH A . 
D 3 HOH 35  251  98  HOH HOH A . 
D 3 HOH 36  252  99  HOH HOH A . 
D 3 HOH 37  253  100 HOH HOH A . 
D 3 HOH 38  254  102 HOH HOH A . 
D 3 HOH 39  255  105 HOH HOH A . 
D 3 HOH 40  256  106 HOH HOH A . 
D 3 HOH 41  257  107 HOH HOH A . 
D 3 HOH 42  258  109 HOH HOH A . 
D 3 HOH 43  259  112 HOH HOH A . 
D 3 HOH 44  260  115 HOH HOH A . 
D 3 HOH 45  261  116 HOH HOH A . 
D 3 HOH 46  262  118 HOH HOH A . 
D 3 HOH 47  263  123 HOH HOH A . 
D 3 HOH 48  264  124 HOH HOH A . 
D 3 HOH 49  265  129 HOH HOH A . 
D 3 HOH 50  266  131 HOH HOH A . 
D 3 HOH 51  267  132 HOH HOH A . 
D 3 HOH 52  268  134 HOH HOH A . 
D 3 HOH 53  269  135 HOH HOH A . 
D 3 HOH 54  270  136 HOH HOH A . 
D 3 HOH 55  271  138 HOH HOH A . 
D 3 HOH 56  272  146 HOH HOH A . 
D 3 HOH 57  273  147 HOH HOH A . 
D 3 HOH 58  274  149 HOH HOH A . 
D 3 HOH 59  275  152 HOH HOH A . 
D 3 HOH 60  276  154 HOH HOH A . 
D 3 HOH 61  277  156 HOH HOH A . 
D 3 HOH 62  278  157 HOH HOH A . 
D 3 HOH 63  279  158 HOH HOH A . 
D 3 HOH 64  280  160 HOH HOH A . 
D 3 HOH 65  281  164 HOH HOH A . 
D 3 HOH 66  282  167 HOH HOH A . 
D 3 HOH 67  283  169 HOH HOH A . 
D 3 HOH 68  284  171 HOH HOH A . 
D 3 HOH 69  285  173 HOH HOH A . 
D 3 HOH 70  286  177 HOH HOH A . 
D 3 HOH 71  287  187 HOH HOH A . 
D 3 HOH 72  288  194 HOH HOH A . 
D 3 HOH 73  289  195 HOH HOH A . 
D 3 HOH 74  290  196 HOH HOH A . 
D 3 HOH 75  291  201 HOH HOH A . 
D 3 HOH 76  292  202 HOH HOH A . 
D 3 HOH 77  293  205 HOH HOH A . 
D 3 HOH 78  294  206 HOH HOH A . 
D 3 HOH 79  295  209 HOH HOH A . 
D 3 HOH 80  296  213 HOH HOH A . 
D 3 HOH 81  297  214 HOH HOH A . 
D 3 HOH 82  298  215 HOH HOH A . 
D 3 HOH 83  299  216 HOH HOH A . 
E 3 HOH 1   1002 2   HOH HOH B . 
E 3 HOH 2   1003 3   HOH HOH B . 
E 3 HOH 3   1004 5   HOH HOH B . 
E 3 HOH 4   1005 7   HOH HOH B . 
E 3 HOH 5   1006 8   HOH HOH B . 
E 3 HOH 6   1007 9   HOH HOH B . 
E 3 HOH 7   1008 10  HOH HOH B . 
E 3 HOH 8   1009 13  HOH HOH B . 
E 3 HOH 9   1010 14  HOH HOH B . 
E 3 HOH 10  1011 16  HOH HOH B . 
E 3 HOH 11  1012 17  HOH HOH B . 
E 3 HOH 12  1013 19  HOH HOH B . 
E 3 HOH 13  1014 21  HOH HOH B . 
E 3 HOH 14  1015 22  HOH HOH B . 
E 3 HOH 15  1016 23  HOH HOH B . 
E 3 HOH 16  1017 24  HOH HOH B . 
E 3 HOH 17  1018 25  HOH HOH B . 
E 3 HOH 18  1019 27  HOH HOH B . 
E 3 HOH 19  1020 28  HOH HOH B . 
E 3 HOH 20  1021 30  HOH HOH B . 
E 3 HOH 21  1022 32  HOH HOH B . 
E 3 HOH 22  1023 33  HOH HOH B . 
E 3 HOH 23  1024 34  HOH HOH B . 
E 3 HOH 24  1025 37  HOH HOH B . 
E 3 HOH 25  1026 38  HOH HOH B . 
E 3 HOH 26  1027 39  HOH HOH B . 
E 3 HOH 27  1028 40  HOH HOH B . 
E 3 HOH 28  1029 41  HOH HOH B . 
E 3 HOH 29  1030 42  HOH HOH B . 
E 3 HOH 30  1031 43  HOH HOH B . 
E 3 HOH 31  1032 44  HOH HOH B . 
E 3 HOH 32  1033 45  HOH HOH B . 
E 3 HOH 33  1034 46  HOH HOH B . 
E 3 HOH 34  1035 47  HOH HOH B . 
E 3 HOH 35  1036 48  HOH HOH B . 
E 3 HOH 36  1037 49  HOH HOH B . 
E 3 HOH 37  1038 51  HOH HOH B . 
E 3 HOH 38  1039 53  HOH HOH B . 
E 3 HOH 39  1040 55  HOH HOH B . 
E 3 HOH 40  1041 56  HOH HOH B . 
E 3 HOH 41  1042 58  HOH HOH B . 
E 3 HOH 42  1043 65  HOH HOH B . 
E 3 HOH 43  1044 67  HOH HOH B . 
E 3 HOH 44  1045 68  HOH HOH B . 
E 3 HOH 45  1046 69  HOH HOH B . 
E 3 HOH 46  1047 72  HOH HOH B . 
E 3 HOH 47  1048 73  HOH HOH B . 
E 3 HOH 48  1049 74  HOH HOH B . 
E 3 HOH 49  1050 75  HOH HOH B . 
E 3 HOH 50  1051 76  HOH HOH B . 
E 3 HOH 51  1052 77  HOH HOH B . 
E 3 HOH 52  1053 78  HOH HOH B . 
E 3 HOH 53  1054 81  HOH HOH B . 
E 3 HOH 54  1055 82  HOH HOH B . 
E 3 HOH 55  1056 84  HOH HOH B . 
E 3 HOH 56  1057 85  HOH HOH B . 
E 3 HOH 57  1058 86  HOH HOH B . 
E 3 HOH 58  1059 89  HOH HOH B . 
E 3 HOH 59  1060 91  HOH HOH B . 
E 3 HOH 60  1061 92  HOH HOH B . 
E 3 HOH 61  1062 94  HOH HOH B . 
E 3 HOH 62  1063 96  HOH HOH B . 
E 3 HOH 63  1064 101 HOH HOH B . 
E 3 HOH 64  1065 103 HOH HOH B . 
E 3 HOH 65  1066 104 HOH HOH B . 
E 3 HOH 66  1067 108 HOH HOH B . 
E 3 HOH 67  1068 110 HOH HOH B . 
E 3 HOH 68  1069 111 HOH HOH B . 
E 3 HOH 69  1070 113 HOH HOH B . 
E 3 HOH 70  1071 114 HOH HOH B . 
E 3 HOH 71  1072 117 HOH HOH B . 
E 3 HOH 72  1073 119 HOH HOH B . 
E 3 HOH 73  1074 120 HOH HOH B . 
E 3 HOH 74  1075 121 HOH HOH B . 
E 3 HOH 75  1076 122 HOH HOH B . 
E 3 HOH 76  1077 125 HOH HOH B . 
E 3 HOH 77  1078 126 HOH HOH B . 
E 3 HOH 78  1079 127 HOH HOH B . 
E 3 HOH 79  1080 130 HOH HOH B . 
E 3 HOH 80  1081 133 HOH HOH B . 
E 3 HOH 81  1082 137 HOH HOH B . 
E 3 HOH 82  1083 139 HOH HOH B . 
E 3 HOH 83  1084 140 HOH HOH B . 
E 3 HOH 84  1085 141 HOH HOH B . 
E 3 HOH 85  1086 142 HOH HOH B . 
E 3 HOH 86  1087 144 HOH HOH B . 
E 3 HOH 87  1088 148 HOH HOH B . 
E 3 HOH 88  1089 150 HOH HOH B . 
E 3 HOH 89  1090 151 HOH HOH B . 
E 3 HOH 90  1091 153 HOH HOH B . 
E 3 HOH 91  1092 155 HOH HOH B . 
E 3 HOH 92  1093 159 HOH HOH B . 
E 3 HOH 93  1094 161 HOH HOH B . 
E 3 HOH 94  1095 162 HOH HOH B . 
E 3 HOH 95  1096 163 HOH HOH B . 
E 3 HOH 96  1097 165 HOH HOH B . 
E 3 HOH 97  1098 168 HOH HOH B . 
E 3 HOH 98  1099 170 HOH HOH B . 
E 3 HOH 99  1100 172 HOH HOH B . 
E 3 HOH 100 1101 174 HOH HOH B . 
E 3 HOH 101 1102 175 HOH HOH B . 
E 3 HOH 102 1103 176 HOH HOH B . 
E 3 HOH 103 1104 178 HOH HOH B . 
E 3 HOH 104 1105 179 HOH HOH B . 
E 3 HOH 105 1106 180 HOH HOH B . 
E 3 HOH 106 1107 181 HOH HOH B . 
E 3 HOH 107 1108 182 HOH HOH B . 
E 3 HOH 108 1109 183 HOH HOH B . 
E 3 HOH 109 1110 186 HOH HOH B . 
E 3 HOH 110 1111 188 HOH HOH B . 
E 3 HOH 111 1112 189 HOH HOH B . 
E 3 HOH 112 1113 190 HOH HOH B . 
E 3 HOH 113 1114 192 HOH HOH B . 
E 3 HOH 114 1115 193 HOH HOH B . 
E 3 HOH 115 1116 197 HOH HOH B . 
E 3 HOH 116 1117 198 HOH HOH B . 
E 3 HOH 117 1118 199 HOH HOH B . 
E 3 HOH 118 1119 200 HOH HOH B . 
E 3 HOH 119 1120 203 HOH HOH B . 
E 3 HOH 120 1121 204 HOH HOH B . 
E 3 HOH 121 1122 207 HOH HOH B . 
E 3 HOH 122 1123 208 HOH HOH B . 
E 3 HOH 123 1124 210 HOH HOH B . 
E 3 HOH 124 1125 211 HOH HOH B . 
E 3 HOH 125 1126 217 HOH HOH B . 
#