data_1EF1
# 
_entry.id   1EF1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1EF1         
RCSB  RCSB010513   
WWPDB D_1000010513 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1EF1 
_pdbx_database_status.recvd_initial_deposition_date   2000-02-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pearson, M.A.' 1 
'Reczek, D.'    2 
'Bretscher, A.' 3 
'Karplus, P.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            101 
_citation.page_first                259 
_citation.page_last                 270 
_citation.year                      2000 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10847681 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)80836-3' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pearson, M.A.' 1 
primary 'Reczek, D.'    2 
primary 'Bretscher, A.' 3 
primary 'Karplus, P.A.' 4 
# 
_cell.entry_id           1EF1 
_cell.length_a           54.200 
_cell.length_b           153.300 
_cell.length_c           112.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1EF1 
_symmetry.space_group_name_H-M             'P 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                17 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man MOESIN        34846.328 2   ? ? 'N-TERMINAL FERM DOMAIN' ? 
2 polymer     man MOESIN        10569.288 2   ? ? 'C-TERMINAL TAIL DOMAIN' ? 
3 non-polymer syn 'SULFATE ION' 96.063    2   ? ? ?                        ? 
4 water       nat water         18.015    412 ? ? ?                        ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;TISVRVTT(MSE)DAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFK
FRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLE
QHKLNKDQWEERIQVWHEEHRG(MSE)LREDAVLEYLKIAQDLE(MSE)YGVNYFSIKNKKGSELWLGVDALGLNIYEQN
DRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALC(MSE)GNHELY(MSE)RRRKP
;
;TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESPLLFKFRAK
FYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKL
NKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWS
EIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP
;
A,B ? 
2 'polypeptide(L)' no yes 
;AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTAND(MSE)IHAEN(MSE)RLGRDKYKTL
RQIRQGNTKQRIDEFES(MSE)
;
;AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNT
KQRIDEFESM
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ILE n 
1 3   SER n 
1 4   VAL n 
1 5   ARG n 
1 6   VAL n 
1 7   THR n 
1 8   THR n 
1 9   MSE n 
1 10  ASP n 
1 11  ALA n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  PHE n 
1 16  ALA n 
1 17  ILE n 
1 18  GLN n 
1 19  PRO n 
1 20  ASN n 
1 21  THR n 
1 22  THR n 
1 23  GLY n 
1 24  LYS n 
1 25  GLN n 
1 26  LEU n 
1 27  PHE n 
1 28  ASP n 
1 29  GLN n 
1 30  VAL n 
1 31  VAL n 
1 32  LYS n 
1 33  THR n 
1 34  ILE n 
1 35  GLY n 
1 36  LEU n 
1 37  ARG n 
1 38  GLU n 
1 39  VAL n 
1 40  TRP n 
1 41  PHE n 
1 42  PHE n 
1 43  GLY n 
1 44  LEU n 
1 45  GLN n 
1 46  TYR n 
1 47  GLN n 
1 48  ASP n 
1 49  THR n 
1 50  LYS n 
1 51  GLY n 
1 52  PHE n 
1 53  SER n 
1 54  THR n 
1 55  TRP n 
1 56  LEU n 
1 57  LYS n 
1 58  LEU n 
1 59  ASN n 
1 60  LYS n 
1 61  LYS n 
1 62  VAL n 
1 63  THR n 
1 64  ALA n 
1 65  GLN n 
1 66  ASP n 
1 67  VAL n 
1 68  ARG n 
1 69  LYS n 
1 70  GLU n 
1 71  SER n 
1 72  PRO n 
1 73  LEU n 
1 74  LEU n 
1 75  PHE n 
1 76  LYS n 
1 77  PHE n 
1 78  ARG n 
1 79  ALA n 
1 80  LYS n 
1 81  PHE n 
1 82  TYR n 
1 83  PRO n 
1 84  GLU n 
1 85  ASP n 
1 86  VAL n 
1 87  SER n 
1 88  GLU n 
1 89  GLU n 
1 90  LEU n 
1 91  ILE n 
1 92  GLN n 
1 93  ASP n 
1 94  ILE n 
1 95  THR n 
1 96  GLN n 
1 97  ARG n 
1 98  LEU n 
1 99  PHE n 
1 100 PHE n 
1 101 LEU n 
1 102 GLN n 
1 103 VAL n 
1 104 LYS n 
1 105 GLU n 
1 106 GLY n 
1 107 ILE n 
1 108 LEU n 
1 109 ASN n 
1 110 ASP n 
1 111 ASP n 
1 112 ILE n 
1 113 TYR n 
1 114 CYS n 
1 115 PRO n 
1 116 PRO n 
1 117 GLU n 
1 118 THR n 
1 119 ALA n 
1 120 VAL n 
1 121 LEU n 
1 122 LEU n 
1 123 ALA n 
1 124 SER n 
1 125 TYR n 
1 126 ALA n 
1 127 VAL n 
1 128 GLN n 
1 129 SER n 
1 130 LYS n 
1 131 TYR n 
1 132 GLY n 
1 133 ASP n 
1 134 PHE n 
1 135 ASN n 
1 136 LYS n 
1 137 GLU n 
1 138 VAL n 
1 139 HIS n 
1 140 LYS n 
1 141 SER n 
1 142 GLY n 
1 143 TYR n 
1 144 LEU n 
1 145 ALA n 
1 146 GLY n 
1 147 ASP n 
1 148 LYS n 
1 149 LEU n 
1 150 LEU n 
1 151 PRO n 
1 152 GLN n 
1 153 ARG n 
1 154 VAL n 
1 155 LEU n 
1 156 GLU n 
1 157 GLN n 
1 158 HIS n 
1 159 LYS n 
1 160 LEU n 
1 161 ASN n 
1 162 LYS n 
1 163 ASP n 
1 164 GLN n 
1 165 TRP n 
1 166 GLU n 
1 167 GLU n 
1 168 ARG n 
1 169 ILE n 
1 170 GLN n 
1 171 VAL n 
1 172 TRP n 
1 173 HIS n 
1 174 GLU n 
1 175 GLU n 
1 176 HIS n 
1 177 ARG n 
1 178 GLY n 
1 179 MSE n 
1 180 LEU n 
1 181 ARG n 
1 182 GLU n 
1 183 ASP n 
1 184 ALA n 
1 185 VAL n 
1 186 LEU n 
1 187 GLU n 
1 188 TYR n 
1 189 LEU n 
1 190 LYS n 
1 191 ILE n 
1 192 ALA n 
1 193 GLN n 
1 194 ASP n 
1 195 LEU n 
1 196 GLU n 
1 197 MSE n 
1 198 TYR n 
1 199 GLY n 
1 200 VAL n 
1 201 ASN n 
1 202 TYR n 
1 203 PHE n 
1 204 SER n 
1 205 ILE n 
1 206 LYS n 
1 207 ASN n 
1 208 LYS n 
1 209 LYS n 
1 210 GLY n 
1 211 SER n 
1 212 GLU n 
1 213 LEU n 
1 214 TRP n 
1 215 LEU n 
1 216 GLY n 
1 217 VAL n 
1 218 ASP n 
1 219 ALA n 
1 220 LEU n 
1 221 GLY n 
1 222 LEU n 
1 223 ASN n 
1 224 ILE n 
1 225 TYR n 
1 226 GLU n 
1 227 GLN n 
1 228 ASN n 
1 229 ASP n 
1 230 ARG n 
1 231 LEU n 
1 232 THR n 
1 233 PRO n 
1 234 LYS n 
1 235 ILE n 
1 236 GLY n 
1 237 PHE n 
1 238 PRO n 
1 239 TRP n 
1 240 SER n 
1 241 GLU n 
1 242 ILE n 
1 243 ARG n 
1 244 ASN n 
1 245 ILE n 
1 246 SER n 
1 247 PHE n 
1 248 ASN n 
1 249 ASP n 
1 250 LYS n 
1 251 LYS n 
1 252 PHE n 
1 253 VAL n 
1 254 ILE n 
1 255 LYS n 
1 256 PRO n 
1 257 ILE n 
1 258 ASP n 
1 259 LYS n 
1 260 LYS n 
1 261 ALA n 
1 262 PRO n 
1 263 ASP n 
1 264 PHE n 
1 265 VAL n 
1 266 PHE n 
1 267 TYR n 
1 268 ALA n 
1 269 PRO n 
1 270 ARG n 
1 271 LEU n 
1 272 ARG n 
1 273 ILE n 
1 274 ASN n 
1 275 LYS n 
1 276 ARG n 
1 277 ILE n 
1 278 LEU n 
1 279 ALA n 
1 280 LEU n 
1 281 CYS n 
1 282 MSE n 
1 283 GLY n 
1 284 ASN n 
1 285 HIS n 
1 286 GLU n 
1 287 LEU n 
1 288 TYR n 
1 289 MSE n 
1 290 ARG n 
1 291 ARG n 
1 292 ARG n 
1 293 LYS n 
1 294 PRO n 
2 1   ALA n 
2 2   GLU n 
2 3   ALA n 
2 4   SER n 
2 5   ALA n 
2 6   ASP n 
2 7   LEU n 
2 8   ARG n 
2 9   ALA n 
2 10  ASP n 
2 11  ALA n 
2 12  MET n 
2 13  ALA n 
2 14  LYS n 
2 15  ASP n 
2 16  ARG n 
2 17  SER n 
2 18  GLU n 
2 19  GLU n 
2 20  GLU n 
2 21  ARG n 
2 22  THR n 
2 23  THR n 
2 24  GLU n 
2 25  ALA n 
2 26  GLU n 
2 27  LYS n 
2 28  ASN n 
2 29  GLU n 
2 30  ARG n 
2 31  VAL n 
2 32  GLN n 
2 33  LYS n 
2 34  HIS n 
2 35  LEU n 
2 36  LYS n 
2 37  ALA n 
2 38  LEU n 
2 39  THR n 
2 40  SER n 
2 41  GLU n 
2 42  LEU n 
2 43  ALA n 
2 44  ASN n 
2 45  ALA n 
2 46  ARG n 
2 47  ASP n 
2 48  GLU n 
2 49  SER n 
2 50  LYS n 
2 51  LYS n 
2 52  THR n 
2 53  ALA n 
2 54  ASN n 
2 55  ASP n 
2 56  MSE n 
2 57  ILE n 
2 58  HIS n 
2 59  ALA n 
2 60  GLU n 
2 61  ASN n 
2 62  MSE n 
2 63  ARG n 
2 64  LEU n 
2 65  GLY n 
2 66  ARG n 
2 67  ASP n 
2 68  LYS n 
2 69  TYR n 
2 70  LYS n 
2 71  THR n 
2 72  LEU n 
2 73  ARG n 
2 74  GLN n 
2 75  ILE n 
2 76  ARG n 
2 77  GLN n 
2 78  GLY n 
2 79  ASN n 
2 80  THR n 
2 81  LYS n 
2 82  GLN n 
2 83  ARG n 
2 84  ILE n 
2 85  ASP n 
2 86  GLU n 
2 87  PHE n 
2 88  GLU n 
2 89  SER n 
2 90  MSE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP MOES_HUMAN P26038 1 3   ? ? 
2 UNP MOES_HUMAN P26038 2 487 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1EF1 A 1 ? 294 ? P26038 3   ? 296 ? 4   297 
2 2 1EF1 C 1 ? 90  ? P26038 487 ? 576 ? 488 577 
3 1 1EF1 B 1 ? 294 ? P26038 3   ? 296 ? 4   297 
4 2 1EF1 D 1 ? 90  ? P26038 487 ? 576 ? 488 577 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1EF1 MSE A 9   ? UNP P26038 MET 11  'MODIFIED RESIDUE' 12  1  
1 1EF1 MSE A 179 ? UNP P26038 MET 181 'MODIFIED RESIDUE' 182 2  
1 1EF1 MSE A 197 ? UNP P26038 MET 199 'MODIFIED RESIDUE' 200 3  
1 1EF1 MSE A 282 ? UNP P26038 MET 184 'MODIFIED RESIDUE' 285 4  
1 1EF1 MSE A 289 ? UNP P26038 MET 291 'MODIFIED RESIDUE' 292 5  
2 1EF1 MSE C 56  ? UNP P26038 MET 542 'MODIFIED RESIDUE' 543 6  
2 1EF1 MSE C 62  ? UNP P26038 MET 548 'MODIFIED RESIDUE' 549 7  
2 1EF1 MSE C 90  ? UNP P26038 MET 576 'MODIFIED RESIDUE' 577 8  
3 1EF1 MSE B 9   ? UNP P26038 MET 11  'MODIFIED RESIDUE' 12  9  
3 1EF1 MSE B 179 ? UNP P26038 MET 181 'MODIFIED RESIDUE' 182 10 
3 1EF1 MSE B 197 ? UNP P26038 MET 199 'MODIFIED RESIDUE' 200 11 
3 1EF1 MSE B 282 ? UNP P26038 MET 184 'MODIFIED RESIDUE' 285 12 
3 1EF1 MSE B 289 ? UNP P26038 MET 291 'MODIFIED RESIDUE' 292 13 
4 1EF1 MSE D 56  ? UNP P26038 MET 542 'MODIFIED RESIDUE' 543 14 
4 1EF1 MSE D 62  ? UNP P26038 MET 548 'MODIFIED RESIDUE' 549 15 
4 1EF1 MSE D 90  ? UNP P26038 MET 576 'MODIFIED RESIDUE' 577 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1EF1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   52.01 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    'PEG3350, lithium sulfate, HEPES, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 100 ? 1 
2 100 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 1998-03-15 ? 
2 CCD 'ADSC Q4'        1998-05-15 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'CHESS BEAMLINE F1' CHESS F1 0.918 ? 
2 SYNCHROTRON 'CHESS BEAMLINE F2' CHESS F2 ?     ? 
# 
_reflns.entry_id                     1EF1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.0 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   71584 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   92 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1EF1 
_refine.ls_number_reflns_obs                     66990 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2270000 
_refine.ls_R_factor_R_free                       0.2870000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3568 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6266 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             412 
_refine_hist.number_atoms_total               6688 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.7   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1EF1 
_struct.title                     'CRYSTAL STRUCTURE OF THE MOESIN FERM DOMAIN/TAIL DOMAIN COMPLEX' 
_struct.pdbx_descriptor           'CRYSTAL STRUCTURE OF THE MOESIN FERM DOMAIN/TAIL DOMAIN COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1EF1 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'membrane, FERM domain, Tail domain, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 22  ? GLY A 35  ? THR A 25  GLY A 38  1 ? 14 
HELX_P HELX_P2  2  GLU A 38  ? TRP A 40  ? GLU A 41  TRP A 43  5 ? 3  
HELX_P HELX_P3  3  VAL A 62  ? GLN A 65  ? VAL A 65  GLN A 68  5 ? 4  
HELX_P HELX_P4  4  ASP A 85  ? LEU A 90  ? ASP A 88  LEU A 93  1 ? 6  
HELX_P HELX_P5  5  GLN A 92  ? ASN A 109 ? GLN A 95  ASN A 112 1 ? 18 
HELX_P HELX_P6  6  PRO A 115 ? GLY A 132 ? PRO A 118 GLY A 135 1 ? 18 
HELX_P HELX_P7  7  PRO A 151 ? HIS A 158 ? PRO A 154 HIS A 161 1 ? 8  
HELX_P HELX_P8  8  ASN A 161 ? HIS A 176 ? ASN A 164 HIS A 179 1 ? 16 
HELX_P HELX_P9  9  LEU A 180 ? GLN A 193 ? LEU A 183 GLN A 196 1 ? 14 
HELX_P HELX_P10 10 ARG A 270 ? LYS A 293 ? ARG A 273 LYS A 296 1 ? 24 
HELX_P HELX_P11 11 ARG B 16  ? ARG B 21  ? ARG C 503 ARG C 508 5 ? 6  
HELX_P HELX_P12 12 THR B 23  ? ASN B 28  ? THR C 510 ASN C 515 1 ? 6  
HELX_P HELX_P13 13 ASN B 28  ? ASN B 44  ? ASN C 515 ASN C 531 1 ? 17 
HELX_P HELX_P14 14 THR B 52  ? LEU B 64  ? THR C 539 LEU C 551 1 ? 13 
HELX_P HELX_P15 15 ASP B 67  ? ARG B 76  ? ASP C 554 ARG C 563 1 ? 10 
HELX_P HELX_P16 16 ASN B 79  ? SER B 89  ? ASN C 566 SER C 576 1 ? 11 
HELX_P HELX_P17 17 THR C 22  ? GLY C 35  ? THR B 25  GLY B 38  1 ? 14 
HELX_P HELX_P18 18 GLU C 38  ? TRP C 40  ? GLU B 41  TRP B 43  5 ? 3  
HELX_P HELX_P19 19 ASP C 85  ? LEU C 90  ? ASP B 88  LEU B 93  1 ? 6  
HELX_P HELX_P20 20 GLN C 92  ? ASN C 109 ? GLN B 95  ASN B 112 1 ? 18 
HELX_P HELX_P21 21 PRO C 115 ? GLY C 132 ? PRO B 118 GLY B 135 1 ? 18 
HELX_P HELX_P22 22 PRO C 151 ? HIS C 158 ? PRO B 154 HIS B 161 1 ? 8  
HELX_P HELX_P23 23 ASN C 161 ? HIS C 176 ? ASN B 164 HIS B 179 1 ? 16 
HELX_P HELX_P24 24 LEU C 180 ? GLN C 193 ? LEU B 183 GLN B 196 1 ? 14 
HELX_P HELX_P25 25 ARG C 270 ? LYS C 293 ? ARG B 273 LYS B 296 1 ? 24 
HELX_P HELX_P26 26 ARG D 16  ? ARG D 21  ? ARG D 503 ARG D 508 5 ? 6  
HELX_P HELX_P27 27 THR D 23  ? ASN D 28  ? THR D 510 ASN D 515 1 ? 6  
HELX_P HELX_P28 28 ASN D 28  ? ASN D 44  ? ASN D 515 ASN D 531 1 ? 17 
HELX_P HELX_P29 29 THR D 52  ? LEU D 64  ? THR D 539 LEU D 551 1 ? 13 
HELX_P HELX_P30 30 ASP D 67  ? ARG D 76  ? ASP D 554 ARG D 563 1 ? 10 
HELX_P HELX_P31 31 ASN D 79  ? MSE D 90  ? ASN D 566 MSE D 577 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A THR 8   C ? ? ? 1_555 A MSE 9   N ? ? A THR 11  A MSE 12  1_555 ? ? ? ? ? ? ? 1.318 ? 
covale2  covale ? ? A MSE 9   C ? ? ? 1_555 A ASP 10  N ? ? A MSE 12  A ASP 13  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale3  covale ? ? A GLY 178 C ? ? ? 1_555 A MSE 179 N ? ? A GLY 181 A MSE 182 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4  covale ? ? A MSE 179 C ? ? ? 1_555 A LEU 180 N ? ? A MSE 182 A LEU 183 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale5  covale ? ? A GLU 196 C ? ? ? 1_555 A MSE 197 N ? ? A GLU 199 A MSE 200 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale6  covale ? ? A MSE 197 C ? ? ? 1_555 A TYR 198 N ? ? A MSE 200 A TYR 201 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale7  covale ? ? A CYS 281 C ? ? ? 1_555 A MSE 282 N ? ? A CYS 284 A MSE 285 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8  covale ? ? A MSE 282 C ? ? ? 1_555 A GLY 283 N ? ? A MSE 285 A GLY 286 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale9  covale ? ? A TYR 288 C ? ? ? 1_555 A MSE 289 N ? ? A TYR 291 A MSE 292 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale10 covale ? ? A MSE 289 C ? ? ? 1_555 A ARG 290 N ? ? A MSE 292 A ARG 293 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale11 covale ? ? C THR 8   C ? ? ? 1_555 C MSE 9   N ? ? B THR 11  B MSE 12  1_555 ? ? ? ? ? ? ? 1.323 ? 
covale12 covale ? ? C MSE 9   C ? ? ? 1_555 C ASP 10  N ? ? B MSE 12  B ASP 13  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale13 covale ? ? C GLY 178 C ? ? ? 1_555 C MSE 179 N ? ? B GLY 181 B MSE 182 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale14 covale ? ? C MSE 179 C ? ? ? 1_555 C LEU 180 N ? ? B MSE 182 B LEU 183 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale15 covale ? ? C GLU 196 C ? ? ? 1_555 C MSE 197 N ? ? B GLU 199 B MSE 200 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale16 covale ? ? C MSE 197 C ? ? ? 1_555 C TYR 198 N ? ? B MSE 200 B TYR 201 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale17 covale ? ? C CYS 281 C ? ? ? 1_555 C MSE 282 N ? ? B CYS 284 B MSE 285 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale18 covale ? ? C MSE 282 C ? ? ? 1_555 C GLY 283 N ? ? B MSE 285 B GLY 286 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale19 covale ? ? C TYR 288 C ? ? ? 1_555 C MSE 289 N ? ? B TYR 291 B MSE 292 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale20 covale ? ? C MSE 289 C ? ? ? 1_555 C ARG 290 N ? ? B MSE 292 B ARG 293 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale21 covale ? ? B ASP 55  C ? ? ? 1_555 B MSE 56  N ? ? C ASP 542 C MSE 543 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale22 covale ? ? B MSE 56  C ? ? ? 1_555 B ILE 57  N ? ? C MSE 543 C ILE 544 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale23 covale ? ? B ASN 61  C ? ? ? 1_555 B MSE 62  N ? ? C ASN 548 C MSE 549 1_555 ? ? ? ? ? ? ? 1.344 ? 
covale24 covale ? ? B MSE 62  C ? ? ? 1_555 B ARG 63  N ? ? C MSE 549 C ARG 550 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale25 covale ? ? B SER 89  C ? ? ? 1_555 B MSE 90  N ? ? C SER 576 C MSE 577 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale26 covale ? ? D ASP 55  C ? ? ? 1_555 D MSE 56  N ? ? D ASP 542 D MSE 543 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale27 covale ? ? D MSE 56  C ? ? ? 1_555 D ILE 57  N ? ? D MSE 543 D ILE 544 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale28 covale ? ? D ASN 61  C ? ? ? 1_555 D MSE 62  N ? ? D ASN 548 D MSE 549 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale29 covale ? ? D MSE 62  C ? ? ? 1_555 D ARG 63  N ? ? D MSE 549 D ARG 550 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale30 covale ? ? D SER 89  C ? ? ? 1_555 D MSE 90  N ? ? D SER 576 D MSE 577 1_555 ? ? ? ? ? ? ? 1.335 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 71 A . ? SER 74 A PRO 72 A ? PRO 75 A 1 -0.20 
2 SER 71 C . ? SER 74 B PRO 72 C ? PRO 75 B 1 -0.72 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 3 ? 
D ? 5 ? 
E ? 4 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 11  ? ILE A 17  ? ALA A 14  ILE A 20  
A 2 ILE A 2   ? THR A 8   ? ILE A 5   THR A 11  
A 3 LEU A 73  ? ALA A 79  ? LEU A 76  ALA A 82  
A 4 PHE A 42  ? GLN A 47  ? PHE A 45  GLN A 50  
A 5 SER A 53  ? TRP A 55  ? SER A 56  TRP A 58  
B 1 ASN A 201 ? LYS A 206 ? ASN A 204 LYS A 209 
B 2 GLU A 212 ? ASP A 218 ? GLU A 215 ASP A 221 
B 3 GLY A 221 ? GLU A 226 ? GLY A 224 GLU A 229 
B 4 ILE A 235 ? PRO A 238 ? ILE A 238 PRO A 241 
C 1 ILE A 242 ? ASN A 248 ? ILE A 245 ASN A 251 
C 2 LYS A 251 ? PRO A 256 ? LYS A 254 PRO A 259 
C 3 PHE A 264 ? TYR A 267 ? PHE A 267 TYR A 270 
D 1 GLU C 12  ? ILE C 17  ? GLU B 15  ILE B 20  
D 2 ILE C 2   ? THR C 7   ? ILE B 5   THR B 10  
D 3 LEU C 73  ? ALA C 79  ? LEU B 76  ALA B 82  
D 4 PHE C 42  ? GLN C 47  ? PHE B 45  GLN B 50  
D 5 SER C 53  ? TRP C 55  ? SER B 56  TRP B 58  
E 1 ASN C 201 ? LYS C 206 ? ASN B 204 LYS B 209 
E 2 GLU C 212 ? ASP C 218 ? GLU B 215 ASP B 221 
E 3 GLY C 221 ? GLU C 226 ? GLY B 224 GLU B 229 
E 4 ILE C 235 ? PRO C 238 ? ILE B 238 PRO B 241 
F 1 ILE C 242 ? ASN C 248 ? ILE B 245 ASN B 251 
F 2 LYS C 251 ? PRO C 256 ? LYS B 254 PRO B 259 
F 3 PHE C 264 ? TYR C 267 ? PHE B 267 TYR B 270 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 17  ? O ILE A 20  N ILE A 2   ? N ILE A 5   
A 2 3 N ARG A 5   ? N ARG A 8   O LEU A 73  ? O LEU A 76  
A 3 4 O ARG A 78  ? O ARG A 81  N GLY A 43  ? N GLY A 46  
A 4 5 O TYR A 46  ? O TYR A 49  N THR A 54  ? N THR A 57  
B 1 2 O ILE A 205 ? O ILE A 208 N LEU A 213 ? N LEU A 216 
B 2 3 N ASP A 218 ? N ASP A 221 O GLY A 221 ? O GLY A 224 
B 3 4 N ILE A 224 ? N ILE A 227 O ILE A 235 ? O ILE A 238 
C 1 2 N ASN A 248 ? N ASN A 251 O LYS A 251 ? O LYS A 254 
C 2 3 N ILE A 254 ? N ILE A 257 O PHE A 264 ? O PHE A 267 
D 1 2 O ILE C 17  ? O ILE B 20  N ILE C 2   ? N ILE B 5   
D 2 3 N ARG C 5   ? N ARG B 8   O LEU C 73  ? O LEU B 76  
D 3 4 O ARG C 78  ? O ARG B 81  N GLY C 43  ? N GLY B 46  
D 4 5 O TYR C 46  ? O TYR B 49  N THR C 54  ? N THR B 57  
E 1 2 O ILE C 205 ? O ILE B 208 N LEU C 213 ? N LEU B 216 
E 2 3 N ASP C 218 ? N ASP B 221 O GLY C 221 ? O GLY B 224 
E 3 4 N ILE C 224 ? N ILE B 227 O ILE C 235 ? O ILE B 238 
F 1 2 N ASN C 248 ? N ASN B 251 O LYS C 251 ? O LYS B 254 
F 2 3 O ILE C 254 ? O ILE B 257 N PHE C 264 ? N PHE B 267 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 2001' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 3001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLN A 92 ? GLN A 95   . ? 1_555 ? 
2  AC1 6 GLN A 92 ? GLN A 95   . ? 4_576 ? 
3  AC1 6 ASP A 93 ? ASP A 96   . ? 1_555 ? 
4  AC1 6 ASP A 93 ? ASP A 96   . ? 4_576 ? 
5  AC1 6 HOH G .  ? HOH A 726  . ? 1_555 ? 
6  AC1 6 HOH G .  ? HOH A 726  . ? 4_576 ? 
7  AC2 7 GLN C 92 ? GLN B 95   . ? 4_566 ? 
8  AC2 7 GLN C 92 ? GLN B 95   . ? 1_555 ? 
9  AC2 7 ASP C 93 ? ASP B 96   . ? 1_555 ? 
10 AC2 7 ASP C 93 ? ASP B 96   . ? 4_566 ? 
11 AC2 7 ILE C 94 ? ILE B 97   . ? 1_555 ? 
12 AC2 7 HOH I .  ? HOH B 1726 . ? 1_555 ? 
13 AC2 7 HOH I .  ? HOH B 1726 . ? 4_566 ? 
# 
_database_PDB_matrix.entry_id          1EF1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1EF1 
_atom_sites.fract_transf_matrix[1][1]   0.018450 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006523 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008921 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 1   ? 49.340 140.379 86.242 1.00 63.00  ? 4    THR A N   1 
ATOM   2    C  CA  . THR A 1 1   ? 48.820 140.398 84.838 1.00 63.62  ? 4    THR A CA  1 
ATOM   3    C  C   . THR A 1 1   ? 48.882 139.055 84.064 1.00 61.92  ? 4    THR A C   1 
ATOM   4    O  O   . THR A 1 1   ? 49.750 138.190 84.268 1.00 54.52  ? 4    THR A O   1 
ATOM   5    C  CB  . THR A 1 1   ? 49.450 141.557 83.951 1.00 65.43  ? 4    THR A CB  1 
ATOM   6    O  OG1 . THR A 1 1   ? 50.853 141.344 83.728 1.00 60.04  ? 4    THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 1   ? 49.228 142.911 84.596 1.00 60.91  ? 4    THR A CG2 1 
ATOM   8    N  N   . ILE A 1 2   ? 47.933 138.927 83.146 1.00 59.93  ? 5    ILE A N   1 
ATOM   9    C  CA  . ILE A 1 2   ? 47.763 137.759 82.301 1.00 52.66  ? 5    ILE A CA  1 
ATOM   10   C  C   . ILE A 1 2   ? 48.300 138.041 80.882 1.00 49.07  ? 5    ILE A C   1 
ATOM   11   O  O   . ILE A 1 2   ? 47.885 138.988 80.195 1.00 42.78  ? 5    ILE A O   1 
ATOM   12   C  CB  . ILE A 1 2   ? 46.270 137.393 82.233 1.00 48.46  ? 5    ILE A CB  1 
ATOM   13   C  CG1 . ILE A 1 2   ? 45.686 137.473 83.642 1.00 44.92  ? 5    ILE A CG1 1 
ATOM   14   C  CG2 . ILE A 1 2   ? 46.085 135.963 81.675 1.00 46.41  ? 5    ILE A CG2 1 
ATOM   15   C  CD1 . ILE A 1 2   ? 44.228 137.225 83.718 1.00 46.52  ? 5    ILE A CD1 1 
ATOM   16   N  N   . SER A 1 3   ? 49.222 137.184 80.466 1.00 44.18  ? 6    SER A N   1 
ATOM   17   C  CA  . SER A 1 3   ? 49.869 137.288 79.180 1.00 44.49  ? 6    SER A CA  1 
ATOM   18   C  C   . SER A 1 3   ? 48.894 136.897 78.093 1.00 44.48  ? 6    SER A C   1 
ATOM   19   O  O   . SER A 1 3   ? 48.199 135.898 78.225 1.00 42.88  ? 6    SER A O   1 
ATOM   20   C  CB  . SER A 1 3   ? 51.073 136.361 79.148 1.00 47.05  ? 6    SER A CB  1 
ATOM   21   O  OG  . SER A 1 3   ? 52.187 137.034 78.599 1.00 54.75  ? 6    SER A OG  1 
ATOM   22   N  N   . VAL A 1 4   ? 48.839 137.691 77.025 1.00 43.93  ? 7    VAL A N   1 
ATOM   23   C  CA  . VAL A 1 4   ? 47.929 137.417 75.913 1.00 40.92  ? 7    VAL A CA  1 
ATOM   24   C  C   . VAL A 1 4   ? 48.526 137.713 74.532 1.00 40.31  ? 7    VAL A C   1 
ATOM   25   O  O   . VAL A 1 4   ? 49.215 138.712 74.296 1.00 41.08  ? 7    VAL A O   1 
ATOM   26   C  CB  . VAL A 1 4   ? 46.552 138.167 76.056 1.00 34.10  ? 7    VAL A CB  1 
ATOM   27   C  CG1 . VAL A 1 4   ? 45.746 137.991 74.811 1.00 32.11  ? 7    VAL A CG1 1 
ATOM   28   C  CG2 . VAL A 1 4   ? 45.753 137.613 77.227 1.00 32.17  ? 7    VAL A CG2 1 
ATOM   29   N  N   . ARG A 1 5   ? 48.256 136.808 73.611 1.00 42.17  ? 8    ARG A N   1 
ATOM   30   C  CA  . ARG A 1 5   ? 48.734 136.960 72.261 1.00 41.14  ? 8    ARG A CA  1 
ATOM   31   C  C   . ARG A 1 5   ? 47.530 136.874 71.333 1.00 38.48  ? 8    ARG A C   1 
ATOM   32   O  O   . ARG A 1 5   ? 46.746 135.925 71.411 1.00 40.30  ? 8    ARG A O   1 
ATOM   33   C  CB  . ARG A 1 5   ? 49.716 135.859 71.929 1.00 38.40  ? 8    ARG A CB  1 
ATOM   34   C  CG  . ARG A 1 5   ? 50.242 135.981 70.541 1.00 40.53  ? 8    ARG A CG  1 
ATOM   35   C  CD  . ARG A 1 5   ? 51.186 134.860 70.255 1.00 47.25  ? 8    ARG A CD  1 
ATOM   36   N  NE  . ARG A 1 5   ? 52.448 135.032 70.959 1.00 46.35  ? 8    ARG A NE  1 
ATOM   37   C  CZ  . ARG A 1 5   ? 53.261 134.030 71.249 1.00 57.79  ? 8    ARG A CZ  1 
ATOM   38   N  NH1 . ARG A 1 5   ? 52.930 132.781 70.909 1.00 62.95  ? 8    ARG A NH1 1 
ATOM   39   N  NH2 . ARG A 1 5   ? 54.427 134.281 71.823 1.00 61.64  ? 8    ARG A NH2 1 
ATOM   40   N  N   . VAL A 1 6   ? 47.368 137.905 70.509 1.00 36.78  ? 9    VAL A N   1 
ATOM   41   C  CA  . VAL A 1 6   ? 46.282 137.979 69.538 1.00 33.04  ? 9    VAL A CA  1 
ATOM   42   C  C   . VAL A 1 6   ? 46.802 138.091 68.102 1.00 32.97  ? 9    VAL A C   1 
ATOM   43   O  O   . VAL A 1 6   ? 47.371 139.110 67.693 1.00 35.39  ? 9    VAL A O   1 
ATOM   44   C  CB  . VAL A 1 6   ? 45.328 139.175 69.800 1.00 28.38  ? 9    VAL A CB  1 
ATOM   45   C  CG1 . VAL A 1 6   ? 44.244 139.224 68.734 1.00 24.25  ? 9    VAL A CG1 1 
ATOM   46   C  CG2 . VAL A 1 6   ? 44.709 139.064 71.175 1.00 27.13  ? 9    VAL A CG2 1 
ATOM   47   N  N   . THR A 1 7   ? 46.557 137.030 67.342 1.00 29.69  ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 7   ? 46.938 136.950 65.952 1.00 27.22  ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 7   ? 45.836 137.227 64.953 1.00 25.31  ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 7   ? 44.804 136.557 64.994 1.00 25.19  ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 7   ? 47.449 135.578 65.663 1.00 27.32  ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 7   ? 48.415 135.274 66.656 1.00 31.20  ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 7   ? 48.100 135.534 64.293 1.00 30.47  ? 10   THR A CG2 1 
ATOM   54   N  N   . THR A 1 8   ? 46.074 138.234 64.092 1.00 28.53  ? 11   THR A N   1 
ATOM   55   C  CA  . THR A 1 8   ? 45.185 138.632 62.985 1.00 27.00  ? 11   THR A CA  1 
ATOM   56   C  C   . THR A 1 8   ? 45.698 137.841 61.760 1.00 23.29  ? 11   THR A C   1 
ATOM   57   O  O   . THR A 1 8   ? 46.655 137.106 61.860 1.00 27.32  ? 11   THR A O   1 
ATOM   58   C  CB  . THR A 1 8   ? 45.305 140.171 62.641 1.00 25.11  ? 11   THR A CB  1 
ATOM   59   O  OG1 . THR A 1 8   ? 46.576 140.455 62.037 1.00 27.54  ? 11   THR A OG1 1 
ATOM   60   C  CG2 . THR A 1 8   ? 45.156 141.016 63.869 1.00 27.98  ? 11   THR A CG2 1 
HETATM 61   N  N   . MSE A 1 9   ? 45.119 138.027 60.591 1.00 23.77  ? 12   MSE A N   1 
HETATM 62   C  CA  . MSE A 1 9   ? 45.603 137.297 59.422 1.00 25.65  ? 12   MSE A CA  1 
HETATM 63   C  C   . MSE A 1 9   ? 47.018 137.704 58.991 1.00 34.41  ? 12   MSE A C   1 
HETATM 64   O  O   . MSE A 1 9   ? 47.640 137.009 58.196 1.00 40.60  ? 12   MSE A O   1 
HETATM 65   C  CB  . MSE A 1 9   ? 44.653 137.501 58.232 1.00 23.11  ? 12   MSE A CB  1 
HETATM 66   C  CG  . MSE A 1 9   ? 43.296 136.807 58.327 1.00 29.00  ? 12   MSE A CG  1 
HETATM 67   SE SE  . MSE A 1 9   ? 43.457 134.885 58.567 1.00 41.01  ? 12   MSE A SE  1 
HETATM 68   C  CE  . MSE A 1 9   ? 44.521 134.471 56.949 1.00 28.20  ? 12   MSE A CE  1 
ATOM   69   N  N   . ASP A 1 10  ? 47.523 138.842 59.445 1.00 32.89  ? 13   ASP A N   1 
ATOM   70   C  CA  . ASP A 1 10  ? 48.873 139.219 59.044 1.00 28.28  ? 13   ASP A CA  1 
ATOM   71   C  C   . ASP A 1 10  ? 49.624 140.001 60.107 1.00 34.84  ? 13   ASP A C   1 
ATOM   72   O  O   . ASP A 1 10  ? 50.455 140.839 59.799 1.00 38.76  ? 13   ASP A O   1 
ATOM   73   C  CB  . ASP A 1 10  ? 48.820 140.020 57.760 1.00 32.04  ? 13   ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 10  ? 48.239 141.414 57.945 1.00 40.73  ? 13   ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 10  ? 47.624 141.715 58.991 1.00 44.11  ? 13   ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 10  ? 48.395 142.221 57.006 1.00 47.23  ? 13   ASP A OD2 1 
ATOM   77   N  N   . ALA A 1 11  ? 49.294 139.780 61.363 1.00 32.63  ? 14   ALA A N   1 
ATOM   78   C  CA  . ALA A 1 11  ? 49.980 140.512 62.409 1.00 39.08  ? 14   ALA A CA  1 
ATOM   79   C  C   . ALA A 1 11  ? 49.776 139.802 63.740 1.00 43.81  ? 14   ALA A C   1 
ATOM   80   O  O   . ALA A 1 11  ? 48.826 139.042 63.920 1.00 40.00  ? 14   ALA A O   1 
ATOM   81   C  CB  . ALA A 1 11  ? 49.472 141.987 62.470 1.00 36.28  ? 14   ALA A CB  1 
ATOM   82   N  N   . GLU A 1 12  ? 50.735 139.998 64.638 1.00 45.88  ? 15   GLU A N   1 
ATOM   83   C  CA  . GLU A 1 12  ? 50.701 139.405 65.958 1.00 44.87  ? 15   GLU A CA  1 
ATOM   84   C  C   . GLU A 1 12  ? 50.801 140.519 66.983 1.00 42.52  ? 15   GLU A C   1 
ATOM   85   O  O   . GLU A 1 12  ? 51.626 141.428 66.858 1.00 42.11  ? 15   GLU A O   1 
ATOM   86   C  CB  . GLU A 1 12  ? 51.866 138.446 66.132 1.00 43.84  ? 15   GLU A CB  1 
ATOM   87   C  CG  . GLU A 1 12  ? 51.996 137.941 67.538 1.00 52.28  ? 15   GLU A CG  1 
ATOM   88   C  CD  . GLU A 1 12  ? 53.060 136.879 67.664 1.00 57.68  ? 15   GLU A CD  1 
ATOM   89   O  OE1 . GLU A 1 12  ? 54.039 137.098 68.413 1.00 60.00  ? 15   GLU A OE1 1 
ATOM   90   O  OE2 . GLU A 1 12  ? 52.916 135.823 67.011 1.00 59.20  ? 15   GLU A OE2 1 
ATOM   91   N  N   . LEU A 1 13  ? 49.937 140.441 67.988 1.00 42.81  ? 16   LEU A N   1 
ATOM   92   C  CA  . LEU A 1 13  ? 49.896 141.430 69.047 1.00 41.73  ? 16   LEU A CA  1 
ATOM   93   C  C   . LEU A 1 13  ? 50.034 140.780 70.401 1.00 39.47  ? 16   LEU A C   1 
ATOM   94   O  O   . LEU A 1 13  ? 49.486 139.719 70.642 1.00 33.64  ? 16   LEU A O   1 
ATOM   95   C  CB  . LEU A 1 13  ? 48.608 142.238 68.981 1.00 37.68  ? 16   LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 13  ? 48.170 142.851 67.636 1.00 40.43  ? 16   LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 13  ? 47.110 143.868 67.956 1.00 40.86  ? 16   LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 13  ? 49.312 143.529 66.872 1.00 35.37  ? 16   LEU A CD2 1 
ATOM   99   N  N   . GLU A 1 14  ? 50.851 141.386 71.249 1.00 45.65  ? 17   GLU A N   1 
ATOM   100  C  CA  . GLU A 1 14  ? 51.074 140.872 72.589 1.00 55.02  ? 17   GLU A CA  1 
ATOM   101  C  C   . GLU A 1 14  ? 50.464 141.888 73.570 1.00 56.74  ? 17   GLU A C   1 
ATOM   102  O  O   . GLU A 1 14  ? 50.709 143.098 73.458 1.00 52.50  ? 17   GLU A O   1 
ATOM   103  C  CB  . GLU A 1 14  ? 52.578 140.705 72.830 1.00 62.62  ? 17   GLU A CB  1 
ATOM   104  C  CG  . GLU A 1 14  ? 53.285 139.763 71.837 1.00 71.29  ? 17   GLU A CG  1 
ATOM   105  C  CD  . GLU A 1 14  ? 53.489 138.347 72.380 1.00 79.84  ? 17   GLU A CD  1 
ATOM   106  O  OE1 . GLU A 1 14  ? 54.646 137.992 72.697 1.00 84.94  ? 17   GLU A OE1 1 
ATOM   107  O  OE2 . GLU A 1 14  ? 52.504 137.585 72.490 1.00 86.65  ? 17   GLU A OE2 1 
ATOM   108  N  N   . PHE A 1 15  ? 49.604 141.399 74.464 1.00 60.28  ? 18   PHE A N   1 
ATOM   109  C  CA  . PHE A 1 15  ? 48.937 142.230 75.482 1.00 62.04  ? 18   PHE A CA  1 
ATOM   110  C  C   . PHE A 1 15  ? 48.989 141.616 76.879 1.00 61.38  ? 18   PHE A C   1 
ATOM   111  O  O   . PHE A 1 15  ? 48.788 140.406 77.040 1.00 57.92  ? 18   PHE A O   1 
ATOM   112  C  CB  . PHE A 1 15  ? 47.424 142.398 75.205 1.00 61.67  ? 18   PHE A CB  1 
ATOM   113  C  CG  . PHE A 1 15  ? 47.094 143.276 74.053 1.00 61.38  ? 18   PHE A CG  1 
ATOM   114  C  CD1 . PHE A 1 15  ? 47.728 144.502 73.885 1.00 67.40  ? 18   PHE A CD1 1 
ATOM   115  C  CD2 . PHE A 1 15  ? 46.162 142.863 73.112 1.00 63.80  ? 18   PHE A CD2 1 
ATOM   116  C  CE1 . PHE A 1 15  ? 47.445 145.314 72.780 1.00 70.98  ? 18   PHE A CE1 1 
ATOM   117  C  CE2 . PHE A 1 15  ? 45.866 143.658 72.003 1.00 69.07  ? 18   PHE A CE2 1 
ATOM   118  C  CZ  . PHE A 1 15  ? 46.510 144.887 71.833 1.00 72.42  ? 18   PHE A CZ  1 
ATOM   119  N  N   . ALA A 1 16  ? 49.201 142.461 77.888 1.00 62.61  ? 19   ALA A N   1 
ATOM   120  C  CA  . ALA A 1 16  ? 49.177 142.004 79.279 1.00 60.86  ? 19   ALA A CA  1 
ATOM   121  C  C   . ALA A 1 16  ? 47.867 142.585 79.829 1.00 56.59  ? 19   ALA A C   1 
ATOM   122  O  O   . ALA A 1 16  ? 47.603 143.788 79.722 1.00 56.56  ? 19   ALA A O   1 
ATOM   123  C  CB  . ALA A 1 16  ? 50.392 142.507 80.068 1.00 60.01  ? 19   ALA A CB  1 
ATOM   124  N  N   . ILE A 1 17  ? 47.013 141.705 80.332 1.00 54.54  ? 20   ILE A N   1 
ATOM   125  C  CA  . ILE A 1 17  ? 45.715 142.108 80.852 1.00 59.08  ? 20   ILE A CA  1 
ATOM   126  C  C   . ILE A 1 17  ? 45.454 141.722 82.330 1.00 64.69  ? 20   ILE A C   1 
ATOM   127  O  O   . ILE A 1 17  ? 45.901 140.676 82.814 1.00 61.28  ? 20   ILE A O   1 
ATOM   128  C  CB  . ILE A 1 17  ? 44.578 141.538 79.943 1.00 60.46  ? 20   ILE A CB  1 
ATOM   129  C  CG1 . ILE A 1 17  ? 44.557 139.991 79.988 1.00 56.76  ? 20   ILE A CG1 1 
ATOM   130  C  CG2 . ILE A 1 17  ? 44.771 142.041 78.506 1.00 58.02  ? 20   ILE A CG2 1 
ATOM   131  C  CD1 . ILE A 1 17  ? 43.191 139.342 79.679 1.00 46.71  ? 20   ILE A CD1 1 
ATOM   132  N  N   . GLN A 1 18  ? 44.742 142.588 83.046 1.00 70.83  ? 21   GLN A N   1 
ATOM   133  C  CA  . GLN A 1 18  ? 44.395 142.337 84.448 1.00 76.17  ? 21   GLN A CA  1 
ATOM   134  C  C   . GLN A 1 18  ? 43.322 141.231 84.494 1.00 76.39  ? 21   GLN A C   1 
ATOM   135  O  O   . GLN A 1 18  ? 42.562 141.065 83.537 1.00 77.28  ? 21   GLN A O   1 
ATOM   136  C  CB  . GLN A 1 18  ? 43.836 143.621 85.074 1.00 82.50  ? 21   GLN A CB  1 
ATOM   137  C  CG  . GLN A 1 18  ? 42.758 144.297 84.211 1.00 89.61  ? 21   GLN A CG  1 
ATOM   138  C  CD  . GLN A 1 18  ? 42.021 145.431 84.912 1.00 94.79  ? 21   GLN A CD  1 
ATOM   139  O  OE1 . GLN A 1 18  ? 42.062 145.552 86.144 1.00 99.99  ? 21   GLN A OE1 1 
ATOM   140  N  NE2 . GLN A 1 18  ? 41.317 146.255 84.126 1.00 92.79  ? 21   GLN A NE2 1 
ATOM   141  N  N   . PRO A 1 19  ? 43.218 140.489 85.618 1.00 75.23  ? 22   PRO A N   1 
ATOM   142  C  CA  . PRO A 1 19  ? 42.215 139.410 85.723 1.00 73.92  ? 22   PRO A CA  1 
ATOM   143  C  C   . PRO A 1 19  ? 40.777 139.897 85.511 1.00 70.81  ? 22   PRO A C   1 
ATOM   144  O  O   . PRO A 1 19  ? 39.882 139.147 85.102 1.00 74.61  ? 22   PRO A O   1 
ATOM   145  C  CB  . PRO A 1 19  ? 42.401 138.895 87.162 1.00 73.16  ? 22   PRO A CB  1 
ATOM   146  C  CG  . PRO A 1 19  ? 43.845 139.226 87.475 1.00 72.96  ? 22   PRO A CG  1 
ATOM   147  C  CD  . PRO A 1 19  ? 44.002 140.608 86.863 1.00 73.31  ? 22   PRO A CD  1 
ATOM   148  N  N   . ASN A 1 20  ? 40.600 141.179 85.783 1.00 65.10  ? 23   ASN A N   1 
ATOM   149  C  CA  . ASN A 1 20  ? 39.339 141.877 85.688 1.00 63.22  ? 23   ASN A CA  1 
ATOM   150  C  C   . ASN A 1 20  ? 38.854 142.087 84.226 1.00 59.62  ? 23   ASN A C   1 
ATOM   151  O  O   . ASN A 1 20  ? 37.651 142.302 83.983 1.00 55.31  ? 23   ASN A O   1 
ATOM   152  C  CB  . ASN A 1 20  ? 39.554 143.219 86.422 1.00 68.44  ? 23   ASN A CB  1 
ATOM   153  C  CG  . ASN A 1 20  ? 38.290 144.047 86.568 1.00 75.67  ? 23   ASN A CG  1 
ATOM   154  O  OD1 . ASN A 1 20  ? 37.617 143.999 87.602 1.00 78.72  ? 23   ASN A OD1 1 
ATOM   155  N  ND2 . ASN A 1 20  ? 38.000 144.870 85.560 1.00 77.26  ? 23   ASN A ND2 1 
ATOM   156  N  N   . THR A 1 21  ? 39.773 141.940 83.265 1.00 54.57  ? 24   THR A N   1 
ATOM   157  C  CA  . THR A 1 21  ? 39.488 142.186 81.847 1.00 50.55  ? 24   THR A CA  1 
ATOM   158  C  C   . THR A 1 21  ? 38.408 141.303 81.267 1.00 48.55  ? 24   THR A C   1 
ATOM   159  O  O   . THR A 1 21  ? 38.379 140.093 81.521 1.00 47.23  ? 24   THR A O   1 
ATOM   160  C  CB  . THR A 1 21  ? 40.746 142.074 80.962 1.00 54.92  ? 24   THR A CB  1 
ATOM   161  O  OG1 . THR A 1 21  ? 41.842 142.726 81.599 1.00 60.56  ? 24   THR A OG1 1 
ATOM   162  C  CG2 . THR A 1 21  ? 40.530 142.771 79.644 1.00 53.38  ? 24   THR A CG2 1 
ATOM   163  N  N   . THR A 1 22  ? 37.480 141.952 80.556 1.00 47.90  ? 25   THR A N   1 
ATOM   164  C  CA  . THR A 1 22  ? 36.344 141.296 79.889 1.00 46.28  ? 25   THR A CA  1 
ATOM   165  C  C   . THR A 1 22  ? 36.661 141.203 78.408 1.00 41.81  ? 25   THR A C   1 
ATOM   166  O  O   . THR A 1 22  ? 37.467 141.982 77.904 1.00 36.37  ? 25   THR A O   1 
ATOM   167  C  CB  . THR A 1 22  ? 35.013 142.093 80.078 1.00 43.03  ? 25   THR A CB  1 
ATOM   168  O  OG1 . THR A 1 22  ? 35.089 143.370 79.427 1.00 42.50  ? 25   THR A OG1 1 
ATOM   169  C  CG2 . THR A 1 22  ? 34.758 142.330 81.558 1.00 48.32  ? 25   THR A CG2 1 
ATOM   170  N  N   . GLY A 1 23  ? 36.016 140.274 77.709 1.00 43.25  ? 26   GLY A N   1 
ATOM   171  C  CA  . GLY A 1 23  ? 36.279 140.110 76.286 1.00 41.24  ? 26   GLY A CA  1 
ATOM   172  C  C   . GLY A 1 23  ? 36.235 141.436 75.530 1.00 39.60  ? 26   GLY A C   1 
ATOM   173  O  O   . GLY A 1 23  ? 37.127 141.745 74.752 1.00 32.79  ? 26   GLY A O   1 
ATOM   174  N  N   . LYS A 1 24  ? 35.229 142.253 75.831 1.00 36.97  ? 27   LYS A N   1 
ATOM   175  C  CA  . LYS A 1 24  ? 35.036 143.546 75.197 1.00 36.21  ? 27   LYS A CA  1 
ATOM   176  C  C   . LYS A 1 24  ? 36.225 144.499 75.333 1.00 37.47  ? 27   LYS A C   1 
ATOM   177  O  O   . LYS A 1 24  ? 36.539 145.262 74.405 1.00 35.05  ? 27   LYS A O   1 
ATOM   178  C  CB  . LYS A 1 24  ? 33.727 144.186 75.711 1.00 36.99  ? 27   LYS A CB  1 
ATOM   179  C  CG  . LYS A 1 24  ? 33.516 145.638 75.364 1.00 42.02  ? 27   LYS A CG  1 
ATOM   180  C  CD  . LYS A 1 24  ? 33.283 145.867 73.886 1.00 48.22  ? 27   LYS A CD  1 
ATOM   181  C  CE  . LYS A 1 24  ? 32.868 147.313 73.648 1.00 51.21  ? 27   LYS A CE  1 
ATOM   182  N  NZ  . LYS A 1 24  ? 32.629 147.552 72.205 1.00 57.31  ? 27   LYS A NZ  1 
ATOM   183  N  N   . GLN A 1 25  ? 36.885 144.455 76.484 1.00 35.35  ? 28   GLN A N   1 
ATOM   184  C  CA  . GLN A 1 25  ? 38.037 145.308 76.734 1.00 37.62  ? 28   GLN A CA  1 
ATOM   185  C  C   . GLN A 1 25  ? 39.236 144.830 75.923 1.00 35.56  ? 28   GLN A C   1 
ATOM   186  O  O   . GLN A 1 25  ? 40.032 145.645 75.437 1.00 35.02  ? 28   GLN A O   1 
ATOM   187  C  CB  . GLN A 1 25  ? 38.365 145.291 78.219 1.00 45.78  ? 28   GLN A CB  1 
ATOM   188  C  CG  . GLN A 1 25  ? 37.137 145.427 79.094 1.00 52.98  ? 28   GLN A CG  1 
ATOM   189  C  CD  . GLN A 1 25  ? 37.495 145.693 80.542 1.00 56.47  ? 28   GLN A CD  1 
ATOM   190  O  OE1 . GLN A 1 25  ? 37.996 144.810 81.264 1.00 54.60  ? 28   GLN A OE1 1 
ATOM   191  N  NE2 . GLN A 1 25  ? 37.271 146.931 80.969 1.00 46.76  ? 28   GLN A NE2 1 
ATOM   192  N  N   . LEU A 1 26  ? 39.386 143.506 75.825 1.00 33.56  ? 29   LEU A N   1 
ATOM   193  C  CA  . LEU A 1 26  ? 40.480 142.900 75.061 1.00 31.27  ? 29   LEU A CA  1 
ATOM   194  C  C   . LEU A 1 26  ? 40.288 143.201 73.573 1.00 29.89  ? 29   LEU A C   1 
ATOM   195  O  O   . LEU A 1 26  ? 41.241 143.571 72.907 1.00 33.22  ? 29   LEU A O   1 
ATOM   196  C  CB  . LEU A 1 26  ? 40.557 141.381 75.272 1.00 28.07  ? 29   LEU A CB  1 
ATOM   197  C  CG  . LEU A 1 26  ? 41.619 140.714 74.400 1.00 24.93  ? 29   LEU A CG  1 
ATOM   198  C  CD1 . LEU A 1 26  ? 42.914 141.465 74.534 1.00 27.92  ? 29   LEU A CD1 1 
ATOM   199  C  CD2 . LEU A 1 26  ? 41.771 139.253 74.754 1.00 23.26  ? 29   LEU A CD2 1 
ATOM   200  N  N   . PHE A 1 27  ? 39.055 143.049 73.079 1.00 27.17  ? 30   PHE A N   1 
ATOM   201  C  CA  . PHE A 1 27  ? 38.706 143.311 71.677 1.00 30.21  ? 30   PHE A CA  1 
ATOM   202  C  C   . PHE A 1 27  ? 39.029 144.758 71.292 1.00 30.55  ? 30   PHE A C   1 
ATOM   203  O  O   . PHE A 1 27  ? 39.652 145.026 70.255 1.00 24.63  ? 30   PHE A O   1 
ATOM   204  C  CB  . PHE A 1 27  ? 37.220 143.003 71.426 1.00 25.26  ? 30   PHE A CB  1 
ATOM   205  C  CG  . PHE A 1 27  ? 36.750 143.270 70.014 1.00 27.20  ? 30   PHE A CG  1 
ATOM   206  C  CD1 . PHE A 1 27  ? 36.717 142.230 69.069 1.00 33.83  ? 30   PHE A CD1 1 
ATOM   207  C  CD2 . PHE A 1 27  ? 36.251 144.535 69.649 1.00 27.26  ? 30   PHE A CD2 1 
ATOM   208  C  CE1 . PHE A 1 27  ? 36.183 142.432 67.769 1.00 30.73  ? 30   PHE A CE1 1 
ATOM   209  C  CE2 . PHE A 1 27  ? 35.717 144.753 68.367 1.00 36.54  ? 30   PHE A CE2 1 
ATOM   210  C  CZ  . PHE A 1 27  ? 35.682 143.685 67.417 1.00 31.74  ? 30   PHE A CZ  1 
ATOM   211  N  N   . ASP A 1 28  ? 38.630 145.681 72.164 1.00 36.94  ? 31   ASP A N   1 
ATOM   212  C  CA  . ASP A 1 28  ? 38.868 147.097 71.957 1.00 34.57  ? 31   ASP A CA  1 
ATOM   213  C  C   . ASP A 1 28  ? 40.346 147.436 71.826 1.00 33.31  ? 31   ASP A C   1 
ATOM   214  O  O   . ASP A 1 28  ? 40.704 148.249 70.989 1.00 36.34  ? 31   ASP A O   1 
ATOM   215  C  CB  . ASP A 1 28  ? 38.157 147.936 73.026 1.00 42.40  ? 31   ASP A CB  1 
ATOM   216  C  CG  . ASP A 1 28  ? 36.628 147.894 72.896 1.00 50.16  ? 31   ASP A CG  1 
ATOM   217  O  OD1 . ASP A 1 28  ? 36.103 147.491 71.832 1.00 52.08  ? 31   ASP A OD1 1 
ATOM   218  O  OD2 . ASP A 1 28  ? 35.943 148.267 73.868 1.00 51.15  ? 31   ASP A OD2 1 
ATOM   219  N  N   . GLN A 1 29  ? 41.201 146.781 72.608 1.00 33.80  ? 32   GLN A N   1 
ATOM   220  C  CA  . GLN A 1 29  ? 42.645 147.019 72.535 1.00 30.07  ? 32   GLN A CA  1 
ATOM   221  C  C   . GLN A 1 29  ? 43.156 146.586 71.188 1.00 26.99  ? 32   GLN A C   1 
ATOM   222  O  O   . GLN A 1 29  ? 43.884 147.320 70.550 1.00 28.07  ? 32   GLN A O   1 
ATOM   223  C  CB  . GLN A 1 29  ? 43.374 146.236 73.606 1.00 36.31  ? 32   GLN A CB  1 
ATOM   224  C  CG  . GLN A 1 29  ? 43.310 146.826 74.982 1.00 45.02  ? 32   GLN A CG  1 
ATOM   225  C  CD  . GLN A 1 29  ? 44.102 145.984 75.953 1.00 55.11  ? 32   GLN A CD  1 
ATOM   226  O  OE1 . GLN A 1 29  ? 45.337 145.892 75.862 1.00 65.78  ? 32   GLN A OE1 1 
ATOM   227  N  NE2 . GLN A 1 29  ? 43.395 145.305 76.852 1.00 56.40  ? 32   GLN A NE2 1 
ATOM   228  N  N   . VAL A 1 30  ? 42.733 145.410 70.742 1.00 26.95  ? 33   VAL A N   1 
ATOM   229  C  CA  . VAL A 1 30  ? 43.137 144.879 69.432 1.00 27.98  ? 33   VAL A CA  1 
ATOM   230  C  C   . VAL A 1 30  ? 42.690 145.764 68.244 1.00 30.63  ? 33   VAL A C   1 
ATOM   231  O  O   . VAL A 1 30  ? 43.509 146.129 67.377 1.00 35.09  ? 33   VAL A O   1 
ATOM   232  C  CB  . VAL A 1 30  ? 42.580 143.471 69.188 1.00 28.01  ? 33   VAL A CB  1 
ATOM   233  C  CG1 . VAL A 1 30  ? 42.966 142.958 67.757 1.00 17.90  ? 33   VAL A CG1 1 
ATOM   234  C  CG2 . VAL A 1 30  ? 43.079 142.550 70.269 1.00 24.99  ? 33   VAL A CG2 1 
ATOM   235  N  N   . VAL A 1 31  ? 41.403 146.101 68.180 1.00 26.70  ? 34   VAL A N   1 
ATOM   236  C  CA  . VAL A 1 31  ? 40.951 146.942 67.059 1.00 29.27  ? 34   VAL A CA  1 
ATOM   237  C  C   . VAL A 1 31  ? 41.597 148.322 67.110 1.00 34.18  ? 34   VAL A C   1 
ATOM   238  O  O   . VAL A 1 31  ? 41.968 148.881 66.072 1.00 31.26  ? 34   VAL A O   1 
ATOM   239  C  CB  . VAL A 1 31  ? 39.414 147.071 66.958 1.00 28.95  ? 34   VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 31  ? 38.784 145.687 66.845 1.00 27.14  ? 34   VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 31  ? 38.846 147.821 68.139 1.00 33.76  ? 34   VAL A CG2 1 
ATOM   242  N  N   . LYS A 1 32  ? 41.821 148.803 68.337 1.00 35.99  ? 35   LYS A N   1 
ATOM   243  C  CA  . LYS A 1 32  ? 42.445 150.092 68.592 1.00 38.17  ? 35   LYS A CA  1 
ATOM   244  C  C   . LYS A 1 32  ? 43.869 150.061 68.040 1.00 34.52  ? 35   LYS A C   1 
ATOM   245  O  O   . LYS A 1 32  ? 44.247 150.885 67.189 1.00 32.74  ? 35   LYS A O   1 
ATOM   246  C  CB  . LYS A 1 32  ? 42.437 150.363 70.094 1.00 40.78  ? 35   LYS A CB  1 
ATOM   247  C  CG  . LYS A 1 32  ? 42.695 151.792 70.489 1.00 47.90  ? 35   LYS A CG  1 
ATOM   248  C  CD  . LYS A 1 32  ? 41.412 152.562 70.715 1.00 60.44  ? 35   LYS A CD  1 
ATOM   249  C  CE  . LYS A 1 32  ? 40.458 152.496 69.518 1.00 62.75  ? 35   LYS A CE  1 
ATOM   250  N  NZ  . LYS A 1 32  ? 39.376 153.515 69.659 1.00 63.62  ? 35   LYS A NZ  1 
ATOM   251  N  N   . THR A 1 33  ? 44.615 149.044 68.463 1.00 33.56  ? 36   THR A N   1 
ATOM   252  C  CA  . THR A 1 33  ? 45.997 148.851 68.042 1.00 31.97  ? 36   THR A CA  1 
ATOM   253  C  C   . THR A 1 33  ? 46.142 148.731 66.518 1.00 32.37  ? 36   THR A C   1 
ATOM   254  O  O   . THR A 1 33  ? 46.997 149.406 65.934 1.00 33.02  ? 36   THR A O   1 
ATOM   255  C  CB  . THR A 1 33  ? 46.624 147.603 68.695 1.00 31.16  ? 36   THR A CB  1 
ATOM   256  O  OG1 . THR A 1 33  ? 46.836 147.859 70.079 1.00 39.38  ? 36   THR A OG1 1 
ATOM   257  C  CG2 . THR A 1 33  ? 47.955 147.259 68.056 1.00 31.37  ? 36   THR A CG2 1 
ATOM   258  N  N   . ILE A 1 34  ? 45.334 147.887 65.865 1.00 30.44  ? 37   ILE A N   1 
ATOM   259  C  CA  . ILE A 1 34  ? 45.476 147.725 64.411 1.00 30.11  ? 37   ILE A CA  1 
ATOM   260  C  C   . ILE A 1 34  ? 44.810 148.810 63.538 1.00 32.55  ? 37   ILE A C   1 
ATOM   261  O  O   . ILE A 1 34  ? 44.900 148.781 62.299 1.00 30.99  ? 37   ILE A O   1 
ATOM   262  C  CB  . ILE A 1 34  ? 45.043 146.334 63.911 1.00 28.21  ? 37   ILE A CB  1 
ATOM   263  C  CG1 . ILE A 1 34  ? 43.541 146.208 63.963 1.00 22.69  ? 37   ILE A CG1 1 
ATOM   264  C  CG2 . ILE A 1 34  ? 45.734 145.240 64.701 1.00 25.84  ? 37   ILE A CG2 1 
ATOM   265  C  CD1 . ILE A 1 34  ? 43.055 144.798 63.717 1.00 30.33  ? 37   ILE A CD1 1 
ATOM   266  N  N   . GLY A 1 35  ? 44.135 149.755 64.190 1.00 31.32  ? 38   GLY A N   1 
ATOM   267  C  CA  . GLY A 1 35  ? 43.498 150.859 63.487 1.00 28.93  ? 38   GLY A CA  1 
ATOM   268  C  C   . GLY A 1 35  ? 42.257 150.478 62.713 1.00 26.95  ? 38   GLY A C   1 
ATOM   269  O  O   . GLY A 1 35  ? 41.954 151.053 61.673 1.00 28.57  ? 38   GLY A O   1 
ATOM   270  N  N   . LEU A 1 36  ? 41.497 149.555 63.286 1.00 27.08  ? 39   LEU A N   1 
ATOM   271  C  CA  . LEU A 1 36  ? 40.282 149.070 62.670 1.00 26.89  ? 39   LEU A CA  1 
ATOM   272  C  C   . LEU A 1 36  ? 39.028 149.663 63.317 1.00 22.17  ? 39   LEU A C   1 
ATOM   273  O  O   . LEU A 1 36  ? 38.825 149.502 64.523 1.00 22.42  ? 39   LEU A O   1 
ATOM   274  C  CB  . LEU A 1 36  ? 40.280 147.516 62.701 1.00 29.84  ? 39   LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 36  ? 38.911 146.848 62.448 1.00 39.43  ? 39   LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 36  ? 38.547 146.874 60.978 1.00 37.41  ? 39   LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 36  ? 38.907 145.447 62.989 1.00 37.92  ? 39   LEU A CD2 1 
ATOM   278  N  N   . ARG A 1 37  ? 38.204 150.325 62.497 1.00 27.14  ? 40   ARG A N   1 
ATOM   279  C  CA  . ARG A 1 37  ? 36.923 150.931 62.904 1.00 27.64  ? 40   ARG A CA  1 
ATOM   280  C  C   . ARG A 1 37  ? 35.694 150.104 62.501 1.00 26.49  ? 40   ARG A C   1 
ATOM   281  O  O   . ARG A 1 37  ? 34.674 150.187 63.185 1.00 27.52  ? 40   ARG A O   1 
ATOM   282  C  CB  . ARG A 1 37  ? 36.806 152.395 62.400 1.00 26.25  ? 40   ARG A CB  1 
ATOM   283  C  CG  . ARG A 1 37  ? 37.779 153.327 63.154 1.00 31.99  ? 40   ARG A CG  1 
ATOM   284  C  CD  . ARG A 1 37  ? 37.885 154.758 62.655 1.00 37.63  ? 40   ARG A CD  1 
ATOM   285  N  NE  . ARG A 1 37  ? 38.889 154.958 61.598 1.00 49.95  ? 40   ARG A NE  1 
ATOM   286  C  CZ  . ARG A 1 37  ? 40.219 154.866 61.736 1.00 56.59  ? 40   ARG A CZ  1 
ATOM   287  N  NH1 . ARG A 1 37  ? 40.797 154.582 62.899 1.00 61.45  ? 40   ARG A NH1 1 
ATOM   288  N  NH2 . ARG A 1 37  ? 40.988 154.994 60.669 1.00 55.02  ? 40   ARG A NH2 1 
ATOM   289  N  N   . GLU A 1 38  ? 35.776 149.279 61.441 1.00 27.03  ? 41   GLU A N   1 
ATOM   290  C  CA  . GLU A 1 38  ? 34.618 148.421 61.044 1.00 28.64  ? 41   GLU A CA  1 
ATOM   291  C  C   . GLU A 1 38  ? 34.639 147.105 61.828 1.00 26.08  ? 41   GLU A C   1 
ATOM   292  O  O   . GLU A 1 38  ? 34.658 146.021 61.262 1.00 27.47  ? 41   GLU A O   1 
ATOM   293  C  CB  . GLU A 1 38  ? 34.626 148.152 59.520 1.00 28.07  ? 41   GLU A CB  1 
ATOM   294  C  CG  . GLU A 1 38  ? 35.106 149.372 58.751 1.00 33.36  ? 41   GLU A CG  1 
ATOM   295  C  CD  . GLU A 1 38  ? 34.832 149.317 57.279 1.00 25.55  ? 41   GLU A CD  1 
ATOM   296  O  OE1 . GLU A 1 38  ? 35.792 149.300 56.508 1.00 24.38  ? 41   GLU A OE1 1 
ATOM   297  O  OE2 . GLU A 1 38  ? 33.657 149.336 56.887 1.00 37.62  ? 41   GLU A OE2 1 
ATOM   298  N  N   . VAL A 1 39  ? 34.504 147.239 63.136 1.00 22.62  ? 42   VAL A N   1 
ATOM   299  C  CA  . VAL A 1 39  ? 34.575 146.153 64.087 1.00 23.81  ? 42   VAL A CA  1 
ATOM   300  C  C   . VAL A 1 39  ? 33.440 145.127 64.176 1.00 16.93  ? 42   VAL A C   1 
ATOM   301  O  O   . VAL A 1 39  ? 33.614 144.056 64.760 1.00 24.64  ? 42   VAL A O   1 
ATOM   302  C  CB  . VAL A 1 39  ? 34.841 146.735 65.527 1.00 25.41  ? 42   VAL A CB  1 
ATOM   303  C  CG1 . VAL A 1 39  ? 36.010 147.690 65.490 1.00 22.52  ? 42   VAL A CG1 1 
ATOM   304  C  CG2 . VAL A 1 39  ? 33.576 147.410 66.102 1.00 22.34  ? 42   VAL A CG2 1 
ATOM   305  N  N   . TRP A 1 40  ? 32.257 145.497 63.701 1.00 19.10  ? 43   TRP A N   1 
ATOM   306  C  CA  . TRP A 1 40  ? 31.084 144.643 63.799 1.00 20.95  ? 43   TRP A CA  1 
ATOM   307  C  C   . TRP A 1 40  ? 31.154 143.281 63.075 1.00 26.85  ? 43   TRP A C   1 
ATOM   308  O  O   . TRP A 1 40  ? 30.347 142.356 63.334 1.00 29.16  ? 43   TRP A O   1 
ATOM   309  C  CB  . TRP A 1 40  ? 29.844 145.426 63.348 1.00 16.94  ? 43   TRP A CB  1 
ATOM   310  C  CG  . TRP A 1 40  ? 30.060 146.247 62.079 1.00 27.14  ? 43   TRP A CG  1 
ATOM   311  C  CD1 . TRP A 1 40  ? 29.826 145.855 60.780 1.00 20.38  ? 43   TRP A CD1 1 
ATOM   312  C  CD2 . TRP A 1 40  ? 30.530 147.605 62.007 1.00 25.42  ? 43   TRP A CD2 1 
ATOM   313  N  NE1 . TRP A 1 40  ? 30.121 146.890 59.925 1.00 28.96  ? 43   TRP A NE1 1 
ATOM   314  C  CE2 . TRP A 1 40  ? 30.548 147.972 60.652 1.00 26.81  ? 43   TRP A CE2 1 
ATOM   315  C  CE3 . TRP A 1 40  ? 30.925 148.547 62.964 1.00 29.27  ? 43   TRP A CE3 1 
ATOM   316  C  CZ2 . TRP A 1 40  ? 30.946 149.235 60.229 1.00 29.03  ? 43   TRP A CZ2 1 
ATOM   317  C  CZ3 . TRP A 1 40  ? 31.314 149.789 62.544 1.00 19.32  ? 43   TRP A CZ3 1 
ATOM   318  C  CH2 . TRP A 1 40  ? 31.317 150.128 61.192 1.00 28.48  ? 43   TRP A CH2 1 
ATOM   319  N  N   . PHE A 1 41  ? 32.101 143.170 62.157 1.00 24.65  ? 44   PHE A N   1 
ATOM   320  C  CA  . PHE A 1 41  ? 32.302 141.941 61.421 1.00 20.99  ? 44   PHE A CA  1 
ATOM   321  C  C   . PHE A 1 41  ? 33.169 140.980 62.190 1.00 20.28  ? 44   PHE A C   1 
ATOM   322  O  O   . PHE A 1 41  ? 33.088 139.769 61.978 1.00 18.90  ? 44   PHE A O   1 
ATOM   323  C  CB  . PHE A 1 41  ? 33.030 142.244 60.128 1.00 16.64  ? 44   PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 41  ? 32.226 142.988 59.167 1.00 15.29  ? 44   PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 41  ? 32.599 144.263 58.775 1.00 19.83  ? 44   PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 41  ? 31.075 142.424 58.620 1.00 19.71  ? 44   PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 41  ? 31.839 144.995 57.834 1.00 14.44  ? 44   PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 41  ? 30.293 143.151 57.669 1.00 24.79  ? 44   PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 41  ? 30.688 144.449 57.277 1.00 21.37  ? 44   PHE A CZ  1 
ATOM   330  N  N   . PHE A 1 42  ? 34.029 141.527 63.051 1.00 20.92  ? 45   PHE A N   1 
ATOM   331  C  CA  . PHE A 1 42  ? 35.009 140.733 63.794 1.00 16.28  ? 45   PHE A CA  1 
ATOM   332  C  C   . PHE A 1 42  ? 34.763 140.167 65.185 1.00 19.13  ? 45   PHE A C   1 
ATOM   333  O  O   . PHE A 1 42  ? 33.873 140.587 65.916 1.00 25.46  ? 45   PHE A O   1 
ATOM   334  C  CB  . PHE A 1 42  ? 36.341 141.481 63.748 1.00 21.72  ? 45   PHE A CB  1 
ATOM   335  C  CG  . PHE A 1 42  ? 36.803 141.798 62.357 1.00 22.75  ? 45   PHE A CG  1 
ATOM   336  C  CD1 . PHE A 1 42  ? 36.271 142.882 61.663 1.00 22.05  ? 45   PHE A CD1 1 
ATOM   337  C  CD2 . PHE A 1 42  ? 37.737 140.976 61.718 1.00 19.10  ? 45   PHE A CD2 1 
ATOM   338  C  CE1 . PHE A 1 42  ? 36.664 143.137 60.349 1.00 20.91  ? 45   PHE A CE1 1 
ATOM   339  C  CE2 . PHE A 1 42  ? 38.130 141.224 60.408 1.00 18.14  ? 45   PHE A CE2 1 
ATOM   340  C  CZ  . PHE A 1 42  ? 37.607 142.291 59.713 1.00 15.90  ? 45   PHE A CZ  1 
ATOM   341  N  N   . GLY A 1 43  ? 35.605 139.212 65.536 1.00 16.80  ? 46   GLY A N   1 
ATOM   342  C  CA  . GLY A 1 43  ? 35.552 138.563 66.826 1.00 22.57  ? 46   GLY A CA  1 
ATOM   343  C  C   . GLY A 1 43  ? 36.894 137.939 67.196 1.00 25.79  ? 46   GLY A C   1 
ATOM   344  O  O   . GLY A 1 43  ? 37.823 137.914 66.372 1.00 28.59  ? 46   GLY A O   1 
ATOM   345  N  N   . LEU A 1 44  ? 37.034 137.538 68.458 1.00 24.19  ? 47   LEU A N   1 
ATOM   346  C  CA  . LEU A 1 44  ? 38.231 136.838 68.904 1.00 28.67  ? 47   LEU A CA  1 
ATOM   347  C  C   . LEU A 1 44  ? 37.876 135.372 69.170 1.00 29.54  ? 47   LEU A C   1 
ATOM   348  O  O   . LEU A 1 44  ? 36.943 135.063 69.928 1.00 26.95  ? 47   LEU A O   1 
ATOM   349  C  CB  . LEU A 1 44  ? 38.801 137.468 70.170 1.00 27.95  ? 47   LEU A CB  1 
ATOM   350  C  CG  . LEU A 1 44  ? 39.481 138.831 70.034 1.00 33.10  ? 47   LEU A CG  1 
ATOM   351  C  CD1 . LEU A 1 44  ? 39.634 139.421 71.448 1.00 30.80  ? 47   LEU A CD1 1 
ATOM   352  C  CD2 . LEU A 1 44  ? 40.829 138.723 69.294 1.00 25.50  ? 47   LEU A CD2 1 
ATOM   353  N  N   . GLN A 1 45  ? 38.617 134.470 68.534 1.00 27.40  ? 48   GLN A N   1 
ATOM   354  C  CA  . GLN A 1 45  ? 38.387 133.046 68.707 1.00 34.05  ? 48   GLN A CA  1 
ATOM   355  C  C   . GLN A 1 45  ? 39.513 132.450 69.517 1.00 28.18  ? 48   GLN A C   1 
ATOM   356  O  O   . GLN A 1 45  ? 40.633 132.929 69.454 1.00 29.38  ? 48   GLN A O   1 
ATOM   357  C  CB  . GLN A 1 45  ? 38.282 132.353 67.354 1.00 37.77  ? 48   GLN A CB  1 
ATOM   358  C  CG  . GLN A 1 45  ? 37.537 131.061 67.430 1.00 44.24  ? 48   GLN A CG  1 
ATOM   359  C  CD  . GLN A 1 45  ? 36.962 130.665 66.097 1.00 53.13  ? 48   GLN A CD  1 
ATOM   360  O  OE1 . GLN A 1 45  ? 35.789 130.222 66.007 1.00 46.95  ? 48   GLN A OE1 1 
ATOM   361  N  NE2 . GLN A 1 45  ? 37.773 130.826 65.034 1.00 42.26  ? 48   GLN A NE2 1 
ATOM   362  N  N   . TYR A 1 46  ? 39.193 131.432 70.310 1.00 32.57  ? 49   TYR A N   1 
ATOM   363  C  CA  . TYR A 1 46  ? 40.202 130.732 71.104 1.00 35.25  ? 49   TYR A CA  1 
ATOM   364  C  C   . TYR A 1 46  ? 39.859 129.247 71.201 1.00 37.69  ? 49   TYR A C   1 
ATOM   365  O  O   . TYR A 1 46  ? 38.730 128.844 70.905 1.00 40.62  ? 49   TYR A O   1 
ATOM   366  C  CB  . TYR A 1 46  ? 40.290 131.327 72.516 1.00 30.90  ? 49   TYR A CB  1 
ATOM   367  C  CG  . TYR A 1 46  ? 39.028 131.118 73.342 1.00 32.17  ? 49   TYR A CG  1 
ATOM   368  C  CD1 . TYR A 1 46  ? 37.919 131.950 73.188 1.00 31.71  ? 49   TYR A CD1 1 
ATOM   369  C  CD2 . TYR A 1 46  ? 38.937 130.062 74.268 1.00 38.24  ? 49   TYR A CD2 1 
ATOM   370  C  CE1 . TYR A 1 46  ? 36.755 131.738 73.928 1.00 41.38  ? 49   TYR A CE1 1 
ATOM   371  C  CE2 . TYR A 1 46  ? 37.773 129.835 75.017 1.00 34.20  ? 49   TYR A CE2 1 
ATOM   372  C  CZ  . TYR A 1 46  ? 36.689 130.674 74.844 1.00 39.70  ? 49   TYR A CZ  1 
ATOM   373  O  OH  . TYR A 1 46  ? 35.544 130.462 75.585 1.00 45.37  ? 49   TYR A OH  1 
ATOM   374  N  N   . GLN A 1 47  ? 40.852 128.426 71.544 1.00 41.29  ? 50   GLN A N   1 
ATOM   375  C  CA  . GLN A 1 47  ? 40.616 127.001 71.755 1.00 38.91  ? 50   GLN A CA  1 
ATOM   376  C  C   . GLN A 1 47  ? 40.198 126.855 73.226 1.00 39.89  ? 50   GLN A C   1 
ATOM   377  O  O   . GLN A 1 47  ? 40.872 127.376 74.125 1.00 40.39  ? 50   GLN A O   1 
ATOM   378  C  CB  . GLN A 1 47  ? 41.895 126.190 71.524 1.00 44.49  ? 50   GLN A CB  1 
ATOM   379  C  CG  . GLN A 1 47  ? 42.350 126.143 70.091 1.00 51.05  ? 50   GLN A CG  1 
ATOM   380  C  CD  . GLN A 1 47  ? 41.291 125.564 69.157 1.00 56.15  ? 50   GLN A CD  1 
ATOM   381  O  OE1 . GLN A 1 47  ? 40.721 126.280 68.323 1.00 55.08  ? 50   GLN A OE1 1 
ATOM   382  N  NE2 . GLN A 1 47  ? 41.029 124.263 69.287 1.00 54.69  ? 50   GLN A NE2 1 
ATOM   383  N  N   . ASP A 1 48  ? 39.067 126.224 73.501 1.00 39.51  ? 51   ASP A N   1 
ATOM   384  C  CA  . ASP A 1 48  ? 38.717 126.068 74.903 1.00 47.16  ? 51   ASP A CA  1 
ATOM   385  C  C   . ASP A 1 48  ? 39.347 124.809 75.536 1.00 52.06  ? 51   ASP A C   1 
ATOM   386  O  O   . ASP A 1 48  ? 39.962 123.993 74.834 1.00 53.60  ? 51   ASP A O   1 
ATOM   387  C  CB  . ASP A 1 48  ? 37.183 126.159 75.131 1.00 49.68  ? 51   ASP A CB  1 
ATOM   388  C  CG  . ASP A 1 48  ? 36.419 124.895 74.743 1.00 47.73  ? 51   ASP A CG  1 
ATOM   389  O  OD1 . ASP A 1 48  ? 37.069 123.884 74.390 1.00 45.92  ? 51   ASP A OD1 1 
ATOM   390  O  OD2 . ASP A 1 48  ? 35.152 124.927 74.797 1.00 37.36  ? 51   ASP A OD2 1 
ATOM   391  N  N   . THR A 1 49  ? 39.172 124.673 76.854 1.00 54.08  ? 52   THR A N   1 
ATOM   392  C  CA  . THR A 1 49  ? 39.695 123.560 77.656 1.00 52.59  ? 52   THR A CA  1 
ATOM   393  C  C   . THR A 1 49  ? 39.397 122.200 77.035 1.00 54.30  ? 52   THR A C   1 
ATOM   394  O  O   . THR A 1 49  ? 40.223 121.302 77.115 1.00 56.90  ? 52   THR A O   1 
ATOM   395  C  CB  . THR A 1 49  ? 39.155 123.657 79.122 1.00 48.99  ? 52   THR A CB  1 
ATOM   396  O  OG1 . THR A 1 49  ? 37.733 123.858 79.115 1.00 51.26  ? 52   THR A OG1 1 
ATOM   397  C  CG2 . THR A 1 49  ? 39.794 124.840 79.850 1.00 50.46  ? 52   THR A CG2 1 
ATOM   398  N  N   . LYS A 1 50  ? 38.258 122.083 76.350 1.00 54.30  ? 53   LYS A N   1 
ATOM   399  C  CA  . LYS A 1 50  ? 37.856 120.837 75.700 1.00 52.46  ? 53   LYS A CA  1 
ATOM   400  C  C   . LYS A 1 50  ? 38.539 120.702 74.336 1.00 56.34  ? 53   LYS A C   1 
ATOM   401  O  O   . LYS A 1 50  ? 38.572 119.611 73.765 1.00 62.84  ? 53   LYS A O   1 
ATOM   402  C  CB  . LYS A 1 50  ? 36.330 120.805 75.493 1.00 56.97  ? 53   LYS A CB  1 
ATOM   403  C  CG  . LYS A 1 50  ? 35.476 121.464 76.599 1.00 62.05  ? 53   LYS A CG  1 
ATOM   404  C  CD  . LYS A 1 50  ? 34.914 120.465 77.601 1.00 68.92  ? 53   LYS A CD  1 
ATOM   405  C  CE  . LYS A 1 50  ? 33.524 119.955 77.208 1.00 72.52  ? 53   LYS A CE  1 
ATOM   406  N  NZ  . LYS A 1 50  ? 33.495 118.951 76.094 1.00 73.39  ? 53   LYS A NZ  1 
ATOM   407  N  N   . GLY A 1 51  ? 39.044 121.818 73.805 1.00 53.29  ? 54   GLY A N   1 
ATOM   408  C  CA  . GLY A 1 51  ? 39.719 121.816 72.509 1.00 50.63  ? 54   GLY A CA  1 
ATOM   409  C  C   . GLY A 1 51  ? 38.867 122.376 71.365 1.00 51.66  ? 54   GLY A C   1 
ATOM   410  O  O   . GLY A 1 51  ? 39.220 122.221 70.186 1.00 44.57  ? 54   GLY A O   1 
ATOM   411  N  N   . PHE A 1 52  ? 37.745 123.023 71.707 1.00 50.64  ? 55   PHE A N   1 
ATOM   412  C  CA  . PHE A 1 52  ? 36.817 123.612 70.718 1.00 50.21  ? 55   PHE A CA  1 
ATOM   413  C  C   . PHE A 1 52  ? 37.087 125.085 70.369 1.00 47.83  ? 55   PHE A C   1 
ATOM   414  O  O   . PHE A 1 52  ? 37.384 125.907 71.249 1.00 42.65  ? 55   PHE A O   1 
ATOM   415  C  CB  . PHE A 1 52  ? 35.348 123.511 71.188 1.00 48.53  ? 55   PHE A CB  1 
ATOM   416  C  CG  . PHE A 1 52  ? 34.802 122.107 71.218 1.00 53.06  ? 55   PHE A CG  1 
ATOM   417  C  CD1 . PHE A 1 52  ? 34.887 121.333 72.382 1.00 48.94  ? 55   PHE A CD1 1 
ATOM   418  C  CD2 . PHE A 1 52  ? 34.178 121.563 70.084 1.00 54.69  ? 55   PHE A CD2 1 
ATOM   419  C  CE1 . PHE A 1 52  ? 34.358 120.046 72.414 1.00 54.79  ? 55   PHE A CE1 1 
ATOM   420  C  CE2 . PHE A 1 52  ? 33.642 120.269 70.100 1.00 53.44  ? 55   PHE A CE2 1 
ATOM   421  C  CZ  . PHE A 1 52  ? 33.731 119.510 71.264 1.00 54.82  ? 55   PHE A CZ  1 
ATOM   422  N  N   . SER A 1 53  ? 36.986 125.406 69.074 1.00 45.60  ? 56   SER A N   1 
ATOM   423  C  CA  . SER A 1 53  ? 37.155 126.779 68.621 1.00 40.80  ? 56   SER A CA  1 
ATOM   424  C  C   . SER A 1 53  ? 35.912 127.471 69.160 1.00 38.40  ? 56   SER A C   1 
ATOM   425  O  O   . SER A 1 53  ? 34.791 127.025 68.913 1.00 44.49  ? 56   SER A O   1 
ATOM   426  C  CB  . SER A 1 53  ? 37.187 126.876 67.095 1.00 32.93  ? 56   SER A CB  1 
ATOM   427  O  OG  . SER A 1 53  ? 38.465 126.500 66.606 1.00 43.57  ? 56   SER A OG  1 
ATOM   428  N  N   . THR A 1 54  ? 36.125 128.549 69.903 1.00 31.00  ? 57   THR A N   1 
ATOM   429  C  CA  . THR A 1 54  ? 35.037 129.286 70.523 1.00 34.78  ? 57   THR A CA  1 
ATOM   430  C  C   . THR A 1 54  ? 35.197 130.813 70.425 1.00 31.15  ? 57   THR A C   1 
ATOM   431  O  O   . THR A 1 54  ? 36.302 131.346 70.508 1.00 32.93  ? 57   THR A O   1 
ATOM   432  C  CB  . THR A 1 54  ? 34.911 128.855 72.055 1.00 40.46  ? 57   THR A CB  1 
ATOM   433  O  OG1 . THR A 1 54  ? 34.800 127.420 72.156 1.00 44.89  ? 57   THR A OG1 1 
ATOM   434  C  CG2 . THR A 1 54  ? 33.670 129.495 72.742 1.00 38.58  ? 57   THR A CG2 1 
ATOM   435  N  N   . TRP A 1 55  ? 34.103 131.509 70.155 1.00 29.54  ? 58   TRP A N   1 
ATOM   436  C  CA  . TRP A 1 55  ? 34.168 132.958 70.127 1.00 31.18  ? 58   TRP A CA  1 
ATOM   437  C  C   . TRP A 1 55  ? 34.058 133.476 71.594 1.00 34.42  ? 58   TRP A C   1 
ATOM   438  O  O   . TRP A 1 55  ? 33.152 133.103 72.371 1.00 33.32  ? 58   TRP A O   1 
ATOM   439  C  CB  . TRP A 1 55  ? 33.026 133.571 69.291 1.00 29.02  ? 58   TRP A CB  1 
ATOM   440  C  CG  . TRP A 1 55  ? 33.051 133.213 67.861 1.00 25.63  ? 58   TRP A CG  1 
ATOM   441  C  CD1 . TRP A 1 55  ? 32.232 132.310 67.235 1.00 26.98  ? 58   TRP A CD1 1 
ATOM   442  C  CD2 . TRP A 1 55  ? 33.936 133.729 66.850 1.00 23.68  ? 58   TRP A CD2 1 
ATOM   443  N  NE1 . TRP A 1 55  ? 32.553 132.233 65.898 1.00 25.55  ? 58   TRP A NE1 1 
ATOM   444  C  CE2 . TRP A 1 55  ? 33.595 133.083 65.630 1.00 22.70  ? 58   TRP A CE2 1 
ATOM   445  C  CE3 . TRP A 1 55  ? 34.976 134.668 66.849 1.00 25.11  ? 58   TRP A CE3 1 
ATOM   446  C  CZ2 . TRP A 1 55  ? 34.264 133.337 64.424 1.00 17.68  ? 58   TRP A CZ2 1 
ATOM   447  C  CZ3 . TRP A 1 55  ? 35.649 134.930 65.633 1.00 25.48  ? 58   TRP A CZ3 1 
ATOM   448  C  CH2 . TRP A 1 55  ? 35.281 134.256 64.439 1.00 19.10  ? 58   TRP A CH2 1 
ATOM   449  N  N   . LEU A 1 56  ? 35.031 134.289 71.969 1.00 29.97  ? 59   LEU A N   1 
ATOM   450  C  CA  . LEU A 1 56  ? 35.103 134.916 73.268 1.00 29.06  ? 59   LEU A CA  1 
ATOM   451  C  C   . LEU A 1 56  ? 33.882 135.871 73.415 1.00 31.28  ? 59   LEU A C   1 
ATOM   452  O  O   . LEU A 1 56  ? 33.669 136.775 72.580 1.00 28.47  ? 59   LEU A O   1 
ATOM   453  C  CB  . LEU A 1 56  ? 36.397 135.729 73.309 1.00 27.19  ? 59   LEU A CB  1 
ATOM   454  C  CG  . LEU A 1 56  ? 36.869 136.433 74.569 1.00 30.25  ? 59   LEU A CG  1 
ATOM   455  C  CD1 . LEU A 1 56  ? 37.711 135.435 75.329 1.00 31.00  ? 59   LEU A CD1 1 
ATOM   456  C  CD2 . LEU A 1 56  ? 37.669 137.703 74.215 1.00 27.54  ? 59   LEU A CD2 1 
ATOM   457  N  N   . LYS A 1 57  ? 33.061 135.634 74.446 1.00 33.42  ? 60   LYS A N   1 
ATOM   458  C  CA  . LYS A 1 57  ? 31.892 136.476 74.743 1.00 31.41  ? 60   LYS A CA  1 
ATOM   459  C  C   . LYS A 1 57  ? 32.453 137.812 75.194 1.00 35.35  ? 60   LYS A C   1 
ATOM   460  O  O   . LYS A 1 57  ? 33.389 137.843 75.992 1.00 41.17  ? 60   LYS A O   1 
ATOM   461  C  CB  . LYS A 1 57  ? 31.034 135.859 75.851 1.00 30.77  ? 60   LYS A CB  1 
ATOM   462  C  CG  . LYS A 1 57  ? 30.506 134.470 75.517 1.00 47.58  ? 60   LYS A CG  1 
ATOM   463  C  CD  . LYS A 1 57  ? 29.635 134.457 74.213 1.00 64.50  ? 60   LYS A CD  1 
ATOM   464  C  CE  . LYS A 1 57  ? 29.362 133.028 73.636 1.00 65.08  ? 60   LYS A CE  1 
ATOM   465  N  NZ  . LYS A 1 57  ? 30.602 132.270 73.191 1.00 64.00  ? 60   LYS A NZ  1 
ATOM   466  N  N   . LEU A 1 58  ? 31.918 138.916 74.680 1.00 39.90  ? 61   LEU A N   1 
ATOM   467  C  CA  . LEU A 1 58  ? 32.451 140.231 75.046 1.00 40.19  ? 61   LEU A CA  1 
ATOM   468  C  C   . LEU A 1 58  ? 31.961 140.826 76.381 1.00 42.47  ? 61   LEU A C   1 
ATOM   469  O  O   . LEU A 1 58  ? 32.650 141.632 77.012 1.00 41.83  ? 61   LEU A O   1 
ATOM   470  C  CB  . LEU A 1 58  ? 32.244 141.227 73.892 1.00 41.78  ? 61   LEU A CB  1 
ATOM   471  C  CG  . LEU A 1 58  ? 32.890 140.927 72.510 1.00 40.50  ? 61   LEU A CG  1 
ATOM   472  C  CD1 . LEU A 1 58  ? 32.781 142.133 71.584 1.00 41.27  ? 61   LEU A CD1 1 
ATOM   473  C  CD2 . LEU A 1 58  ? 34.340 140.537 72.638 1.00 38.80  ? 61   LEU A CD2 1 
ATOM   474  N  N   . ASN A 1 59  ? 30.809 140.362 76.844 1.00 48.04  ? 62   ASN A N   1 
ATOM   475  C  CA  . ASN A 1 59  ? 30.191 140.844 78.087 1.00 53.04  ? 62   ASN A CA  1 
ATOM   476  C  C   . ASN A 1 59  ? 30.650 140.137 79.377 1.00 53.34  ? 62   ASN A C   1 
ATOM   477  O  O   . ASN A 1 59  ? 30.215 140.498 80.465 1.00 55.19  ? 62   ASN A O   1 
ATOM   478  C  CB  . ASN A 1 59  ? 28.660 140.779 77.945 1.00 52.70  ? 62   ASN A CB  1 
ATOM   479  C  CG  . ASN A 1 59  ? 28.179 139.472 77.287 1.00 59.31  ? 62   ASN A CG  1 
ATOM   480  O  OD1 . ASN A 1 59  ? 28.553 139.129 76.141 1.00 54.49  ? 62   ASN A OD1 1 
ATOM   481  N  ND2 . ASN A 1 59  ? 27.351 138.733 78.018 1.00 66.09  ? 62   ASN A ND2 1 
ATOM   482  N  N   . LYS A 1 60  ? 31.502 139.117 79.236 1.00 50.10  ? 63   LYS A N   1 
ATOM   483  C  CA  . LYS A 1 60  ? 32.049 138.342 80.358 1.00 45.54  ? 63   LYS A CA  1 
ATOM   484  C  C   . LYS A 1 60  ? 33.556 138.601 80.512 1.00 47.38  ? 63   LYS A C   1 
ATOM   485  O  O   . LYS A 1 60  ? 34.194 139.151 79.602 1.00 48.15  ? 63   LYS A O   1 
ATOM   486  C  CB  . LYS A 1 60  ? 31.824 136.829 80.148 1.00 43.97  ? 63   LYS A CB  1 
ATOM   487  C  CG  . LYS A 1 60  ? 30.535 136.269 80.695 1.00 41.31  ? 63   LYS A CG  1 
ATOM   488  C  CD  . LYS A 1 60  ? 29.376 136.743 79.857 1.00 46.13  ? 63   LYS A CD  1 
ATOM   489  C  CE  . LYS A 1 60  ? 28.057 136.427 80.505 1.00 49.32  ? 63   LYS A CE  1 
ATOM   490  N  NZ  . LYS A 1 60  ? 27.913 137.193 81.764 1.00 55.86  ? 63   LYS A NZ  1 
ATOM   491  N  N   . LYS A 1 61  ? 34.117 138.239 81.672 1.00 49.25  ? 64   LYS A N   1 
ATOM   492  C  CA  . LYS A 1 61  ? 35.563 138.381 81.896 1.00 54.77  ? 64   LYS A CA  1 
ATOM   493  C  C   . LYS A 1 61  ? 36.329 137.295 81.099 1.00 53.16  ? 64   LYS A C   1 
ATOM   494  O  O   . LYS A 1 61  ? 35.839 136.175 80.961 1.00 53.67  ? 64   LYS A O   1 
ATOM   495  C  CB  . LYS A 1 61  ? 35.873 138.262 83.385 1.00 56.63  ? 64   LYS A CB  1 
ATOM   496  N  N   . VAL A 1 62  ? 37.497 137.622 80.545 1.00 48.60  ? 65   VAL A N   1 
ATOM   497  C  CA  . VAL A 1 62  ? 38.284 136.634 79.779 1.00 46.75  ? 65   VAL A CA  1 
ATOM   498  C  C   . VAL A 1 62  ? 38.529 135.371 80.615 1.00 53.28  ? 65   VAL A C   1 
ATOM   499  O  O   . VAL A 1 62  ? 38.216 134.256 80.195 1.00 52.32  ? 65   VAL A O   1 
ATOM   500  C  CB  . VAL A 1 62  ? 39.666 137.231 79.319 1.00 35.79  ? 65   VAL A CB  1 
ATOM   501  C  CG1 . VAL A 1 62  ? 40.540 136.192 78.604 1.00 40.33  ? 65   VAL A CG1 1 
ATOM   502  C  CG2 . VAL A 1 62  ? 39.445 138.364 78.411 1.00 33.31  ? 65   VAL A CG2 1 
ATOM   503  N  N   . THR A 1 63  ? 39.010 135.589 81.836 1.00 60.95  ? 66   THR A N   1 
ATOM   504  C  CA  . THR A 1 63  ? 39.351 134.539 82.797 1.00 61.28  ? 66   THR A CA  1 
ATOM   505  C  C   . THR A 1 63  ? 38.171 133.634 83.221 1.00 58.81  ? 66   THR A C   1 
ATOM   506  O  O   . THR A 1 63  ? 38.372 132.474 83.602 1.00 59.82  ? 66   THR A O   1 
ATOM   507  C  CB  . THR A 1 63  ? 40.025 135.198 84.033 1.00 62.62  ? 66   THR A CB  1 
ATOM   508  O  OG1 . THR A 1 63  ? 39.053 135.942 84.775 1.00 65.20  ? 66   THR A OG1 1 
ATOM   509  C  CG2 . THR A 1 63  ? 41.085 136.188 83.574 1.00 58.41  ? 66   THR A CG2 1 
ATOM   510  N  N   . ALA A 1 64  ? 36.951 134.155 83.111 1.00 53.65  ? 67   ALA A N   1 
ATOM   511  C  CA  . ALA A 1 64  ? 35.739 133.406 83.453 1.00 50.93  ? 67   ALA A CA  1 
ATOM   512  C  C   . ALA A 1 64  ? 35.250 132.491 82.308 1.00 53.07  ? 67   ALA A C   1 
ATOM   513  O  O   . ALA A 1 64  ? 34.233 131.797 82.438 1.00 52.15  ? 67   ALA A O   1 
ATOM   514  C  CB  . ALA A 1 64  ? 34.621 134.391 83.819 1.00 51.08  ? 67   ALA A CB  1 
ATOM   515  N  N   . GLN A 1 65  ? 35.927 132.546 81.165 1.00 54.29  ? 68   GLN A N   1 
ATOM   516  C  CA  . GLN A 1 65  ? 35.552 131.736 80.011 1.00 53.81  ? 68   GLN A CA  1 
ATOM   517  C  C   . GLN A 1 65  ? 36.520 130.580 79.980 1.00 54.38  ? 68   GLN A C   1 
ATOM   518  O  O   . GLN A 1 65  ? 37.622 130.693 80.528 1.00 58.30  ? 68   GLN A O   1 
ATOM   519  C  CB  . GLN A 1 65  ? 35.590 132.600 78.756 1.00 52.29  ? 68   GLN A CB  1 
ATOM   520  C  CG  . GLN A 1 65  ? 34.784 133.901 78.952 1.00 49.96  ? 68   GLN A CG  1 
ATOM   521  C  CD  . GLN A 1 65  ? 34.645 134.752 77.693 1.00 48.89  ? 68   GLN A CD  1 
ATOM   522  O  OE1 . GLN A 1 65  ? 34.458 134.231 76.596 1.00 50.93  ? 68   GLN A OE1 1 
ATOM   523  N  NE2 . GLN A 1 65  ? 34.700 136.072 77.860 1.00 40.92  ? 68   GLN A NE2 1 
ATOM   524  N  N   . ASP A 1 66  ? 36.112 129.455 79.397 1.00 55.10  ? 69   ASP A N   1 
ATOM   525  C  CA  . ASP A 1 66  ? 36.970 128.271 79.417 1.00 54.27  ? 69   ASP A CA  1 
ATOM   526  C  C   . ASP A 1 66  ? 38.204 128.335 78.549 1.00 54.13  ? 69   ASP A C   1 
ATOM   527  O  O   . ASP A 1 66  ? 38.485 127.412 77.805 1.00 53.31  ? 69   ASP A O   1 
ATOM   528  C  CB  . ASP A 1 66  ? 36.159 126.999 79.160 1.00 54.27  ? 69   ASP A CB  1 
ATOM   529  N  N   . VAL A 1 67  ? 38.974 129.411 78.676 1.00 57.46  ? 70   VAL A N   1 
ATOM   530  C  CA  . VAL A 1 67  ? 40.200 129.552 77.904 1.00 59.53  ? 70   VAL A CA  1 
ATOM   531  C  C   . VAL A 1 67  ? 41.183 128.478 78.337 1.00 62.05  ? 70   VAL A C   1 
ATOM   532  O  O   . VAL A 1 67  ? 41.254 128.138 79.521 1.00 62.23  ? 70   VAL A O   1 
ATOM   533  C  CB  . VAL A 1 67  ? 40.854 130.939 78.094 1.00 58.80  ? 70   VAL A CB  1 
ATOM   534  C  CG1 . VAL A 1 67  ? 40.226 131.947 77.156 1.00 54.90  ? 70   VAL A CG1 1 
ATOM   535  C  CG2 . VAL A 1 67  ? 40.724 131.397 79.554 1.00 62.66  ? 70   VAL A CG2 1 
ATOM   536  N  N   . ARG A 1 68  ? 41.874 127.904 77.349 1.00 65.78  ? 71   ARG A N   1 
ATOM   537  C  CA  . ARG A 1 68  ? 42.887 126.870 77.562 1.00 67.86  ? 71   ARG A CA  1 
ATOM   538  C  C   . ARG A 1 68  ? 44.000 127.463 78.438 1.00 67.15  ? 71   ARG A C   1 
ATOM   539  O  O   . ARG A 1 68  ? 44.883 128.165 77.938 1.00 68.19  ? 71   ARG A O   1 
ATOM   540  C  CB  . ARG A 1 68  ? 43.467 126.410 76.208 1.00 68.76  ? 71   ARG A CB  1 
ATOM   541  C  CG  . ARG A 1 68  ? 44.473 125.250 76.295 1.00 74.85  ? 71   ARG A CG  1 
ATOM   542  C  CD  . ARG A 1 68  ? 44.801 124.650 74.920 1.00 76.36  ? 71   ARG A CD  1 
ATOM   543  N  NE  . ARG A 1 68  ? 44.763 123.184 74.930 1.00 82.78  ? 71   ARG A NE  1 
ATOM   544  C  CZ  . ARG A 1 68  ? 43.651 122.457 75.071 1.00 84.37  ? 71   ARG A CZ  1 
ATOM   545  N  NH1 . ARG A 1 68  ? 42.478 123.057 75.218 1.00 79.26  ? 71   ARG A NH1 1 
ATOM   546  N  NH2 . ARG A 1 68  ? 43.704 121.124 75.060 1.00 83.47  ? 71   ARG A NH2 1 
ATOM   547  N  N   . LYS A 1 69  ? 43.921 127.196 79.743 1.00 64.15  ? 72   LYS A N   1 
ATOM   548  C  CA  . LYS A 1 69  ? 44.884 127.684 80.714 1.00 60.56  ? 72   LYS A CA  1 
ATOM   549  C  C   . LYS A 1 69  ? 46.273 127.381 80.227 1.00 60.84  ? 72   LYS A C   1 
ATOM   550  O  O   . LYS A 1 69  ? 46.661 126.213 80.100 1.00 62.69  ? 72   LYS A O   1 
ATOM   551  C  CB  . LYS A 1 69  ? 44.639 127.027 82.066 1.00 61.16  ? 72   LYS A CB  1 
ATOM   552  N  N   . GLU A 1 70  ? 46.961 128.455 79.841 1.00 62.87  ? 73   GLU A N   1 
ATOM   553  C  CA  . GLU A 1 70  ? 48.337 128.422 79.333 1.00 60.23  ? 73   GLU A CA  1 
ATOM   554  C  C   . GLU A 1 70  ? 48.801 129.870 79.284 1.00 54.28  ? 73   GLU A C   1 
ATOM   555  O  O   . GLU A 1 70  ? 48.044 130.785 79.628 1.00 57.99  ? 73   GLU A O   1 
ATOM   556  C  CB  . GLU A 1 70  ? 48.400 127.800 77.938 1.00 64.71  ? 73   GLU A CB  1 
ATOM   557  C  CG  . GLU A 1 70  ? 47.671 128.588 76.870 1.00 68.26  ? 73   GLU A CG  1 
ATOM   558  C  CD  . GLU A 1 70  ? 47.857 127.981 75.507 1.00 70.25  ? 73   GLU A CD  1 
ATOM   559  O  OE1 . GLU A 1 70  ? 47.088 127.046 75.181 1.00 74.98  ? 73   GLU A OE1 1 
ATOM   560  O  OE2 . GLU A 1 70  ? 48.786 128.424 74.783 1.00 63.59  ? 73   GLU A OE2 1 
ATOM   561  N  N   . SER A 1 71  ? 50.031 130.086 78.842 1.00 48.20  ? 74   SER A N   1 
ATOM   562  C  CA  . SER A 1 71  ? 50.553 131.436 78.785 1.00 47.94  ? 74   SER A CA  1 
ATOM   563  C  C   . SER A 1 71  ? 51.607 131.630 77.696 1.00 49.08  ? 74   SER A C   1 
ATOM   564  O  O   . SER A 1 71  ? 52.584 130.886 77.627 1.00 48.87  ? 74   SER A O   1 
ATOM   565  C  CB  . SER A 1 71  ? 51.088 131.852 80.163 1.00 46.41  ? 74   SER A CB  1 
ATOM   566  O  OG  . SER A 1 71  ? 51.044 133.258 80.337 1.00 41.66  ? 74   SER A OG  1 
ATOM   567  N  N   . PRO A 1 72  ? 51.409 132.642 76.825 1.00 46.66  ? 75   PRO A N   1 
ATOM   568  C  CA  . PRO A 1 72  ? 50.239 133.522 76.903 1.00 41.77  ? 75   PRO A CA  1 
ATOM   569  C  C   . PRO A 1 72  ? 48.954 132.851 76.423 1.00 38.66  ? 75   PRO A C   1 
ATOM   570  O  O   . PRO A 1 72  ? 48.991 131.717 75.946 1.00 37.77  ? 75   PRO A O   1 
ATOM   571  C  CB  . PRO A 1 72  ? 50.630 134.679 75.987 1.00 40.02  ? 75   PRO A CB  1 
ATOM   572  C  CG  . PRO A 1 72  ? 51.449 134.016 74.937 1.00 45.22  ? 75   PRO A CG  1 
ATOM   573  C  CD  . PRO A 1 72  ? 52.338 133.116 75.780 1.00 49.39  ? 75   PRO A CD  1 
ATOM   574  N  N   . LEU A 1 73  ? 47.819 133.508 76.665 1.00 36.21  ? 76   LEU A N   1 
ATOM   575  C  CA  . LEU A 1 73  ? 46.534 133.014 76.206 1.00 35.18  ? 76   LEU A CA  1 
ATOM   576  C  C   . LEU A 1 73  ? 46.560 133.325 74.731 1.00 31.84  ? 76   LEU A C   1 
ATOM   577  O  O   . LEU A 1 73  ? 46.903 134.433 74.368 1.00 29.90  ? 76   LEU A O   1 
ATOM   578  C  CB  . LEU A 1 73  ? 45.396 133.817 76.841 1.00 36.19  ? 76   LEU A CB  1 
ATOM   579  C  CG  . LEU A 1 73  ? 45.093 133.498 78.302 1.00 36.70  ? 76   LEU A CG  1 
ATOM   580  C  CD1 . LEU A 1 73  ? 43.812 134.208 78.746 1.00 33.99  ? 76   LEU A CD1 1 
ATOM   581  C  CD2 . LEU A 1 73  ? 44.931 131.987 78.441 1.00 41.34  ? 76   LEU A CD2 1 
ATOM   582  N  N   . LEU A 1 74  ? 46.208 132.355 73.891 1.00 31.88  ? 77   LEU A N   1 
ATOM   583  C  CA  . LEU A 1 74  ? 46.232 132.554 72.449 1.00 30.24  ? 77   LEU A CA  1 
ATOM   584  C  C   . LEU A 1 74  ? 44.870 132.795 71.812 1.00 28.97  ? 77   LEU A C   1 
ATOM   585  O  O   . LEU A 1 74  ? 44.004 131.921 71.858 1.00 37.12  ? 77   LEU A O   1 
ATOM   586  C  CB  . LEU A 1 74  ? 46.909 131.362 71.769 1.00 32.73  ? 77   LEU A CB  1 
ATOM   587  C  CG  . LEU A 1 74  ? 48.365 131.046 72.149 1.00 38.01  ? 77   LEU A CG  1 
ATOM   588  C  CD1 . LEU A 1 74  ? 48.902 129.964 71.221 1.00 37.33  ? 77   LEU A CD1 1 
ATOM   589  C  CD2 . LEU A 1 74  ? 49.254 132.292 72.082 1.00 38.63  ? 77   LEU A CD2 1 
ATOM   590  N  N   . PHE A 1 75  ? 44.695 133.954 71.175 1.00 25.45  ? 78   PHE A N   1 
ATOM   591  C  CA  . PHE A 1 75  ? 43.437 134.274 70.475 1.00 30.18  ? 78   PHE A CA  1 
ATOM   592  C  C   . PHE A 1 75  ? 43.643 134.590 69.014 1.00 30.83  ? 78   PHE A C   1 
ATOM   593  O  O   . PHE A 1 75  ? 44.608 135.235 68.665 1.00 31.15  ? 78   PHE A O   1 
ATOM   594  C  CB  . PHE A 1 75  ? 42.787 135.525 71.062 1.00 30.78  ? 78   PHE A CB  1 
ATOM   595  C  CG  . PHE A 1 75  ? 42.372 135.383 72.492 1.00 33.76  ? 78   PHE A CG  1 
ATOM   596  C  CD1 . PHE A 1 75  ? 43.197 135.822 73.513 1.00 35.50  ? 78   PHE A CD1 1 
ATOM   597  C  CD2 . PHE A 1 75  ? 41.143 134.851 72.813 1.00 30.09  ? 78   PHE A CD2 1 
ATOM   598  C  CE1 . PHE A 1 75  ? 42.789 135.737 74.829 1.00 37.20  ? 78   PHE A CE1 1 
ATOM   599  C  CE2 . PHE A 1 75  ? 40.726 134.762 74.135 1.00 33.48  ? 78   PHE A CE2 1 
ATOM   600  C  CZ  . PHE A 1 75  ? 41.544 135.205 75.141 1.00 36.43  ? 78   PHE A CZ  1 
ATOM   601  N  N   . LYS A 1 76  ? 42.678 134.241 68.173 1.00 31.13  ? 79   LYS A N   1 
ATOM   602  C  CA  . LYS A 1 76  ? 42.767 134.545 66.741 1.00 28.02  ? 79   LYS A CA  1 
ATOM   603  C  C   . LYS A 1 76  ? 41.692 135.598 66.405 1.00 22.27  ? 79   LYS A C   1 
ATOM   604  O  O   . LYS A 1 76  ? 40.522 135.429 66.734 1.00 25.57  ? 79   LYS A O   1 
ATOM   605  C  CB  . LYS A 1 76  ? 42.563 133.265 65.907 1.00 20.98  ? 79   LYS A CB  1 
ATOM   606  C  CG  . LYS A 1 76  ? 43.786 132.376 65.828 1.00 26.48  ? 79   LYS A CG  1 
ATOM   607  C  CD  . LYS A 1 76  ? 43.429 131.122 65.065 1.00 34.21  ? 79   LYS A CD  1 
ATOM   608  C  CE  . LYS A 1 76  ? 44.593 130.143 64.925 1.00 41.12  ? 79   LYS A CE  1 
ATOM   609  N  NZ  . LYS A 1 76  ? 44.078 128.813 64.438 1.00 35.47  ? 79   LYS A NZ  1 
ATOM   610  N  N   . PHE A 1 77  ? 42.113 136.725 65.850 1.00 21.68  ? 80   PHE A N   1 
ATOM   611  C  CA  . PHE A 1 77  ? 41.184 137.781 65.474 1.00 21.04  ? 80   PHE A CA  1 
ATOM   612  C  C   . PHE A 1 77  ? 40.709 137.459 64.068 1.00 25.59  ? 80   PHE A C   1 
ATOM   613  O  O   . PHE A 1 77  ? 41.523 137.439 63.128 1.00 22.97  ? 80   PHE A O   1 
ATOM   614  C  CB  . PHE A 1 77  ? 41.908 139.120 65.469 1.00 19.21  ? 80   PHE A CB  1 
ATOM   615  C  CG  . PHE A 1 77  ? 41.023 140.288 65.167 1.00 20.29  ? 80   PHE A CG  1 
ATOM   616  C  CD1 . PHE A 1 77  ? 40.209 140.854 66.181 1.00 22.11  ? 80   PHE A CD1 1 
ATOM   617  C  CD2 . PHE A 1 77  ? 41.021 140.855 63.906 1.00 17.54  ? 80   PHE A CD2 1 
ATOM   618  C  CE1 . PHE A 1 77  ? 39.405 141.972 65.940 1.00 22.09  ? 80   PHE A CE1 1 
ATOM   619  C  CE2 . PHE A 1 77  ? 40.218 141.997 63.645 1.00 19.98  ? 80   PHE A CE2 1 
ATOM   620  C  CZ  . PHE A 1 77  ? 39.407 142.548 64.681 1.00 27.52  ? 80   PHE A CZ  1 
ATOM   621  N  N   . ARG A 1 78  ? 39.410 137.163 63.927 1.00 24.30  ? 81   ARG A N   1 
ATOM   622  C  CA  . ARG A 1 78  ? 38.849 136.791 62.618 1.00 21.58  ? 81   ARG A CA  1 
ATOM   623  C  C   . ARG A 1 78  ? 37.506 137.401 62.389 1.00 15.46  ? 81   ARG A C   1 
ATOM   624  O  O   . ARG A 1 78  ? 36.896 137.872 63.323 1.00 20.09  ? 81   ARG A O   1 
ATOM   625  C  CB  . ARG A 1 78  ? 38.708 135.257 62.534 1.00 23.54  ? 81   ARG A CB  1 
ATOM   626  C  CG  . ARG A 1 78  ? 40.079 134.542 62.440 1.00 26.79  ? 81   ARG A CG  1 
ATOM   627  C  CD  . ARG A 1 78  ? 39.934 133.057 62.549 1.00 33.06  ? 81   ARG A CD  1 
ATOM   628  N  NE  . ARG A 1 78  ? 39.218 132.513 61.379 1.00 46.11  ? 81   ARG A NE  1 
ATOM   629  C  CZ  . ARG A 1 78  ? 39.777 132.083 60.231 1.00 42.16  ? 81   ARG A CZ  1 
ATOM   630  N  NH1 . ARG A 1 78  ? 41.100 132.103 60.022 1.00 35.19  ? 81   ARG A NH1 1 
ATOM   631  N  NH2 . ARG A 1 78  ? 38.995 131.614 59.271 1.00 38.60  ? 81   ARG A NH2 1 
ATOM   632  N  N   . ALA A 1 79  ? 37.071 137.446 61.134 1.00 17.85  ? 82   ALA A N   1 
ATOM   633  C  CA  . ALA A 1 79  ? 35.735 137.939 60.799 1.00 24.91  ? 82   ALA A CA  1 
ATOM   634  C  C   . ALA A 1 79  ? 34.769 136.829 61.143 1.00 18.78  ? 82   ALA A C   1 
ATOM   635  O  O   . ALA A 1 79  ? 35.000 135.661 60.802 1.00 22.13  ? 82   ALA A O   1 
ATOM   636  C  CB  . ALA A 1 79  ? 35.595 138.297 59.287 1.00 18.81  ? 82   ALA A CB  1 
ATOM   637  N  N   . LYS A 1 80  ? 33.755 137.180 61.920 1.00 18.39  ? 83   LYS A N   1 
ATOM   638  C  CA  . LYS A 1 80  ? 32.693 136.255 62.303 1.00 15.16  ? 83   LYS A CA  1 
ATOM   639  C  C   . LYS A 1 80  ? 31.495 136.472 61.376 1.00 18.75  ? 83   LYS A C   1 
ATOM   640  O  O   . LYS A 1 80  ? 30.675 135.569 61.174 1.00 19.90  ? 83   LYS A O   1 
ATOM   641  C  CB  . LYS A 1 80  ? 32.256 136.531 63.717 1.00 17.34  ? 83   LYS A CB  1 
ATOM   642  C  CG  . LYS A 1 80  ? 31.239 135.572 64.245 1.00 15.84  ? 83   LYS A CG  1 
ATOM   643  C  CD  . LYS A 1 80  ? 31.154 135.722 65.739 1.00 18.13  ? 83   LYS A CD  1 
ATOM   644  C  CE  . LYS A 1 80  ? 30.058 134.871 66.325 1.00 27.66  ? 83   LYS A CE  1 
ATOM   645  N  NZ  . LYS A 1 80  ? 29.942 135.111 67.781 1.00 36.09  ? 83   LYS A NZ  1 
ATOM   646  N  N   . PHE A 1 81  ? 31.382 137.694 60.854 1.00 20.83  ? 84   PHE A N   1 
ATOM   647  C  CA  . PHE A 1 81  ? 30.308 138.071 59.938 1.00 19.36  ? 84   PHE A CA  1 
ATOM   648  C  C   . PHE A 1 81  ? 30.933 138.650 58.678 1.00 16.54  ? 84   PHE A C   1 
ATOM   649  O  O   . PHE A 1 81  ? 32.042 139.221 58.684 1.00 18.33  ? 84   PHE A O   1 
ATOM   650  C  CB  . PHE A 1 81  ? 29.358 139.098 60.564 1.00 17.68  ? 84   PHE A CB  1 
ATOM   651  C  CG  . PHE A 1 81  ? 28.707 138.614 61.822 1.00 22.56  ? 84   PHE A CG  1 
ATOM   652  C  CD1 . PHE A 1 81  ? 29.189 139.018 63.072 1.00 23.65  ? 84   PHE A CD1 1 
ATOM   653  C  CD2 . PHE A 1 81  ? 27.715 137.632 61.773 1.00 17.04  ? 84   PHE A CD2 1 
ATOM   654  C  CE1 . PHE A 1 81  ? 28.702 138.431 64.268 1.00 22.34  ? 84   PHE A CE1 1 
ATOM   655  C  CE2 . PHE A 1 81  ? 27.235 137.046 62.949 1.00 21.63  ? 84   PHE A CE2 1 
ATOM   656  C  CZ  . PHE A 1 81  ? 27.728 137.442 64.200 1.00 20.40  ? 84   PHE A CZ  1 
ATOM   657  N  N   . TYR A 1 82  ? 30.230 138.430 57.574 1.00 23.81  ? 85   TYR A N   1 
ATOM   658  C  CA  . TYR A 1 82  ? 30.642 138.900 56.259 1.00 16.24  ? 85   TYR A CA  1 
ATOM   659  C  C   . TYR A 1 82  ? 29.655 139.912 55.733 1.00 14.82  ? 85   TYR A C   1 
ATOM   660  O  O   . TYR A 1 82  ? 28.438 139.813 55.967 1.00 18.92  ? 85   TYR A O   1 
ATOM   661  C  CB  . TYR A 1 82  ? 30.678 137.759 55.234 1.00 18.21  ? 85   TYR A CB  1 
ATOM   662  C  CG  . TYR A 1 82  ? 31.688 136.693 55.527 1.00 17.85  ? 85   TYR A CG  1 
ATOM   663  C  CD1 . TYR A 1 82  ? 31.597 135.932 56.693 1.00 23.72  ? 85   TYR A CD1 1 
ATOM   664  C  CD2 . TYR A 1 82  ? 32.780 136.486 54.682 1.00 22.16  ? 85   TYR A CD2 1 
ATOM   665  C  CE1 . TYR A 1 82  ? 32.572 134.992 57.037 1.00 29.54  ? 85   TYR A CE1 1 
ATOM   666  C  CE2 . TYR A 1 82  ? 33.779 135.549 55.012 1.00 26.21  ? 85   TYR A CE2 1 
ATOM   667  C  CZ  . TYR A 1 82  ? 33.662 134.815 56.197 1.00 24.05  ? 85   TYR A CZ  1 
ATOM   668  O  OH  . TYR A 1 82  ? 34.648 133.930 56.575 1.00 36.87  ? 85   TYR A OH  1 
ATOM   669  N  N   . PRO A 1 83  ? 30.160 140.909 55.005 1.00 15.81  ? 86   PRO A N   1 
ATOM   670  C  CA  . PRO A 1 83  ? 29.284 141.922 54.421 1.00 20.88  ? 86   PRO A CA  1 
ATOM   671  C  C   . PRO A 1 83  ? 28.495 141.289 53.268 1.00 27.97  ? 86   PRO A C   1 
ATOM   672  O  O   . PRO A 1 83  ? 28.888 140.245 52.724 1.00 27.57  ? 86   PRO A O   1 
ATOM   673  C  CB  . PRO A 1 83  ? 30.268 142.938 53.837 1.00 19.43  ? 86   PRO A CB  1 
ATOM   674  C  CG  . PRO A 1 83  ? 31.396 142.125 53.455 1.00 15.39  ? 86   PRO A CG  1 
ATOM   675  C  CD  . PRO A 1 83  ? 31.559 141.185 54.657 1.00 14.19  ? 86   PRO A CD  1 
ATOM   676  N  N   . GLU A 1 84  ? 27.383 141.900 52.882 1.00 30.62  ? 87   GLU A N   1 
ATOM   677  C  CA  . GLU A 1 84  ? 26.635 141.358 51.742 1.00 34.24  ? 87   GLU A CA  1 
ATOM   678  C  C   . GLU A 1 84  ? 27.317 141.721 50.431 1.00 33.62  ? 87   GLU A C   1 
ATOM   679  O  O   . GLU A 1 84  ? 27.275 140.968 49.466 1.00 34.77  ? 87   GLU A O   1 
ATOM   680  C  CB  . GLU A 1 84  ? 25.212 141.885 51.727 1.00 27.96  ? 87   GLU A CB  1 
ATOM   681  C  CG  . GLU A 1 84  ? 24.405 141.426 52.938 1.00 31.97  ? 87   GLU A CG  1 
ATOM   682  C  CD  . GLU A 1 84  ? 23.026 142.051 52.992 1.00 24.78  ? 87   GLU A CD  1 
ATOM   683  O  OE1 . GLU A 1 84  ? 22.555 142.329 54.125 1.00 21.76  ? 87   GLU A OE1 1 
ATOM   684  O  OE2 . GLU A 1 84  ? 22.421 142.218 51.904 1.00 26.37  ? 87   GLU A OE2 1 
ATOM   685  N  N   . ASP A 1 85  ? 28.013 142.847 50.446 1.00 29.37  ? 88   ASP A N   1 
ATOM   686  C  CA  . ASP A 1 85  ? 28.706 143.346 49.280 1.00 30.49  ? 88   ASP A CA  1 
ATOM   687  C  C   . ASP A 1 85  ? 29.975 144.025 49.788 1.00 31.02  ? 88   ASP A C   1 
ATOM   688  O  O   . ASP A 1 85  ? 29.912 144.895 50.664 1.00 31.61  ? 88   ASP A O   1 
ATOM   689  C  CB  . ASP A 1 85  ? 27.769 144.315 48.541 1.00 35.98  ? 88   ASP A CB  1 
ATOM   690  C  CG  . ASP A 1 85  ? 28.285 144.704 47.177 1.00 40.93  ? 88   ASP A CG  1 
ATOM   691  O  OD1 . ASP A 1 85  ? 28.290 145.907 46.832 1.00 45.41  ? 88   ASP A OD1 1 
ATOM   692  O  OD2 . ASP A 1 85  ? 28.702 143.800 46.446 1.00 45.67  ? 88   ASP A OD2 1 
ATOM   693  N  N   . VAL A 1 86  ? 31.128 143.584 49.288 1.00 24.97  ? 89   VAL A N   1 
ATOM   694  C  CA  . VAL A 1 86  ? 32.406 144.127 49.733 1.00 28.83  ? 89   VAL A CA  1 
ATOM   695  C  C   . VAL A 1 86  ? 32.684 145.535 49.283 1.00 34.46  ? 89   VAL A C   1 
ATOM   696  O  O   . VAL A 1 86  ? 33.202 146.327 50.080 1.00 38.55  ? 89   VAL A O   1 
ATOM   697  C  CB  . VAL A 1 86  ? 33.639 143.238 49.372 1.00 25.86  ? 89   VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 86  ? 33.643 141.988 50.258 1.00 24.79  ? 89   VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 86  ? 33.634 142.879 47.897 1.00 29.81  ? 89   VAL A CG2 1 
ATOM   700  N  N   . SER A 1 87  ? 32.294 145.870 48.048 1.00 38.29  ? 90   SER A N   1 
ATOM   701  C  CA  . SER A 1 87  ? 32.558 147.208 47.513 1.00 40.77  ? 90   SER A CA  1 
ATOM   702  C  C   . SER A 1 87  ? 31.740 148.307 48.205 1.00 40.09  ? 90   SER A C   1 
ATOM   703  O  O   . SER A 1 87  ? 32.111 149.483 48.166 1.00 48.97  ? 90   SER A O   1 
ATOM   704  C  CB  . SER A 1 87  ? 32.417 147.238 45.991 1.00 38.89  ? 90   SER A CB  1 
ATOM   705  O  OG  . SER A 1 87  ? 31.099 146.958 45.588 1.00 45.71  ? 90   SER A OG  1 
ATOM   706  N  N   . GLU A 1 88  ? 30.665 147.936 48.890 1.00 37.20  ? 91   GLU A N   1 
ATOM   707  C  CA  . GLU A 1 88  ? 29.925 148.945 49.626 1.00 38.50  ? 91   GLU A CA  1 
ATOM   708  C  C   . GLU A 1 88  ? 30.121 148.909 51.143 1.00 37.35  ? 91   GLU A C   1 
ATOM   709  O  O   . GLU A 1 88  ? 29.958 149.921 51.816 1.00 38.60  ? 91   GLU A O   1 
ATOM   710  C  CB  . GLU A 1 88  ? 28.446 148.950 49.245 1.00 41.73  ? 91   GLU A CB  1 
ATOM   711  C  CG  . GLU A 1 88  ? 27.583 147.860 49.785 1.00 55.14  ? 91   GLU A CG  1 
ATOM   712  C  CD  . GLU A 1 88  ? 26.205 147.813 49.093 1.00 65.63  ? 91   GLU A CD  1 
ATOM   713  O  OE1 . GLU A 1 88  ? 25.909 148.687 48.239 1.00 65.45  ? 91   GLU A OE1 1 
ATOM   714  O  OE2 . GLU A 1 88  ? 25.419 146.885 49.394 1.00 65.47  ? 91   GLU A OE2 1 
ATOM   715  N  N   . GLU A 1 89  ? 30.647 147.812 51.665 1.00 29.76  ? 92   GLU A N   1 
ATOM   716  C  CA  . GLU A 1 89  ? 30.775 147.718 53.090 1.00 28.85  ? 92   GLU A CA  1 
ATOM   717  C  C   . GLU A 1 89  ? 32.141 147.660 53.718 1.00 34.96  ? 92   GLU A C   1 
ATOM   718  O  O   . GLU A 1 89  ? 32.272 147.757 54.938 1.00 40.78  ? 92   GLU A O   1 
ATOM   719  C  CB  . GLU A 1 89  ? 29.924 146.547 53.577 1.00 26.25  ? 92   GLU A CB  1 
ATOM   720  C  CG  . GLU A 1 89  ? 28.455 146.596 53.092 1.00 29.03  ? 92   GLU A CG  1 
ATOM   721  C  CD  . GLU A 1 89  ? 27.679 145.369 53.526 1.00 33.22  ? 92   GLU A CD  1 
ATOM   722  O  OE1 . GLU A 1 89  ? 27.794 145.074 54.714 1.00 36.75  ? 92   GLU A OE1 1 
ATOM   723  O  OE2 . GLU A 1 89  ? 26.972 144.703 52.719 1.00 30.94  ? 92   GLU A OE2 1 
ATOM   724  N  N   . LEU A 1 90  ? 33.159 147.435 52.918 1.00 34.80  ? 93   LEU A N   1 
ATOM   725  C  CA  . LEU A 1 90  ? 34.483 147.367 53.471 1.00 31.44  ? 93   LEU A CA  1 
ATOM   726  C  C   . LEU A 1 90  ? 35.151 148.648 53.002 1.00 38.50  ? 93   LEU A C   1 
ATOM   727  O  O   . LEU A 1 90  ? 35.668 148.716 51.877 1.00 43.05  ? 93   LEU A O   1 
ATOM   728  C  CB  . LEU A 1 90  ? 35.192 146.125 52.952 1.00 31.79  ? 93   LEU A CB  1 
ATOM   729  C  CG  . LEU A 1 90  ? 34.558 144.797 53.358 1.00 32.10  ? 93   LEU A CG  1 
ATOM   730  C  CD1 . LEU A 1 90  ? 35.559 143.713 53.072 1.00 28.27  ? 93   LEU A CD1 1 
ATOM   731  C  CD2 . LEU A 1 90  ? 34.223 144.790 54.851 1.00 36.30  ? 93   LEU A CD2 1 
ATOM   732  N  N   . ILE A 1 91  ? 35.092 149.674 53.855 1.00 31.78  ? 94   ILE A N   1 
ATOM   733  C  CA  . ILE A 1 91  ? 35.665 150.966 53.535 1.00 31.49  ? 94   ILE A CA  1 
ATOM   734  C  C   . ILE A 1 91  ? 37.150 151.131 53.807 1.00 31.51  ? 94   ILE A C   1 
ATOM   735  O  O   . ILE A 1 91  ? 37.842 151.761 53.015 1.00 37.36  ? 94   ILE A O   1 
ATOM   736  C  CB  . ILE A 1 91  ? 34.847 152.091 54.193 1.00 33.22  ? 94   ILE A CB  1 
ATOM   737  C  CG1 . ILE A 1 91  ? 33.440 152.104 53.606 1.00 31.85  ? 94   ILE A CG1 1 
ATOM   738  C  CG2 . ILE A 1 91  ? 35.467 153.452 53.893 1.00 38.51  ? 94   ILE A CG2 1 
ATOM   739  C  CD1 . ILE A 1 91  ? 33.378 152.601 52.149 1.00 40.96  ? 94   ILE A CD1 1 
ATOM   740  N  N   . GLN A 1 92  ? 37.661 150.551 54.888 1.00 28.91  ? 95   GLN A N   1 
ATOM   741  C  CA  . GLN A 1 92  ? 39.077 150.698 55.209 1.00 26.00  ? 95   GLN A CA  1 
ATOM   742  C  C   . GLN A 1 92  ? 39.967 149.702 54.513 1.00 27.86  ? 95   GLN A C   1 
ATOM   743  O  O   . GLN A 1 92  ? 39.478 148.673 54.047 1.00 26.57  ? 95   GLN A O   1 
ATOM   744  C  CB  . GLN A 1 92  ? 39.312 150.598 56.706 1.00 26.95  ? 95   GLN A CB  1 
ATOM   745  C  CG  . GLN A 1 92  ? 38.641 151.655 57.510 1.00 25.26  ? 95   GLN A CG  1 
ATOM   746  C  CD  . GLN A 1 92  ? 38.957 151.486 58.960 1.00 22.56  ? 95   GLN A CD  1 
ATOM   747  O  OE1 . GLN A 1 92  ? 38.166 150.960 59.708 1.00 32.11  ? 95   GLN A OE1 1 
ATOM   748  N  NE2 . GLN A 1 92  ? 40.147 151.857 59.347 1.00 24.79  ? 95   GLN A NE2 1 
ATOM   749  N  N   . ASP A 1 93  ? 41.266 150.040 54.460 1.00 29.63  ? 96   ASP A N   1 
ATOM   750  C  CA  . ASP A 1 93  ? 42.339 149.231 53.888 1.00 31.50  ? 96   ASP A CA  1 
ATOM   751  C  C   . ASP A 1 93  ? 42.632 148.026 54.771 1.00 35.82  ? 96   ASP A C   1 
ATOM   752  O  O   . ASP A 1 93  ? 42.813 146.919 54.276 1.00 41.64  ? 96   ASP A O   1 
ATOM   753  C  CB  . ASP A 1 93  ? 43.606 150.041 53.677 1.00 35.49  ? 96   ASP A CB  1 
ATOM   754  C  CG  . ASP A 1 93  ? 43.660 150.658 52.302 1.00 50.51  ? 96   ASP A CG  1 
ATOM   755  O  OD1 . ASP A 1 93  ? 43.119 150.034 51.363 1.00 62.34  ? 96   ASP A OD1 1 
ATOM   756  O  OD2 . ASP A 1 93  ? 44.234 151.757 52.142 1.00 55.26  ? 96   ASP A OD2 1 
ATOM   757  N  N   . ILE A 1 94  ? 42.699 148.242 56.074 1.00 29.97  ? 97   ILE A N   1 
ATOM   758  C  CA  . ILE A 1 94  ? 42.927 147.144 57.002 1.00 30.54  ? 97   ILE A CA  1 
ATOM   759  C  C   . ILE A 1 94  ? 41.745 146.122 56.965 1.00 32.90  ? 97   ILE A C   1 
ATOM   760  O  O   . ILE A 1 94  ? 41.962 144.915 57.037 1.00 31.09  ? 97   ILE A O   1 
ATOM   761  C  CB  . ILE A 1 94  ? 43.152 147.700 58.427 1.00 33.83  ? 97   ILE A CB  1 
ATOM   762  C  CG1 . ILE A 1 94  ? 43.457 146.567 59.434 1.00 32.48  ? 97   ILE A CG1 1 
ATOM   763  C  CG2 . ILE A 1 94  ? 41.941 148.565 58.840 1.00 26.94  ? 97   ILE A CG2 1 
ATOM   764  C  CD1 . ILE A 1 94  ? 44.738 145.810 59.226 1.00 33.88  ? 97   ILE A CD1 1 
ATOM   765  N  N   . THR A 1 95  ? 40.511 146.606 56.800 1.00 26.32  ? 98   THR A N   1 
ATOM   766  C  CA  . THR A 1 95  ? 39.331 145.744 56.788 1.00 26.76  ? 98   THR A CA  1 
ATOM   767  C  C   . THR A 1 95  ? 39.315 144.848 55.527 1.00 26.59  ? 98   THR A C   1 
ATOM   768  O  O   . THR A 1 95  ? 38.972 143.661 55.580 1.00 24.13  ? 98   THR A O   1 
ATOM   769  C  CB  . THR A 1 95  ? 38.014 146.607 56.834 1.00 24.43  ? 98   THR A CB  1 
ATOM   770  O  OG1 . THR A 1 95  ? 38.128 147.575 57.884 1.00 27.99  ? 98   THR A OG1 1 
ATOM   771  C  CG2 . THR A 1 95  ? 36.720 145.719 57.090 1.00 17.51  ? 98   THR A CG2 1 
ATOM   772  N  N   . GLN A 1 96  ? 39.653 145.443 54.389 1.00 23.36  ? 99   GLN A N   1 
ATOM   773  C  CA  . GLN A 1 96  ? 39.681 144.719 53.138 1.00 24.02  ? 99   GLN A CA  1 
ATOM   774  C  C   . GLN A 1 96  ? 40.757 143.685 53.153 1.00 22.17  ? 99   GLN A C   1 
ATOM   775  O  O   . GLN A 1 96  ? 40.538 142.555 52.744 1.00 24.70  ? 99   GLN A O   1 
ATOM   776  C  CB  . GLN A 1 96  ? 39.869 145.635 51.921 1.00 24.88  ? 99   GLN A CB  1 
ATOM   777  C  CG  . GLN A 1 96  ? 38.676 146.532 51.665 1.00 34.00  ? 99   GLN A CG  1 
ATOM   778  C  CD  . GLN A 1 96  ? 38.616 147.050 50.251 1.00 47.11  ? 99   GLN A CD  1 
ATOM   779  O  OE1 . GLN A 1 96  ? 39.014 146.358 49.296 1.00 41.94  ? 99   GLN A OE1 1 
ATOM   780  N  NE2 . GLN A 1 96  ? 38.096 148.271 50.097 1.00 50.35  ? 99   GLN A NE2 1 
ATOM   781  N  N   . ARG A 1 97  ? 41.927 144.081 53.629 1.00 27.46  ? 100  ARG A N   1 
ATOM   782  C  CA  . ARG A 1 97  ? 43.059 143.187 53.709 1.00 27.23  ? 100  ARG A CA  1 
ATOM   783  C  C   . ARG A 1 97  ? 42.722 141.974 54.578 1.00 31.41  ? 100  ARG A C   1 
ATOM   784  O  O   . ARG A 1 97  ? 42.867 140.832 54.114 1.00 28.82  ? 100  ARG A O   1 
ATOM   785  C  CB  . ARG A 1 97  ? 44.303 143.929 54.185 1.00 24.96  ? 100  ARG A CB  1 
ATOM   786  C  CG  . ARG A 1 97  ? 45.546 143.147 54.055 1.00 31.27  ? 100  ARG A CG  1 
ATOM   787  C  CD  . ARG A 1 97  ? 46.774 144.023 54.236 1.00 43.64  ? 100  ARG A CD  1 
ATOM   788  N  NE  . ARG A 1 97  ? 46.992 144.497 55.605 1.00 45.74  ? 100  ARG A NE  1 
ATOM   789  C  CZ  . ARG A 1 97  ? 46.775 145.748 56.007 1.00 53.10  ? 100  ARG A CZ  1 
ATOM   790  N  NH1 . ARG A 1 97  ? 46.310 146.660 55.156 1.00 57.36  ? 100  ARG A NH1 1 
ATOM   791  N  NH2 . ARG A 1 97  ? 47.096 146.112 57.238 1.00 54.27  ? 100  ARG A NH2 1 
ATOM   792  N  N   . LEU A 1 98  ? 42.150 142.226 55.766 1.00 25.46  ? 101  LEU A N   1 
ATOM   793  C  CA  . LEU A 1 98  ? 41.803 141.163 56.714 1.00 28.66  ? 101  LEU A CA  1 
ATOM   794  C  C   . LEU A 1 98  ? 40.812 140.172 56.135 1.00 27.38  ? 101  LEU A C   1 
ATOM   795  O  O   . LEU A 1 98  ? 41.035 138.958 56.254 1.00 24.38  ? 101  LEU A O   1 
ATOM   796  C  CB  . LEU A 1 98  ? 41.340 141.715 58.061 1.00 27.30  ? 101  LEU A CB  1 
ATOM   797  C  CG  . LEU A 1 98  ? 42.480 142.291 58.932 1.00 38.91  ? 101  LEU A CG  1 
ATOM   798  C  CD1 . LEU A 1 98  ? 41.947 142.608 60.340 1.00 33.09  ? 101  LEU A CD1 1 
ATOM   799  C  CD2 . LEU A 1 98  ? 43.706 141.360 58.998 1.00 22.93  ? 101  LEU A CD2 1 
ATOM   800  N  N   . PHE A 1 99  ? 39.746 140.680 55.506 1.00 22.61  ? 102  PHE A N   1 
ATOM   801  C  CA  . PHE A 1 99  ? 38.747 139.827 54.845 1.00 21.97  ? 102  PHE A CA  1 
ATOM   802  C  C   . PHE A 1 99  ? 39.391 139.026 53.668 1.00 21.29  ? 102  PHE A C   1 
ATOM   803  O  O   . PHE A 1 99  ? 39.113 137.843 53.485 1.00 16.48  ? 102  PHE A O   1 
ATOM   804  C  CB  . PHE A 1 99  ? 37.589 140.656 54.267 1.00 12.44  ? 102  PHE A CB  1 
ATOM   805  C  CG  . PHE A 1 99  ? 36.397 140.635 55.103 1.00 21.98  ? 102  PHE A CG  1 
ATOM   806  C  CD1 . PHE A 1 99  ? 36.065 141.734 55.881 1.00 28.26  ? 102  PHE A CD1 1 
ATOM   807  C  CD2 . PHE A 1 99  ? 35.639 139.493 55.204 1.00 17.21  ? 102  PHE A CD2 1 
ATOM   808  C  CE1 . PHE A 1 99  ? 34.978 141.685 56.767 1.00 30.18  ? 102  PHE A CE1 1 
ATOM   809  C  CE2 . PHE A 1 99  ? 34.577 139.430 56.056 1.00 22.40  ? 102  PHE A CE2 1 
ATOM   810  C  CZ  . PHE A 1 99  ? 34.231 140.532 56.856 1.00 27.41  ? 102  PHE A CZ  1 
ATOM   811  N  N   . PHE A 1 100 ? 40.245 139.700 52.897 1.00 19.74  ? 103  PHE A N   1 
ATOM   812  C  CA  . PHE A 1 100 ? 40.922 139.108 51.771 1.00 15.82  ? 103  PHE A CA  1 
ATOM   813  C  C   . PHE A 1 100 ? 41.812 137.965 52.223 1.00 19.08  ? 103  PHE A C   1 
ATOM   814  O  O   . PHE A 1 100 ? 41.726 136.865 51.658 1.00 18.03  ? 103  PHE A O   1 
ATOM   815  C  CB  . PHE A 1 100 ? 41.677 140.180 50.948 1.00 18.30  ? 103  PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 100 ? 42.821 139.651 50.086 1.00 16.61  ? 103  PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 100 ? 44.154 139.751 50.536 1.00 16.47  ? 103  PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 100 ? 42.580 139.085 48.832 1.00 15.83  ? 103  PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 100 ? 45.196 139.293 49.756 1.00 15.94  ? 103  PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 100 ? 43.643 138.623 48.036 1.00 13.47  ? 103  PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 100 ? 44.939 138.728 48.498 1.00 14.25  ? 103  PHE A CZ  1 
ATOM   822  N  N   . LEU A 1 101 ? 42.614 138.184 53.264 1.00 13.05  ? 104  LEU A N   1 
ATOM   823  C  CA  . LEU A 1 101 ? 43.514 137.127 53.702 1.00 16.87  ? 104  LEU A CA  1 
ATOM   824  C  C   . LEU A 1 101 ? 42.719 135.943 54.249 1.00 17.20  ? 104  LEU A C   1 
ATOM   825  O  O   . LEU A 1 101 ? 43.070 134.801 54.007 1.00 16.48  ? 104  LEU A O   1 
ATOM   826  C  CB  . LEU A 1 101 ? 44.562 137.643 54.703 1.00 17.67  ? 104  LEU A CB  1 
ATOM   827  C  CG  . LEU A 1 101 ? 45.510 138.718 54.083 1.00 24.76  ? 104  LEU A CG  1 
ATOM   828  C  CD1 . LEU A 1 101 ? 46.440 139.289 55.108 1.00 14.22  ? 104  LEU A CD1 1 
ATOM   829  C  CD2 . LEU A 1 101 ? 46.327 138.156 52.901 1.00 18.96  ? 104  LEU A CD2 1 
ATOM   830  N  N   . GLN A 1 102 ? 41.626 136.214 54.959 1.00 16.29  ? 105  GLN A N   1 
ATOM   831  C  CA  . GLN A 1 102 ? 40.821 135.144 55.522 1.00 12.56  ? 105  GLN A CA  1 
ATOM   832  C  C   . GLN A 1 102 ? 40.080 134.369 54.456 1.00 17.06  ? 105  GLN A C   1 
ATOM   833  O  O   . GLN A 1 102 ? 39.980 133.118 54.533 1.00 18.08  ? 105  GLN A O   1 
ATOM   834  C  CB  . GLN A 1 102 ? 39.829 135.669 56.587 1.00 11.65  ? 105  GLN A CB  1 
ATOM   835  C  CG  . GLN A 1 102 ? 38.933 134.591 57.265 1.00 15.37  ? 105  GLN A CG  1 
ATOM   836  C  CD  . GLN A 1 102 ? 38.084 135.164 58.369 1.00 15.79  ? 105  GLN A CD  1 
ATOM   837  O  OE1 . GLN A 1 102 ? 38.504 136.079 59.048 1.00 18.00  ? 105  GLN A OE1 1 
ATOM   838  N  NE2 . GLN A 1 102 ? 36.904 134.631 58.561 1.00 13.71  ? 105  GLN A NE2 1 
ATOM   839  N  N   . VAL A 1 103 ? 39.546 135.085 53.466 1.00 14.96  ? 106  VAL A N   1 
ATOM   840  C  CA  . VAL A 1 103 ? 38.798 134.444 52.381 1.00 17.41  ? 106  VAL A CA  1 
ATOM   841  C  C   . VAL A 1 103 ? 39.769 133.619 51.521 1.00 21.16  ? 106  VAL A C   1 
ATOM   842  O  O   . VAL A 1 103 ? 39.501 132.432 51.205 1.00 15.38  ? 106  VAL A O   1 
ATOM   843  C  CB  . VAL A 1 103 ? 38.044 135.484 51.531 1.00 16.41  ? 106  VAL A CB  1 
ATOM   844  C  CG1 . VAL A 1 103 ? 37.652 134.904 50.197 1.00 14.42  ? 106  VAL A CG1 1 
ATOM   845  C  CG2 . VAL A 1 103 ? 36.794 135.961 52.299 1.00 16.98  ? 106  VAL A CG2 1 
ATOM   846  N  N   . LYS A 1 104 ? 40.926 134.218 51.213 1.00 19.07  ? 107  LYS A N   1 
ATOM   847  C  CA  . LYS A 1 104 ? 41.960 133.555 50.398 1.00 17.81  ? 107  LYS A CA  1 
ATOM   848  C  C   . LYS A 1 104 ? 42.401 132.229 51.079 1.00 19.04  ? 107  LYS A C   1 
ATOM   849  O  O   . LYS A 1 104 ? 42.505 131.183 50.435 1.00 18.42  ? 107  LYS A O   1 
ATOM   850  C  CB  . LYS A 1 104 ? 43.159 134.469 50.175 1.00 17.94  ? 107  LYS A CB  1 
ATOM   851  C  CG  . LYS A 1 104 ? 44.306 133.775 49.452 1.00 16.20  ? 107  LYS A CG  1 
ATOM   852  C  CD  . LYS A 1 104 ? 45.232 134.783 48.772 1.00 21.46  ? 107  LYS A CD  1 
ATOM   853  C  CE  . LYS A 1 104 ? 46.165 135.528 49.730 1.00 13.28  ? 107  LYS A CE  1 
ATOM   854  N  NZ  . LYS A 1 104 ? 47.077 134.636 50.409 1.00 13.79  ? 107  LYS A NZ  1 
ATOM   855  N  N   . GLU A 1 105 ? 42.520 132.263 52.399 1.00 16.00  ? 108  GLU A N   1 
ATOM   856  C  CA  . GLU A 1 105 ? 42.895 131.113 53.178 1.00 13.99  ? 108  GLU A CA  1 
ATOM   857  C  C   . GLU A 1 105 ? 41.868 129.986 53.014 1.00 17.99  ? 108  GLU A C   1 
ATOM   858  O  O   . GLU A 1 105 ? 42.242 128.832 52.865 1.00 17.34  ? 108  GLU A O   1 
ATOM   859  C  CB  . GLU A 1 105 ? 43.004 131.486 54.649 1.00 18.60  ? 108  GLU A CB  1 
ATOM   860  C  CG  . GLU A 1 105 ? 43.213 130.246 55.544 1.00 27.20  ? 108  GLU A CG  1 
ATOM   861  C  CD  . GLU A 1 105 ? 43.437 130.625 56.995 1.00 34.69  ? 108  GLU A CD  1 
ATOM   862  O  OE1 . GLU A 1 105 ? 44.625 130.781 57.400 1.00 35.24  ? 108  GLU A OE1 1 
ATOM   863  O  OE2 . GLU A 1 105 ? 42.415 130.787 57.712 1.00 33.18  ? 108  GLU A OE2 1 
ATOM   864  N  N   . GLY A 1 106 ? 40.585 130.328 53.054 1.00 14.09  ? 109  GLY A N   1 
ATOM   865  C  CA  . GLY A 1 106 ? 39.541 129.342 52.870 1.00 14.65  ? 109  GLY A CA  1 
ATOM   866  C  C   . GLY A 1 106 ? 39.550 128.785 51.435 1.00 19.05  ? 109  GLY A C   1 
ATOM   867  O  O   . GLY A 1 106 ? 39.296 127.604 51.203 1.00 23.60  ? 109  GLY A O   1 
ATOM   868  N  N   . ILE A 1 107 ? 39.817 129.638 50.451 1.00 20.85  ? 110  ILE A N   1 
ATOM   869  C  CA  . ILE A 1 107 ? 39.877 129.183 49.078 1.00 16.38  ? 110  ILE A CA  1 
ATOM   870  C  C   . ILE A 1 107 ? 41.044 128.235 48.882 1.00 19.21  ? 110  ILE A C   1 
ATOM   871  O  O   . ILE A 1 107 ? 40.864 127.123 48.404 1.00 19.52  ? 110  ILE A O   1 
ATOM   872  C  CB  . ILE A 1 107 ? 39.953 130.345 48.145 1.00 17.47  ? 110  ILE A CB  1 
ATOM   873  C  CG1 . ILE A 1 107 ? 38.545 130.969 48.119 1.00 17.42  ? 110  ILE A CG1 1 
ATOM   874  C  CG2 . ILE A 1 107 ? 40.331 129.903 46.713 1.00 16.19  ? 110  ILE A CG2 1 
ATOM   875  C  CD1 . ILE A 1 107 ? 38.480 132.264 47.408 1.00 21.98  ? 110  ILE A CD1 1 
ATOM   876  N  N   . LEU A 1 108 ? 42.192 128.624 49.396 1.00 13.14  ? 111  LEU A N   1 
ATOM   877  C  CA  . LEU A 1 108 ? 43.403 127.838 49.268 1.00 15.65  ? 111  LEU A CA  1 
ATOM   878  C  C   . LEU A 1 108 ? 43.332 126.501 49.974 1.00 17.28  ? 111  LEU A C   1 
ATOM   879  O  O   . LEU A 1 108 ? 43.931 125.530 49.516 1.00 17.57  ? 111  LEU A O   1 
ATOM   880  C  CB  . LEU A 1 108 ? 44.615 128.660 49.729 1.00 18.72  ? 111  LEU A CB  1 
ATOM   881  C  CG  . LEU A 1 108 ? 44.915 129.825 48.754 1.00 20.92  ? 111  LEU A CG  1 
ATOM   882  C  CD1 . LEU A 1 108 ? 46.064 130.678 49.289 1.00 19.98  ? 111  LEU A CD1 1 
ATOM   883  C  CD2 . LEU A 1 108 ? 45.206 129.275 47.371 1.00 12.32  ? 111  LEU A CD2 1 
ATOM   884  N  N   . ASN A 1 109 ? 42.599 126.439 51.083 1.00 18.25  ? 112  ASN A N   1 
ATOM   885  C  CA  . ASN A 1 109 ? 42.446 125.196 51.835 1.00 24.28  ? 112  ASN A CA  1 
ATOM   886  C  C   . ASN A 1 109 ? 41.221 124.365 51.434 1.00 19.76  ? 112  ASN A C   1 
ATOM   887  O  O   . ASN A 1 109 ? 40.886 123.373 52.077 1.00 24.92  ? 112  ASN A O   1 
ATOM   888  C  CB  . ASN A 1 109 ? 42.400 125.454 53.342 1.00 27.05  ? 112  ASN A CB  1 
ATOM   889  C  CG  . ASN A 1 109 ? 43.733 125.860 53.881 1.00 49.17  ? 112  ASN A CG  1 
ATOM   890  O  OD1 . ASN A 1 109 ? 43.822 126.695 54.799 1.00 60.24  ? 112  ASN A OD1 1 
ATOM   891  N  ND2 . ASN A 1 109 ? 44.809 125.290 53.297 1.00 48.55  ? 112  ASN A ND2 1 
ATOM   892  N  N   . ASP A 1 110 ? 40.496 124.836 50.435 1.00 23.54  ? 113  ASP A N   1 
ATOM   893  C  CA  . ASP A 1 110 ? 39.307 124.157 49.936 1.00 23.71  ? 113  ASP A CA  1 
ATOM   894  C  C   . ASP A 1 110 ? 38.084 124.116 50.879 1.00 28.05  ? 113  ASP A C   1 
ATOM   895  O  O   . ASP A 1 110 ? 37.209 123.233 50.778 1.00 31.78  ? 113  ASP A O   1 
ATOM   896  C  CB  . ASP A 1 110 ? 39.664 122.744 49.387 1.00 28.12  ? 113  ASP A CB  1 
ATOM   897  C  CG  . ASP A 1 110 ? 38.974 122.429 48.038 1.00 26.57  ? 113  ASP A CG  1 
ATOM   898  O  OD1 . ASP A 1 110 ? 37.833 122.877 47.813 1.00 31.24  ? 113  ASP A OD1 1 
ATOM   899  O  OD2 . ASP A 1 110 ? 39.576 121.750 47.172 1.00 28.87  ? 113  ASP A OD2 1 
ATOM   900  N  N   . ASP A 1 111 ? 38.018 125.072 51.800 1.00 27.80  ? 114  ASP A N   1 
ATOM   901  C  CA  . ASP A 1 111 ? 36.869 125.212 52.691 1.00 22.20  ? 114  ASP A CA  1 
ATOM   902  C  C   . ASP A 1 111 ? 35.732 125.804 51.820 1.00 19.67  ? 114  ASP A C   1 
ATOM   903  O  O   . ASP A 1 111 ? 34.522 125.523 51.996 1.00 21.27  ? 114  ASP A O   1 
ATOM   904  C  CB  . ASP A 1 111 ? 37.197 126.149 53.851 1.00 22.37  ? 114  ASP A CB  1 
ATOM   905  C  CG  . ASP A 1 111 ? 38.355 125.642 54.714 1.00 30.99  ? 114  ASP A CG  1 
ATOM   906  O  OD1 . ASP A 1 111 ? 38.421 124.426 54.943 1.00 25.03  ? 114  ASP A OD1 1 
ATOM   907  O  OD2 . ASP A 1 111 ? 39.209 126.450 55.170 1.00 39.63  ? 114  ASP A OD2 1 
ATOM   908  N  N   . ILE A 1 112 ? 36.138 126.629 50.863 1.00 17.32  ? 115  ILE A N   1 
ATOM   909  C  CA  . ILE A 1 112 ? 35.201 127.273 49.949 1.00 22.10  ? 115  ILE A CA  1 
ATOM   910  C  C   . ILE A 1 112 ? 35.506 126.760 48.548 1.00 16.12  ? 115  ILE A C   1 
ATOM   911  O  O   . ILE A 1 112 ? 36.516 127.130 47.974 1.00 22.70  ? 115  ILE A O   1 
ATOM   912  C  CB  . ILE A 1 112 ? 35.438 128.788 49.867 1.00 24.42  ? 115  ILE A CB  1 
ATOM   913  C  CG1 . ILE A 1 112 ? 35.358 129.453 51.239 1.00 32.47  ? 115  ILE A CG1 1 
ATOM   914  C  CG2 . ILE A 1 112 ? 34.461 129.408 48.912 1.00 20.90  ? 115  ILE A CG2 1 
ATOM   915  C  CD1 . ILE A 1 112 ? 35.851 130.900 51.195 1.00 32.03  ? 115  ILE A CD1 1 
ATOM   916  N  N   . TYR A 1 113 ? 34.654 125.913 48.002 1.00 17.76  ? 116  TYR A N   1 
ATOM   917  C  CA  . TYR A 1 113 ? 34.911 125.409 46.660 1.00 17.74  ? 116  TYR A CA  1 
ATOM   918  C  C   . TYR A 1 113 ? 35.080 126.538 45.653 1.00 19.68  ? 116  TYR A C   1 
ATOM   919  O  O   . TYR A 1 113 ? 34.327 127.505 45.645 1.00 19.73  ? 116  TYR A O   1 
ATOM   920  C  CB  . TYR A 1 113 ? 33.804 124.513 46.168 1.00 10.77  ? 116  TYR A CB  1 
ATOM   921  C  CG  . TYR A 1 113 ? 33.985 124.122 44.735 1.00 13.68  ? 116  TYR A CG  1 
ATOM   922  C  CD1 . TYR A 1 113 ? 34.845 123.069 44.386 1.00 15.26  ? 116  TYR A CD1 1 
ATOM   923  C  CD2 . TYR A 1 113 ? 33.365 124.830 43.723 1.00 14.59  ? 116  TYR A CD2 1 
ATOM   924  C  CE1 . TYR A 1 113 ? 35.061 122.757 43.063 1.00 14.23  ? 116  TYR A CE1 1 
ATOM   925  C  CE2 . TYR A 1 113 ? 33.588 124.515 42.416 1.00 14.82  ? 116  TYR A CE2 1 
ATOM   926  C  CZ  . TYR A 1 113 ? 34.429 123.488 42.094 1.00 11.89  ? 116  TYR A CZ  1 
ATOM   927  O  OH  . TYR A 1 113 ? 34.661 123.216 40.778 1.00 15.46  ? 116  TYR A OH  1 
ATOM   928  N  N   . CYS A 1 114 ? 36.082 126.418 44.794 1.00 17.00  ? 117  CYS A N   1 
ATOM   929  C  CA  . CYS A 1 114 ? 36.285 127.430 43.794 1.00 13.18  ? 117  CYS A CA  1 
ATOM   930  C  C   . CYS A 1 114 ? 36.689 126.686 42.535 1.00 14.91  ? 117  CYS A C   1 
ATOM   931  O  O   . CYS A 1 114 ? 37.686 125.940 42.544 1.00 19.69  ? 117  CYS A O   1 
ATOM   932  C  CB  . CYS A 1 114 ? 37.438 128.324 44.255 1.00 16.92  ? 117  CYS A CB  1 
ATOM   933  S  SG  . CYS A 1 114 ? 37.845 129.591 43.102 1.00 22.98  ? 117  CYS A SG  1 
ATOM   934  N  N   . PRO A 1 115 ? 35.992 126.923 41.417 1.00 22.54  ? 118  PRO A N   1 
ATOM   935  C  CA  . PRO A 1 115 ? 36.383 126.209 40.181 1.00 20.33  ? 118  PRO A CA  1 
ATOM   936  C  C   . PRO A 1 115 ? 37.806 126.622 39.767 1.00 24.69  ? 118  PRO A C   1 
ATOM   937  O  O   . PRO A 1 115 ? 38.343 127.661 40.232 1.00 17.25  ? 118  PRO A O   1 
ATOM   938  C  CB  . PRO A 1 115 ? 35.305 126.647 39.169 1.00 26.60  ? 118  PRO A CB  1 
ATOM   939  C  CG  . PRO A 1 115 ? 34.877 128.007 39.631 1.00 18.51  ? 118  PRO A CG  1 
ATOM   940  C  CD  . PRO A 1 115 ? 34.910 127.900 41.171 1.00 25.31  ? 118  PRO A CD  1 
ATOM   941  N  N   . PRO A 1 116 ? 38.452 125.807 38.899 1.00 25.79  ? 119  PRO A N   1 
ATOM   942  C  CA  . PRO A 1 116 ? 39.830 126.068 38.428 1.00 23.66  ? 119  PRO A CA  1 
ATOM   943  C  C   . PRO A 1 116 ? 40.094 127.415 37.713 1.00 19.30  ? 119  PRO A C   1 
ATOM   944  O  O   . PRO A 1 116 ? 41.077 128.089 38.005 1.00 17.65  ? 119  PRO A O   1 
ATOM   945  C  CB  . PRO A 1 116 ? 40.142 124.860 37.511 1.00 27.06  ? 119  PRO A CB  1 
ATOM   946  C  CG  . PRO A 1 116 ? 39.082 123.801 37.895 1.00 27.29  ? 119  PRO A CG  1 
ATOM   947  C  CD  . PRO A 1 116 ? 37.862 124.617 38.248 1.00 27.37  ? 119  PRO A CD  1 
ATOM   948  N  N   . GLU A 1 117 ? 39.241 127.795 36.765 1.00 18.49  ? 120  GLU A N   1 
ATOM   949  C  CA  . GLU A 1 117 ? 39.452 129.051 36.059 1.00 24.22  ? 120  GLU A CA  1 
ATOM   950  C  C   . GLU A 1 117 ? 39.451 130.262 37.031 1.00 24.05  ? 120  GLU A C   1 
ATOM   951  O  O   . GLU A 1 117 ? 40.325 131.150 36.986 1.00 23.36  ? 120  GLU A O   1 
ATOM   952  C  CB  . GLU A 1 117 ? 38.432 129.254 34.915 1.00 33.83  ? 120  GLU A CB  1 
ATOM   953  C  CG  . GLU A 1 117 ? 37.159 128.402 34.963 1.00 46.28  ? 120  GLU A CG  1 
ATOM   954  C  CD  . GLU A 1 117 ? 37.448 126.933 34.702 1.00 50.87  ? 120  GLU A CD  1 
ATOM   955  O  OE1 . GLU A 1 117 ? 38.191 126.600 33.730 1.00 47.71  ? 120  GLU A OE1 1 
ATOM   956  O  OE2 . GLU A 1 117 ? 36.944 126.111 35.499 1.00 57.78  ? 120  GLU A OE2 1 
ATOM   957  N  N   . THR A 1 118 ? 38.443 130.293 37.885 1.00 20.90  ? 121  THR A N   1 
ATOM   958  C  CA  . THR A 1 118 ? 38.323 131.299 38.916 1.00 15.35  ? 121  THR A CA  1 
ATOM   959  C  C   . THR A 1 118 ? 39.493 131.223 39.909 1.00 18.94  ? 121  THR A C   1 
ATOM   960  O  O   . THR A 1 118 ? 40.055 132.277 40.307 1.00 16.42  ? 121  THR A O   1 
ATOM   961  C  CB  . THR A 1 118 ? 36.972 131.108 39.625 1.00 19.90  ? 121  THR A CB  1 
ATOM   962  O  OG1 . THR A 1 118 ? 35.950 131.224 38.633 1.00 19.62  ? 121  THR A OG1 1 
ATOM   963  C  CG2 . THR A 1 118 ? 36.753 132.191 40.712 1.00 19.22  ? 121  THR A CG2 1 
ATOM   964  N  N   . ALA A 1 119 ? 39.915 130.003 40.272 1.00 12.09  ? 122  ALA A N   1 
ATOM   965  C  CA  . ALA A 1 119 ? 41.039 129.875 41.224 1.00 12.11  ? 122  ALA A CA  1 
ATOM   966  C  C   . ALA A 1 119 ? 42.312 130.513 40.629 1.00 22.94  ? 122  ALA A C   1 
ATOM   967  O  O   . ALA A 1 119 ? 43.084 131.168 41.360 1.00 21.49  ? 122  ALA A O   1 
ATOM   968  C  CB  . ALA A 1 119 ? 41.316 128.399 41.618 1.00 8.49   ? 122  ALA A CB  1 
ATOM   969  N  N   . VAL A 1 120 ? 42.523 130.347 39.319 1.00 22.51  ? 123  VAL A N   1 
ATOM   970  C  CA  . VAL A 1 120 ? 43.703 130.933 38.675 1.00 21.61  ? 123  VAL A CA  1 
ATOM   971  C  C   . VAL A 1 120 ? 43.572 132.442 38.557 1.00 20.61  ? 123  VAL A C   1 
ATOM   972  O  O   . VAL A 1 120 ? 44.551 133.168 38.756 1.00 20.68  ? 123  VAL A O   1 
ATOM   973  C  CB  . VAL A 1 120 ? 44.004 130.335 37.295 1.00 20.02  ? 123  VAL A CB  1 
ATOM   974  C  CG1 . VAL A 1 120 ? 45.174 131.117 36.646 1.00 18.88  ? 123  VAL A CG1 1 
ATOM   975  C  CG2 . VAL A 1 120 ? 44.421 128.867 37.462 1.00 17.65  ? 123  VAL A CG2 1 
ATOM   976  N  N   . LEU A 1 121 ? 42.363 132.926 38.275 1.00 21.53  ? 124  LEU A N   1 
ATOM   977  C  CA  . LEU A 1 121 ? 42.182 134.362 38.170 1.00 19.21  ? 124  LEU A CA  1 
ATOM   978  C  C   . LEU A 1 121 ? 42.351 134.947 39.568 1.00 20.62  ? 124  LEU A C   1 
ATOM   979  O  O   . LEU A 1 121 ? 42.993 135.981 39.736 1.00 21.10  ? 124  LEU A O   1 
ATOM   980  C  CB  . LEU A 1 121 ? 40.816 134.710 37.587 1.00 15.12  ? 124  LEU A CB  1 
ATOM   981  C  CG  . LEU A 1 121 ? 40.518 136.207 37.495 1.00 20.94  ? 124  LEU A CG  1 
ATOM   982  C  CD1 . LEU A 1 121 ? 41.544 136.898 36.613 1.00 20.58  ? 124  LEU A CD1 1 
ATOM   983  C  CD2 . LEU A 1 121 ? 39.089 136.421 36.986 1.00 12.89  ? 124  LEU A CD2 1 
ATOM   984  N  N   . LEU A 1 122 ? 41.855 134.263 40.591 1.00 18.36  ? 125  LEU A N   1 
ATOM   985  C  CA  . LEU A 1 122 ? 42.047 134.780 41.944 1.00 15.79  ? 125  LEU A CA  1 
ATOM   986  C  C   . LEU A 1 122 ? 43.544 134.824 42.299 1.00 21.60  ? 125  LEU A C   1 
ATOM   987  O  O   . LEU A 1 122 ? 44.035 135.826 42.814 1.00 20.87  ? 125  LEU A O   1 
ATOM   988  C  CB  . LEU A 1 122 ? 41.255 133.949 42.972 1.00 16.32  ? 125  LEU A CB  1 
ATOM   989  C  CG  . LEU A 1 122 ? 39.712 134.090 42.935 1.00 13.70  ? 125  LEU A CG  1 
ATOM   990  C  CD1 . LEU A 1 122 ? 39.022 133.316 44.076 1.00 14.27  ? 125  LEU A CD1 1 
ATOM   991  C  CD2 . LEU A 1 122 ? 39.336 135.570 43.014 1.00 17.92  ? 125  LEU A CD2 1 
ATOM   992  N  N   . ALA A 1 123 ? 44.275 133.751 41.993 1.00 15.55  ? 126  ALA A N   1 
ATOM   993  C  CA  . ALA A 1 123 ? 45.715 133.668 42.273 1.00 17.01  ? 126  ALA A CA  1 
ATOM   994  C  C   . ALA A 1 123 ? 46.461 134.869 41.652 1.00 21.51  ? 126  ALA A C   1 
ATOM   995  O  O   . ALA A 1 123 ? 47.329 135.486 42.297 1.00 19.70  ? 126  ALA A O   1 
ATOM   996  C  CB  . ALA A 1 123 ? 46.270 132.341 41.716 1.00 13.69  ? 126  ALA A CB  1 
ATOM   997  N  N   . SER A 1 124 ? 46.116 135.200 40.408 1.00 23.21  ? 127  SER A N   1 
ATOM   998  C  CA  . SER A 1 124 ? 46.753 136.321 39.720 1.00 19.77  ? 127  SER A CA  1 
ATOM   999  C  C   . SER A 1 124 ? 46.476 137.656 40.397 1.00 21.93  ? 127  SER A C   1 
ATOM   1000 O  O   . SER A 1 124 ? 47.367 138.506 40.436 1.00 25.04  ? 127  SER A O   1 
ATOM   1001 C  CB  . SER A 1 124 ? 46.395 136.353 38.232 1.00 18.83  ? 127  SER A CB  1 
ATOM   1002 O  OG  . SER A 1 124 ? 45.025 136.610 37.941 1.00 21.75  ? 127  SER A OG  1 
ATOM   1003 N  N   . TYR A 1 125 ? 45.282 137.841 40.967 1.00 20.14  ? 128  TYR A N   1 
ATOM   1004 C  CA  . TYR A 1 125 ? 44.999 139.102 41.674 1.00 26.88  ? 128  TYR A CA  1 
ATOM   1005 C  C   . TYR A 1 125 ? 45.810 139.100 42.968 1.00 23.88  ? 128  TYR A C   1 
ATOM   1006 O  O   . TYR A 1 125 ? 46.424 140.129 43.304 1.00 22.86  ? 128  TYR A O   1 
ATOM   1007 C  CB  . TYR A 1 125 ? 43.499 139.311 41.993 1.00 21.33  ? 128  TYR A CB  1 
ATOM   1008 C  CG  . TYR A 1 125 ? 42.651 139.665 40.807 1.00 26.20  ? 128  TYR A CG  1 
ATOM   1009 C  CD1 . TYR A 1 125 ? 41.545 138.885 40.458 1.00 18.73  ? 128  TYR A CD1 1 
ATOM   1010 C  CD2 . TYR A 1 125 ? 42.998 140.736 39.966 1.00 33.56  ? 128  TYR A CD2 1 
ATOM   1011 C  CE1 . TYR A 1 125 ? 40.802 139.161 39.277 1.00 30.52  ? 128  TYR A CE1 1 
ATOM   1012 C  CE2 . TYR A 1 125 ? 42.264 141.022 38.772 1.00 34.12  ? 128  TYR A CE2 1 
ATOM   1013 C  CZ  . TYR A 1 125 ? 41.170 140.227 38.435 1.00 34.23  ? 128  TYR A CZ  1 
ATOM   1014 O  OH  . TYR A 1 125 ? 40.459 140.477 37.272 1.00 35.28  ? 128  TYR A OH  1 
ATOM   1015 N  N   . ALA A 1 126 ? 45.841 137.948 43.667 1.00 19.30  ? 129  ALA A N   1 
ATOM   1016 C  CA  . ALA A 1 126 ? 46.594 137.815 44.908 1.00 16.55  ? 129  ALA A CA  1 
ATOM   1017 C  C   . ALA A 1 126 ? 48.096 138.124 44.671 1.00 25.72  ? 129  ALA A C   1 
ATOM   1018 O  O   . ALA A 1 126 ? 48.757 138.716 45.526 1.00 23.61  ? 129  ALA A O   1 
ATOM   1019 C  CB  . ALA A 1 126 ? 46.405 136.435 45.492 1.00 14.16  ? 129  ALA A CB  1 
ATOM   1020 N  N   . VAL A 1 127 ? 48.612 137.734 43.503 1.00 25.08  ? 130  VAL A N   1 
ATOM   1021 C  CA  . VAL A 1 127 ? 49.984 138.015 43.108 1.00 27.50  ? 130  VAL A CA  1 
ATOM   1022 C  C   . VAL A 1 127 ? 50.164 139.523 42.910 1.00 24.58  ? 130  VAL A C   1 
ATOM   1023 O  O   . VAL A 1 127 ? 51.057 140.086 43.498 1.00 22.35  ? 130  VAL A O   1 
ATOM   1024 C  CB  . VAL A 1 127 ? 50.422 137.197 41.827 1.00 27.41  ? 130  VAL A CB  1 
ATOM   1025 C  CG1 . VAL A 1 127 ? 51.828 137.626 41.343 1.00 18.55  ? 130  VAL A CG1 1 
ATOM   1026 C  CG2 . VAL A 1 127 ? 50.437 135.700 42.173 1.00 17.41  ? 130  VAL A CG2 1 
ATOM   1027 N  N   . GLN A 1 128 ? 49.287 140.174 42.147 1.00 22.74  ? 131  GLN A N   1 
ATOM   1028 C  CA  . GLN A 1 128 ? 49.391 141.610 41.909 1.00 22.73  ? 131  GLN A CA  1 
ATOM   1029 C  C   . GLN A 1 128 ? 49.346 142.358 43.250 1.00 22.45  ? 131  GLN A C   1 
ATOM   1030 O  O   . GLN A 1 128 ? 50.015 143.363 43.457 1.00 23.12  ? 131  GLN A O   1 
ATOM   1031 C  CB  . GLN A 1 128 ? 48.252 142.068 41.004 1.00 23.41  ? 131  GLN A CB  1 
ATOM   1032 C  CG  . GLN A 1 128 ? 48.257 143.554 40.702 1.00 21.44  ? 131  GLN A CG  1 
ATOM   1033 C  CD  . GLN A 1 128 ? 49.334 143.968 39.705 1.00 22.20  ? 131  GLN A CD  1 
ATOM   1034 O  OE1 . GLN A 1 128 ? 49.941 143.151 39.013 1.00 22.34  ? 131  GLN A OE1 1 
ATOM   1035 N  NE2 . GLN A 1 128 ? 49.528 145.255 39.601 1.00 24.82  ? 131  GLN A NE2 1 
ATOM   1036 N  N   . SER A 1 129 ? 48.543 141.863 44.173 1.00 22.56  ? 132  SER A N   1 
ATOM   1037 C  CA  . SER A 1 129 ? 48.445 142.493 45.469 1.00 25.85  ? 132  SER A CA  1 
ATOM   1038 C  C   . SER A 1 129 ? 49.757 142.341 46.277 1.00 27.11  ? 132  SER A C   1 
ATOM   1039 O  O   . SER A 1 129 ? 50.195 143.253 46.970 1.00 30.17  ? 132  SER A O   1 
ATOM   1040 C  CB  . SER A 1 129 ? 47.317 141.847 46.261 1.00 27.01  ? 132  SER A CB  1 
ATOM   1041 O  OG  . SER A 1 129 ? 47.401 142.313 47.587 1.00 39.98  ? 132  SER A OG  1 
ATOM   1042 N  N   . LYS A 1 130 ? 50.350 141.160 46.237 1.00 20.81  ? 133  LYS A N   1 
ATOM   1043 C  CA  . LYS A 1 130 ? 51.560 140.918 46.962 1.00 21.06  ? 133  LYS A CA  1 
ATOM   1044 C  C   . LYS A 1 130 ? 52.811 141.549 46.322 1.00 29.20  ? 133  LYS A C   1 
ATOM   1045 O  O   . LYS A 1 130 ? 53.613 142.202 46.995 1.00 29.48  ? 133  LYS A O   1 
ATOM   1046 C  CB  . LYS A 1 130 ? 51.762 139.397 47.134 1.00 21.55  ? 133  LYS A CB  1 
ATOM   1047 C  CG  . LYS A 1 130 ? 53.090 139.006 47.804 1.00 19.78  ? 133  LYS A CG  1 
ATOM   1048 C  CD  . LYS A 1 130 ? 53.186 137.531 48.076 1.00 20.04  ? 133  LYS A CD  1 
ATOM   1049 C  CE  . LYS A 1 130 ? 54.524 137.209 48.714 1.00 25.25  ? 133  LYS A CE  1 
ATOM   1050 N  NZ  . LYS A 1 130 ? 54.573 135.869 49.408 1.00 25.62  ? 133  LYS A NZ  1 
ATOM   1051 N  N   . TYR A 1 131 ? 52.947 141.418 45.016 1.00 26.40  ? 134  TYR A N   1 
ATOM   1052 C  CA  . TYR A 1 131 ? 54.105 141.933 44.312 1.00 25.40  ? 134  TYR A CA  1 
ATOM   1053 C  C   . TYR A 1 131 ? 53.993 143.260 43.586 1.00 29.44  ? 134  TYR A C   1 
ATOM   1054 O  O   . TYR A 1 131 ? 55.014 143.813 43.230 1.00 33.15  ? 134  TYR A O   1 
ATOM   1055 C  CB  . TYR A 1 131 ? 54.569 140.880 43.298 1.00 25.45  ? 134  TYR A CB  1 
ATOM   1056 C  CG  . TYR A 1 131 ? 54.932 139.573 43.930 1.00 23.15  ? 134  TYR A CG  1 
ATOM   1057 C  CD1 . TYR A 1 131 ? 54.026 138.522 43.980 1.00 23.73  ? 134  TYR A CD1 1 
ATOM   1058 C  CD2 . TYR A 1 131 ? 56.165 139.405 44.548 1.00 24.39  ? 134  TYR A CD2 1 
ATOM   1059 C  CE1 . TYR A 1 131 ? 54.346 137.332 44.646 1.00 19.37  ? 134  TYR A CE1 1 
ATOM   1060 C  CE2 . TYR A 1 131 ? 56.482 138.237 45.212 1.00 21.28  ? 134  TYR A CE2 1 
ATOM   1061 C  CZ  . TYR A 1 131 ? 55.586 137.206 45.265 1.00 21.71  ? 134  TYR A CZ  1 
ATOM   1062 O  OH  . TYR A 1 131 ? 55.930 136.040 45.941 1.00 27.77  ? 134  TYR A OH  1 
ATOM   1063 N  N   . GLY A 1 132 ? 52.788 143.790 43.392 1.00 28.84  ? 135  GLY A N   1 
ATOM   1064 C  CA  . GLY A 1 132 ? 52.640 145.040 42.656 1.00 29.91  ? 135  GLY A CA  1 
ATOM   1065 C  C   . GLY A 1 132 ? 52.877 144.633 41.212 1.00 31.28  ? 135  GLY A C   1 
ATOM   1066 O  O   . GLY A 1 132 ? 52.845 143.428 40.913 1.00 32.60  ? 135  GLY A O   1 
ATOM   1067 N  N   . ASP A 1 133 ? 53.133 145.602 40.329 1.00 31.38  ? 136  ASP A N   1 
ATOM   1068 C  CA  . ASP A 1 133 ? 53.380 145.346 38.894 1.00 34.54  ? 136  ASP A CA  1 
ATOM   1069 C  C   . ASP A 1 133 ? 54.504 144.364 38.597 1.00 31.95  ? 136  ASP A C   1 
ATOM   1070 O  O   . ASP A 1 133 ? 55.610 144.446 39.171 1.00 34.07  ? 136  ASP A O   1 
ATOM   1071 C  CB  . ASP A 1 133 ? 53.714 146.630 38.129 1.00 32.56  ? 136  ASP A CB  1 
ATOM   1072 C  CG  . ASP A 1 133 ? 52.507 147.527 37.892 1.00 38.20  ? 136  ASP A CG  1 
ATOM   1073 O  OD1 . ASP A 1 133 ? 51.353 147.173 38.223 1.00 35.88  ? 136  ASP A OD1 1 
ATOM   1074 O  OD2 . ASP A 1 133 ? 52.731 148.635 37.365 1.00 49.95  ? 136  ASP A OD2 1 
ATOM   1075 N  N   . PHE A 1 134 ? 54.233 143.460 37.660 1.00 30.86  ? 137  PHE A N   1 
ATOM   1076 C  CA  . PHE A 1 134 ? 55.251 142.508 37.278 1.00 26.97  ? 137  PHE A CA  1 
ATOM   1077 C  C   . PHE A 1 134 ? 56.461 143.329 36.796 1.00 30.80  ? 137  PHE A C   1 
ATOM   1078 O  O   . PHE A 1 134 ? 56.299 144.286 36.055 1.00 32.85  ? 137  PHE A O   1 
ATOM   1079 C  CB  . PHE A 1 134 ? 54.785 141.601 36.140 1.00 21.61  ? 137  PHE A CB  1 
ATOM   1080 C  CG  . PHE A 1 134 ? 55.847 140.623 35.726 1.00 28.85  ? 137  PHE A CG  1 
ATOM   1081 C  CD1 . PHE A 1 134 ? 56.216 139.577 36.579 1.00 31.02  ? 137  PHE A CD1 1 
ATOM   1082 C  CD2 . PHE A 1 134 ? 56.539 140.786 34.538 1.00 30.99  ? 137  PHE A CD2 1 
ATOM   1083 C  CE1 . PHE A 1 134 ? 57.245 138.716 36.262 1.00 28.69  ? 137  PHE A CE1 1 
ATOM   1084 C  CE2 . PHE A 1 134 ? 57.578 139.924 34.206 1.00 28.75  ? 137  PHE A CE2 1 
ATOM   1085 C  CZ  . PHE A 1 134 ? 57.930 138.889 35.072 1.00 30.41  ? 137  PHE A CZ  1 
ATOM   1086 N  N   . ASN A 1 135 ? 57.659 142.956 37.221 1.00 29.80  ? 138  ASN A N   1 
ATOM   1087 C  CA  . ASN A 1 135 ? 58.859 143.655 36.821 1.00 33.85  ? 138  ASN A CA  1 
ATOM   1088 C  C   . ASN A 1 135 ? 59.885 142.561 36.481 1.00 36.23  ? 138  ASN A C   1 
ATOM   1089 O  O   . ASN A 1 135 ? 60.321 141.818 37.375 1.00 34.74  ? 138  ASN A O   1 
ATOM   1090 C  CB  . ASN A 1 135 ? 59.311 144.553 37.964 1.00 33.02  ? 138  ASN A CB  1 
ATOM   1091 C  CG  . ASN A 1 135 ? 60.677 145.177 37.727 1.00 43.75  ? 138  ASN A CG  1 
ATOM   1092 O  OD1 . ASN A 1 135 ? 61.263 145.085 36.633 1.00 39.56  ? 138  ASN A OD1 1 
ATOM   1093 N  ND2 . ASN A 1 135 ? 61.213 145.795 38.774 1.00 42.96  ? 138  ASN A ND2 1 
ATOM   1094 N  N   . LYS A 1 136 ? 60.216 142.464 35.182 1.00 37.34  ? 139  LYS A N   1 
ATOM   1095 C  CA  . LYS A 1 136 ? 61.154 141.486 34.615 1.00 40.93  ? 139  LYS A CA  1 
ATOM   1096 C  C   . LYS A 1 136 ? 62.505 141.410 35.318 1.00 46.83  ? 139  LYS A C   1 
ATOM   1097 O  O   . LYS A 1 136 ? 63.177 140.367 35.241 1.00 49.44  ? 139  LYS A O   1 
ATOM   1098 C  CB  . LYS A 1 136 ? 61.366 141.765 33.141 1.00 44.49  ? 139  LYS A CB  1 
ATOM   1099 N  N   . GLU A 1 137 ? 62.882 142.516 35.984 1.00 46.22  ? 140  GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 137 ? 64.142 142.665 36.735 1.00 45.95  ? 140  GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 137 ? 64.166 142.046 38.115 1.00 44.36  ? 140  GLU A C   1 
ATOM   1102 O  O   . GLU A 1 137 ? 65.193 141.526 38.563 1.00 46.39  ? 140  GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 137 ? 64.543 144.152 36.864 1.00 47.63  ? 140  GLU A CB  1 
ATOM   1104 C  CG  . GLU A 1 137 ? 65.210 144.717 35.619 1.00 63.44  ? 140  GLU A CG  1 
ATOM   1105 C  CD  . GLU A 1 137 ? 66.379 143.842 35.158 1.00 70.80  ? 140  GLU A CD  1 
ATOM   1106 O  OE1 . GLU A 1 137 ? 67.490 144.008 35.709 1.00 80.79  ? 140  GLU A OE1 1 
ATOM   1107 O  OE2 . GLU A 1 137 ? 66.187 142.969 34.278 1.00 66.36  ? 140  GLU A OE2 1 
ATOM   1108 N  N   . VAL A 1 138 ? 63.037 142.137 38.794 1.00 44.33  ? 141  VAL A N   1 
ATOM   1109 C  CA  . VAL A 1 138 ? 62.900 141.634 40.147 1.00 43.49  ? 141  VAL A CA  1 
ATOM   1110 C  C   . VAL A 1 138 ? 62.253 140.250 40.167 1.00 40.92  ? 141  VAL A C   1 
ATOM   1111 O  O   . VAL A 1 138 ? 62.700 139.315 40.856 1.00 34.88  ? 141  VAL A O   1 
ATOM   1112 C  CB  . VAL A 1 138 ? 62.026 142.573 40.973 1.00 41.33  ? 141  VAL A CB  1 
ATOM   1113 C  CG1 . VAL A 1 138 ? 62.031 142.124 42.410 1.00 40.05  ? 141  VAL A CG1 1 
ATOM   1114 C  CG2 . VAL A 1 138 ? 62.533 144.000 40.829 1.00 37.59  ? 141  VAL A CG2 1 
ATOM   1115 N  N   . HIS A 1 139 ? 61.212 140.124 39.359 1.00 39.71  ? 142  HIS A N   1 
ATOM   1116 C  CA  . HIS A 1 139 ? 60.447 138.899 39.315 1.00 37.93  ? 142  HIS A CA  1 
ATOM   1117 C  C   . HIS A 1 139 ? 60.937 137.911 38.294 1.00 37.07  ? 142  HIS A C   1 
ATOM   1118 O  O   . HIS A 1 139 ? 60.257 137.621 37.306 1.00 35.56  ? 142  HIS A O   1 
ATOM   1119 C  CB  . HIS A 1 139 ? 58.976 139.236 39.126 1.00 33.74  ? 142  HIS A CB  1 
ATOM   1120 C  CG  . HIS A 1 139 ? 58.496 140.274 40.092 1.00 32.91  ? 142  HIS A CG  1 
ATOM   1121 N  ND1 . HIS A 1 139 ? 57.807 141.399 39.697 1.00 31.44  ? 142  HIS A ND1 1 
ATOM   1122 C  CD2 . HIS A 1 139 ? 58.701 140.405 41.426 1.00 26.50  ? 142  HIS A CD2 1 
ATOM   1123 C  CE1 . HIS A 1 139 ? 57.619 142.187 40.740 1.00 32.20  ? 142  HIS A CE1 1 
ATOM   1124 N  NE2 . HIS A 1 139 ? 58.156 141.607 41.801 1.00 27.16  ? 142  HIS A NE2 1 
ATOM   1125 N  N   . LYS A 1 140 ? 62.075 137.310 38.638 1.00 39.19  ? 143  LYS A N   1 
ATOM   1126 C  CA  . LYS A 1 140 ? 62.764 136.330 37.796 1.00 44.03  ? 143  LYS A CA  1 
ATOM   1127 C  C   . LYS A 1 140 ? 62.135 134.974 38.002 1.00 45.42  ? 143  LYS A C   1 
ATOM   1128 O  O   . LYS A 1 140 ? 61.303 134.788 38.884 1.00 49.92  ? 143  LYS A O   1 
ATOM   1129 C  CB  . LYS A 1 140 ? 64.272 136.191 38.138 1.00 44.31  ? 143  LYS A CB  1 
ATOM   1130 C  CG  . LYS A 1 140 ? 65.141 137.455 38.174 1.00 43.31  ? 143  LYS A CG  1 
ATOM   1131 C  CD  . LYS A 1 140 ? 65.487 138.001 36.821 1.00 55.19  ? 143  LYS A CD  1 
ATOM   1132 C  CE  . LYS A 1 140 ? 66.459 139.175 36.964 1.00 63.26  ? 143  LYS A CE  1 
ATOM   1133 N  NZ  . LYS A 1 140 ? 66.678 139.850 35.638 1.00 69.90  ? 143  LYS A NZ  1 
ATOM   1134 N  N   . SER A 1 141 ? 62.588 134.016 37.214 1.00 42.84  ? 144  SER A N   1 
ATOM   1135 C  CA  . SER A 1 141 ? 62.104 132.657 37.306 1.00 42.13  ? 144  SER A CA  1 
ATOM   1136 C  C   . SER A 1 141 ? 62.142 132.214 38.767 1.00 40.72  ? 144  SER A C   1 
ATOM   1137 O  O   . SER A 1 141 ? 63.144 132.404 39.458 1.00 43.49  ? 144  SER A O   1 
ATOM   1138 C  CB  . SER A 1 141 ? 63.010 131.764 36.478 1.00 42.55  ? 144  SER A CB  1 
ATOM   1139 O  OG  . SER A 1 141 ? 62.587 130.427 36.586 1.00 53.68  ? 144  SER A OG  1 
ATOM   1140 N  N   . GLY A 1 142 ? 61.012 131.725 39.257 1.00 39.23  ? 145  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 142 ? 60.932 131.276 40.633 1.00 32.35  ? 145  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 142 ? 60.431 132.274 41.658 1.00 22.82  ? 145  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 142 ? 60.413 131.951 42.842 1.00 30.66  ? 145  GLY A O   1 
ATOM   1144 N  N   . TYR A 1 143 ? 60.047 133.475 41.246 1.00 25.03  ? 146  TYR A N   1 
ATOM   1145 C  CA  . TYR A 1 143 ? 59.546 134.474 42.200 1.00 23.33  ? 146  TYR A CA  1 
ATOM   1146 C  C   . TYR A 1 143 ? 58.246 134.024 42.934 1.00 26.35  ? 146  TYR A C   1 
ATOM   1147 O  O   . TYR A 1 143 ? 57.926 134.507 44.042 1.00 27.19  ? 146  TYR A O   1 
ATOM   1148 C  CB  . TYR A 1 143 ? 59.352 135.824 41.502 1.00 19.63  ? 146  TYR A CB  1 
ATOM   1149 C  CG  . TYR A 1 143 ? 58.066 135.997 40.691 1.00 26.48  ? 146  TYR A CG  1 
ATOM   1150 C  CD1 . TYR A 1 143 ? 57.881 135.315 39.488 1.00 27.87  ? 146  TYR A CD1 1 
ATOM   1151 C  CD2 . TYR A 1 143 ? 57.089 136.934 41.070 1.00 24.38  ? 146  TYR A CD2 1 
ATOM   1152 C  CE1 . TYR A 1 143 ? 56.766 135.570 38.655 1.00 30.63  ? 146  TYR A CE1 1 
ATOM   1153 C  CE2 . TYR A 1 143 ? 55.969 137.190 40.254 1.00 20.23  ? 146  TYR A CE2 1 
ATOM   1154 C  CZ  . TYR A 1 143 ? 55.831 136.509 39.045 1.00 22.95  ? 146  TYR A CZ  1 
ATOM   1155 O  OH  . TYR A 1 143 ? 54.818 136.796 38.188 1.00 26.27  ? 146  TYR A OH  1 
ATOM   1156 N  N   . LEU A 1 144 ? 57.514 133.077 42.352 1.00 25.20  ? 147  LEU A N   1 
ATOM   1157 C  CA  . LEU A 1 144 ? 56.280 132.590 42.989 1.00 23.12  ? 147  LEU A CA  1 
ATOM   1158 C  C   . LEU A 1 144 ? 56.488 131.189 43.620 1.00 22.74  ? 147  LEU A C   1 
ATOM   1159 O  O   . LEU A 1 144 ? 55.533 130.515 43.978 1.00 25.26  ? 147  LEU A O   1 
ATOM   1160 C  CB  . LEU A 1 144 ? 55.193 132.467 41.922 1.00 18.79  ? 147  LEU A CB  1 
ATOM   1161 C  CG  . LEU A 1 144 ? 54.642 133.652 41.150 1.00 17.75  ? 147  LEU A CG  1 
ATOM   1162 C  CD1 . LEU A 1 144 ? 53.397 133.163 40.437 1.00 17.83  ? 147  LEU A CD1 1 
ATOM   1163 C  CD2 . LEU A 1 144 ? 54.250 134.775 42.095 1.00 17.18  ? 147  LEU A CD2 1 
ATOM   1164 N  N   . ALA A 1 145 ? 57.736 130.766 43.797 1.00 23.38  ? 148  ALA A N   1 
ATOM   1165 C  CA  . ALA A 1 145 ? 58.014 129.451 44.319 1.00 24.45  ? 148  ALA A CA  1 
ATOM   1166 C  C   . ALA A 1 145 ? 57.601 129.173 45.755 1.00 28.79  ? 148  ALA A C   1 
ATOM   1167 O  O   . ALA A 1 145 ? 57.285 128.031 46.095 1.00 34.22  ? 148  ALA A O   1 
ATOM   1168 C  CB  . ALA A 1 145 ? 59.501 129.084 44.066 1.00 25.76  ? 148  ALA A CB  1 
ATOM   1169 N  N   . GLY A 1 146 ? 57.600 130.198 46.601 1.00 26.92  ? 149  GLY A N   1 
ATOM   1170 C  CA  . GLY A 1 146 ? 57.166 130.019 47.982 1.00 27.82  ? 149  GLY A CA  1 
ATOM   1171 C  C   . GLY A 1 146 ? 55.704 130.348 48.273 1.00 21.39  ? 149  GLY A C   1 
ATOM   1172 O  O   . GLY A 1 146 ? 55.291 130.307 49.428 1.00 22.19  ? 149  GLY A O   1 
ATOM   1173 N  N   . ASP A 1 147 ? 54.960 130.768 47.253 1.00 22.94  ? 150  ASP A N   1 
ATOM   1174 C  CA  . ASP A 1 147 ? 53.535 131.141 47.405 1.00 26.14  ? 150  ASP A CA  1 
ATOM   1175 C  C   . ASP A 1 147 ? 52.557 129.971 47.258 1.00 23.60  ? 150  ASP A C   1 
ATOM   1176 O  O   . ASP A 1 147 ? 52.783 129.066 46.459 1.00 21.80  ? 150  ASP A O   1 
ATOM   1177 C  CB  . ASP A 1 147 ? 53.101 132.201 46.369 1.00 29.77  ? 150  ASP A CB  1 
ATOM   1178 C  CG  . ASP A 1 147 ? 53.812 133.538 46.533 1.00 37.72  ? 150  ASP A CG  1 
ATOM   1179 O  OD1 . ASP A 1 147 ? 53.380 134.504 45.872 1.00 48.55  ? 150  ASP A OD1 1 
ATOM   1180 O  OD2 . ASP A 1 147 ? 54.811 133.627 47.285 1.00 43.39  ? 150  ASP A OD2 1 
ATOM   1181 N  N   . LYS A 1 148 ? 51.469 130.009 48.039 1.00 27.74  ? 151  LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 148 ? 50.391 129.019 47.953 1.00 27.06  ? 151  LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 148 ? 49.391 129.751 47.024 1.00 25.86  ? 151  LYS A C   1 
ATOM   1184 O  O   . LYS A 1 148 ? 48.638 130.656 47.427 1.00 25.09  ? 151  LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 148 ? 49.786 128.671 49.336 1.00 26.57  ? 151  LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 148 ? 49.071 127.319 49.324 1.00 27.96  ? 151  LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 148 ? 48.013 127.200 50.417 1.00 36.98  ? 151  LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 148 ? 47.428 125.763 50.501 1.00 47.83  ? 151  LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 148 ? 47.137 125.090 49.159 1.00 52.16  ? 151  LYS A NZ  1 
ATOM   1190 N  N   . LEU A 1 149 ? 49.484 129.418 45.740 1.00 23.27  ? 152  LEU A N   1 
ATOM   1191 C  CA  . LEU A 1 149 ? 48.675 130.083 44.754 1.00 23.32  ? 152  LEU A CA  1 
ATOM   1192 C  C   . LEU A 1 149 ? 47.335 129.397 44.453 1.00 17.93  ? 152  LEU A C   1 
ATOM   1193 O  O   . LEU A 1 149 ? 46.384 130.070 44.106 1.00 17.36  ? 152  LEU A O   1 
ATOM   1194 C  CB  . LEU A 1 149 ? 49.477 130.288 43.449 1.00 18.82  ? 152  LEU A CB  1 
ATOM   1195 C  CG  . LEU A 1 149 ? 50.870 130.954 43.466 1.00 26.24  ? 152  LEU A CG  1 
ATOM   1196 C  CD1 . LEU A 1 149 ? 51.640 130.594 42.190 1.00 32.88  ? 152  LEU A CD1 1 
ATOM   1197 C  CD2 . LEU A 1 149 ? 50.857 132.433 43.683 1.00 25.02  ? 152  LEU A CD2 1 
ATOM   1198 N  N   . LEU A 1 150 ? 47.268 128.080 44.633 1.00 15.97  ? 153  LEU A N   1 
ATOM   1199 C  CA  . LEU A 1 150 ? 46.106 127.309 44.275 1.00 11.87  ? 153  LEU A CA  1 
ATOM   1200 C  C   . LEU A 1 150 ? 45.725 126.203 45.220 1.00 14.07  ? 153  LEU A C   1 
ATOM   1201 O  O   . LEU A 1 150 ? 46.570 125.635 45.884 1.00 18.62  ? 153  LEU A O   1 
ATOM   1202 C  CB  . LEU A 1 150 ? 46.372 126.673 42.900 1.00 17.50  ? 153  LEU A CB  1 
ATOM   1203 C  CG  . LEU A 1 150 ? 46.501 127.608 41.688 1.00 16.88  ? 153  LEU A CG  1 
ATOM   1204 C  CD1 . LEU A 1 150 ? 47.073 126.806 40.556 1.00 12.19  ? 153  LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A 1 150 ? 45.168 128.231 41.280 1.00 15.34  ? 153  LEU A CD2 1 
ATOM   1206 N  N   . PRO A 1 151 ? 44.433 125.848 45.246 1.00 12.85  ? 154  PRO A N   1 
ATOM   1207 C  CA  . PRO A 1 151 ? 44.011 124.767 46.132 1.00 17.96  ? 154  PRO A CA  1 
ATOM   1208 C  C   . PRO A 1 151 ? 44.677 123.500 45.559 1.00 18.19  ? 154  PRO A C   1 
ATOM   1209 O  O   . PRO A 1 151 ? 44.884 123.412 44.338 1.00 14.04  ? 154  PRO A O   1 
ATOM   1210 C  CB  . PRO A 1 151 ? 42.516 124.693 45.879 1.00 15.29  ? 154  PRO A CB  1 
ATOM   1211 C  CG  . PRO A 1 151 ? 42.153 126.060 45.399 1.00 13.62  ? 154  PRO A CG  1 
ATOM   1212 C  CD  . PRO A 1 151 ? 43.294 126.464 44.551 1.00 11.71  ? 154  PRO A CD  1 
ATOM   1213 N  N   . GLN A 1 152 ? 45.039 122.572 46.434 1.00 12.74  ? 155  GLN A N   1 
ATOM   1214 C  CA  . GLN A 1 152 ? 45.589 121.291 46.053 1.00 18.43  ? 155  GLN A CA  1 
ATOM   1215 C  C   . GLN A 1 152 ? 44.772 120.572 44.964 1.00 22.42  ? 155  GLN A C   1 
ATOM   1216 O  O   . GLN A 1 152 ? 45.353 120.017 44.021 1.00 22.39  ? 155  GLN A O   1 
ATOM   1217 C  CB  . GLN A 1 152 ? 45.641 120.370 47.255 1.00 29.47  ? 155  GLN A CB  1 
ATOM   1218 C  CG  . GLN A 1 152 ? 46.527 119.172 46.989 1.00 31.21  ? 155  GLN A CG  1 
ATOM   1219 C  CD  . GLN A 1 152 ? 47.948 119.613 46.658 1.00 33.01  ? 155  GLN A CD  1 
ATOM   1220 O  OE1 . GLN A 1 152 ? 48.457 120.607 47.207 1.00 38.85  ? 155  GLN A OE1 1 
ATOM   1221 N  NE2 . GLN A 1 152 ? 48.581 118.906 45.742 1.00 37.05  ? 155  GLN A NE2 1 
ATOM   1222 N  N   . ARG A 1 153 ? 43.439 120.593 45.093 1.00 18.59  ? 156  ARG A N   1 
ATOM   1223 C  CA  . ARG A 1 153 ? 42.516 119.981 44.126 1.00 18.71  ? 156  ARG A CA  1 
ATOM   1224 C  C   . ARG A 1 153 ? 42.791 120.441 42.699 1.00 22.28  ? 156  ARG A C   1 
ATOM   1225 O  O   . ARG A 1 153 ? 42.792 119.612 41.801 1.00 20.49  ? 156  ARG A O   1 
ATOM   1226 C  CB  . ARG A 1 153 ? 41.043 120.279 44.494 1.00 22.49  ? 156  ARG A CB  1 
ATOM   1227 C  CG  . ARG A 1 153 ? 40.009 120.170 43.335 1.00 15.09  ? 156  ARG A CG  1 
ATOM   1228 C  CD  . ARG A 1 153 ? 38.553 120.520 43.786 1.00 13.66  ? 156  ARG A CD  1 
ATOM   1229 N  NE  . ARG A 1 153 ? 38.503 121.743 44.607 1.00 16.23  ? 156  ARG A NE  1 
ATOM   1230 C  CZ  . ARG A 1 153 ? 38.622 122.988 44.130 1.00 14.33  ? 156  ARG A CZ  1 
ATOM   1231 N  NH1 . ARG A 1 153 ? 38.782 123.170 42.834 1.00 16.47  ? 156  ARG A NH1 1 
ATOM   1232 N  NH2 . ARG A 1 153 ? 38.577 124.072 44.939 1.00 18.82  ? 156  ARG A NH2 1 
ATOM   1233 N  N   . VAL A 1 154 ? 42.995 121.754 42.485 1.00 23.55  ? 157  VAL A N   1 
ATOM   1234 C  CA  . VAL A 1 154 ? 43.306 122.316 41.145 1.00 21.00  ? 157  VAL A CA  1 
ATOM   1235 C  C   . VAL A 1 154 ? 44.681 121.817 40.610 1.00 22.56  ? 157  VAL A C   1 
ATOM   1236 O  O   . VAL A 1 154 ? 44.829 121.457 39.446 1.00 25.63  ? 157  VAL A O   1 
ATOM   1237 C  CB  . VAL A 1 154 ? 43.225 123.865 41.129 1.00 20.23  ? 157  VAL A CB  1 
ATOM   1238 C  CG1 . VAL A 1 154 ? 43.645 124.394 39.766 1.00 19.38  ? 157  VAL A CG1 1 
ATOM   1239 C  CG2 . VAL A 1 154 ? 41.764 124.328 41.447 1.00 13.62  ? 157  VAL A CG2 1 
ATOM   1240 N  N   . LEU A 1 155 ? 45.650 121.725 41.501 1.00 19.85  ? 158  LEU A N   1 
ATOM   1241 C  CA  . LEU A 1 155 ? 46.991 121.229 41.168 1.00 24.88  ? 158  LEU A CA  1 
ATOM   1242 C  C   . LEU A 1 155 ? 46.910 119.766 40.733 1.00 33.35  ? 158  LEU A C   1 
ATOM   1243 O  O   . LEU A 1 155 ? 47.574 119.386 39.778 1.00 33.40  ? 158  LEU A O   1 
ATOM   1244 C  CB  . LEU A 1 155 ? 47.913 121.335 42.397 1.00 23.69  ? 158  LEU A CB  1 
ATOM   1245 C  CG  . LEU A 1 155 ? 48.133 122.776 42.898 1.00 28.76  ? 158  LEU A CG  1 
ATOM   1246 C  CD1 . LEU A 1 155 ? 49.191 122.837 43.978 1.00 24.13  ? 158  LEU A CD1 1 
ATOM   1247 C  CD2 . LEU A 1 155 ? 48.503 123.676 41.699 1.00 23.41  ? 158  LEU A CD2 1 
ATOM   1248 N  N   . GLU A 1 156 ? 46.082 118.966 41.414 1.00 37.95  ? 159  GLU A N   1 
ATOM   1249 C  CA  . GLU A 1 156 ? 45.941 117.538 41.106 1.00 44.38  ? 159  GLU A CA  1 
ATOM   1250 C  C   . GLU A 1 156 ? 45.212 117.228 39.813 1.00 43.80  ? 159  GLU A C   1 
ATOM   1251 O  O   . GLU A 1 156 ? 45.442 116.172 39.206 1.00 49.75  ? 159  GLU A O   1 
ATOM   1252 C  CB  . GLU A 1 156 ? 45.298 116.779 42.263 1.00 46.60  ? 159  GLU A CB  1 
ATOM   1253 C  CG  . GLU A 1 156 ? 46.262 116.576 43.403 1.00 53.94  ? 159  GLU A CG  1 
ATOM   1254 C  CD  . GLU A 1 156 ? 45.589 116.192 44.713 1.00 64.46  ? 159  GLU A CD  1 
ATOM   1255 O  OE1 . GLU A 1 156 ? 44.333 116.215 44.795 1.00 71.98  ? 159  GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A 1 156 ? 46.332 115.882 45.675 1.00 69.70  ? 159  GLU A OE2 1 
ATOM   1257 N  N   . GLN A 1 157 ? 44.362 118.150 39.379 1.00 35.94  ? 160  GLN A N   1 
ATOM   1258 C  CA  . GLN A 1 157 ? 43.598 117.947 38.163 1.00 36.37  ? 160  GLN A CA  1 
ATOM   1259 C  C   . GLN A 1 157 ? 44.274 118.389 36.880 1.00 36.34  ? 160  GLN A C   1 
ATOM   1260 O  O   . GLN A 1 157 ? 43.758 118.131 35.819 1.00 38.21  ? 160  GLN A O   1 
ATOM   1261 C  CB  . GLN A 1 157 ? 42.284 118.678 38.216 1.00 30.11  ? 160  GLN A CB  1 
ATOM   1262 C  CG  . GLN A 1 157 ? 41.580 118.416 39.451 1.00 37.98  ? 160  GLN A CG  1 
ATOM   1263 C  CD  . GLN A 1 157 ? 40.296 119.103 39.435 1.00 39.82  ? 160  GLN A CD  1 
ATOM   1264 O  OE1 . GLN A 1 157 ? 40.205 120.285 39.042 1.00 34.11  ? 160  GLN A OE1 1 
ATOM   1265 N  NE2 . GLN A 1 157 ? 39.257 118.374 39.799 1.00 24.55  ? 160  GLN A NE2 1 
ATOM   1266 N  N   . HIS A 1 158 ? 45.338 119.172 36.956 1.00 35.34  ? 161  HIS A N   1 
ATOM   1267 C  CA  . HIS A 1 158 ? 45.973 119.612 35.730 1.00 31.62  ? 161  HIS A CA  1 
ATOM   1268 C  C   . HIS A 1 158 ? 47.353 119.033 35.612 1.00 37.95  ? 161  HIS A C   1 
ATOM   1269 O  O   . HIS A 1 158 ? 48.091 118.977 36.605 1.00 38.73  ? 161  HIS A O   1 
ATOM   1270 C  CB  . HIS A 1 158 ? 46.042 121.117 35.634 1.00 21.87  ? 161  HIS A CB  1 
ATOM   1271 C  CG  . HIS A 1 158 ? 44.693 121.759 35.625 1.00 26.68  ? 161  HIS A CG  1 
ATOM   1272 N  ND1 . HIS A 1 158 ? 43.923 121.883 36.765 1.00 23.02  ? 161  HIS A ND1 1 
ATOM   1273 C  CD2 . HIS A 1 158 ? 43.961 122.274 34.615 1.00 18.83  ? 161  HIS A CD2 1 
ATOM   1274 C  CE1 . HIS A 1 158 ? 42.771 122.448 36.455 1.00 22.34  ? 161  HIS A CE1 1 
ATOM   1275 N  NE2 . HIS A 1 158 ? 42.770 122.692 35.159 1.00 22.29  ? 161  HIS A NE2 1 
ATOM   1276 N  N   . LYS A 1 159 ? 47.709 118.623 34.394 1.00 38.00  ? 162  LYS A N   1 
ATOM   1277 C  CA  . LYS A 1 159 ? 48.999 117.990 34.157 1.00 36.63  ? 162  LYS A CA  1 
ATOM   1278 C  C   . LYS A 1 159 ? 50.089 119.057 33.953 1.00 39.14  ? 162  LYS A C   1 
ATOM   1279 O  O   . LYS A 1 159 ? 50.657 119.229 32.865 1.00 40.37  ? 162  LYS A O   1 
ATOM   1280 C  CB  . LYS A 1 159 ? 48.909 116.990 32.990 1.00 37.81  ? 162  LYS A CB  1 
ATOM   1281 C  CG  . LYS A 1 159 ? 48.105 115.684 33.303 1.00 35.82  ? 162  LYS A CG  1 
ATOM   1282 C  CD  . LYS A 1 159 ? 47.426 115.215 32.033 1.00 44.38  ? 162  LYS A CD  1 
ATOM   1283 C  CE  . LYS A 1 159 ? 46.588 113.943 32.180 1.00 52.95  ? 162  LYS A CE  1 
ATOM   1284 N  NZ  . LYS A 1 159 ? 45.880 113.601 30.859 1.00 48.50  ? 162  LYS A NZ  1 
ATOM   1285 N  N   . LEU A 1 160 ? 50.338 119.798 35.032 1.00 33.55  ? 163  LEU A N   1 
ATOM   1286 C  CA  . LEU A 1 160 ? 51.303 120.874 35.044 1.00 26.76  ? 163  LEU A CA  1 
ATOM   1287 C  C   . LEU A 1 160 ? 52.170 120.781 36.284 1.00 30.46  ? 163  LEU A C   1 
ATOM   1288 O  O   . LEU A 1 160 ? 51.711 120.396 37.364 1.00 26.17  ? 163  LEU A O   1 
ATOM   1289 C  CB  . LEU A 1 160 ? 50.619 122.239 35.025 1.00 20.54  ? 163  LEU A CB  1 
ATOM   1290 C  CG  . LEU A 1 160 ? 49.707 122.524 33.864 1.00 25.59  ? 163  LEU A CG  1 
ATOM   1291 C  CD1 . LEU A 1 160 ? 48.971 123.814 34.124 1.00 27.23  ? 163  LEU A CD1 1 
ATOM   1292 C  CD2 . LEU A 1 160 ? 50.520 122.588 32.589 1.00 26.32  ? 163  LEU A CD2 1 
ATOM   1293 N  N   . ASN A 1 161 ? 53.452 121.076 36.114 1.00 35.56  ? 164  ASN A N   1 
ATOM   1294 C  CA  . ASN A 1 161 ? 54.358 121.080 37.236 1.00 38.44  ? 164  ASN A CA  1 
ATOM   1295 C  C   . ASN A 1 161 ? 54.366 122.471 37.827 1.00 37.72  ? 164  ASN A C   1 
ATOM   1296 O  O   . ASN A 1 161 ? 53.745 123.419 37.284 1.00 28.30  ? 164  ASN A O   1 
ATOM   1297 C  CB  . ASN A 1 161 ? 55.785 120.691 36.803 1.00 39.21  ? 164  ASN A CB  1 
ATOM   1298 C  CG  . ASN A 1 161 ? 56.355 121.601 35.719 1.00 34.66  ? 164  ASN A CG  1 
ATOM   1299 O  OD1 . ASN A 1 161 ? 56.202 122.811 35.735 1.00 34.97  ? 164  ASN A OD1 1 
ATOM   1300 N  ND2 . ASN A 1 161 ? 57.037 120.999 34.776 1.00 40.86  ? 164  ASN A ND2 1 
ATOM   1301 N  N   . LYS A 1 162 ? 55.134 122.584 38.902 1.00 40.59  ? 165  LYS A N   1 
ATOM   1302 C  CA  . LYS A 1 162 ? 55.270 123.826 39.622 1.00 41.99  ? 165  LYS A CA  1 
ATOM   1303 C  C   . LYS A 1 162 ? 55.704 124.964 38.699 1.00 41.49  ? 165  LYS A C   1 
ATOM   1304 O  O   . LYS A 1 162 ? 55.094 126.041 38.727 1.00 38.14  ? 165  LYS A O   1 
ATOM   1305 C  CB  . LYS A 1 162 ? 56.279 123.590 40.749 1.00 39.83  ? 165  LYS A CB  1 
ATOM   1306 C  CG  . LYS A 1 162 ? 56.340 124.679 41.820 1.00 41.42  ? 165  LYS A CG  1 
ATOM   1307 C  CD  . LYS A 1 162 ? 56.845 124.112 43.161 1.00 47.12  ? 165  LYS A CD  1 
ATOM   1308 C  CE  . LYS A 1 162 ? 56.870 125.162 44.244 1.00 32.49  ? 165  LYS A CE  1 
ATOM   1309 N  NZ  . LYS A 1 162 ? 57.673 126.278 43.710 1.00 45.14  ? 165  LYS A NZ  1 
ATOM   1310 N  N   . ASP A 1 163 ? 56.654 124.687 37.801 1.00 36.34  ? 166  ASP A N   1 
ATOM   1311 C  CA  . ASP A 1 163 ? 57.174 125.730 36.920 1.00 39.75  ? 166  ASP A CA  1 
ATOM   1312 C  C   . ASP A 1 163 ? 56.203 126.173 35.862 1.00 40.57  ? 166  ASP A C   1 
ATOM   1313 O  O   . ASP A 1 163 ? 56.147 127.354 35.530 1.00 39.67  ? 166  ASP A O   1 
ATOM   1314 C  CB  . ASP A 1 163 ? 58.470 125.292 36.252 1.00 52.33  ? 166  ASP A CB  1 
ATOM   1315 C  CG  . ASP A 1 163 ? 59.562 124.946 37.253 1.00 67.63  ? 166  ASP A CG  1 
ATOM   1316 O  OD1 . ASP A 1 163 ? 59.343 125.070 38.488 1.00 73.88  ? 166  ASP A OD1 1 
ATOM   1317 O  OD2 . ASP A 1 163 ? 60.649 124.531 36.790 1.00 74.64  ? 166  ASP A OD2 1 
ATOM   1318 N  N   . GLN A 1 164 ? 55.447 125.227 35.319 1.00 38.64  ? 167  GLN A N   1 
ATOM   1319 C  CA  . GLN A 1 164 ? 54.440 125.528 34.311 1.00 33.27  ? 167  GLN A CA  1 
ATOM   1320 C  C   . GLN A 1 164 ? 53.346 126.367 34.934 1.00 26.99  ? 167  GLN A C   1 
ATOM   1321 O  O   . GLN A 1 164 ? 52.799 127.257 34.284 1.00 31.06  ? 167  GLN A O   1 
ATOM   1322 C  CB  . GLN A 1 164 ? 53.858 124.229 33.794 1.00 40.05  ? 167  GLN A CB  1 
ATOM   1323 C  CG  . GLN A 1 164 ? 54.896 123.296 33.207 1.00 46.27  ? 167  GLN A CG  1 
ATOM   1324 C  CD  . GLN A 1 164 ? 54.274 122.017 32.718 1.00 41.49  ? 167  GLN A CD  1 
ATOM   1325 O  OE1 . GLN A 1 164 ? 54.311 121.014 33.402 1.00 46.18  ? 167  GLN A OE1 1 
ATOM   1326 N  NE2 . GLN A 1 164 ? 53.661 122.060 31.548 1.00 44.20  ? 167  GLN A NE2 1 
ATOM   1327 N  N   . TRP A 1 165 ? 52.973 126.017 36.169 1.00 30.75  ? 168  TRP A N   1 
ATOM   1328 C  CA  . TRP A 1 165 ? 51.965 126.770 36.902 1.00 31.58  ? 168  TRP A CA  1 
ATOM   1329 C  C   . TRP A 1 165 ? 52.411 128.227 37.067 1.00 25.37  ? 168  TRP A C   1 
ATOM   1330 O  O   . TRP A 1 165 ? 51.687 129.131 36.663 1.00 21.50  ? 168  TRP A O   1 
ATOM   1331 C  CB  . TRP A 1 165 ? 51.718 126.089 38.236 1.00 33.55  ? 168  TRP A CB  1 
ATOM   1332 C  CG  . TRP A 1 165 ? 50.581 125.129 38.194 1.00 26.92  ? 168  TRP A CG  1 
ATOM   1333 C  CD1 . TRP A 1 165 ? 50.585 123.817 38.615 1.00 27.33  ? 168  TRP A CD1 1 
ATOM   1334 C  CD2 . TRP A 1 165 ? 49.262 125.395 37.710 1.00 17.91  ? 168  TRP A CD2 1 
ATOM   1335 N  NE1 . TRP A 1 165 ? 49.339 123.253 38.414 1.00 22.88  ? 168  TRP A NE1 1 
ATOM   1336 C  CE2 . TRP A 1 165 ? 48.508 124.191 37.854 1.00 18.73  ? 168  TRP A CE2 1 
ATOM   1337 C  CE3 . TRP A 1 165 ? 48.639 126.520 37.149 1.00 21.77  ? 168  TRP A CE3 1 
ATOM   1338 C  CZ2 . TRP A 1 165 ? 47.167 124.088 37.454 1.00 15.00  ? 168  TRP A CZ2 1 
ATOM   1339 C  CZ3 . TRP A 1 165 ? 47.318 126.411 36.754 1.00 17.62  ? 168  TRP A CZ3 1 
ATOM   1340 C  CH2 . TRP A 1 165 ? 46.593 125.193 36.910 1.00 16.86  ? 168  TRP A CH2 1 
ATOM   1341 N  N   . GLU A 1 166 ? 53.643 128.417 37.559 1.00 26.11  ? 169  GLU A N   1 
ATOM   1342 C  CA  . GLU A 1 166 ? 54.254 129.745 37.795 1.00 30.50  ? 169  GLU A CA  1 
ATOM   1343 C  C   . GLU A 1 166 ? 54.495 130.576 36.538 1.00 28.59  ? 169  GLU A C   1 
ATOM   1344 O  O   . GLU A 1 166 ? 54.693 131.766 36.618 1.00 34.45  ? 169  GLU A O   1 
ATOM   1345 C  CB  . GLU A 1 166 ? 55.550 129.576 38.595 1.00 34.42  ? 169  GLU A CB  1 
ATOM   1346 C  CG  . GLU A 1 166 ? 55.310 129.120 40.071 1.00 44.07  ? 169  GLU A CG  1 
ATOM   1347 C  CD  . GLU A 1 166 ? 56.545 128.523 40.785 1.00 49.26  ? 169  GLU A CD  1 
ATOM   1348 O  OE1 . GLU A 1 166 ? 57.726 128.845 40.474 1.00 47.67  ? 169  GLU A OE1 1 
ATOM   1349 O  OE2 . GLU A 1 166 ? 56.312 127.708 41.699 1.00 57.95  ? 169  GLU A OE2 1 
ATOM   1350 N  N   . GLU A 1 167 ? 54.506 129.932 35.378 1.00 28.16  ? 170  GLU A N   1 
ATOM   1351 C  CA  . GLU A 1 167 ? 54.671 130.617 34.110 1.00 29.10  ? 170  GLU A CA  1 
ATOM   1352 C  C   . GLU A 1 167 ? 53.303 131.064 33.634 1.00 27.45  ? 170  GLU A C   1 
ATOM   1353 O  O   . GLU A 1 167 ? 53.163 132.110 32.992 1.00 37.76  ? 170  GLU A O   1 
ATOM   1354 C  CB  . GLU A 1 167 ? 55.238 129.655 33.057 1.00 35.99  ? 170  GLU A CB  1 
ATOM   1355 C  CG  . GLU A 1 167 ? 56.704 129.309 33.267 1.00 52.19  ? 170  GLU A CG  1 
ATOM   1356 C  CD  . GLU A 1 167 ? 57.192 128.152 32.404 1.00 58.56  ? 170  GLU A CD  1 
ATOM   1357 O  OE1 . GLU A 1 167 ? 56.689 127.977 31.259 1.00 57.55  ? 170  GLU A OE1 1 
ATOM   1358 O  OE2 . GLU A 1 167 ? 58.094 127.424 32.891 1.00 54.31  ? 170  GLU A OE2 1 
ATOM   1359 N  N   . ARG A 1 168 ? 52.297 130.233 33.883 1.00 29.45  ? 171  ARG A N   1 
ATOM   1360 C  CA  . ARG A 1 168 ? 50.940 130.575 33.447 1.00 28.03  ? 171  ARG A CA  1 
ATOM   1361 C  C   . ARG A 1 168 ? 50.394 131.684 34.324 1.00 27.64  ? 171  ARG A C   1 
ATOM   1362 O  O   . ARG A 1 168 ? 49.676 132.546 33.840 1.00 29.08  ? 171  ARG A O   1 
ATOM   1363 C  CB  . ARG A 1 168 ? 50.033 129.336 33.504 1.00 33.56  ? 171  ARG A CB  1 
ATOM   1364 C  CG  . ARG A 1 168 ? 50.171 128.450 32.273 1.00 44.64  ? 171  ARG A CG  1 
ATOM   1365 C  CD  . ARG A 1 168 ? 49.846 126.985 32.565 1.00 50.13  ? 171  ARG A CD  1 
ATOM   1366 N  NE  . ARG A 1 168 ? 49.691 126.203 31.333 1.00 49.65  ? 171  ARG A NE  1 
ATOM   1367 C  CZ  . ARG A 1 168 ? 48.546 126.100 30.651 1.00 59.83  ? 171  ARG A CZ  1 
ATOM   1368 N  NH1 . ARG A 1 168 ? 47.454 126.731 31.071 1.00 61.99  ? 171  ARG A NH1 1 
ATOM   1369 N  NH2 . ARG A 1 168 ? 48.472 125.338 29.565 1.00 61.21  ? 171  ARG A NH2 1 
ATOM   1370 N  N   . ILE A 1 169 ? 50.745 131.650 35.612 1.00 19.93  ? 172  ILE A N   1 
ATOM   1371 C  CA  . ILE A 1 169 ? 50.294 132.653 36.554 1.00 24.80  ? 172  ILE A CA  1 
ATOM   1372 C  C   . ILE A 1 169 ? 50.983 133.958 36.274 1.00 26.69  ? 172  ILE A C   1 
ATOM   1373 O  O   . ILE A 1 169 ? 50.359 135.009 36.440 1.00 29.37  ? 172  ILE A O   1 
ATOM   1374 C  CB  . ILE A 1 169 ? 50.579 132.244 38.021 1.00 21.98  ? 172  ILE A CB  1 
ATOM   1375 C  CG1 . ILE A 1 169 ? 49.972 130.866 38.344 1.00 28.56  ? 172  ILE A CG1 1 
ATOM   1376 C  CG2 . ILE A 1 169 ? 50.010 133.306 39.012 1.00 20.47  ? 172  ILE A CG2 1 
ATOM   1377 C  CD1 . ILE A 1 169 ? 48.495 130.826 38.456 1.00 30.13  ? 172  ILE A CD1 1 
ATOM   1378 N  N   . GLN A 1 170 ? 52.261 133.902 35.870 1.00 25.20  ? 173  GLN A N   1 
ATOM   1379 C  CA  . GLN A 1 170 ? 53.034 135.128 35.533 1.00 26.31  ? 173  GLN A CA  1 
ATOM   1380 C  C   . GLN A 1 170 ? 52.368 135.893 34.392 1.00 22.03  ? 173  GLN A C   1 
ATOM   1381 O  O   . GLN A 1 170 ? 52.261 137.110 34.405 1.00 24.90  ? 173  GLN A O   1 
ATOM   1382 C  CB  . GLN A 1 170 ? 54.484 134.753 35.159 1.00 37.13  ? 173  GLN A CB  1 
ATOM   1383 C  CG  . GLN A 1 170 ? 55.455 135.915 34.783 1.00 41.14  ? 173  GLN A CG  1 
ATOM   1384 C  CD  . GLN A 1 170 ? 55.232 136.450 33.377 1.00 45.59  ? 173  GLN A CD  1 
ATOM   1385 O  OE1 . GLN A 1 170 ? 54.710 135.736 32.505 1.00 56.53  ? 173  GLN A OE1 1 
ATOM   1386 N  NE2 . GLN A 1 170 ? 55.578 137.722 33.156 1.00 41.62  ? 173  GLN A NE2 1 
ATOM   1387 N  N   . VAL A 1 171 ? 51.887 135.166 33.402 1.00 26.19  ? 174  VAL A N   1 
ATOM   1388 C  CA  . VAL A 1 171 ? 51.235 135.806 32.289 1.00 31.40  ? 174  VAL A CA  1 
ATOM   1389 C  C   . VAL A 1 171 ? 50.054 136.636 32.786 1.00 25.07  ? 174  VAL A C   1 
ATOM   1390 O  O   . VAL A 1 171 ? 49.780 137.742 32.303 1.00 22.77  ? 174  VAL A O   1 
ATOM   1391 C  CB  . VAL A 1 171 ? 50.732 134.719 31.277 1.00 39.20  ? 174  VAL A CB  1 
ATOM   1392 C  CG1 . VAL A 1 171 ? 49.992 135.342 30.128 1.00 32.88  ? 174  VAL A CG1 1 
ATOM   1393 C  CG2 . VAL A 1 171 ? 51.892 133.894 30.788 1.00 39.58  ? 174  VAL A CG2 1 
ATOM   1394 N  N   . TRP A 1 172 ? 49.341 136.067 33.739 1.00 26.96  ? 175  TRP A N   1 
ATOM   1395 C  CA  . TRP A 1 172 ? 48.164 136.696 34.311 1.00 27.24  ? 175  TRP A CA  1 
ATOM   1396 C  C   . TRP A 1 172 ? 48.526 137.833 35.242 1.00 25.30  ? 175  TRP A C   1 
ATOM   1397 O  O   . TRP A 1 172 ? 47.812 138.838 35.277 1.00 29.53  ? 175  TRP A O   1 
ATOM   1398 C  CB  . TRP A 1 172 ? 47.335 135.627 35.012 1.00 23.73  ? 175  TRP A CB  1 
ATOM   1399 C  CG  . TRP A 1 172 ? 46.640 134.902 34.010 1.00 23.29  ? 175  TRP A CG  1 
ATOM   1400 C  CD1 . TRP A 1 172 ? 46.936 133.663 33.544 1.00 27.53  ? 175  TRP A CD1 1 
ATOM   1401 C  CD2 . TRP A 1 172 ? 45.543 135.376 33.245 1.00 20.72  ? 175  TRP A CD2 1 
ATOM   1402 N  NE1 . TRP A 1 172 ? 46.082 133.323 32.525 1.00 31.03  ? 175  TRP A NE1 1 
ATOM   1403 C  CE2 . TRP A 1 172 ? 45.208 134.359 32.320 1.00 31.36  ? 175  TRP A CE2 1 
ATOM   1404 C  CE3 . TRP A 1 172 ? 44.811 136.570 33.243 1.00 22.75  ? 175  TRP A CE3 1 
ATOM   1405 C  CZ2 . TRP A 1 172 ? 44.152 134.496 31.386 1.00 24.57  ? 175  TRP A CZ2 1 
ATOM   1406 C  CZ3 . TRP A 1 172 ? 43.779 136.711 32.326 1.00 21.96  ? 175  TRP A CZ3 1 
ATOM   1407 C  CH2 . TRP A 1 172 ? 43.457 135.671 31.403 1.00 26.76  ? 175  TRP A CH2 1 
ATOM   1408 N  N   . HIS A 1 173 ? 49.629 137.674 35.981 1.00 19.03  ? 176  HIS A N   1 
ATOM   1409 C  CA  . HIS A 1 173 ? 50.130 138.728 36.870 1.00 23.72  ? 176  HIS A CA  1 
ATOM   1410 C  C   . HIS A 1 173 ? 50.394 139.956 35.974 1.00 23.71  ? 176  HIS A C   1 
ATOM   1411 O  O   . HIS A 1 173 ? 49.899 141.076 36.207 1.00 22.07  ? 176  HIS A O   1 
ATOM   1412 C  CB  . HIS A 1 173 ? 51.455 138.277 37.497 1.00 20.50  ? 176  HIS A CB  1 
ATOM   1413 C  CG  . HIS A 1 173 ? 52.096 139.307 38.380 1.00 20.66  ? 176  HIS A CG  1 
ATOM   1414 N  ND1 . HIS A 1 173 ? 53.393 139.202 38.828 1.00 21.62  ? 176  HIS A ND1 1 
ATOM   1415 C  CD2 . HIS A 1 173 ? 51.606 140.442 38.931 1.00 24.47  ? 176  HIS A CD2 1 
ATOM   1416 C  CE1 . HIS A 1 173 ? 53.675 140.220 39.621 1.00 16.85  ? 176  HIS A CE1 1 
ATOM   1417 N  NE2 . HIS A 1 173 ? 52.605 140.986 39.697 1.00 18.35  ? 176  HIS A NE2 1 
ATOM   1418 N  N   . GLU A 1 174 ? 51.143 139.687 34.914 1.00 25.63  ? 177  GLU A N   1 
ATOM   1419 C  CA  . GLU A 1 174 ? 51.534 140.671 33.924 1.00 29.76  ? 177  GLU A CA  1 
ATOM   1420 C  C   . GLU A 1 174 ? 50.300 141.398 33.392 1.00 29.53  ? 177  GLU A C   1 
ATOM   1421 O  O   . GLU A 1 174 ? 50.336 142.602 33.166 1.00 32.48  ? 177  GLU A O   1 
ATOM   1422 C  CB  . GLU A 1 174 ? 52.223 139.888 32.805 1.00 32.22  ? 177  GLU A CB  1 
ATOM   1423 C  CG  . GLU A 1 174 ? 52.595 140.662 31.581 1.00 46.06  ? 177  GLU A CG  1 
ATOM   1424 C  CD  . GLU A 1 174 ? 54.030 141.144 31.624 1.00 59.84  ? 177  GLU A CD  1 
ATOM   1425 O  OE1 . GLU A 1 174 ? 54.223 142.370 31.803 1.00 63.94  ? 177  GLU A OE1 1 
ATOM   1426 O  OE2 . GLU A 1 174 ? 54.955 140.299 31.472 1.00 57.43  ? 177  GLU A OE2 1 
ATOM   1427 N  N   . GLU A 1 175 ? 49.196 140.669 33.234 1.00 29.48  ? 178  GLU A N   1 
ATOM   1428 C  CA  . GLU A 1 175 ? 47.959 141.230 32.704 1.00 28.87  ? 178  GLU A CA  1 
ATOM   1429 C  C   . GLU A 1 175 ? 47.355 142.343 33.541 1.00 29.33  ? 178  GLU A C   1 
ATOM   1430 O  O   . GLU A 1 175 ? 46.698 143.239 33.010 1.00 35.82  ? 178  GLU A O   1 
ATOM   1431 C  CB  . GLU A 1 175 ? 46.931 140.129 32.590 1.00 28.55  ? 178  GLU A CB  1 
ATOM   1432 C  CG  . GLU A 1 175 ? 45.562 140.589 32.145 1.00 35.54  ? 178  GLU A CG  1 
ATOM   1433 C  CD  . GLU A 1 175 ? 45.526 141.098 30.706 1.00 40.06  ? 178  GLU A CD  1 
ATOM   1434 O  OE1 . GLU A 1 175 ? 46.363 140.684 29.868 1.00 38.70  ? 178  GLU A OE1 1 
ATOM   1435 O  OE2 . GLU A 1 175 ? 44.623 141.906 30.412 1.00 35.32  ? 178  GLU A OE2 1 
ATOM   1436 N  N   . HIS A 1 176 ? 47.546 142.283 34.851 1.00 29.59  ? 179  HIS A N   1 
ATOM   1437 C  CA  . HIS A 1 176 ? 46.956 143.294 35.724 1.00 28.14  ? 179  HIS A CA  1 
ATOM   1438 C  C   . HIS A 1 176 ? 47.854 144.487 35.908 1.00 31.16  ? 179  HIS A C   1 
ATOM   1439 O  O   . HIS A 1 176 ? 47.666 145.246 36.875 1.00 33.07  ? 179  HIS A O   1 
ATOM   1440 C  CB  . HIS A 1 176 ? 46.646 142.720 37.107 1.00 27.32  ? 179  HIS A CB  1 
ATOM   1441 C  CG  . HIS A 1 176 ? 45.886 141.433 37.085 1.00 30.97  ? 179  HIS A CG  1 
ATOM   1442 N  ND1 . HIS A 1 176 ? 44.704 141.274 36.387 1.00 29.32  ? 179  HIS A ND1 1 
ATOM   1443 C  CD2 . HIS A 1 176 ? 46.161 140.231 37.646 1.00 17.93  ? 179  HIS A CD2 1 
ATOM   1444 C  CE1 . HIS A 1 176 ? 44.288 140.026 36.510 1.00 27.60  ? 179  HIS A CE1 1 
ATOM   1445 N  NE2 . HIS A 1 176 ? 45.156 139.373 37.268 1.00 24.02  ? 179  HIS A NE2 1 
ATOM   1446 N  N   . ARG A 1 177 ? 48.828 144.645 35.006 1.00 31.88  ? 180  ARG A N   1 
ATOM   1447 C  CA  . ARG A 1 177 ? 49.785 145.762 35.068 1.00 36.78  ? 180  ARG A CA  1 
ATOM   1448 C  C   . ARG A 1 177 ? 49.066 147.086 35.270 1.00 35.41  ? 180  ARG A C   1 
ATOM   1449 O  O   . ARG A 1 177 ? 48.080 147.384 34.568 1.00 36.31  ? 180  ARG A O   1 
ATOM   1450 C  CB  . ARG A 1 177 ? 50.639 145.842 33.796 1.00 36.36  ? 180  ARG A CB  1 
ATOM   1451 C  CG  . ARG A 1 177 ? 51.424 147.166 33.683 1.00 42.66  ? 180  ARG A CG  1 
ATOM   1452 C  CD  . ARG A 1 177 ? 52.477 147.087 32.601 1.00 46.26  ? 180  ARG A CD  1 
ATOM   1453 N  NE  . ARG A 1 177 ? 53.406 146.012 32.908 1.00 50.71  ? 180  ARG A NE  1 
ATOM   1454 C  CZ  . ARG A 1 177 ? 54.412 146.120 33.772 1.00 53.35  ? 180  ARG A CZ  1 
ATOM   1455 N  NH1 . ARG A 1 177 ? 54.646 147.263 34.412 1.00 60.02  ? 180  ARG A NH1 1 
ATOM   1456 N  NH2 . ARG A 1 177 ? 55.138 145.056 34.060 1.00 53.34  ? 180  ARG A NH2 1 
ATOM   1457 N  N   . GLY A 1 178 ? 49.542 147.852 36.251 1.00 34.70  ? 181  GLY A N   1 
ATOM   1458 C  CA  . GLY A 1 178 ? 48.946 149.146 36.541 1.00 40.78  ? 181  GLY A CA  1 
ATOM   1459 C  C   . GLY A 1 178 ? 47.923 149.161 37.652 1.00 41.83  ? 181  GLY A C   1 
ATOM   1460 O  O   . GLY A 1 178 ? 47.632 150.213 38.227 1.00 43.38  ? 181  GLY A O   1 
HETATM 1461 N  N   . MSE A 1 179 ? 47.371 147.994 37.962 1.00 40.56  ? 182  MSE A N   1 
HETATM 1462 C  CA  . MSE A 1 179 ? 46.355 147.890 38.997 1.00 37.64  ? 182  MSE A CA  1 
HETATM 1463 C  C   . MSE A 1 179 ? 46.972 148.047 40.401 1.00 32.44  ? 182  MSE A C   1 
HETATM 1464 O  O   . MSE A 1 179 ? 47.907 147.342 40.781 1.00 32.42  ? 182  MSE A O   1 
HETATM 1465 C  CB  . MSE A 1 179 ? 45.643 146.545 38.836 1.00 35.05  ? 182  MSE A CB  1 
HETATM 1466 C  CG  . MSE A 1 179 ? 44.536 146.248 39.828 1.00 40.53  ? 182  MSE A CG  1 
HETATM 1467 SE SE  . MSE A 1 179 ? 44.018 144.470 39.573 1.00 49.52  ? 182  MSE A SE  1 
HETATM 1468 C  CE  . MSE A 1 179 ? 42.043 144.794 39.409 1.00 36.15  ? 182  MSE A CE  1 
ATOM   1469 N  N   . LEU A 1 180 ? 46.456 148.988 41.180 1.00 36.00  ? 183  LEU A N   1 
ATOM   1470 C  CA  . LEU A 1 180 ? 46.971 149.180 42.528 1.00 31.69  ? 183  LEU A CA  1 
ATOM   1471 C  C   . LEU A 1 180 ? 46.772 147.929 43.380 1.00 33.47  ? 183  LEU A C   1 
ATOM   1472 O  O   . LEU A 1 180 ? 45.884 147.118 43.114 1.00 32.77  ? 183  LEU A O   1 
ATOM   1473 C  CB  . LEU A 1 180 ? 46.279 150.371 43.185 1.00 34.57  ? 183  LEU A CB  1 
ATOM   1474 C  CG  . LEU A 1 180 ? 46.421 151.668 42.391 1.00 36.64  ? 183  LEU A CG  1 
ATOM   1475 C  CD1 . LEU A 1 180 ? 45.929 152.829 43.229 1.00 39.39  ? 183  LEU A CD1 1 
ATOM   1476 C  CD2 . LEU A 1 180 ? 47.871 151.905 42.061 1.00 34.47  ? 183  LEU A CD2 1 
ATOM   1477 N  N   . ARG A 1 181 ? 47.609 147.752 44.388 1.00 30.72  ? 184  ARG A N   1 
ATOM   1478 C  CA  . ARG A 1 181 ? 47.480 146.606 45.280 1.00 30.90  ? 184  ARG A CA  1 
ATOM   1479 C  C   . ARG A 1 181 ? 46.086 146.469 45.961 1.00 30.37  ? 184  ARG A C   1 
ATOM   1480 O  O   . ARG A 1 181 ? 45.500 145.382 46.012 1.00 29.99  ? 184  ARG A O   1 
ATOM   1481 C  CB  . ARG A 1 181 ? 48.620 146.656 46.286 1.00 29.64  ? 184  ARG A CB  1 
ATOM   1482 C  CG  . ARG A 1 181 ? 49.973 146.274 45.610 1.00 40.73  ? 184  ARG A CG  1 
ATOM   1483 C  CD  . ARG A 1 181 ? 51.187 146.959 46.262 1.00 42.86  ? 184  ARG A CD  1 
ATOM   1484 N  NE  . ARG A 1 181 ? 52.276 146.030 46.567 1.00 44.55  ? 184  ARG A NE  1 
ATOM   1485 C  CZ  . ARG A 1 181 ? 53.517 146.131 46.094 1.00 54.58  ? 184  ARG A CZ  1 
ATOM   1486 N  NH1 . ARG A 1 181 ? 53.837 147.129 45.274 1.00 52.89  ? 184  ARG A NH1 1 
ATOM   1487 N  NH2 . ARG A 1 181 ? 54.447 145.239 46.456 1.00 49.84  ? 184  ARG A NH2 1 
ATOM   1488 N  N   . GLU A 1 182 ? 45.563 147.587 46.455 1.00 30.76  ? 185  GLU A N   1 
ATOM   1489 C  CA  . GLU A 1 182 ? 44.232 147.679 47.083 1.00 29.94  ? 185  GLU A CA  1 
ATOM   1490 C  C   . GLU A 1 182 ? 43.098 147.305 46.095 1.00 26.74  ? 185  GLU A C   1 
ATOM   1491 O  O   . GLU A 1 182 ? 42.067 146.790 46.477 1.00 29.76  ? 185  GLU A O   1 
ATOM   1492 C  CB  . GLU A 1 182 ? 43.994 149.109 47.587 1.00 34.22  ? 185  GLU A CB  1 
ATOM   1493 C  CG  . GLU A 1 182 ? 44.893 149.559 48.738 1.00 47.39  ? 185  GLU A CG  1 
ATOM   1494 C  CD  . GLU A 1 182 ? 46.375 149.768 48.379 1.00 55.04  ? 185  GLU A CD  1 
ATOM   1495 O  OE1 . GLU A 1 182 ? 46.707 150.246 47.236 1.00 44.06  ? 185  GLU A OE1 1 
ATOM   1496 O  OE2 . GLU A 1 182 ? 47.195 149.457 49.291 1.00 49.35  ? 185  GLU A OE2 1 
ATOM   1497 N  N   . ASP A 1 183 ? 43.269 147.639 44.826 1.00 23.75  ? 186  ASP A N   1 
ATOM   1498 C  CA  . ASP A 1 183 ? 42.288 147.308 43.828 1.00 29.25  ? 186  ASP A CA  1 
ATOM   1499 C  C   . ASP A 1 183 ? 42.356 145.824 43.481 1.00 27.77  ? 186  ASP A C   1 
ATOM   1500 O  O   . ASP A 1 183 ? 41.339 145.254 43.075 1.00 31.22  ? 186  ASP A O   1 
ATOM   1501 C  CB  . ASP A 1 183 ? 42.486 148.182 42.576 1.00 38.28  ? 186  ASP A CB  1 
ATOM   1502 C  CG  . ASP A 1 183 ? 41.970 149.602 42.778 1.00 47.53  ? 186  ASP A CG  1 
ATOM   1503 O  OD1 . ASP A 1 183 ? 40.876 149.746 43.377 1.00 51.27  ? 186  ASP A OD1 1 
ATOM   1504 O  OD2 . ASP A 1 183 ? 42.647 150.570 42.362 1.00 51.87  ? 186  ASP A OD2 1 
ATOM   1505 N  N   . ALA A 1 184 ? 43.537 145.200 43.591 1.00 28.09  ? 187  ALA A N   1 
ATOM   1506 C  CA  . ALA A 1 184 ? 43.643 143.757 43.294 1.00 22.59  ? 187  ALA A CA  1 
ATOM   1507 C  C   . ALA A 1 184 ? 42.938 143.008 44.438 1.00 21.52  ? 187  ALA A C   1 
ATOM   1508 O  O   . ALA A 1 184 ? 42.219 142.056 44.206 1.00 21.13  ? 187  ALA A O   1 
ATOM   1509 C  CB  . ALA A 1 184 ? 45.123 143.305 43.143 1.00 18.12  ? 187  ALA A CB  1 
ATOM   1510 N  N   . VAL A 1 185 ? 43.177 143.441 45.672 1.00 24.07  ? 188  VAL A N   1 
ATOM   1511 C  CA  . VAL A 1 185 ? 42.505 142.886 46.852 1.00 26.85  ? 188  VAL A CA  1 
ATOM   1512 C  C   . VAL A 1 185 ? 40.940 143.014 46.721 1.00 26.14  ? 188  VAL A C   1 
ATOM   1513 O  O   . VAL A 1 185 ? 40.178 142.085 46.998 1.00 22.49  ? 188  VAL A O   1 
ATOM   1514 C  CB  . VAL A 1 185 ? 42.950 143.660 48.157 1.00 24.08  ? 188  VAL A CB  1 
ATOM   1515 C  CG1 . VAL A 1 185 ? 42.014 143.361 49.306 1.00 23.49  ? 188  VAL A CG1 1 
ATOM   1516 C  CG2 . VAL A 1 185 ? 44.368 143.319 48.532 1.00 26.47  ? 188  VAL A CG2 1 
ATOM   1517 N  N   . LEU A 1 186 ? 40.473 144.158 46.246 1.00 18.25  ? 189  LEU A N   1 
ATOM   1518 C  CA  . LEU A 1 186 ? 39.048 144.379 46.140 1.00 18.86  ? 189  LEU A CA  1 
ATOM   1519 C  C   . LEU A 1 186 ? 38.460 143.524 45.030 1.00 24.05  ? 189  LEU A C   1 
ATOM   1520 O  O   . LEU A 1 186 ? 37.427 142.905 45.211 1.00 17.94  ? 189  LEU A O   1 
ATOM   1521 C  CB  . LEU A 1 186 ? 38.811 145.861 45.858 1.00 30.13  ? 189  LEU A CB  1 
ATOM   1522 C  CG  . LEU A 1 186 ? 37.381 146.229 45.483 1.00 39.59  ? 189  LEU A CG  1 
ATOM   1523 C  CD1 . LEU A 1 186 ? 36.444 145.900 46.640 1.00 41.76  ? 189  LEU A CD1 1 
ATOM   1524 C  CD2 . LEU A 1 186 ? 37.289 147.680 45.060 1.00 37.17  ? 189  LEU A CD2 1 
ATOM   1525 N  N   . GLU A 1 187 ? 39.142 143.489 43.885 1.00 23.75  ? 190  GLU A N   1 
ATOM   1526 C  CA  . GLU A 1 187 ? 38.719 142.701 42.735 1.00 22.70  ? 190  GLU A CA  1 
ATOM   1527 C  C   . GLU A 1 187 ? 38.626 141.232 43.119 1.00 24.99  ? 190  GLU A C   1 
ATOM   1528 O  O   . GLU A 1 187 ? 37.672 140.567 42.717 1.00 20.41  ? 190  GLU A O   1 
ATOM   1529 C  CB  . GLU A 1 187 ? 39.672 142.897 41.575 1.00 22.77  ? 190  GLU A CB  1 
ATOM   1530 C  CG  . GLU A 1 187 ? 39.183 142.190 40.350 1.00 42.32  ? 190  GLU A CG  1 
ATOM   1531 C  CD  . GLU A 1 187 ? 37.837 142.700 39.894 1.00 48.93  ? 190  GLU A CD  1 
ATOM   1532 O  OE1 . GLU A 1 187 ? 36.886 141.883 39.747 1.00 50.25  ? 190  GLU A OE1 1 
ATOM   1533 O  OE2 . GLU A 1 187 ? 37.747 143.934 39.698 1.00 46.27  ? 190  GLU A OE2 1 
ATOM   1534 N  N   . TYR A 1 188 ? 39.625 140.741 43.869 1.00 25.38  ? 191  TYR A N   1 
ATOM   1535 C  CA  . TYR A 1 188 ? 39.663 139.357 44.370 1.00 26.90  ? 191  TYR A CA  1 
ATOM   1536 C  C   . TYR A 1 188 ? 38.376 139.043 45.221 1.00 26.23  ? 191  TYR A C   1 
ATOM   1537 O  O   . TYR A 1 188 ? 37.701 138.002 45.019 1.00 19.73  ? 191  TYR A O   1 
ATOM   1538 C  CB  . TYR A 1 188 ? 40.962 139.131 45.198 1.00 16.47  ? 191  TYR A CB  1 
ATOM   1539 C  CG  . TYR A 1 188 ? 41.151 137.726 45.765 1.00 17.69  ? 191  TYR A CG  1 
ATOM   1540 C  CD1 . TYR A 1 188 ? 42.142 136.876 45.257 1.00 20.13  ? 191  TYR A CD1 1 
ATOM   1541 C  CD2 . TYR A 1 188 ? 40.346 137.240 46.817 1.00 15.81  ? 191  TYR A CD2 1 
ATOM   1542 C  CE1 . TYR A 1 188 ? 42.336 135.572 45.790 1.00 14.75  ? 191  TYR A CE1 1 
ATOM   1543 C  CE2 . TYR A 1 188 ? 40.520 135.942 47.339 1.00 16.61  ? 191  TYR A CE2 1 
ATOM   1544 C  CZ  . TYR A 1 188 ? 41.531 135.120 46.807 1.00 18.14  ? 191  TYR A CZ  1 
ATOM   1545 O  OH  . TYR A 1 188 ? 41.747 133.859 47.276 1.00 16.45  ? 191  TYR A OH  1 
ATOM   1546 N  N   . LEU A 1 189 ? 38.064 139.943 46.168 1.00 26.24  ? 192  LEU A N   1 
ATOM   1547 C  CA  . LEU A 1 189 ? 36.896 139.832 47.040 1.00 23.24  ? 192  LEU A CA  1 
ATOM   1548 C  C   . LEU A 1 189 ? 35.561 139.936 46.245 1.00 15.95  ? 192  LEU A C   1 
ATOM   1549 O  O   . LEU A 1 189 ? 34.616 139.242 46.567 1.00 16.72  ? 192  LEU A O   1 
ATOM   1550 C  CB  . LEU A 1 189 ? 36.960 140.877 48.182 1.00 18.62  ? 192  LEU A CB  1 
ATOM   1551 C  CG  . LEU A 1 189 ? 37.932 140.637 49.344 1.00 16.28  ? 192  LEU A CG  1 
ATOM   1552 C  CD1 . LEU A 1 189 ? 37.951 141.809 50.303 1.00 20.20  ? 192  LEU A CD1 1 
ATOM   1553 C  CD2 . LEU A 1 189 ? 37.477 139.457 50.093 1.00 13.05  ? 192  LEU A CD2 1 
ATOM   1554 N  N   . LYS A 1 190 ? 35.511 140.740 45.180 1.00 13.81  ? 193  LYS A N   1 
ATOM   1555 C  CA  . LYS A 1 190 ? 34.306 140.861 44.348 1.00 20.30  ? 193  LYS A CA  1 
ATOM   1556 C  C   . LYS A 1 190 ? 34.009 139.534 43.660 1.00 18.31  ? 193  LYS A C   1 
ATOM   1557 O  O   . LYS A 1 190 ? 32.887 139.030 43.693 1.00 19.44  ? 193  LYS A O   1 
ATOM   1558 C  CB  . LYS A 1 190 ? 34.457 141.982 43.312 1.00 20.37  ? 193  LYS A CB  1 
ATOM   1559 C  CG  . LYS A 1 190 ? 34.743 143.340 43.982 1.00 26.05  ? 193  LYS A CG  1 
ATOM   1560 C  CD  . LYS A 1 190 ? 34.434 144.538 43.093 1.00 26.11  ? 193  LYS A CD  1 
ATOM   1561 C  CE  . LYS A 1 190 ? 35.392 144.647 41.965 1.00 34.20  ? 193  LYS A CE  1 
ATOM   1562 N  NZ  . LYS A 1 190 ? 34.929 145.663 40.978 1.00 41.44  ? 193  LYS A NZ  1 
ATOM   1563 N  N   . ILE A 1 191 ? 35.041 138.909 43.137 1.00 19.12  ? 194  ILE A N   1 
ATOM   1564 C  CA  . ILE A 1 191 ? 34.859 137.620 42.514 1.00 19.37  ? 194  ILE A CA  1 
ATOM   1565 C  C   . ILE A 1 191 ? 34.560 136.539 43.563 1.00 17.26  ? 194  ILE A C   1 
ATOM   1566 O  O   . ILE A 1 191 ? 33.592 135.798 43.412 1.00 15.86  ? 194  ILE A O   1 
ATOM   1567 C  CB  . ILE A 1 191 ? 36.092 137.292 41.669 1.00 24.31  ? 194  ILE A CB  1 
ATOM   1568 C  CG1 . ILE A 1 191 ? 36.136 138.263 40.477 1.00 18.92  ? 194  ILE A CG1 1 
ATOM   1569 C  CG2 . ILE A 1 191 ? 36.078 135.800 41.194 1.00 29.70  ? 194  ILE A CG2 1 
ATOM   1570 C  CD1 . ILE A 1 191 ? 37.365 138.186 39.733 1.00 18.19  ? 194  ILE A CD1 1 
ATOM   1571 N  N   . ALA A 1 192 ? 35.336 136.511 44.653 1.00 15.70  ? 195  ALA A N   1 
ATOM   1572 C  CA  . ALA A 1 192 ? 35.142 135.491 45.679 1.00 18.31  ? 195  ALA A CA  1 
ATOM   1573 C  C   . ALA A 1 192 ? 33.772 135.495 46.358 1.00 20.21  ? 195  ALA A C   1 
ATOM   1574 O  O   . ALA A 1 192 ? 33.272 134.423 46.696 1.00 16.55  ? 195  ALA A O   1 
ATOM   1575 C  CB  . ALA A 1 192 ? 36.246 135.563 46.712 1.00 18.48  ? 195  ALA A CB  1 
ATOM   1576 N  N   . GLN A 1 193 ? 33.168 136.680 46.565 1.00 22.69  ? 196  GLN A N   1 
ATOM   1577 C  CA  . GLN A 1 193 ? 31.859 136.762 47.207 1.00 18.58  ? 196  GLN A CA  1 
ATOM   1578 C  C   . GLN A 1 193 ? 30.707 136.144 46.442 1.00 13.21  ? 196  GLN A C   1 
ATOM   1579 O  O   . GLN A 1 193 ? 29.655 135.897 47.033 1.00 20.63  ? 196  GLN A O   1 
ATOM   1580 C  CB  . GLN A 1 193 ? 31.509 138.178 47.639 1.00 19.35  ? 196  GLN A CB  1 
ATOM   1581 C  CG  . GLN A 1 193 ? 31.085 139.062 46.513 1.00 21.63  ? 196  GLN A CG  1 
ATOM   1582 C  CD  . GLN A 1 193 ? 30.844 140.469 46.938 1.00 24.96  ? 196  GLN A CD  1 
ATOM   1583 O  OE1 . GLN A 1 193 ? 30.818 140.793 48.134 1.00 16.04  ? 196  GLN A OE1 1 
ATOM   1584 N  NE2 . GLN A 1 193 ? 30.654 141.337 45.947 1.00 24.12  ? 196  GLN A NE2 1 
ATOM   1585 N  N   . ASP A 1 194 ? 30.924 135.824 45.177 1.00 16.07  ? 197  ASP A N   1 
ATOM   1586 C  CA  . ASP A 1 194 ? 29.901 135.171 44.354 1.00 25.88  ? 197  ASP A CA  1 
ATOM   1587 C  C   . ASP A 1 194 ? 29.897 133.654 44.458 1.00 21.76  ? 197  ASP A C   1 
ATOM   1588 O  O   . ASP A 1 194 ? 28.985 133.008 43.952 1.00 21.30  ? 197  ASP A O   1 
ATOM   1589 C  CB  . ASP A 1 194 ? 30.058 135.561 42.881 1.00 29.73  ? 197  ASP A CB  1 
ATOM   1590 C  CG  . ASP A 1 194 ? 29.716 137.041 42.595 1.00 23.20  ? 197  ASP A CG  1 
ATOM   1591 O  OD1 . ASP A 1 194 ? 30.349 137.539 41.671 1.00 20.57  ? 197  ASP A OD1 1 
ATOM   1592 O  OD2 . ASP A 1 194 ? 28.847 137.695 43.231 1.00 26.73  ? 197  ASP A OD2 1 
ATOM   1593 N  N   . LEU A 1 195 ? 30.962 133.088 45.023 1.00 21.96  ? 198  LEU A N   1 
ATOM   1594 C  CA  . LEU A 1 195 ? 31.074 131.634 45.186 1.00 19.15  ? 198  LEU A CA  1 
ATOM   1595 C  C   . LEU A 1 195 ? 29.966 131.181 46.103 1.00 15.49  ? 198  LEU A C   1 
ATOM   1596 O  O   . LEU A 1 195 ? 29.628 131.840 47.083 1.00 19.15  ? 198  LEU A O   1 
ATOM   1597 C  CB  . LEU A 1 195 ? 32.429 131.228 45.784 1.00 19.69  ? 198  LEU A CB  1 
ATOM   1598 C  CG  . LEU A 1 195 ? 33.674 131.520 44.941 1.00 12.98  ? 198  LEU A CG  1 
ATOM   1599 C  CD1 . LEU A 1 195 ? 34.892 131.193 45.742 1.00 16.12  ? 198  LEU A CD1 1 
ATOM   1600 C  CD2 . LEU A 1 195 ? 33.633 130.729 43.610 1.00 16.18  ? 198  LEU A CD2 1 
ATOM   1601 N  N   . GLU A 1 196 ? 29.415 130.032 45.781 1.00 17.11  ? 199  GLU A N   1 
ATOM   1602 C  CA  . GLU A 1 196 ? 28.310 129.445 46.531 1.00 19.36  ? 199  GLU A CA  1 
ATOM   1603 C  C   . GLU A 1 196 ? 28.561 129.230 48.020 1.00 18.38  ? 199  GLU A C   1 
ATOM   1604 O  O   . GLU A 1 196 ? 27.707 129.537 48.843 1.00 18.57  ? 199  GLU A O   1 
ATOM   1605 C  CB  . GLU A 1 196 ? 27.887 128.106 45.892 1.00 21.66  ? 199  GLU A CB  1 
ATOM   1606 C  CG  . GLU A 1 196 ? 27.288 128.245 44.499 1.00 22.24  ? 199  GLU A CG  1 
ATOM   1607 C  CD  . GLU A 1 196 ? 28.327 128.336 43.402 1.00 21.57  ? 199  GLU A CD  1 
ATOM   1608 O  OE1 . GLU A 1 196 ? 27.903 128.492 42.239 1.00 24.44  ? 199  GLU A OE1 1 
ATOM   1609 O  OE2 . GLU A 1 196 ? 29.545 128.265 43.686 1.00 30.30  ? 199  GLU A OE2 1 
HETATM 1610 N  N   . MSE A 1 197 ? 29.748 128.761 48.372 1.00 19.22  ? 200  MSE A N   1 
HETATM 1611 C  CA  . MSE A 1 197 ? 30.062 128.492 49.755 1.00 18.59  ? 200  MSE A CA  1 
HETATM 1612 C  C   . MSE A 1 197 ? 30.680 129.673 50.476 1.00 16.64  ? 200  MSE A C   1 
HETATM 1613 O  O   . MSE A 1 197 ? 30.978 129.584 51.644 1.00 15.05  ? 200  MSE A O   1 
HETATM 1614 C  CB  . MSE A 1 197 ? 31.000 127.313 49.866 1.00 17.17  ? 200  MSE A CB  1 
HETATM 1615 C  CG  . MSE A 1 197 ? 30.514 126.080 49.099 1.00 22.61  ? 200  MSE A CG  1 
HETATM 1616 SE SE  . MSE A 1 197 ? 31.715 124.599 49.526 1.00 32.78  ? 200  MSE A SE  1 
HETATM 1617 C  CE  . MSE A 1 197 ? 31.645 124.192 48.203 1.00 29.43  ? 200  MSE A CE  1 
ATOM   1618 N  N   . TYR A 1 198 ? 30.863 130.777 49.769 1.00 15.23  ? 201  TYR A N   1 
ATOM   1619 C  CA  . TYR A 1 198 ? 31.448 131.970 50.378 1.00 17.60  ? 201  TYR A CA  1 
ATOM   1620 C  C   . TYR A 1 198 ? 30.570 132.514 51.519 1.00 18.07  ? 201  TYR A C   1 
ATOM   1621 O  O   . TYR A 1 198 ? 29.347 132.674 51.353 1.00 17.88  ? 201  TYR A O   1 
ATOM   1622 C  CB  . TYR A 1 198 ? 31.633 133.068 49.302 1.00 17.30  ? 201  TYR A CB  1 
ATOM   1623 C  CG  . TYR A 1 198 ? 32.018 134.435 49.860 1.00 24.35  ? 201  TYR A CG  1 
ATOM   1624 C  CD1 . TYR A 1 198 ? 33.371 134.849 49.897 1.00 21.43  ? 201  TYR A CD1 1 
ATOM   1625 C  CD2 . TYR A 1 198 ? 31.040 135.303 50.365 1.00 20.62  ? 201  TYR A CD2 1 
ATOM   1626 C  CE1 . TYR A 1 198 ? 33.737 136.102 50.433 1.00 26.72  ? 201  TYR A CE1 1 
ATOM   1627 C  CE2 . TYR A 1 198 ? 31.389 136.552 50.908 1.00 26.83  ? 201  TYR A CE2 1 
ATOM   1628 C  CZ  . TYR A 1 198 ? 32.742 136.952 50.939 1.00 34.04  ? 201  TYR A CZ  1 
ATOM   1629 O  OH  . TYR A 1 198 ? 33.084 138.198 51.441 1.00 30.64  ? 201  TYR A OH  1 
ATOM   1630 N  N   . GLY A 1 199 ? 31.197 132.864 52.638 1.00 15.88  ? 202  GLY A N   1 
ATOM   1631 C  CA  . GLY A 1 199 ? 30.444 133.388 53.767 1.00 18.70  ? 202  GLY A CA  1 
ATOM   1632 C  C   . GLY A 1 199 ? 29.364 132.503 54.421 1.00 21.24  ? 202  GLY A C   1 
ATOM   1633 O  O   . GLY A 1 199 ? 28.566 133.005 55.195 1.00 21.27  ? 202  GLY A O   1 
ATOM   1634 N  N   . VAL A 1 200 ? 29.358 131.198 54.165 1.00 18.95  ? 203  VAL A N   1 
ATOM   1635 C  CA  . VAL A 1 200 ? 28.358 130.315 54.734 1.00 15.59  ? 203  VAL A CA  1 
ATOM   1636 C  C   . VAL A 1 200 ? 28.907 129.502 55.900 1.00 17.35  ? 203  VAL A C   1 
ATOM   1637 O  O   . VAL A 1 200 ? 29.959 128.965 55.791 1.00 18.38  ? 203  VAL A O   1 
ATOM   1638 C  CB  . VAL A 1 200 ? 27.774 129.338 53.681 1.00 13.94  ? 203  VAL A CB  1 
ATOM   1639 C  CG1 . VAL A 1 200 ? 26.684 128.552 54.276 1.00 11.59  ? 203  VAL A CG1 1 
ATOM   1640 C  CG2 . VAL A 1 200 ? 27.240 130.093 52.486 1.00 21.38  ? 203  VAL A CG2 1 
ATOM   1641 N  N   . ASN A 1 201 ? 28.215 129.522 57.046 1.00 17.44  ? 204  ASN A N   1 
ATOM   1642 C  CA  . ASN A 1 201 ? 28.559 128.736 58.248 1.00 15.84  ? 204  ASN A CA  1 
ATOM   1643 C  C   . ASN A 1 201 ? 27.675 127.507 58.109 1.00 18.87  ? 204  ASN A C   1 
ATOM   1644 O  O   . ASN A 1 201 ? 26.453 127.606 58.159 1.00 13.27  ? 204  ASN A O   1 
ATOM   1645 C  CB  . ASN A 1 201 ? 28.207 129.453 59.586 1.00 21.31  ? 204  ASN A CB  1 
ATOM   1646 C  CG  . ASN A 1 201 ? 28.849 130.826 59.725 1.00 19.57  ? 204  ASN A CG  1 
ATOM   1647 O  OD1 . ASN A 1 201 ? 29.972 130.937 60.188 1.00 20.07  ? 204  ASN A OD1 1 
ATOM   1648 N  ND2 . ASN A 1 201 ? 28.131 131.879 59.314 1.00 16.97  ? 204  ASN A ND2 1 
ATOM   1649 N  N   . TYR A 1 202 ? 28.299 126.351 57.952 1.00 15.84  ? 205  TYR A N   1 
ATOM   1650 C  CA  . TYR A 1 202 ? 27.585 125.087 57.734 1.00 17.65  ? 205  TYR A CA  1 
ATOM   1651 C  C   . TYR A 1 202 ? 27.507 124.333 59.007 1.00 16.56  ? 205  TYR A C   1 
ATOM   1652 O  O   . TYR A 1 202 ? 28.474 124.329 59.767 1.00 20.10  ? 205  TYR A O   1 
ATOM   1653 C  CB  . TYR A 1 202 ? 28.369 124.240 56.733 1.00 15.23  ? 205  TYR A CB  1 
ATOM   1654 C  CG  . TYR A 1 202 ? 28.273 124.771 55.338 1.00 10.58  ? 205  TYR A CG  1 
ATOM   1655 C  CD1 . TYR A 1 202 ? 29.296 125.586 54.801 1.00 9.47   ? 205  TYR A CD1 1 
ATOM   1656 C  CD2 . TYR A 1 202 ? 27.163 124.450 54.531 1.00 12.61  ? 205  TYR A CD2 1 
ATOM   1657 C  CE1 . TYR A 1 202 ? 29.215 126.080 53.447 1.00 15.95  ? 205  TYR A CE1 1 
ATOM   1658 C  CE2 . TYR A 1 202 ? 27.059 124.932 53.173 1.00 13.52  ? 205  TYR A CE2 1 
ATOM   1659 C  CZ  . TYR A 1 202 ? 28.089 125.745 52.649 1.00 22.02  ? 205  TYR A CZ  1 
ATOM   1660 O  OH  . TYR A 1 202 ? 27.949 126.237 51.377 1.00 13.99  ? 205  TYR A OH  1 
ATOM   1661 N  N   . PHE A 1 203 ? 26.370 123.673 59.224 1.00 14.75  ? 206  PHE A N   1 
ATOM   1662 C  CA  . PHE A 1 203 ? 26.123 122.876 60.434 1.00 18.05  ? 206  PHE A CA  1 
ATOM   1663 C  C   . PHE A 1 203 ? 25.418 121.588 60.099 1.00 22.17  ? 206  PHE A C   1 
ATOM   1664 O  O   . PHE A 1 203 ? 24.446 121.563 59.331 1.00 23.06  ? 206  PHE A O   1 
ATOM   1665 C  CB  . PHE A 1 203 ? 25.238 123.616 61.434 1.00 18.05  ? 206  PHE A CB  1 
ATOM   1666 C  CG  . PHE A 1 203 ? 25.836 124.883 61.916 1.00 23.63  ? 206  PHE A CG  1 
ATOM   1667 C  CD1 . PHE A 1 203 ? 25.576 126.087 61.247 1.00 18.27  ? 206  PHE A CD1 1 
ATOM   1668 C  CD2 . PHE A 1 203 ? 26.701 124.878 63.007 1.00 20.38  ? 206  PHE A CD2 1 
ATOM   1669 C  CE1 . PHE A 1 203 ? 26.174 127.262 61.656 1.00 20.30  ? 206  PHE A CE1 1 
ATOM   1670 C  CE2 . PHE A 1 203 ? 27.296 126.048 63.428 1.00 20.69  ? 206  PHE A CE2 1 
ATOM   1671 C  CZ  . PHE A 1 203 ? 27.041 127.238 62.762 1.00 21.22  ? 206  PHE A CZ  1 
ATOM   1672 N  N   . SER A 1 204 ? 25.966 120.495 60.613 1.00 22.69  ? 207  SER A N   1 
ATOM   1673 C  CA  . SER A 1 204 ? 25.328 119.228 60.414 1.00 28.91  ? 207  SER A CA  1 
ATOM   1674 C  C   . SER A 1 204 ? 24.019 119.153 61.257 1.00 30.57  ? 207  SER A C   1 
ATOM   1675 O  O   . SER A 1 204 ? 24.006 119.376 62.486 1.00 26.17  ? 207  SER A O   1 
ATOM   1676 C  CB  . SER A 1 204 ? 26.291 118.128 60.768 1.00 24.07  ? 207  SER A CB  1 
ATOM   1677 O  OG  . SER A 1 204 ? 25.656 116.911 60.531 1.00 30.58  ? 207  SER A OG  1 
ATOM   1678 N  N   . ILE A 1 205 ? 22.909 118.910 60.569 1.00 24.03  ? 208  ILE A N   1 
ATOM   1679 C  CA  . ILE A 1 205 ? 21.615 118.813 61.231 1.00 27.10  ? 208  ILE A CA  1 
ATOM   1680 C  C   . ILE A 1 205 ? 20.806 117.625 60.702 1.00 24.48  ? 208  ILE A C   1 
ATOM   1681 O  O   . ILE A 1 205 ? 21.167 117.035 59.690 1.00 22.16  ? 208  ILE A O   1 
ATOM   1682 C  CB  . ILE A 1 205 ? 20.772 120.124 61.084 1.00 16.35  ? 208  ILE A CB  1 
ATOM   1683 C  CG1 . ILE A 1 205 ? 20.319 120.323 59.645 1.00 19.27  ? 208  ILE A CG1 1 
ATOM   1684 C  CG2 . ILE A 1 205 ? 21.565 121.321 61.565 1.00 18.92  ? 208  ILE A CG2 1 
ATOM   1685 C  CD1 . ILE A 1 205 ? 19.252 121.448 59.511 1.00 17.84  ? 208  ILE A CD1 1 
ATOM   1686 N  N   . LYS A 1 206 ? 19.716 117.292 61.404 1.00 26.17  ? 209  LYS A N   1 
ATOM   1687 C  CA  . LYS A 1 206 ? 18.818 116.186 61.060 1.00 24.97  ? 209  LYS A CA  1 
ATOM   1688 C  C   . LYS A 1 206 ? 17.403 116.696 61.086 1.00 26.25  ? 209  LYS A C   1 
ATOM   1689 O  O   . LYS A 1 206 ? 17.128 117.662 61.792 1.00 26.28  ? 209  LYS A O   1 
ATOM   1690 C  CB  . LYS A 1 206 ? 18.964 115.055 62.090 1.00 21.08  ? 209  LYS A CB  1 
ATOM   1691 C  CG  . LYS A 1 206 ? 19.995 114.073 61.716 1.00 24.10  ? 209  LYS A CG  1 
ATOM   1692 C  CD  . LYS A 1 206 ? 20.173 112.980 62.735 1.00 33.43  ? 209  LYS A CD  1 
ATOM   1693 C  CE  . LYS A 1 206 ? 20.983 111.805 62.155 1.00 33.23  ? 209  LYS A CE  1 
ATOM   1694 N  NZ  . LYS A 1 206 ? 21.706 111.046 63.224 1.00 33.13  ? 209  LYS A NZ  1 
ATOM   1695 N  N   . ASN A 1 207 ? 16.531 116.122 60.252 1.00 30.67  ? 210  ASN A N   1 
ATOM   1696 C  CA  . ASN A 1 207 ? 15.103 116.496 60.269 1.00 30.59  ? 210  ASN A CA  1 
ATOM   1697 C  C   . ASN A 1 207 ? 14.405 115.491 61.250 1.00 28.96  ? 210  ASN A C   1 
ATOM   1698 O  O   . ASN A 1 207 ? 15.082 114.740 61.960 1.00 24.77  ? 210  ASN A O   1 
ATOM   1699 C  CB  . ASN A 1 207 ? 14.502 116.452 58.852 1.00 26.02  ? 210  ASN A CB  1 
ATOM   1700 C  CG  . ASN A 1 207 ? 14.724 115.110 58.134 1.00 15.45  ? 210  ASN A CG  1 
ATOM   1701 O  OD1 . ASN A 1 207 ? 14.978 114.108 58.749 1.00 25.58  ? 210  ASN A OD1 1 
ATOM   1702 N  ND2 . ASN A 1 207 ? 14.627 115.117 56.814 1.00 23.18  ? 210  ASN A ND2 1 
ATOM   1703 N  N   . LYS A 1 208 ? 13.083 115.534 61.344 1.00 27.46  ? 211  LYS A N   1 
ATOM   1704 C  CA  . LYS A 1 208 ? 12.321 114.639 62.234 1.00 27.83  ? 211  LYS A CA  1 
ATOM   1705 C  C   . LYS A 1 208 ? 12.713 113.167 61.933 1.00 32.00  ? 211  LYS A C   1 
ATOM   1706 O  O   . LYS A 1 208 ? 13.133 112.419 62.810 1.00 32.70  ? 211  LYS A O   1 
ATOM   1707 C  CB  . LYS A 1 208 ? 10.818 114.836 61.946 1.00 30.13  ? 211  LYS A CB  1 
ATOM   1708 C  CG  . LYS A 1 208 ? 9.803  114.433 63.014 1.00 41.18  ? 211  LYS A CG  1 
ATOM   1709 C  CD  . LYS A 1 208 ? 9.829  115.426 64.160 1.00 51.62  ? 211  LYS A CD  1 
ATOM   1710 C  CE  . LYS A 1 208 ? 9.476  116.846 63.698 1.00 53.01  ? 211  LYS A CE  1 
ATOM   1711 N  NZ  . LYS A 1 208 ? 9.684  117.898 64.750 1.00 40.27  ? 211  LYS A NZ  1 
ATOM   1712 N  N   . LYS A 1 209 ? 12.638 112.766 60.671 1.00 33.37  ? 212  LYS A N   1 
ATOM   1713 C  CA  . LYS A 1 209 ? 12.942 111.400 60.315 1.00 30.94  ? 212  LYS A CA  1 
ATOM   1714 C  C   . LYS A 1 209 ? 14.392 110.939 60.431 1.00 36.85  ? 212  LYS A C   1 
ATOM   1715 O  O   . LYS A 1 209 ? 14.701 109.784 60.105 1.00 37.65  ? 212  LYS A O   1 
ATOM   1716 C  CB  . LYS A 1 209 ? 12.416 111.094 58.922 1.00 36.92  ? 212  LYS A CB  1 
ATOM   1717 C  CG  . LYS A 1 209 ? 12.885 112.048 57.869 1.00 37.28  ? 212  LYS A CG  1 
ATOM   1718 C  CD  . LYS A 1 209 ? 13.175 111.311 56.592 1.00 40.74  ? 212  LYS A CD  1 
ATOM   1719 C  CE  . LYS A 1 209 ? 11.963 111.231 55.663 1.00 47.68  ? 212  LYS A CE  1 
ATOM   1720 N  NZ  . LYS A 1 209 ? 12.404 111.124 54.223 1.00 49.01  ? 212  LYS A NZ  1 
ATOM   1721 N  N   . GLY A 1 210 ? 15.280 111.830 60.878 1.00 32.26  ? 213  GLY A N   1 
ATOM   1722 C  CA  . GLY A 1 210 ? 16.684 111.476 61.032 1.00 30.38  ? 213  GLY A CA  1 
ATOM   1723 C  C   . GLY A 1 210 ? 17.586 111.639 59.814 1.00 28.19  ? 213  GLY A C   1 
ATOM   1724 O  O   . GLY A 1 210 ? 18.718 111.129 59.811 1.00 27.64  ? 213  GLY A O   1 
ATOM   1725 N  N   . SER A 1 211 ? 17.092 112.312 58.771 1.00 31.40  ? 214  SER A N   1 
ATOM   1726 C  CA  . SER A 1 211 ? 17.886 112.549 57.565 1.00 29.29  ? 214  SER A CA  1 
ATOM   1727 C  C   . SER A 1 211 ? 19.018 113.537 57.868 1.00 26.59  ? 214  SER A C   1 
ATOM   1728 O  O   . SER A 1 211 ? 18.808 114.590 58.494 1.00 26.14  ? 214  SER A O   1 
ATOM   1729 C  CB  . SER A 1 211 ? 17.034 113.120 56.432 1.00 30.97  ? 214  SER A CB  1 
ATOM   1730 O  OG  . SER A 1 211 ? 16.175 112.150 55.869 1.00 36.28  ? 214  SER A OG  1 
ATOM   1731 N  N   . GLU A 1 212 ? 20.213 113.166 57.426 1.00 25.00  ? 215  GLU A N   1 
ATOM   1732 C  CA  . GLU A 1 212 ? 21.420 113.964 57.591 1.00 28.09  ? 215  GLU A CA  1 
ATOM   1733 C  C   . GLU A 1 212 ? 21.501 115.079 56.518 1.00 25.01  ? 215  GLU A C   1 
ATOM   1734 O  O   . GLU A 1 212 ? 21.504 114.820 55.315 1.00 26.17  ? 215  GLU A O   1 
ATOM   1735 C  CB  . GLU A 1 212 ? 22.652 113.054 57.551 1.00 33.42  ? 215  GLU A CB  1 
ATOM   1736 C  CG  . GLU A 1 212 ? 23.344 112.938 58.913 1.00 49.87  ? 215  GLU A CG  1 
ATOM   1737 C  CD  . GLU A 1 212 ? 23.778 114.304 59.446 1.00 67.46  ? 215  GLU A CD  1 
ATOM   1738 O  OE1 . GLU A 1 212 ? 24.399 115.083 58.668 1.00 75.63  ? 215  GLU A OE1 1 
ATOM   1739 O  OE2 . GLU A 1 212 ? 23.479 114.614 60.631 1.00 74.44  ? 215  GLU A OE2 1 
ATOM   1740 N  N   . LEU A 1 213 ? 21.553 116.324 56.979 1.00 25.41  ? 216  LEU A N   1 
ATOM   1741 C  CA  . LEU A 1 213 ? 21.519 117.498 56.092 1.00 24.21  ? 216  LEU A CA  1 
ATOM   1742 C  C   . LEU A 1 213 ? 22.503 118.598 56.545 1.00 22.75  ? 216  LEU A C   1 
ATOM   1743 O  O   . LEU A 1 213 ? 23.268 118.423 57.514 1.00 18.85  ? 216  LEU A O   1 
ATOM   1744 C  CB  . LEU A 1 213 ? 20.082 118.085 56.082 1.00 24.44  ? 216  LEU A CB  1 
ATOM   1745 C  CG  . LEU A 1 213 ? 18.906 117.122 55.804 1.00 24.98  ? 216  LEU A CG  1 
ATOM   1746 C  CD1 . LEU A 1 213 ? 17.556 117.835 55.921 1.00 21.94  ? 216  LEU A CD1 1 
ATOM   1747 C  CD2 . LEU A 1 213 ? 19.101 116.527 54.399 1.00 28.03  ? 216  LEU A CD2 1 
ATOM   1748 N  N   . TRP A 1 214 ? 22.506 119.723 55.834 1.00 18.33  ? 217  TRP A N   1 
ATOM   1749 C  CA  . TRP A 1 214 ? 23.348 120.822 56.258 1.00 20.59  ? 217  TRP A CA  1 
ATOM   1750 C  C   . TRP A 1 214 ? 22.515 122.054 56.389 1.00 17.73  ? 217  TRP A C   1 
ATOM   1751 O  O   . TRP A 1 214 ? 21.651 122.292 55.564 1.00 18.52  ? 217  TRP A O   1 
ATOM   1752 C  CB  . TRP A 1 214 ? 24.448 121.124 55.238 1.00 16.25  ? 217  TRP A CB  1 
ATOM   1753 C  CG  . TRP A 1 214 ? 25.465 120.043 55.087 1.00 17.38  ? 217  TRP A CG  1 
ATOM   1754 C  CD1 . TRP A 1 214 ? 25.496 119.093 54.112 1.00 18.69  ? 217  TRP A CD1 1 
ATOM   1755 C  CD2 . TRP A 1 214 ? 26.594 119.799 55.935 1.00 14.52  ? 217  TRP A CD2 1 
ATOM   1756 N  NE1 . TRP A 1 214 ? 26.578 118.276 54.299 1.00 20.64  ? 217  TRP A NE1 1 
ATOM   1757 C  CE2 . TRP A 1 214 ? 27.270 118.681 55.407 1.00 18.04  ? 217  TRP A CE2 1 
ATOM   1758 C  CE3 . TRP A 1 214 ? 27.088 120.405 57.097 1.00 16.10  ? 217  TRP A CE3 1 
ATOM   1759 C  CZ2 . TRP A 1 214 ? 28.423 118.145 56.003 1.00 26.73  ? 217  TRP A CZ2 1 
ATOM   1760 C  CZ3 . TRP A 1 214 ? 28.224 119.880 57.689 1.00 28.98  ? 217  TRP A CZ3 1 
ATOM   1761 C  CH2 . TRP A 1 214 ? 28.884 118.755 57.139 1.00 28.15  ? 217  TRP A CH2 1 
ATOM   1762 N  N   . LEU A 1 215 ? 22.738 122.783 57.473 1.00 16.00  ? 218  LEU A N   1 
ATOM   1763 C  CA  . LEU A 1 215 ? 22.091 124.049 57.691 1.00 17.85  ? 218  LEU A CA  1 
ATOM   1764 C  C   . LEU A 1 215 ? 23.197 125.030 57.369 1.00 19.41  ? 218  LEU A C   1 
ATOM   1765 O  O   . LEU A 1 215 ? 24.324 124.864 57.820 1.00 22.93  ? 218  LEU A O   1 
ATOM   1766 C  CB  . LEU A 1 215 ? 21.720 124.247 59.173 1.00 20.04  ? 218  LEU A CB  1 
ATOM   1767 C  CG  . LEU A 1 215 ? 21.216 125.686 59.459 1.00 26.23  ? 218  LEU A CG  1 
ATOM   1768 C  CD1 . LEU A 1 215 ? 19.913 125.929 58.696 1.00 21.89  ? 218  LEU A CD1 1 
ATOM   1769 C  CD2 . LEU A 1 215 ? 21.051 125.992 60.967 1.00 17.44  ? 218  LEU A CD2 1 
ATOM   1770 N  N   . GLY A 1 216 ? 22.896 126.023 56.558 1.00 18.46  ? 219  GLY A N   1 
ATOM   1771 C  CA  . GLY A 1 216 ? 23.863 127.052 56.256 1.00 18.71  ? 219  GLY A CA  1 
ATOM   1772 C  C   . GLY A 1 216 ? 23.342 128.344 56.898 1.00 24.15  ? 219  GLY A C   1 
ATOM   1773 O  O   . GLY A 1 216 ? 22.147 128.605 56.804 1.00 17.75  ? 219  GLY A O   1 
ATOM   1774 N  N   . VAL A 1 217 ? 24.181 129.072 57.647 1.00 23.01  ? 220  VAL A N   1 
ATOM   1775 C  CA  . VAL A 1 217 ? 23.798 130.366 58.228 1.00 21.84  ? 220  VAL A CA  1 
ATOM   1776 C  C   . VAL A 1 217 ? 24.715 131.379 57.596 1.00 11.58  ? 220  VAL A C   1 
ATOM   1777 O  O   . VAL A 1 217 ? 25.928 131.243 57.679 1.00 16.45  ? 220  VAL A O   1 
ATOM   1778 C  CB  . VAL A 1 217 ? 24.029 130.496 59.805 1.00 16.63  ? 220  VAL A CB  1 
ATOM   1779 C  CG1 . VAL A 1 217 ? 23.434 131.865 60.292 1.00 18.63  ? 220  VAL A CG1 1 
ATOM   1780 C  CG2 . VAL A 1 217 ? 23.366 129.316 60.579 1.00 17.79  ? 220  VAL A CG2 1 
ATOM   1781 N  N   . ASP A 1 218 ? 24.168 132.420 56.973 1.00 24.40  ? 221  ASP A N   1 
ATOM   1782 C  CA  . ASP A 1 218 ? 25.023 133.451 56.366 1.00 24.86  ? 221  ASP A CA  1 
ATOM   1783 C  C   . ASP A 1 218 ? 24.377 134.840 56.470 1.00 23.68  ? 221  ASP A C   1 
ATOM   1784 O  O   . ASP A 1 218 ? 23.291 134.984 57.083 1.00 22.80  ? 221  ASP A O   1 
ATOM   1785 C  CB  . ASP A 1 218 ? 25.439 133.091 54.916 1.00 31.57  ? 221  ASP A CB  1 
ATOM   1786 C  CG  . ASP A 1 218 ? 24.279 133.126 53.900 1.00 36.75  ? 221  ASP A CG  1 
ATOM   1787 O  OD1 . ASP A 1 218 ? 23.113 133.428 54.273 1.00 25.76  ? 221  ASP A OD1 1 
ATOM   1788 O  OD2 . ASP A 1 218 ? 24.553 132.837 52.704 1.00 31.85  ? 221  ASP A OD2 1 
ATOM   1789 N  N   . ALA A 1 219 ? 25.035 135.846 55.875 1.00 18.83  ? 222  ALA A N   1 
ATOM   1790 C  CA  . ALA A 1 219 ? 24.519 137.217 55.925 1.00 23.09  ? 222  ALA A CA  1 
ATOM   1791 C  C   . ALA A 1 219 ? 23.073 137.422 55.438 1.00 23.45  ? 222  ALA A C   1 
ATOM   1792 O  O   . ALA A 1 219 ? 22.344 138.292 55.945 1.00 23.77  ? 222  ALA A O   1 
ATOM   1793 C  CB  . ALA A 1 219 ? 25.458 138.166 55.224 1.00 16.40  ? 222  ALA A CB  1 
ATOM   1794 N  N   . LEU A 1 220 ? 22.632 136.546 54.535 1.00 24.43  ? 223  LEU A N   1 
ATOM   1795 C  CA  . LEU A 1 220 ? 21.311 136.664 53.913 1.00 27.91  ? 223  LEU A CA  1 
ATOM   1796 C  C   . LEU A 1 220 ? 20.162 135.867 54.498 1.00 29.52  ? 223  LEU A C   1 
ATOM   1797 O  O   . LEU A 1 220 ? 19.006 136.165 54.216 1.00 33.80  ? 223  LEU A O   1 
ATOM   1798 C  CB  . LEU A 1 220 ? 21.408 136.333 52.419 1.00 27.07  ? 223  LEU A CB  1 
ATOM   1799 C  CG  . LEU A 1 220 ? 22.447 137.217 51.757 1.00 31.07  ? 223  LEU A CG  1 
ATOM   1800 C  CD1 . LEU A 1 220 ? 22.598 136.803 50.313 1.00 37.93  ? 223  LEU A CD1 1 
ATOM   1801 C  CD2 . LEU A 1 220 ? 22.022 138.692 51.899 1.00 21.52  ? 223  LEU A CD2 1 
ATOM   1802 N  N   . GLY A 1 221 ? 20.447 134.842 55.286 1.00 27.14  ? 224  GLY A N   1 
ATOM   1803 C  CA  . GLY A 1 221 ? 19.361 134.033 55.787 1.00 23.05  ? 224  GLY A CA  1 
ATOM   1804 C  C   . GLY A 1 221 ? 19.780 132.645 56.207 1.00 20.69  ? 224  GLY A C   1 
ATOM   1805 O  O   . GLY A 1 221 ? 20.891 132.458 56.648 1.00 22.70  ? 224  GLY A O   1 
ATOM   1806 N  N   . LEU A 1 222 ? 18.858 131.694 56.142 1.00 23.10  ? 225  LEU A N   1 
ATOM   1807 C  CA  . LEU A 1 222 ? 19.133 130.308 56.491 1.00 22.59  ? 225  LEU A CA  1 
ATOM   1808 C  C   . LEU A 1 222 ? 18.864 129.426 55.279 1.00 25.21  ? 225  LEU A C   1 
ATOM   1809 O  O   . LEU A 1 222 ? 17.866 129.592 54.592 1.00 26.90  ? 225  LEU A O   1 
ATOM   1810 C  CB  . LEU A 1 222 ? 18.284 129.841 57.669 1.00 22.95  ? 225  LEU A CB  1 
ATOM   1811 C  CG  . LEU A 1 222 ? 18.504 130.558 59.011 1.00 30.18  ? 225  LEU A CG  1 
ATOM   1812 C  CD1 . LEU A 1 222 ? 17.549 130.020 60.033 1.00 25.25  ? 225  LEU A CD1 1 
ATOM   1813 C  CD2 . LEU A 1 222 ? 19.915 130.379 59.505 1.00 24.69  ? 225  LEU A CD2 1 
ATOM   1814 N  N   . ASN A 1 223 ? 19.726 128.443 55.062 1.00 22.40  ? 226  ASN A N   1 
ATOM   1815 C  CA  . ASN A 1 223 ? 19.606 127.592 53.909 1.00 19.63  ? 226  ASN A CA  1 
ATOM   1816 C  C   . ASN A 1 223 ? 19.762 126.167 54.345 1.00 16.21  ? 226  ASN A C   1 
ATOM   1817 O  O   . ASN A 1 223 ? 20.374 125.879 55.346 1.00 17.67  ? 226  ASN A O   1 
ATOM   1818 C  CB  . ASN A 1 223 ? 20.709 127.947 52.932 1.00 26.08  ? 226  ASN A CB  1 
ATOM   1819 C  CG  . ASN A 1 223 ? 20.584 129.370 52.405 1.00 31.56  ? 226  ASN A CG  1 
ATOM   1820 O  OD1 . ASN A 1 223 ? 19.477 129.881 52.220 1.00 27.17  ? 226  ASN A OD1 1 
ATOM   1821 N  ND2 . ASN A 1 223 ? 21.719 130.002 52.137 1.00 27.03  ? 226  ASN A ND2 1 
ATOM   1822 N  N   . ILE A 1 224 ? 19.104 125.284 53.612 1.00 18.26  ? 227  ILE A N   1 
ATOM   1823 C  CA  . ILE A 1 224 ? 19.146 123.869 53.868 1.00 17.63  ? 227  ILE A CA  1 
ATOM   1824 C  C   . ILE A 1 224 ? 19.777 123.190 52.624 1.00 15.08  ? 227  ILE A C   1 
ATOM   1825 O  O   . ILE A 1 224 ? 19.331 123.398 51.473 1.00 18.80  ? 227  ILE A O   1 
ATOM   1826 C  CB  . ILE A 1 224 ? 17.713 123.290 54.147 1.00 21.50  ? 227  ILE A CB  1 
ATOM   1827 C  CG1 . ILE A 1 224 ? 17.023 124.040 55.318 1.00 20.07  ? 227  ILE A CG1 1 
ATOM   1828 C  CG2 . ILE A 1 224 ? 17.824 121.767 54.354 1.00 22.06  ? 227  ILE A CG2 1 
ATOM   1829 C  CD1 . ILE A 1 224 ? 17.755 123.893 56.692 1.00 21.72  ? 227  ILE A CD1 1 
ATOM   1830 N  N   . TYR A 1 225 ? 20.803 122.371 52.862 1.00 19.46  ? 228  TYR A N   1 
ATOM   1831 C  CA  . TYR A 1 225 ? 21.497 121.641 51.787 1.00 18.16  ? 228  TYR A CA  1 
ATOM   1832 C  C   . TYR A 1 225 ? 21.449 120.146 51.950 1.00 15.01  ? 228  TYR A C   1 
ATOM   1833 O  O   . TYR A 1 225 ? 21.345 119.612 53.067 1.00 18.94  ? 228  TYR A O   1 
ATOM   1834 C  CB  . TYR A 1 225 ? 22.981 121.955 51.723 1.00 12.95  ? 228  TYR A CB  1 
ATOM   1835 C  CG  . TYR A 1 225 ? 23.329 123.390 51.686 1.00 10.71  ? 228  TYR A CG  1 
ATOM   1836 C  CD1 . TYR A 1 225 ? 23.264 124.154 52.834 1.00 16.39  ? 228  TYR A CD1 1 
ATOM   1837 C  CD2 . TYR A 1 225 ? 23.725 123.986 50.520 1.00 6.59   ? 228  TYR A CD2 1 
ATOM   1838 C  CE1 . TYR A 1 225 ? 23.577 125.480 52.826 1.00 16.78  ? 228  TYR A CE1 1 
ATOM   1839 C  CE2 . TYR A 1 225 ? 24.057 125.325 50.508 1.00 8.38   ? 228  TYR A CE2 1 
ATOM   1840 C  CZ  . TYR A 1 225 ? 23.965 126.055 51.658 1.00 11.98  ? 228  TYR A CZ  1 
ATOM   1841 O  OH  . TYR A 1 225 ? 24.154 127.400 51.661 1.00 20.98  ? 228  TYR A OH  1 
ATOM   1842 N  N   . GLU A 1 226 ? 21.461 119.485 50.811 1.00 16.56  ? 229  GLU A N   1 
ATOM   1843 C  CA  . GLU A 1 226 ? 21.491 118.038 50.739 1.00 18.52  ? 229  GLU A CA  1 
ATOM   1844 C  C   . GLU A 1 226 ? 22.886 117.686 51.355 1.00 24.62  ? 229  GLU A C   1 
ATOM   1845 O  O   . GLU A 1 226 ? 23.852 118.453 51.225 1.00 20.18  ? 229  GLU A O   1 
ATOM   1846 C  CB  . GLU A 1 226 ? 21.492 117.667 49.246 1.00 27.18  ? 229  GLU A CB  1 
ATOM   1847 C  CG  . GLU A 1 226 ? 20.510 116.612 48.805 1.00 45.71  ? 229  GLU A CG  1 
ATOM   1848 C  CD  . GLU A 1 226 ? 21.158 115.657 47.788 1.00 67.15  ? 229  GLU A CD  1 
ATOM   1849 O  OE1 . GLU A 1 226 ? 20.627 115.546 46.658 1.00 72.82  ? 229  GLU A OE1 1 
ATOM   1850 O  OE2 . GLU A 1 226 ? 22.212 115.032 48.106 1.00 71.70  ? 229  GLU A OE2 1 
ATOM   1851 N  N   . GLN A 1 227 ? 23.002 116.545 52.023 1.00 20.28  ? 230  GLN A N   1 
ATOM   1852 C  CA  . GLN A 1 227 ? 24.265 116.136 52.618 1.00 23.41  ? 230  GLN A CA  1 
ATOM   1853 C  C   . GLN A 1 227 ? 25.489 116.170 51.651 1.00 23.15  ? 230  GLN A C   1 
ATOM   1854 O  O   . GLN A 1 227 ? 26.566 116.579 52.046 1.00 19.52  ? 230  GLN A O   1 
ATOM   1855 C  CB  . GLN A 1 227 ? 24.123 114.718 53.198 1.00 22.01  ? 230  GLN A CB  1 
ATOM   1856 C  CG  . GLN A 1 227 ? 25.185 114.353 54.225 1.00 31.43  ? 230  GLN A CG  1 
ATOM   1857 C  CD  . GLN A 1 227 ? 25.277 112.847 54.488 1.00 40.25  ? 230  GLN A CD  1 
ATOM   1858 O  OE1 . GLN A 1 227 ? 26.168 112.392 55.211 1.00 50.24  ? 230  GLN A OE1 1 
ATOM   1859 N  NE2 . GLN A 1 227 ? 24.368 112.070 53.896 1.00 35.19  ? 230  GLN A NE2 1 
ATOM   1860 N  N   . ASN A 1 228 ? 25.267 115.851 50.374 1.00 20.90  ? 231  ASN A N   1 
ATOM   1861 C  CA  . ASN A 1 228 ? 26.326 115.737 49.370 1.00 19.94  ? 231  ASN A CA  1 
ATOM   1862 C  C   . ASN A 1 228 ? 26.577 116.953 48.518 1.00 24.67  ? 231  ASN A C   1 
ATOM   1863 O  O   . ASN A 1 228 ? 27.471 116.943 47.664 1.00 28.45  ? 231  ASN A O   1 
ATOM   1864 C  CB  . ASN A 1 228 ? 25.873 114.679 48.362 1.00 19.06  ? 231  ASN A CB  1 
ATOM   1865 C  CG  . ASN A 1 228 ? 26.013 113.292 48.887 1.00 31.99  ? 231  ASN A CG  1 
ATOM   1866 O  OD1 . ASN A 1 228 ? 26.529 113.074 49.992 1.00 34.43  ? 231  ASN A OD1 1 
ATOM   1867 N  ND2 . ASN A 1 228 ? 25.587 112.325 48.096 1.00 31.28  ? 231  ASN A ND2 1 
ATOM   1868 N  N   . ASP A 1 229 ? 25.719 117.947 48.642 1.00 20.25  ? 232  ASP A N   1 
ATOM   1869 C  CA  . ASP A 1 229 ? 25.858 119.126 47.821 1.00 13.58  ? 232  ASP A CA  1 
ATOM   1870 C  C   . ASP A 1 229 ? 25.798 120.429 48.692 1.00 22.08  ? 232  ASP A C   1 
ATOM   1871 O  O   . ASP A 1 229 ? 24.725 120.926 49.069 1.00 18.53  ? 232  ASP A O   1 
ATOM   1872 C  CB  . ASP A 1 229 ? 24.773 119.052 46.724 1.00 12.76  ? 232  ASP A CB  1 
ATOM   1873 C  CG  . ASP A 1 229 ? 24.749 120.270 45.779 1.00 18.84  ? 232  ASP A CG  1 
ATOM   1874 O  OD1 . ASP A 1 229 ? 25.494 121.257 45.950 1.00 21.28  ? 232  ASP A OD1 1 
ATOM   1875 O  OD2 . ASP A 1 229 ? 23.945 120.251 44.830 1.00 25.41  ? 232  ASP A OD2 1 
ATOM   1876 N  N   . ARG A 1 230 ? 26.959 120.963 49.042 1.00 20.96  ? 233  ARG A N   1 
ATOM   1877 C  CA  . ARG A 1 230 ? 26.994 122.211 49.806 1.00 22.21  ? 233  ARG A CA  1 
ATOM   1878 C  C   . ARG A 1 230 ? 27.069 123.475 48.910 1.00 20.80  ? 233  ARG A C   1 
ATOM   1879 O  O   . ARG A 1 230 ? 27.041 124.593 49.397 1.00 17.81  ? 233  ARG A O   1 
ATOM   1880 C  CB  . ARG A 1 230 ? 28.084 122.159 50.868 1.00 19.36  ? 233  ARG A CB  1 
ATOM   1881 C  CG  . ARG A 1 230 ? 27.636 121.220 51.971 1.00 24.67  ? 233  ARG A CG  1 
ATOM   1882 C  CD  . ARG A 1 230 ? 28.761 120.567 52.675 1.00 24.86  ? 233  ARG A CD  1 
ATOM   1883 N  NE  . ARG A 1 230 ? 29.434 121.484 53.539 1.00 32.54  ? 233  ARG A NE  1 
ATOM   1884 C  CZ  . ARG A 1 230 ? 30.716 121.401 53.850 1.00 44.42  ? 233  ARG A CZ  1 
ATOM   1885 N  NH1 . ARG A 1 230 ? 31.459 120.423 53.344 1.00 44.39  ? 233  ARG A NH1 1 
ATOM   1886 N  NH2 . ARG A 1 230 ? 31.242 122.310 54.670 1.00 46.66  ? 233  ARG A NH2 1 
ATOM   1887 N  N   . LEU A 1 231 ? 27.058 123.288 47.597 1.00 20.25  ? 234  LEU A N   1 
ATOM   1888 C  CA  . LEU A 1 231 ? 27.090 124.406 46.659 1.00 20.45  ? 234  LEU A CA  1 
ATOM   1889 C  C   . LEU A 1 231 ? 25.712 124.991 46.347 1.00 18.82  ? 234  LEU A C   1 
ATOM   1890 O  O   . LEU A 1 231 ? 25.572 126.208 46.163 1.00 21.93  ? 234  LEU A O   1 
ATOM   1891 C  CB  . LEU A 1 231 ? 27.703 123.946 45.318 1.00 20.06  ? 234  LEU A CB  1 
ATOM   1892 C  CG  . LEU A 1 231 ? 29.220 123.974 45.175 1.00 17.04  ? 234  LEU A CG  1 
ATOM   1893 C  CD1 . LEU A 1 231 ? 29.783 122.981 46.062 1.00 20.99  ? 234  LEU A CD1 1 
ATOM   1894 C  CD2 . LEU A 1 231 ? 29.612 123.679 43.725 1.00 16.13  ? 234  LEU A CD2 1 
ATOM   1895 N  N   . THR A 1 232 ? 24.713 124.120 46.214 1.00 21.53  ? 235  THR A N   1 
ATOM   1896 C  CA  . THR A 1 232 ? 23.356 124.536 45.849 1.00 18.27  ? 235  THR A CA  1 
ATOM   1897 C  C   . THR A 1 232 ? 22.324 124.184 46.880 1.00 22.54  ? 235  THR A C   1 
ATOM   1898 O  O   . THR A 1 232 ? 21.877 123.060 46.973 1.00 16.68  ? 235  THR A O   1 
ATOM   1899 C  CB  . THR A 1 232 ? 22.927 123.909 44.513 1.00 22.24  ? 235  THR A CB  1 
ATOM   1900 O  OG1 . THR A 1 232 ? 23.854 124.303 43.502 1.00 30.85  ? 235  THR A OG1 1 
ATOM   1901 C  CG2 . THR A 1 232 ? 21.555 124.410 44.079 1.00 19.15  ? 235  THR A CG2 1 
ATOM   1902 N  N   . PRO A 1 233 ? 21.940 125.158 47.693 1.00 23.88  ? 236  PRO A N   1 
ATOM   1903 C  CA  . PRO A 1 233 ? 20.931 124.838 48.712 1.00 23.12  ? 236  PRO A CA  1 
ATOM   1904 C  C   . PRO A 1 233 ? 19.577 124.481 48.057 1.00 19.01  ? 236  PRO A C   1 
ATOM   1905 O  O   . PRO A 1 233 ? 19.295 124.861 46.899 1.00 16.95  ? 236  PRO A O   1 
ATOM   1906 C  CB  . PRO A 1 233 ? 20.878 126.120 49.583 1.00 17.85  ? 236  PRO A CB  1 
ATOM   1907 C  CG  . PRO A 1 233 ? 21.334 127.212 48.643 1.00 18.57  ? 236  PRO A CG  1 
ATOM   1908 C  CD  . PRO A 1 233 ? 22.422 126.546 47.781 1.00 16.47  ? 236  PRO A CD  1 
ATOM   1909 N  N   . LYS A 1 234 ? 18.835 123.597 48.714 1.00 22.16  ? 237  LYS A N   1 
ATOM   1910 C  CA  . LYS A 1 234 ? 17.502 123.200 48.201 1.00 21.25  ? 237  LYS A CA  1 
ATOM   1911 C  C   . LYS A 1 234 ? 16.319 124.057 48.751 1.00 19.63  ? 237  LYS A C   1 
ATOM   1912 O  O   . LYS A 1 234 ? 15.367 124.366 48.004 1.00 18.69  ? 237  LYS A O   1 
ATOM   1913 C  CB  . LYS A 1 234 ? 17.273 121.716 48.412 1.00 23.54  ? 237  LYS A CB  1 
ATOM   1914 C  CG  . LYS A 1 234 ? 18.344 120.876 47.740 1.00 31.07  ? 237  LYS A CG  1 
ATOM   1915 C  CD  . LYS A 1 234 ? 18.389 121.104 46.221 1.00 31.27  ? 237  LYS A CD  1 
ATOM   1916 C  CE  . LYS A 1 234 ? 19.213 119.998 45.486 1.00 32.42  ? 237  LYS A CE  1 
ATOM   1917 N  NZ  . LYS A 1 234 ? 20.687 119.997 45.766 1.00 32.25  ? 237  LYS A NZ  1 
ATOM   1918 N  N   . ILE A 1 235 ? 16.428 124.491 50.014 1.00 17.85  ? 238  ILE A N   1 
ATOM   1919 C  CA  . ILE A 1 235 ? 15.411 125.318 50.688 1.00 20.67  ? 238  ILE A CA  1 
ATOM   1920 C  C   . ILE A 1 235 ? 16.044 126.524 51.358 1.00 21.85  ? 238  ILE A C   1 
ATOM   1921 O  O   . ILE A 1 235 ? 17.162 126.465 51.846 1.00 17.48  ? 238  ILE A O   1 
ATOM   1922 C  CB  . ILE A 1 235 ? 14.612 124.554 51.809 1.00 23.66  ? 238  ILE A CB  1 
ATOM   1923 C  CG1 . ILE A 1 235 ? 14.000 123.243 51.262 1.00 19.66  ? 238  ILE A CG1 1 
ATOM   1924 C  CG2 . ILE A 1 235 ? 13.453 125.475 52.362 1.00 19.75  ? 238  ILE A CG2 1 
ATOM   1925 C  CD1 . ILE A 1 235 ? 13.742 122.220 52.325 1.00 24.21  ? 238  ILE A CD1 1 
ATOM   1926 N  N   . GLY A 1 236 ? 15.281 127.601 51.440 1.00 25.29  ? 239  GLY A N   1 
ATOM   1927 C  CA  . GLY A 1 236 ? 15.809 128.794 52.040 1.00 25.69  ? 239  GLY A CA  1 
ATOM   1928 C  C   . GLY A 1 236 ? 14.753 129.629 52.722 1.00 22.03  ? 239  GLY A C   1 
ATOM   1929 O  O   . GLY A 1 236 ? 13.578 129.580 52.349 1.00 21.57  ? 239  GLY A O   1 
ATOM   1930 N  N   . PHE A 1 237 ? 15.178 130.298 53.788 1.00 26.61  ? 240  PHE A N   1 
ATOM   1931 C  CA  . PHE A 1 237 ? 14.338 131.187 54.586 1.00 30.27  ? 240  PHE A CA  1 
ATOM   1932 C  C   . PHE A 1 237 ? 15.031 132.530 54.686 1.00 33.17  ? 240  PHE A C   1 
ATOM   1933 O  O   . PHE A 1 237 ? 16.173 132.626 55.189 1.00 35.00  ? 240  PHE A O   1 
ATOM   1934 C  CB  . PHE A 1 237 ? 14.150 130.650 56.008 1.00 25.70  ? 240  PHE A CB  1 
ATOM   1935 C  CG  . PHE A 1 237 ? 13.470 129.318 56.053 1.00 27.64  ? 240  PHE A CG  1 
ATOM   1936 C  CD1 . PHE A 1 237 ? 14.211 128.141 56.051 1.00 30.41  ? 240  PHE A CD1 1 
ATOM   1937 C  CD2 . PHE A 1 237 ? 12.090 129.232 56.056 1.00 26.82  ? 240  PHE A CD2 1 
ATOM   1938 C  CE1 . PHE A 1 237 ? 13.558 126.896 56.047 1.00 30.03  ? 240  PHE A CE1 1 
ATOM   1939 C  CE2 . PHE A 1 237 ? 11.440 127.990 56.056 1.00 26.68  ? 240  PHE A CE2 1 
ATOM   1940 C  CZ  . PHE A 1 237 ? 12.163 126.833 56.050 1.00 19.08  ? 240  PHE A CZ  1 
ATOM   1941 N  N   . PRO A 1 238 ? 14.369 133.592 54.183 1.00 33.20  ? 241  PRO A N   1 
ATOM   1942 C  CA  . PRO A 1 238 ? 14.997 134.914 54.262 1.00 29.34  ? 241  PRO A CA  1 
ATOM   1943 C  C   . PRO A 1 238 ? 14.808 135.371 55.703 1.00 27.88  ? 241  PRO A C   1 
ATOM   1944 O  O   . PRO A 1 238 ? 13.905 134.851 56.364 1.00 34.29  ? 241  PRO A O   1 
ATOM   1945 C  CB  . PRO A 1 238 ? 14.162 135.739 53.282 1.00 31.07  ? 241  PRO A CB  1 
ATOM   1946 C  CG  . PRO A 1 238 ? 12.761 135.154 53.473 1.00 26.73  ? 241  PRO A CG  1 
ATOM   1947 C  CD  . PRO A 1 238 ? 12.995 133.657 53.628 1.00 28.31  ? 241  PRO A CD  1 
ATOM   1948 N  N   . TRP A 1 239 ? 15.636 136.288 56.217 1.00 31.10  ? 242  TRP A N   1 
ATOM   1949 C  CA  . TRP A 1 239 ? 15.465 136.774 57.618 1.00 31.56  ? 242  TRP A CA  1 
ATOM   1950 C  C   . TRP A 1 239 ? 14.052 137.285 57.975 1.00 30.59  ? 242  TRP A C   1 
ATOM   1951 O  O   . TRP A 1 239 ? 13.470 136.894 58.979 1.00 30.33  ? 242  TRP A O   1 
ATOM   1952 C  CB  . TRP A 1 239 ? 16.448 137.895 57.954 1.00 31.80  ? 242  TRP A CB  1 
ATOM   1953 C  CG  . TRP A 1 239 ? 17.844 137.452 57.996 1.00 28.06  ? 242  TRP A CG  1 
ATOM   1954 C  CD1 . TRP A 1 239 ? 18.880 137.925 57.237 1.00 32.00  ? 242  TRP A CD1 1 
ATOM   1955 C  CD2 . TRP A 1 239 ? 18.372 136.398 58.794 1.00 23.81  ? 242  TRP A CD2 1 
ATOM   1956 N  NE1 . TRP A 1 239 ? 20.032 137.218 57.507 1.00 27.84  ? 242  TRP A NE1 1 
ATOM   1957 C  CE2 . TRP A 1 239 ? 19.755 136.270 58.458 1.00 25.52  ? 242  TRP A CE2 1 
ATOM   1958 C  CE3 . TRP A 1 239 ? 17.818 135.529 59.752 1.00 22.22  ? 242  TRP A CE3 1 
ATOM   1959 C  CZ2 . TRP A 1 239 ? 20.598 135.304 59.044 1.00 20.11  ? 242  TRP A CZ2 1 
ATOM   1960 C  CZ3 . TRP A 1 239 ? 18.675 134.549 60.347 1.00 21.58  ? 242  TRP A CZ3 1 
ATOM   1961 C  CH2 . TRP A 1 239 ? 20.045 134.459 59.976 1.00 22.51  ? 242  TRP A CH2 1 
ATOM   1962 N  N   . SER A 1 240 ? 13.501 138.142 57.121 1.00 34.54  ? 243  SER A N   1 
ATOM   1963 C  CA  . SER A 1 240 ? 12.173 138.703 57.329 1.00 37.64  ? 243  SER A CA  1 
ATOM   1964 C  C   . SER A 1 240 ? 11.036 137.701 57.591 1.00 43.45  ? 243  SER A C   1 
ATOM   1965 O  O   . SER A 1 240 ? 9.929  138.098 57.945 1.00 51.33  ? 243  SER A O   1 
ATOM   1966 C  CB  . SER A 1 240 ? 11.795 139.601 56.155 1.00 38.30  ? 243  SER A CB  1 
ATOM   1967 O  OG  . SER A 1 240 ? 11.766 138.887 54.935 1.00 42.81  ? 243  SER A OG  1 
ATOM   1968 N  N   . GLU A 1 241 ? 11.289 136.412 57.394 1.00 42.33  ? 244  GLU A N   1 
ATOM   1969 C  CA  . GLU A 1 241 ? 10.270 135.391 57.629 1.00 37.61  ? 244  GLU A CA  1 
ATOM   1970 C  C   . GLU A 1 241 ? 10.400 134.702 58.975 1.00 38.93  ? 244  GLU A C   1 
ATOM   1971 O  O   . GLU A 1 241 ? 9.602  133.802 59.313 1.00 36.65  ? 244  GLU A O   1 
ATOM   1972 C  CB  . GLU A 1 241 ? 10.297 134.321 56.547 1.00 37.94  ? 244  GLU A CB  1 
ATOM   1973 C  CG  . GLU A 1 241 ? 9.867  134.816 55.178 1.00 44.31  ? 244  GLU A CG  1 
ATOM   1974 C  CD  . GLU A 1 241 ? 9.543  133.675 54.222 1.00 40.23  ? 244  GLU A CD  1 
ATOM   1975 O  OE1 . GLU A 1 241 ? 9.914  132.503 54.537 1.00 33.51  ? 244  GLU A OE1 1 
ATOM   1976 O  OE2 . GLU A 1 241 ? 8.888  133.975 53.189 1.00 43.48  ? 244  GLU A OE2 1 
ATOM   1977 N  N   . ILE A 1 242 ? 11.463 135.059 59.695 1.00 39.64  ? 245  ILE A N   1 
ATOM   1978 C  CA  . ILE A 1 242 ? 11.759 134.473 60.996 1.00 37.02  ? 245  ILE A CA  1 
ATOM   1979 C  C   . ILE A 1 242 ? 11.430 135.493 62.080 1.00 41.27  ? 245  ILE A C   1 
ATOM   1980 O  O   . ILE A 1 242 ? 11.854 136.663 62.008 1.00 39.80  ? 245  ILE A O   1 
ATOM   1981 C  CB  . ILE A 1 242 ? 13.268 134.120 61.161 1.00 37.56  ? 245  ILE A CB  1 
ATOM   1982 C  CG1 . ILE A 1 242 ? 13.820 133.301 59.976 1.00 36.49  ? 245  ILE A CG1 1 
ATOM   1983 C  CG2 . ILE A 1 242 ? 13.492 133.402 62.490 1.00 34.75  ? 245  ILE A CG2 1 
ATOM   1984 C  CD1 . ILE A 1 242 ? 13.202 131.977 59.825 1.00 40.46  ? 245  ILE A CD1 1 
ATOM   1985 N  N   . ARG A 1 243 ? 10.652 135.081 63.070 1.00 44.14  ? 246  ARG A N   1 
ATOM   1986 C  CA  . ARG A 1 243 ? 10.335 136.014 64.151 1.00 46.10  ? 246  ARG A CA  1 
ATOM   1987 C  C   . ARG A 1 243 ? 11.082 135.664 65.443 1.00 36.71  ? 246  ARG A C   1 
ATOM   1988 O  O   . ARG A 1 243 ? 11.507 136.553 66.163 1.00 40.29  ? 246  ARG A O   1 
ATOM   1989 C  CB  . ARG A 1 243 ? 8.803  136.158 64.401 1.00 49.51  ? 246  ARG A CB  1 
ATOM   1990 C  CG  . ARG A 1 243 ? 8.012  134.885 64.731 1.00 54.50  ? 246  ARG A CG  1 
ATOM   1991 C  CD  . ARG A 1 243 ? 6.803  135.181 65.627 1.00 56.86  ? 246  ARG A CD  1 
ATOM   1992 N  NE  . ARG A 1 243 ? 7.214  135.336 67.031 1.00 72.68  ? 246  ARG A NE  1 
ATOM   1993 C  CZ  . ARG A 1 243 ? 7.688  136.458 67.597 1.00 79.04  ? 246  ARG A CZ  1 
ATOM   1994 N  NH1 . ARG A 1 243 ? 7.824  137.591 66.905 1.00 79.14  ? 246  ARG A NH1 1 
ATOM   1995 N  NH2 . ARG A 1 243 ? 8.071  136.437 68.871 1.00 82.04  ? 246  ARG A NH2 1 
ATOM   1996 N  N   . ASN A 1 244 ? 11.313 134.375 65.670 1.00 32.11  ? 247  ASN A N   1 
ATOM   1997 C  CA  . ASN A 1 244 ? 11.990 133.911 66.860 1.00 36.94  ? 247  ASN A CA  1 
ATOM   1998 C  C   . ASN A 1 244 ? 12.692 132.586 66.637 1.00 38.82  ? 247  ASN A C   1 
ATOM   1999 O  O   . ASN A 1 244 ? 12.149 131.710 65.973 1.00 36.46  ? 247  ASN A O   1 
ATOM   2000 C  CB  . ASN A 1 244 ? 10.947 133.724 67.998 1.00 45.59  ? 247  ASN A CB  1 
ATOM   2001 C  CG  . ASN A 1 244 ? 11.564 133.199 69.309 1.00 45.67  ? 247  ASN A CG  1 
ATOM   2002 O  OD1 . ASN A 1 244 ? 11.680 131.984 69.524 1.00 50.12  ? 247  ASN A OD1 1 
ATOM   2003 N  ND2 . ASN A 1 244 ? 11.976 134.119 70.175 1.00 42.09  ? 247  ASN A ND2 1 
ATOM   2004 N  N   . ILE A 1 245 ? 13.884 132.450 67.223 1.00 37.27  ? 248  ILE A N   1 
ATOM   2005 C  CA  . ILE A 1 245 ? 14.678 131.221 67.158 1.00 37.65  ? 248  ILE A CA  1 
ATOM   2006 C  C   . ILE A 1 245 ? 14.959 130.844 68.593 1.00 38.16  ? 248  ILE A C   1 
ATOM   2007 O  O   . ILE A 1 245 ? 15.000 131.700 69.465 1.00 44.19  ? 248  ILE A O   1 
ATOM   2008 C  CB  . ILE A 1 245 ? 16.019 131.402 66.449 1.00 36.28  ? 248  ILE A CB  1 
ATOM   2009 C  CG1 . ILE A 1 245 ? 16.941 132.332 67.281 1.00 31.34  ? 248  ILE A CG1 1 
ATOM   2010 C  CG2 . ILE A 1 245 ? 15.750 131.759 64.991 1.00 26.90  ? 248  ILE A CG2 1 
ATOM   2011 C  CD1 . ILE A 1 245 ? 17.729 133.382 66.506 1.00 25.24  ? 248  ILE A CD1 1 
ATOM   2012 N  N   . SER A 1 246 ? 15.157 129.560 68.836 1.00 37.25  ? 249  SER A N   1 
ATOM   2013 C  CA  . SER A 1 246 ? 15.431 129.094 70.179 1.00 34.20  ? 249  SER A CA  1 
ATOM   2014 C  C   . SER A 1 246 ? 15.815 127.613 70.163 1.00 34.75  ? 249  SER A C   1 
ATOM   2015 O  O   . SER A 1 246 ? 15.581 126.917 69.178 1.00 35.04  ? 249  SER A O   1 
ATOM   2016 C  CB  . SER A 1 246 ? 14.169 129.279 71.037 1.00 40.04  ? 249  SER A CB  1 
ATOM   2017 O  OG  . SER A 1 246 ? 13.174 128.300 70.757 1.00 37.93  ? 249  SER A OG  1 
ATOM   2018 N  N   . PHE A 1 247 ? 16.449 127.140 71.230 1.00 31.88  ? 250  PHE A N   1 
ATOM   2019 C  CA  . PHE A 1 247 ? 16.770 125.717 71.321 1.00 38.13  ? 250  PHE A CA  1 
ATOM   2020 C  C   . PHE A 1 247 ? 16.560 125.100 72.694 1.00 41.07  ? 250  PHE A C   1 
ATOM   2021 O  O   . PHE A 1 247 ? 16.708 125.739 73.732 1.00 45.22  ? 250  PHE A O   1 
ATOM   2022 C  CB  . PHE A 1 247 ? 18.211 125.403 70.872 1.00 34.67  ? 250  PHE A CB  1 
ATOM   2023 C  CG  . PHE A 1 247 ? 19.270 126.051 71.711 1.00 38.60  ? 250  PHE A CG  1 
ATOM   2024 C  CD1 . PHE A 1 247 ? 19.788 125.400 72.831 1.00 46.77  ? 250  PHE A CD1 1 
ATOM   2025 C  CD2 . PHE A 1 247 ? 19.696 127.350 71.431 1.00 39.93  ? 250  PHE A CD2 1 
ATOM   2026 C  CE1 . PHE A 1 247 ? 20.709 126.043 73.677 1.00 39.68  ? 250  PHE A CE1 1 
ATOM   2027 C  CE2 . PHE A 1 247 ? 20.618 128.006 72.266 1.00 37.80  ? 250  PHE A CE2 1 
ATOM   2028 C  CZ  . PHE A 1 247 ? 21.120 127.347 73.394 1.00 40.69  ? 250  PHE A CZ  1 
ATOM   2029 N  N   . ASN A 1 248 ? 16.215 123.831 72.675 1.00 45.64  ? 251  ASN A N   1 
ATOM   2030 C  CA  . ASN A 1 248 ? 16.016 123.074 73.886 1.00 48.59  ? 251  ASN A CA  1 
ATOM   2031 C  C   . ASN A 1 248 ? 16.941 121.873 73.690 1.00 47.21  ? 251  ASN A C   1 
ATOM   2032 O  O   . ASN A 1 248 ? 16.598 120.899 72.999 1.00 44.41  ? 251  ASN A O   1 
ATOM   2033 C  CB  . ASN A 1 248 ? 14.554 122.618 73.981 1.00 53.76  ? 251  ASN A CB  1 
ATOM   2034 C  CG  . ASN A 1 248 ? 14.186 122.190 75.375 1.00 50.99  ? 251  ASN A CG  1 
ATOM   2035 O  OD1 . ASN A 1 248 ? 14.989 121.542 76.055 1.00 52.11  ? 251  ASN A OD1 1 
ATOM   2036 N  ND2 . ASN A 1 248 ? 13.005 122.598 75.838 1.00 49.45  ? 251  ASN A ND2 1 
ATOM   2037 N  N   . ASP A 1 249 ? 18.119 121.952 74.295 1.00 49.23  ? 252  ASP A N   1 
ATOM   2038 C  CA  . ASP A 1 249 ? 19.132 120.908 74.135 1.00 52.41  ? 252  ASP A CA  1 
ATOM   2039 C  C   . ASP A 1 249 ? 19.529 120.725 72.625 1.00 52.26  ? 252  ASP A C   1 
ATOM   2040 O  O   . ASP A 1 249 ? 20.061 121.653 71.995 1.00 51.03  ? 252  ASP A O   1 
ATOM   2041 C  CB  . ASP A 1 249 ? 18.675 119.588 74.770 1.00 49.40  ? 252  ASP A CB  1 
ATOM   2042 C  CG  . ASP A 1 249 ? 19.819 118.588 74.914 1.00 58.52  ? 252  ASP A CG  1 
ATOM   2043 O  OD1 . ASP A 1 249 ? 20.986 119.025 75.097 1.00 54.15  ? 252  ASP A OD1 1 
ATOM   2044 O  OD2 . ASP A 1 249 ? 19.549 117.368 74.825 1.00 64.29  ? 252  ASP A OD2 1 
ATOM   2045 N  N   . LYS A 1 250 ? 19.264 119.553 72.048 1.00 50.89  ? 253  LYS A N   1 
ATOM   2046 C  CA  . LYS A 1 250 ? 19.586 119.306 70.645 1.00 42.52  ? 253  LYS A CA  1 
ATOM   2047 C  C   . LYS A 1 250 ? 18.520 119.821 69.686 1.00 37.32  ? 253  LYS A C   1 
ATOM   2048 O  O   . LYS A 1 250 ? 18.766 119.946 68.503 1.00 39.93  ? 253  LYS A O   1 
ATOM   2049 C  CB  . LYS A 1 250 ? 19.806 117.817 70.390 1.00 33.95  ? 253  LYS A CB  1 
ATOM   2050 C  CG  . LYS A 1 250 ? 20.798 117.123 71.322 1.00 42.95  ? 253  LYS A CG  1 
ATOM   2051 C  CD  . LYS A 1 250 ? 22.077 117.925 71.591 1.00 47.90  ? 253  LYS A CD  1 
ATOM   2052 C  CE  . LYS A 1 250 ? 23.048 117.135 72.517 1.00 56.78  ? 253  LYS A CE  1 
ATOM   2053 N  NZ  . LYS A 1 250 ? 23.942 117.961 73.445 1.00 58.78  ? 253  LYS A NZ  1 
ATOM   2054 N  N   . LYS A 1 251 ? 17.330 120.108 70.195 1.00 36.43  ? 254  LYS A N   1 
ATOM   2055 C  CA  . LYS A 1 251 ? 16.251 120.595 69.357 1.00 40.03  ? 254  LYS A CA  1 
ATOM   2056 C  C   . LYS A 1 251 ? 16.310 122.100 69.167 1.00 34.13  ? 254  LYS A C   1 
ATOM   2057 O  O   . LYS A 1 251 ? 16.448 122.841 70.121 1.00 36.01  ? 254  LYS A O   1 
ATOM   2058 C  CB  . LYS A 1 251 ? 14.875 120.182 69.914 1.00 45.37  ? 254  LYS A CB  1 
ATOM   2059 C  CG  . LYS A 1 251 ? 13.725 121.013 69.343 1.00 49.49  ? 254  LYS A CG  1 
ATOM   2060 C  CD  . LYS A 1 251 ? 12.410 120.776 70.038 1.00 55.77  ? 254  LYS A CD  1 
ATOM   2061 C  CE  . LYS A 1 251 ? 11.784 119.496 69.571 1.00 53.55  ? 254  LYS A CE  1 
ATOM   2062 N  NZ  . LYS A 1 251 ? 10.309 119.633 69.715 1.00 56.02  ? 254  LYS A NZ  1 
ATOM   2063 N  N   . PHE A 1 252 ? 16.167 122.532 67.918 1.00 31.77  ? 255  PHE A N   1 
ATOM   2064 C  CA  . PHE A 1 252 ? 16.185 123.937 67.580 1.00 30.62  ? 255  PHE A CA  1 
ATOM   2065 C  C   . PHE A 1 252 ? 14.830 124.174 66.940 1.00 29.98  ? 255  PHE A C   1 
ATOM   2066 O  O   . PHE A 1 252 ? 14.310 123.330 66.201 1.00 36.79  ? 255  PHE A O   1 
ATOM   2067 C  CB  . PHE A 1 252 ? 17.312 124.244 66.582 1.00 31.36  ? 255  PHE A CB  1 
ATOM   2068 C  CG  . PHE A 1 252 ? 17.783 125.685 66.602 1.00 23.98  ? 255  PHE A CG  1 
ATOM   2069 C  CD1 . PHE A 1 252 ? 18.956 126.037 67.273 1.00 19.77  ? 255  PHE A CD1 1 
ATOM   2070 C  CD2 . PHE A 1 252 ? 17.102 126.669 65.888 1.00 26.78  ? 255  PHE A CD2 1 
ATOM   2071 C  CE1 . PHE A 1 252 ? 19.457 127.347 67.231 1.00 24.52  ? 255  PHE A CE1 1 
ATOM   2072 C  CE2 . PHE A 1 252 ? 17.593 128.006 65.832 1.00 28.71  ? 255  PHE A CE2 1 
ATOM   2073 C  CZ  . PHE A 1 252 ? 18.772 128.340 66.503 1.00 26.48  ? 255  PHE A CZ  1 
ATOM   2074 N  N   . VAL A 1 253 ? 14.239 125.313 67.263 1.00 35.60  ? 256  VAL A N   1 
ATOM   2075 C  CA  . VAL A 1 253 ? 12.937 125.667 66.743 1.00 37.57  ? 256  VAL A CA  1 
ATOM   2076 C  C   . VAL A 1 253 ? 12.968 127.073 66.198 1.00 37.58  ? 256  VAL A C   1 
ATOM   2077 O  O   . VAL A 1 253 ? 13.470 127.989 66.837 1.00 33.42  ? 256  VAL A O   1 
ATOM   2078 C  CB  . VAL A 1 253 ? 11.821 125.489 67.835 1.00 39.03  ? 256  VAL A CB  1 
ATOM   2079 C  CG1 . VAL A 1 253 ? 10.429 125.657 67.226 1.00 40.59  ? 256  VAL A CG1 1 
ATOM   2080 C  CG2 . VAL A 1 253 ? 11.956 124.104 68.536 1.00 32.75  ? 256  VAL A CG2 1 
ATOM   2081 N  N   . ILE A 1 254 ? 12.487 127.209 64.972 1.00 39.05  ? 257  ILE A N   1 
ATOM   2082 C  CA  . ILE A 1 254 ? 12.445 128.485 64.295 1.00 42.82  ? 257  ILE A CA  1 
ATOM   2083 C  C   . ILE A 1 254 ? 10.981 128.795 64.054 1.00 47.77  ? 257  ILE A C   1 
ATOM   2084 O  O   . ILE A 1 254 ? 10.279 128.045 63.367 1.00 46.87  ? 257  ILE A O   1 
ATOM   2085 C  CB  . ILE A 1 254 ? 13.232 128.416 62.976 1.00 38.39  ? 257  ILE A CB  1 
ATOM   2086 C  CG1 . ILE A 1 254 ? 14.728 128.226 63.295 1.00 39.69  ? 257  ILE A CG1 1 
ATOM   2087 C  CG2 . ILE A 1 254 ? 12.971 129.654 62.142 1.00 27.26  ? 257  ILE A CG2 1 
ATOM   2088 C  CD1 . ILE A 1 254 ? 15.612 128.234 62.101 1.00 41.25  ? 257  ILE A CD1 1 
ATOM   2089 N  N   . LYS A 1 255 ? 10.518 129.863 64.697 1.00 49.72  ? 258  LYS A N   1 
ATOM   2090 C  CA  . LYS A 1 255 ? 9.143  130.315 64.584 1.00 49.88  ? 258  LYS A CA  1 
ATOM   2091 C  C   . LYS A 1 255 ? 8.993  131.377 63.522 1.00 49.83  ? 258  LYS A C   1 
ATOM   2092 O  O   . LYS A 1 255 ? 9.667  132.396 63.573 1.00 51.20  ? 258  LYS A O   1 
ATOM   2093 C  CB  . LYS A 1 255 ? 8.647  130.833 65.950 1.00 54.96  ? 258  LYS A CB  1 
ATOM   2094 C  CG  . LYS A 1 255 ? 8.518  129.773 67.077 1.00 49.70  ? 258  LYS A CG  1 
ATOM   2095 C  CD  . LYS A 1 255 ? 7.825  130.405 68.287 1.00 50.61  ? 258  LYS A CD  1 
ATOM   2096 C  CE  . LYS A 1 255 ? 7.239  129.378 69.263 1.00 56.42  ? 258  LYS A CE  1 
ATOM   2097 N  NZ  . LYS A 1 255 ? 8.233  128.727 70.188 1.00 53.61  ? 258  LYS A NZ  1 
ATOM   2098 N  N   . PRO A 1 256 ? 8.119  131.132 62.523 1.00 58.42  ? 259  PRO A N   1 
ATOM   2099 C  CA  . PRO A 1 256 ? 7.778  131.993 61.364 1.00 65.26  ? 259  PRO A CA  1 
ATOM   2100 C  C   . PRO A 1 256 ? 6.913  133.230 61.719 1.00 68.83  ? 259  PRO A C   1 
ATOM   2101 O  O   . PRO A 1 256 ? 6.195  133.233 62.730 1.00 72.06  ? 259  PRO A O   1 
ATOM   2102 C  CB  . PRO A 1 256 ? 6.995  131.033 60.460 1.00 66.79  ? 259  PRO A CB  1 
ATOM   2103 C  CG  . PRO A 1 256 ? 6.325  130.091 61.449 1.00 63.95  ? 259  PRO A CG  1 
ATOM   2104 C  CD  . PRO A 1 256 ? 7.463  129.812 62.407 1.00 59.90  ? 259  PRO A CD  1 
ATOM   2105 N  N   . ILE A 1 257 ? 6.974  134.265 60.878 1.00 69.15  ? 260  ILE A N   1 
ATOM   2106 C  CA  . ILE A 1 257 ? 6.191  135.480 61.099 1.00 69.01  ? 260  ILE A CA  1 
ATOM   2107 C  C   . ILE A 1 257 ? 4.757  135.444 60.523 1.00 72.34  ? 260  ILE A C   1 
ATOM   2108 O  O   . ILE A 1 257 ? 4.499  135.859 59.380 1.00 73.00  ? 260  ILE A O   1 
ATOM   2109 C  CB  . ILE A 1 257 ? 6.916  136.726 60.584 1.00 67.46  ? 260  ILE A CB  1 
ATOM   2110 C  CG1 . ILE A 1 257 ? 8.198  136.939 61.378 1.00 68.32  ? 260  ILE A CG1 1 
ATOM   2111 C  CG2 . ILE A 1 257 ? 6.017  137.959 60.733 1.00 71.31  ? 260  ILE A CG2 1 
ATOM   2112 C  CD1 . ILE A 1 257 ? 8.929  138.246 61.071 1.00 66.69  ? 260  ILE A CD1 1 
ATOM   2113 N  N   . ASP A 1 258 ? 3.840  134.928 61.339 1.00 72.14  ? 261  ASP A N   1 
ATOM   2114 C  CA  . ASP A 1 258 ? 2.408  134.812 61.035 1.00 73.52  ? 261  ASP A CA  1 
ATOM   2115 C  C   . ASP A 1 258 ? 1.806  133.937 62.145 1.00 71.88  ? 261  ASP A C   1 
ATOM   2116 O  O   . ASP A 1 258 ? 1.810  134.316 63.326 1.00 69.66  ? 261  ASP A O   1 
ATOM   2117 C  CB  . ASP A 1 258 ? 2.141  134.223 59.637 1.00 74.13  ? 261  ASP A CB  1 
ATOM   2118 C  CG  . ASP A 1 258 ? 2.977  132.988 59.343 1.00 72.75  ? 261  ASP A CG  1 
ATOM   2119 O  OD1 . ASP A 1 258 ? 3.359  132.226 60.266 1.00 64.74  ? 261  ASP A OD1 1 
ATOM   2120 O  OD2 . ASP A 1 258 ? 3.255  132.785 58.152 1.00 75.46  ? 261  ASP A OD2 1 
ATOM   2121 N  N   . LYS A 1 259 ? 1.319  132.759 61.778 1.00 71.81  ? 262  LYS A N   1 
ATOM   2122 C  CA  . LYS A 1 259 ? 0.750  131.839 62.751 1.00 72.05  ? 262  LYS A CA  1 
ATOM   2123 C  C   . LYS A 1 259 ? 0.292  130.592 62.032 1.00 69.83  ? 262  LYS A C   1 
ATOM   2124 O  O   . LYS A 1 259 ? 0.186  129.529 62.635 1.00 64.34  ? 262  LYS A O   1 
ATOM   2125 C  CB  . LYS A 1 259 ? -0.448 132.479 63.470 1.00 77.77  ? 262  LYS A CB  1 
ATOM   2126 C  CG  . LYS A 1 259 ? -1.628 132.835 62.547 1.00 80.51  ? 262  LYS A CG  1 
ATOM   2127 C  CD  . LYS A 1 259 ? -2.839 133.340 63.319 1.00 74.93  ? 262  LYS A CD  1 
ATOM   2128 C  CE  . LYS A 1 259 ? -4.104 133.156 62.487 1.00 76.97  ? 262  LYS A CE  1 
ATOM   2129 N  NZ  . LYS A 1 259 ? -4.391 131.705 62.254 1.00 74.80  ? 262  LYS A NZ  1 
ATOM   2130 N  N   . LYS A 1 260 ? 0.007  130.733 60.741 1.00 66.46  ? 263  LYS A N   1 
ATOM   2131 C  CA  . LYS A 1 260 ? -0.464 129.607 59.989 1.00 67.56  ? 263  LYS A CA  1 
ATOM   2132 C  C   . LYS A 1 260 ? 0.609  128.579 59.726 1.00 68.07  ? 263  LYS A C   1 
ATOM   2133 O  O   . LYS A 1 260 ? 0.361  127.389 59.911 1.00 68.46  ? 263  LYS A O   1 
ATOM   2134 C  CB  . LYS A 1 260 ? -1.224 130.072 58.740 1.00 70.52  ? 263  LYS A CB  1 
ATOM   2135 C  CG  . LYS A 1 260 ? -2.709 130.298 59.054 1.00 77.58  ? 263  LYS A CG  1 
ATOM   2136 C  CD  . LYS A 1 260 ? -3.235 129.087 59.865 1.00 81.62  ? 263  LYS A CD  1 
ATOM   2137 C  CE  . LYS A 1 260 ? -4.562 129.325 60.563 1.00 78.07  ? 263  LYS A CE  1 
ATOM   2138 N  NZ  . LYS A 1 260 ? -4.578 128.569 61.856 1.00 76.82  ? 263  LYS A NZ  1 
ATOM   2139 N  N   . ALA A 1 261 ? 1.831  129.033 59.436 1.00 68.04  ? 264  ALA A N   1 
ATOM   2140 C  CA  . ALA A 1 261 ? 2.940  128.113 59.157 1.00 62.51  ? 264  ALA A CA  1 
ATOM   2141 C  C   . ALA A 1 261 ? 3.427  127.444 60.453 1.00 60.57  ? 264  ALA A C   1 
ATOM   2142 O  O   . ALA A 1 261 ? 3.374  128.044 61.532 1.00 60.66  ? 264  ALA A O   1 
ATOM   2143 C  CB  . ALA A 1 261 ? 4.066  128.841 58.466 1.00 68.57  ? 264  ALA A CB  1 
ATOM   2144 N  N   . PRO A 1 262 ? 3.823  126.161 60.377 1.00 57.78  ? 265  PRO A N   1 
ATOM   2145 C  CA  . PRO A 1 262 ? 4.305  125.461 61.564 1.00 56.67  ? 265  PRO A CA  1 
ATOM   2146 C  C   . PRO A 1 262 ? 5.723  125.897 61.895 1.00 53.15  ? 265  PRO A C   1 
ATOM   2147 O  O   . PRO A 1 262 ? 6.262  126.762 61.214 1.00 52.38  ? 265  PRO A O   1 
ATOM   2148 C  CB  . PRO A 1 262 ? 4.212  123.988 61.157 1.00 59.23  ? 265  PRO A CB  1 
ATOM   2149 C  CG  . PRO A 1 262 ? 4.556  124.041 59.728 1.00 65.46  ? 265  PRO A CG  1 
ATOM   2150 C  CD  . PRO A 1 262 ? 3.757  125.242 59.229 1.00 61.83  ? 265  PRO A CD  1 
ATOM   2151 N  N   . ASP A 1 263 ? 6.294  125.373 62.977 1.00 50.63  ? 266  ASP A N   1 
ATOM   2152 C  CA  . ASP A 1 263 ? 7.654  125.742 63.345 1.00 49.01  ? 266  ASP A CA  1 
ATOM   2153 C  C   . ASP A 1 263 ? 8.650  124.914 62.559 1.00 47.86  ? 266  ASP A C   1 
ATOM   2154 O  O   . ASP A 1 263 ? 8.451  123.708 62.333 1.00 46.60  ? 266  ASP A O   1 
ATOM   2155 C  CB  . ASP A 1 263 ? 7.923  125.523 64.832 1.00 44.83  ? 266  ASP A CB  1 
ATOM   2156 C  CG  . ASP A 1 263 ? 7.210  126.521 65.722 1.00 43.46  ? 266  ASP A CG  1 
ATOM   2157 O  OD1 . ASP A 1 263 ? 6.791  127.613 65.257 1.00 39.51  ? 266  ASP A OD1 1 
ATOM   2158 O  OD2 . ASP A 1 263 ? 7.090  126.178 66.910 1.00 37.70  ? 266  ASP A OD2 1 
ATOM   2159 N  N   . PHE A 1 264 ? 9.694  125.591 62.093 1.00 42.82  ? 267  PHE A N   1 
ATOM   2160 C  CA  . PHE A 1 264 ? 10.751 124.934 61.360 1.00 36.97  ? 267  PHE A CA  1 
ATOM   2161 C  C   . PHE A 1 264 ? 11.639 124.348 62.472 1.00 30.48  ? 267  PHE A C   1 
ATOM   2162 O  O   . PHE A 1 264 ? 12.202 125.095 63.294 1.00 37.63  ? 267  PHE A O   1 
ATOM   2163 C  CB  . PHE A 1 264 ? 11.456 125.953 60.438 1.00 26.37  ? 267  PHE A CB  1 
ATOM   2164 C  CG  . PHE A 1 264 ? 12.735 125.449 59.857 1.00 35.93  ? 267  PHE A CG  1 
ATOM   2165 C  CD1 . PHE A 1 264 ? 13.871 126.272 59.840 1.00 38.63  ? 267  PHE A CD1 1 
ATOM   2166 C  CD2 . PHE A 1 264 ? 12.843 124.120 59.429 1.00 35.37  ? 267  PHE A CD2 1 
ATOM   2167 C  CE1 . PHE A 1 264 ? 15.107 125.783 59.414 1.00 38.39  ? 267  PHE A CE1 1 
ATOM   2168 C  CE2 . PHE A 1 264 ? 14.062 123.615 59.004 1.00 34.97  ? 267  PHE A CE2 1 
ATOM   2169 C  CZ  . PHE A 1 264 ? 15.203 124.448 58.998 1.00 40.60  ? 267  PHE A CZ  1 
ATOM   2170 N  N   . VAL A 1 265 ? 11.658 123.017 62.584 1.00 30.26  ? 268  VAL A N   1 
ATOM   2171 C  CA  . VAL A 1 265 ? 12.445 122.356 63.645 1.00 30.74  ? 268  VAL A CA  1 
ATOM   2172 C  C   . VAL A 1 265 ? 13.441 121.368 63.098 1.00 27.02  ? 268  VAL A C   1 
ATOM   2173 O  O   . VAL A 1 265 ? 13.126 120.564 62.205 1.00 32.35  ? 268  VAL A O   1 
ATOM   2174 C  CB  . VAL A 1 265 ? 11.532 121.521 64.683 1.00 30.66  ? 268  VAL A CB  1 
ATOM   2175 C  CG1 . VAL A 1 265 ? 12.377 120.889 65.749 1.00 30.76  ? 268  VAL A CG1 1 
ATOM   2176 C  CG2 . VAL A 1 265 ? 10.515 122.407 65.381 1.00 33.43  ? 268  VAL A CG2 1 
ATOM   2177 N  N   . PHE A 1 266 ? 14.626 121.389 63.704 1.00 31.08  ? 269  PHE A N   1 
ATOM   2178 C  CA  . PHE A 1 266 ? 15.722 120.495 63.346 1.00 30.05  ? 269  PHE A CA  1 
ATOM   2179 C  C   . PHE A 1 266 ? 16.507 120.142 64.592 1.00 31.79  ? 269  PHE A C   1 
ATOM   2180 O  O   . PHE A 1 266 ? 16.351 120.772 65.651 1.00 36.16  ? 269  PHE A O   1 
ATOM   2181 C  CB  . PHE A 1 266 ? 16.618 121.065 62.223 1.00 29.51  ? 269  PHE A CB  1 
ATOM   2182 C  CG  . PHE A 1 266 ? 17.247 122.387 62.547 1.00 25.54  ? 269  PHE A CG  1 
ATOM   2183 C  CD1 . PHE A 1 266 ? 18.395 122.459 63.346 1.00 21.50  ? 269  PHE A CD1 1 
ATOM   2184 C  CD2 . PHE A 1 266 ? 16.670 123.568 62.088 1.00 22.56  ? 269  PHE A CD2 1 
ATOM   2185 C  CE1 . PHE A 1 266 ? 18.948 123.698 63.690 1.00 24.35  ? 269  PHE A CE1 1 
ATOM   2186 C  CE2 . PHE A 1 266 ? 17.204 124.806 62.418 1.00 29.35  ? 269  PHE A CE2 1 
ATOM   2187 C  CZ  . PHE A 1 266 ? 18.346 124.882 63.222 1.00 25.83  ? 269  PHE A CZ  1 
ATOM   2188 N  N   . TYR A 1 267 ? 17.340 119.119 64.468 1.00 29.06  ? 270  TYR A N   1 
ATOM   2189 C  CA  . TYR A 1 267 ? 18.135 118.644 65.584 1.00 31.54  ? 270  TYR A CA  1 
ATOM   2190 C  C   . TYR A 1 267 ? 19.656 118.697 65.331 1.00 36.93  ? 270  TYR A C   1 
ATOM   2191 O  O   . TYR A 1 267 ? 20.128 118.209 64.318 1.00 33.38  ? 270  TYR A O   1 
ATOM   2192 C  CB  . TYR A 1 267 ? 17.703 117.204 65.927 1.00 35.59  ? 270  TYR A CB  1 
ATOM   2193 C  CG  . TYR A 1 267 ? 16.204 117.046 66.111 1.00 37.66  ? 270  TYR A CG  1 
ATOM   2194 C  CD1 . TYR A 1 267 ? 15.365 116.786 65.014 1.00 39.72  ? 270  TYR A CD1 1 
ATOM   2195 C  CD2 . TYR A 1 267 ? 15.606 117.257 67.359 1.00 39.16  ? 270  TYR A CD2 1 
ATOM   2196 C  CE1 . TYR A 1 267 ? 13.972 116.756 65.149 1.00 31.08  ? 270  TYR A CE1 1 
ATOM   2197 C  CE2 . TYR A 1 267 ? 14.207 117.226 67.503 1.00 36.88  ? 270  TYR A CE2 1 
ATOM   2198 C  CZ  . TYR A 1 267 ? 13.402 116.986 66.395 1.00 36.93  ? 270  TYR A CZ  1 
ATOM   2199 O  OH  . TYR A 1 267 ? 12.034 117.074 66.523 1.00 40.59  ? 270  TYR A OH  1 
ATOM   2200 N  N   . ALA A 1 268 ? 20.406 119.315 66.247 1.00 37.43  ? 271  ALA A N   1 
ATOM   2201 C  CA  . ALA A 1 268 ? 21.863 119.405 66.144 1.00 36.45  ? 271  ALA A CA  1 
ATOM   2202 C  C   . ALA A 1 268 ? 22.475 118.270 66.965 1.00 39.20  ? 271  ALA A C   1 
ATOM   2203 O  O   . ALA A 1 268 ? 21.927 117.873 67.985 1.00 46.57  ? 271  ALA A O   1 
ATOM   2204 C  CB  . ALA A 1 268 ? 22.355 120.732 66.679 1.00 33.91  ? 271  ALA A CB  1 
ATOM   2205 N  N   . PRO A 1 269 ? 23.627 117.738 66.545 1.00 36.72  ? 272  PRO A N   1 
ATOM   2206 C  CA  . PRO A 1 269 ? 24.243 116.650 67.316 1.00 32.33  ? 272  PRO A CA  1 
ATOM   2207 C  C   . PRO A 1 269 ? 24.738 117.029 68.724 1.00 33.73  ? 272  PRO A C   1 
ATOM   2208 O  O   . PRO A 1 269 ? 24.929 116.161 69.557 1.00 33.75  ? 272  PRO A O   1 
ATOM   2209 C  CB  . PRO A 1 269 ? 25.419 116.254 66.441 1.00 30.97  ? 272  PRO A CB  1 
ATOM   2210 C  CG  . PRO A 1 269 ? 25.763 117.538 65.752 1.00 32.65  ? 272  PRO A CG  1 
ATOM   2211 C  CD  . PRO A 1 269 ? 24.431 118.067 65.356 1.00 32.01  ? 272  PRO A CD  1 
ATOM   2212 N  N   . ARG A 1 270 ? 24.934 118.323 68.974 1.00 35.01  ? 273  ARG A N   1 
ATOM   2213 C  CA  . ARG A 1 270 ? 25.451 118.836 70.244 1.00 38.33  ? 273  ARG A CA  1 
ATOM   2214 C  C   . ARG A 1 270 ? 24.765 120.165 70.604 1.00 43.48  ? 273  ARG A C   1 
ATOM   2215 O  O   . ARG A 1 270 ? 24.257 120.869 69.721 1.00 47.17  ? 273  ARG A O   1 
ATOM   2216 C  CB  . ARG A 1 270 ? 26.979 119.035 70.141 1.00 42.35  ? 273  ARG A CB  1 
ATOM   2217 C  CG  . ARG A 1 270 ? 27.880 117.829 70.505 1.00 49.86  ? 273  ARG A CG  1 
ATOM   2218 C  CD  . ARG A 1 270 ? 28.000 117.644 72.033 1.00 65.34  ? 273  ARG A CD  1 
ATOM   2219 N  NE  . ARG A 1 270 ? 28.440 118.876 72.714 1.00 73.61  ? 273  ARG A NE  1 
ATOM   2220 C  CZ  . ARG A 1 270 ? 27.671 119.649 73.494 1.00 72.72  ? 273  ARG A CZ  1 
ATOM   2221 N  NH1 . ARG A 1 270 ? 26.393 119.332 73.723 1.00 69.09  ? 273  ARG A NH1 1 
ATOM   2222 N  NH2 . ARG A 1 270 ? 28.174 120.765 74.025 1.00 65.73  ? 273  ARG A NH2 1 
ATOM   2223 N  N   . LEU A 1 271 ? 24.664 120.466 71.903 1.00 42.47  ? 274  LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 271 ? 24.060 121.722 72.358 1.00 37.36  ? 274  LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 271 ? 24.965 122.899 71.938 1.00 35.47  ? 274  LEU A C   1 
ATOM   2226 O  O   . LEU A 1 271 ? 24.483 124.001 71.615 1.00 36.29  ? 274  LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 271 ? 23.919 121.695 73.887 1.00 41.00  ? 274  LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 271 ? 23.715 123.062 74.567 1.00 38.11  ? 274  LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 271 ? 22.238 123.467 74.603 1.00 34.44  ? 274  LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 271 ? 24.294 123.022 75.954 1.00 42.20  ? 274  LEU A CD2 1 
ATOM   2231 N  N   . ARG A 1 272 ? 26.276 122.631 71.987 1.00 40.81  ? 275  ARG A N   1 
ATOM   2232 C  CA  . ARG A 1 272 ? 27.356 123.557 71.626 1.00 39.70  ? 275  ARG A CA  1 
ATOM   2233 C  C   . ARG A 1 272 ? 27.070 124.156 70.252 1.00 41.46  ? 275  ARG A C   1 
ATOM   2234 O  O   . ARG A 1 272 ? 27.213 125.373 70.071 1.00 43.18  ? 275  ARG A O   1 
ATOM   2235 C  CB  . ARG A 1 272 ? 28.671 122.770 71.580 1.00 36.23  ? 275  ARG A CB  1 
ATOM   2236 C  CG  . ARG A 1 272 ? 29.904 123.563 71.171 1.00 39.61  ? 275  ARG A CG  1 
ATOM   2237 C  CD  . ARG A 1 272 ? 31.146 122.658 71.196 1.00 49.24  ? 275  ARG A CD  1 
ATOM   2238 N  NE  . ARG A 1 272 ? 31.206 121.858 72.430 1.00 66.06  ? 275  ARG A NE  1 
ATOM   2239 C  CZ  . ARG A 1 272 ? 31.770 122.236 73.589 1.00 75.41  ? 275  ARG A CZ  1 
ATOM   2240 N  NH1 . ARG A 1 272 ? 32.371 123.425 73.720 1.00 71.95  ? 275  ARG A NH1 1 
ATOM   2241 N  NH2 . ARG A 1 272 ? 31.675 121.437 74.656 1.00 76.74  ? 275  ARG A NH2 1 
ATOM   2242 N  N   . ILE A 1 273 ? 26.686 123.286 69.302 1.00 41.48  ? 276  ILE A N   1 
ATOM   2243 C  CA  . ILE A 1 273 ? 26.348 123.656 67.902 1.00 42.35  ? 276  ILE A CA  1 
ATOM   2244 C  C   . ILE A 1 273 ? 25.091 124.603 67.840 1.00 39.51  ? 276  ILE A C   1 
ATOM   2245 O  O   . ILE A 1 273 ? 25.061 125.588 67.091 1.00 32.75  ? 276  ILE A O   1 
ATOM   2246 C  CB  . ILE A 1 273 ? 26.114 122.345 67.001 1.00 44.10  ? 276  ILE A CB  1 
ATOM   2247 C  CG1 . ILE A 1 273 ? 27.345 121.423 67.014 1.00 37.37  ? 276  ILE A CG1 1 
ATOM   2248 C  CG2 . ILE A 1 273 ? 25.722 122.701 65.568 1.00 44.88  ? 276  ILE A CG2 1 
ATOM   2249 C  CD1 . ILE A 1 273 ? 28.591 122.021 66.423 1.00 45.27  ? 276  ILE A CD1 1 
ATOM   2250 N  N   . ASN A 1 274 ? 24.055 124.288 68.611 1.00 34.64  ? 277  ASN A N   1 
ATOM   2251 C  CA  . ASN A 1 274 ? 22.871 125.134 68.665 1.00 36.71  ? 277  ASN A CA  1 
ATOM   2252 C  C   . ASN A 1 274 ? 23.147 126.522 69.252 1.00 31.46  ? 277  ASN A C   1 
ATOM   2253 O  O   . ASN A 1 274 ? 22.554 127.519 68.831 1.00 30.04  ? 277  ASN A O   1 
ATOM   2254 C  CB  . ASN A 1 274 ? 21.769 124.431 69.435 1.00 38.01  ? 277  ASN A CB  1 
ATOM   2255 C  CG  . ASN A 1 274 ? 21.029 123.457 68.572 1.00 46.35  ? 277  ASN A CG  1 
ATOM   2256 O  OD1 . ASN A 1 274 ? 20.833 123.704 67.381 1.00 37.24  ? 277  ASN A OD1 1 
ATOM   2257 N  ND2 . ASN A 1 274 ? 20.617 122.340 69.152 1.00 52.08  ? 277  ASN A ND2 1 
ATOM   2258 N  N   . LYS A 1 275 ? 24.091 126.579 70.185 1.00 31.69  ? 278  LYS A N   1 
ATOM   2259 C  CA  . LYS A 1 275 ? 24.481 127.838 70.799 1.00 37.83  ? 278  LYS A CA  1 
ATOM   2260 C  C   . LYS A 1 275 ? 25.178 128.703 69.736 1.00 40.39  ? 278  LYS A C   1 
ATOM   2261 O  O   . LYS A 1 275 ? 24.982 129.942 69.688 1.00 38.08  ? 278  LYS A O   1 
ATOM   2262 C  CB  . LYS A 1 275 ? 25.450 127.590 71.953 1.00 41.14  ? 278  LYS A CB  1 
ATOM   2263 C  CG  . LYS A 1 275 ? 24.845 126.882 73.152 1.00 43.61  ? 278  LYS A CG  1 
ATOM   2264 C  CD  . LYS A 1 275 ? 25.519 127.361 74.425 1.00 39.98  ? 278  LYS A CD  1 
ATOM   2265 C  CE  . LYS A 1 275 ? 25.765 126.231 75.395 1.00 49.11  ? 278  LYS A CE  1 
ATOM   2266 N  NZ  . LYS A 1 275 ? 26.484 126.695 76.622 1.00 45.88  ? 278  LYS A NZ  1 
ATOM   2267 N  N   . ARG A 1 276 ? 26.013 128.050 68.910 1.00 34.84  ? 279  ARG A N   1 
ATOM   2268 C  CA  . ARG A 1 276 ? 26.726 128.743 67.831 1.00 32.52  ? 279  ARG A CA  1 
ATOM   2269 C  C   . ARG A 1 276 ? 25.745 129.199 66.774 1.00 24.46  ? 279  ARG A C   1 
ATOM   2270 O  O   . ARG A 1 276 ? 25.862 130.309 66.300 1.00 24.29  ? 279  ARG A O   1 
ATOM   2271 C  CB  . ARG A 1 276 ? 27.810 127.858 67.187 1.00 45.00  ? 279  ARG A CB  1 
ATOM   2272 C  CG  . ARG A 1 276 ? 28.916 127.398 68.146 1.00 61.46  ? 279  ARG A CG  1 
ATOM   2273 C  CD  . ARG A 1 276 ? 30.037 126.633 67.424 1.00 70.48  ? 279  ARG A CD  1 
ATOM   2274 N  NE  . ARG A 1 276 ? 30.941 127.504 66.660 1.00 78.85  ? 279  ARG A NE  1 
ATOM   2275 C  CZ  . ARG A 1 276 ? 31.865 128.298 67.207 1.00 79.18  ? 279  ARG A CZ  1 
ATOM   2276 N  NH1 . ARG A 1 276 ? 32.009 128.358 68.529 1.00 81.66  ? 279  ARG A NH1 1 
ATOM   2277 N  NH2 . ARG A 1 276 ? 32.709 128.964 66.434 1.00 73.68  ? 279  ARG A NH2 1 
ATOM   2278 N  N   . ILE A 1 277 ? 24.768 128.349 66.443 1.00 22.49  ? 280  ILE A N   1 
ATOM   2279 C  CA  . ILE A 1 277 ? 23.769 128.679 65.458 1.00 22.75  ? 280  ILE A CA  1 
ATOM   2280 C  C   . ILE A 1 277 ? 22.971 129.879 65.937 1.00 24.15  ? 280  ILE A C   1 
ATOM   2281 O  O   . ILE A 1 277 ? 22.701 130.801 65.161 1.00 26.03  ? 280  ILE A O   1 
ATOM   2282 C  CB  . ILE A 1 277 ? 22.822 127.480 65.154 1.00 19.59  ? 280  ILE A CB  1 
ATOM   2283 C  CG1 . ILE A 1 277 ? 23.620 126.354 64.504 1.00 25.33  ? 280  ILE A CG1 1 
ATOM   2284 C  CG2 . ILE A 1 277 ? 21.780 127.874 64.145 1.00 17.39  ? 280  ILE A CG2 1 
ATOM   2285 C  CD1 . ILE A 1 277 ? 22.853 125.118 64.214 1.00 22.76  ? 280  ILE A CD1 1 
ATOM   2286 N  N   . LEU A 1 278 ? 22.622 129.900 67.217 1.00 29.30  ? 281  LEU A N   1 
ATOM   2287 C  CA  . LEU A 1 278 ? 21.816 131.021 67.740 1.00 29.45  ? 281  LEU A CA  1 
ATOM   2288 C  C   . LEU A 1 278 ? 22.594 132.327 67.674 1.00 19.73  ? 281  LEU A C   1 
ATOM   2289 O  O   . LEU A 1 278 ? 22.105 133.324 67.126 1.00 21.38  ? 281  LEU A O   1 
ATOM   2290 C  CB  . LEU A 1 278 ? 21.322 130.724 69.165 1.00 31.58  ? 281  LEU A CB  1 
ATOM   2291 C  CG  . LEU A 1 278 ? 20.114 131.574 69.577 1.00 30.64  ? 281  LEU A CG  1 
ATOM   2292 C  CD1 . LEU A 1 278 ? 18.917 130.675 69.909 1.00 24.42  ? 281  LEU A CD1 1 
ATOM   2293 C  CD2 . LEU A 1 278 ? 20.513 132.457 70.744 1.00 34.33  ? 281  LEU A CD2 1 
ATOM   2294 N  N   . ALA A 1 279 ? 23.811 132.310 68.203 1.00 23.95  ? 282  ALA A N   1 
ATOM   2295 C  CA  . ALA A 1 279 ? 24.699 133.480 68.122 1.00 24.01  ? 282  ALA A CA  1 
ATOM   2296 C  C   . ALA A 1 279 ? 24.831 133.995 66.655 1.00 23.09  ? 282  ALA A C   1 
ATOM   2297 O  O   . ALA A 1 279 ? 24.598 135.159 66.381 1.00 21.95  ? 282  ALA A O   1 
ATOM   2298 C  CB  . ALA A 1 279 ? 26.063 133.133 68.712 1.00 24.92  ? 282  ALA A CB  1 
ATOM   2299 N  N   . LEU A 1 280 ? 25.104 133.103 65.705 1.00 19.35  ? 283  LEU A N   1 
ATOM   2300 C  CA  . LEU A 1 280 ? 25.238 133.474 64.301 1.00 23.79  ? 283  LEU A CA  1 
ATOM   2301 C  C   . LEU A 1 280 ? 23.965 134.007 63.671 1.00 21.74  ? 283  LEU A C   1 
ATOM   2302 O  O   . LEU A 1 280 ? 24.025 134.958 62.892 1.00 22.23  ? 283  LEU A O   1 
ATOM   2303 C  CB  . LEU A 1 280 ? 25.772 132.305 63.455 1.00 25.12  ? 283  LEU A CB  1 
ATOM   2304 C  CG  . LEU A 1 280 ? 27.191 131.900 63.802 1.00 26.37  ? 283  LEU A CG  1 
ATOM   2305 C  CD1 . LEU A 1 280 ? 27.550 130.664 62.994 1.00 22.46  ? 283  LEU A CD1 1 
ATOM   2306 C  CD2 . LEU A 1 280 ? 28.139 133.035 63.483 1.00 27.65  ? 283  LEU A CD2 1 
ATOM   2307 N  N   . CYS A 1 281 ? 22.818 133.380 63.944 1.00 20.43  ? 284  CYS A N   1 
ATOM   2308 C  CA  . CYS A 1 281 ? 21.546 133.902 63.399 1.00 23.35  ? 284  CYS A CA  1 
ATOM   2309 C  C   . CYS A 1 281 ? 21.309 135.332 63.902 1.00 22.40  ? 284  CYS A C   1 
ATOM   2310 O  O   . CYS A 1 281 ? 21.092 136.249 63.122 1.00 27.01  ? 284  CYS A O   1 
ATOM   2311 C  CB  . CYS A 1 281 ? 20.393 133.028 63.863 1.00 20.74  ? 284  CYS A CB  1 
ATOM   2312 S  SG  . CYS A 1 281 ? 20.360 131.429 63.063 1.00 26.30  ? 284  CYS A SG  1 
HETATM 2313 N  N   . MSE A 1 282 ? 21.431 135.516 65.214 1.00 24.18  ? 285  MSE A N   1 
HETATM 2314 C  CA  . MSE A 1 282 ? 21.232 136.822 65.820 1.00 29.93  ? 285  MSE A CA  1 
HETATM 2315 C  C   . MSE A 1 282 ? 22.097 137.880 65.175 1.00 25.20  ? 285  MSE A C   1 
HETATM 2316 O  O   . MSE A 1 282 ? 21.589 138.922 64.745 1.00 31.12  ? 285  MSE A O   1 
HETATM 2317 C  CB  . MSE A 1 282 ? 21.556 136.750 67.318 1.00 36.42  ? 285  MSE A CB  1 
HETATM 2318 C  CG  . MSE A 1 282 ? 20.613 135.884 68.136 1.00 49.72  ? 285  MSE A CG  1 
HETATM 2319 SE SE  . MSE A 1 282 ? 21.012 135.961 70.004 1.00 59.92  ? 285  MSE A SE  1 
HETATM 2320 C  CE  . MSE A 1 282 ? 20.582 137.755 70.197 1.00 55.80  ? 285  MSE A CE  1 
ATOM   2321 N  N   . GLY A 1 283 ? 23.397 137.601 65.078 1.00 21.79  ? 286  GLY A N   1 
ATOM   2322 C  CA  . GLY A 1 283 ? 24.330 138.560 64.509 1.00 20.31  ? 286  GLY A CA  1 
ATOM   2323 C  C   . GLY A 1 283 ? 24.088 138.915 63.068 1.00 21.43  ? 286  GLY A C   1 
ATOM   2324 O  O   . GLY A 1 283 ? 24.145 140.097 62.730 1.00 25.42  ? 286  GLY A O   1 
ATOM   2325 N  N   . ASN A 1 284 ? 23.901 137.920 62.204 1.00 25.90  ? 287  ASN A N   1 
ATOM   2326 C  CA  . ASN A 1 284 ? 23.602 138.180 60.795 1.00 23.20  ? 287  ASN A CA  1 
ATOM   2327 C  C   . ASN A 1 284 ? 22.215 138.856 60.645 1.00 19.51  ? 287  ASN A C   1 
ATOM   2328 O  O   . ASN A 1 284 ? 22.051 139.767 59.832 1.00 25.09  ? 287  ASN A O   1 
ATOM   2329 C  CB  . ASN A 1 284 ? 23.682 136.883 59.986 1.00 17.70  ? 287  ASN A CB  1 
ATOM   2330 C  CG  . ASN A 1 284 ? 25.103 136.438 59.771 1.00 15.60  ? 287  ASN A CG  1 
ATOM   2331 O  OD1 . ASN A 1 284 ? 25.765 136.998 58.948 1.00 17.15  ? 287  ASN A OD1 1 
ATOM   2332 N  ND2 . ASN A 1 284 ? 25.582 135.437 60.532 1.00 14.76  ? 287  ASN A ND2 1 
ATOM   2333 N  N   . HIS A 1 285 ? 21.233 138.452 61.441 1.00 21.33  ? 288  HIS A N   1 
ATOM   2334 C  CA  . HIS A 1 285 ? 19.920 139.107 61.341 1.00 22.69  ? 288  HIS A CA  1 
ATOM   2335 C  C   . HIS A 1 285 ? 19.995 140.622 61.655 1.00 24.97  ? 288  HIS A C   1 
ATOM   2336 O  O   . HIS A 1 285 ? 19.473 141.448 60.921 1.00 27.93  ? 288  HIS A O   1 
ATOM   2337 C  CB  . HIS A 1 285 ? 18.939 138.474 62.286 1.00 25.63  ? 288  HIS A CB  1 
ATOM   2338 C  CG  . HIS A 1 285 ? 17.585 139.107 62.229 1.00 41.85  ? 288  HIS A CG  1 
ATOM   2339 N  ND1 . HIS A 1 285 ? 17.309 140.320 62.818 1.00 40.55  ? 288  HIS A ND1 1 
ATOM   2340 C  CD2 . HIS A 1 285 ? 16.451 138.736 61.582 1.00 42.11  ? 288  HIS A CD2 1 
ATOM   2341 C  CE1 . HIS A 1 285 ? 16.070 140.676 62.533 1.00 47.08  ? 288  HIS A CE1 1 
ATOM   2342 N  NE2 . HIS A 1 285 ? 15.527 139.731 61.784 1.00 50.80  ? 288  HIS A NE2 1 
ATOM   2343 N  N   . GLU A 1 286 ? 20.680 140.966 62.744 1.00 29.18  ? 289  GLU A N   1 
ATOM   2344 C  CA  . GLU A 1 286 ? 20.884 142.355 63.176 1.00 31.01  ? 289  GLU A CA  1 
ATOM   2345 C  C   . GLU A 1 286 ? 21.608 143.205 62.145 1.00 30.12  ? 289  GLU A C   1 
ATOM   2346 O  O   . GLU A 1 286 ? 21.169 144.307 61.805 1.00 33.27  ? 289  GLU A O   1 
ATOM   2347 C  CB  . GLU A 1 286 ? 21.694 142.369 64.472 1.00 37.47  ? 289  GLU A CB  1 
ATOM   2348 C  CG  . GLU A 1 286 ? 21.573 143.641 65.317 1.00 47.87  ? 289  GLU A CG  1 
ATOM   2349 C  CD  . GLU A 1 286 ? 22.597 143.686 66.453 1.00 50.11  ? 289  GLU A CD  1 
ATOM   2350 O  OE1 . GLU A 1 286 ? 22.811 144.786 67.000 1.00 60.40  ? 289  GLU A OE1 1 
ATOM   2351 O  OE2 . GLU A 1 286 ? 23.204 142.640 66.797 1.00 56.40  ? 289  GLU A OE2 1 
ATOM   2352 N  N   . LEU A 1 287 ? 22.729 142.704 61.651 1.00 23.89  ? 290  LEU A N   1 
ATOM   2353 C  CA  . LEU A 1 287 ? 23.457 143.442 60.653 1.00 17.88  ? 290  LEU A CA  1 
ATOM   2354 C  C   . LEU A 1 287 ? 22.656 143.539 59.339 1.00 28.46  ? 290  LEU A C   1 
ATOM   2355 O  O   . LEU A 1 287 ? 22.774 144.532 58.578 1.00 27.15  ? 290  LEU A O   1 
ATOM   2356 C  CB  . LEU A 1 287 ? 24.829 142.773 60.423 1.00 28.00  ? 290  LEU A CB  1 
ATOM   2357 C  CG  . LEU A 1 287 ? 25.930 142.797 61.498 1.00 32.24  ? 290  LEU A CG  1 
ATOM   2358 C  CD1 . LEU A 1 287 ? 27.134 141.893 61.090 1.00 27.59  ? 290  LEU A CD1 1 
ATOM   2359 C  CD2 . LEU A 1 287 ? 26.420 144.236 61.709 1.00 37.79  ? 290  LEU A CD2 1 
ATOM   2360 N  N   . TYR A 1 288 ? 21.827 142.533 59.063 1.00 32.46  ? 291  TYR A N   1 
ATOM   2361 C  CA  . TYR A 1 288 ? 21.066 142.533 57.801 1.00 33.73  ? 291  TYR A CA  1 
ATOM   2362 C  C   . TYR A 1 288 ? 20.101 143.712 57.810 1.00 33.55  ? 291  TYR A C   1 
ATOM   2363 O  O   . TYR A 1 288 ? 20.046 144.519 56.848 1.00 32.51  ? 291  TYR A O   1 
ATOM   2364 C  CB  . TYR A 1 288 ? 20.312 141.192 57.640 1.00 27.86  ? 291  TYR A CB  1 
ATOM   2365 C  CG  . TYR A 1 288 ? 19.492 141.108 56.374 1.00 30.27  ? 291  TYR A CG  1 
ATOM   2366 C  CD1 . TYR A 1 288 ? 20.042 140.613 55.198 1.00 27.72  ? 291  TYR A CD1 1 
ATOM   2367 C  CD2 . TYR A 1 288 ? 18.167 141.559 56.347 1.00 34.18  ? 291  TYR A CD2 1 
ATOM   2368 C  CE1 . TYR A 1 288 ? 19.298 140.570 54.036 1.00 25.06  ? 291  TYR A CE1 1 
ATOM   2369 C  CE2 . TYR A 1 288 ? 17.408 141.528 55.186 1.00 28.25  ? 291  TYR A CE2 1 
ATOM   2370 C  CZ  . TYR A 1 288 ? 17.969 141.035 54.032 1.00 31.88  ? 291  TYR A CZ  1 
ATOM   2371 O  OH  . TYR A 1 288 ? 17.214 141.042 52.872 1.00 29.76  ? 291  TYR A OH  1 
HETATM 2372 N  N   . MSE A 1 289 ? 19.410 143.805 58.947 1.00 36.69  ? 292  MSE A N   1 
HETATM 2373 C  CA  . MSE A 1 289 ? 18.404 144.820 59.232 1.00 37.76  ? 292  MSE A CA  1 
HETATM 2374 C  C   . MSE A 1 289 ? 19.078 146.213 59.265 1.00 35.58  ? 292  MSE A C   1 
HETATM 2375 O  O   . MSE A 1 289 ? 18.669 147.139 58.550 1.00 38.63  ? 292  MSE A O   1 
HETATM 2376 C  CB  . MSE A 1 289 ? 17.710 144.470 60.569 1.00 32.32  ? 292  MSE A CB  1 
HETATM 2377 C  CG  . MSE A 1 289 ? 16.783 143.253 60.507 1.00 29.42  ? 292  MSE A CG  1 
HETATM 2378 SE SE  . MSE A 1 289 ? 15.596 143.296 58.962 1.00 53.15  ? 292  MSE A SE  1 
HETATM 2379 C  CE  . MSE A 1 289 ? 15.440 141.418 58.696 1.00 51.97  ? 292  MSE A CE  1 
ATOM   2380 N  N   . ARG A 1 290 ? 20.138 146.327 60.054 1.00 36.59  ? 293  ARG A N   1 
ATOM   2381 C  CA  . ARG A 1 290 ? 20.897 147.568 60.182 1.00 42.56  ? 293  ARG A CA  1 
ATOM   2382 C  C   . ARG A 1 290 ? 21.392 148.163 58.824 1.00 44.31  ? 293  ARG A C   1 
ATOM   2383 O  O   . ARG A 1 290 ? 21.592 149.384 58.729 1.00 45.17  ? 293  ARG A O   1 
ATOM   2384 C  CB  . ARG A 1 290 ? 22.061 147.337 61.192 1.00 45.73  ? 293  ARG A CB  1 
ATOM   2385 C  CG  . ARG A 1 290 ? 22.903 148.560 61.609 1.00 54.31  ? 293  ARG A CG  1 
ATOM   2386 C  CD  . ARG A 1 290 ? 24.195 148.174 62.436 1.00 58.53  ? 293  ARG A CD  1 
ATOM   2387 N  NE  . ARG A 1 290 ? 25.433 148.057 61.624 1.00 60.54  ? 293  ARG A NE  1 
ATOM   2388 C  CZ  . ARG A 1 290 ? 26.370 149.010 61.481 1.00 55.34  ? 293  ARG A CZ  1 
ATOM   2389 N  NH1 . ARG A 1 290 ? 26.256 150.175 62.097 1.00 61.26  ? 293  ARG A NH1 1 
ATOM   2390 N  NH2 . ARG A 1 290 ? 27.387 148.844 60.654 1.00 38.51  ? 293  ARG A NH2 1 
ATOM   2391 N  N   . ARG A 1 291 ? 21.601 147.331 57.789 1.00 36.13  ? 294  ARG A N   1 
ATOM   2392 C  CA  . ARG A 1 291 ? 22.035 147.846 56.466 1.00 34.78  ? 294  ARG A CA  1 
ATOM   2393 C  C   . ARG A 1 291 ? 20.885 148.502 55.703 1.00 35.59  ? 294  ARG A C   1 
ATOM   2394 O  O   . ARG A 1 291 ? 21.109 149.392 54.846 1.00 32.36  ? 294  ARG A O   1 
ATOM   2395 C  CB  . ARG A 1 291 ? 22.529 146.737 55.521 1.00 29.23  ? 294  ARG A CB  1 
ATOM   2396 C  CG  . ARG A 1 291 ? 23.594 145.868 56.034 1.00 35.41  ? 294  ARG A CG  1 
ATOM   2397 C  CD  . ARG A 1 291 ? 24.213 144.986 54.958 1.00 29.75  ? 294  ARG A CD  1 
ATOM   2398 N  NE  . ARG A 1 291 ? 25.405 144.405 55.555 1.00 25.16  ? 294  ARG A NE  1 
ATOM   2399 C  CZ  . ARG A 1 291 ? 25.455 143.258 56.225 1.00 25.97  ? 294  ARG A CZ  1 
ATOM   2400 N  NH1 . ARG A 1 291 ? 24.358 142.497 56.378 1.00 22.44  ? 294  ARG A NH1 1 
ATOM   2401 N  NH2 . ARG A 1 291 ? 26.600 142.914 56.823 1.00 25.87  ? 294  ARG A NH2 1 
ATOM   2402 N  N   . ARG A 1 292 ? 19.677 147.984 55.967 1.00 34.82  ? 295  ARG A N   1 
ATOM   2403 C  CA  . ARG A 1 292 ? 18.449 148.397 55.305 1.00 37.00  ? 295  ARG A CA  1 
ATOM   2404 C  C   . ARG A 1 292 ? 17.722 149.564 55.911 1.00 43.88  ? 295  ARG A C   1 
ATOM   2405 O  O   . ARG A 1 292 ? 17.319 150.508 55.190 1.00 45.47  ? 295  ARG A O   1 
ATOM   2406 C  CB  . ARG A 1 292 ? 17.542 147.177 55.198 1.00 37.70  ? 295  ARG A CB  1 
ATOM   2407 C  CG  . ARG A 1 292 ? 18.138 146.207 54.204 1.00 38.31  ? 295  ARG A CG  1 
ATOM   2408 C  CD  . ARG A 1 292 ? 17.504 144.858 54.102 1.00 32.68  ? 295  ARG A CD  1 
ATOM   2409 N  NE  . ARG A 1 292 ? 18.136 144.169 52.963 1.00 33.15  ? 295  ARG A NE  1 
ATOM   2410 C  CZ  . ARG A 1 292 ? 19.379 143.667 52.940 1.00 28.24  ? 295  ARG A CZ  1 
ATOM   2411 N  NH1 . ARG A 1 292 ? 20.172 143.746 54.010 1.00 25.45  ? 295  ARG A NH1 1 
ATOM   2412 N  NH2 . ARG A 1 292 ? 19.826 143.051 51.838 1.00 27.82  ? 295  ARG A NH2 1 
ATOM   2413 N  N   . LYS A 1 293 ? 17.573 149.500 57.231 1.00 43.46  ? 296  LYS A N   1 
ATOM   2414 C  CA  . LYS A 1 293 ? 16.896 150.537 58.007 1.00 51.64  ? 296  LYS A CA  1 
ATOM   2415 C  C   . LYS A 1 293 ? 17.766 150.731 59.223 1.00 55.37  ? 296  LYS A C   1 
ATOM   2416 O  O   . LYS A 1 293 ? 17.570 150.044 60.241 1.00 51.88  ? 296  LYS A O   1 
ATOM   2417 C  CB  . LYS A 1 293 ? 15.472 150.083 58.414 1.00 57.51  ? 296  LYS A CB  1 
ATOM   2418 C  CG  . LYS A 1 293 ? 14.373 150.231 57.324 1.00 58.00  ? 296  LYS A CG  1 
ATOM   2419 C  CD  . LYS A 1 293 ? 13.487 148.979 57.238 1.00 55.53  ? 296  LYS A CD  1 
ATOM   2420 C  CE  . LYS A 1 293 ? 12.289 149.193 56.314 1.00 57.86  ? 296  LYS A CE  1 
ATOM   2421 N  NZ  . LYS A 1 293 ? 12.656 149.516 54.899 1.00 53.86  ? 296  LYS A NZ  1 
ATOM   2422 N  N   . PRO A 1 294 ? 18.746 151.671 59.127 1.00 61.41  ? 297  PRO A N   1 
ATOM   2423 C  CA  . PRO A 1 294 ? 19.745 152.071 60.135 1.00 66.76  ? 297  PRO A CA  1 
ATOM   2424 C  C   . PRO A 1 294 ? 19.263 152.918 61.342 1.00 70.38  ? 297  PRO A C   1 
ATOM   2425 O  O   . PRO A 1 294 ? 18.159 153.511 61.238 1.00 69.49  ? 297  PRO A O   1 
ATOM   2426 C  CB  . PRO A 1 294 ? 20.772 152.845 59.286 1.00 65.75  ? 297  PRO A CB  1 
ATOM   2427 C  CG  . PRO A 1 294 ? 19.895 153.581 58.322 1.00 59.25  ? 297  PRO A CG  1 
ATOM   2428 C  CD  . PRO A 1 294 ? 18.913 152.485 57.901 1.00 58.63  ? 297  PRO A CD  1 
ATOM   2429 O  OXT . PRO A 1 294 ? 20.014 152.995 62.359 1.00 69.11  ? 297  PRO A OXT 1 
ATOM   2430 N  N   . ALA B 2 1   ? 20.781 183.418 34.087 1.00 53.54  ? 488  ALA C N   1 
ATOM   2431 C  CA  . ALA B 2 1   ? 20.218 182.037 33.866 1.00 55.56  ? 488  ALA C CA  1 
ATOM   2432 C  C   . ALA B 2 1   ? 19.136 181.575 34.876 1.00 57.94  ? 488  ALA C C   1 
ATOM   2433 O  O   . ALA B 2 1   ? 18.695 182.343 35.771 1.00 56.34  ? 488  ALA C O   1 
ATOM   2434 C  CB  . ALA B 2 1   ? 21.339 180.995 33.757 1.00 50.91  ? 488  ALA C CB  1 
ATOM   2435 N  N   . GLU B 2 2   ? 18.746 180.303 34.733 1.00 57.37  ? 489  GLU C N   1 
ATOM   2436 C  CA  . GLU B 2 2   ? 17.691 179.688 35.543 1.00 58.22  ? 489  GLU C CA  1 
ATOM   2437 C  C   . GLU B 2 2   ? 17.910 178.208 35.783 1.00 56.83  ? 489  GLU C C   1 
ATOM   2438 O  O   . GLU B 2 2   ? 18.342 177.489 34.860 1.00 61.74  ? 489  GLU C O   1 
ATOM   2439 C  CB  . GLU B 2 2   ? 16.375 179.841 34.781 1.00 63.08  ? 489  GLU C CB  1 
ATOM   2440 C  CG  . GLU B 2 2   ? 15.185 180.380 35.562 1.00 66.19  ? 489  GLU C CG  1 
ATOM   2441 C  CD  . GLU B 2 2   ? 14.171 181.034 34.630 1.00 71.20  ? 489  GLU C CD  1 
ATOM   2442 O  OE1 . GLU B 2 2   ? 13.052 181.346 35.112 1.00 69.39  ? 489  GLU C OE1 1 
ATOM   2443 O  OE2 . GLU B 2 2   ? 14.503 181.239 33.419 1.00 67.61  ? 489  GLU C OE2 1 
ATOM   2444 N  N   . ALA B 2 3   ? 17.582 177.748 36.996 1.00 46.03  ? 490  ALA C N   1 
ATOM   2445 C  CA  . ALA B 2 3   ? 17.713 176.334 37.324 1.00 45.86  ? 490  ALA C CA  1 
ATOM   2446 C  C   . ALA B 2 3   ? 16.697 176.002 38.383 1.00 47.94  ? 490  ALA C C   1 
ATOM   2447 O  O   . ALA B 2 3   ? 16.290 176.881 39.134 1.00 52.50  ? 490  ALA C O   1 
ATOM   2448 C  CB  . ALA B 2 3   ? 19.114 176.043 37.805 1.00 38.42  ? 490  ALA C CB  1 
ATOM   2449 N  N   . SER B 2 4   ? 16.242 174.751 38.377 1.00 50.06  ? 491  SER C N   1 
ATOM   2450 C  CA  . SER B 2 4   ? 15.277 174.237 39.341 1.00 50.91  ? 491  SER C CA  1 
ATOM   2451 C  C   . SER B 2 4   ? 15.750 172.860 39.777 1.00 53.27  ? 491  SER C C   1 
ATOM   2452 O  O   . SER B 2 4   ? 16.618 172.252 39.128 1.00 56.14  ? 491  SER C O   1 
ATOM   2453 C  CB  . SER B 2 4   ? 13.884 174.146 38.711 1.00 55.32  ? 491  SER C CB  1 
ATOM   2454 O  OG  . SER B 2 4   ? 13.385 175.432 38.358 1.00 57.66  ? 491  SER C OG  1 
ATOM   2455 N  N   . ALA B 2 5   ? 15.226 172.404 40.911 1.00 50.26  ? 492  ALA C N   1 
ATOM   2456 C  CA  . ALA B 2 5   ? 15.558 171.090 41.426 1.00 49.03  ? 492  ALA C CA  1 
ATOM   2457 C  C   . ALA B 2 5   ? 14.513 170.695 42.455 1.00 50.75  ? 492  ALA C C   1 
ATOM   2458 O  O   . ALA B 2 5   ? 14.126 171.518 43.285 1.00 50.16  ? 492  ALA C O   1 
ATOM   2459 C  CB  . ALA B 2 5   ? 16.970 171.093 42.032 1.00 37.10  ? 492  ALA C CB  1 
ATOM   2460 N  N   . ASP B 2 6   ? 13.965 169.489 42.288 1.00 54.91  ? 493  ASP C N   1 
ATOM   2461 C  CA  . ASP B 2 6   ? 12.992 168.915 43.217 1.00 59.75  ? 493  ASP C CA  1 
ATOM   2462 C  C   . ASP B 2 6   ? 13.790 168.211 44.299 1.00 63.12  ? 493  ASP C C   1 
ATOM   2463 O  O   . ASP B 2 6   ? 14.849 167.646 44.015 1.00 65.24  ? 493  ASP C O   1 
ATOM   2464 C  CB  . ASP B 2 6   ? 12.026 167.959 42.497 1.00 60.38  ? 493  ASP C CB  1 
ATOM   2465 C  CG  . ASP B 2 6   ? 10.955 168.700 41.669 1.00 64.16  ? 493  ASP C CG  1 
ATOM   2466 O  OD1 . ASP B 2 6   ? 10.839 169.939 41.786 1.00 63.95  ? 493  ASP C OD1 1 
ATOM   2467 O  OD2 . ASP B 2 6   ? 10.210 168.032 40.907 1.00 63.55  ? 493  ASP C OD2 1 
ATOM   2468 N  N   . LEU B 2 7   ? 13.291 168.239 45.532 1.00 62.81  ? 494  LEU C N   1 
ATOM   2469 C  CA  . LEU B 2 7   ? 14.010 167.643 46.647 1.00 63.73  ? 494  LEU C CA  1 
ATOM   2470 C  C   . LEU B 2 7   ? 13.193 166.525 47.320 1.00 68.54  ? 494  LEU C C   1 
ATOM   2471 O  O   . LEU B 2 7   ? 12.104 166.762 47.863 1.00 68.58  ? 494  LEU C O   1 
ATOM   2472 C  CB  . LEU B 2 7   ? 14.429 168.756 47.649 1.00 59.19  ? 494  LEU C CB  1 
ATOM   2473 C  CG  . LEU B 2 7   ? 15.149 170.065 47.226 1.00 49.49  ? 494  LEU C CG  1 
ATOM   2474 C  CD1 . LEU B 2 7   ? 15.490 170.861 48.475 1.00 52.04  ? 494  LEU C CD1 1 
ATOM   2475 C  CD2 . LEU B 2 7   ? 16.466 169.833 46.457 1.00 48.84  ? 494  LEU C CD2 1 
ATOM   2476 N  N   . ARG B 2 8   ? 13.741 165.306 47.263 1.00 73.67  ? 495  ARG C N   1 
ATOM   2477 C  CA  . ARG B 2 8   ? 13.110 164.124 47.849 1.00 79.86  ? 495  ARG C CA  1 
ATOM   2478 C  C   . ARG B 2 8   ? 14.100 162.960 48.108 1.00 83.92  ? 495  ARG C C   1 
ATOM   2479 O  O   . ARG B 2 8   ? 15.003 162.707 47.294 1.00 80.36  ? 495  ARG C O   1 
ATOM   2480 C  CB  . ARG B 2 8   ? 11.954 163.664 46.942 1.00 78.98  ? 495  ARG C CB  1 
ATOM   2481 N  N   . ALA B 2 9   ? 13.915 162.260 49.237 1.00 88.81  ? 496  ALA C N   1 
ATOM   2482 C  CA  . ALA B 2 9   ? 14.753 161.103 49.621 1.00 93.00  ? 496  ALA C CA  1 
ATOM   2483 C  C   . ALA B 2 9   ? 14.422 159.855 48.798 1.00 97.88  ? 496  ALA C C   1 
ATOM   2484 O  O   . ALA B 2 9   ? 13.321 159.307 48.940 1.00 100.00 ? 496  ALA C O   1 
ATOM   2485 C  CB  . ALA B 2 9   ? 14.567 160.784 51.115 1.00 89.27  ? 496  ALA C CB  1 
ATOM   2486 N  N   . ASP B 2 10  ? 15.357 159.390 47.959 1.00 99.99  ? 497  ASP C N   1 
ATOM   2487 C  CA  . ASP B 2 10  ? 15.101 158.181 47.144 1.00 99.99  ? 497  ASP C CA  1 
ATOM   2488 C  C   . ASP B 2 10  ? 15.721 156.877 47.699 1.00 99.99  ? 497  ASP C C   1 
ATOM   2489 O  O   . ASP B 2 10  ? 16.722 156.364 47.170 1.00 100.00 ? 497  ASP C O   1 
ATOM   2490 C  CB  . ASP B 2 10  ? 15.446 158.401 45.650 1.00 94.80  ? 497  ASP C CB  1 
ATOM   2491 N  N   . ALA B 2 11  ? 15.104 156.352 48.765 1.00 98.37  ? 498  ALA C N   1 
ATOM   2492 C  CA  . ALA B 2 11  ? 15.550 155.120 49.426 1.00 97.16  ? 498  ALA C CA  1 
ATOM   2493 C  C   . ALA B 2 11  ? 15.868 154.030 48.386 1.00 95.89  ? 498  ALA C C   1 
ATOM   2494 O  O   . ALA B 2 11  ? 14.969 153.547 47.685 1.00 97.47  ? 498  ALA C O   1 
ATOM   2495 C  CB  . ALA B 2 11  ? 14.471 154.640 50.406 1.00 98.67  ? 498  ALA C CB  1 
ATOM   2496 N  N   . MET B 2 12  ? 17.151 153.670 48.289 1.00 90.54  ? 499  MET C N   1 
ATOM   2497 C  CA  . MET B 2 12  ? 17.637 152.676 47.325 1.00 85.89  ? 499  MET C CA  1 
ATOM   2498 C  C   . MET B 2 12  ? 17.769 151.198 47.793 1.00 83.39  ? 499  MET C C   1 
ATOM   2499 O  O   . MET B 2 12  ? 17.753 150.282 46.966 1.00 80.29  ? 499  MET C O   1 
ATOM   2500 C  CB  . MET B 2 12  ? 18.970 153.166 46.759 1.00 83.72  ? 499  MET C CB  1 
ATOM   2501 N  N   . ALA B 2 13  ? 17.937 150.972 49.099 1.00 79.41  ? 500  ALA C N   1 
ATOM   2502 C  CA  . ALA B 2 13  ? 18.039 149.622 49.678 1.00 76.68  ? 500  ALA C CA  1 
ATOM   2503 C  C   . ALA B 2 13  ? 16.680 148.889 49.556 1.00 75.21  ? 500  ALA C C   1 
ATOM   2504 O  O   . ALA B 2 13  ? 15.754 149.424 48.940 1.00 80.27  ? 500  ALA C O   1 
ATOM   2505 C  CB  . ALA B 2 13  ? 18.464 149.718 51.138 1.00 80.05  ? 500  ALA C CB  1 
ATOM   2506 N  N   . LYS B 2 14  ? 16.543 147.700 50.156 1.00 69.08  ? 501  LYS C N   1 
ATOM   2507 C  CA  . LYS B 2 14  ? 15.289 146.914 50.078 1.00 62.17  ? 501  LYS C CA  1 
ATOM   2508 C  C   . LYS B 2 14  ? 15.381 145.484 50.659 1.00 55.37  ? 501  LYS C C   1 
ATOM   2509 O  O   . LYS B 2 14  ? 16.338 144.743 50.368 1.00 53.66  ? 501  LYS C O   1 
ATOM   2510 C  CB  . LYS B 2 14  ? 14.805 146.822 48.610 1.00 65.92  ? 501  LYS C CB  1 
ATOM   2511 C  CG  . LYS B 2 14  ? 13.733 145.772 48.331 1.00 67.73  ? 501  LYS C CG  1 
ATOM   2512 C  CD  . LYS B 2 14  ? 13.577 145.481 46.841 1.00 68.44  ? 501  LYS C CD  1 
ATOM   2513 C  CE  . LYS B 2 14  ? 12.617 144.324 46.635 1.00 68.36  ? 501  LYS C CE  1 
ATOM   2514 N  NZ  . LYS B 2 14  ? 11.340 144.520 47.404 1.00 66.26  ? 501  LYS C NZ  1 
ATOM   2515 N  N   . ASP B 2 15  ? 14.373 145.082 51.438 1.00 42.00  ? 502  ASP C N   1 
ATOM   2516 C  CA  . ASP B 2 15  ? 14.336 143.727 51.995 1.00 38.21  ? 502  ASP C CA  1 
ATOM   2517 C  C   . ASP B 2 15  ? 14.426 142.695 50.857 1.00 35.94  ? 502  ASP C C   1 
ATOM   2518 O  O   . ASP B 2 15  ? 13.938 142.920 49.745 1.00 35.15  ? 502  ASP C O   1 
ATOM   2519 C  CB  . ASP B 2 15  ? 13.027 143.509 52.774 1.00 42.27  ? 502  ASP C CB  1 
ATOM   2520 C  CG  . ASP B 2 15  ? 12.979 142.157 53.543 1.00 48.43  ? 502  ASP C CG  1 
ATOM   2521 O  OD1 . ASP B 2 15  ? 12.068 141.347 53.276 1.00 48.56  ? 502  ASP C OD1 1 
ATOM   2522 O  OD2 . ASP B 2 15  ? 13.810 141.910 54.452 1.00 51.46  ? 502  ASP C OD2 1 
ATOM   2523 N  N   . ARG B 2 16  ? 15.153 141.615 51.113 1.00 34.32  ? 503  ARG C N   1 
ATOM   2524 C  CA  . ARG B 2 16  ? 15.327 140.543 50.140 1.00 29.98  ? 503  ARG C CA  1 
ATOM   2525 C  C   . ARG B 2 16  ? 15.867 140.953 48.780 1.00 26.79  ? 503  ARG C C   1 
ATOM   2526 O  O   . ARG B 2 16  ? 15.718 140.229 47.800 1.00 33.71  ? 503  ARG C O   1 
ATOM   2527 C  CB  . ARG B 2 16  ? 14.018 139.740 50.065 1.00 31.57  ? 503  ARG C CB  1 
ATOM   2528 C  CG  . ARG B 2 16  ? 13.701 139.045 51.403 1.00 29.54  ? 503  ARG C CG  1 
ATOM   2529 C  CD  . ARG B 2 16  ? 12.373 138.313 51.403 1.00 34.92  ? 503  ARG C CD  1 
ATOM   2530 N  NE  . ARG B 2 16  ? 12.318 137.330 50.325 1.00 40.11  ? 503  ARG C NE  1 
ATOM   2531 C  CZ  . ARG B 2 16  ? 11.403 136.375 50.199 1.00 31.56  ? 503  ARG C CZ  1 
ATOM   2532 N  NH1 . ARG B 2 16  ? 10.428 136.236 51.081 1.00 37.39  ? 503  ARG C NH1 1 
ATOM   2533 N  NH2 . ARG B 2 16  ? 11.486 135.543 49.187 1.00 29.75  ? 503  ARG C NH2 1 
ATOM   2534 N  N   . SER B 2 17  ? 16.572 142.088 48.745 1.00 33.68  ? 504  SER C N   1 
ATOM   2535 C  CA  . SER B 2 17  ? 17.187 142.615 47.519 1.00 32.92  ? 504  SER C CA  1 
ATOM   2536 C  C   . SER B 2 17  ? 18.237 141.666 46.906 1.00 37.61  ? 504  SER C C   1 
ATOM   2537 O  O   . SER B 2 17  ? 18.478 141.698 45.688 1.00 36.85  ? 504  SER C O   1 
ATOM   2538 C  CB  . SER B 2 17  ? 17.856 143.954 47.831 1.00 36.24  ? 504  SER C CB  1 
ATOM   2539 O  OG  . SER B 2 17  ? 19.021 143.776 48.623 1.00 35.05  ? 504  SER C OG  1 
ATOM   2540 N  N   . GLU B 2 18  ? 18.893 140.877 47.771 1.00 38.71  ? 505  GLU C N   1 
ATOM   2541 C  CA  . GLU B 2 18  ? 19.913 139.885 47.379 1.00 35.21  ? 505  GLU C CA  1 
ATOM   2542 C  C   . GLU B 2 18  ? 19.414 138.974 46.243 1.00 38.62  ? 505  GLU C C   1 
ATOM   2543 O  O   . GLU B 2 18  ? 20.183 138.571 45.354 1.00 38.50  ? 505  GLU C O   1 
ATOM   2544 C  CB  . GLU B 2 18  ? 20.326 139.035 48.591 1.00 31.25  ? 505  GLU C CB  1 
ATOM   2545 C  CG  . GLU B 2 18  ? 19.174 138.223 49.263 1.00 25.56  ? 505  GLU C CG  1 
ATOM   2546 C  CD  . GLU B 2 18  ? 18.495 138.940 50.437 1.00 32.88  ? 505  GLU C CD  1 
ATOM   2547 O  OE1 . GLU B 2 18  ? 18.659 140.185 50.568 1.00 32.91  ? 505  GLU C OE1 1 
ATOM   2548 O  OE2 . GLU B 2 18  ? 17.793 138.251 51.234 1.00 28.34  ? 505  GLU C OE2 1 
ATOM   2549 N  N   . GLU B 2 19  ? 18.108 138.715 46.237 1.00 34.72  ? 506  GLU C N   1 
ATOM   2550 C  CA  . GLU B 2 19  ? 17.507 137.861 45.226 1.00 38.20  ? 506  GLU C CA  1 
ATOM   2551 C  C   . GLU B 2 19  ? 17.663 138.364 43.788 1.00 40.01  ? 506  GLU C C   1 
ATOM   2552 O  O   . GLU B 2 19  ? 17.661 137.554 42.840 1.00 45.35  ? 506  GLU C O   1 
ATOM   2553 C  CB  . GLU B 2 19  ? 16.030 137.646 45.543 1.00 32.25  ? 506  GLU C CB  1 
ATOM   2554 C  CG  . GLU B 2 19  ? 15.820 136.939 46.855 1.00 33.90  ? 506  GLU C CG  1 
ATOM   2555 C  CD  . GLU B 2 19  ? 14.372 136.614 47.135 1.00 30.76  ? 506  GLU C CD  1 
ATOM   2556 O  OE1 . GLU B 2 19  ? 13.482 136.929 46.307 1.00 41.51  ? 506  GLU C OE1 1 
ATOM   2557 O  OE2 . GLU B 2 19  ? 14.123 136.055 48.212 1.00 32.49  ? 506  GLU C OE2 1 
ATOM   2558 N  N   . GLU B 2 20  ? 17.841 139.682 43.631 1.00 41.03  ? 507  GLU C N   1 
ATOM   2559 C  CA  . GLU B 2 20  ? 17.978 140.300 42.303 1.00 37.34  ? 507  GLU C CA  1 
ATOM   2560 C  C   . GLU B 2 20  ? 19.414 140.611 41.905 1.00 40.66  ? 507  GLU C C   1 
ATOM   2561 O  O   . GLU B 2 20  ? 19.665 141.097 40.786 1.00 42.65  ? 507  GLU C O   1 
ATOM   2562 C  CB  . GLU B 2 20  ? 17.131 141.601 42.182 1.00 40.91  ? 507  GLU C CB  1 
ATOM   2563 C  CG  . GLU B 2 20  ? 15.763 141.595 42.885 1.00 45.52  ? 507  GLU C CG  1 
ATOM   2564 C  CD  . GLU B 2 20  ? 14.856 140.416 42.512 1.00 49.11  ? 507  GLU C CD  1 
ATOM   2565 O  OE1 . GLU B 2 20  ? 14.201 139.910 43.439 1.00 59.42  ? 507  GLU C OE1 1 
ATOM   2566 O  OE2 . GLU B 2 20  ? 14.766 139.994 41.326 1.00 50.73  ? 507  GLU C OE2 1 
ATOM   2567 N  N   . ARG B 2 21  ? 20.346 140.367 42.829 1.00 37.19  ? 508  ARG C N   1 
ATOM   2568 C  CA  . ARG B 2 21  ? 21.769 140.590 42.570 1.00 40.16  ? 508  ARG C CA  1 
ATOM   2569 C  C   . ARG B 2 21  ? 22.288 139.710 41.441 1.00 39.74  ? 508  ARG C C   1 
ATOM   2570 O  O   . ARG B 2 21  ? 21.739 138.655 41.138 1.00 37.21  ? 508  ARG C O   1 
ATOM   2571 C  CB  . ARG B 2 21  ? 22.620 140.320 43.820 1.00 39.85  ? 508  ARG C CB  1 
ATOM   2572 C  CG  . ARG B 2 21  ? 22.608 141.407 44.866 1.00 38.08  ? 508  ARG C CG  1 
ATOM   2573 C  CD  . ARG B 2 21  ? 23.333 140.967 46.119 1.00 36.84  ? 508  ARG C CD  1 
ATOM   2574 N  NE  . ARG B 2 21  ? 24.764 140.738 45.902 1.00 43.67  ? 508  ARG C NE  1 
ATOM   2575 C  CZ  . ARG B 2 21  ? 25.614 140.357 46.855 1.00 45.15  ? 508  ARG C CZ  1 
ATOM   2576 N  NH1 . ARG B 2 21  ? 25.177 140.171 48.101 1.00 39.98  ? 508  ARG C NH1 1 
ATOM   2577 N  NH2 . ARG B 2 21  ? 26.886 140.089 46.546 1.00 42.20  ? 508  ARG C NH2 1 
ATOM   2578 N  N   . THR B 2 22  ? 23.340 140.191 40.798 1.00 41.88  ? 509  THR C N   1 
ATOM   2579 C  CA  . THR B 2 22  ? 23.985 139.460 39.729 1.00 39.41  ? 509  THR C CA  1 
ATOM   2580 C  C   . THR B 2 22  ? 25.451 139.301 40.164 1.00 34.45  ? 509  THR C C   1 
ATOM   2581 O  O   . THR B 2 22  ? 25.885 139.882 41.157 1.00 30.15  ? 509  THR C O   1 
ATOM   2582 C  CB  . THR B 2 22  ? 23.787 140.184 38.380 1.00 41.70  ? 509  THR C CB  1 
ATOM   2583 O  OG1 . THR B 2 22  ? 24.248 141.534 38.488 1.00 39.95  ? 509  THR C OG1 1 
ATOM   2584 C  CG2 . THR B 2 22  ? 22.284 140.192 38.009 1.00 35.11  ? 509  THR C CG2 1 
ATOM   2585 N  N   . THR B 2 23  ? 26.186 138.452 39.476 1.00 31.35  ? 510  THR C N   1 
ATOM   2586 C  CA  . THR B 2 23  ? 27.564 138.222 39.835 1.00 31.16  ? 510  THR C CA  1 
ATOM   2587 C  C   . THR B 2 23  ? 28.482 139.283 39.234 1.00 27.43  ? 510  THR C C   1 
ATOM   2588 O  O   . THR B 2 23  ? 28.038 140.077 38.404 1.00 33.08  ? 510  THR C O   1 
ATOM   2589 C  CB  . THR B 2 23  ? 27.978 136.792 39.378 1.00 35.63  ? 510  THR C CB  1 
ATOM   2590 O  OG1 . THR B 2 23  ? 27.888 136.716 37.952 1.00 32.97  ? 510  THR C OG1 1 
ATOM   2591 C  CG2 . THR B 2 23  ? 27.040 135.701 40.030 1.00 26.72  ? 510  THR C CG2 1 
ATOM   2592 N  N   . GLU B 2 24  ? 29.711 139.369 39.739 1.00 28.71  ? 511  GLU C N   1 
ATOM   2593 C  CA  . GLU B 2 24  ? 30.702 140.298 39.189 1.00 33.71  ? 511  GLU C CA  1 
ATOM   2594 C  C   . GLU B 2 24  ? 31.033 139.915 37.723 1.00 37.95  ? 511  GLU C C   1 
ATOM   2595 O  O   . GLU B 2 24  ? 31.178 140.789 36.874 1.00 36.42  ? 511  GLU C O   1 
ATOM   2596 C  CB  . GLU B 2 24  ? 32.011 140.314 39.990 1.00 32.89  ? 511  GLU C CB  1 
ATOM   2597 C  CG  . GLU B 2 24  ? 33.044 141.424 39.565 1.00 35.12  ? 511  GLU C CG  1 
ATOM   2598 C  CD  . GLU B 2 24  ? 32.472 142.840 39.728 1.00 37.21  ? 511  GLU C CD  1 
ATOM   2599 O  OE1 . GLU B 2 24  ? 31.562 143.032 40.567 1.00 41.57  ? 511  GLU C OE1 1 
ATOM   2600 O  OE2 . GLU B 2 24  ? 32.910 143.755 39.002 1.00 48.82  ? 511  GLU C OE2 1 
ATOM   2601 N  N   . ALA B 2 25  ? 31.114 138.619 37.418 1.00 35.20  ? 512  ALA C N   1 
ATOM   2602 C  CA  . ALA B 2 25  ? 31.474 138.197 36.073 1.00 39.81  ? 512  ALA C CA  1 
ATOM   2603 C  C   . ALA B 2 25  ? 30.399 138.578 35.065 1.00 45.79  ? 512  ALA C C   1 
ATOM   2604 O  O   . ALA B 2 25  ? 30.673 138.721 33.864 1.00 52.22  ? 512  ALA C O   1 
ATOM   2605 C  CB  . ALA B 2 25  ? 31.759 136.708 36.039 1.00 39.11  ? 512  ALA C CB  1 
ATOM   2606 N  N   . GLU B 2 26  ? 29.175 138.740 35.564 1.00 45.72  ? 513  GLU C N   1 
ATOM   2607 C  CA  . GLU B 2 26  ? 28.042 139.137 34.727 1.00 49.39  ? 513  GLU C CA  1 
ATOM   2608 C  C   . GLU B 2 26  ? 28.001 140.650 34.545 1.00 48.43  ? 513  GLU C C   1 
ATOM   2609 O  O   . GLU B 2 26  ? 27.522 141.129 33.532 1.00 46.75  ? 513  GLU C O   1 
ATOM   2610 C  CB  . GLU B 2 26  ? 26.733 138.674 35.354 1.00 50.99  ? 513  GLU C CB  1 
ATOM   2611 C  CG  . GLU B 2 26  ? 25.471 139.060 34.608 1.00 57.16  ? 513  GLU C CG  1 
ATOM   2612 C  CD  . GLU B 2 26  ? 24.207 138.487 35.267 1.00 68.12  ? 513  GLU C CD  1 
ATOM   2613 O  OE1 . GLU B 2 26  ? 24.308 137.872 36.368 1.00 72.03  ? 513  GLU C OE1 1 
ATOM   2614 O  OE2 . GLU B 2 26  ? 23.109 138.651 34.679 1.00 71.14  ? 513  GLU C OE2 1 
ATOM   2615 N  N   . LYS B 2 27  ? 28.499 141.390 35.537 1.00 47.60  ? 514  LYS C N   1 
ATOM   2616 C  CA  . LYS B 2 27  ? 28.524 142.847 35.485 1.00 47.32  ? 514  LYS C CA  1 
ATOM   2617 C  C   . LYS B 2 27  ? 29.871 143.422 35.081 1.00 46.77  ? 514  LYS C C   1 
ATOM   2618 O  O   . LYS B 2 27  ? 29.963 144.601 34.751 1.00 47.09  ? 514  LYS C O   1 
ATOM   2619 C  CB  . LYS B 2 27  ? 28.062 143.459 36.819 1.00 48.41  ? 514  LYS C CB  1 
ATOM   2620 C  CG  . LYS B 2 27  ? 28.841 142.994 38.043 1.00 53.38  ? 514  LYS C CG  1 
ATOM   2621 C  CD  . LYS B 2 27  ? 28.548 143.818 39.314 1.00 57.74  ? 514  LYS C CD  1 
ATOM   2622 C  CE  . LYS B 2 27  ? 27.087 143.780 39.754 1.00 51.17  ? 514  LYS C CE  1 
ATOM   2623 N  NZ  . LYS B 2 27  ? 26.602 142.411 39.999 1.00 52.18  ? 514  LYS C NZ  1 
ATOM   2624 N  N   . ASN B 2 28  ? 30.896 142.575 35.048 1.00 44.87  ? 515  ASN C N   1 
ATOM   2625 C  CA  . ASN B 2 28  ? 32.256 142.996 34.714 1.00 47.22  ? 515  ASN C CA  1 
ATOM   2626 C  C   . ASN B 2 28  ? 32.632 142.259 33.428 1.00 45.65  ? 515  ASN C C   1 
ATOM   2627 O  O   . ASN B 2 28  ? 32.711 141.021 33.398 1.00 45.34  ? 515  ASN C O   1 
ATOM   2628 C  CB  . ASN B 2 28  ? 33.187 142.626 35.868 1.00 47.94  ? 515  ASN C CB  1 
ATOM   2629 C  CG  . ASN B 2 28  ? 34.544 143.289 35.769 1.00 54.12  ? 515  ASN C CG  1 
ATOM   2630 O  OD1 . ASN B 2 28  ? 35.136 143.373 34.688 1.00 55.04  ? 515  ASN C OD1 1 
ATOM   2631 N  ND2 . ASN B 2 28  ? 35.055 143.753 36.909 1.00 51.24  ? 515  ASN C ND2 1 
ATOM   2632 N  N   . GLU B 2 29  ? 32.812 143.022 32.353 1.00 40.12  ? 516  GLU C N   1 
ATOM   2633 C  CA  . GLU B 2 29  ? 33.138 142.418 31.073 1.00 38.04  ? 516  GLU C CA  1 
ATOM   2634 C  C   . GLU B 2 29  ? 34.570 141.955 31.003 1.00 37.20  ? 516  GLU C C   1 
ATOM   2635 O  O   . GLU B 2 29  ? 34.824 140.967 30.339 1.00 39.74  ? 516  GLU C O   1 
ATOM   2636 C  CB  . GLU B 2 29  ? 32.791 143.368 29.893 1.00 43.63  ? 516  GLU C CB  1 
ATOM   2637 N  N   . ARG B 2 30  ? 35.494 142.634 31.701 1.00 37.53  ? 517  ARG C N   1 
ATOM   2638 C  CA  . ARG B 2 30  ? 36.924 142.241 31.713 1.00 37.39  ? 517  ARG C CA  1 
ATOM   2639 C  C   . ARG B 2 30  ? 37.123 140.910 32.439 1.00 36.73  ? 517  ARG C C   1 
ATOM   2640 O  O   . ARG B 2 30  ? 37.888 140.058 31.974 1.00 32.65  ? 517  ARG C O   1 
ATOM   2641 C  CB  . ARG B 2 30  ? 37.831 143.344 32.334 1.00 33.41  ? 517  ARG C CB  1 
ATOM   2642 N  N   . VAL B 2 31  ? 36.420 140.740 33.564 1.00 38.26  ? 518  VAL C N   1 
ATOM   2643 C  CA  . VAL B 2 31  ? 36.494 139.516 34.368 1.00 34.03  ? 518  VAL C CA  1 
ATOM   2644 C  C   . VAL B 2 31  ? 35.915 138.371 33.540 1.00 33.92  ? 518  VAL C C   1 
ATOM   2645 O  O   . VAL B 2 31  ? 36.494 137.295 33.443 1.00 33.10  ? 518  VAL C O   1 
ATOM   2646 C  CB  . VAL B 2 31  ? 35.762 139.685 35.686 1.00 34.15  ? 518  VAL C CB  1 
ATOM   2647 C  CG1 . VAL B 2 31  ? 35.333 138.334 36.238 1.00 37.45  ? 518  VAL C CG1 1 
ATOM   2648 C  CG2 . VAL B 2 31  ? 36.698 140.378 36.677 1.00 38.37  ? 518  VAL C CG2 1 
ATOM   2649 N  N   . GLN B 2 32  ? 34.813 138.654 32.864 1.00 36.57  ? 519  GLN C N   1 
ATOM   2650 C  CA  . GLN B 2 32  ? 34.144 137.683 32.007 1.00 37.93  ? 519  GLN C CA  1 
ATOM   2651 C  C   . GLN B 2 32  ? 35.070 137.250 30.849 1.00 37.60  ? 519  GLN C C   1 
ATOM   2652 O  O   . GLN B 2 32  ? 35.179 136.064 30.542 1.00 39.71  ? 519  GLN C O   1 
ATOM   2653 C  CB  . GLN B 2 32  ? 32.858 138.330 31.515 1.00 37.15  ? 519  GLN C CB  1 
ATOM   2654 C  CG  . GLN B 2 32  ? 32.073 137.621 30.474 1.00 46.75  ? 519  GLN C CG  1 
ATOM   2655 C  CD  . GLN B 2 32  ? 30.685 138.254 30.325 1.00 56.82  ? 519  GLN C CD  1 
ATOM   2656 O  OE1 . GLN B 2 32  ? 29.807 137.690 29.678 1.00 59.64  ? 519  GLN C OE1 1 
ATOM   2657 N  NE2 . GLN B 2 32  ? 30.478 139.419 30.954 1.00 56.51  ? 519  GLN C NE2 1 
ATOM   2658 N  N   . LYS B 2 33  ? 35.794 138.194 30.256 1.00 37.91  ? 520  LYS C N   1 
ATOM   2659 C  CA  . LYS B 2 33  ? 36.731 137.868 29.175 1.00 38.92  ? 520  LYS C CA  1 
ATOM   2660 C  C   . LYS B 2 33  ? 37.947 137.088 29.766 1.00 40.65  ? 520  LYS C C   1 
ATOM   2661 O  O   . LYS B 2 33  ? 38.515 136.178 29.123 1.00 35.75  ? 520  LYS C O   1 
ATOM   2662 C  CB  . LYS B 2 33  ? 37.204 139.151 28.449 1.00 43.71  ? 520  LYS C CB  1 
ATOM   2663 C  CG  . LYS B 2 33  ? 38.402 139.001 27.489 1.00 56.35  ? 520  LYS C CG  1 
ATOM   2664 C  CD  . LYS B 2 33  ? 39.759 139.238 28.202 1.00 68.02  ? 520  LYS C CD  1 
ATOM   2665 C  CE  . LYS B 2 33  ? 40.927 138.440 27.560 1.00 72.49  ? 520  LYS C CE  1 
ATOM   2666 N  NZ  . LYS B 2 33  ? 42.198 138.417 28.388 1.00 64.90  ? 520  LYS C NZ  1 
ATOM   2667 N  N   . HIS B 2 34  ? 38.359 137.434 30.987 1.00 38.01  ? 521  HIS C N   1 
ATOM   2668 C  CA  . HIS B 2 34  ? 39.502 136.734 31.579 1.00 30.21  ? 521  HIS C CA  1 
ATOM   2669 C  C   . HIS B 2 34  ? 39.184 135.279 31.831 1.00 31.62  ? 521  HIS C C   1 
ATOM   2670 O  O   . HIS B 2 34  ? 39.987 134.388 31.522 1.00 31.35  ? 521  HIS C O   1 
ATOM   2671 C  CB  . HIS B 2 34  ? 39.930 137.346 32.911 1.00 27.60  ? 521  HIS C CB  1 
ATOM   2672 C  CG  . HIS B 2 34  ? 40.691 138.629 32.783 1.00 35.65  ? 521  HIS C CG  1 
ATOM   2673 N  ND1 . HIS B 2 34  ? 41.164 139.104 31.575 1.00 35.83  ? 521  HIS C ND1 1 
ATOM   2674 C  CD2 . HIS B 2 34  ? 41.055 139.544 33.715 1.00 32.13  ? 521  HIS C CD2 1 
ATOM   2675 C  CE1 . HIS B 2 34  ? 41.777 140.258 31.767 1.00 31.82  ? 521  HIS C CE1 1 
ATOM   2676 N  NE2 . HIS B 2 34  ? 41.726 140.545 33.056 1.00 31.29  ? 521  HIS C NE2 1 
ATOM   2677 N  N   . LEU B 2 35  ? 37.987 135.048 32.374 1.00 29.18  ? 522  LEU C N   1 
ATOM   2678 C  CA  . LEU B 2 35  ? 37.547 133.712 32.723 1.00 25.47  ? 522  LEU C CA  1 
ATOM   2679 C  C   . LEU B 2 35  ? 37.418 132.861 31.484 1.00 26.89  ? 522  LEU C C   1 
ATOM   2680 O  O   . LEU B 2 35  ? 37.759 131.688 31.542 1.00 26.58  ? 522  LEU C O   1 
ATOM   2681 C  CB  . LEU B 2 35  ? 36.233 133.757 33.514 1.00 29.60  ? 522  LEU C CB  1 
ATOM   2682 C  CG  . LEU B 2 35  ? 36.308 134.288 34.949 1.00 26.62  ? 522  LEU C CG  1 
ATOM   2683 C  CD1 . LEU B 2 35  ? 34.905 134.307 35.546 1.00 25.96  ? 522  LEU C CD1 1 
ATOM   2684 C  CD2 . LEU B 2 35  ? 37.257 133.418 35.788 1.00 22.46  ? 522  LEU C CD2 1 
ATOM   2685 N  N   . LYS B 2 36  ? 36.937 133.452 30.377 1.00 33.72  ? 523  LYS C N   1 
ATOM   2686 C  CA  . LYS B 2 36  ? 36.746 132.731 29.100 1.00 38.32  ? 523  LYS C CA  1 
ATOM   2687 C  C   . LYS B 2 36  ? 38.108 132.301 28.557 1.00 31.75  ? 523  LYS C C   1 
ATOM   2688 O  O   . LYS B 2 36  ? 38.294 131.188 28.083 1.00 36.09  ? 523  LYS C O   1 
ATOM   2689 C  CB  . LYS B 2 36  ? 36.035 133.590 28.051 1.00 44.69  ? 523  LYS C CB  1 
ATOM   2690 C  CG  . LYS B 2 36  ? 34.786 132.919 27.480 1.00 54.75  ? 523  LYS C CG  1 
ATOM   2691 C  CD  . LYS B 2 36  ? 33.598 132.983 28.452 1.00 61.59  ? 523  LYS C CD  1 
ATOM   2692 C  CE  . LYS B 2 36  ? 32.650 131.788 28.313 1.00 58.11  ? 523  LYS C CE  1 
ATOM   2693 N  NZ  . LYS B 2 36  ? 33.333 130.527 28.737 1.00 64.48  ? 523  LYS C NZ  1 
ATOM   2694 N  N   . ALA B 2 37  ? 39.069 133.202 28.657 1.00 31.77  ? 524  ALA C N   1 
ATOM   2695 C  CA  . ALA B 2 37  ? 40.417 132.932 28.223 1.00 32.17  ? 524  ALA C CA  1 
ATOM   2696 C  C   . ALA B 2 37  ? 41.019 131.779 29.049 1.00 34.39  ? 524  ALA C C   1 
ATOM   2697 O  O   . ALA B 2 37  ? 41.603 130.836 28.495 1.00 34.26  ? 524  ALA C O   1 
ATOM   2698 C  CB  . ALA B 2 37  ? 41.272 134.224 28.394 1.00 29.04  ? 524  ALA C CB  1 
ATOM   2699 N  N   . LEU B 2 38  ? 40.891 131.872 30.377 1.00 33.42  ? 525  LEU C N   1 
ATOM   2700 C  CA  . LEU B 2 38  ? 41.392 130.831 31.280 1.00 25.97  ? 525  LEU C CA  1 
ATOM   2701 C  C   . LEU B 2 38  ? 40.742 129.475 31.031 1.00 29.37  ? 525  LEU C C   1 
ATOM   2702 O  O   . LEU B 2 38  ? 41.381 128.431 31.237 1.00 27.64  ? 525  LEU C O   1 
ATOM   2703 C  CB  . LEU B 2 38  ? 41.241 131.232 32.755 1.00 23.92  ? 525  LEU C CB  1 
ATOM   2704 C  CG  . LEU B 2 38  ? 42.317 132.176 33.291 1.00 21.58  ? 525  LEU C CG  1 
ATOM   2705 C  CD1 . LEU B 2 38  ? 41.812 132.851 34.582 1.00 19.23  ? 525  LEU C CD1 1 
ATOM   2706 C  CD2 . LEU B 2 38  ? 43.626 131.386 33.509 1.00 22.95  ? 525  LEU C CD2 1 
ATOM   2707 N  N   . THR B 2 39  ? 39.473 129.467 30.615 1.00 28.90  ? 526  THR C N   1 
ATOM   2708 C  CA  . THR B 2 39  ? 38.826 128.185 30.310 1.00 31.32  ? 526  THR C CA  1 
ATOM   2709 C  C   . THR B 2 39  ? 39.568 127.507 29.126 1.00 31.58  ? 526  THR C C   1 
ATOM   2710 O  O   . THR B 2 39  ? 39.903 126.318 29.215 1.00 27.44  ? 526  THR C O   1 
ATOM   2711 C  CB  . THR B 2 39  ? 37.345 128.314 29.983 1.00 28.31  ? 526  THR C CB  1 
ATOM   2712 O  OG1 . THR B 2 39  ? 36.694 129.060 31.017 1.00 31.67  ? 526  THR C OG1 1 
ATOM   2713 C  CG2 . THR B 2 39  ? 36.719 126.930 29.939 1.00 26.12  ? 526  THR C CG2 1 
ATOM   2714 N  N   . SER B 2 40  ? 39.878 128.269 28.064 1.00 32.19  ? 527  SER C N   1 
ATOM   2715 C  CA  . SER B 2 40  ? 40.633 127.734 26.905 1.00 35.11  ? 527  SER C CA  1 
ATOM   2716 C  C   . SER B 2 40  ? 42.018 127.208 27.316 1.00 36.46  ? 527  SER C C   1 
ATOM   2717 O  O   . SER B 2 40  ? 42.415 126.084 26.997 1.00 40.49  ? 527  SER C O   1 
ATOM   2718 C  CB  . SER B 2 40  ? 40.940 128.833 25.874 1.00 31.95  ? 527  SER C CB  1 
ATOM   2719 O  OG  . SER B 2 40  ? 39.790 129.455 25.403 1.00 43.67  ? 527  SER C OG  1 
ATOM   2720 N  N   . GLU B 2 41  ? 42.776 128.089 27.955 1.00 36.54  ? 528  GLU C N   1 
ATOM   2721 C  CA  . GLU B 2 41  ? 44.136 127.797 28.396 1.00 39.29  ? 528  GLU C CA  1 
ATOM   2722 C  C   . GLU B 2 41  ? 44.272 126.555 29.261 1.00 37.97  ? 528  GLU C C   1 
ATOM   2723 O  O   . GLU B 2 41  ? 45.306 125.861 29.228 1.00 44.68  ? 528  GLU C O   1 
ATOM   2724 C  CB  . GLU B 2 41  ? 44.699 128.992 29.161 1.00 43.85  ? 528  GLU C CB  1 
ATOM   2725 C  CG  . GLU B 2 41  ? 44.445 130.292 28.415 1.00 51.88  ? 528  GLU C CG  1 
ATOM   2726 C  CD  . GLU B 2 41  ? 45.095 131.500 29.037 1.00 56.67  ? 528  GLU C CD  1 
ATOM   2727 O  OE1 . GLU B 2 41  ? 45.820 131.393 30.067 1.00 51.63  ? 528  GLU C OE1 1 
ATOM   2728 O  OE2 . GLU B 2 41  ? 44.872 132.577 28.453 1.00 56.93  ? 528  GLU C OE2 1 
ATOM   2729 N  N   . LEU B 2 42  ? 43.247 126.260 30.041 1.00 30.71  ? 529  LEU C N   1 
ATOM   2730 C  CA  . LEU B 2 42  ? 43.361 125.108 30.911 1.00 38.27  ? 529  LEU C CA  1 
ATOM   2731 C  C   . LEU B 2 42  ? 42.786 123.812 30.328 1.00 36.87  ? 529  LEU C C   1 
ATOM   2732 O  O   . LEU B 2 42  ? 43.220 122.734 30.745 1.00 33.55  ? 529  LEU C O   1 
ATOM   2733 C  CB  . LEU B 2 42  ? 42.800 125.399 32.328 1.00 35.30  ? 529  LEU C CB  1 
ATOM   2734 C  CG  . LEU B 2 42  ? 43.410 126.550 33.150 1.00 25.20  ? 529  LEU C CG  1 
ATOM   2735 C  CD1 . LEU B 2 42  ? 42.576 126.772 34.399 1.00 27.23  ? 529  LEU C CD1 1 
ATOM   2736 C  CD2 . LEU B 2 42  ? 44.852 126.294 33.502 1.00 23.29  ? 529  LEU C CD2 1 
ATOM   2737 N  N   . ALA B 2 43  ? 41.899 123.936 29.324 1.00 37.74  ? 530  ALA C N   1 
ATOM   2738 C  CA  . ALA B 2 43  ? 41.211 122.803 28.671 1.00 31.58  ? 530  ALA C CA  1 
ATOM   2739 C  C   . ALA B 2 43  ? 42.116 121.655 28.278 1.00 32.65  ? 530  ALA C C   1 
ATOM   2740 O  O   . ALA B 2 43  ? 41.798 120.509 28.526 1.00 39.16  ? 530  ALA C O   1 
ATOM   2741 C  CB  . ALA B 2 43  ? 40.428 123.263 27.509 1.00 35.38  ? 530  ALA C CB  1 
ATOM   2742 N  N   . ASN B 2 44  ? 43.310 121.997 27.821 1.00 31.08  ? 531  ASN C N   1 
ATOM   2743 C  CA  . ASN B 2 44  ? 44.316 121.032 27.402 1.00 40.57  ? 531  ASN C CA  1 
ATOM   2744 C  C   . ASN B 2 44  ? 45.293 120.571 28.477 1.00 40.78  ? 531  ASN C C   1 
ATOM   2745 O  O   . ASN B 2 44  ? 46.205 119.803 28.180 1.00 35.92  ? 531  ASN C O   1 
ATOM   2746 C  CB  . ASN B 2 44  ? 45.142 121.643 26.266 1.00 54.24  ? 531  ASN C CB  1 
ATOM   2747 C  CG  . ASN B 2 44  ? 44.836 121.027 24.916 1.00 67.83  ? 531  ASN C CG  1 
ATOM   2748 O  OD1 . ASN B 2 44  ? 43.799 121.310 24.297 1.00 70.79  ? 531  ASN C OD1 1 
ATOM   2749 N  ND2 . ASN B 2 44  ? 45.751 120.181 24.442 1.00 73.22  ? 531  ASN C ND2 1 
ATOM   2750 N  N   . ALA B 2 45  ? 45.197 121.118 29.682 1.00 37.79  ? 532  ALA C N   1 
ATOM   2751 C  CA  . ALA B 2 45  ? 46.077 120.676 30.765 1.00 28.29  ? 532  ALA C CA  1 
ATOM   2752 C  C   . ALA B 2 45  ? 45.293 119.806 31.708 1.00 27.05  ? 532  ALA C C   1 
ATOM   2753 O  O   . ALA B 2 45  ? 45.880 119.066 32.500 1.00 29.36  ? 532  ALA C O   1 
ATOM   2754 C  CB  . ALA B 2 45  ? 46.631 121.868 31.529 1.00 27.33  ? 532  ALA C CB  1 
ATOM   2755 N  N   . ARG B 2 46  ? 43.970 119.931 31.623 1.00 23.28  ? 533  ARG C N   1 
ATOM   2756 C  CA  . ARG B 2 46  ? 43.058 119.219 32.497 1.00 31.01  ? 533  ARG C CA  1 
ATOM   2757 C  C   . ARG B 2 46  ? 43.088 117.705 32.321 1.00 32.92  ? 533  ARG C C   1 
ATOM   2758 O  O   . ARG B 2 46  ? 43.210 117.187 31.220 1.00 32.58  ? 533  ARG C O   1 
ATOM   2759 C  CB  . ARG B 2 46  ? 41.633 119.720 32.298 1.00 25.30  ? 533  ARG C CB  1 
ATOM   2760 C  CG  . ARG B 2 46  ? 40.622 119.017 33.207 1.00 39.97  ? 533  ARG C CG  1 
ATOM   2761 C  CD  . ARG B 2 46  ? 40.966 119.165 34.724 1.00 51.65  ? 533  ARG C CD  1 
ATOM   2762 N  NE  . ARG B 2 46  ? 40.027 118.458 35.607 1.00 52.38  ? 533  ARG C NE  1 
ATOM   2763 C  CZ  . ARG B 2 46  ? 39.029 119.033 36.273 1.00 48.29  ? 533  ARG C CZ  1 
ATOM   2764 N  NH1 . ARG B 2 46  ? 38.239 118.296 37.035 1.00 48.27  ? 533  ARG C NH1 1 
ATOM   2765 N  NH2 . ARG B 2 46  ? 38.831 120.343 36.203 1.00 40.33  ? 533  ARG C NH2 1 
ATOM   2766 N  N   . ASP B 2 47  ? 43.080 117.003 33.437 1.00 28.81  ? 534  ASP C N   1 
ATOM   2767 C  CA  . ASP B 2 47  ? 42.988 115.576 33.417 1.00 25.55  ? 534  ASP C CA  1 
ATOM   2768 C  C   . ASP B 2 47  ? 41.514 115.364 33.747 1.00 27.08  ? 534  ASP C C   1 
ATOM   2769 O  O   . ASP B 2 47  ? 41.119 115.471 34.910 1.00 31.38  ? 534  ASP C O   1 
ATOM   2770 C  CB  . ASP B 2 47  ? 43.865 114.940 34.486 1.00 21.85  ? 534  ASP C CB  1 
ATOM   2771 C  CG  . ASP B 2 47  ? 43.790 113.422 34.456 1.00 29.67  ? 534  ASP C CG  1 
ATOM   2772 O  OD1 . ASP B 2 47  ? 42.770 112.890 33.955 1.00 33.29  ? 534  ASP C OD1 1 
ATOM   2773 O  OD2 . ASP B 2 47  ? 44.754 112.760 34.905 1.00 34.14  ? 534  ASP C OD2 1 
ATOM   2774 N  N   . GLU B 2 48  ? 40.716 115.058 32.732 1.00 30.47  ? 535  GLU C N   1 
ATOM   2775 C  CA  . GLU B 2 48  ? 39.277 114.842 32.880 1.00 27.72  ? 535  GLU C CA  1 
ATOM   2776 C  C   . GLU B 2 48  ? 38.830 113.653 33.724 1.00 26.51  ? 535  GLU C C   1 
ATOM   2777 O  O   . GLU B 2 48  ? 37.654 113.557 34.024 1.00 26.49  ? 535  GLU C O   1 
ATOM   2778 C  CB  . GLU B 2 48  ? 38.638 114.821 31.488 1.00 34.02  ? 535  GLU C CB  1 
ATOM   2779 C  CG  . GLU B 2 48  ? 38.533 116.208 30.781 1.00 48.16  ? 535  GLU C CG  1 
ATOM   2780 C  CD  . GLU B 2 48  ? 37.393 117.113 31.339 1.00 49.71  ? 535  GLU C CD  1 
ATOM   2781 O  OE1 . GLU B 2 48  ? 36.289 116.597 31.629 1.00 56.74  ? 535  GLU C OE1 1 
ATOM   2782 O  OE2 . GLU B 2 48  ? 37.601 118.343 31.483 1.00 36.71  ? 535  GLU C OE2 1 
ATOM   2783 N  N   . SER B 2 49  ? 39.764 112.793 34.148 1.00 23.43  ? 536  SER C N   1 
ATOM   2784 C  CA  . SER B 2 49  ? 39.432 111.628 34.985 1.00 26.95  ? 536  SER C CA  1 
ATOM   2785 C  C   . SER B 2 49  ? 39.550 111.911 36.456 1.00 28.17  ? 536  SER C C   1 
ATOM   2786 O  O   . SER B 2 49  ? 39.292 111.045 37.281 1.00 28.99  ? 536  SER C O   1 
ATOM   2787 C  CB  . SER B 2 49  ? 40.344 110.473 34.661 1.00 29.61  ? 536  SER C CB  1 
ATOM   2788 O  OG  . SER B 2 49  ? 41.679 110.876 34.835 1.00 36.62  ? 536  SER C OG  1 
ATOM   2789 N  N   . LYS B 2 50  ? 39.982 113.127 36.761 1.00 27.29  ? 537  LYS C N   1 
ATOM   2790 C  CA  . LYS B 2 50  ? 40.173 113.613 38.110 1.00 25.77  ? 537  LYS C CA  1 
ATOM   2791 C  C   . LYS B 2 50  ? 39.094 114.685 38.142 1.00 26.34  ? 537  LYS C C   1 
ATOM   2792 O  O   . LYS B 2 50  ? 39.202 115.697 37.471 1.00 38.68  ? 537  LYS C O   1 
ATOM   2793 C  CB  . LYS B 2 50  ? 41.571 114.251 38.160 1.00 26.08  ? 537  LYS C CB  1 
ATOM   2794 C  CG  . LYS B 2 50  ? 42.702 113.270 37.835 1.00 25.98  ? 537  LYS C CG  1 
ATOM   2795 C  CD  . LYS B 2 50  ? 43.227 112.570 39.042 1.00 34.11  ? 537  LYS C CD  1 
ATOM   2796 C  CE  . LYS B 2 50  ? 44.387 111.676 38.687 1.00 40.07  ? 537  LYS C CE  1 
ATOM   2797 N  NZ  . LYS B 2 50  ? 45.398 112.409 37.907 1.00 40.59  ? 537  LYS C NZ  1 
ATOM   2798 N  N   . LYS B 2 51  ? 37.977 114.362 38.737 1.00 28.15  ? 538  LYS C N   1 
ATOM   2799 C  CA  . LYS B 2 51  ? 36.870 115.299 38.860 1.00 25.82  ? 538  LYS C CA  1 
ATOM   2800 C  C   . LYS B 2 51  ? 36.342 114.998 40.248 1.00 22.48  ? 538  LYS C C   1 
ATOM   2801 O  O   . LYS B 2 51  ? 36.099 113.837 40.559 1.00 27.98  ? 538  LYS C O   1 
ATOM   2802 C  CB  . LYS B 2 51  ? 35.729 114.999 37.871 1.00 29.99  ? 538  LYS C CB  1 
ATOM   2803 C  CG  . LYS B 2 51  ? 35.825 115.505 36.446 1.00 29.70  ? 538  LYS C CG  1 
ATOM   2804 C  CD  . LYS B 2 51  ? 34.503 115.140 35.773 1.00 32.06  ? 538  LYS C CD  1 
ATOM   2805 C  CE  . LYS B 2 51  ? 34.432 115.456 34.278 1.00 35.79  ? 538  LYS C CE  1 
ATOM   2806 N  NZ  . LYS B 2 51  ? 35.141 114.467 33.422 1.00 37.54  ? 538  LYS C NZ  1 
ATOM   2807 N  N   . THR B 2 52  ? 36.297 115.987 41.130 1.00 19.95  ? 539  THR C N   1 
ATOM   2808 C  CA  . THR B 2 52  ? 35.711 115.733 42.443 1.00 18.14  ? 539  THR C CA  1 
ATOM   2809 C  C   . THR B 2 52  ? 34.194 115.908 42.303 1.00 12.65  ? 539  THR C C   1 
ATOM   2810 O  O   . THR B 2 52  ? 33.704 116.438 41.284 1.00 13.48  ? 539  THR C O   1 
ATOM   2811 C  CB  . THR B 2 52  ? 36.207 116.713 43.506 1.00 16.73  ? 539  THR C CB  1 
ATOM   2812 O  OG1 . THR B 2 52  ? 35.663 118.014 43.231 1.00 15.86  ? 539  THR C OG1 1 
ATOM   2813 C  CG2 . THR B 2 52  ? 37.733 116.765 43.482 1.00 17.27  ? 539  THR C CG2 1 
ATOM   2814 N  N   . ALA B 2 53  ? 33.471 115.493 43.349 1.00 16.92  ? 540  ALA C N   1 
ATOM   2815 C  CA  . ALA B 2 53  ? 32.007 115.617 43.430 1.00 14.84  ? 540  ALA C CA  1 
ATOM   2816 C  C   . ALA B 2 53  ? 31.580 117.059 43.222 1.00 13.12  ? 540  ALA C C   1 
ATOM   2817 O  O   . ALA B 2 53  ? 30.626 117.318 42.455 1.00 13.58  ? 540  ALA C O   1 
ATOM   2818 C  CB  . ALA B 2 53  ? 31.464 115.084 44.782 1.00 14.52  ? 540  ALA C CB  1 
ATOM   2819 N  N   . ASN B 2 54  ? 32.266 117.991 43.920 1.00 16.46  ? 541  ASN C N   1 
ATOM   2820 C  CA  . ASN B 2 54  ? 32.003 119.450 43.797 1.00 13.93  ? 541  ASN C CA  1 
ATOM   2821 C  C   . ASN B 2 54  ? 32.265 119.963 42.388 1.00 16.63  ? 541  ASN C C   1 
ATOM   2822 O  O   . ASN B 2 54  ? 31.526 120.838 41.899 1.00 18.42  ? 541  ASN C O   1 
ATOM   2823 C  CB  . ASN B 2 54  ? 32.798 120.277 44.790 1.00 13.57  ? 541  ASN C CB  1 
ATOM   2824 C  CG  . ASN B 2 54  ? 32.216 120.232 46.193 1.00 21.46  ? 541  ASN C CG  1 
ATOM   2825 O  OD1 . ASN B 2 54  ? 31.081 119.802 46.387 1.00 18.34  ? 541  ASN C OD1 1 
ATOM   2826 N  ND2 . ASN B 2 54  ? 32.974 120.708 47.171 1.00 16.12  ? 541  ASN C ND2 1 
ATOM   2827 N  N   . ASP B 2 55  ? 33.286 119.414 41.716 1.00 17.73  ? 542  ASP C N   1 
ATOM   2828 C  CA  . ASP B 2 55  ? 33.576 119.812 40.326 1.00 16.08  ? 542  ASP C CA  1 
ATOM   2829 C  C   . ASP B 2 55  ? 32.405 119.466 39.440 1.00 12.77  ? 542  ASP C C   1 
ATOM   2830 O  O   . ASP B 2 55  ? 32.008 120.260 38.590 1.00 16.67  ? 542  ASP C O   1 
ATOM   2831 C  CB  . ASP B 2 55  ? 34.823 119.137 39.748 1.00 12.51  ? 542  ASP C CB  1 
ATOM   2832 C  CG  . ASP B 2 55  ? 36.099 119.644 40.359 1.00 19.36  ? 542  ASP C CG  1 
ATOM   2833 O  OD1 . ASP B 2 55  ? 36.295 120.866 40.483 1.00 21.06  ? 542  ASP C OD1 1 
ATOM   2834 O  OD2 . ASP B 2 55  ? 36.929 118.808 40.716 1.00 23.05  ? 542  ASP C OD2 1 
HETATM 2835 N  N   . MSE B 2 56  ? 31.848 118.275 39.636 1.00 13.15  ? 543  MSE C N   1 
HETATM 2836 C  CA  . MSE B 2 56  ? 30.689 117.840 38.874 1.00 12.26  ? 543  MSE C CA  1 
HETATM 2837 C  C   . MSE B 2 56  ? 29.437 118.641 39.181 1.00 9.01   ? 543  MSE C C   1 
HETATM 2838 O  O   . MSE B 2 56  ? 28.707 119.010 38.279 1.00 17.31  ? 543  MSE C O   1 
HETATM 2839 C  CB  . MSE B 2 56  ? 30.484 116.345 39.040 1.00 10.77  ? 543  MSE C CB  1 
HETATM 2840 C  CG  . MSE B 2 56  ? 31.633 115.600 38.326 1.00 23.77  ? 543  MSE C CG  1 
HETATM 2841 SE SE  . MSE B 2 56  ? 31.507 113.751 38.361 1.00 32.89  ? 543  MSE C SE  1 
HETATM 2842 C  CE  . MSE B 2 56  ? 31.910 113.482 40.019 1.00 11.57  ? 543  MSE C CE  1 
ATOM   2843 N  N   . ILE B 2 57  ? 29.201 118.903 40.457 1.00 14.36  ? 544  ILE C N   1 
ATOM   2844 C  CA  . ILE B 2 57  ? 28.015 119.652 40.912 1.00 10.31  ? 544  ILE C CA  1 
ATOM   2845 C  C   . ILE B 2 57  ? 28.149 121.024 40.272 1.00 10.88  ? 544  ILE C C   1 
ATOM   2846 O  O   . ILE B 2 57  ? 27.247 121.491 39.608 1.00 15.37  ? 544  ILE C O   1 
ATOM   2847 C  CB  . ILE B 2 57  ? 28.026 119.818 42.456 1.00 9.50   ? 544  ILE C CB  1 
ATOM   2848 C  CG1 . ILE B 2 57  ? 27.790 118.468 43.135 1.00 13.05  ? 544  ILE C CG1 1 
ATOM   2849 C  CG2 . ILE B 2 57  ? 26.993 120.821 42.887 1.00 21.23  ? 544  ILE C CG2 1 
ATOM   2850 C  CD1 . ILE B 2 57  ? 28.195 118.466 44.623 1.00 12.88  ? 544  ILE C CD1 1 
ATOM   2851 N  N   . HIS B 2 58  ? 29.334 121.631 40.397 1.00 18.95  ? 545  HIS C N   1 
ATOM   2852 C  CA  . HIS B 2 58  ? 29.550 122.952 39.799 1.00 17.84  ? 545  HIS C CA  1 
ATOM   2853 C  C   . HIS B 2 58  ? 29.335 123.018 38.268 1.00 18.34  ? 545  HIS C C   1 
ATOM   2854 O  O   . HIS B 2 58  ? 28.645 123.923 37.788 1.00 16.71  ? 545  HIS C O   1 
ATOM   2855 C  CB  . HIS B 2 58  ? 30.945 123.511 40.148 1.00 19.20  ? 545  HIS C CB  1 
ATOM   2856 C  CG  . HIS B 2 58  ? 31.267 124.772 39.398 1.00 25.01  ? 545  HIS C CG  1 
ATOM   2857 N  ND1 . HIS B 2 58  ? 30.643 125.974 39.666 1.00 21.59  ? 545  HIS C ND1 1 
ATOM   2858 C  CD2 . HIS B 2 58  ? 32.071 124.997 38.333 1.00 18.58  ? 545  HIS C CD2 1 
ATOM   2859 C  CE1 . HIS B 2 58  ? 31.042 126.881 38.792 1.00 18.74  ? 545  HIS C CE1 1 
ATOM   2860 N  NE2 . HIS B 2 58  ? 31.909 126.315 37.976 1.00 22.59  ? 545  HIS C NE2 1 
ATOM   2861 N  N   . ALA B 2 59  ? 29.901 122.049 37.515 1.00 14.78  ? 546  ALA C N   1 
ATOM   2862 C  CA  . ALA B 2 59  ? 29.741 122.026 36.059 1.00 17.16  ? 546  ALA C CA  1 
ATOM   2863 C  C   . ALA B 2 59  ? 28.272 121.834 35.615 1.00 17.36  ? 546  ALA C C   1 
ATOM   2864 O  O   . ALA B 2 59  ? 27.819 122.436 34.642 1.00 14.67  ? 546  ALA C O   1 
ATOM   2865 C  CB  . ALA B 2 59  ? 30.672 121.001 35.450 1.00 11.72  ? 546  ALA C CB  1 
ATOM   2866 N  N   . GLU B 2 60  ? 27.516 121.083 36.416 1.00 19.33  ? 547  GLU C N   1 
ATOM   2867 C  CA  . GLU B 2 60  ? 26.111 120.814 36.144 1.00 15.61  ? 547  GLU C CA  1 
ATOM   2868 C  C   . GLU B 2 60  ? 25.324 122.108 36.436 1.00 13.58  ? 547  GLU C C   1 
ATOM   2869 O  O   . GLU B 2 60  ? 24.444 122.486 35.690 1.00 15.41  ? 547  GLU C O   1 
ATOM   2870 C  CB  . GLU B 2 60  ? 25.641 119.616 36.985 1.00 20.75  ? 547  GLU C CB  1 
ATOM   2871 C  CG  . GLU B 2 60  ? 24.183 119.193 36.690 1.00 25.57  ? 547  GLU C CG  1 
ATOM   2872 C  CD  . GLU B 2 60  ? 23.880 118.750 35.236 1.00 28.16  ? 547  GLU C CD  1 
ATOM   2873 O  OE1 . GLU B 2 60  ? 24.762 118.684 34.342 1.00 19.60  ? 547  GLU C OE1 1 
ATOM   2874 O  OE2 . GLU B 2 60  ? 22.709 118.434 34.983 1.00 19.89  ? 547  GLU C OE2 1 
ATOM   2875 N  N   . ASN B 2 61  ? 25.690 122.788 37.519 1.00 13.23  ? 548  ASN C N   1 
ATOM   2876 C  CA  . ASN B 2 61  ? 25.079 124.057 37.897 1.00 17.96  ? 548  ASN C CA  1 
ATOM   2877 C  C   . ASN B 2 61  ? 25.242 125.064 36.744 1.00 21.06  ? 548  ASN C C   1 
ATOM   2878 O  O   . ASN B 2 61  ? 24.269 125.730 36.362 1.00 18.05  ? 548  ASN C O   1 
ATOM   2879 C  CB  . ASN B 2 61  ? 25.740 124.591 39.165 1.00 10.99  ? 548  ASN C CB  1 
ATOM   2880 C  CG  . ASN B 2 61  ? 25.137 123.999 40.421 1.00 9.29   ? 548  ASN C CG  1 
ATOM   2881 O  OD1 . ASN B 2 61  ? 24.051 123.421 40.373 1.00 17.46  ? 548  ASN C OD1 1 
ATOM   2882 N  ND2 . ASN B 2 61  ? 25.799 124.194 41.559 1.00 15.16  ? 548  ASN C ND2 1 
HETATM 2883 N  N   . MSE B 2 62  ? 26.464 125.157 36.193 1.00 20.42  ? 549  MSE C N   1 
HETATM 2884 C  CA  . MSE B 2 62  ? 26.749 126.044 35.066 1.00 16.55  ? 549  MSE C CA  1 
HETATM 2885 C  C   . MSE B 2 62  ? 25.992 125.587 33.864 1.00 19.13  ? 549  MSE C C   1 
HETATM 2886 O  O   . MSE B 2 62  ? 25.383 126.405 33.195 1.00 20.49  ? 549  MSE C O   1 
HETATM 2887 C  CB  . MSE B 2 62  ? 28.249 126.117 34.745 1.00 20.79  ? 549  MSE C CB  1 
HETATM 2888 C  CG  . MSE B 2 62  ? 29.107 126.673 35.867 1.00 41.08  ? 549  MSE C CG  1 
HETATM 2889 SE SE  . MSE B 2 62  ? 28.609 128.464 36.382 1.00 51.13  ? 549  MSE C SE  1 
HETATM 2890 C  CE  . MSE B 2 62  ? 29.763 129.300 34.922 1.00 50.88  ? 549  MSE C CE  1 
ATOM   2891 N  N   . ARG B 2 63  ? 25.977 124.277 33.601 1.00 21.87  ? 550  ARG C N   1 
ATOM   2892 C  CA  . ARG B 2 63  ? 25.229 123.779 32.438 1.00 19.63  ? 550  ARG C CA  1 
ATOM   2893 C  C   . ARG B 2 63  ? 23.752 124.225 32.456 1.00 19.37  ? 550  ARG C C   1 
ATOM   2894 O  O   . ARG B 2 63  ? 23.203 124.641 31.436 1.00 21.78  ? 550  ARG C O   1 
ATOM   2895 C  CB  . ARG B 2 63  ? 25.347 122.262 32.313 1.00 14.34  ? 550  ARG C CB  1 
ATOM   2896 C  CG  . ARG B 2 63  ? 24.906 121.735 30.904 1.00 22.65  ? 550  ARG C CG  1 
ATOM   2897 C  CD  . ARG B 2 63  ? 24.810 120.187 30.846 1.00 25.33  ? 550  ARG C CD  1 
ATOM   2898 N  NE  . ARG B 2 63  ? 23.792 119.623 31.763 1.00 24.72  ? 550  ARG C NE  1 
ATOM   2899 C  CZ  . ARG B 2 63  ? 22.483 119.578 31.518 1.00 14.32  ? 550  ARG C CZ  1 
ATOM   2900 N  NH1 . ARG B 2 63  ? 22.004 120.046 30.382 1.00 26.63  ? 550  ARG C NH1 1 
ATOM   2901 N  NH2 . ARG B 2 63  ? 21.629 119.148 32.431 1.00 24.14  ? 550  ARG C NH2 1 
ATOM   2902 N  N   . LEU B 2 64  ? 23.158 124.224 33.646 1.00 25.67  ? 551  LEU C N   1 
ATOM   2903 C  CA  . LEU B 2 64  ? 21.763 124.588 33.863 1.00 18.69  ? 551  LEU C CA  1 
ATOM   2904 C  C   . LEU B 2 64  ? 21.544 126.096 34.081 1.00 16.50  ? 551  LEU C C   1 
ATOM   2905 O  O   . LEU B 2 64  ? 20.454 126.520 34.394 1.00 17.78  ? 551  LEU C O   1 
ATOM   2906 C  CB  . LEU B 2 64  ? 21.255 123.793 35.071 1.00 22.22  ? 551  LEU C CB  1 
ATOM   2907 C  CG  . LEU B 2 64  ? 21.297 122.273 34.863 1.00 19.95  ? 551  LEU C CG  1 
ATOM   2908 C  CD1 . LEU B 2 64  ? 20.992 121.473 36.151 1.00 23.20  ? 551  LEU C CD1 1 
ATOM   2909 C  CD2 . LEU B 2 64  ? 20.281 121.965 33.797 1.00 18.46  ? 551  LEU C CD2 1 
ATOM   2910 N  N   . GLY B 2 65  ? 22.602 126.889 33.978 1.00 23.87  ? 552  GLY C N   1 
ATOM   2911 C  CA  . GLY B 2 65  ? 22.508 128.338 34.144 1.00 25.40  ? 552  GLY C CA  1 
ATOM   2912 C  C   . GLY B 2 65  ? 22.317 128.918 35.541 1.00 30.03  ? 552  GLY C C   1 
ATOM   2913 O  O   . GLY B 2 65  ? 21.804 130.029 35.697 1.00 32.62  ? 552  GLY C O   1 
ATOM   2914 N  N   . ARG B 2 66  ? 22.825 128.227 36.551 1.00 18.59  ? 553  ARG C N   1 
ATOM   2915 C  CA  . ARG B 2 66  ? 22.612 128.652 37.913 1.00 19.78  ? 553  ARG C CA  1 
ATOM   2916 C  C   . ARG B 2 66  ? 23.658 129.615 38.396 1.00 17.71  ? 553  ARG C C   1 
ATOM   2917 O  O   . ARG B 2 66  ? 24.750 129.727 37.844 1.00 23.27  ? 553  ARG C O   1 
ATOM   2918 C  CB  . ARG B 2 66  ? 22.658 127.438 38.828 1.00 18.19  ? 553  ARG C CB  1 
ATOM   2919 C  CG  . ARG B 2 66  ? 21.557 126.455 38.533 1.00 19.96  ? 553  ARG C CG  1 
ATOM   2920 C  CD  . ARG B 2 66  ? 21.633 125.270 39.498 1.00 27.56  ? 553  ARG C CD  1 
ATOM   2921 N  NE  . ARG B 2 66  ? 20.402 124.501 39.419 1.00 24.29  ? 553  ARG C NE  1 
ATOM   2922 C  CZ  . ARG B 2 66  ? 20.308 123.195 39.606 1.00 29.16  ? 553  ARG C CZ  1 
ATOM   2923 N  NH1 . ARG B 2 66  ? 21.384 122.471 39.898 1.00 22.27  ? 553  ARG C NH1 1 
ATOM   2924 N  NH2 . ARG B 2 66  ? 19.120 122.611 39.481 1.00 24.91  ? 553  ARG C NH2 1 
ATOM   2925 N  N   . ASP B 2 67  ? 23.274 130.343 39.424 1.00 25.85  ? 554  ASP C N   1 
ATOM   2926 C  CA  . ASP B 2 67  ? 24.165 131.242 40.127 1.00 30.40  ? 554  ASP C CA  1 
ATOM   2927 C  C   . ASP B 2 67  ? 23.555 131.420 41.537 1.00 31.87  ? 554  ASP C C   1 
ATOM   2928 O  O   . ASP B 2 67  ? 22.353 131.173 41.759 1.00 20.22  ? 554  ASP C O   1 
ATOM   2929 C  CB  . ASP B 2 67  ? 24.435 132.577 39.387 1.00 33.52  ? 554  ASP C CB  1 
ATOM   2930 C  CG  . ASP B 2 67  ? 23.222 133.495 39.327 1.00 28.75  ? 554  ASP C CG  1 
ATOM   2931 O  OD1 . ASP B 2 67  ? 22.924 134.136 40.351 1.00 33.15  ? 554  ASP C OD1 1 
ATOM   2932 O  OD2 . ASP B 2 67  ? 22.568 133.573 38.267 1.00 37.41  ? 554  ASP C OD2 1 
ATOM   2933 N  N   . LYS B 2 68  ? 24.430 131.761 42.483 1.00 31.51  ? 555  LYS C N   1 
ATOM   2934 C  CA  . LYS B 2 68  ? 24.110 131.941 43.887 1.00 29.32  ? 555  LYS C CA  1 
ATOM   2935 C  C   . LYS B 2 68  ? 22.778 132.736 44.145 1.00 26.71  ? 555  LYS C C   1 
ATOM   2936 O  O   . LYS B 2 68  ? 21.863 132.275 44.836 1.00 21.49  ? 555  LYS C O   1 
ATOM   2937 C  CB  . LYS B 2 68  ? 25.350 132.570 44.581 1.00 21.12  ? 555  LYS C CB  1 
ATOM   2938 C  CG  . LYS B 2 68  ? 25.419 132.526 46.091 1.00 28.85  ? 555  LYS C CG  1 
ATOM   2939 C  CD  . LYS B 2 68  ? 26.589 133.432 46.634 1.00 30.52  ? 555  LYS C CD  1 
ATOM   2940 C  CE  . LYS B 2 68  ? 27.013 133.049 48.051 1.00 22.25  ? 555  LYS C CE  1 
ATOM   2941 N  NZ  . LYS B 2 68  ? 27.883 134.119 48.557 1.00 35.48  ? 555  LYS C NZ  1 
ATOM   2942 N  N   . TYR B 2 69  ? 22.629 133.883 43.518 1.00 24.93  ? 556  TYR C N   1 
ATOM   2943 C  CA  . TYR B 2 69  ? 21.442 134.699 43.742 1.00 23.06  ? 556  TYR C CA  1 
ATOM   2944 C  C   . TYR B 2 69  ? 20.154 134.171 43.070 1.00 24.18  ? 556  TYR C C   1 
ATOM   2945 O  O   . TYR B 2 69  ? 19.057 134.260 43.628 1.00 24.61  ? 556  TYR C O   1 
ATOM   2946 C  CB  . TYR B 2 69  ? 21.774 136.156 43.403 1.00 20.62  ? 556  TYR C CB  1 
ATOM   2947 C  CG  . TYR B 2 69  ? 23.159 136.572 43.921 1.00 24.81  ? 556  TYR C CG  1 
ATOM   2948 C  CD1 . TYR B 2 69  ? 24.227 136.753 43.047 1.00 25.49  ? 556  TYR C CD1 1 
ATOM   2949 C  CD2 . TYR B 2 69  ? 23.399 136.731 45.296 1.00 24.43  ? 556  TYR C CD2 1 
ATOM   2950 C  CE1 . TYR B 2 69  ? 25.506 137.075 43.533 1.00 34.26  ? 556  TYR C CE1 1 
ATOM   2951 C  CE2 . TYR B 2 69  ? 24.653 137.054 45.786 1.00 26.09  ? 556  TYR C CE2 1 
ATOM   2952 C  CZ  . TYR B 2 69  ? 25.698 137.222 44.904 1.00 24.01  ? 556  TYR C CZ  1 
ATOM   2953 O  OH  . TYR B 2 69  ? 26.930 137.547 45.390 1.00 27.18  ? 556  TYR C OH  1 
ATOM   2954 N  N   . LYS B 2 70  ? 20.283 133.619 41.873 1.00 22.36  ? 557  LYS C N   1 
ATOM   2955 C  CA  . LYS B 2 70  ? 19.133 133.051 41.184 1.00 26.48  ? 557  LYS C CA  1 
ATOM   2956 C  C   . LYS B 2 70  ? 18.617 131.863 42.010 1.00 24.80  ? 557  LYS C C   1 
ATOM   2957 O  O   . LYS B 2 70  ? 17.409 131.724 42.191 1.00 28.03  ? 557  LYS C O   1 
ATOM   2958 C  CB  . LYS B 2 70  ? 19.507 132.652 39.744 1.00 31.86  ? 557  LYS C CB  1 
ATOM   2959 C  CG  . LYS B 2 70  ? 18.390 132.038 38.930 1.00 45.35  ? 557  LYS C CG  1 
ATOM   2960 C  CD  . LYS B 2 70  ? 17.357 133.070 38.508 1.00 58.96  ? 557  LYS C CD  1 
ATOM   2961 C  CE  . LYS B 2 70  ? 16.325 132.449 37.566 1.00 66.39  ? 557  LYS C CE  1 
ATOM   2962 N  NZ  . LYS B 2 70  ? 16.915 131.874 36.313 1.00 70.91  ? 557  LYS C NZ  1 
ATOM   2963 N  N   . THR B 2 71  ? 19.527 131.046 42.556 1.00 24.21  ? 558  THR C N   1 
ATOM   2964 C  CA  . THR B 2 71  ? 19.151 129.886 43.384 1.00 20.71  ? 558  THR C CA  1 
ATOM   2965 C  C   . THR B 2 71  ? 18.485 130.333 44.709 1.00 21.03  ? 558  THR C C   1 
ATOM   2966 O  O   . THR B 2 71  ? 17.452 129.787 45.131 1.00 20.83  ? 558  THR C O   1 
ATOM   2967 C  CB  . THR B 2 71  ? 20.355 129.013 43.694 1.00 22.57  ? 558  THR C CB  1 
ATOM   2968 O  OG1 . THR B 2 71  ? 20.768 128.331 42.492 1.00 20.94  ? 558  THR C OG1 1 
ATOM   2969 C  CG2 . THR B 2 71  ? 20.011 128.002 44.806 1.00 15.99  ? 558  THR C CG2 1 
ATOM   2970 N  N   . LEU B 2 72  ? 19.058 131.357 45.342 1.00 18.18  ? 559  LEU C N   1 
ATOM   2971 C  CA  . LEU B 2 72  ? 18.493 131.884 46.591 1.00 22.31  ? 559  LEU C CA  1 
ATOM   2972 C  C   . LEU B 2 72  ? 17.043 132.294 46.335 1.00 25.28  ? 559  LEU C C   1 
ATOM   2973 O  O   . LEU B 2 72  ? 16.145 131.961 47.130 1.00 29.43  ? 559  LEU C O   1 
ATOM   2974 C  CB  . LEU B 2 72  ? 19.289 133.104 47.033 1.00 27.85  ? 559  LEU C CB  1 
ATOM   2975 C  CG  . LEU B 2 72  ? 19.471 133.434 48.505 1.00 30.93  ? 559  LEU C CG  1 
ATOM   2976 C  CD1 . LEU B 2 72  ? 19.774 132.190 49.298 1.00 31.56  ? 559  LEU C CD1 1 
ATOM   2977 C  CD2 . LEU B 2 72  ? 20.629 134.403 48.578 1.00 35.52  ? 559  LEU C CD2 1 
ATOM   2978 N  N   . ARG B 2 73  ? 16.824 132.982 45.206 1.00 23.80  ? 560  ARG C N   1 
ATOM   2979 C  CA  . ARG B 2 73  ? 15.483 133.412 44.784 1.00 23.10  ? 560  ARG C CA  1 
ATOM   2980 C  C   . ARG B 2 73  ? 14.567 132.200 44.656 1.00 22.67  ? 560  ARG C C   1 
ATOM   2981 O  O   . ARG B 2 73  ? 13.597 132.064 45.370 1.00 24.92  ? 560  ARG C O   1 
ATOM   2982 C  CB  . ARG B 2 73  ? 15.549 134.146 43.449 1.00 26.57  ? 560  ARG C CB  1 
ATOM   2983 C  CG  . ARG B 2 73  ? 14.240 134.784 43.075 1.00 33.92  ? 560  ARG C CG  1 
ATOM   2984 C  CD  . ARG B 2 73  ? 14.374 135.743 41.907 1.00 44.76  ? 560  ARG C CD  1 
ATOM   2985 N  NE  . ARG B 2 73  ? 13.120 136.468 41.749 1.00 56.72  ? 560  ARG C NE  1 
ATOM   2986 C  CZ  . ARG B 2 73  ? 11.991 135.902 41.324 1.00 65.56  ? 560  ARG C CZ  1 
ATOM   2987 N  NH1 . ARG B 2 73  ? 11.983 134.605 41.001 1.00 68.32  ? 560  ARG C NH1 1 
ATOM   2988 N  NH2 . ARG B 2 73  ? 10.859 136.612 41.265 1.00 62.41  ? 560  ARG C NH2 1 
ATOM   2989 N  N   . GLN B 2 74  ? 14.969 131.261 43.818 1.00 28.32  ? 561  GLN C N   1 
ATOM   2990 C  CA  . GLN B 2 74  ? 14.230 130.031 43.592 1.00 26.71  ? 561  GLN C CA  1 
ATOM   2991 C  C   . GLN B 2 74  ? 13.873 129.204 44.828 1.00 28.70  ? 561  GLN C C   1 
ATOM   2992 O  O   . GLN B 2 74  ? 12.722 128.795 44.981 1.00 22.18  ? 561  GLN C O   1 
ATOM   2993 C  CB  . GLN B 2 74  ? 15.007 129.166 42.608 1.00 26.25  ? 561  GLN C CB  1 
ATOM   2994 C  CG  . GLN B 2 74  ? 14.691 127.686 42.677 1.00 49.69  ? 561  GLN C CG  1 
ATOM   2995 C  CD  . GLN B 2 74  ? 14.053 127.164 41.422 1.00 56.24  ? 561  GLN C CD  1 
ATOM   2996 O  OE1 . GLN B 2 74  ? 12.867 127.408 41.165 1.00 65.82  ? 561  GLN C OE1 1 
ATOM   2997 N  NE2 . GLN B 2 74  ? 14.827 126.423 40.629 1.00 58.95  ? 561  GLN C NE2 1 
ATOM   2998 N  N   . ILE B 2 75  ? 14.846 128.978 45.713 1.00 23.09  ? 562  ILE C N   1 
ATOM   2999 C  CA  . ILE B 2 75  ? 14.621 128.109 46.873 1.00 21.18  ? 562  ILE C CA  1 
ATOM   3000 C  C   . ILE B 2 75  ? 13.766 128.703 47.958 1.00 23.33  ? 562  ILE C C   1 
ATOM   3001 O  O   . ILE B 2 75  ? 13.386 127.982 48.884 1.00 22.90  ? 562  ILE C O   1 
ATOM   3002 C  CB  . ILE B 2 75  ? 15.951 127.553 47.528 1.00 23.21  ? 562  ILE C CB  1 
ATOM   3003 C  CG1 . ILE B 2 75  ? 16.752 128.702 48.148 1.00 25.24  ? 562  ILE C CG1 1 
ATOM   3004 C  CG2 . ILE B 2 75  ? 16.815 126.775 46.515 1.00 16.95  ? 562  ILE C CG2 1 
ATOM   3005 C  CD1 . ILE B 2 75  ? 18.014 128.265 48.825 1.00 31.79  ? 562  ILE C CD1 1 
ATOM   3006 N  N   . ARG B 2 76  ? 13.555 130.019 47.897 1.00 25.68  ? 563  ARG C N   1 
ATOM   3007 C  CA  . ARG B 2 76  ? 12.707 130.737 48.869 1.00 30.42  ? 563  ARG C CA  1 
ATOM   3008 C  C   . ARG B 2 76  ? 11.251 130.828 48.436 1.00 31.44  ? 563  ARG C C   1 
ATOM   3009 O  O   . ARG B 2 76  ? 10.420 131.357 49.168 1.00 34.48  ? 563  ARG C O   1 
ATOM   3010 C  CB  . ARG B 2 76  ? 13.235 132.156 49.113 1.00 21.02  ? 563  ARG C CB  1 
ATOM   3011 C  CG  . ARG B 2 76  ? 14.510 132.178 49.897 1.00 28.24  ? 563  ARG C CG  1 
ATOM   3012 C  CD  . ARG B 2 76  ? 15.022 133.580 49.976 1.00 28.47  ? 563  ARG C CD  1 
ATOM   3013 N  NE  . ARG B 2 76  ? 16.087 133.697 50.955 1.00 26.11  ? 563  ARG C NE  1 
ATOM   3014 C  CZ  . ARG B 2 76  ? 16.754 134.819 51.185 1.00 26.94  ? 563  ARG C CZ  1 
ATOM   3015 N  NH1 . ARG B 2 76  ? 16.455 135.930 50.516 1.00 30.09  ? 563  ARG C NH1 1 
ATOM   3016 N  NH2 . ARG B 2 76  ? 17.751 134.803 52.039 1.00 24.40  ? 563  ARG C NH2 1 
ATOM   3017 N  N   . GLN B 2 77  ? 10.967 130.303 47.245 1.00 31.36  ? 564  GLN C N   1 
ATOM   3018 C  CA  . GLN B 2 77  ? 9.633  130.282 46.684 1.00 27.04  ? 564  GLN C CA  1 
ATOM   3019 C  C   . GLN B 2 77  ? 8.762  129.331 47.431 1.00 25.82  ? 564  GLN C C   1 
ATOM   3020 O  O   . GLN B 2 77  ? 9.216  128.358 48.018 1.00 27.41  ? 564  GLN C O   1 
ATOM   3021 C  CB  . GLN B 2 77  ? 9.659  129.942 45.214 1.00 26.30  ? 564  GLN C CB  1 
ATOM   3022 C  CG  . GLN B 2 77  ? 10.160 131.123 44.420 1.00 25.09  ? 564  GLN C CG  1 
ATOM   3023 C  CD  . GLN B 2 77  ? 10.001 130.923 42.966 1.00 23.91  ? 564  GLN C CD  1 
ATOM   3024 O  OE1 . GLN B 2 77  ? 9.822  129.788 42.508 1.00 35.65  ? 564  GLN C OE1 1 
ATOM   3025 N  NE2 . GLN B 2 77  ? 10.050 132.012 42.207 1.00 28.50  ? 564  GLN C NE2 1 
ATOM   3026 N  N   . GLY B 2 78  ? 7.482  129.624 47.405 1.00 28.34  ? 565  GLY C N   1 
ATOM   3027 C  CA  . GLY B 2 78  ? 6.555  128.767 48.104 1.00 33.17  ? 565  GLY C CA  1 
ATOM   3028 C  C   . GLY B 2 78  ? 6.386  129.424 49.445 1.00 33.87  ? 565  GLY C C   1 
ATOM   3029 O  O   . GLY B 2 78  ? 7.062  130.418 49.748 1.00 35.89  ? 565  GLY C O   1 
ATOM   3030 N  N   . ASN B 2 79  ? 5.403  128.969 50.201 1.00 29.17  ? 566  ASN C N   1 
ATOM   3031 C  CA  . ASN B 2 79  ? 5.176  129.546 51.499 1.00 33.59  ? 566  ASN C CA  1 
ATOM   3032 C  C   . ASN B 2 79  ? 6.018  128.774 52.509 1.00 35.17  ? 566  ASN C C   1 
ATOM   3033 O  O   . ASN B 2 79  ? 6.690  127.792 52.145 1.00 38.20  ? 566  ASN C O   1 
ATOM   3034 C  CB  . ASN B 2 79  ? 3.672  129.582 51.866 1.00 26.21  ? 566  ASN C CB  1 
ATOM   3035 C  CG  . ASN B 2 79  ? 3.069  128.202 51.972 1.00 22.32  ? 566  ASN C CG  1 
ATOM   3036 O  OD1 . ASN B 2 79  ? 3.557  127.352 52.696 1.00 32.87  ? 566  ASN C OD1 1 
ATOM   3037 N  ND2 . ASN B 2 79  ? 2.006  127.969 51.244 1.00 31.16  ? 566  ASN C ND2 1 
ATOM   3038 N  N   . THR B 2 80  ? 5.996  129.234 53.761 1.00 37.16  ? 567  THR C N   1 
ATOM   3039 C  CA  . THR B 2 80  ? 6.747  128.603 54.848 1.00 36.90  ? 567  THR C CA  1 
ATOM   3040 C  C   . THR B 2 80  ? 6.345  127.141 55.161 1.00 35.68  ? 567  THR C C   1 
ATOM   3041 O  O   . THR B 2 80  ? 7.196  126.326 55.484 1.00 37.78  ? 567  THR C O   1 
ATOM   3042 C  CB  . THR B 2 80  ? 6.686  129.443 56.140 1.00 34.57  ? 567  THR C CB  1 
ATOM   3043 O  OG1 . THR B 2 80  ? 7.020  130.810 55.847 1.00 34.65  ? 567  THR C OG1 1 
ATOM   3044 C  CG2 . THR B 2 80  ? 7.675  128.907 57.159 1.00 35.79  ? 567  THR C CG2 1 
ATOM   3045 N  N   . LYS B 2 81  ? 5.064  126.794 55.081 1.00 33.25  ? 568  LYS C N   1 
ATOM   3046 C  CA  . LYS B 2 81  ? 4.693  125.404 55.306 1.00 37.81  ? 568  LYS C CA  1 
ATOM   3047 C  C   . LYS B 2 81  ? 5.122  124.456 54.183 1.00 36.93  ? 568  LYS C C   1 
ATOM   3048 O  O   . LYS B 2 81  ? 5.376  123.276 54.435 1.00 37.27  ? 568  LYS C O   1 
ATOM   3049 C  CB  . LYS B 2 81  ? 3.187  125.236 55.577 1.00 38.02  ? 568  LYS C CB  1 
ATOM   3050 C  CG  . LYS B 2 81  ? 2.632  123.844 55.257 1.00 35.17  ? 568  LYS C CG  1 
ATOM   3051 C  CD  . LYS B 2 81  ? 1.329  123.564 56.033 1.00 45.79  ? 568  LYS C CD  1 
ATOM   3052 C  CE  . LYS B 2 81  ? 0.522  122.370 55.434 1.00 52.04  ? 568  LYS C CE  1 
ATOM   3053 N  NZ  . LYS B 2 81  ? 1.196  121.023 55.361 1.00 41.16  ? 568  LYS C NZ  1 
ATOM   3054 N  N   . GLN B 2 82  ? 5.170  124.946 52.946 1.00 34.21  ? 569  GLN C N   1 
ATOM   3055 C  CA  . GLN B 2 82  ? 5.568  124.095 51.834 1.00 33.49  ? 569  GLN C CA  1 
ATOM   3056 C  C   . GLN B 2 82  ? 7.049  123.782 51.961 1.00 30.86  ? 569  GLN C C   1 
ATOM   3057 O  O   . GLN B 2 82  ? 7.463  122.638 51.755 1.00 26.06  ? 569  GLN C O   1 
ATOM   3058 C  CB  . GLN B 2 82  ? 5.317  124.812 50.527 1.00 37.37  ? 569  GLN C CB  1 
ATOM   3059 C  CG  . GLN B 2 82  ? 3.838  125.033 50.215 1.00 43.60  ? 569  GLN C CG  1 
ATOM   3060 C  CD  . GLN B 2 82  ? 3.619  126.016 49.058 1.00 45.44  ? 569  GLN C CD  1 
ATOM   3061 O  OE1 . GLN B 2 82  ? 4.346  127.004 48.905 1.00 44.05  ? 569  GLN C OE1 1 
ATOM   3062 N  NE2 . GLN B 2 82  ? 2.615  125.747 48.244 1.00 47.64  ? 569  GLN C NE2 1 
ATOM   3063 N  N   . ARG B 2 83  ? 7.839  124.799 52.319 1.00 28.83  ? 570  ARG C N   1 
ATOM   3064 C  CA  . ARG B 2 83  ? 9.279  124.593 52.448 1.00 32.70  ? 570  ARG C CA  1 
ATOM   3065 C  C   . ARG B 2 83  ? 9.666  123.770 53.644 1.00 33.67  ? 570  ARG C C   1 
ATOM   3066 O  O   . ARG B 2 83  ? 10.675 123.084 53.606 1.00 38.03  ? 570  ARG C O   1 
ATOM   3067 C  CB  . ARG B 2 83  ? 10.026 125.907 52.448 1.00 31.47  ? 570  ARG C CB  1 
ATOM   3068 C  CG  . ARG B 2 83  ? 10.061 126.500 51.100 1.00 25.64  ? 570  ARG C CG  1 
ATOM   3069 C  CD  . ARG B 2 83  ? 10.678 127.829 51.158 1.00 28.12  ? 570  ARG C CD  1 
ATOM   3070 N  NE  . ARG B 2 83  ? 9.679  128.867 51.274 1.00 31.50  ? 570  ARG C NE  1 
ATOM   3071 C  CZ  . ARG B 2 83  ? 9.639  129.759 52.251 1.00 30.17  ? 570  ARG C CZ  1 
ATOM   3072 N  NH1 . ARG B 2 83  ? 10.543 129.742 53.229 1.00 27.96  ? 570  ARG C NH1 1 
ATOM   3073 N  NH2 . ARG B 2 83  ? 8.704  130.692 52.223 1.00 27.59  ? 570  ARG C NH2 1 
ATOM   3074 N  N   . ILE B 2 84  ? 8.890  123.872 54.719 1.00 34.32  ? 571  ILE C N   1 
ATOM   3075 C  CA  . ILE B 2 84  ? 9.140  123.071 55.916 1.00 36.33  ? 571  ILE C CA  1 
ATOM   3076 C  C   . ILE B 2 84  ? 8.785  121.589 55.614 1.00 36.27  ? 571  ILE C C   1 
ATOM   3077 O  O   . ILE B 2 84  ? 9.440  120.650 56.098 1.00 33.96  ? 571  ILE C O   1 
ATOM   3078 C  CB  . ILE B 2 84  ? 8.353  123.626 57.157 1.00 34.51  ? 571  ILE C CB  1 
ATOM   3079 C  CG1 . ILE B 2 84  ? 9.063  124.844 57.743 1.00 26.64  ? 571  ILE C CG1 1 
ATOM   3080 C  CG2 . ILE B 2 84  ? 8.231  122.588 58.243 1.00 37.62  ? 571  ILE C CG2 1 
ATOM   3081 C  CD1 . ILE B 2 84  ? 8.238  125.520 58.836 1.00 25.57  ? 571  ILE C CD1 1 
ATOM   3082 N  N   . ASP B 2 85  ? 7.791  121.393 54.751 1.00 37.70  ? 572  ASP C N   1 
ATOM   3083 C  CA  . ASP B 2 85  ? 7.336  120.061 54.370 1.00 33.88  ? 572  ASP C CA  1 
ATOM   3084 C  C   . ASP B 2 85  ? 8.345  119.359 53.473 1.00 34.65  ? 572  ASP C C   1 
ATOM   3085 O  O   . ASP B 2 85  ? 8.461  118.119 53.495 1.00 35.68  ? 572  ASP C O   1 
ATOM   3086 C  CB  . ASP B 2 85  ? 5.984  120.145 53.639 1.00 46.62  ? 572  ASP C CB  1 
ATOM   3087 C  CG  . ASP B 2 85  ? 4.781  120.219 54.595 1.00 50.14  ? 572  ASP C CG  1 
ATOM   3088 O  OD1 . ASP B 2 85  ? 3.635  120.420 54.117 1.00 51.42  ? 572  ASP C OD1 1 
ATOM   3089 O  OD2 . ASP B 2 85  ? 4.980  120.074 55.817 1.00 51.38  ? 572  ASP C OD2 1 
ATOM   3090 N  N   . GLU B 2 86  ? 8.983  120.143 52.603 1.00 33.90  ? 573  GLU C N   1 
ATOM   3091 C  CA  . GLU B 2 86  ? 10.009 119.617 51.722 1.00 29.09  ? 573  GLU C CA  1 
ATOM   3092 C  C   . GLU B 2 86  ? 11.197 119.221 52.586 1.00 25.35  ? 573  GLU C C   1 
ATOM   3093 O  O   . GLU B 2 86  ? 11.802 118.194 52.353 1.00 29.33  ? 573  GLU C O   1 
ATOM   3094 C  CB  . GLU B 2 86  ? 10.452 120.650 50.718 1.00 30.08  ? 573  GLU C CB  1 
ATOM   3095 C  CG  . GLU B 2 86  ? 11.402 120.062 49.704 1.00 40.90  ? 573  GLU C CG  1 
ATOM   3096 C  CD  . GLU B 2 86  ? 11.862 121.063 48.663 1.00 48.14  ? 573  GLU C CD  1 
ATOM   3097 O  OE1 . GLU B 2 86  ? 11.332 122.197 48.625 1.00 52.78  ? 573  GLU C OE1 1 
ATOM   3098 O  OE2 . GLU B 2 86  ? 12.769 120.711 47.882 1.00 54.37  ? 573  GLU C OE2 1 
ATOM   3099 N  N   . PHE B 2 87  ? 11.510 120.057 53.581 1.00 21.20  ? 574  PHE C N   1 
ATOM   3100 C  CA  . PHE B 2 87  ? 12.585 119.798 54.535 1.00 27.19  ? 574  PHE C CA  1 
ATOM   3101 C  C   . PHE B 2 87  ? 12.391 118.450 55.222 1.00 30.66  ? 574  PHE C C   1 
ATOM   3102 O  O   . PHE B 2 87  ? 13.334 117.650 55.299 1.00 28.64  ? 574  PHE C O   1 
ATOM   3103 C  CB  . PHE B 2 87  ? 12.645 120.893 55.616 1.00 28.85  ? 574  PHE C CB  1 
ATOM   3104 C  CG  . PHE B 2 87  ? 13.533 120.555 56.826 1.00 37.62  ? 574  PHE C CG  1 
ATOM   3105 C  CD1 . PHE B 2 87  ? 14.934 120.367 56.682 1.00 38.53  ? 574  PHE C CD1 1 
ATOM   3106 C  CD2 . PHE B 2 87  ? 12.982 120.510 58.125 1.00 38.11  ? 574  PHE C CD2 1 
ATOM   3107 C  CE1 . PHE B 2 87  ? 15.763 120.146 57.808 1.00 25.05  ? 574  PHE C CE1 1 
ATOM   3108 C  CE2 . PHE B 2 87  ? 13.805 120.287 59.271 1.00 28.98  ? 574  PHE C CE2 1 
ATOM   3109 C  CZ  . PHE B 2 87  ? 15.197 120.105 59.103 1.00 32.75  ? 574  PHE C CZ  1 
ATOM   3110 N  N   . GLU B 2 88  ? 11.178 118.209 55.733 1.00 33.67  ? 575  GLU C N   1 
ATOM   3111 C  CA  . GLU B 2 88  ? 10.895 116.955 56.417 1.00 33.41  ? 575  GLU C CA  1 
ATOM   3112 C  C   . GLU B 2 88  ? 10.979 115.778 55.460 1.00 33.92  ? 575  GLU C C   1 
ATOM   3113 O  O   . GLU B 2 88  ? 11.362 114.670 55.849 1.00 36.17  ? 575  GLU C O   1 
ATOM   3114 C  CB  . GLU B 2 88  ? 9.531  116.955 57.094 1.00 32.63  ? 575  GLU C CB  1 
ATOM   3115 C  CG  . GLU B 2 88  ? 9.365  117.945 58.240 1.00 35.03  ? 575  GLU C CG  1 
ATOM   3116 C  CD  . GLU B 2 88  ? 10.400 117.838 59.376 1.00 33.89  ? 575  GLU C CD  1 
ATOM   3117 O  OE1 . GLU B 2 88  ? 10.331 118.722 60.276 1.00 34.08  ? 575  GLU C OE1 1 
ATOM   3118 O  OE2 . GLU B 2 88  ? 11.275 116.931 59.371 1.00 29.43  ? 575  GLU C OE2 1 
ATOM   3119 N  N   . SER B 2 89  ? 10.657 116.020 54.197 1.00 38.31  ? 576  SER C N   1 
ATOM   3120 C  CA  . SER B 2 89  ? 10.693 114.944 53.214 1.00 38.08  ? 576  SER C CA  1 
ATOM   3121 C  C   . SER B 2 89  ? 12.090 114.665 52.676 1.00 37.46  ? 576  SER C C   1 
ATOM   3122 O  O   . SER B 2 89  ? 12.257 113.767 51.870 1.00 40.20  ? 576  SER C O   1 
ATOM   3123 C  CB  . SER B 2 89  ? 9.759  115.231 52.042 1.00 42.95  ? 576  SER C CB  1 
ATOM   3124 O  OG  . SER B 2 89  ? 10.348 116.170 51.160 1.00 50.27  ? 576  SER C OG  1 
HETATM 3125 N  N   . MSE B 2 90  ? 13.080 115.465 53.074 1.00 36.43  ? 577  MSE C N   1 
HETATM 3126 C  CA  . MSE B 2 90  ? 14.458 115.262 52.607 1.00 40.14  ? 577  MSE C CA  1 
HETATM 3127 C  C   . MSE B 2 90  ? 15.167 114.062 53.290 1.00 42.51  ? 577  MSE C C   1 
HETATM 3128 O  O   . MSE B 2 90  ? 16.282 113.684 52.854 1.00 40.12  ? 577  MSE C O   1 
HETATM 3129 O  OXT . MSE B 2 90  ? 14.586 113.472 54.231 1.00 46.60  ? 577  MSE C OXT 1 
HETATM 3130 C  CB  . MSE B 2 90  ? 15.295 116.567 52.724 1.00 35.21  ? 577  MSE C CB  1 
HETATM 3131 C  CG  . MSE B 2 90  ? 15.073 117.580 51.573 1.00 32.75  ? 577  MSE C CG  1 
HETATM 3132 SE SE  . MSE B 2 90  ? 15.938 119.273 51.771 1.00 42.38  ? 577  MSE C SE  1 
HETATM 3133 C  CE  . MSE B 2 90  ? 17.543 118.812 50.832 1.00 40.54  ? 577  MSE C CE  1 
ATOM   3134 N  N   . THR C 1 1   ? 7.928  89.710  85.949 1.00 62.04  ? 4    THR B N   1 
ATOM   3135 C  CA  . THR C 1 1   ? 8.377  89.739  84.523 1.00 62.80  ? 4    THR B CA  1 
ATOM   3136 C  C   . THR C 1 1   ? 8.269  91.063  83.740 1.00 61.13  ? 4    THR B C   1 
ATOM   3137 O  O   . THR C 1 1   ? 7.315  91.850  83.854 1.00 49.45  ? 4    THR B O   1 
ATOM   3138 C  CB  . THR C 1 1   ? 7.756  88.590  83.623 1.00 61.52  ? 4    THR B CB  1 
ATOM   3139 O  OG1 . THR C 1 1   ? 6.339  88.766  83.467 1.00 57.68  ? 4    THR B OG1 1 
ATOM   3140 C  CG2 . THR C 1 1   ? 8.079  87.220  84.186 1.00 54.70  ? 4    THR B CG2 1 
ATOM   3141 N  N   . ILE C 1 2   ? 9.281  91.243  82.895 1.00 62.12  ? 5    ILE B N   1 
ATOM   3142 C  CA  . ILE C 1 2   ? 9.442  92.389  82.018 1.00 53.77  ? 5    ILE B CA  1 
ATOM   3143 C  C   . ILE C 1 2   ? 8.916  92.090  80.598 1.00 46.22  ? 5    ILE B C   1 
ATOM   3144 O  O   . ILE C 1 2   ? 9.191  91.046  79.995 1.00 37.01  ? 5    ILE B O   1 
ATOM   3145 C  CB  . ILE C 1 2   ? 10.902 92.867  82.088 1.00 56.40  ? 5    ILE B CB  1 
ATOM   3146 C  CG1 . ILE C 1 2   ? 11.245 93.089  83.567 1.00 46.48  ? 5    ILE B CG1 1 
ATOM   3147 C  CG2 . ILE C 1 2   ? 11.117 94.154  81.265 1.00 54.18  ? 5    ILE B CG2 1 
ATOM   3148 C  CD1 . ILE C 1 2   ? 12.678 93.353  83.796 1.00 56.95  ? 5    ILE B CD1 1 
ATOM   3149 N  N   . SER C 1 3   ? 8.033  92.974  80.155 1.00 40.70  ? 6    SER B N   1 
ATOM   3150 C  CA  . SER C 1 3   ? 7.375  92.864  78.869 1.00 40.26  ? 6    SER B CA  1 
ATOM   3151 C  C   . SER C 1 3   ? 8.321  93.296  77.769 1.00 40.24  ? 6    SER B C   1 
ATOM   3152 O  O   . SER C 1 3   ? 8.886  94.395  77.841 1.00 35.70  ? 6    SER B O   1 
ATOM   3153 C  CB  . SER C 1 3   ? 6.161  93.782  78.886 1.00 37.32  ? 6    SER B CB  1 
ATOM   3154 O  OG  . SER C 1 3   ? 5.137  93.237  78.111 1.00 48.21  ? 6    SER B OG  1 
ATOM   3155 N  N   . VAL C 1 4   ? 8.462  92.448  76.747 1.00 38.71  ? 7    VAL B N   1 
ATOM   3156 C  CA  . VAL C 1 4   ? 9.350  92.715  75.603 1.00 38.91  ? 7    VAL B CA  1 
ATOM   3157 C  C   . VAL C 1 4   ? 8.704  92.441  74.250 1.00 36.70  ? 7    VAL B C   1 
ATOM   3158 O  O   . VAL C 1 4   ? 7.952  91.481  74.068 1.00 37.24  ? 7    VAL B O   1 
ATOM   3159 C  CB  . VAL C 1 4   ? 10.693 91.892  75.680 1.00 38.30  ? 7    VAL B CB  1 
ATOM   3160 C  CG1 . VAL C 1 4   ? 11.472 92.014  74.378 1.00 43.20  ? 7    VAL B CG1 1 
ATOM   3161 C  CG2 . VAL C 1 4   ? 11.565 92.398  76.823 1.00 34.45  ? 7    VAL B CG2 1 
ATOM   3162 N  N   . ARG C 1 5   ? 9.031  93.298  73.295 1.00 38.87  ? 8    ARG B N   1 
ATOM   3163 C  CA  . ARG C 1 5   ? 8.543  93.147  71.943 1.00 37.33  ? 8    ARG B CA  1 
ATOM   3164 C  C   . ARG C 1 5   ? 9.741  93.215  70.995 1.00 33.95  ? 8    ARG B C   1 
ATOM   3165 O  O   . ARG C 1 5   ? 10.529 94.149  71.068 1.00 26.47  ? 8    ARG B O   1 
ATOM   3166 C  CB  . ARG C 1 5   ? 7.547  94.251  71.647 1.00 38.54  ? 8    ARG B CB  1 
ATOM   3167 C  CG  . ARG C 1 5   ? 6.852  94.107  70.337 1.00 43.90  ? 8    ARG B CG  1 
ATOM   3168 C  CD  . ARG C 1 5   ? 5.966  95.313  70.150 1.00 50.01  ? 8    ARG B CD  1 
ATOM   3169 N  NE  . ARG C 1 5   ? 4.849  95.277  71.081 1.00 55.53  ? 8    ARG B NE  1 
ATOM   3170 C  CZ  . ARG C 1 5   ? 3.773  96.048  70.975 1.00 62.10  ? 8    ARG B CZ  1 
ATOM   3171 N  NH1 . ARG C 1 5   ? 3.687  96.927  69.989 1.00 62.43  ? 8    ARG B NH1 1 
ATOM   3172 N  NH2 . ARG C 1 5   ? 2.746  95.881  71.797 1.00 64.79  ? 8    ARG B NH2 1 
ATOM   3173 N  N   . VAL C 1 6   ? 9.925  92.175  70.185 1.00 29.36  ? 9    VAL B N   1 
ATOM   3174 C  CA  . VAL C 1 6   ? 11.029 92.135  69.240 1.00 28.14  ? 9    VAL B CA  1 
ATOM   3175 C  C   . VAL C 1 6   ? 10.507 92.074  67.823 1.00 29.87  ? 9    VAL B C   1 
ATOM   3176 O  O   . VAL C 1 6   ? 9.829  91.111  67.438 1.00 29.37  ? 9    VAL B O   1 
ATOM   3177 C  CB  . VAL C 1 6   ? 12.026 90.941  69.487 1.00 28.87  ? 9    VAL B CB  1 
ATOM   3178 C  CG1 . VAL C 1 6   ? 13.058 90.838  68.323 1.00 22.84  ? 9    VAL B CG1 1 
ATOM   3179 C  CG2 . VAL C 1 6   ? 12.795 91.129  70.838 1.00 22.84  ? 9    VAL B CG2 1 
ATOM   3180 N  N   . THR C 1 7   ? 10.861 93.089  67.035 1.00 27.17  ? 10   THR B N   1 
ATOM   3181 C  CA  . THR C 1 7   ? 10.447 93.135  65.657 1.00 24.68  ? 10   THR B CA  1 
ATOM   3182 C  C   . THR C 1 7   ? 11.524 92.816  64.648 1.00 21.94  ? 10   THR B C   1 
ATOM   3183 O  O   . THR C 1 7   ? 12.560 93.445  64.649 1.00 19.83  ? 10   THR B O   1 
ATOM   3184 C  CB  . THR C 1 7   ? 9.889  94.478  65.335 1.00 32.82  ? 10   THR B CB  1 
ATOM   3185 O  OG1 . THR C 1 7   ? 9.043  94.867  66.414 1.00 43.47  ? 10   THR B OG1 1 
ATOM   3186 C  CG2 . THR C 1 7   ? 9.017  94.383  64.069 1.00 39.92  ? 10   THR B CG2 1 
ATOM   3187 N  N   . THR C 1 8   ? 11.279 91.809  63.812 1.00 24.58  ? 11   THR B N   1 
ATOM   3188 C  CA  . THR C 1 8   ? 12.187 91.456  62.714 1.00 25.97  ? 11   THR B CA  1 
ATOM   3189 C  C   . THR C 1 8   ? 11.660 92.255  61.490 1.00 26.00  ? 11   THR B C   1 
ATOM   3190 O  O   . THR C 1 8   ? 10.699 93.025  61.595 1.00 26.21  ? 11   THR B O   1 
ATOM   3191 C  CB  . THR C 1 8   ? 12.165 89.930  62.398 1.00 26.79  ? 11   THR B CB  1 
ATOM   3192 O  OG1 . THR C 1 8   ? 10.882 89.550  61.868 1.00 31.69  ? 11   THR B OG1 1 
ATOM   3193 C  CG2 . THR C 1 8   ? 12.466 89.117  63.659 1.00 28.96  ? 11   THR B CG2 1 
HETATM 3194 N  N   . MSE C 1 9   ? 12.221 92.032  60.313 1.00 24.39  ? 12   MSE B N   1 
HETATM 3195 C  CA  . MSE C 1 9   ? 11.763 92.770  59.137 1.00 21.72  ? 12   MSE B CA  1 
HETATM 3196 C  C   . MSE C 1 9   ? 10.320 92.423  58.747 1.00 28.52  ? 12   MSE B C   1 
HETATM 3197 O  O   . MSE C 1 9   ? 9.653  93.219  58.093 1.00 30.14  ? 12   MSE B O   1 
HETATM 3198 C  CB  . MSE C 1 9   ? 12.679 92.534  57.940 1.00 19.03  ? 12   MSE B CB  1 
HETATM 3199 C  CG  . MSE C 1 9   ? 14.034 93.256  58.052 1.00 22.37  ? 12   MSE B CG  1 
HETATM 3200 SE SE  . MSE C 1 9   ? 13.907 95.166  58.297 1.00 34.02  ? 12   MSE B SE  1 
HETATM 3201 C  CE  . MSE C 1 9   ? 12.785 95.595  56.810 1.00 30.39  ? 12   MSE B CE  1 
ATOM   3202 N  N   . ASP C 1 10  ? 9.835  91.244  59.125 1.00 21.82  ? 13   ASP B N   1 
ATOM   3203 C  CA  . ASP C 1 10  ? 8.483  90.884  58.736 1.00 24.74  ? 13   ASP B CA  1 
ATOM   3204 C  C   . ASP C 1 10  ? 7.688  90.164  59.801 1.00 26.15  ? 13   ASP B C   1 
ATOM   3205 O  O   . ASP C 1 10  ? 6.761  89.429  59.487 1.00 28.26  ? 13   ASP B O   1 
ATOM   3206 C  CB  . ASP C 1 10  ? 8.497  90.034  57.457 1.00 24.48  ? 13   ASP B CB  1 
ATOM   3207 C  CG  . ASP C 1 10  ? 9.163  88.675  57.640 1.00 32.78  ? 13   ASP B CG  1 
ATOM   3208 O  OD1 . ASP C 1 10  ? 9.397  88.234  58.787 1.00 36.96  ? 13   ASP B OD1 1 
ATOM   3209 O  OD2 . ASP C 1 10  ? 9.440  88.024  56.609 1.00 39.70  ? 13   ASP B OD2 1 
ATOM   3210 N  N   . ALA C 1 11  ? 8.077  90.311  61.055 1.00 24.82  ? 14   ALA B N   1 
ATOM   3211 C  CA  . ALA C 1 11  ? 7.340  89.619  62.095 1.00 28.35  ? 14   ALA B CA  1 
ATOM   3212 C  C   . ALA C 1 11  ? 7.538  90.311  63.423 1.00 30.68  ? 14   ALA B C   1 
ATOM   3213 O  O   . ALA C 1 11  ? 8.476  91.069  63.623 1.00 35.13  ? 14   ALA B O   1 
ATOM   3214 C  CB  . ALA C 1 11  ? 7.751  88.140  62.169 1.00 31.58  ? 14   ALA B CB  1 
ATOM   3215 N  N   . GLU C 1 12  ? 6.580  90.127  64.307 1.00 37.32  ? 15   GLU B N   1 
ATOM   3216 C  CA  . GLU C 1 12  ? 6.661  90.737  65.622 1.00 39.39  ? 15   GLU B CA  1 
ATOM   3217 C  C   . GLU C 1 12  ? 6.502  89.660  66.699 1.00 38.61  ? 15   GLU B C   1 
ATOM   3218 O  O   . GLU C 1 12  ? 5.651  88.768  66.610 1.00 32.60  ? 15   GLU B O   1 
ATOM   3219 C  CB  . GLU C 1 12  ? 5.652  91.877  65.749 1.00 37.23  ? 15   GLU B CB  1 
ATOM   3220 C  CG  . GLU C 1 12  ? 5.571  92.465  67.143 1.00 46.51  ? 15   GLU B CG  1 
ATOM   3221 C  CD  . GLU C 1 12  ? 4.444  93.460  67.269 1.00 50.01  ? 15   GLU B CD  1 
ATOM   3222 O  OE1 . GLU C 1 12  ? 3.387  93.095  67.851 1.00 50.06  ? 15   GLU B OE1 1 
ATOM   3223 O  OE2 . GLU C 1 12  ? 4.610  94.593  66.760 1.00 53.44  ? 15   GLU B OE2 1 
ATOM   3224 N  N   . LEU C 1 13  ? 7.391  89.708  67.677 1.00 36.52  ? 16   LEU B N   1 
ATOM   3225 C  CA  . LEU C 1 13  ? 7.386  88.722  68.733 1.00 38.35  ? 16   LEU B CA  1 
ATOM   3226 C  C   . LEU C 1 13  ? 7.209  89.375  70.078 1.00 34.99  ? 16   LEU B C   1 
ATOM   3227 O  O   . LEU C 1 13  ? 7.801  90.407  70.352 1.00 35.48  ? 16   LEU B O   1 
ATOM   3228 C  CB  . LEU C 1 13  ? 8.705  87.951  68.729 1.00 33.25  ? 16   LEU B CB  1 
ATOM   3229 C  CG  . LEU C 1 13  ? 9.184  87.216  67.468 1.00 33.36  ? 16   LEU B CG  1 
ATOM   3230 C  CD1 . LEU C 1 13  ? 10.306 86.300  67.897 1.00 29.51  ? 16   LEU B CD1 1 
ATOM   3231 C  CD2 . LEU C 1 13  ? 8.044  86.387  66.840 1.00 29.46  ? 16   LEU B CD2 1 
ATOM   3232 N  N   . GLU C 1 14  ? 6.365  88.781  70.908 1.00 37.27  ? 17   GLU B N   1 
ATOM   3233 C  CA  . GLU C 1 14  ? 6.171  89.290  72.252 1.00 44.35  ? 17   GLU B CA  1 
ATOM   3234 C  C   . GLU C 1 14  ? 6.685  88.287  73.303 1.00 48.97  ? 17   GLU B C   1 
ATOM   3235 O  O   . GLU C 1 14  ? 6.312  87.110  73.292 1.00 50.40  ? 17   GLU B O   1 
ATOM   3236 C  CB  . GLU C 1 14  ? 4.711  89.649  72.453 1.00 50.54  ? 17   GLU B CB  1 
ATOM   3237 C  CG  . GLU C 1 14  ? 4.246  90.750  71.495 1.00 60.47  ? 17   GLU B CG  1 
ATOM   3238 C  CD  . GLU C 1 14  ? 3.476  91.863  72.195 1.00 67.66  ? 17   GLU B CD  1 
ATOM   3239 O  OE1 . GLU C 1 14  ? 2.242  91.728  72.344 1.00 75.22  ? 17   GLU B OE1 1 
ATOM   3240 O  OE2 . GLU C 1 14  ? 4.101  92.873  72.593 1.00 71.10  ? 17   GLU B OE2 1 
ATOM   3241 N  N   . PHE C 1 15  ? 7.649  88.733  74.108 1.00 51.71  ? 18   PHE B N   1 
ATOM   3242 C  CA  . PHE C 1 15  ? 8.260  87.910  75.155 1.00 54.00  ? 18   PHE B CA  1 
ATOM   3243 C  C   . PHE C 1 15  ? 8.074  88.536  76.544 1.00 53.40  ? 18   PHE B C   1 
ATOM   3244 O  O   . PHE C 1 15  ? 7.819  89.733  76.669 1.00 49.17  ? 18   PHE B O   1 
ATOM   3245 C  CB  . PHE C 1 15  ? 9.767  87.733  74.878 1.00 54.97  ? 18   PHE B CB  1 
ATOM   3246 C  CG  . PHE C 1 15  ? 10.067 86.888  73.686 1.00 57.89  ? 18   PHE B CG  1 
ATOM   3247 C  CD1 . PHE C 1 15  ? 9.400  85.685  73.481 1.00 65.76  ? 18   PHE B CD1 1 
ATOM   3248 C  CD2 . PHE C 1 15  ? 11.017 87.285  72.767 1.00 62.32  ? 18   PHE B CD2 1 
ATOM   3249 C  CE1 . PHE C 1 15  ? 9.680  84.874  72.363 1.00 70.98  ? 18   PHE B CE1 1 
ATOM   3250 C  CE2 . PHE C 1 15  ? 11.311 86.490  71.645 1.00 70.75  ? 18   PHE B CE2 1 
ATOM   3251 C  CZ  . PHE C 1 15  ? 10.641 85.280  71.442 1.00 70.27  ? 18   PHE B CZ  1 
ATOM   3252 N  N   . ALA C 1 16  ? 8.112  87.689  77.571 1.00 57.44  ? 19   ALA B N   1 
ATOM   3253 C  CA  . ALA C 1 16  ? 8.036  88.127  78.968 1.00 57.32  ? 19   ALA B CA  1 
ATOM   3254 C  C   . ALA C 1 16  ? 9.322  87.549  79.582 1.00 53.27  ? 19   ALA B C   1 
ATOM   3255 O  O   . ALA C 1 16  ? 9.534  86.338  79.584 1.00 51.70  ? 19   ALA B O   1 
ATOM   3256 C  CB  . ALA C 1 16  ? 6.786  87.571  79.661 1.00 58.04  ? 19   ALA B CB  1 
ATOM   3257 N  N   . ILE C 1 17  ? 10.217 88.429  80.008 1.00 48.26  ? 20   ILE B N   1 
ATOM   3258 C  CA  . ILE C 1 17  ? 11.493 88.010  80.560 1.00 48.67  ? 20   ILE B CA  1 
ATOM   3259 C  C   . ILE C 1 17  ? 11.701 88.346  82.039 1.00 54.21  ? 20   ILE B C   1 
ATOM   3260 O  O   . ILE C 1 17  ? 11.251 89.381  82.515 1.00 50.49  ? 20   ILE B O   1 
ATOM   3261 C  CB  . ILE C 1 17  ? 12.676 88.677  79.775 1.00 46.61  ? 20   ILE B CB  1 
ATOM   3262 C  CG1 . ILE C 1 17  ? 12.630 90.215  79.885 1.00 41.28  ? 20   ILE B CG1 1 
ATOM   3263 C  CG2 . ILE C 1 17  ? 12.672 88.241  78.327 1.00 46.48  ? 20   ILE B CG2 1 
ATOM   3264 C  CD1 . ILE C 1 17  ? 13.991 90.925  79.714 1.00 38.67  ? 20   ILE B CD1 1 
ATOM   3265 N  N   . GLN C 1 18  ? 12.449 87.503  82.750 1.00 63.64  ? 21   GLN B N   1 
ATOM   3266 C  CA  . GLN C 1 18  ? 12.751 87.776  84.156 1.00 68.32  ? 21   GLN B CA  1 
ATOM   3267 C  C   . GLN C 1 18  ? 13.820 88.876  84.190 1.00 67.42  ? 21   GLN B C   1 
ATOM   3268 O  O   . GLN C 1 18  ? 14.491 89.130  83.191 1.00 68.36  ? 21   GLN B O   1 
ATOM   3269 C  CB  . GLN C 1 18  ? 13.204 86.509  84.885 1.00 73.13  ? 21   GLN B CB  1 
ATOM   3270 C  CG  . GLN C 1 18  ? 14.274 85.702  84.177 1.00 81.77  ? 21   GLN B CG  1 
ATOM   3271 C  CD  . GLN C 1 18  ? 14.807 84.577  85.044 1.00 86.56  ? 21   GLN B CD  1 
ATOM   3272 O  OE1 . GLN C 1 18  ? 14.680 84.618  86.272 1.00 89.14  ? 21   GLN B OE1 1 
ATOM   3273 N  NE2 . GLN C 1 18  ? 15.417 83.571  84.415 1.00 85.73  ? 21   GLN B NE2 1 
ATOM   3274 N  N   . PRO C 1 19  ? 13.956 89.578  85.320 1.00 67.04  ? 22   PRO B N   1 
ATOM   3275 C  CA  . PRO C 1 19  ? 14.950 90.656  85.443 1.00 66.77  ? 22   PRO B CA  1 
ATOM   3276 C  C   . PRO C 1 19  ? 16.370 90.142  85.257 1.00 65.65  ? 22   PRO B C   1 
ATOM   3277 O  O   . PRO C 1 19  ? 17.271 90.878  84.851 1.00 66.90  ? 22   PRO B O   1 
ATOM   3278 C  CB  . PRO C 1 19  ? 14.722 91.163  86.871 1.00 70.34  ? 22   PRO B CB  1 
ATOM   3279 C  CG  . PRO C 1 19  ? 13.265 90.788  87.155 1.00 66.89  ? 22   PRO B CG  1 
ATOM   3280 C  CD  . PRO C 1 19  ? 13.195 89.415  86.571 1.00 67.16  ? 22   PRO B CD  1 
ATOM   3281 N  N   . ASN C 1 20  ? 16.534 88.854  85.527 1.00 64.09  ? 23   ASN B N   1 
ATOM   3282 C  CA  . ASN C 1 20  ? 17.812 88.175  85.436 1.00 64.39  ? 23   ASN B CA  1 
ATOM   3283 C  C   . ASN C 1 20  ? 18.308 87.994  83.991 1.00 61.07  ? 23   ASN B C   1 
ATOM   3284 O  O   . ASN C 1 20  ? 19.519 87.807  83.769 1.00 55.66  ? 23   ASN B O   1 
ATOM   3285 C  CB  . ASN C 1 20  ? 17.662 86.813  86.118 1.00 71.47  ? 23   ASN B CB  1 
ATOM   3286 C  CG  . ASN C 1 20  ? 18.945 86.009  86.121 1.00 82.73  ? 23   ASN B CG  1 
ATOM   3287 O  OD1 . ASN C 1 20  ? 19.585 85.862  87.165 1.00 88.02  ? 23   ASN B OD1 1 
ATOM   3288 N  ND2 . ASN C 1 20  ? 19.322 85.461  84.955 1.00 84.81  ? 23   ASN B ND2 1 
ATOM   3289 N  N   . THR C 1 21  ? 17.378 88.061  83.028 1.00 56.90  ? 24   THR B N   1 
ATOM   3290 C  CA  . THR C 1 21  ? 17.678 87.852  81.602 1.00 49.32  ? 24   THR B CA  1 
ATOM   3291 C  C   . THR C 1 21  ? 18.763 88.759  81.027 1.00 44.74  ? 24   THR B C   1 
ATOM   3292 O  O   . THR C 1 21  ? 18.782 89.970  81.274 1.00 44.04  ? 24   THR B O   1 
ATOM   3293 C  CB  . THR C 1 21  ? 16.379 87.904  80.721 1.00 50.88  ? 24   THR B CB  1 
ATOM   3294 O  OG1 . THR C 1 21  ? 15.360 87.102  81.329 1.00 51.34  ? 24   THR B OG1 1 
ATOM   3295 C  CG2 . THR C 1 21  ? 16.624 87.322  79.325 1.00 48.79  ? 24   THR B CG2 1 
ATOM   3296 N  N   . THR C 1 22  ? 19.698 88.109  80.329 1.00 45.51  ? 25   THR B N   1 
ATOM   3297 C  CA  . THR C 1 22  ? 20.859 88.711  79.656 1.00 42.74  ? 25   THR B CA  1 
ATOM   3298 C  C   . THR C 1 22  ? 20.474 88.941  78.187 1.00 37.76  ? 25   THR B C   1 
ATOM   3299 O  O   . THR C 1 22  ? 19.499 88.364  77.710 1.00 33.45  ? 25   THR B O   1 
ATOM   3300 C  CB  . THR C 1 22  ? 22.011 87.703  79.604 1.00 39.81  ? 25   THR B CB  1 
ATOM   3301 O  OG1 . THR C 1 22  ? 21.614 86.597  78.789 1.00 47.31  ? 25   THR B OG1 1 
ATOM   3302 C  CG2 . THR C 1 22  ? 22.319 87.155  80.977 1.00 42.97  ? 25   THR B CG2 1 
ATOM   3303 N  N   . GLY C 1 23  ? 21.258 89.731  77.457 1.00 35.00  ? 26   GLY B N   1 
ATOM   3304 C  CA  . GLY C 1 23  ? 20.951 89.936  76.057 1.00 34.64  ? 26   GLY B CA  1 
ATOM   3305 C  C   . GLY C 1 23  ? 21.008 88.621  75.302 1.00 35.04  ? 26   GLY B C   1 
ATOM   3306 O  O   . GLY C 1 23  ? 20.196 88.370  74.440 1.00 32.96  ? 26   GLY B O   1 
ATOM   3307 N  N   . LYS C 1 24  ? 21.968 87.772  75.661 1.00 37.65  ? 27   LYS B N   1 
ATOM   3308 C  CA  . LYS C 1 24  ? 22.165 86.463  75.040 1.00 38.46  ? 27   LYS B CA  1 
ATOM   3309 C  C   . LYS C 1 24  ? 20.921 85.570  75.196 1.00 33.70  ? 27   LYS B C   1 
ATOM   3310 O  O   . LYS C 1 24  ? 20.546 84.872  74.268 1.00 30.71  ? 27   LYS B O   1 
ATOM   3311 C  CB  . LYS C 1 24  ? 23.396 85.787  75.687 1.00 39.34  ? 27   LYS B CB  1 
ATOM   3312 C  CG  . LYS C 1 24  ? 23.590 84.293  75.379 1.00 44.46  ? 27   LYS B CG  1 
ATOM   3313 C  CD  . LYS C 1 24  ? 23.990 84.063  73.929 1.00 50.85  ? 27   LYS B CD  1 
ATOM   3314 C  CE  . LYS C 1 24  ? 24.157 82.584  73.612 1.00 53.09  ? 27   LYS B CE  1 
ATOM   3315 N  NZ  . LYS C 1 24  ? 24.364 82.434  72.155 1.00 58.25  ? 27   LYS B NZ  1 
ATOM   3316 N  N   . GLN C 1 25  ? 20.281 85.576  76.359 1.00 31.15  ? 28   GLN B N   1 
ATOM   3317 C  CA  . GLN C 1 25  ? 19.125 84.708  76.540 1.00 34.72  ? 28   GLN B CA  1 
ATOM   3318 C  C   . GLN C 1 25  ? 17.937 85.176  75.719 1.00 33.69  ? 28   GLN B C   1 
ATOM   3319 O  O   . GLN C 1 25  ? 17.148 84.351  75.220 1.00 35.23  ? 28   GLN B O   1 
ATOM   3320 C  CB  . GLN C 1 25  ? 18.739 84.641  78.013 1.00 42.18  ? 28   GLN B CB  1 
ATOM   3321 C  CG  . GLN C 1 25  ? 19.859 84.150  78.900 1.00 45.62  ? 28   GLN B CG  1 
ATOM   3322 C  CD  . GLN C 1 25  ? 19.507 84.253  80.361 1.00 49.11  ? 28   GLN B CD  1 
ATOM   3323 O  OE1 . GLN C 1 25  ? 19.704 85.293  80.991 1.00 45.66  ? 28   GLN B OE1 1 
ATOM   3324 N  NE2 . GLN C 1 25  ? 18.974 83.175  80.909 1.00 49.46  ? 28   GLN B NE2 1 
ATOM   3325 N  N   . LEU C 1 26  ? 17.784 86.504  75.643 1.00 30.64  ? 29   LEU B N   1 
ATOM   3326 C  CA  . LEU C 1 26  ? 16.738 87.131  74.838 1.00 26.88  ? 29   LEU B CA  1 
ATOM   3327 C  C   . LEU C 1 26  ? 16.984 86.853  73.341 1.00 26.08  ? 29   LEU B C   1 
ATOM   3328 O  O   . LEU C 1 26  ? 16.064 86.462  72.642 1.00 35.67  ? 29   LEU B O   1 
ATOM   3329 C  CB  . LEU C 1 26  ? 16.685 88.632  75.084 1.00 22.31  ? 29   LEU B CB  1 
ATOM   3330 C  CG  . LEU C 1 26  ? 15.643 89.372  74.244 1.00 24.64  ? 29   LEU B CG  1 
ATOM   3331 C  CD1 . LEU C 1 26  ? 14.264 88.867  74.632 1.00 20.90  ? 29   LEU B CD1 1 
ATOM   3332 C  CD2 . LEU C 1 26  ? 15.770 90.872  74.460 1.00 19.84  ? 29   LEU B CD2 1 
ATOM   3333 N  N   . PHE C 1 27  ? 18.232 86.964  72.875 1.00 23.30  ? 30   PHE B N   1 
ATOM   3334 C  CA  . PHE C 1 27  ? 18.580 86.712  71.468 1.00 23.78  ? 30   PHE B CA  1 
ATOM   3335 C  C   . PHE C 1 27  ? 18.274 85.257  71.059 1.00 22.37  ? 30   PHE B C   1 
ATOM   3336 O  O   . PHE C 1 27  ? 17.694 84.981  69.995 1.00 23.47  ? 30   PHE B O   1 
ATOM   3337 C  CB  . PHE C 1 27  ? 20.066 87.101  71.261 1.00 21.92  ? 30   PHE B CB  1 
ATOM   3338 C  CG  . PHE C 1 27  ? 20.568 86.901  69.858 1.00 27.78  ? 30   PHE B CG  1 
ATOM   3339 C  CD1 . PHE C 1 27  ? 20.545 87.971  68.928 1.00 21.78  ? 30   PHE B CD1 1 
ATOM   3340 C  CD2 . PHE C 1 27  ? 21.024 85.642  69.445 1.00 21.29  ? 30   PHE B CD2 1 
ATOM   3341 C  CE1 . PHE C 1 27  ? 20.955 87.783  67.612 1.00 18.29  ? 30   PHE B CE1 1 
ATOM   3342 C  CE2 . PHE C 1 27  ? 21.441 85.441  68.123 1.00 33.16  ? 30   PHE B CE2 1 
ATOM   3343 C  CZ  . PHE C 1 27  ? 21.405 86.521  67.201 1.00 27.14  ? 30   PHE B CZ  1 
ATOM   3344 N  N   . ASP C 1 28  ? 18.529 84.342  71.989 1.00 32.35  ? 31   ASP B N   1 
ATOM   3345 C  CA  . ASP C 1 28  ? 18.301 82.912  71.777 1.00 32.21  ? 31   ASP B CA  1 
ATOM   3346 C  C   . ASP C 1 28  ? 16.811 82.580  71.651 1.00 31.75  ? 31   ASP B C   1 
ATOM   3347 O  O   . ASP C 1 28  ? 16.440 81.685  70.885 1.00 35.34  ? 31   ASP B O   1 
ATOM   3348 C  CB  . ASP C 1 28  ? 18.918 82.096  72.922 1.00 40.50  ? 31   ASP B CB  1 
ATOM   3349 C  CG  . ASP C 1 28  ? 20.434 82.023  72.850 1.00 51.23  ? 31   ASP B CG  1 
ATOM   3350 O  OD1 . ASP C 1 28  ? 21.031 82.594  71.913 1.00 57.51  ? 31   ASP B OD1 1 
ATOM   3351 O  OD2 . ASP C 1 28  ? 21.042 81.381  73.733 1.00 59.59  ? 31   ASP B OD2 1 
ATOM   3352 N  N   . GLN C 1 29  ? 15.955 83.280  72.393 1.00 27.47  ? 32   GLN B N   1 
ATOM   3353 C  CA  . GLN C 1 29  ? 14.517 83.028  72.282 1.00 31.29  ? 32   GLN B CA  1 
ATOM   3354 C  C   . GLN C 1 29  ? 13.998 83.456  70.921 1.00 28.20  ? 32   GLN B C   1 
ATOM   3355 O  O   . GLN C 1 29  ? 13.163 82.798  70.335 1.00 32.92  ? 32   GLN B O   1 
ATOM   3356 C  CB  . GLN C 1 29  ? 13.709 83.806  73.308 1.00 34.49  ? 32   GLN B CB  1 
ATOM   3357 C  CG  . GLN C 1 29  ? 13.767 83.277  74.699 1.00 44.21  ? 32   GLN B CG  1 
ATOM   3358 C  CD  . GLN C 1 29  ? 12.814 84.028  75.592 1.00 45.47  ? 32   GLN B CD  1 
ATOM   3359 O  OE1 . GLN C 1 29  ? 11.607 84.053  75.344 1.00 49.06  ? 32   GLN B OE1 1 
ATOM   3360 N  NE2 . GLN C 1 29  ? 13.352 84.686  76.610 1.00 45.03  ? 32   GLN B NE2 1 
ATOM   3361 N  N   . VAL C 1 30  ? 14.461 84.618  70.482 1.00 32.58  ? 33   VAL B N   1 
ATOM   3362 C  CA  . VAL C 1 30  ? 14.136 85.212  69.191 1.00 27.78  ? 33   VAL B CA  1 
ATOM   3363 C  C   . VAL C 1 30  ? 14.549 84.279  68.050 1.00 26.78  ? 33   VAL B C   1 
ATOM   3364 O  O   . VAL C 1 30  ? 13.694 83.838  67.278 1.00 22.76  ? 33   VAL B O   1 
ATOM   3365 C  CB  . VAL C 1 30  ? 14.939 86.548  69.037 1.00 28.74  ? 33   VAL B CB  1 
ATOM   3366 C  CG1 . VAL C 1 30  ? 14.771 87.189  67.621 1.00 22.45  ? 33   VAL B CG1 1 
ATOM   3367 C  CG2 . VAL C 1 30  ? 14.510 87.504  70.111 1.00 25.23  ? 33   VAL B CG2 1 
ATOM   3368 N  N   . VAL C 1 31  ? 15.849 83.983  67.931 1.00 22.02  ? 34   VAL B N   1 
ATOM   3369 C  CA  . VAL C 1 31  ? 16.284 83.114  66.828 1.00 22.95  ? 34   VAL B CA  1 
ATOM   3370 C  C   . VAL C 1 31  ? 15.605 81.755  66.883 1.00 25.33  ? 34   VAL B C   1 
ATOM   3371 O  O   . VAL C 1 31  ? 15.224 81.225  65.844 1.00 26.61  ? 34   VAL B O   1 
ATOM   3372 C  CB  . VAL C 1 31  ? 17.818 83.001  66.742 1.00 22.33  ? 34   VAL B CB  1 
ATOM   3373 C  CG1 . VAL C 1 31  ? 18.408 84.386  66.655 1.00 21.26  ? 34   VAL B CG1 1 
ATOM   3374 C  CG2 . VAL C 1 31  ? 18.385 82.244  67.950 1.00 28.75  ? 34   VAL B CG2 1 
ATOM   3375 N  N   . LYS C 1 32  ? 15.402 81.238  68.108 1.00 31.36  ? 35   LYS B N   1 
ATOM   3376 C  CA  . LYS C 1 32  ? 14.732 79.958  68.363 1.00 33.35  ? 35   LYS B CA  1 
ATOM   3377 C  C   . LYS C 1 32  ? 13.301 79.988  67.799 1.00 35.13  ? 35   LYS B C   1 
ATOM   3378 O  O   . LYS C 1 32  ? 12.886 79.113  67.012 1.00 33.27  ? 35   LYS B O   1 
ATOM   3379 C  CB  . LYS C 1 32  ? 14.649 79.741  69.872 1.00 38.70  ? 35   LYS B CB  1 
ATOM   3380 C  CG  . LYS C 1 32  ? 14.357 78.319  70.309 1.00 49.80  ? 35   LYS B CG  1 
ATOM   3381 C  CD  . LYS C 1 32  ? 15.621 77.452  70.386 1.00 61.97  ? 35   LYS B CD  1 
ATOM   3382 C  CE  . LYS C 1 32  ? 16.283 77.185  69.021 1.00 60.65  ? 35   LYS B CE  1 
ATOM   3383 N  NZ  . LYS C 1 32  ? 17.359 78.158  68.607 1.00 57.90  ? 35   LYS B NZ  1 
ATOM   3384 N  N   . THR C 1 33  ? 12.563 81.013  68.222 1.00 31.41  ? 36   THR B N   1 
ATOM   3385 C  CA  . THR C 1 33  ? 11.193 81.247  67.805 1.00 29.41  ? 36   THR B CA  1 
ATOM   3386 C  C   . THR C 1 33  ? 11.002 81.403  66.312 1.00 29.47  ? 36   THR B C   1 
ATOM   3387 O  O   . THR C 1 33  ? 10.010 80.867  65.780 1.00 28.71  ? 36   THR B O   1 
ATOM   3388 C  CB  . THR C 1 33  ? 10.596 82.487  68.522 1.00 34.25  ? 36   THR B CB  1 
ATOM   3389 O  OG1 . THR C 1 33  ? 10.427 82.200  69.913 1.00 47.29  ? 36   THR B OG1 1 
ATOM   3390 C  CG2 . THR C 1 33  ? 9.235  82.875  67.931 1.00 36.05  ? 36   THR B CG2 1 
ATOM   3391 N  N   . ILE C 1 34  ? 11.889 82.160  65.636 1.00 24.84  ? 37   ILE B N   1 
ATOM   3392 C  CA  . ILE C 1 34  ? 11.775 82.336  64.173 1.00 20.21  ? 37   ILE B CA  1 
ATOM   3393 C  C   . ILE C 1 34  ? 12.454 81.230  63.334 1.00 22.30  ? 37   ILE B C   1 
ATOM   3394 O  O   . ILE C 1 34  ? 12.349 81.221  62.104 1.00 24.22  ? 37   ILE B O   1 
ATOM   3395 C  CB  . ILE C 1 34  ? 12.219 83.711  63.723 1.00 18.73  ? 37   ILE B CB  1 
ATOM   3396 C  CG1 . ILE C 1 34  ? 13.726 83.846  63.853 1.00 23.31  ? 37   ILE B CG1 1 
ATOM   3397 C  CG2 . ILE C 1 34  ? 11.526 84.770  64.568 1.00 18.12  ? 37   ILE B CG2 1 
ATOM   3398 C  CD1 . ILE C 1 34  ? 14.256 85.184  63.401 1.00 23.02  ? 37   ILE B CD1 1 
ATOM   3399 N  N   . GLY C 1 35  ? 13.112 80.269  63.996 1.00 20.34  ? 38   GLY B N   1 
ATOM   3400 C  CA  . GLY C 1 35  ? 13.745 79.162  63.263 1.00 15.93  ? 38   GLY B CA  1 
ATOM   3401 C  C   . GLY C 1 35  ? 15.010 79.510  62.520 1.00 19.57  ? 38   GLY B C   1 
ATOM   3402 O  O   . GLY C 1 35  ? 15.317 78.919  61.476 1.00 24.59  ? 38   GLY B O   1 
ATOM   3403 N  N   . LEU C 1 36  ? 15.771 80.439  63.098 1.00 20.97  ? 39   LEU B N   1 
ATOM   3404 C  CA  . LEU C 1 36  ? 16.992 80.950  62.478 1.00 24.18  ? 39   LEU B CA  1 
ATOM   3405 C  C   . LEU C 1 36  ? 18.266 80.381  63.115 1.00 17.70  ? 39   LEU B C   1 
ATOM   3406 O  O   . LEU C 1 36  ? 18.521 80.573  64.310 1.00 21.61  ? 39   LEU B O   1 
ATOM   3407 C  CB  . LEU C 1 36  ? 16.988 82.499  62.552 1.00 20.13  ? 39   LEU B CB  1 
ATOM   3408 C  CG  . LEU C 1 36  ? 18.300 83.222  62.205 1.00 24.95  ? 39   LEU B CG  1 
ATOM   3409 C  CD1 . LEU C 1 36  ? 18.570 83.124  60.764 1.00 28.28  ? 39   LEU B CD1 1 
ATOM   3410 C  CD2 . LEU C 1 36  ? 18.226 84.657  62.605 1.00 34.22  ? 39   LEU B CD2 1 
ATOM   3411 N  N   . ARG C 1 37  ? 19.037 79.653  62.312 1.00 24.00  ? 40   ARG B N   1 
ATOM   3412 C  CA  . ARG C 1 37  ? 20.318 79.057  62.733 1.00 21.94  ? 40   ARG B CA  1 
ATOM   3413 C  C   . ARG C 1 37  ? 21.576 79.882  62.354 1.00 23.29  ? 40   ARG B C   1 
ATOM   3414 O  O   . ARG C 1 37  ? 22.544 79.849  63.105 1.00 19.89  ? 40   ARG B O   1 
ATOM   3415 C  CB  . ARG C 1 37  ? 20.411 77.556  62.346 1.00 24.96  ? 40   ARG B CB  1 
ATOM   3416 C  CG  . ARG C 1 37  ? 19.394 76.709  63.168 1.00 26.48  ? 40   ARG B CG  1 
ATOM   3417 C  CD  . ARG C 1 37  ? 19.278 75.231  62.819 1.00 34.11  ? 40   ARG B CD  1 
ATOM   3418 N  NE  . ARG C 1 37  ? 18.307 74.977  61.747 1.00 43.65  ? 40   ARG B NE  1 
ATOM   3419 C  CZ  . ARG C 1 37  ? 16.989 75.186  61.817 1.00 43.18  ? 40   ARG B CZ  1 
ATOM   3420 N  NH1 . ARG C 1 37  ? 16.404 75.636  62.926 1.00 37.38  ? 40   ARG B NH1 1 
ATOM   3421 N  NH2 . ARG C 1 37  ? 16.261 75.076  60.715 1.00 41.03  ? 40   ARG B NH2 1 
ATOM   3422 N  N   . GLU C 1 38  ? 21.535 80.691  61.280 1.00 16.20  ? 41   GLU B N   1 
ATOM   3423 C  CA  . GLU C 1 38  ? 22.687 81.532  60.879 1.00 18.93  ? 41   GLU B CA  1 
ATOM   3424 C  C   . GLU C 1 38  ? 22.672 82.838  61.665 1.00 17.25  ? 41   GLU B C   1 
ATOM   3425 O  O   . GLU C 1 38  ? 22.632 83.924  61.111 1.00 22.49  ? 41   GLU B O   1 
ATOM   3426 C  CB  . GLU C 1 38  ? 22.683 81.777  59.366 1.00 19.74  ? 41   GLU B CB  1 
ATOM   3427 C  CG  . GLU C 1 38  ? 22.821 80.466  58.609 1.00 17.60  ? 41   GLU B CG  1 
ATOM   3428 C  CD  . GLU C 1 38  ? 22.415 80.552  57.173 1.00 17.82  ? 41   GLU B CD  1 
ATOM   3429 O  OE1 . GLU C 1 38  ? 21.238 80.801  56.879 1.00 21.24  ? 41   GLU B OE1 1 
ATOM   3430 O  OE2 . GLU C 1 38  ? 23.268 80.356  56.308 1.00 25.06  ? 41   GLU B OE2 1 
ATOM   3431 N  N   . VAL C 1 39  ? 22.825 82.698  62.966 1.00 14.42  ? 42   VAL B N   1 
ATOM   3432 C  CA  . VAL C 1 39  ? 22.727 83.779  63.919 1.00 14.77  ? 42   VAL B CA  1 
ATOM   3433 C  C   . VAL C 1 39  ? 23.832 84.813  63.978 1.00 13.19  ? 42   VAL B C   1 
ATOM   3434 O  O   . VAL C 1 39  ? 23.644 85.889  64.511 1.00 15.00  ? 42   VAL B O   1 
ATOM   3435 C  CB  . VAL C 1 39  ? 22.618 83.164  65.359 1.00 21.43  ? 42   VAL B CB  1 
ATOM   3436 C  CG1 . VAL C 1 39  ? 21.439 82.225  65.432 1.00 16.69  ? 42   VAL B CG1 1 
ATOM   3437 C  CG2 . VAL C 1 39  ? 23.934 82.402  65.742 1.00 23.64  ? 42   VAL B CG2 1 
ATOM   3438 N  N   . TRP C 1 40  ? 25.023 84.408  63.598 1.00 14.45  ? 43   TRP B N   1 
ATOM   3439 C  CA  . TRP C 1 40  ? 26.192 85.282  63.630 1.00 20.78  ? 43   TRP B CA  1 
ATOM   3440 C  C   . TRP C 1 40  ? 26.061 86.644  62.950 1.00 22.54  ? 43   TRP B C   1 
ATOM   3441 O  O   . TRP C 1 40  ? 26.741 87.576  63.320 1.00 22.45  ? 43   TRP B O   1 
ATOM   3442 C  CB  . TRP C 1 40  ? 27.413 84.548  63.077 1.00 16.02  ? 43   TRP B CB  1 
ATOM   3443 C  CG  . TRP C 1 40  ? 27.184 83.663  61.851 1.00 23.50  ? 43   TRP B CG  1 
ATOM   3444 C  CD1 . TRP C 1 40  ? 27.404 83.996  60.543 1.00 16.39  ? 43   TRP B CD1 1 
ATOM   3445 C  CD2 . TRP C 1 40  ? 26.725 82.290  61.845 1.00 19.85  ? 43   TRP B CD2 1 
ATOM   3446 N  NE1 . TRP C 1 40  ? 27.098 82.925  59.731 1.00 25.33  ? 43   TRP B NE1 1 
ATOM   3447 C  CE2 . TRP C 1 40  ? 26.685 81.868  60.503 1.00 24.79  ? 43   TRP B CE2 1 
ATOM   3448 C  CE3 . TRP C 1 40  ? 26.343 81.388  62.844 1.00 26.06  ? 43   TRP B CE3 1 
ATOM   3449 C  CZ2 . TRP C 1 40  ? 26.273 80.578  60.131 1.00 29.26  ? 43   TRP B CZ2 1 
ATOM   3450 C  CZ3 . TRP C 1 40  ? 25.932 80.117  62.476 1.00 19.59  ? 43   TRP B CZ3 1 
ATOM   3451 C  CH2 . TRP C 1 40  ? 25.902 79.724  61.124 1.00 23.89  ? 43   TRP B CH2 1 
ATOM   3452 N  N   . PHE C 1 41  ? 25.209 86.745  61.944 1.00 22.66  ? 44   PHE B N   1 
ATOM   3453 C  CA  . PHE C 1 41  ? 24.997 87.991  61.232 1.00 16.11  ? 44   PHE B CA  1 
ATOM   3454 C  C   . PHE C 1 41  ? 24.116 88.975  61.989 1.00 19.74  ? 44   PHE B C   1 
ATOM   3455 O  O   . PHE C 1 41  ? 24.193 90.184  61.762 1.00 17.36  ? 44   PHE B O   1 
ATOM   3456 C  CB  . PHE C 1 41  ? 24.251 87.681  59.947 1.00 14.88  ? 44   PHE B CB  1 
ATOM   3457 C  CG  . PHE C 1 41  ? 25.056 86.919  58.971 1.00 18.78  ? 44   PHE B CG  1 
ATOM   3458 C  CD1 . PHE C 1 41  ? 24.688 85.635  58.611 1.00 19.12  ? 44   PHE B CD1 1 
ATOM   3459 C  CD2 . PHE C 1 41  ? 26.200 87.485  58.393 1.00 19.81  ? 44   PHE B CD2 1 
ATOM   3460 C  CE1 . PHE C 1 41  ? 25.435 84.909  57.676 1.00 14.64  ? 44   PHE B CE1 1 
ATOM   3461 C  CE2 . PHE C 1 41  ? 26.960 86.760  57.457 1.00 22.14  ? 44   PHE B CE2 1 
ATOM   3462 C  CZ  . PHE C 1 41  ? 26.563 85.462  57.099 1.00 20.14  ? 44   PHE B CZ  1 
ATOM   3463 N  N   . PHE C 1 42  ? 23.304 88.460  62.905 1.00 17.56  ? 45   PHE B N   1 
ATOM   3464 C  CA  . PHE C 1 42  ? 22.329 89.268  63.608 1.00 16.63  ? 45   PHE B CA  1 
ATOM   3465 C  C   . PHE C 1 42  ? 22.558 89.851  64.985 1.00 19.95  ? 45   PHE B C   1 
ATOM   3466 O  O   . PHE C 1 42  ? 23.398 89.401  65.774 1.00 16.24  ? 45   PHE B O   1 
ATOM   3467 C  CB  . PHE C 1 42  ? 20.997 88.536  63.602 1.00 16.03  ? 45   PHE B CB  1 
ATOM   3468 C  CG  . PHE C 1 42  ? 20.545 88.177  62.245 1.00 12.73  ? 45   PHE B CG  1 
ATOM   3469 C  CD1 . PHE C 1 42  ? 20.972 86.995  61.661 1.00 12.93  ? 45   PHE B CD1 1 
ATOM   3470 C  CD2 . PHE C 1 42  ? 19.729 89.044  61.526 1.00 12.51  ? 45   PHE B CD2 1 
ATOM   3471 C  CE1 . PHE C 1 42  ? 20.594 86.652  60.351 1.00 18.83  ? 45   PHE B CE1 1 
ATOM   3472 C  CE2 . PHE C 1 42  ? 19.345 88.729  60.223 1.00 15.46  ? 45   PHE B CE2 1 
ATOM   3473 C  CZ  . PHE C 1 42  ? 19.771 87.525  59.619 1.00 16.22  ? 45   PHE B CZ  1 
ATOM   3474 N  N   . GLY C 1 43  ? 21.702 90.802  65.311 1.00 15.63  ? 46   GLY B N   1 
ATOM   3475 C  CA  . GLY C 1 43  ? 21.781 91.439  66.600 1.00 15.36  ? 46   GLY B CA  1 
ATOM   3476 C  C   . GLY C 1 43  ? 20.456 92.074  66.957 1.00 24.01  ? 46   GLY B C   1 
ATOM   3477 O  O   . GLY C 1 43  ? 19.545 92.116  66.125 1.00 22.95  ? 46   GLY B O   1 
ATOM   3478 N  N   . LEU C 1 44  ? 20.325 92.542  68.196 1.00 19.46  ? 47   LEU B N   1 
ATOM   3479 C  CA  . LEU C 1 44  ? 19.100 93.207  68.649 1.00 26.56  ? 47   LEU B CA  1 
ATOM   3480 C  C   . LEU C 1 44  ? 19.424 94.688  68.904 1.00 27.51  ? 47   LEU B C   1 
ATOM   3481 O  O   . LEU C 1 44  ? 20.330 95.028  69.674 1.00 30.16  ? 47   LEU B O   1 
ATOM   3482 C  CB  . LEU C 1 44  ? 18.561 92.559  69.929 1.00 26.08  ? 47   LEU B CB  1 
ATOM   3483 C  CG  . LEU C 1 44  ? 17.814 91.237  69.787 1.00 22.64  ? 47   LEU B CG  1 
ATOM   3484 C  CD1 . LEU C 1 44  ? 17.685 90.550  71.176 1.00 20.54  ? 47   LEU B CD1 1 
ATOM   3485 C  CD2 . LEU C 1 44  ? 16.466 91.524  69.137 1.00 16.67  ? 47   LEU B CD2 1 
ATOM   3486 N  N   . GLN C 1 45  ? 18.697 95.575  68.250 1.00 23.21  ? 48   GLN B N   1 
ATOM   3487 C  CA  . GLN C 1 45  ? 18.952 96.988  68.401 1.00 27.03  ? 48   GLN B CA  1 
ATOM   3488 C  C   . GLN C 1 45  ? 17.855 97.612  69.236 1.00 25.87  ? 48   GLN B C   1 
ATOM   3489 O  O   . GLN C 1 45  ? 16.728 97.164  69.199 1.00 21.86  ? 48   GLN B O   1 
ATOM   3490 C  CB  . GLN C 1 45  ? 18.936 97.622  67.017 1.00 31.81  ? 48   GLN B CB  1 
ATOM   3491 C  CG  . GLN C 1 45  ? 19.415 99.045  66.952 1.00 36.80  ? 48   GLN B CG  1 
ATOM   3492 C  CD  . GLN C 1 45  ? 20.334 99.276  65.761 1.00 45.51  ? 48   GLN B CD  1 
ATOM   3493 O  OE1 . GLN C 1 45  ? 21.521 99.658  65.915 1.00 45.24  ? 48   GLN B OE1 1 
ATOM   3494 N  NE2 . GLN C 1 45  ? 19.805 99.026  64.562 1.00 38.62  ? 48   GLN B NE2 1 
ATOM   3495 N  N   . TYR C 1 46  ? 18.185 98.647  69.997 1.00 28.63  ? 49   TYR B N   1 
ATOM   3496 C  CA  . TYR C 1 46  ? 17.183 99.311  70.816 1.00 25.25  ? 49   TYR B CA  1 
ATOM   3497 C  C   . TYR C 1 46  ? 17.514 100.795 70.852 1.00 29.13  ? 49   TYR B C   1 
ATOM   3498 O  O   . TYR C 1 46  ? 18.565 101.207 70.394 1.00 24.99  ? 49   TYR B O   1 
ATOM   3499 C  CB  . TYR C 1 46  ? 17.175 98.737  72.237 1.00 22.55  ? 49   TYR B CB  1 
ATOM   3500 C  CG  . TYR C 1 46  ? 18.420 99.030  73.050 1.00 26.35  ? 49   TYR B CG  1 
ATOM   3501 C  CD1 . TYR C 1 46  ? 19.499 98.138  73.062 1.00 27.09  ? 49   TYR B CD1 1 
ATOM   3502 C  CD2 . TYR C 1 46  ? 18.501 100.181 73.864 1.00 30.56  ? 49   TYR B CD2 1 
ATOM   3503 C  CE1 . TYR C 1 46  ? 20.619 98.374  73.865 1.00 31.21  ? 49   TYR B CE1 1 
ATOM   3504 C  CE2 . TYR C 1 46  ? 19.624 100.426 74.679 1.00 35.22  ? 49   TYR B CE2 1 
ATOM   3505 C  CZ  . TYR C 1 46  ? 20.671 99.516  74.674 1.00 27.76  ? 49   TYR B CZ  1 
ATOM   3506 O  OH  . TYR C 1 46  ? 21.747 99.714  75.488 1.00 44.82  ? 49   TYR B OH  1 
ATOM   3507 N  N   . GLN C 1 47  ? 16.572 101.601 71.321 1.00 32.34  ? 50   GLN B N   1 
ATOM   3508 C  CA  . GLN C 1 47  ? 16.786 103.028 71.471 1.00 29.63  ? 50   GLN B CA  1 
ATOM   3509 C  C   . GLN C 1 47  ? 17.128 103.239 72.932 1.00 30.95  ? 50   GLN B C   1 
ATOM   3510 O  O   . GLN C 1 47  ? 16.333 102.902 73.810 1.00 33.05  ? 50   GLN B O   1 
ATOM   3511 C  CB  . GLN C 1 47  ? 15.494 103.772 71.131 1.00 35.91  ? 50   GLN B CB  1 
ATOM   3512 C  CG  . GLN C 1 47  ? 15.123 103.686 69.668 1.00 43.55  ? 50   GLN B CG  1 
ATOM   3513 C  CD  . GLN C 1 47  ? 16.238 104.238 68.778 1.00 51.97  ? 50   GLN B CD  1 
ATOM   3514 O  OE1 . GLN C 1 47  ? 16.780 103.529 67.916 1.00 43.86  ? 50   GLN B OE1 1 
ATOM   3515 N  NE2 . GLN C 1 47  ? 16.610 105.502 69.010 1.00 53.07  ? 50   GLN B NE2 1 
ATOM   3516 N  N   . ASP C 1 48  ? 18.324 103.732 73.231 1.00 35.65  ? 51   ASP B N   1 
ATOM   3517 C  CA  . ASP C 1 48  ? 18.640 103.937 74.642 1.00 41.63  ? 51   ASP B CA  1 
ATOM   3518 C  C   . ASP C 1 48  ? 17.934 105.163 75.281 1.00 43.83  ? 51   ASP B C   1 
ATOM   3519 O  O   . ASP C 1 48  ? 17.152 105.858 74.611 1.00 38.19  ? 51   ASP B O   1 
ATOM   3520 C  CB  . ASP C 1 48  ? 20.151 103.906 74.900 1.00 41.70  ? 51   ASP B CB  1 
ATOM   3521 C  CG  . ASP C 1 48  ? 20.837 105.159 74.488 1.00 42.74  ? 51   ASP B CG  1 
ATOM   3522 O  OD1 . ASP C 1 48  ? 20.120 106.114 74.147 1.00 39.73  ? 51   ASP B OD1 1 
ATOM   3523 O  OD2 . ASP C 1 48  ? 22.095 105.191 74.508 1.00 49.69  ? 51   ASP B OD2 1 
ATOM   3524 N  N   . THR C 1 49  ? 18.238 105.408 76.563 1.00 49.78  ? 52   THR B N   1 
ATOM   3525 C  CA  . THR C 1 49  ? 17.686 106.515 77.372 1.00 49.63  ? 52   THR B CA  1 
ATOM   3526 C  C   . THR C 1 49  ? 17.911 107.845 76.671 1.00 51.04  ? 52   THR B C   1 
ATOM   3527 O  O   . THR C 1 49  ? 17.013 108.686 76.591 1.00 50.53  ? 52   THR B O   1 
ATOM   3528 C  CB  . THR C 1 49  ? 18.382 106.632 78.780 1.00 47.92  ? 52   THR B CB  1 
ATOM   3529 O  OG1 . THR C 1 49  ? 19.811 106.604 78.612 1.00 56.15  ? 52   THR B OG1 1 
ATOM   3530 C  CG2 . THR C 1 49  ? 17.940 105.506 79.744 1.00 42.48  ? 52   THR B CG2 1 
ATOM   3531 N  N   . LYS C 1 50  ? 19.126 107.990 76.141 1.00 50.63  ? 53   LYS B N   1 
ATOM   3532 C  CA  . LYS C 1 50  ? 19.568 109.186 75.431 1.00 51.53  ? 53   LYS B CA  1 
ATOM   3533 C  C   . LYS C 1 50  ? 18.925 109.305 74.037 1.00 52.16  ? 53   LYS B C   1 
ATOM   3534 O  O   . LYS C 1 50  ? 18.969 110.376 73.426 1.00 56.79  ? 53   LYS B O   1 
ATOM   3535 C  CB  . LYS C 1 50  ? 21.096 109.171 75.263 1.00 57.97  ? 53   LYS B CB  1 
ATOM   3536 C  CG  . LYS C 1 50  ? 21.914 108.441 76.355 1.00 66.06  ? 53   LYS B CG  1 
ATOM   3537 C  CD  . LYS C 1 50  ? 22.194 109.313 77.584 1.00 69.34  ? 53   LYS B CD  1 
ATOM   3538 C  CE  . LYS C 1 50  ? 23.577 109.979 77.536 1.00 69.34  ? 53   LYS B CE  1 
ATOM   3539 N  NZ  . LYS C 1 50  ? 23.760 111.005 76.456 1.00 68.12  ? 53   LYS B NZ  1 
ATOM   3540 N  N   . GLY C 1 51  ? 18.336 108.216 73.536 1.00 47.50  ? 54   GLY B N   1 
ATOM   3541 C  CA  . GLY C 1 51  ? 17.736 108.221 72.204 1.00 42.03  ? 54   GLY B CA  1 
ATOM   3542 C  C   . GLY C 1 51  ? 18.629 107.646 71.075 1.00 44.55  ? 54   GLY B C   1 
ATOM   3543 O  O   . GLY C 1 51  ? 18.348 107.797 69.882 1.00 39.50  ? 54   GLY B O   1 
ATOM   3544 N  N   . PHE C 1 52  ? 19.719 106.980 71.443 1.00 43.73  ? 55   PHE B N   1 
ATOM   3545 C  CA  . PHE C 1 52  ? 20.635 106.399 70.459 1.00 43.76  ? 55   PHE B CA  1 
ATOM   3546 C  C   . PHE C 1 52  ? 20.329 104.934 70.108 1.00 42.95  ? 55   PHE B C   1 
ATOM   3547 O  O   . PHE C 1 52  ? 19.936 104.154 70.976 1.00 34.23  ? 55   PHE B O   1 
ATOM   3548 C  CB  . PHE C 1 52  ? 22.092 106.526 70.949 1.00 37.81  ? 55   PHE B CB  1 
ATOM   3549 C  CG  . PHE C 1 52  ? 22.559 107.954 71.121 1.00 45.52  ? 55   PHE B CG  1 
ATOM   3550 C  CD1 . PHE C 1 52  ? 22.482 108.586 72.364 1.00 39.19  ? 55   PHE B CD1 1 
ATOM   3551 C  CD2 . PHE C 1 52  ? 23.064 108.677 70.032 1.00 46.84  ? 55   PHE B CD2 1 
ATOM   3552 C  CE1 . PHE C 1 52  ? 22.897 109.913 72.517 1.00 41.11  ? 55   PHE B CE1 1 
ATOM   3553 C  CE2 . PHE C 1 52  ? 23.482 110.015 70.182 1.00 43.07  ? 55   PHE B CE2 1 
ATOM   3554 C  CZ  . PHE C 1 52  ? 23.395 110.628 71.427 1.00 42.55  ? 55   PHE B CZ  1 
ATOM   3555 N  N   . SER C 1 53  ? 20.463 104.590 68.818 1.00 42.50  ? 56   SER B N   1 
ATOM   3556 C  CA  . SER C 1 53  ? 20.272 103.218 68.360 1.00 39.56  ? 56   SER B CA  1 
ATOM   3557 C  C   . SER C 1 53  ? 21.503 102.498 68.881 1.00 38.24  ? 56   SER B C   1 
ATOM   3558 O  O   . SER C 1 53  ? 22.633 102.941 68.659 1.00 41.68  ? 56   SER B O   1 
ATOM   3559 C  CB  . SER C 1 53  ? 20.167 103.142 66.842 1.00 36.87  ? 56   SER B CB  1 
ATOM   3560 O  OG  . SER C 1 53  ? 18.888 103.601 66.435 1.00 38.93  ? 56   SER B OG  1 
ATOM   3561 N  N   . THR C 1 54  ? 21.266 101.414 69.615 1.00 31.15  ? 57   THR B N   1 
ATOM   3562 C  CA  . THR C 1 54  ? 22.331 100.683 70.259 1.00 26.85  ? 57   THR B CA  1 
ATOM   3563 C  C   . THR C 1 54  ? 22.149 99.165  70.129 1.00 27.36  ? 57   THR B C   1 
ATOM   3564 O  O   . THR C 1 54  ? 21.024 98.640  70.159 1.00 19.76  ? 57   THR B O   1 
ATOM   3565 C  CB  . THR C 1 54  ? 22.353 101.089 71.782 1.00 24.31  ? 57   THR B CB  1 
ATOM   3566 O  OG1 . THR C 1 54  ? 22.309 102.519 71.912 1.00 27.89  ? 57   THR B OG1 1 
ATOM   3567 C  CG2 . THR C 1 54  ? 23.582 100.564 72.467 1.00 23.37  ? 57   THR B CG2 1 
ATOM   3568 N  N   . TRP C 1 55  ? 23.260 98.462  69.923 1.00 24.31  ? 58   TRP B N   1 
ATOM   3569 C  CA  . TRP C 1 55  ? 23.180 97.009  69.893 1.00 26.44  ? 58   TRP B CA  1 
ATOM   3570 C  C   . TRP C 1 55  ? 23.249 96.507  71.355 1.00 28.50  ? 58   TRP B C   1 
ATOM   3571 O  O   . TRP C 1 55  ? 24.086 96.935  72.153 1.00 26.52  ? 58   TRP B O   1 
ATOM   3572 C  CB  . TRP C 1 55  ? 24.309 96.385  69.074 1.00 23.77  ? 58   TRP B CB  1 
ATOM   3573 C  CG  . TRP C 1 55  ? 24.296 96.743  67.604 1.00 24.97  ? 58   TRP B CG  1 
ATOM   3574 C  CD1 . TRP C 1 55  ? 25.137 97.619  66.968 1.00 23.46  ? 58   TRP B CD1 1 
ATOM   3575 C  CD2 . TRP C 1 55  ? 23.433 96.202  66.589 1.00 23.05  ? 58   TRP B CD2 1 
ATOM   3576 N  NE1 . TRP C 1 55  ? 24.862 97.644  65.620 1.00 23.65  ? 58   TRP B NE1 1 
ATOM   3577 C  CE2 . TRP C 1 55  ? 23.818 96.793  65.356 1.00 20.08  ? 58   TRP B CE2 1 
ATOM   3578 C  CE3 . TRP C 1 55  ? 22.368 95.285  66.600 1.00 19.65  ? 58   TRP B CE3 1 
ATOM   3579 C  CZ2 . TRP C 1 55  ? 23.179 96.503  64.151 1.00 11.67  ? 58   TRP B CZ2 1 
ATOM   3580 C  CZ3 . TRP C 1 55  ? 21.721 94.991  65.373 1.00 19.34  ? 58   TRP B CZ3 1 
ATOM   3581 C  CH2 . TRP C 1 55  ? 22.136 95.605  64.174 1.00 20.99  ? 58   TRP B CH2 1 
ATOM   3582 N  N   . LEU C 1 56  ? 22.301 95.661  71.717 1.00 25.83  ? 59   LEU B N   1 
ATOM   3583 C  CA  . LEU C 1 56  ? 22.232 95.072  73.042 1.00 28.81  ? 59   LEU B CA  1 
ATOM   3584 C  C   . LEU C 1 56  ? 23.453 94.142  73.228 1.00 32.96  ? 59   LEU B C   1 
ATOM   3585 O  O   . LEU C 1 56  ? 23.701 93.257  72.396 1.00 35.94  ? 59   LEU B O   1 
ATOM   3586 C  CB  . LEU C 1 56  ? 20.947 94.240  73.121 1.00 27.04  ? 59   LEU B CB  1 
ATOM   3587 C  CG  . LEU C 1 56  ? 20.499 93.586  74.419 1.00 27.48  ? 59   LEU B CG  1 
ATOM   3588 C  CD1 . LEU C 1 56  ? 19.596 94.517  75.161 1.00 23.73  ? 59   LEU B CD1 1 
ATOM   3589 C  CD2 . LEU C 1 56  ? 19.772 92.308  74.074 1.00 25.60  ? 59   LEU B CD2 1 
ATOM   3590 N  N   . LYS C 1 57  ? 24.230 94.351  74.292 1.00 34.78  ? 60   LYS B N   1 
ATOM   3591 C  CA  . LYS C 1 57  ? 25.378 93.483  74.564 1.00 34.40  ? 60   LYS B CA  1 
ATOM   3592 C  C   . LYS C 1 57  ? 24.761 92.153  74.988 1.00 30.83  ? 60   LYS B C   1 
ATOM   3593 O  O   . LYS C 1 57  ? 23.760 92.124  75.704 1.00 33.47  ? 60   LYS B O   1 
ATOM   3594 C  CB  . LYS C 1 57  ? 26.237 94.067  75.685 1.00 31.62  ? 60   LYS B CB  1 
ATOM   3595 C  CG  . LYS C 1 57  ? 26.689 95.485  75.381 1.00 43.79  ? 60   LYS B CG  1 
ATOM   3596 C  CD  . LYS C 1 57  ? 27.512 95.533  74.077 1.00 52.84  ? 60   LYS B CD  1 
ATOM   3597 C  CE  . LYS C 1 57  ? 27.659 96.937  73.502 1.00 51.73  ? 60   LYS B CE  1 
ATOM   3598 N  NZ  . LYS C 1 57  ? 26.390 97.453  72.892 1.00 47.70  ? 60   LYS B NZ  1 
ATOM   3599 N  N   . LEU C 1 58  ? 25.329 91.054  74.512 1.00 33.72  ? 61   LEU B N   1 
ATOM   3600 C  CA  . LEU C 1 58  ? 24.804 89.737  74.845 1.00 36.87  ? 61   LEU B CA  1 
ATOM   3601 C  C   . LEU C 1 58  ? 25.242 89.138  76.193 1.00 40.39  ? 61   LEU B C   1 
ATOM   3602 O  O   . LEU C 1 58  ? 24.532 88.324  76.785 1.00 39.00  ? 61   LEU B O   1 
ATOM   3603 C  CB  . LEU C 1 58  ? 25.143 88.805  73.704 1.00 42.98  ? 61   LEU B CB  1 
ATOM   3604 C  CG  . LEU C 1 58  ? 24.532 89.298  72.387 1.00 44.17  ? 61   LEU B CG  1 
ATOM   3605 C  CD1 . LEU C 1 58  ? 25.076 88.454  71.271 1.00 43.41  ? 61   LEU B CD1 1 
ATOM   3606 C  CD2 . LEU C 1 58  ? 22.975 89.253  72.418 1.00 39.47  ? 61   LEU B CD2 1 
ATOM   3607 N  N   . ASN C 1 59  ? 26.423 89.545  76.650 1.00 44.56  ? 62   ASN B N   1 
ATOM   3608 C  CA  . ASN C 1 59  ? 27.046 89.108  77.909 1.00 48.11  ? 62   ASN B CA  1 
ATOM   3609 C  C   . ASN C 1 59  ? 26.456 89.759  79.193 1.00 49.71  ? 62   ASN B C   1 
ATOM   3610 O  O   . ASN C 1 59  ? 26.608 89.217  80.285 1.00 53.46  ? 62   ASN B O   1 
ATOM   3611 C  CB  . ASN C 1 59  ? 28.570 89.369  77.824 1.00 54.36  ? 62   ASN B CB  1 
ATOM   3612 C  CG  . ASN C 1 59  ? 28.917 90.735  77.140 1.00 64.73  ? 62   ASN B CG  1 
ATOM   3613 O  OD1 . ASN C 1 59  ? 28.765 90.899  75.915 1.00 66.92  ? 62   ASN B OD1 1 
ATOM   3614 N  ND2 . ASN C 1 59  ? 29.376 91.705  77.935 1.00 62.78  ? 62   ASN B ND2 1 
ATOM   3615 N  N   . LYS C 1 60  ? 25.793 90.912  79.048 1.00 46.24  ? 63   LYS B N   1 
ATOM   3616 C  CA  . LYS C 1 60  ? 25.181 91.649  80.148 1.00 43.59  ? 63   LYS B CA  1 
ATOM   3617 C  C   . LYS C 1 60  ? 23.689 91.378  80.273 1.00 47.53  ? 63   LYS B C   1 
ATOM   3618 O  O   . LYS C 1 60  ? 23.061 90.878  79.340 1.00 51.73  ? 63   LYS B O   1 
ATOM   3619 C  CB  . LYS C 1 60  ? 25.326 93.165  79.903 1.00 51.39  ? 63   LYS B CB  1 
ATOM   3620 C  CG  . LYS C 1 60  ? 26.532 93.884  80.539 1.00 64.70  ? 63   LYS B CG  1 
ATOM   3621 C  CD  . LYS C 1 60  ? 27.869 93.488  79.906 1.00 69.45  ? 63   LYS B CD  1 
ATOM   3622 C  CE  . LYS C 1 60  ? 29.062 94.201  80.550 1.00 67.56  ? 63   LYS B CE  1 
ATOM   3623 N  NZ  . LYS C 1 60  ? 29.334 93.743  81.943 1.00 76.86  ? 63   LYS B NZ  1 
ATOM   3624 N  N   . LYS C 1 61  ? 23.111 91.781  81.407 1.00 50.54  ? 64   LYS B N   1 
ATOM   3625 C  CA  . LYS C 1 61  ? 21.660 91.649  81.663 1.00 49.43  ? 64   LYS B CA  1 
ATOM   3626 C  C   . LYS C 1 61  ? 20.942 92.696  80.788 1.00 44.40  ? 64   LYS B C   1 
ATOM   3627 O  O   . LYS C 1 61  ? 21.496 93.758  80.517 1.00 44.67  ? 64   LYS B O   1 
ATOM   3628 C  CB  . LYS C 1 61  ? 21.350 91.932  83.165 1.00 48.27  ? 64   LYS B CB  1 
ATOM   3629 N  N   . VAL C 1 62  ? 19.700 92.443  80.392 1.00 45.15  ? 65   VAL B N   1 
ATOM   3630 C  CA  . VAL C 1 62  ? 18.966 93.407  79.551 1.00 45.85  ? 65   VAL B CA  1 
ATOM   3631 C  C   . VAL C 1 62  ? 18.624 94.660  80.359 1.00 48.22  ? 65   VAL B C   1 
ATOM   3632 O  O   . VAL C 1 62  ? 18.614 95.785  79.840 1.00 43.66  ? 65   VAL B O   1 
ATOM   3633 C  CB  . VAL C 1 62  ? 17.620 92.827  79.024 1.00 37.60  ? 65   VAL B CB  1 
ATOM   3634 C  CG1 . VAL C 1 62  ? 16.887 93.859  78.163 1.00 39.16  ? 65   VAL B CG1 1 
ATOM   3635 C  CG2 . VAL C 1 62  ? 17.840 91.546  78.263 1.00 36.49  ? 65   VAL B CG2 1 
ATOM   3636 N  N   . THR C 1 63  ? 18.269 94.438  81.621 1.00 56.57  ? 66   THR B N   1 
ATOM   3637 C  CA  . THR C 1 63  ? 17.902 95.526  82.523 1.00 58.73  ? 66   THR B CA  1 
ATOM   3638 C  C   . THR C 1 63  ? 19.086 96.431  82.904 1.00 55.29  ? 66   THR B C   1 
ATOM   3639 O  O   . THR C 1 63  ? 18.923 97.644  83.082 1.00 50.09  ? 66   THR B O   1 
ATOM   3640 C  CB  . THR C 1 63  ? 17.138 94.988  83.751 1.00 61.49  ? 66   THR B CB  1 
ATOM   3641 O  OG1 . THR C 1 63  ? 17.819 93.841  84.285 1.00 68.41  ? 66   THR B OG1 1 
ATOM   3642 C  CG2 . THR C 1 63  ? 15.732 94.584  83.331 1.00 60.95  ? 66   THR B CG2 1 
ATOM   3643 N  N   . ALA C 1 64  ? 20.289 95.860  82.918 1.00 55.20  ? 67   ALA B N   1 
ATOM   3644 C  CA  . ALA C 1 64  ? 21.498 96.621  83.244 1.00 52.68  ? 67   ALA B CA  1 
ATOM   3645 C  C   . ALA C 1 64  ? 22.021 97.490  82.077 1.00 51.56  ? 67   ALA B C   1 
ATOM   3646 O  O   . ALA C 1 64  ? 23.049 98.151  82.215 1.00 53.51  ? 67   ALA B O   1 
ATOM   3647 C  CB  . ALA C 1 64  ? 22.596 95.681  83.781 1.00 57.92  ? 67   ALA B CB  1 
ATOM   3648 N  N   . GLN C 1 65  ? 21.348 97.459  80.921 1.00 47.62  ? 68   GLN B N   1 
ATOM   3649 C  CA  . GLN C 1 65  ? 21.758 98.279  79.768 1.00 46.60  ? 68   GLN B CA  1 
ATOM   3650 C  C   . GLN C 1 65  ? 20.817 99.472  79.751 1.00 48.29  ? 68   GLN B C   1 
ATOM   3651 O  O   . GLN C 1 65  ? 19.742 99.403  80.351 1.00 48.86  ? 68   GLN B O   1 
ATOM   3652 C  CB  . GLN C 1 65  ? 21.724 97.483  78.464 1.00 41.08  ? 68   GLN B CB  1 
ATOM   3653 C  CG  . GLN C 1 65  ? 22.250 96.058  78.682 1.00 40.49  ? 68   GLN B CG  1 
ATOM   3654 C  CD  . GLN C 1 65  ? 22.631 95.322  77.421 1.00 32.61  ? 68   GLN B CD  1 
ATOM   3655 O  OE1 . GLN C 1 65  ? 23.188 95.913  76.494 1.00 34.25  ? 68   GLN B OE1 1 
ATOM   3656 N  NE2 . GLN C 1 65  ? 22.397 93.999  77.408 1.00 27.36  ? 68   GLN B NE2 1 
ATOM   3657 N  N   . ASP C 1 66  ? 21.204 100.562 79.093 1.00 49.81  ? 69   ASP B N   1 
ATOM   3658 C  CA  . ASP C 1 66  ? 20.376 101.763 79.133 1.00 49.36  ? 69   ASP B CA  1 
ATOM   3659 C  C   . ASP C 1 66  ? 19.124 101.736 78.291 1.00 51.67  ? 69   ASP B C   1 
ATOM   3660 O  O   . ASP C 1 66  ? 18.797 102.714 77.636 1.00 51.59  ? 69   ASP B O   1 
ATOM   3661 C  CB  . ASP C 1 66  ? 21.211 103.043 78.850 1.00 46.97  ? 69   ASP B CB  1 
ATOM   3662 N  N   . VAL C 1 67  ? 18.384 100.632 78.365 1.00 55.36  ? 70   VAL B N   1 
ATOM   3663 C  CA  . VAL C 1 67  ? 17.135 100.485 77.630 1.00 53.67  ? 70   VAL B CA  1 
ATOM   3664 C  C   . VAL C 1 67  ? 16.110 101.520 78.086 1.00 56.15  ? 70   VAL B C   1 
ATOM   3665 O  O   . VAL C 1 67  ? 15.891 101.725 79.293 1.00 54.68  ? 70   VAL B O   1 
ATOM   3666 C  CB  . VAL C 1 67  ? 16.523 99.085  77.812 1.00 53.07  ? 70   VAL B CB  1 
ATOM   3667 C  CG1 . VAL C 1 67  ? 17.317 98.066  77.025 1.00 47.66  ? 70   VAL B CG1 1 
ATOM   3668 C  CG2 . VAL C 1 67  ? 16.479 98.716  79.312 1.00 55.72  ? 70   VAL B CG2 1 
ATOM   3669 N  N   . ARG C 1 68  ? 15.515 102.175 77.091 1.00 56.82  ? 71   ARG B N   1 
ATOM   3670 C  CA  . ARG C 1 68  ? 14.501 103.205 77.268 1.00 57.78  ? 71   ARG B CA  1 
ATOM   3671 C  C   . ARG C 1 68  ? 13.350 102.665 78.122 1.00 61.35  ? 71   ARG B C   1 
ATOM   3672 O  O   . ARG C 1 68  ? 12.419 102.047 77.599 1.00 62.44  ? 71   ARG B O   1 
ATOM   3673 C  CB  . ARG C 1 68  ? 14.005 103.629 75.885 1.00 57.44  ? 71   ARG B CB  1 
ATOM   3674 C  CG  . ARG C 1 68  ? 13.477 105.015 75.785 1.00 62.01  ? 71   ARG B CG  1 
ATOM   3675 C  CD  . ARG C 1 68  ? 13.037 105.356 74.358 1.00 64.95  ? 71   ARG B CD  1 
ATOM   3676 N  NE  . ARG C 1 68  ? 12.470 106.700 74.313 1.00 73.75  ? 71   ARG B NE  1 
ATOM   3677 C  CZ  . ARG C 1 68  ? 13.169 107.822 74.503 1.00 81.15  ? 71   ARG B CZ  1 
ATOM   3678 N  NH1 . ARG C 1 68  ? 14.483 107.786 74.733 1.00 80.69  ? 71   ARG B NH1 1 
ATOM   3679 N  NH2 . ARG C 1 68  ? 12.535 108.987 74.563 1.00 80.42  ? 71   ARG B NH2 1 
ATOM   3680 N  N   . LYS C 1 69  ? 13.449 102.870 79.441 1.00 66.01  ? 72   LYS B N   1 
ATOM   3681 C  CA  . LYS C 1 69  ? 12.437 102.405 80.391 1.00 62.56  ? 72   LYS B CA  1 
ATOM   3682 C  C   . LYS C 1 69  ? 11.049 102.738 79.868 1.00 62.86  ? 72   LYS B C   1 
ATOM   3683 O  O   . LYS C 1 69  ? 10.691 103.904 79.672 1.00 61.47  ? 72   LYS B O   1 
ATOM   3684 C  CB  . LYS C 1 69  ? 12.647 103.020 81.768 1.00 61.77  ? 72   LYS B CB  1 
ATOM   3685 N  N   . GLU C 1 70  ? 10.353 101.676 79.483 1.00 66.21  ? 73   GLU B N   1 
ATOM   3686 C  CA  . GLU C 1 70  ? 8.984  101.726 78.973 1.00 62.77  ? 73   GLU B CA  1 
ATOM   3687 C  C   . GLU C 1 70  ? 8.502  100.286 78.907 1.00 57.65  ? 73   GLU B C   1 
ATOM   3688 O  O   . GLU C 1 70  ? 9.264  99.360  79.198 1.00 60.13  ? 73   GLU B O   1 
ATOM   3689 C  CB  . GLU C 1 70  ? 8.911  102.370 77.581 1.00 65.87  ? 73   GLU B CB  1 
ATOM   3690 C  CG  . GLU C 1 70  ? 9.555  101.538 76.477 1.00 72.66  ? 73   GLU B CG  1 
ATOM   3691 C  CD  . GLU C 1 70  ? 9.298  102.095 75.086 1.00 75.03  ? 73   GLU B CD  1 
ATOM   3692 O  OE1 . GLU C 1 70  ? 10.190 102.796 74.552 1.00 74.26  ? 73   GLU B OE1 1 
ATOM   3693 O  OE2 . GLU C 1 70  ? 8.208  101.819 74.525 1.00 72.02  ? 73   GLU B OE2 1 
ATOM   3694 N  N   . SER C 1 71  ? 7.261  100.081 78.499 1.00 47.08  ? 74   SER B N   1 
ATOM   3695 C  CA  . SER C 1 71  ? 6.734  98.725  78.443 1.00 47.70  ? 74   SER B CA  1 
ATOM   3696 C  C   . SER C 1 71  ? 5.711  98.548  77.302 1.00 47.73  ? 74   SER B C   1 
ATOM   3697 O  O   . SER C 1 71  ? 4.800  99.360  77.142 1.00 52.53  ? 74   SER B O   1 
ATOM   3698 C  CB  . SER C 1 71  ? 6.097  98.378  79.803 1.00 49.68  ? 74   SER B CB  1 
ATOM   3699 O  OG  . SER C 1 71  ? 5.338  97.176  79.784 1.00 48.05  ? 74   SER B OG  1 
ATOM   3700 N  N   . PRO C 1 72  ? 5.915  97.531  76.440 1.00 47.33  ? 75   PRO B N   1 
ATOM   3701 C  CA  . PRO C 1 72  ? 7.062  96.628  76.552 1.00 43.03  ? 75   PRO B CA  1 
ATOM   3702 C  C   . PRO C 1 72  ? 8.362  97.283  76.070 1.00 42.58  ? 75   PRO B C   1 
ATOM   3703 O  O   . PRO C 1 72  ? 8.362  98.412  75.555 1.00 43.08  ? 75   PRO B O   1 
ATOM   3704 C  CB  . PRO C 1 72  ? 6.651  95.464  75.640 1.00 43.24  ? 75   PRO B CB  1 
ATOM   3705 C  CG  . PRO C 1 72  ? 5.824  96.111  74.597 1.00 42.34  ? 75   PRO B CG  1 
ATOM   3706 C  CD  . PRO C 1 72  ? 4.962  97.027  75.431 1.00 45.38  ? 75   PRO B CD  1 
ATOM   3707 N  N   . LEU C 1 73  ? 9.481  96.625  76.346 1.00 37.56  ? 76   LEU B N   1 
ATOM   3708 C  CA  . LEU C 1 73  ? 10.765 97.100  75.877 1.00 35.99  ? 76   LEU B CA  1 
ATOM   3709 C  C   . LEU C 1 73  ? 10.744 96.778  74.364 1.00 36.49  ? 76   LEU B C   1 
ATOM   3710 O  O   . LEU C 1 73  ? 10.327 95.692  73.957 1.00 31.38  ? 76   LEU B O   1 
ATOM   3711 C  CB  . LEU C 1 73  ? 11.882 96.359  76.600 1.00 37.51  ? 76   LEU B CB  1 
ATOM   3712 C  CG  . LEU C 1 73  ? 12.021 96.811  78.052 1.00 37.96  ? 76   LEU B CG  1 
ATOM   3713 C  CD1 . LEU C 1 73  ? 13.261 96.153  78.653 1.00 43.96  ? 76   LEU B CD1 1 
ATOM   3714 C  CD2 . LEU C 1 73  ? 12.099 98.362  78.124 1.00 34.73  ? 76   LEU B CD2 1 
ATOM   3715 N  N   . LEU C 1 74  ? 11.123 97.751  73.542 1.00 32.78  ? 77   LEU B N   1 
ATOM   3716 C  CA  . LEU C 1 74  ? 11.111 97.554  72.120 1.00 28.16  ? 77   LEU B CA  1 
ATOM   3717 C  C   . LEU C 1 74  ? 12.476 97.310  71.522 1.00 26.72  ? 77   LEU B C   1 
ATOM   3718 O  O   . LEU C 1 74  ? 13.351 98.167  71.615 1.00 33.41  ? 77   LEU B O   1 
ATOM   3719 C  CB  . LEU C 1 74  ? 10.471 98.762  71.443 1.00 29.81  ? 77   LEU B CB  1 
ATOM   3720 C  CG  . LEU C 1 74  ? 9.049  99.163  71.890 1.00 29.99  ? 77   LEU B CG  1 
ATOM   3721 C  CD1 . LEU C 1 74  ? 8.599  100.394 71.104 1.00 27.92  ? 77   LEU B CD1 1 
ATOM   3722 C  CD2 . LEU C 1 74  ? 8.049  98.030  71.730 1.00 27.08  ? 77   LEU B CD2 1 
ATOM   3723 N  N   . PHE C 1 75  ? 12.637 96.169  70.850 1.00 23.11  ? 78   PHE B N   1 
ATOM   3724 C  CA  . PHE C 1 75  ? 13.908 95.826  70.161 1.00 25.47  ? 78   PHE B CA  1 
ATOM   3725 C  C   . PHE C 1 75  ? 13.671 95.524  68.697 1.00 22.88  ? 78   PHE B C   1 
ATOM   3726 O  O   . PHE C 1 75  ? 12.637 94.993  68.335 1.00 22.11  ? 78   PHE B O   1 
ATOM   3727 C  CB  . PHE C 1 75  ? 14.563 94.566  70.737 1.00 20.82  ? 78   PHE B CB  1 
ATOM   3728 C  CG  . PHE C 1 75  ? 14.918 94.681  72.202 1.00 31.42  ? 78   PHE B CG  1 
ATOM   3729 C  CD1 . PHE C 1 75  ? 14.015 94.261  73.184 1.00 21.55  ? 78   PHE B CD1 1 
ATOM   3730 C  CD2 . PHE C 1 75  ? 16.165 95.172  72.596 1.00 25.63  ? 78   PHE B CD2 1 
ATOM   3731 C  CE1 . PHE C 1 75  ? 14.344 94.317  74.508 1.00 25.54  ? 78   PHE B CE1 1 
ATOM   3732 C  CE2 . PHE C 1 75  ? 16.510 95.234  73.940 1.00 27.72  ? 78   PHE B CE2 1 
ATOM   3733 C  CZ  . PHE C 1 75  ? 15.602 94.805  74.898 1.00 31.97  ? 78   PHE B CZ  1 
ATOM   3734 N  N   . LYS C 1 76  ? 14.654 95.821  67.865 1.00 23.56  ? 79   LYS B N   1 
ATOM   3735 C  CA  . LYS C 1 76  ? 14.595 95.497  66.451 1.00 21.92  ? 79   LYS B CA  1 
ATOM   3736 C  C   . LYS C 1 76  ? 15.658 94.439  66.150 1.00 20.28  ? 79   LYS B C   1 
ATOM   3737 O  O   . LYS C 1 76  ? 16.848 94.616  66.473 1.00 21.57  ? 79   LYS B O   1 
ATOM   3738 C  CB  . LYS C 1 76  ? 14.845 96.741  65.589 1.00 21.23  ? 79   LYS B CB  1 
ATOM   3739 C  CG  . LYS C 1 76  ? 13.680 97.655  65.571 1.00 23.55  ? 79   LYS B CG  1 
ATOM   3740 C  CD  . LYS C 1 76  ? 13.959 98.864  64.724 1.00 29.21  ? 79   LYS B CD  1 
ATOM   3741 C  CE  . LYS C 1 76  ? 12.673 99.682  64.525 1.00 35.64  ? 79   LYS B CE  1 
ATOM   3742 N  NZ  . LYS C 1 76  ? 12.986 101.111 64.307 1.00 38.37  ? 79   LYS B NZ  1 
ATOM   3743 N  N   . PHE C 1 77  ? 15.233 93.305  65.611 1.00 16.53  ? 80   PHE B N   1 
ATOM   3744 C  CA  . PHE C 1 77  ? 16.183 92.257  65.219 1.00 17.43  ? 80   PHE B CA  1 
ATOM   3745 C  C   . PHE C 1 77  ? 16.601 92.580  63.779 1.00 18.98  ? 80   PHE B C   1 
ATOM   3746 O  O   . PHE C 1 77  ? 15.768 92.685  62.844 1.00 20.51  ? 80   PHE B O   1 
ATOM   3747 C  CB  . PHE C 1 77  ? 15.530 90.907  65.303 1.00 13.12  ? 80   PHE B CB  1 
ATOM   3748 C  CG  . PHE C 1 77  ? 16.422 89.774  64.956 1.00 14.12  ? 80   PHE B CG  1 
ATOM   3749 C  CD1 . PHE C 1 77  ? 17.244 89.205  65.940 1.00 16.60  ? 80   PHE B CD1 1 
ATOM   3750 C  CD2 . PHE C 1 77  ? 16.333 89.163  63.715 1.00 14.40  ? 80   PHE B CD2 1 
ATOM   3751 C  CE1 . PHE C 1 77  ? 17.936 88.057  65.698 1.00 12.82  ? 80   PHE B CE1 1 
ATOM   3752 C  CE2 . PHE C 1 77  ? 17.037 87.983  63.453 1.00 14.95  ? 80   PHE B CE2 1 
ATOM   3753 C  CZ  . PHE C 1 77  ? 17.834 87.435  64.449 1.00 19.74  ? 80   PHE B CZ  1 
ATOM   3754 N  N   . ARG C 1 78  ? 17.902 92.781  63.627 1.00 19.62  ? 81   ARG B N   1 
ATOM   3755 C  CA  . ARG C 1 78  ? 18.512 93.175  62.362 1.00 17.75  ? 81   ARG B CA  1 
ATOM   3756 C  C   . ARG C 1 78  ? 19.908 92.591  62.163 1.00 16.71  ? 81   ARG B C   1 
ATOM   3757 O  O   . ARG C 1 78  ? 20.566 92.203  63.114 1.00 19.84  ? 81   ARG B O   1 
ATOM   3758 C  CB  . ARG C 1 78  ? 18.612 94.688  62.323 1.00 18.39  ? 81   ARG B CB  1 
ATOM   3759 C  CG  . ARG C 1 78  ? 17.274 95.350  62.170 1.00 21.10  ? 81   ARG B CG  1 
ATOM   3760 C  CD  . ARG C 1 78  ? 17.390 96.848  62.294 1.00 38.21  ? 81   ARG B CD  1 
ATOM   3761 N  NE  . ARG C 1 78  ? 18.192 97.444  61.215 1.00 47.51  ? 81   ARG B NE  1 
ATOM   3762 C  CZ  . ARG C 1 78  ? 17.723 97.989  60.086 1.00 44.61  ? 81   ARG B CZ  1 
ATOM   3763 N  NH1 . ARG C 1 78  ? 16.410 98.047  59.796 1.00 28.03  ? 81   ARG B NH1 1 
ATOM   3764 N  NH2 . ARG C 1 78  ? 18.601 98.525  59.255 1.00 37.88  ? 81   ARG B NH2 1 
ATOM   3765 N  N   . ALA C 1 79  ? 20.336 92.525  60.910 1.00 16.06  ? 82   ALA B N   1 
ATOM   3766 C  CA  . ALA C 1 79  ? 21.644 92.018  60.557 1.00 17.07  ? 82   ALA B CA  1 
ATOM   3767 C  C   . ALA C 1 79  ? 22.623 93.132  60.915 1.00 21.13  ? 82   ALA B C   1 
ATOM   3768 O  O   . ALA C 1 79  ? 22.383 94.312  60.618 1.00 20.54  ? 82   ALA B O   1 
ATOM   3769 C  CB  . ALA C 1 79  ? 21.681 91.690  59.030 1.00 14.54  ? 82   ALA B CB  1 
ATOM   3770 N  N   . LYS C 1 80  ? 23.620 92.777  61.712 1.00 18.08  ? 83   LYS B N   1 
ATOM   3771 C  CA  . LYS C 1 80  ? 24.657 93.694  62.106 1.00 15.21  ? 83   LYS B CA  1 
ATOM   3772 C  C   . LYS C 1 80  ? 25.869 93.474  61.163 1.00 16.75  ? 83   LYS B C   1 
ATOM   3773 O  O   . LYS C 1 80  ? 26.612 94.419  60.847 1.00 15.41  ? 83   LYS B O   1 
ATOM   3774 C  CB  . LYS C 1 80  ? 25.024 93.448  63.570 1.00 19.27  ? 83   LYS B CB  1 
ATOM   3775 C  CG  . LYS C 1 80  ? 26.247 94.256  64.064 1.00 25.13  ? 83   LYS B CG  1 
ATOM   3776 C  CD  . LYS C 1 80  ? 26.486 94.134  65.575 1.00 23.87  ? 83   LYS B CD  1 
ATOM   3777 C  CE  . LYS C 1 80  ? 27.520 95.146  66.058 1.00 18.52  ? 83   LYS B CE  1 
ATOM   3778 N  NZ  . LYS C 1 80  ? 27.673 95.135  67.531 1.00 23.70  ? 83   LYS B NZ  1 
ATOM   3779 N  N   . PHE C 1 81  ? 26.005 92.250  60.661 1.00 15.49  ? 84   PHE B N   1 
ATOM   3780 C  CA  . PHE C 1 81  ? 27.092 91.871  59.754 1.00 17.89  ? 84   PHE B CA  1 
ATOM   3781 C  C   . PHE C 1 81  ? 26.479 91.309  58.506 1.00 20.96  ? 84   PHE B C   1 
ATOM   3782 O  O   . PHE C 1 81  ? 25.399 90.693  58.540 1.00 19.88  ? 84   PHE B O   1 
ATOM   3783 C  CB  . PHE C 1 81  ? 28.025 90.827  60.393 1.00 9.51   ? 84   PHE B CB  1 
ATOM   3784 C  CG  . PHE C 1 81  ? 28.619 91.288  61.692 1.00 15.50  ? 84   PHE B CG  1 
ATOM   3785 C  CD1 . PHE C 1 81  ? 27.994 90.971  62.912 1.00 15.23  ? 84   PHE B CD1 1 
ATOM   3786 C  CD2 . PHE C 1 81  ? 29.711 92.173  61.705 1.00 13.97  ? 84   PHE B CD2 1 
ATOM   3787 C  CE1 . PHE C 1 81  ? 28.421 91.546  64.148 1.00 15.72  ? 84   PHE B CE1 1 
ATOM   3788 C  CE2 . PHE C 1 81  ? 30.153 92.755  62.920 1.00 17.84  ? 84   PHE B CE2 1 
ATOM   3789 C  CZ  . PHE C 1 81  ? 29.505 92.448  64.153 1.00 17.34  ? 84   PHE B CZ  1 
ATOM   3790 N  N   . TYR C 1 82  ? 27.181 91.531  57.402 1.00 19.99  ? 85   TYR B N   1 
ATOM   3791 C  CA  . TYR C 1 82  ? 26.771 91.052  56.096 1.00 15.76  ? 85   TYR B CA  1 
ATOM   3792 C  C   . TYR C 1 82  ? 27.740 90.009  55.586 1.00 20.91  ? 85   TYR B C   1 
ATOM   3793 O  O   . TYR C 1 82  ? 28.963 90.120  55.818 1.00 17.64  ? 85   TYR B O   1 
ATOM   3794 C  CB  . TYR C 1 82  ? 26.829 92.220  55.101 1.00 11.96  ? 85   TYR B CB  1 
ATOM   3795 C  CG  . TYR C 1 82  ? 25.818 93.293  55.336 1.00 24.37  ? 85   TYR B CG  1 
ATOM   3796 C  CD1 . TYR C 1 82  ? 25.892 94.122  56.453 1.00 27.32  ? 85   TYR B CD1 1 
ATOM   3797 C  CD2 . TYR C 1 82  ? 24.719 93.423  54.487 1.00 24.71  ? 85   TYR B CD2 1 
ATOM   3798 C  CE1 . TYR C 1 82  ? 24.876 95.040  56.727 1.00 25.07  ? 85   TYR B CE1 1 
ATOM   3799 C  CE2 . TYR C 1 82  ? 23.723 94.319  54.748 1.00 20.64  ? 85   TYR B CE2 1 
ATOM   3800 C  CZ  . TYR C 1 82  ? 23.791 95.114  55.857 1.00 25.77  ? 85   TYR B CZ  1 
ATOM   3801 O  OH  . TYR C 1 82  ? 22.734 95.948  56.111 1.00 30.97  ? 85   TYR B OH  1 
ATOM   3802 N  N   . PRO C 1 83  ? 27.219 89.018  54.825 1.00 18.31  ? 86   PRO B N   1 
ATOM   3803 C  CA  . PRO C 1 83  ? 28.062 87.976  54.246 1.00 19.41  ? 86   PRO B CA  1 
ATOM   3804 C  C   . PRO C 1 83  ? 28.858 88.650  53.108 1.00 23.97  ? 86   PRO B C   1 
ATOM   3805 O  O   . PRO C 1 83  ? 28.481 89.746  52.616 1.00 20.03  ? 86   PRO B O   1 
ATOM   3806 C  CB  . PRO C 1 83  ? 27.028 87.013  53.644 1.00 20.67  ? 86   PRO B CB  1 
ATOM   3807 C  CG  . PRO C 1 83  ? 25.878 87.862  53.298 1.00 14.74  ? 86   PRO B CG  1 
ATOM   3808 C  CD  . PRO C 1 83  ? 25.799 88.781  54.491 1.00 17.46  ? 86   PRO B CD  1 
ATOM   3809 N  N   . GLU C 1 84  ? 29.943 87.996  52.689 1.00 22.24  ? 87   GLU B N   1 
ATOM   3810 C  CA  . GLU C 1 84  ? 30.769 88.497  51.575 1.00 19.95  ? 87   GLU B CA  1 
ATOM   3811 C  C   . GLU C 1 84  ? 30.086 88.129  50.270 1.00 21.28  ? 87   GLU B C   1 
ATOM   3812 O  O   . GLU C 1 84  ? 30.138 88.875  49.288 1.00 24.32  ? 87   GLU B O   1 
ATOM   3813 C  CB  . GLU C 1 84  ? 32.174 87.897  51.594 1.00 15.25  ? 87   GLU B CB  1 
ATOM   3814 C  CG  . GLU C 1 84  ? 32.948 88.298  52.837 1.00 21.66  ? 87   GLU B CG  1 
ATOM   3815 C  CD  . GLU C 1 84  ? 34.380 87.737  52.855 1.00 18.94  ? 87   GLU B CD  1 
ATOM   3816 O  OE1 . GLU C 1 84  ? 34.892 87.468  53.969 1.00 20.61  ? 87   GLU B OE1 1 
ATOM   3817 O  OE2 . GLU C 1 84  ? 34.988 87.631  51.762 1.00 21.38  ? 87   GLU B OE2 1 
ATOM   3818 N  N   . ASP C 1 85  ? 29.367 87.018  50.307 1.00 23.33  ? 88   ASP B N   1 
ATOM   3819 C  CA  . ASP C 1 85  ? 28.676 86.511  49.139 1.00 24.99  ? 88   ASP B CA  1 
ATOM   3820 C  C   . ASP C 1 85  ? 27.381 85.819  49.587 1.00 22.84  ? 88   ASP B C   1 
ATOM   3821 O  O   . ASP C 1 85  ? 27.399 84.855  50.340 1.00 20.67  ? 88   ASP B O   1 
ATOM   3822 C  CB  . ASP C 1 85  ? 29.599 85.557  48.391 1.00 29.64  ? 88   ASP B CB  1 
ATOM   3823 C  CG  . ASP C 1 85  ? 29.205 85.394  46.973 1.00 37.71  ? 88   ASP B CG  1 
ATOM   3824 O  OD1 . ASP C 1 85  ? 30.098 85.076  46.165 1.00 39.13  ? 88   ASP B OD1 1 
ATOM   3825 O  OD2 . ASP C 1 85  ? 28.007 85.603  46.670 1.00 32.81  ? 88   ASP B OD2 1 
ATOM   3826 N  N   . VAL C 1 86  ? 26.245 86.324  49.121 1.00 18.01  ? 89   VAL B N   1 
ATOM   3827 C  CA  . VAL C 1 86  ? 24.974 85.789  49.541 1.00 21.68  ? 89   VAL B CA  1 
ATOM   3828 C  C   . VAL C 1 86  ? 24.683 84.355  49.104 1.00 30.15  ? 89   VAL B C   1 
ATOM   3829 O  O   . VAL C 1 86  ? 24.167 83.558  49.905 1.00 35.25  ? 89   VAL B O   1 
ATOM   3830 C  CB  . VAL C 1 86  ? 23.777 86.713  49.113 1.00 23.70  ? 89   VAL B CB  1 
ATOM   3831 C  CG1 . VAL C 1 86  ? 23.745 87.969  49.985 1.00 14.82  ? 89   VAL B CG1 1 
ATOM   3832 C  CG2 . VAL C 1 86  ? 23.870 87.080  47.624 1.00 14.39  ? 89   VAL B CG2 1 
ATOM   3833 N  N   . SER C 1 87  ? 25.022 84.017  47.856 1.00 32.00  ? 90   SER B N   1 
ATOM   3834 C  CA  . SER C 1 87  ? 24.777 82.671  47.334 1.00 34.98  ? 90   SER B CA  1 
ATOM   3835 C  C   . SER C 1 87  ? 25.512 81.564  48.122 1.00 37.42  ? 90   SER B C   1 
ATOM   3836 O  O   . SER C 1 87  ? 24.994 80.454  48.298 1.00 37.65  ? 90   SER B O   1 
ATOM   3837 C  CB  . SER C 1 87  ? 25.058 82.599  45.834 1.00 39.54  ? 90   SER B CB  1 
ATOM   3838 O  OG  . SER C 1 87  ? 26.427 82.856  45.581 1.00 48.38  ? 90   SER B OG  1 
ATOM   3839 N  N   . GLU C 1 88  ? 26.674 81.902  48.674 1.00 32.11  ? 91   GLU B N   1 
ATOM   3840 C  CA  . GLU C 1 88  ? 27.428 80.945  49.485 1.00 38.41  ? 91   GLU B CA  1 
ATOM   3841 C  C   . GLU C 1 88  ? 27.008 80.903  50.956 1.00 36.31  ? 91   GLU B C   1 
ATOM   3842 O  O   . GLU C 1 88  ? 26.900 79.843  51.577 1.00 36.29  ? 91   GLU B O   1 
ATOM   3843 C  CB  . GLU C 1 88  ? 28.892 81.333  49.530 1.00 38.55  ? 91   GLU B CB  1 
ATOM   3844 C  CG  . GLU C 1 88  ? 29.619 81.367  48.215 1.00 58.48  ? 91   GLU B CG  1 
ATOM   3845 C  CD  . GLU C 1 88  ? 31.049 81.854  48.402 1.00 66.74  ? 91   GLU B CD  1 
ATOM   3846 O  OE1 . GLU C 1 88  ? 31.902 81.551  47.528 1.00 68.86  ? 91   GLU B OE1 1 
ATOM   3847 O  OE2 . GLU C 1 88  ? 31.313 82.533  49.437 1.00 70.05  ? 91   GLU B OE2 1 
ATOM   3848 N  N   . GLU C 1 89  ? 26.793 82.076  51.514 1.00 31.25  ? 92   GLU B N   1 
ATOM   3849 C  CA  . GLU C 1 89  ? 26.529 82.176  52.933 1.00 33.75  ? 92   GLU B CA  1 
ATOM   3850 C  C   . GLU C 1 89  ? 25.147 82.290  53.524 1.00 38.36  ? 92   GLU B C   1 
ATOM   3851 O  O   . GLU C 1 89  ? 25.008 82.294  54.749 1.00 47.18  ? 92   GLU B O   1 
ATOM   3852 C  CB  . GLU C 1 89  ? 27.361 83.314  53.482 1.00 26.48  ? 92   GLU B CB  1 
ATOM   3853 C  CG  . GLU C 1 89  ? 28.793 83.252  52.953 1.00 31.27  ? 92   GLU B CG  1 
ATOM   3854 C  CD  . GLU C 1 89  ? 29.513 84.526  53.238 1.00 26.10  ? 92   GLU B CD  1 
ATOM   3855 O  OE1 . GLU C 1 89  ? 29.387 84.979  54.401 1.00 29.49  ? 92   GLU B OE1 1 
ATOM   3856 O  OE2 . GLU C 1 89  ? 30.138 85.080  52.304 1.00 24.72  ? 92   GLU B OE2 1 
ATOM   3857 N  N   . LEU C 1 90  ? 24.124 82.463  52.708 1.00 34.27  ? 93   LEU B N   1 
ATOM   3858 C  CA  . LEU C 1 90  ? 22.814 82.584  53.299 1.00 33.33  ? 93   LEU B CA  1 
ATOM   3859 C  C   . LEU C 1 90  ? 21.949 81.376  52.934 1.00 38.00  ? 93   LEU B C   1 
ATOM   3860 O  O   . LEU C 1 90  ? 21.013 81.485  52.139 1.00 37.99  ? 93   LEU B O   1 
ATOM   3861 C  CB  . LEU C 1 90  ? 22.152 83.916  52.922 1.00 28.07  ? 93   LEU B CB  1 
ATOM   3862 C  CG  . LEU C 1 90  ? 23.011 85.140  53.235 1.00 29.60  ? 93   LEU B CG  1 
ATOM   3863 C  CD1 . LEU C 1 90  ? 22.250 86.359  52.879 1.00 25.30  ? 93   LEU B CD1 1 
ATOM   3864 C  CD2 . LEU C 1 90  ? 23.433 85.162  54.696 1.00 30.51  ? 93   LEU B CD2 1 
ATOM   3865 N  N   . ILE C 1 91  ? 22.257 80.246  53.582 1.00 33.30  ? 94   ILE B N   1 
ATOM   3866 C  CA  . ILE C 1 91  ? 21.593 78.970  53.345 1.00 30.20  ? 94   ILE B CA  1 
ATOM   3867 C  C   . ILE C 1 91  ? 20.099 78.859  53.647 1.00 23.71  ? 94   ILE B C   1 
ATOM   3868 O  O   . ILE C 1 91  ? 19.367 78.214  52.910 1.00 29.91  ? 94   ILE B O   1 
ATOM   3869 C  CB  . ILE C 1 91  ? 22.317 77.802  54.065 1.00 35.46  ? 94   ILE B CB  1 
ATOM   3870 C  CG1 . ILE C 1 91  ? 23.714 77.627  53.489 1.00 35.30  ? 94   ILE B CG1 1 
ATOM   3871 C  CG2 . ILE C 1 91  ? 21.555 76.496  53.877 1.00 39.63  ? 94   ILE B CG2 1 
ATOM   3872 C  CD1 . ILE C 1 91  ? 23.709 77.219  52.033 1.00 49.51  ? 94   ILE B CD1 1 
ATOM   3873 N  N   . GLN C 1 92  ? 19.617 79.471  54.709 1.00 22.62  ? 95   GLN B N   1 
ATOM   3874 C  CA  . GLN C 1 92  ? 18.208 79.324  55.021 1.00 21.89  ? 95   GLN B CA  1 
ATOM   3875 C  C   . GLN C 1 92  ? 17.275 80.317  54.355 1.00 26.01  ? 95   GLN B C   1 
ATOM   3876 O  O   . GLN C 1 92  ? 17.672 81.428  54.015 1.00 23.27  ? 95   GLN B O   1 
ATOM   3877 C  CB  . GLN C 1 92  ? 17.990 79.444  56.520 1.00 20.21  ? 95   GLN B CB  1 
ATOM   3878 C  CG  . GLN C 1 92  ? 18.566 78.332  57.331 1.00 23.42  ? 95   GLN B CG  1 
ATOM   3879 C  CD  . GLN C 1 92  ? 18.296 78.549  58.785 1.00 24.24  ? 95   GLN B CD  1 
ATOM   3880 O  OE1 . GLN C 1 92  ? 19.112 79.124  59.481 1.00 31.38  ? 95   GLN B OE1 1 
ATOM   3881 N  NE2 . GLN C 1 92  ? 17.120 78.165  59.239 1.00 24.63  ? 95   GLN B NE2 1 
ATOM   3882 N  N   . ASP C 1 93  ? 16.007 79.926  54.261 1.00 27.27  ? 96   ASP B N   1 
ATOM   3883 C  CA  . ASP C 1 93  ? 14.948 80.749  53.690 1.00 31.63  ? 96   ASP B CA  1 
ATOM   3884 C  C   . ASP C 1 93  ? 14.732 81.970  54.581 1.00 28.09  ? 96   ASP B C   1 
ATOM   3885 O  O   . ASP C 1 93  ? 14.638 83.088  54.084 1.00 29.15  ? 96   ASP B O   1 
ATOM   3886 C  CB  . ASP C 1 93  ? 13.645 79.958  53.680 1.00 38.08  ? 96   ASP B CB  1 
ATOM   3887 C  CG  . ASP C 1 93  ? 13.278 79.490  52.314 1.00 60.40  ? 96   ASP B CG  1 
ATOM   3888 O  OD1 . ASP C 1 93  ? 13.205 80.360  51.412 1.00 66.32  ? 96   ASP B OD1 1 
ATOM   3889 O  OD2 . ASP C 1 93  ? 13.075 78.263  52.137 1.00 65.87  ? 96   ASP B OD2 1 
ATOM   3890 N  N   . ILE C 1 94  ? 14.634 81.760  55.891 1.00 24.17  ? 97   ILE B N   1 
ATOM   3891 C  CA  . ILE C 1 94  ? 14.420 82.887  56.794 1.00 24.88  ? 97   ILE B CA  1 
ATOM   3892 C  C   . ILE C 1 94  ? 15.622 83.865  56.757 1.00 24.15  ? 97   ILE B C   1 
ATOM   3893 O  O   . ILE C 1 94  ? 15.444 85.079  56.742 1.00 20.79  ? 97   ILE B O   1 
ATOM   3894 C  CB  . ILE C 1 94  ? 14.146 82.392  58.225 1.00 22.67  ? 97   ILE B CB  1 
ATOM   3895 C  CG1 . ILE C 1 94  ? 13.875 83.549  59.183 1.00 25.05  ? 97   ILE B CG1 1 
ATOM   3896 C  CG2 . ILE C 1 94  ? 15.316 81.571  58.737 1.00 17.76  ? 97   ILE B CG2 1 
ATOM   3897 C  CD1 . ILE C 1 94  ? 12.598 84.293  58.987 1.00 28.26  ? 97   ILE B CD1 1 
ATOM   3898 N  N   . THR C 1 95  ? 16.843 83.345  56.672 1.00 23.12  ? 98   THR B N   1 
ATOM   3899 C  CA  . THR C 1 95  ? 18.008 84.222  56.599 1.00 23.83  ? 98   THR B CA  1 
ATOM   3900 C  C   . THR C 1 95  ? 17.990 85.115  55.349 1.00 17.89  ? 98   THR B C   1 
ATOM   3901 O  O   . THR C 1 95  ? 18.232 86.332  55.434 1.00 20.25  ? 98   THR B O   1 
ATOM   3902 C  CB  . THR C 1 95  ? 19.344 83.405  56.666 1.00 20.03  ? 98   THR B CB  1 
ATOM   3903 O  OG1 . THR C 1 95  ? 19.222 82.424  57.705 1.00 21.86  ? 98   THR B OG1 1 
ATOM   3904 C  CG2 . THR C 1 95  ? 20.581 84.347  57.023 1.00 19.01  ? 98   THR B CG2 1 
ATOM   3905 N  N   . GLN C 1 96  ? 17.732 84.502  54.196 1.00 14.85  ? 99   GLN B N   1 
ATOM   3906 C  CA  . GLN C 1 96  ? 17.665 85.218  52.934 1.00 19.56  ? 99   GLN B CA  1 
ATOM   3907 C  C   . GLN C 1 96  ? 16.592 86.268  52.960 1.00 19.51  ? 99   GLN B C   1 
ATOM   3908 O  O   . GLN C 1 96  ? 16.841 87.399  52.574 1.00 25.27  ? 99   GLN B O   1 
ATOM   3909 C  CB  . GLN C 1 96  ? 17.381 84.267  51.795 1.00 24.17  ? 99   GLN B CB  1 
ATOM   3910 C  CG  . GLN C 1 96  ? 18.607 83.589  51.231 1.00 43.82  ? 99   GLN B CG  1 
ATOM   3911 C  CD  . GLN C 1 96  ? 18.258 82.800  50.009 1.00 57.10  ? 99   GLN B CD  1 
ATOM   3912 O  OE1 . GLN C 1 96  ? 17.734 83.345  49.028 1.00 59.86  ? 99   GLN B OE1 1 
ATOM   3913 N  NE2 . GLN C 1 96  ? 18.490 81.494  50.073 1.00 60.59  ? 99   GLN B NE2 1 
ATOM   3914 N  N   . ARG C 1 97  ? 15.411 85.898  53.441 1.00 21.28  ? 100  ARG B N   1 
ATOM   3915 C  CA  . ARG C 1 97  ? 14.290 86.811  53.509 1.00 23.80  ? 100  ARG B CA  1 
ATOM   3916 C  C   . ARG C 1 97  ? 14.609 88.011  54.401 1.00 24.70  ? 100  ARG B C   1 
ATOM   3917 O  O   . ARG C 1 97  ? 14.275 89.142  54.061 1.00 17.67  ? 100  ARG B O   1 
ATOM   3918 C  CB  . ARG C 1 97  ? 13.075 86.077  54.076 1.00 22.66  ? 100  ARG B CB  1 
ATOM   3919 C  CG  . ARG C 1 97  ? 11.771 86.825  53.866 1.00 24.87  ? 100  ARG B CG  1 
ATOM   3920 C  CD  . ARG C 1 97  ? 10.587 85.913  54.060 1.00 31.73  ? 100  ARG B CD  1 
ATOM   3921 N  NE  . ARG C 1 97  ? 10.497 85.332  55.404 1.00 38.46  ? 100  ARG B NE  1 
ATOM   3922 C  CZ  . ARG C 1 97  ? 10.655 84.032  55.676 1.00 43.65  ? 100  ARG B CZ  1 
ATOM   3923 N  NH1 . ARG C 1 97  ? 10.920 83.154  54.708 1.00 51.70  ? 100  ARG B NH1 1 
ATOM   3924 N  NH2 . ARG C 1 97  ? 10.528 83.594  56.912 1.00 41.09  ? 100  ARG B NH2 1 
ATOM   3925 N  N   . LEU C 1 98  ? 15.230 87.761  55.554 1.00 22.64  ? 101  LEU B N   1 
ATOM   3926 C  CA  . LEU C 1 98  ? 15.564 88.843  56.473 1.00 20.02  ? 101  LEU B CA  1 
ATOM   3927 C  C   . LEU C 1 98  ? 16.598 89.807  55.923 1.00 18.80  ? 101  LEU B C   1 
ATOM   3928 O  O   . LEU C 1 98  ? 16.460 91.008  56.105 1.00 18.26  ? 101  LEU B O   1 
ATOM   3929 C  CB  . LEU C 1 98  ? 15.935 88.327  57.883 1.00 21.98  ? 101  LEU B CB  1 
ATOM   3930 C  CG  . LEU C 1 98  ? 14.767 87.765  58.743 1.00 24.95  ? 101  LEU B CG  1 
ATOM   3931 C  CD1 . LEU C 1 98  ? 15.190 87.511  60.185 1.00 22.28  ? 101  LEU B CD1 1 
ATOM   3932 C  CD2 . LEU C 1 98  ? 13.497 88.623  58.724 1.00 22.21  ? 101  LEU B CD2 1 
ATOM   3933 N  N   . PHE C 1 99  ? 17.613 89.289  55.238 1.00 19.84  ? 102  PHE B N   1 
ATOM   3934 C  CA  . PHE C 1 99  ? 18.636 90.133  54.614 1.00 18.08  ? 102  PHE B CA  1 
ATOM   3935 C  C   . PHE C 1 99  ? 17.966 90.917  53.451 1.00 15.83  ? 102  PHE B C   1 
ATOM   3936 O  O   . PHE C 1 99  ? 18.122 92.115  53.349 1.00 15.49  ? 102  PHE B O   1 
ATOM   3937 C  CB  . PHE C 1 99  ? 19.816 89.286  54.067 1.00 17.44  ? 102  PHE B CB  1 
ATOM   3938 C  CG  . PHE C 1 99  ? 21.000 89.313  54.925 1.00 14.00  ? 102  PHE B CG  1 
ATOM   3939 C  CD1 . PHE C 1 99  ? 21.280 88.252  55.747 1.00 20.74  ? 102  PHE B CD1 1 
ATOM   3940 C  CD2 . PHE C 1 99  ? 21.806 90.446  54.989 1.00 19.42  ? 102  PHE B CD2 1 
ATOM   3941 C  CE1 . PHE C 1 99  ? 22.371 88.326  56.655 1.00 25.37  ? 102  PHE B CE1 1 
ATOM   3942 C  CE2 . PHE C 1 99  ? 22.875 90.542  55.858 1.00 15.94  ? 102  PHE B CE2 1 
ATOM   3943 C  CZ  . PHE C 1 99  ? 23.168 89.482  56.706 1.00 21.04  ? 102  PHE B CZ  1 
ATOM   3944 N  N   . PHE C 1 100 ? 17.155 90.243  52.648 1.00 12.50  ? 103  PHE B N   1 
ATOM   3945 C  CA  . PHE C 1 100 ? 16.470 90.856  51.513 1.00 14.93  ? 103  PHE B CA  1 
ATOM   3946 C  C   . PHE C 1 100 ? 15.585 92.022  51.939 1.00 11.50  ? 103  PHE B C   1 
ATOM   3947 O  O   . PHE C 1 100 ? 15.677 93.115  51.390 1.00 14.28  ? 103  PHE B O   1 
ATOM   3948 C  CB  . PHE C 1 100 ? 15.633 89.771  50.794 1.00 16.87  ? 103  PHE B CB  1 
ATOM   3949 C  CG  . PHE C 1 100 ? 14.575 90.303  49.867 1.00 20.11  ? 103  PHE B CG  1 
ATOM   3950 C  CD1 . PHE C 1 100 ? 13.212 90.255  50.244 1.00 15.52  ? 103  PHE B CD1 1 
ATOM   3951 C  CD2 . PHE C 1 100 ? 14.920 90.849  48.600 1.00 14.58  ? 103  PHE B CD2 1 
ATOM   3952 C  CE1 . PHE C 1 100 ? 12.227 90.733  49.383 1.00 16.18  ? 103  PHE B CE1 1 
ATOM   3953 C  CE2 . PHE C 1 100 ? 13.922 91.340  47.714 1.00 14.55  ? 103  PHE B CE2 1 
ATOM   3954 C  CZ  . PHE C 1 100 ? 12.589 91.279  48.103 1.00 18.12  ? 103  PHE B CZ  1 
ATOM   3955 N  N   . LEU C 1 101 ? 14.746 91.803  52.936 1.00 12.87  ? 104  LEU B N   1 
ATOM   3956 C  CA  . LEU C 1 101 ? 13.893 92.872  53.410 1.00 18.59  ? 104  LEU B CA  1 
ATOM   3957 C  C   . LEU C 1 101 ? 14.687 94.049  53.965 1.00 17.00  ? 104  LEU B C   1 
ATOM   3958 O  O   . LEU C 1 101 ? 14.380 95.192  53.687 1.00 13.71  ? 104  LEU B O   1 
ATOM   3959 C  CB  . LEU C 1 101 ? 12.886 92.327  54.419 1.00 17.93  ? 104  LEU B CB  1 
ATOM   3960 C  CG  . LEU C 1 101 ? 11.893 91.240  53.901 1.00 18.09  ? 104  LEU B CG  1 
ATOM   3961 C  CD1 . LEU C 1 101 ? 11.012 90.853  55.054 1.00 13.07  ? 104  LEU B CD1 1 
ATOM   3962 C  CD2 . LEU C 1 101 ? 11.039 91.682  52.687 1.00 14.55  ? 104  LEU B CD2 1 
ATOM   3963 N  N   . GLN C 1 102 ? 15.759 93.774  54.685 1.00 16.38  ? 105  GLN B N   1 
ATOM   3964 C  CA  . GLN C 1 102 ? 16.572 94.844  55.240 1.00 14.80  ? 105  GLN B CA  1 
ATOM   3965 C  C   . GLN C 1 102 ? 17.298 95.627  54.168 1.00 15.32  ? 105  GLN B C   1 
ATOM   3966 O  O   . GLN C 1 102 ? 17.293 96.872  54.216 1.00 16.41  ? 105  GLN B O   1 
ATOM   3967 C  CB  . GLN C 1 102 ? 17.573 94.315  56.281 1.00 12.67  ? 105  GLN B CB  1 
ATOM   3968 C  CG  . GLN C 1 102 ? 18.293 95.431  57.041 1.00 9.29   ? 105  GLN B CG  1 
ATOM   3969 C  CD  . GLN C 1 102 ? 19.090 94.866  58.175 1.00 23.28  ? 105  GLN B CD  1 
ATOM   3970 O  OE1 . GLN C 1 102 ? 18.621 93.955  58.863 1.00 15.62  ? 105  GLN B OE1 1 
ATOM   3971 N  NE2 . GLN C 1 102 ? 20.313 95.356  58.364 1.00 14.32  ? 105  GLN B NE2 1 
ATOM   3972 N  N   . VAL C 1 103 ? 17.935 94.908  53.229 1.00 13.93  ? 106  VAL B N   1 
ATOM   3973 C  CA  . VAL C 1 103 ? 18.686 95.506  52.131 1.00 12.86  ? 106  VAL B CA  1 
ATOM   3974 C  C   . VAL C 1 103 ? 17.746 96.333  51.258 1.00 15.91  ? 106  VAL B C   1 
ATOM   3975 O  O   . VAL C 1 103 ? 18.071 97.483  50.921 1.00 10.61  ? 106  VAL B O   1 
ATOM   3976 C  CB  . VAL C 1 103 ? 19.448 94.409  51.299 1.00 15.20  ? 106  VAL B CB  1 
ATOM   3977 C  CG1 . VAL C 1 103 ? 20.075 95.024  50.038 1.00 9.62   ? 106  VAL B CG1 1 
ATOM   3978 C  CG2 . VAL C 1 103 ? 20.580 93.751  52.183 1.00 11.51  ? 106  VAL B CG2 1 
ATOM   3979 N  N   . LYS C 1 104 ? 16.592 95.742  50.904 1.00 11.70  ? 107  LYS B N   1 
ATOM   3980 C  CA  . LYS C 1 104 ? 15.544 96.429  50.117 1.00 16.10  ? 107  LYS B CA  1 
ATOM   3981 C  C   . LYS C 1 104 ? 15.141 97.759  50.802 1.00 12.71  ? 107  LYS B C   1 
ATOM   3982 O  O   . LYS C 1 104 ? 14.985 98.794  50.145 1.00 12.24  ? 107  LYS B O   1 
ATOM   3983 C  CB  . LYS C 1 104 ? 14.295 95.519  49.999 1.00 14.51  ? 107  LYS B CB  1 
ATOM   3984 C  CG  . LYS C 1 104 ? 13.203 96.067  49.076 1.00 14.22  ? 107  LYS B CG  1 
ATOM   3985 C  CD  . LYS C 1 104 ? 12.293 94.926  48.519 1.00 12.74  ? 107  LYS B CD  1 
ATOM   3986 C  CE  . LYS C 1 104 ? 11.382 94.358  49.609 1.00 9.45   ? 107  LYS B CE  1 
ATOM   3987 N  NZ  . LYS C 1 104 ? 10.473 95.388  50.152 1.00 12.73  ? 107  LYS B NZ  1 
ATOM   3988 N  N   . GLU C 1 105 ? 14.990 97.713  52.131 1.00 14.97  ? 108  GLU B N   1 
ATOM   3989 C  CA  . GLU C 1 105 ? 14.624 98.875  52.914 1.00 15.51  ? 108  GLU B CA  1 
ATOM   3990 C  C   . GLU C 1 105 ? 15.640 99.988  52.768 1.00 15.27  ? 108  GLU B C   1 
ATOM   3991 O  O   . GLU C 1 105 ? 15.265 101.140 52.619 1.00 16.60  ? 108  GLU B O   1 
ATOM   3992 C  CB  . GLU C 1 105 ? 14.473 98.478  54.377 1.00 17.55  ? 108  GLU B CB  1 
ATOM   3993 C  CG  . GLU C 1 105 ? 14.231 99.696  55.289 1.00 21.29  ? 108  GLU B CG  1 
ATOM   3994 C  CD  . GLU C 1 105 ? 14.204 99.311  56.746 1.00 23.65  ? 108  GLU B CD  1 
ATOM   3995 O  OE1 . GLU C 1 105 ? 13.106 99.102  57.279 1.00 26.27  ? 108  GLU B OE1 1 
ATOM   3996 O  OE2 . GLU C 1 105 ? 15.280 99.171  57.358 1.00 26.93  ? 108  GLU B OE2 1 
ATOM   3997 N  N   . GLY C 1 106 ? 16.921 99.637  52.748 1.00 16.00  ? 109  GLY B N   1 
ATOM   3998 C  CA  . GLY C 1 106 ? 17.985 100.621 52.599 1.00 14.72  ? 109  GLY B CA  1 
ATOM   3999 C  C   . GLY C 1 106 ? 18.026 101.163 51.182 1.00 10.43  ? 109  GLY B C   1 
ATOM   4000 O  O   . GLY C 1 106 ? 18.383 102.322 50.975 1.00 16.05  ? 109  GLY B O   1 
ATOM   4001 N  N   . ILE C 1 107 ? 17.734 100.320 50.190 1.00 13.98  ? 110  ILE B N   1 
ATOM   4002 C  CA  . ILE C 1 107 ? 17.681 100.793 48.812 1.00 12.40  ? 110  ILE B CA  1 
ATOM   4003 C  C   . ILE C 1 107 ? 16.479 101.753 48.611 1.00 14.51  ? 110  ILE B C   1 
ATOM   4004 O  O   . ILE C 1 107 ? 16.629 102.881 48.114 1.00 12.81  ? 110  ILE B O   1 
ATOM   4005 C  CB  . ILE C 1 107 ? 17.669 99.629  47.870 1.00 12.46  ? 110  ILE B CB  1 
ATOM   4006 C  CG1 . ILE C 1 107 ? 19.063 99.005  47.948 1.00 20.26  ? 110  ILE B CG1 1 
ATOM   4007 C  CG2 . ILE C 1 107 ? 17.350 100.054 46.353 1.00 10.21  ? 110  ILE B CG2 1 
ATOM   4008 C  CD1 . ILE C 1 107 ? 19.257 97.835  47.046 1.00 16.03  ? 110  ILE B CD1 1 
ATOM   4009 N  N   . LEU C 1 108 ? 15.324 101.343 49.102 1.00 13.77  ? 111  LEU B N   1 
ATOM   4010 C  CA  . LEU C 1 108 ? 14.114 102.130 48.976 1.00 13.06  ? 111  LEU B CA  1 
ATOM   4011 C  C   . LEU C 1 108 ? 14.181 103.456 49.693 1.00 18.70  ? 111  LEU B C   1 
ATOM   4012 O  O   . LEU C 1 108 ? 13.550 104.407 49.256 1.00 16.56  ? 111  LEU B O   1 
ATOM   4013 C  CB  . LEU C 1 108 ? 12.898 101.283 49.448 1.00 10.67  ? 111  LEU B CB  1 
ATOM   4014 C  CG  . LEU C 1 108 ? 12.633 100.110 48.474 1.00 9.98   ? 111  LEU B CG  1 
ATOM   4015 C  CD1 . LEU C 1 108 ? 11.455 99.272  48.912 1.00 12.86  ? 111  LEU B CD1 1 
ATOM   4016 C  CD2 . LEU C 1 108 ? 12.416 100.671 47.034 1.00 8.70   ? 111  LEU B CD2 1 
ATOM   4017 N  N   . ASN C 1 109 ? 14.938 103.524 50.786 1.00 16.04  ? 112  ASN B N   1 
ATOM   4018 C  CA  . ASN C 1 109 ? 15.098 104.764 51.542 1.00 15.83  ? 112  ASN B CA  1 
ATOM   4019 C  C   . ASN C 1 109 ? 16.314 105.578 51.187 1.00 13.19  ? 112  ASN B C   1 
ATOM   4020 O  O   . ASN C 1 109 ? 16.610 106.519 51.863 1.00 16.54  ? 112  ASN B O   1 
ATOM   4021 C  CB  . ASN C 1 109 ? 15.078 104.476 53.050 1.00 24.38  ? 112  ASN B CB  1 
ATOM   4022 C  CG  . ASN C 1 109 ? 13.701 104.061 53.539 1.00 31.94  ? 112  ASN B CG  1 
ATOM   4023 O  OD1 . ASN C 1 109 ? 13.554 103.582 54.659 1.00 40.22  ? 112  ASN B OD1 1 
ATOM   4024 N  ND2 . ASN C 1 109 ? 12.672 104.266 52.697 1.00 40.03  ? 112  ASN B ND2 1 
ATOM   4025 N  N   . ASP C 1 110 ? 17.040 105.152 50.163 1.00 13.67  ? 113  ASP B N   1 
ATOM   4026 C  CA  . ASP C 1 110 ? 18.247 105.801 49.678 1.00 19.83  ? 113  ASP B CA  1 
ATOM   4027 C  C   . ASP C 1 110 ? 19.399 105.860 50.662 1.00 22.91  ? 113  ASP B C   1 
ATOM   4028 O  O   . ASP C 1 110 ? 20.152 106.851 50.676 1.00 25.33  ? 113  ASP B O   1 
ATOM   4029 C  CB  . ASP C 1 110 ? 17.944 107.199 49.134 1.00 16.52  ? 113  ASP B CB  1 
ATOM   4030 C  CG  . ASP C 1 110 ? 18.660 107.480 47.824 1.00 15.11  ? 113  ASP B CG  1 
ATOM   4031 O  OD1 . ASP C 1 110 ? 19.773 106.932 47.538 1.00 24.28  ? 113  ASP B OD1 1 
ATOM   4032 O  OD2 . ASP C 1 110 ? 18.094 108.252 47.031 1.00 27.33  ? 113  ASP B OD2 1 
ATOM   4033 N  N   . ASP C 1 111 ? 19.517 104.825 51.502 1.00 23.84  ? 114  ASP B N   1 
ATOM   4034 C  CA  . ASP C 1 111 ? 20.643 104.704 52.450 1.00 19.20  ? 114  ASP B CA  1 
ATOM   4035 C  C   . ASP C 1 111 ? 21.785 104.150 51.632 1.00 14.42  ? 114  ASP B C   1 
ATOM   4036 O  O   . ASP C 1 111 ? 22.942 104.497 51.873 1.00 20.46  ? 114  ASP B O   1 
ATOM   4037 C  CB  . ASP C 1 111 ? 20.292 103.731 53.582 1.00 19.60  ? 114  ASP B CB  1 
ATOM   4038 C  CG  . ASP C 1 111 ? 19.161 104.240 54.466 1.00 27.33  ? 114  ASP B CG  1 
ATOM   4039 O  OD1 . ASP C 1 111 ? 19.093 105.447 54.740 1.00 32.62  ? 114  ASP B OD1 1 
ATOM   4040 O  OD2 . ASP C 1 111 ? 18.314 103.437 54.887 1.00 36.04  ? 114  ASP B OD2 1 
ATOM   4041 N  N   . ILE C 1 112 ? 21.433 103.290 50.663 1.00 16.79  ? 115  ILE B N   1 
ATOM   4042 C  CA  . ILE C 1 112 ? 22.385 102.666 49.729 1.00 18.66  ? 115  ILE B CA  1 
ATOM   4043 C  C   . ILE C 1 112 ? 22.048 103.251 48.363 1.00 15.66  ? 115  ILE B C   1 
ATOM   4044 O  O   . ILE C 1 112 ? 20.967 102.989 47.840 1.00 19.81  ? 115  ILE B O   1 
ATOM   4045 C  CB  . ILE C 1 112 ? 22.182 101.111 49.506 1.00 20.02  ? 115  ILE B CB  1 
ATOM   4046 C  CG1 . ILE C 1 112 ? 22.047 100.344 50.808 1.00 31.18  ? 115  ILE B CG1 1 
ATOM   4047 C  CG2 . ILE C 1 112 ? 23.393 100.516 48.735 1.00 22.06  ? 115  ILE B CG2 1 
ATOM   4048 C  CD1 . ILE C 1 112 ? 21.683 98.876  50.552 1.00 18.06  ? 115  ILE B CD1 1 
ATOM   4049 N  N   . TYR C 1 113 ? 22.982 103.969 47.756 1.00 16.35  ? 116  TYR B N   1 
ATOM   4050 C  CA  . TYR C 1 113 ? 22.718 104.527 46.437 1.00 19.08  ? 116  TYR B CA  1 
ATOM   4051 C  C   . TYR C 1 113 ? 22.574 103.379 45.434 1.00 18.72  ? 116  TYR B C   1 
ATOM   4052 O  O   . TYR C 1 113 ? 23.363 102.429 45.428 1.00 18.74  ? 116  TYR B O   1 
ATOM   4053 C  CB  . TYR C 1 113 ? 23.856 105.434 45.976 1.00 14.18  ? 116  TYR B CB  1 
ATOM   4054 C  CG  . TYR C 1 113 ? 23.692 105.861 44.527 1.00 13.22  ? 116  TYR B CG  1 
ATOM   4055 C  CD1 . TYR C 1 113 ? 22.796 106.877 44.193 1.00 9.91   ? 116  TYR B CD1 1 
ATOM   4056 C  CD2 . TYR C 1 113 ? 24.358 105.212 43.497 1.00 12.79  ? 116  TYR B CD2 1 
ATOM   4057 C  CE1 . TYR C 1 113 ? 22.571 107.224 42.884 1.00 8.50   ? 116  TYR B CE1 1 
ATOM   4058 C  CE2 . TYR C 1 113 ? 24.131 105.561 42.162 1.00 12.89  ? 116  TYR B CE2 1 
ATOM   4059 C  CZ  . TYR C 1 113 ? 23.227 106.579 41.871 1.00 11.59  ? 116  TYR B CZ  1 
ATOM   4060 O  OH  . TYR C 1 113 ? 22.924 106.947 40.566 1.00 12.25  ? 116  TYR B OH  1 
ATOM   4061 N  N   . CYS C 1 114 ? 21.602 103.506 44.553 1.00 13.50  ? 117  CYS B N   1 
ATOM   4062 C  CA  . CYS C 1 114 ? 21.367 102.505 43.545 1.00 11.21  ? 117  CYS B CA  1 
ATOM   4063 C  C   . CYS C 1 114 ? 20.949 103.269 42.300 1.00 14.17  ? 117  CYS B C   1 
ATOM   4064 O  O   . CYS C 1 114 ? 20.019 104.099 42.368 1.00 18.81  ? 117  CYS B O   1 
ATOM   4065 C  CB  . CYS C 1 114 ? 20.232 101.593 44.023 1.00 13.75  ? 117  CYS B CB  1 
ATOM   4066 S  SG  . CYS C 1 114 ? 19.771 100.345 42.834 1.00 20.30  ? 117  CYS B SG  1 
ATOM   4067 N  N   . PRO C 1 115 ? 21.649 103.070 41.164 1.00 15.09  ? 118  PRO B N   1 
ATOM   4068 C  CA  . PRO C 1 115 ? 21.277 103.773 39.916 1.00 14.64  ? 118  PRO B CA  1 
ATOM   4069 C  C   . PRO C 1 115 ? 19.861 103.356 39.430 1.00 14.50  ? 118  PRO B C   1 
ATOM   4070 O  O   . PRO C 1 115 ? 19.383 102.267 39.726 1.00 13.89  ? 118  PRO B O   1 
ATOM   4071 C  CB  . PRO C 1 115 ? 22.387 103.391 38.938 1.00 15.05  ? 118  PRO B CB  1 
ATOM   4072 C  CG  . PRO C 1 115 ? 22.931 102.038 39.493 1.00 13.17  ? 118  PRO B CG  1 
ATOM   4073 C  CD  . PRO C 1 115 ? 22.841 102.211 40.987 1.00 23.09  ? 118  PRO B CD  1 
ATOM   4074 N  N   . PRO C 1 116 ? 19.185 104.220 38.665 1.00 21.47  ? 119  PRO B N   1 
ATOM   4075 C  CA  . PRO C 1 116 ? 17.817 103.904 38.194 1.00 16.89  ? 119  PRO B CA  1 
ATOM   4076 C  C   . PRO C 1 116 ? 17.552 102.583 37.469 1.00 13.61  ? 119  PRO B C   1 
ATOM   4077 O  O   . PRO C 1 116 ? 16.578 101.892 37.787 1.00 16.45  ? 119  PRO B O   1 
ATOM   4078 C  CB  . PRO C 1 116 ? 17.409 105.146 37.357 1.00 19.79  ? 119  PRO B CB  1 
ATOM   4079 C  CG  . PRO C 1 116 ? 18.403 106.230 37.776 1.00 28.77  ? 119  PRO B CG  1 
ATOM   4080 C  CD  . PRO C 1 116 ? 19.711 105.455 38.047 1.00 20.44  ? 119  PRO B CD  1 
ATOM   4081 N  N   . GLU C 1 117 ? 18.391 102.222 36.508 1.00 12.55  ? 120  GLU B N   1 
ATOM   4082 C  CA  . GLU C 1 117 ? 18.182 100.966 35.799 1.00 19.05  ? 120  GLU B CA  1 
ATOM   4083 C  C   . GLU C 1 117 ? 18.193 99.766  36.775 1.00 17.85  ? 120  GLU B C   1 
ATOM   4084 O  O   . GLU C 1 117 ? 17.316 98.896  36.734 1.00 16.54  ? 120  GLU B O   1 
ATOM   4085 C  CB  . GLU C 1 117 ? 19.175 100.824 34.629 1.00 21.60  ? 120  GLU B CB  1 
ATOM   4086 C  CG  . GLU C 1 117 ? 20.574 101.420 34.896 1.00 38.51  ? 120  GLU B CG  1 
ATOM   4087 C  CD  . GLU C 1 117 ? 20.605 102.949 34.748 1.00 42.51  ? 120  GLU B CD  1 
ATOM   4088 O  OE1 . GLU C 1 117 ? 19.934 103.484 33.829 1.00 46.48  ? 120  GLU B OE1 1 
ATOM   4089 O  OE2 . GLU C 1 117 ? 21.304 103.617 35.544 1.00 52.16  ? 120  GLU B OE2 1 
ATOM   4090 N  N   . THR C 1 118 ? 19.191 99.729  37.650 1.00 17.56  ? 121  THR B N   1 
ATOM   4091 C  CA  . THR C 1 118 ? 19.283 98.677  38.654 1.00 16.16  ? 121  THR B CA  1 
ATOM   4092 C  C   . THR C 1 118 ? 18.083 98.742  39.619 1.00 17.19  ? 121  THR B C   1 
ATOM   4093 O  O   . THR C 1 118 ? 17.510 97.688  39.962 1.00 12.14  ? 121  THR B O   1 
ATOM   4094 C  CB  . THR C 1 118 ? 20.589 98.817  39.397 1.00 16.41  ? 121  THR B CB  1 
ATOM   4095 O  OG1 . THR C 1 118 ? 21.622 98.660  38.437 1.00 18.08  ? 121  THR B OG1 1 
ATOM   4096 C  CG2 . THR C 1 118 ? 20.736 97.727  40.504 1.00 13.50  ? 121  THR B CG2 1 
ATOM   4097 N  N   . ALA C 1 119 ? 17.682 99.960  40.028 1.00 13.50  ? 122  ALA B N   1 
ATOM   4098 C  CA  . ALA C 1 119 ? 16.537 100.093 40.941 1.00 11.40  ? 122  ALA B CA  1 
ATOM   4099 C  C   . ALA C 1 119 ? 15.251 99.496  40.329 1.00 13.15  ? 122  ALA B C   1 
ATOM   4100 O  O   . ALA C 1 119 ? 14.443 98.894  41.045 1.00 20.02  ? 122  ALA B O   1 
ATOM   4101 C  CB  . ALA C 1 119 ? 16.298 101.562 41.352 1.00 12.47  ? 122  ALA B CB  1 
ATOM   4102 N  N   . VAL C 1 120 ? 15.055 99.647  39.018 1.00 13.56  ? 123  VAL B N   1 
ATOM   4103 C  CA  . VAL C 1 120 ? 13.866 99.080  38.399 1.00 11.52  ? 123  VAL B CA  1 
ATOM   4104 C  C   . VAL C 1 120 ? 13.977 97.555  38.255 1.00 16.59  ? 123  VAL B C   1 
ATOM   4105 O  O   . VAL C 1 120 ? 12.990 96.827  38.430 1.00 14.24  ? 123  VAL B O   1 
ATOM   4106 C  CB  . VAL C 1 120 ? 13.507 99.742  37.041 1.00 13.62  ? 123  VAL B CB  1 
ATOM   4107 C  CG1 . VAL C 1 120 ? 12.201 99.100  36.480 1.00 16.13  ? 123  VAL B CG1 1 
ATOM   4108 C  CG2 . VAL C 1 120 ? 13.262 101.244 37.249 1.00 12.77  ? 123  VAL B CG2 1 
ATOM   4109 N  N   . LEU C 1 121 ? 15.186 97.064  37.993 1.00 14.83  ? 124  LEU B N   1 
ATOM   4110 C  CA  . LEU C 1 121 ? 15.363 95.624  37.874 1.00 12.14  ? 124  LEU B CA  1 
ATOM   4111 C  C   . LEU C 1 121 ? 15.134 95.035  39.252 1.00 18.99  ? 124  LEU B C   1 
ATOM   4112 O  O   . LEU C 1 121 ? 14.366 94.077  39.396 1.00 13.53  ? 124  LEU B O   1 
ATOM   4113 C  CB  . LEU C 1 121 ? 16.712 95.248  37.310 1.00 11.12  ? 124  LEU B CB  1 
ATOM   4114 C  CG  . LEU C 1 121 ? 16.973 93.749  37.097 1.00 14.03  ? 124  LEU B CG  1 
ATOM   4115 C  CD1 . LEU C 1 121 ? 15.962 93.142  36.151 1.00 17.60  ? 124  LEU B CD1 1 
ATOM   4116 C  CD2 . LEU C 1 121 ? 18.373 93.643  36.511 1.00 13.16  ? 124  LEU B CD2 1 
ATOM   4117 N  N   . LEU C 1 122 ? 15.702 95.663  40.280 1.00 13.53  ? 125  LEU B N   1 
ATOM   4118 C  CA  . LEU C 1 122 ? 15.498 95.168  41.641 1.00 15.67  ? 125  LEU B CA  1 
ATOM   4119 C  C   . LEU C 1 122 ? 13.986 95.173  41.996 1.00 12.68  ? 125  LEU B C   1 
ATOM   4120 O  O   . LEU C 1 122 ? 13.457 94.204  42.579 1.00 14.18  ? 125  LEU B O   1 
ATOM   4121 C  CB  . LEU C 1 122 ? 16.328 95.973  42.650 1.00 13.14  ? 125  LEU B CB  1 
ATOM   4122 C  CG  . LEU C 1 122 ? 17.861 95.741  42.665 1.00 12.27  ? 125  LEU B CG  1 
ATOM   4123 C  CD1 . LEU C 1 122 ? 18.506 96.679  43.685 1.00 7.62   ? 125  LEU B CD1 1 
ATOM   4124 C  CD2 . LEU C 1 122 ? 18.166 94.256  43.041 1.00 13.27  ? 125  LEU B CD2 1 
ATOM   4125 N  N   . ALA C 1 123 ? 13.304 96.272  41.703 1.00 11.59  ? 126  ALA B N   1 
ATOM   4126 C  CA  . ALA C 1 123 ? 11.858 96.372  41.966 1.00 16.04  ? 126  ALA B CA  1 
ATOM   4127 C  C   . ALA C 1 123 ? 11.064 95.180  41.353 1.00 19.10  ? 126  ALA B C   1 
ATOM   4128 O  O   . ALA C 1 123 ? 10.161 94.639  41.996 1.00 15.98  ? 126  ALA B O   1 
ATOM   4129 C  CB  . ALA C 1 123 ? 11.316 97.718  41.380 1.00 8.15   ? 126  ALA B CB  1 
ATOM   4130 N  N   . SER C 1 124 ? 11.423 94.794  40.118 1.00 15.31  ? 127  SER B N   1 
ATOM   4131 C  CA  . SER C 1 124 ? 10.772 93.696  39.410 1.00 17.70  ? 127  SER B CA  1 
ATOM   4132 C  C   . SER C 1 124 ? 10.999 92.320  40.095 1.00 20.29  ? 127  SER B C   1 
ATOM   4133 O  O   . SER C 1 124 ? 10.074 91.482  40.164 1.00 14.41  ? 127  SER B O   1 
ATOM   4134 C  CB  . SER C 1 124 ? 11.156 93.709  37.922 1.00 10.50  ? 127  SER B CB  1 
ATOM   4135 O  OG  . SER C 1 124 ? 12.475 93.215  37.628 1.00 13.29  ? 127  SER B OG  1 
ATOM   4136 N  N   . TYR C 1 125 ? 12.216 92.088  40.618 1.00 17.37  ? 128  TYR B N   1 
ATOM   4137 C  CA  . TYR C 1 125 ? 12.510 90.861  41.363 1.00 16.82  ? 128  TYR B CA  1 
ATOM   4138 C  C   . TYR C 1 125 ? 11.740 90.879  42.712 1.00 18.56  ? 128  TYR B C   1 
ATOM   4139 O  O   . TYR C 1 125 ? 11.243 89.830  43.157 1.00 20.76  ? 128  TYR B O   1 
ATOM   4140 C  CB  . TYR C 1 125 ? 14.012 90.642  41.609 1.00 16.68  ? 128  TYR B CB  1 
ATOM   4141 C  CG  . TYR C 1 125 ? 14.792 90.277  40.393 1.00 18.73  ? 128  TYR B CG  1 
ATOM   4142 C  CD1 . TYR C 1 125 ? 15.852 91.088  39.955 1.00 18.59  ? 128  TYR B CD1 1 
ATOM   4143 C  CD2 . TYR C 1 125 ? 14.476 89.135  39.641 1.00 21.57  ? 128  TYR B CD2 1 
ATOM   4144 C  CE1 . TYR C 1 125 ? 16.576 90.759  38.785 1.00 20.30  ? 128  TYR B CE1 1 
ATOM   4145 C  CE2 . TYR C 1 125 ? 15.209 88.793  38.448 1.00 19.48  ? 128  TYR B CE2 1 
ATOM   4146 C  CZ  . TYR C 1 125 ? 16.250 89.618  38.037 1.00 23.37  ? 128  TYR B CZ  1 
ATOM   4147 O  OH  . TYR C 1 125 ? 16.962 89.342  36.881 1.00 32.51  ? 128  TYR B OH  1 
ATOM   4148 N  N   . ALA C 1 126 ? 11.688 92.044  43.381 1.00 13.49  ? 129  ALA B N   1 
ATOM   4149 C  CA  . ALA C 1 126 ? 10.926 92.196  44.620 1.00 16.69  ? 129  ALA B CA  1 
ATOM   4150 C  C   . ALA C 1 126 ? 9.416  91.878  44.351 1.00 14.56  ? 129  ALA B C   1 
ATOM   4151 O  O   . ALA C 1 126 ? 8.764  91.262  45.180 1.00 16.29  ? 129  ALA B O   1 
ATOM   4152 C  CB  . ALA C 1 126 ? 11.111 93.590  45.193 1.00 12.27  ? 129  ALA B CB  1 
ATOM   4153 N  N   . VAL C 1 127 ? 8.901  92.281  43.181 1.00 18.47  ? 130  VAL B N   1 
ATOM   4154 C  CA  . VAL C 1 127 ? 7.518  92.030  42.758 1.00 18.79  ? 130  VAL B CA  1 
ATOM   4155 C  C   . VAL C 1 127 ? 7.293  90.525  42.479 1.00 20.71  ? 130  VAL B C   1 
ATOM   4156 O  O   . VAL C 1 127 ? 6.307  89.920  42.967 1.00 14.55  ? 130  VAL B O   1 
ATOM   4157 C  CB  . VAL C 1 127 ? 7.114  92.903  41.529 1.00 16.63  ? 130  VAL B CB  1 
ATOM   4158 C  CG1 . VAL C 1 127 ? 5.832  92.375  40.868 1.00 13.73  ? 130  VAL B CG1 1 
ATOM   4159 C  CG2 . VAL C 1 127 ? 6.855  94.344  42.011 1.00 14.55  ? 130  VAL B CG2 1 
ATOM   4160 N  N   . GLN C 1 128 ? 8.242  89.890  41.796 1.00 17.46  ? 131  GLN B N   1 
ATOM   4161 C  CA  . GLN C 1 128 ? 8.123  88.447  41.551 1.00 19.78  ? 131  GLN B CA  1 
ATOM   4162 C  C   . GLN C 1 128 ? 8.107  87.686  42.897 1.00 23.03  ? 131  GLN B C   1 
ATOM   4163 O  O   . GLN C 1 128 ? 7.296  86.804  43.121 1.00 16.72  ? 131  GLN B O   1 
ATOM   4164 C  CB  . GLN C 1 128 ? 9.281  87.990  40.648 1.00 15.35  ? 131  GLN B CB  1 
ATOM   4165 C  CG  . GLN C 1 128 ? 9.302  86.490  40.277 1.00 18.84  ? 131  GLN B CG  1 
ATOM   4166 C  CD  . GLN C 1 128 ? 8.125  86.058  39.397 1.00 15.20  ? 131  GLN B CD  1 
ATOM   4167 O  OE1 . GLN C 1 128 ? 7.519  86.866  38.656 1.00 13.62  ? 131  GLN B OE1 1 
ATOM   4168 N  NE2 . GLN C 1 128 ? 7.794  84.765  39.481 1.00 15.33  ? 131  GLN B NE2 1 
ATOM   4169 N  N   . SER C 1 129 ? 8.975  88.093  43.811 1.00 19.40  ? 132  SER B N   1 
ATOM   4170 C  CA  . SER C 1 129 ? 9.042  87.522  45.122 1.00 23.16  ? 132  SER B CA  1 
ATOM   4171 C  C   . SER C 1 129 ? 7.719  87.712  45.944 1.00 22.15  ? 132  SER B C   1 
ATOM   4172 O  O   . SER C 1 129 ? 7.261  86.814  46.637 1.00 25.47  ? 132  SER B O   1 
ATOM   4173 C  CB  . SER C 1 129 ? 10.227 88.183  45.829 1.00 25.08  ? 132  SER B CB  1 
ATOM   4174 O  OG  . SER C 1 129 ? 10.283 87.796  47.181 1.00 38.20  ? 132  SER B OG  1 
ATOM   4175 N  N   . LYS C 1 130 ? 7.126  88.885  45.890 1.00 18.51  ? 133  LYS B N   1 
ATOM   4176 C  CA  . LYS C 1 130 ? 5.914  89.127  46.629 1.00 15.73  ? 133  LYS B CA  1 
ATOM   4177 C  C   . LYS C 1 130 ? 4.711  88.445  46.000 1.00 18.65  ? 133  LYS B C   1 
ATOM   4178 O  O   . LYS C 1 130 ? 4.017  87.680  46.661 1.00 25.28  ? 133  LYS B O   1 
ATOM   4179 C  CB  . LYS C 1 130 ? 5.646  90.621  46.747 1.00 15.24  ? 133  LYS B CB  1 
ATOM   4180 C  CG  . LYS C 1 130 ? 4.327  90.912  47.427 1.00 13.29  ? 133  LYS B CG  1 
ATOM   4181 C  CD  . LYS C 1 130 ? 4.302  92.313  47.933 1.00 15.98  ? 133  LYS B CD  1 
ATOM   4182 C  CE  . LYS C 1 130 ? 2.908  92.686  48.331 1.00 14.52  ? 133  LYS B CE  1 
ATOM   4183 N  NZ  . LYS C 1 130 ? 2.844  94.072  48.871 1.00 25.15  ? 133  LYS B NZ  1 
ATOM   4184 N  N   . TYR C 1 131 ? 4.530  88.637  44.699 1.00 19.92  ? 134  TYR B N   1 
ATOM   4185 C  CA  . TYR C 1 131 ? 3.361  88.127  43.979 1.00 24.96  ? 134  TYR B CA  1 
ATOM   4186 C  C   . TYR C 1 131 ? 3.458  86.784  43.268 1.00 28.01  ? 134  TYR B C   1 
ATOM   4187 O  O   . TYR C 1 131 ? 2.436  86.194  42.940 1.00 31.50  ? 134  TYR B O   1 
ATOM   4188 C  CB  . TYR C 1 131 ? 2.860  89.149  42.941 1.00 18.03  ? 134  TYR B CB  1 
ATOM   4189 C  CG  . TYR C 1 131 ? 2.485  90.410  43.579 1.00 21.81  ? 134  TYR B CG  1 
ATOM   4190 C  CD1 . TYR C 1 131 ? 3.414  91.447  43.662 1.00 25.78  ? 134  TYR B CD1 1 
ATOM   4191 C  CD2 . TYR C 1 131 ? 1.243  90.572  44.163 1.00 18.30  ? 134  TYR B CD2 1 
ATOM   4192 C  CE1 . TYR C 1 131 ? 3.119  92.604  44.309 1.00 18.59  ? 134  TYR B CE1 1 
ATOM   4193 C  CE2 . TYR C 1 131 ? 0.932  91.745  44.824 1.00 17.43  ? 134  TYR B CE2 1 
ATOM   4194 C  CZ  . TYR C 1 131 ? 1.877  92.752  44.888 1.00 19.14  ? 134  TYR B CZ  1 
ATOM   4195 O  OH  . TYR C 1 131 ? 1.605  93.947  45.500 1.00 25.10  ? 134  TYR B OH  1 
ATOM   4196 N  N   . GLY C 1 132 ? 4.659  86.274  43.061 1.00 20.98  ? 135  GLY B N   1 
ATOM   4197 C  CA  . GLY C 1 132 ? 4.793  85.030  42.321 1.00 20.03  ? 135  GLY B CA  1 
ATOM   4198 C  C   . GLY C 1 132 ? 4.540  85.406  40.876 1.00 14.21  ? 135  GLY B C   1 
ATOM   4199 O  O   . GLY C 1 132 ? 4.531  86.593  40.583 1.00 15.51  ? 135  GLY B O   1 
ATOM   4200 N  N   . ASP C 1 133 ? 4.311  84.444  39.984 1.00 14.62  ? 136  ASP B N   1 
ATOM   4201 C  CA  . ASP C 1 133 ? 4.103  84.733  38.548 1.00 23.13  ? 136  ASP B CA  1 
ATOM   4202 C  C   . ASP C 1 133 ? 3.007  85.719  38.238 1.00 27.42  ? 136  ASP B C   1 
ATOM   4203 O  O   . ASP C 1 133 ? 1.924  85.670  38.839 1.00 27.58  ? 136  ASP B O   1 
ATOM   4204 C  CB  . ASP C 1 133 ? 3.815  83.475  37.730 1.00 23.95  ? 136  ASP B CB  1 
ATOM   4205 C  CG  . ASP C 1 133 ? 4.975  82.488  37.706 1.00 28.51  ? 136  ASP B CG  1 
ATOM   4206 O  OD1 . ASP C 1 133 ? 6.168  82.847  37.884 1.00 28.59  ? 136  ASP B OD1 1 
ATOM   4207 O  OD2 . ASP C 1 133 ? 4.674  81.301  37.489 1.00 31.73  ? 136  ASP B OD2 1 
ATOM   4208 N  N   . PHE C 1 134 ? 3.274  86.600  37.277 1.00 25.12  ? 137  PHE B N   1 
ATOM   4209 C  CA  . PHE C 1 134 ? 2.255  87.581  36.918 1.00 24.58  ? 137  PHE B CA  1 
ATOM   4210 C  C   . PHE C 1 134 ? 1.081  86.744  36.399 1.00 29.49  ? 137  PHE B C   1 
ATOM   4211 O  O   . PHE C 1 134 ? 1.292  85.727  35.720 1.00 27.46  ? 137  PHE B O   1 
ATOM   4212 C  CB  . PHE C 1 134 ? 2.739  88.555  35.839 1.00 18.72  ? 137  PHE B CB  1 
ATOM   4213 C  CG  . PHE C 1 134 ? 1.655  89.470  35.333 1.00 25.00  ? 137  PHE B CG  1 
ATOM   4214 C  CD1 . PHE C 1 134 ? 1.200  90.527  36.112 1.00 23.68  ? 137  PHE B CD1 1 
ATOM   4215 C  CD2 . PHE C 1 134 ? 1.032  89.228  34.117 1.00 28.73  ? 137  PHE B CD2 1 
ATOM   4216 C  CE1 . PHE C 1 134 ? 0.144  91.329  35.701 1.00 27.09  ? 137  PHE B CE1 1 
ATOM   4217 C  CE2 . PHE C 1 134 ? -0.036 90.036  33.692 1.00 28.98  ? 137  PHE B CE2 1 
ATOM   4218 C  CZ  . PHE C 1 134 ? -0.477 91.086  34.490 1.00 25.55  ? 137  PHE B CZ  1 
ATOM   4219 N  N   . ASN C 1 135 ? -0.125 87.124  36.824 1.00 27.84  ? 138  ASN B N   1 
ATOM   4220 C  CA  . ASN C 1 135 ? -1.374 86.483  36.436 1.00 29.20  ? 138  ASN B CA  1 
ATOM   4221 C  C   . ASN C 1 135 ? -2.368 87.574  35.989 1.00 26.92  ? 138  ASN B C   1 
ATOM   4222 O  O   . ASN C 1 135 ? -2.899 88.295  36.836 1.00 28.26  ? 138  ASN B O   1 
ATOM   4223 C  CB  . ASN C 1 135 ? -1.953 85.729  37.628 1.00 29.70  ? 138  ASN B CB  1 
ATOM   4224 C  CG  . ASN C 1 135 ? -3.235 84.964  37.278 1.00 40.92  ? 138  ASN B CG  1 
ATOM   4225 O  OD1 . ASN C 1 135 ? -3.921 85.261  36.288 1.00 40.06  ? 138  ASN B OD1 1 
ATOM   4226 N  ND2 . ASN C 1 135 ? -3.553 83.966  38.090 1.00 41.45  ? 138  ASN B ND2 1 
ATOM   4227 N  N   . LYS C 1 136 ? -2.694 87.639  34.697 1.00 27.14  ? 139  LYS B N   1 
ATOM   4228 C  CA  . LYS C 1 136 ? -3.616 88.681  34.215 1.00 35.64  ? 139  LYS B CA  1 
ATOM   4229 C  C   . LYS C 1 136 ? -4.969 88.749  34.936 1.00 36.54  ? 139  LYS B C   1 
ATOM   4230 O  O   . LYS C 1 136 ? -5.621 89.809  34.927 1.00 39.28  ? 139  LYS B O   1 
ATOM   4231 C  CB  . LYS C 1 136 ? -3.835 88.572  32.690 1.00 39.15  ? 139  LYS B CB  1 
ATOM   4232 N  N   . GLU C 1 137 ? -5.341 87.648  35.605 1.00 42.55  ? 140  GLU B N   1 
ATOM   4233 C  CA  . GLU C 1 137 ? -6.618 87.512  36.340 1.00 44.74  ? 140  GLU B CA  1 
ATOM   4234 C  C   . GLU C 1 137 ? -6.676 88.109  37.715 1.00 41.50  ? 140  GLU B C   1 
ATOM   4235 O  O   . GLU C 1 137 ? -7.725 88.548  38.176 1.00 33.77  ? 140  GLU B O   1 
ATOM   4236 C  CB  . GLU C 1 137 ? -6.999 86.025  36.502 1.00 50.53  ? 140  GLU B CB  1 
ATOM   4237 C  CG  . GLU C 1 137 ? -7.655 85.420  35.253 1.00 62.00  ? 140  GLU B CG  1 
ATOM   4238 C  CD  . GLU C 1 137 ? -8.605 86.418  34.561 1.00 65.23  ? 140  GLU B CD  1 
ATOM   4239 O  OE1 . GLU C 1 137 ? -9.520 86.963  35.237 1.00 65.11  ? 140  GLU B OE1 1 
ATOM   4240 O  OE2 . GLU C 1 137 ? -8.414 86.678  33.348 1.00 57.61  ? 140  GLU B OE2 1 
ATOM   4241 N  N   . VAL C 1 138 ? -5.542 88.034  38.385 1.00 39.85  ? 141  VAL B N   1 
ATOM   4242 C  CA  . VAL C 1 138 ? -5.380 88.501  39.747 1.00 35.70  ? 141  VAL B CA  1 
ATOM   4243 C  C   . VAL C 1 138 ? -4.728 89.876  39.808 1.00 33.70  ? 141  VAL B C   1 
ATOM   4244 O  O   . VAL C 1 138 ? -5.156 90.768  40.542 1.00 31.53  ? 141  VAL B O   1 
ATOM   4245 C  CB  . VAL C 1 138 ? -4.444 87.470  40.463 1.00 37.66  ? 141  VAL B CB  1 
ATOM   4246 C  CG1 . VAL C 1 138 ? -4.260 87.803  41.901 1.00 30.80  ? 141  VAL B CG1 1 
ATOM   4247 C  CG2 . VAL C 1 138 ? -4.969 86.048  40.280 1.00 26.30  ? 141  VAL B CG2 1 
ATOM   4248 N  N   . HIS C 1 139 ? -3.705 90.031  38.984 1.00 27.87  ? 142  HIS B N   1 
ATOM   4249 C  CA  . HIS C 1 139 ? -2.921 91.238  38.941 1.00 29.07  ? 142  HIS B CA  1 
ATOM   4250 C  C   . HIS C 1 139 ? -3.445 92.209  37.926 1.00 29.32  ? 142  HIS B C   1 
ATOM   4251 O  O   . HIS C 1 139 ? -2.865 92.375  36.868 1.00 33.01  ? 142  HIS B O   1 
ATOM   4252 C  CB  . HIS C 1 139 ? -1.461 90.834  38.699 1.00 21.29  ? 142  HIS B CB  1 
ATOM   4253 C  CG  . HIS C 1 139 ? -0.970 89.830  39.696 1.00 15.78  ? 142  HIS B CG  1 
ATOM   4254 N  ND1 . HIS C 1 139 ? -0.315 88.674  39.338 1.00 18.02  ? 142  HIS B ND1 1 
ATOM   4255 C  CD2 . HIS C 1 139 ? -1.090 89.789  41.045 1.00 23.08  ? 142  HIS B CD2 1 
ATOM   4256 C  CE1 . HIS C 1 139 ? -0.060 87.957  40.418 1.00 19.54  ? 142  HIS B CE1 1 
ATOM   4257 N  NE2 . HIS C 1 139 ? -0.518 88.610  41.468 1.00 19.24  ? 142  HIS B NE2 1 
ATOM   4258 N  N   . LYS C 1 140 ? -4.557 92.853  38.273 1.00 34.45  ? 143  LYS B N   1 
ATOM   4259 C  CA  . LYS C 1 140 ? -5.211 93.845  37.410 1.00 33.63  ? 143  LYS B CA  1 
ATOM   4260 C  C   . LYS C 1 140 ? -4.577 95.207  37.656 1.00 33.75  ? 143  LYS B C   1 
ATOM   4261 O  O   . LYS C 1 140 ? -3.816 95.404  38.605 1.00 29.67  ? 143  LYS B O   1 
ATOM   4262 C  CB  . LYS C 1 140 ? -6.696 93.970  37.780 1.00 37.43  ? 143  LYS B CB  1 
ATOM   4263 C  CG  . LYS C 1 140 ? -7.480 92.670  37.857 1.00 35.58  ? 143  LYS B CG  1 
ATOM   4264 C  CD  . LYS C 1 140 ? -7.577 92.024  36.523 1.00 46.16  ? 143  LYS B CD  1 
ATOM   4265 C  CE  . LYS C 1 140 ? -8.607 90.918  36.576 1.00 57.21  ? 143  LYS B CE  1 
ATOM   4266 N  NZ  . LYS C 1 140 ? -8.565 90.102  35.326 1.00 66.81  ? 143  LYS B NZ  1 
ATOM   4267 N  N   . SER C 1 141 ? -4.932 96.149  36.799 1.00 30.63  ? 144  SER B N   1 
ATOM   4268 C  CA  . SER C 1 141 ? -4.479 97.519  36.880 1.00 31.05  ? 144  SER B CA  1 
ATOM   4269 C  C   . SER C 1 141 ? -4.541 97.974  38.344 1.00 33.27  ? 144  SER B C   1 
ATOM   4270 O  O   . SER C 1 141 ? -5.585 97.863  39.009 1.00 31.69  ? 144  SER B O   1 
ATOM   4271 C  CB  . SER C 1 141 ? -5.399 98.391  36.019 1.00 32.44  ? 144  SER B CB  1 
ATOM   4272 O  OG  . SER C 1 141 ? -4.990 99.739  36.027 1.00 47.56  ? 144  SER B OG  1 
ATOM   4273 N  N   . GLY C 1 142 ? -3.392 98.414  38.859 1.00 30.81  ? 145  GLY B N   1 
ATOM   4274 C  CA  . GLY C 1 142 ? -3.314 98.885  40.229 1.00 20.91  ? 145  GLY B CA  1 
ATOM   4275 C  C   . GLY C 1 142 ? -2.804 97.863  41.239 1.00 19.56  ? 145  GLY B C   1 
ATOM   4276 O  O   . GLY C 1 142 ? -2.685 98.209  42.398 1.00 19.74  ? 145  GLY B O   1 
ATOM   4277 N  N   . TYR C 1 143 ? -2.465 96.638  40.847 1.00 18.08  ? 146  TYR B N   1 
ATOM   4278 C  CA  . TYR C 1 143 ? -1.997 95.683  41.848 1.00 18.81  ? 146  TYR B CA  1 
ATOM   4279 C  C   . TYR C 1 143 ? -0.709 96.087  42.630 1.00 16.15  ? 146  TYR B C   1 
ATOM   4280 O  O   . TYR C 1 143 ? -0.492 95.673  43.768 1.00 18.75  ? 146  TYR B O   1 
ATOM   4281 C  CB  . TYR C 1 143 ? -1.875 94.283  41.266 1.00 17.03  ? 146  TYR B CB  1 
ATOM   4282 C  CG  . TYR C 1 143 ? -0.649 94.043  40.429 1.00 16.83  ? 146  TYR B CG  1 
ATOM   4283 C  CD1 . TYR C 1 143 ? -0.502 94.668  39.182 1.00 23.33  ? 146  TYR B CD1 1 
ATOM   4284 C  CD2 . TYR C 1 143 ? 0.345  93.161  40.862 1.00 17.62  ? 146  TYR B CD2 1 
ATOM   4285 C  CE1 . TYR C 1 143 ? 0.590  94.424  38.370 1.00 25.22  ? 146  TYR B CE1 1 
ATOM   4286 C  CE2 . TYR C 1 143 ? 1.466  92.909  40.059 1.00 23.12  ? 146  TYR B CE2 1 
ATOM   4287 C  CZ  . TYR C 1 143 ? 1.569  93.542  38.816 1.00 19.40  ? 146  TYR B CZ  1 
ATOM   4288 O  OH  . TYR C 1 143 ? 2.631  93.292  38.001 1.00 20.67  ? 146  TYR B OH  1 
ATOM   4289 N  N   . LEU C 1 144 ? 0.053  97.004  42.058 1.00 18.90  ? 147  LEU B N   1 
ATOM   4290 C  CA  . LEU C 1 144 ? 1.289  97.500  42.664 1.00 18.83  ? 147  LEU B CA  1 
ATOM   4291 C  C   . LEU C 1 144 ? 1.134  98.884  43.303 1.00 17.65  ? 147  LEU B C   1 
ATOM   4292 O  O   . LEU C 1 144 ? 2.116  99.491  43.755 1.00 20.55  ? 147  LEU B O   1 
ATOM   4293 C  CB  . LEU C 1 144 ? 2.416  97.522  41.625 1.00 18.41  ? 147  LEU B CB  1 
ATOM   4294 C  CG  . LEU C 1 144 ? 2.881  96.253  40.931 1.00 17.17  ? 147  LEU B CG  1 
ATOM   4295 C  CD1 . LEU C 1 144 ? 3.965  96.615  39.982 1.00 12.72  ? 147  LEU B CD1 1 
ATOM   4296 C  CD2 . LEU C 1 144 ? 3.387  95.260  41.924 1.00 16.18  ? 147  LEU B CD2 1 
ATOM   4297 N  N   . ALA C 1 145 ? -0.103 99.359  43.395 1.00 16.52  ? 148  ALA B N   1 
ATOM   4298 C  CA  . ALA C 1 145 ? -0.386 100.690 43.923 1.00 19.25  ? 148  ALA B CA  1 
ATOM   4299 C  C   . ALA C 1 145 ? 0.051  100.969 45.370 1.00 17.83  ? 148  ALA B C   1 
ATOM   4300 O  O   . ALA C 1 145 ? 0.398  102.101 45.706 1.00 22.76  ? 148  ALA B O   1 
ATOM   4301 C  CB  . ALA C 1 145 ? -1.904 101.050 43.692 1.00 18.58  ? 148  ALA B CB  1 
ATOM   4302 N  N   . GLY C 1 146 ? 0.038  99.936  46.214 1.00 22.07  ? 149  GLY B N   1 
ATOM   4303 C  CA  . GLY C 1 146 ? 0.418  100.091 47.611 1.00 19.13  ? 149  GLY B CA  1 
ATOM   4304 C  C   . GLY C 1 146 ? 1.855  99.665  47.919 1.00 21.34  ? 149  GLY B C   1 
ATOM   4305 O  O   . GLY C 1 146 ? 2.266  99.673  49.053 1.00 23.02  ? 149  GLY B O   1 
ATOM   4306 N  N   . ASP C 1 147 ? 2.629  99.346  46.891 1.00 18.34  ? 150  ASP B N   1 
ATOM   4307 C  CA  . ASP C 1 147 ? 4.026  98.935  47.045 1.00 18.62  ? 150  ASP B CA  1 
ATOM   4308 C  C   . ASP C 1 147 ? 5.060  100.079 46.913 1.00 18.35  ? 150  ASP B C   1 
ATOM   4309 O  O   . ASP C 1 147 ? 4.939  100.939 46.036 1.00 23.65  ? 150  ASP B O   1 
ATOM   4310 C  CB  . ASP C 1 147 ? 4.387  97.882  45.981 1.00 13.92  ? 150  ASP B CB  1 
ATOM   4311 C  CG  . ASP C 1 147 ? 3.718  96.551  46.196 1.00 27.94  ? 150  ASP B CG  1 
ATOM   4312 O  OD1 . ASP C 1 147 ? 4.182  95.585  45.576 1.00 34.73  ? 150  ASP B OD1 1 
ATOM   4313 O  OD2 . ASP C 1 147 ? 2.748  96.448  46.963 1.00 33.41  ? 150  ASP B OD2 1 
ATOM   4314 N  N   . LYS C 1 148 ? 6.103  100.059 47.741 1.00 16.13  ? 151  LYS B N   1 
ATOM   4315 C  CA  . LYS C 1 148 ? 7.172  101.049 47.613 1.00 18.91  ? 151  LYS B CA  1 
ATOM   4316 C  C   . LYS C 1 148 ? 8.164  100.317 46.672 1.00 19.14  ? 151  LYS B C   1 
ATOM   4317 O  O   . LYS C 1 148 ? 8.924  99.435  47.095 1.00 18.56  ? 151  LYS B O   1 
ATOM   4318 C  CB  . LYS C 1 148 ? 7.772  101.383 48.998 1.00 21.48  ? 151  LYS B CB  1 
ATOM   4319 C  CG  . LYS C 1 148 ? 8.795  102.482 48.953 1.00 19.54  ? 151  LYS B CG  1 
ATOM   4320 C  CD  . LYS C 1 148 ? 9.174  102.879 50.366 1.00 34.60  ? 151  LYS B CD  1 
ATOM   4321 C  CE  . LYS C 1 148 ? 10.304 103.934 50.433 1.00 44.01  ? 151  LYS B CE  1 
ATOM   4322 N  NZ  . LYS C 1 148 ? 10.076 105.140 49.554 1.00 49.80  ? 151  LYS B NZ  1 
ATOM   4323 N  N   . LEU C 1 149 ? 8.086  100.641 45.379 1.00 16.45  ? 152  LEU B N   1 
ATOM   4324 C  CA  . LEU C 1 149 ? 8.888  99.979  44.388 1.00 14.59  ? 152  LEU B CA  1 
ATOM   4325 C  C   . LEU C 1 149 ? 10.222 100.640 44.126 1.00 14.83  ? 152  LEU B C   1 
ATOM   4326 O  O   . LEU C 1 149 ? 11.164 99.945  43.802 1.00 13.21  ? 152  LEU B O   1 
ATOM   4327 C  CB  . LEU C 1 149 ? 8.116  99.934  43.068 1.00 22.69  ? 152  LEU B CB  1 
ATOM   4328 C  CG  . LEU C 1 149 ? 6.679  99.355  43.031 1.00 21.41  ? 152  LEU B CG  1 
ATOM   4329 C  CD1 . LEU C 1 149 ? 5.901  99.788  41.729 1.00 19.73  ? 152  LEU B CD1 1 
ATOM   4330 C  CD2 . LEU C 1 149 ? 6.729  97.874  43.197 1.00 17.70  ? 152  LEU B CD2 1 
ATOM   4331 N  N   . LEU C 1 150 ? 10.300 101.969 44.277 1.00 14.12  ? 153  LEU B N   1 
ATOM   4332 C  CA  . LEU C 1 150 ? 11.525 102.709 43.962 1.00 13.50  ? 153  LEU B CA  1 
ATOM   4333 C  C   . LEU C 1 150 ? 11.890 103.803 44.922 1.00 11.96  ? 153  LEU B C   1 
ATOM   4334 O  O   . LEU C 1 150 ? 11.066 104.217 45.702 1.00 12.04  ? 153  LEU B O   1 
ATOM   4335 C  CB  . LEU C 1 150 ? 11.421 103.336 42.541 1.00 10.74  ? 153  LEU B CB  1 
ATOM   4336 C  CG  . LEU C 1 150 ? 11.242 102.418 41.334 1.00 11.95  ? 153  LEU B CG  1 
ATOM   4337 C  CD1 . LEU C 1 150 ? 10.816 103.207 40.170 1.00 12.79  ? 153  LEU B CD1 1 
ATOM   4338 C  CD2 . LEU C 1 150 ? 12.468 101.684 41.005 1.00 15.78  ? 153  LEU B CD2 1 
ATOM   4339 N  N   . PRO C 1 151 ? 13.201 104.160 44.980 1.00 12.19  ? 154  PRO B N   1 
ATOM   4340 C  CA  . PRO C 1 151 ? 13.648 105.242 45.868 1.00 14.08  ? 154  PRO B CA  1 
ATOM   4341 C  C   . PRO C 1 151 ? 13.104 106.545 45.302 1.00 18.08  ? 154  PRO B C   1 
ATOM   4342 O  O   . PRO C 1 151 ? 13.039 106.697 44.086 1.00 14.73  ? 154  PRO B O   1 
ATOM   4343 C  CB  . PRO C 1 151 ? 15.179 105.221 45.765 1.00 13.66  ? 154  PRO B CB  1 
ATOM   4344 C  CG  . PRO C 1 151 ? 15.523 104.163 44.763 1.00 16.45  ? 154  PRO B CG  1 
ATOM   4345 C  CD  . PRO C 1 151 ? 14.307 103.271 44.609 1.00 13.88  ? 154  PRO B CD  1 
ATOM   4346 N  N   . GLN C 1 152 ? 12.655 107.448 46.170 1.00 22.53  ? 155  GLN B N   1 
ATOM   4347 C  CA  . GLN C 1 152 ? 12.100 108.732 45.752 1.00 20.21  ? 155  GLN B CA  1 
ATOM   4348 C  C   . GLN C 1 152 ? 12.941 109.424 44.663 1.00 17.21  ? 155  GLN B C   1 
ATOM   4349 O  O   . GLN C 1 152 ? 12.397 109.988 43.733 1.00 20.74  ? 155  GLN B O   1 
ATOM   4350 C  CB  . GLN C 1 152 ? 12.020 109.649 46.964 1.00 31.90  ? 155  GLN B CB  1 
ATOM   4351 C  CG  . GLN C 1 152 ? 11.093 110.817 46.738 1.00 37.26  ? 155  GLN B CG  1 
ATOM   4352 C  CD  . GLN C 1 152 ? 9.708  110.319 46.435 1.00 36.70  ? 155  GLN B CD  1 
ATOM   4353 O  OE1 . GLN C 1 152 ? 9.254  109.318 47.027 1.00 40.02  ? 155  GLN B OE1 1 
ATOM   4354 N  NE2 . GLN C 1 152 ? 9.047  110.958 45.476 1.00 42.92  ? 155  GLN B NE2 1 
ATOM   4355 N  N   . ARG C 1 153 ? 14.262 109.371 44.784 1.00 18.25  ? 156  ARG B N   1 
ATOM   4356 C  CA  . ARG C 1 153 ? 15.178 109.984 43.813 1.00 17.52  ? 156  ARG B CA  1 
ATOM   4357 C  C   . ARG C 1 153 ? 14.904 109.500 42.376 1.00 18.81  ? 156  ARG B C   1 
ATOM   4358 O  O   . ARG C 1 153 ? 14.944 110.288 41.429 1.00 19.02  ? 156  ARG B O   1 
ATOM   4359 C  CB  . ARG C 1 153 ? 16.634 109.664 44.220 1.00 22.54  ? 156  ARG B CB  1 
ATOM   4360 C  CG  . ARG C 1 153 ? 17.638 109.653 43.082 1.00 17.81  ? 156  ARG B CG  1 
ATOM   4361 C  CD  . ARG C 1 153 ? 19.049 109.298 43.581 1.00 19.48  ? 156  ARG B CD  1 
ATOM   4362 N  NE  . ARG C 1 153 ? 19.128 108.021 44.322 1.00 20.61  ? 156  ARG B NE  1 
ATOM   4363 C  CZ  . ARG C 1 153 ? 19.136 106.798 43.779 1.00 24.11  ? 156  ARG B CZ  1 
ATOM   4364 N  NH1 . ARG C 1 153 ? 19.057 106.664 42.475 1.00 22.32  ? 156  ARG B NH1 1 
ATOM   4365 N  NH2 . ARG C 1 153 ? 19.243 105.696 44.535 1.00 21.14  ? 156  ARG B NH2 1 
ATOM   4366 N  N   . VAL C 1 154 ? 14.652 108.197 42.204 1.00 20.39  ? 157  VAL B N   1 
ATOM   4367 C  CA  . VAL C 1 154 ? 14.369 107.653 40.866 1.00 20.63  ? 157  VAL B CA  1 
ATOM   4368 C  C   . VAL C 1 154 ? 13.013 108.236 40.341 1.00 21.34  ? 157  VAL B C   1 
ATOM   4369 O  O   . VAL C 1 154 ? 12.942 108.785 39.220 1.00 22.16  ? 157  VAL B O   1 
ATOM   4370 C  CB  . VAL C 1 154 ? 14.417 106.081 40.869 1.00 19.20  ? 157  VAL B CB  1 
ATOM   4371 C  CG1 . VAL C 1 154 ? 14.243 105.503 39.440 1.00 20.23  ? 157  VAL B CG1 1 
ATOM   4372 C  CG2 . VAL C 1 154 ? 15.729 105.585 41.456 1.00 13.04  ? 157  VAL B CG2 1 
ATOM   4373 N  N   . LEU C 1 155 ? 11.995 108.273 41.201 1.00 23.11  ? 158  LEU B N   1 
ATOM   4374 C  CA  . LEU C 1 155 ? 10.690 108.824 40.804 1.00 24.69  ? 158  LEU B CA  1 
ATOM   4375 C  C   . LEU C 1 155 ? 10.829 110.303 40.331 1.00 30.32  ? 158  LEU B C   1 
ATOM   4376 O  O   . LEU C 1 155 ? 10.336 110.675 39.256 1.00 30.41  ? 158  LEU B O   1 
ATOM   4377 C  CB  . LEU C 1 155 ? 9.691  108.711 41.964 1.00 19.23  ? 158  LEU B CB  1 
ATOM   4378 C  CG  . LEU C 1 155 ? 9.484  107.248 42.436 1.00 23.06  ? 158  LEU B CG  1 
ATOM   4379 C  CD1 . LEU C 1 155 ? 8.644  107.190 43.697 1.00 19.06  ? 158  LEU B CD1 1 
ATOM   4380 C  CD2 . LEU C 1 155 ? 8.895  106.353 41.339 1.00 15.00  ? 158  LEU B CD2 1 
ATOM   4381 N  N   . GLU C 1 156 ? 11.587 111.100 41.089 1.00 30.25  ? 159  GLU B N   1 
ATOM   4382 C  CA  . GLU C 1 156 ? 11.820 112.523 40.798 1.00 33.57  ? 159  GLU B CA  1 
ATOM   4383 C  C   . GLU C 1 156 ? 12.650 112.831 39.558 1.00 34.22  ? 159  GLU B C   1 
ATOM   4384 O  O   . GLU C 1 156 ? 12.666 113.962 39.074 1.00 38.93  ? 159  GLU B O   1 
ATOM   4385 C  CB  . GLU C 1 156 ? 12.510 113.207 41.981 1.00 29.22  ? 159  GLU B CB  1 
ATOM   4386 C  CG  . GLU C 1 156 ? 11.621 113.387 43.198 1.00 41.69  ? 159  GLU B CG  1 
ATOM   4387 C  CD  . GLU C 1 156 ? 12.400 113.756 44.464 1.00 55.76  ? 159  GLU B CD  1 
ATOM   4388 O  OE1 . GLU C 1 156 ? 13.661 113.738 44.447 1.00 54.64  ? 159  GLU B OE1 1 
ATOM   4389 O  OE2 . GLU C 1 156 ? 11.735 114.058 45.485 1.00 61.41  ? 159  GLU B OE2 1 
ATOM   4390 N  N   . GLN C 1 157 ? 13.381 111.844 39.078 1.00 30.07  ? 160  GLN B N   1 
ATOM   4391 C  CA  . GLN C 1 157 ? 14.193 112.037 37.897 1.00 29.68  ? 160  GLN B CA  1 
ATOM   4392 C  C   . GLN C 1 157 ? 13.568 111.610 36.622 1.00 30.96  ? 160  GLN B C   1 
ATOM   4393 O  O   . GLN C 1 157 ? 14.140 111.908 35.591 1.00 31.83  ? 160  GLN B O   1 
ATOM   4394 C  CB  . GLN C 1 157 ? 15.480 111.268 38.048 1.00 31.12  ? 160  GLN B CB  1 
ATOM   4395 C  CG  . GLN C 1 157 ? 16.072 111.646 39.318 1.00 43.75  ? 160  GLN B CG  1 
ATOM   4396 C  CD  . GLN C 1 157 ? 17.409 111.092 39.479 1.00 38.68  ? 160  GLN B CD  1 
ATOM   4397 O  OE1 . GLN C 1 157 ? 17.709 110.002 38.979 1.00 52.42  ? 160  GLN B OE1 1 
ATOM   4398 N  NE2 . GLN C 1 157 ? 18.260 111.849 40.136 1.00 30.50  ? 160  GLN B NE2 1 
ATOM   4399 N  N   . HIS C 1 158 ? 12.450 110.864 36.674 1.00 23.52  ? 161  HIS B N   1 
ATOM   4400 C  CA  . HIS C 1 158 ? 11.803 110.402 35.448 1.00 20.94  ? 161  HIS B CA  1 
ATOM   4401 C  C   . HIS C 1 158 ? 10.435 111.025 35.349 1.00 21.60  ? 161  HIS B C   1 
ATOM   4402 O  O   . HIS C 1 158 ? 9.764  111.247 36.355 1.00 23.70  ? 161  HIS B O   1 
ATOM   4403 C  CB  . HIS C 1 158 ? 11.778 108.867 35.393 1.00 20.61  ? 161  HIS B CB  1 
ATOM   4404 C  CG  . HIS C 1 158 ? 13.159 108.257 35.379 1.00 24.08  ? 161  HIS B CG  1 
ATOM   4405 N  ND1 . HIS C 1 158 ? 13.903 108.059 36.523 1.00 21.31  ? 161  HIS B ND1 1 
ATOM   4406 C  CD2 . HIS C 1 158 ? 13.946 107.861 34.354 1.00 16.07  ? 161  HIS B CD2 1 
ATOM   4407 C  CE1 . HIS C 1 158 ? 15.080 107.566 36.200 1.00 20.64  ? 161  HIS B CE1 1 
ATOM   4408 N  NE2 . HIS C 1 158 ? 15.131 107.440 34.890 1.00 18.88  ? 161  HIS B NE2 1 
ATOM   4409 N  N   . LYS C 1 159 ? 10.118 111.441 34.131 1.00 21.18  ? 162  LYS B N   1 
ATOM   4410 C  CA  . LYS C 1 159 ? 8.847  112.073 33.820 1.00 24.24  ? 162  LYS B CA  1 
ATOM   4411 C  C   . LYS C 1 159 ? 7.829  110.963 33.535 1.00 22.80  ? 162  LYS B C   1 
ATOM   4412 O  O   . LYS C 1 159 ? 7.542  110.608 32.373 1.00 25.39  ? 162  LYS B O   1 
ATOM   4413 C  CB  . LYS C 1 159 ? 9.101  113.060 32.669 1.00 20.64  ? 162  LYS B CB  1 
ATOM   4414 C  CG  . LYS C 1 159 ? 10.033 114.260 33.047 1.00 22.50  ? 162  LYS B CG  1 
ATOM   4415 C  CD  . LYS C 1 159 ? 10.494 114.933 31.767 1.00 34.51  ? 162  LYS B CD  1 
ATOM   4416 C  CE  . LYS C 1 159 ? 11.294 116.199 31.965 1.00 51.55  ? 162  LYS B CE  1 
ATOM   4417 N  NZ  . LYS C 1 159 ? 11.708 116.812 30.641 1.00 53.92  ? 162  LYS B NZ  1 
ATOM   4418 N  N   . LEU C 1 160 ? 7.436  110.318 34.643 1.00 24.63  ? 163  LEU B N   1 
ATOM   4419 C  CA  . LEU C 1 160 ? 6.487  109.196 34.671 1.00 22.19  ? 163  LEU B CA  1 
ATOM   4420 C  C   . LEU C 1 160 ? 5.617  109.295 35.900 1.00 21.30  ? 163  LEU B C   1 
ATOM   4421 O  O   . LEU C 1 160 ? 6.099  109.644 36.985 1.00 21.15  ? 163  LEU B O   1 
ATOM   4422 C  CB  . LEU C 1 160 ? 7.240  107.854 34.727 1.00 17.19  ? 163  LEU B CB  1 
ATOM   4423 C  CG  . LEU C 1 160 ? 8.198  107.623 33.584 1.00 23.47  ? 163  LEU B CG  1 
ATOM   4424 C  CD1 . LEU C 1 160 ? 8.981  106.382 33.780 1.00 28.13  ? 163  LEU B CD1 1 
ATOM   4425 C  CD2 . LEU C 1 160 ? 7.419  107.566 32.301 1.00 28.61  ? 163  LEU B CD2 1 
ATOM   4426 N  N   . ASN C 1 161 ? 4.333  108.950 35.756 1.00 21.68  ? 164  ASN B N   1 
ATOM   4427 C  CA  . ASN C 1 161 ? 3.435  108.978 36.892 1.00 22.52  ? 164  ASN B CA  1 
ATOM   4428 C  C   . ASN C 1 161 ? 3.381  107.573 37.435 1.00 18.00  ? 164  ASN B C   1 
ATOM   4429 O  O   . ASN C 1 161 ? 3.994  106.615 36.901 1.00 21.15  ? 164  ASN B O   1 
ATOM   4430 C  CB  . ASN C 1 161 ? 2.025  109.426 36.544 1.00 26.98  ? 164  ASN B CB  1 
ATOM   4431 C  CG  . ASN C 1 161 ? 1.454  108.662 35.388 1.00 28.32  ? 164  ASN B CG  1 
ATOM   4432 O  OD1 . ASN C 1 161 ? 1.646  107.463 35.254 1.00 23.77  ? 164  ASN B OD1 1 
ATOM   4433 N  ND2 . ASN C 1 161 ? 0.797  109.375 34.507 1.00 32.45  ? 164  ASN B ND2 1 
ATOM   4434 N  N   . LYS C 1 162 ? 2.623  107.471 38.507 1.00 25.08  ? 165  LYS B N   1 
ATOM   4435 C  CA  . LYS C 1 162 ? 2.451  106.231 39.210 1.00 27.90  ? 165  LYS B CA  1 
ATOM   4436 C  C   . LYS C 1 162 ? 1.997  105.122 38.262 1.00 24.97  ? 165  LYS B C   1 
ATOM   4437 O  O   . LYS C 1 162 ? 2.564  104.048 38.215 1.00 22.29  ? 165  LYS B O   1 
ATOM   4438 C  CB  . LYS C 1 162 ? 1.476  106.439 40.368 1.00 27.43  ? 165  LYS B CB  1 
ATOM   4439 C  CG  . LYS C 1 162 ? 1.513  105.349 41.436 1.00 31.77  ? 165  LYS B CG  1 
ATOM   4440 C  CD  . LYS C 1 162 ? 1.231  105.932 42.825 1.00 39.43  ? 165  LYS B CD  1 
ATOM   4441 C  CE  . LYS C 1 162 ? 1.061  104.857 43.884 1.00 34.82  ? 165  LYS B CE  1 
ATOM   4442 N  NZ  . LYS C 1 162 ? -0.205 104.201 43.627 1.00 40.26  ? 165  LYS B NZ  1 
ATOM   4443 N  N   . ASP C 1 163 ? 1.014  105.403 37.441 1.00 27.83  ? 166  ASP B N   1 
ATOM   4444 C  CA  . ASP C 1 163 ? 0.509  104.381 36.545 1.00 27.57  ? 166  ASP B CA  1 
ATOM   4445 C  C   . ASP C 1 163 ? 1.516  103.925 35.519 1.00 29.40  ? 166  ASP B C   1 
ATOM   4446 O  O   . ASP C 1 163 ? 1.616  102.725 35.267 1.00 26.41  ? 166  ASP B O   1 
ATOM   4447 C  CB  . ASP C 1 163 ? -0.790 104.826 35.885 1.00 37.22  ? 166  ASP B CB  1 
ATOM   4448 C  CG  . ASP C 1 163 ? -1.717 105.482 36.863 1.00 52.00  ? 166  ASP B CG  1 
ATOM   4449 O  OD1 . ASP C 1 163 ? -1.921 104.925 37.964 1.00 55.22  ? 166  ASP B OD1 1 
ATOM   4450 O  OD2 . ASP C 1 163 ? -2.202 106.588 36.552 1.00 65.25  ? 166  ASP B OD2 1 
ATOM   4451 N  N   . GLN C 1 164 ? 2.292  104.867 34.967 1.00 25.46  ? 167  GLN B N   1 
ATOM   4452 C  CA  . GLN C 1 164 ? 3.299  104.561 33.954 1.00 24.67  ? 167  GLN B CA  1 
ATOM   4453 C  C   . GLN C 1 164 ? 4.379  103.672 34.617 1.00 20.92  ? 167  GLN B C   1 
ATOM   4454 O  O   . GLN C 1 164 ? 4.813  102.664 34.033 1.00 21.11  ? 167  GLN B O   1 
ATOM   4455 C  CB  . GLN C 1 164 ? 3.904  105.863 33.432 1.00 28.64  ? 167  GLN B CB  1 
ATOM   4456 C  CG  . GLN C 1 164 ? 2.884  106.751 32.764 1.00 23.63  ? 167  GLN B CG  1 
ATOM   4457 C  CD  . GLN C 1 164 ? 3.470  108.030 32.265 1.00 19.92  ? 167  GLN B CD  1 
ATOM   4458 O  OE1 . GLN C 1 164 ? 3.774  108.900 33.041 1.00 27.54  ? 167  GLN B OE1 1 
ATOM   4459 N  NE2 . GLN C 1 164 ? 3.576  108.178 30.957 1.00 25.39  ? 167  GLN B NE2 1 
ATOM   4460 N  N   . TRP C 1 165 ? 4.757  104.031 35.853 1.00 18.24  ? 168  TRP B N   1 
ATOM   4461 C  CA  . TRP C 1 165 ? 5.727  103.246 36.579 1.00 24.35  ? 168  TRP B CA  1 
ATOM   4462 C  C   . TRP C 1 165 ? 5.226  101.789 36.804 1.00 20.52  ? 168  TRP B C   1 
ATOM   4463 O  O   . TRP C 1 165 ? 5.965  100.820 36.574 1.00 23.72  ? 168  TRP B O   1 
ATOM   4464 C  CB  . TRP C 1 165 ? 6.072  103.892 37.914 1.00 24.07  ? 168  TRP B CB  1 
ATOM   4465 C  CG  . TRP C 1 165 ? 7.204  104.851 37.871 1.00 17.90  ? 168  TRP B CG  1 
ATOM   4466 C  CD1 . TRP C 1 165 ? 7.178  106.139 38.299 1.00 18.34  ? 168  TRP B CD1 1 
ATOM   4467 C  CD2 . TRP C 1 165 ? 8.527  104.614 37.374 1.00 15.13  ? 168  TRP B CD2 1 
ATOM   4468 N  NE1 . TRP C 1 165 ? 8.405  106.731 38.101 1.00 17.66  ? 168  TRP B NE1 1 
ATOM   4469 C  CE2 . TRP C 1 165 ? 9.253  105.823 37.529 1.00 13.78  ? 168  TRP B CE2 1 
ATOM   4470 C  CE3 . TRP C 1 165 ? 9.172  103.501 36.802 1.00 15.08  ? 168  TRP B CE3 1 
ATOM   4471 C  CZ2 . TRP C 1 165 ? 10.584 105.961 37.142 1.00 15.19  ? 168  TRP B CZ2 1 
ATOM   4472 C  CZ3 . TRP C 1 165 ? 10.508 103.629 36.407 1.00 21.45  ? 168  TRP B CZ3 1 
ATOM   4473 C  CH2 . TRP C 1 165 ? 11.201 104.858 36.581 1.00 22.18  ? 168  TRP B CH2 1 
ATOM   4474 N  N   . GLU C 1 166 ? 3.963  101.639 37.203 1.00 21.16  ? 169  GLU B N   1 
ATOM   4475 C  CA  . GLU C 1 166 ? 3.383  100.310 37.419 1.00 19.53  ? 169  GLU B CA  1 
ATOM   4476 C  C   . GLU C 1 166 ? 3.340  99.470  36.151 1.00 22.21  ? 169  GLU B C   1 
ATOM   4477 O  O   . GLU C 1 166 ? 3.667  98.291  36.158 1.00 26.31  ? 169  GLU B O   1 
ATOM   4478 C  CB  . GLU C 1 166 ? 2.025  100.418 38.119 1.00 22.24  ? 169  GLU B CB  1 
ATOM   4479 C  CG  . GLU C 1 166 ? 2.267  100.925 39.592 1.00 38.49  ? 169  GLU B CG  1 
ATOM   4480 C  CD  . GLU C 1 166 ? 1.036  101.334 40.426 1.00 36.74  ? 169  GLU B CD  1 
ATOM   4481 O  OE1 . GLU C 1 166 ? -0.082 100.820 40.243 1.00 38.05  ? 169  GLU B OE1 1 
ATOM   4482 O  OE2 . GLU C 1 166 ? 1.225  102.168 41.327 1.00 41.93  ? 169  GLU B OE2 1 
ATOM   4483 N  N   . GLU C 1 167 ? 3.047  100.118 35.029 1.00 22.59  ? 170  GLU B N   1 
ATOM   4484 C  CA  . GLU C 1 167 ? 2.977  99.448  33.743 1.00 21.67  ? 170  GLU B CA  1 
ATOM   4485 C  C   . GLU C 1 167 ? 4.340  98.956  33.289 1.00 21.41  ? 170  GLU B C   1 
ATOM   4486 O  O   . GLU C 1 167 ? 4.452  97.903  32.655 1.00 23.76  ? 170  GLU B O   1 
ATOM   4487 C  CB  . GLU C 1 167 ? 2.427  100.412 32.688 1.00 22.27  ? 170  GLU B CB  1 
ATOM   4488 C  CG  . GLU C 1 167 ? 0.969  100.699 32.910 1.00 41.80  ? 170  GLU B CG  1 
ATOM   4489 C  CD  . GLU C 1 167 ? 0.447  101.844 32.076 1.00 53.22  ? 170  GLU B CD  1 
ATOM   4490 O  OE1 . GLU C 1 167 ? 1.046  102.142 31.017 1.00 58.82  ? 170  GLU B OE1 1 
ATOM   4491 O  OE2 . GLU C 1 167 ? -0.567 102.452 32.494 1.00 60.24  ? 170  GLU B OE2 1 
ATOM   4492 N  N   . ARG C 1 168 ? 5.358  99.793  33.510 1.00 20.00  ? 171  ARG B N   1 
ATOM   4493 C  CA  . ARG C 1 168 ? 6.715  99.468  33.080 1.00 16.70  ? 171  ARG B CA  1 
ATOM   4494 C  C   . ARG C 1 168 ? 7.228  98.317  33.914 1.00 19.16  ? 171  ARG B C   1 
ATOM   4495 O  O   . ARG C 1 168 ? 7.787  97.354  33.376 1.00 19.74  ? 171  ARG B O   1 
ATOM   4496 C  CB  . ARG C 1 168 ? 7.618  100.692 33.186 1.00 17.72  ? 171  ARG B CB  1 
ATOM   4497 C  CG  . ARG C 1 168 ? 7.570  101.570 31.950 1.00 21.33  ? 171  ARG B CG  1 
ATOM   4498 C  CD  . ARG C 1 168 ? 7.982  102.976 32.330 1.00 26.86  ? 171  ARG B CD  1 
ATOM   4499 N  NE  . ARG C 1 168 ? 8.083  103.858 31.170 1.00 26.97  ? 171  ARG B NE  1 
ATOM   4500 C  CZ  . ARG C 1 168 ? 9.079  103.863 30.277 1.00 33.68  ? 171  ARG B CZ  1 
ATOM   4501 N  NH1 . ARG C 1 168 ? 10.096 103.014 30.367 1.00 34.39  ? 171  ARG B NH1 1 
ATOM   4502 N  NH2 . ARG C 1 168 ? 9.116  104.809 29.340 1.00 30.73  ? 171  ARG B NH2 1 
ATOM   4503 N  N   . ILE C 1 169 ? 6.928  98.385  35.213 1.00 18.73  ? 172  ILE B N   1 
ATOM   4504 C  CA  . ILE C 1 169 ? 7.340  97.366  36.177 1.00 21.59  ? 172  ILE B CA  1 
ATOM   4505 C  C   . ILE C 1 169 ? 6.614  96.042  35.953 1.00 23.67  ? 172  ILE B C   1 
ATOM   4506 O  O   . ILE C 1 169 ? 7.217  94.961  36.106 1.00 21.27  ? 172  ILE B O   1 
ATOM   4507 C  CB  . ILE C 1 169 ? 7.295  97.904  37.664 1.00 18.69  ? 172  ILE B CB  1 
ATOM   4508 C  CG1 . ILE C 1 169 ? 8.359  99.012  37.764 1.00 17.90  ? 172  ILE B CG1 1 
ATOM   4509 C  CG2 . ILE C 1 169 ? 7.554  96.753  38.691 1.00 10.93  ? 172  ILE B CG2 1 
ATOM   4510 C  CD1 . ILE C 1 169 ? 8.295  99.872  38.942 1.00 20.68  ? 172  ILE B CD1 1 
ATOM   4511 N  N   . GLN C 1 170 ? 5.376  96.130  35.464 1.00 18.70  ? 173  GLN B N   1 
ATOM   4512 C  CA  . GLN C 1 170 ? 4.557  94.934  35.184 1.00 15.40  ? 173  GLN B CA  1 
ATOM   4513 C  C   . GLN C 1 170 ? 5.175  94.187  34.015 1.00 13.85  ? 173  GLN B C   1 
ATOM   4514 O  O   . GLN C 1 170 ? 5.184  92.960  33.972 1.00 20.02  ? 173  GLN B O   1 
ATOM   4515 C  CB  . GLN C 1 170 ? 3.074  95.347  34.920 1.00 22.18  ? 173  GLN B CB  1 
ATOM   4516 C  CG  . GLN C 1 170 ? 2.081  94.235  34.546 1.00 25.58  ? 173  GLN B CG  1 
ATOM   4517 C  CD  . GLN C 1 170 ? 2.213  93.826  33.103 1.00 38.34  ? 173  GLN B CD  1 
ATOM   4518 O  OE1 . GLN C 1 170 ? 2.421  94.681  32.233 1.00 50.10  ? 173  GLN B OE1 1 
ATOM   4519 N  NE2 . GLN C 1 170 ? 2.155  92.512  32.830 1.00 35.44  ? 173  GLN B NE2 1 
ATOM   4520 N  N   . VAL C 1 171 ? 5.752  94.915  33.076 1.00 16.19  ? 174  VAL B N   1 
ATOM   4521 C  CA  . VAL C 1 171 ? 6.367  94.236  31.961 1.00 23.13  ? 174  VAL B CA  1 
ATOM   4522 C  C   . VAL C 1 171 ? 7.526  93.394  32.460 1.00 21.53  ? 174  VAL B C   1 
ATOM   4523 O  O   . VAL C 1 171 ? 7.672  92.223  32.085 1.00 18.97  ? 174  VAL B O   1 
ATOM   4524 C  CB  . VAL C 1 171 ? 6.797  95.205  30.828 1.00 20.77  ? 174  VAL B CB  1 
ATOM   4525 C  CG1 . VAL C 1 171 ? 7.561  94.428  29.723 1.00 18.46  ? 174  VAL B CG1 1 
ATOM   4526 C  CG2 . VAL C 1 171 ? 5.551  95.894  30.238 1.00 23.12  ? 174  VAL B CG2 1 
ATOM   4527 N  N   . TRP C 1 172 ? 8.294  93.973  33.379 1.00 18.83  ? 175  TRP B N   1 
ATOM   4528 C  CA  . TRP C 1 172 ? 9.440  93.306  33.951 1.00 13.69  ? 175  TRP B CA  1 
ATOM   4529 C  C   . TRP C 1 172 ? 9.051  92.174  34.858 1.00 15.80  ? 175  TRP B C   1 
ATOM   4530 O  O   . TRP C 1 172 ? 9.753  91.139  34.877 1.00 19.63  ? 175  TRP B O   1 
ATOM   4531 C  CB  . TRP C 1 172 ? 10.410 94.296  34.591 1.00 15.43  ? 175  TRP B CB  1 
ATOM   4532 C  CG  . TRP C 1 172 ? 11.226 95.032  33.534 1.00 17.01  ? 175  TRP B CG  1 
ATOM   4533 C  CD1 . TRP C 1 172 ? 11.003 96.285  33.055 1.00 14.87  ? 175  TRP B CD1 1 
ATOM   4534 C  CD2 . TRP C 1 172 ? 12.300 94.482  32.747 1.00 18.49  ? 175  TRP B CD2 1 
ATOM   4535 N  NE1 . TRP C 1 172 ? 11.858 96.555  31.998 1.00 13.48  ? 175  TRP B NE1 1 
ATOM   4536 C  CE2 . TRP C 1 172 ? 12.665 95.463  31.791 1.00 18.80  ? 175  TRP B CE2 1 
ATOM   4537 C  CE3 . TRP C 1 172 ? 12.986 93.240  32.750 1.00 20.81  ? 175  TRP B CE3 1 
ATOM   4538 C  CZ2 . TRP C 1 172 ? 13.695 95.251  30.843 1.00 20.71  ? 175  TRP B CZ2 1 
ATOM   4539 C  CZ3 . TRP C 1 172 ? 13.999 93.028  31.807 1.00 26.47  ? 175  TRP B CZ3 1 
ATOM   4540 C  CH2 . TRP C 1 172 ? 14.342 94.038  30.861 1.00 18.93  ? 175  TRP B CH2 1 
ATOM   4541 N  N   . HIS C 1 173 ? 7.969  92.368  35.628 1.00 14.18  ? 176  HIS B N   1 
ATOM   4542 C  CA  . HIS C 1 173 ? 7.431  91.317  36.526 1.00 20.76  ? 176  HIS B CA  1 
ATOM   4543 C  C   . HIS C 1 173 ? 7.186  90.086  35.647 1.00 24.11  ? 176  HIS B C   1 
ATOM   4544 O  O   . HIS C 1 173 ? 7.650  88.978  35.938 1.00 16.08  ? 176  HIS B O   1 
ATOM   4545 C  CB  . HIS C 1 173 ? 6.070  91.734  37.072 1.00 16.74  ? 176  HIS B CB  1 
ATOM   4546 C  CG  . HIS C 1 173 ? 5.402  90.679  37.896 1.00 17.08  ? 176  HIS B CG  1 
ATOM   4547 N  ND1 . HIS C 1 173 ? 4.186  90.885  38.507 1.00 24.12  ? 176  HIS B ND1 1 
ATOM   4548 C  CD2 . HIS C 1 173 ? 5.841  89.478  38.345 1.00 18.73  ? 176  HIS B CD2 1 
ATOM   4549 C  CE1 . HIS C 1 173 ? 3.915  89.872  39.312 1.00 22.71  ? 176  HIS B CE1 1 
ATOM   4550 N  NE2 . HIS C 1 173 ? 4.904  89.008  39.231 1.00 16.20  ? 176  HIS B NE2 1 
ATOM   4551 N  N   . GLU C 1 174 ? 6.407  90.329  34.587 1.00 25.15  ? 177  GLU B N   1 
ATOM   4552 C  CA  . GLU C 1 174 ? 6.012  89.334  33.592 1.00 25.36  ? 177  GLU B CA  1 
ATOM   4553 C  C   . GLU C 1 174 ? 7.228  88.601  33.006 1.00 25.16  ? 177  GLU B C   1 
ATOM   4554 O  O   . GLU C 1 174 ? 7.172  87.392  32.714 1.00 27.38  ? 177  GLU B O   1 
ATOM   4555 C  CB  . GLU C 1 174 ? 5.204  90.023  32.497 1.00 26.31  ? 177  GLU B CB  1 
ATOM   4556 C  CG  . GLU C 1 174 ? 4.786  89.125  31.377 1.00 45.13  ? 177  GLU B CG  1 
ATOM   4557 C  CD  . GLU C 1 174 ? 3.287  88.945  31.333 1.00 55.94  ? 177  GLU B CD  1 
ATOM   4558 O  OE1 . GLU C 1 174 ? 2.834  87.820  31.655 1.00 58.00  ? 177  GLU B OE1 1 
ATOM   4559 O  OE2 . GLU C 1 174 ? 2.571  89.927  30.995 1.00 50.64  ? 177  GLU B OE2 1 
ATOM   4560 N  N   . GLU C 1 175 ? 8.339  89.329  32.872 1.00 22.49  ? 178  GLU B N   1 
ATOM   4561 C  CA  . GLU C 1 175 ? 9.593  88.775  32.341 1.00 20.19  ? 178  GLU B CA  1 
ATOM   4562 C  C   . GLU C 1 175 ? 10.242 87.632  33.151 1.00 17.43  ? 178  GLU B C   1 
ATOM   4563 O  O   . GLU C 1 175 ? 10.863 86.714  32.570 1.00 20.24  ? 178  GLU B O   1 
ATOM   4564 C  CB  . GLU C 1 175 ? 10.598 89.895  32.100 1.00 18.10  ? 178  GLU B CB  1 
ATOM   4565 C  CG  . GLU C 1 175 ? 11.937 89.468  31.525 1.00 29.50  ? 178  GLU B CG  1 
ATOM   4566 C  CD  . GLU C 1 175 ? 11.861 88.864  30.139 1.00 30.79  ? 178  GLU B CD  1 
ATOM   4567 O  OE1 . GLU C 1 175 ? 11.064 89.328  29.303 1.00 32.46  ? 178  GLU B OE1 1 
ATOM   4568 O  OE2 . GLU C 1 175 ? 12.642 87.938  29.880 1.00 29.35  ? 178  GLU B OE2 1 
ATOM   4569 N  N   . HIS C 1 176 ? 10.029 87.671  34.469 1.00 17.90  ? 179  HIS B N   1 
ATOM   4570 C  CA  . HIS C 1 176 ? 10.570 86.719  35.406 1.00 20.93  ? 179  HIS B CA  1 
ATOM   4571 C  C   . HIS C 1 176 ? 9.676  85.526  35.553 1.00 20.94  ? 179  HIS B C   1 
ATOM   4572 O  O   . HIS C 1 176 ? 9.886  84.747  36.478 1.00 19.43  ? 179  HIS B O   1 
ATOM   4573 C  CB  . HIS C 1 176 ? 10.753 87.345  36.800 1.00 18.45  ? 179  HIS B CB  1 
ATOM   4574 C  CG  . HIS C 1 176 ? 11.485 88.648  36.788 1.00 18.78  ? 179  HIS B CG  1 
ATOM   4575 N  ND1 . HIS C 1 176 ? 12.442 88.957  35.849 1.00 26.33  ? 179  HIS B ND1 1 
ATOM   4576 C  CD2 . HIS C 1 176 ? 11.358 89.740  37.564 1.00 14.73  ? 179  HIS B CD2 1 
ATOM   4577 C  CE1 . HIS C 1 176 ? 12.868 90.192  36.037 1.00 21.61  ? 179  HIS B CE1 1 
ATOM   4578 N  NE2 . HIS C 1 176 ? 12.227 90.686  37.075 1.00 21.85  ? 179  HIS B NE2 1 
ATOM   4579 N  N   . ARG C 1 177 ? 8.665  85.410  34.688 1.00 24.86  ? 180  ARG B N   1 
ATOM   4580 C  CA  . ARG C 1 177 ? 7.704  84.297  34.740 1.00 26.06  ? 180  ARG B CA  1 
ATOM   4581 C  C   . ARG C 1 177 ? 8.418  82.954  34.911 1.00 25.19  ? 180  ARG B C   1 
ATOM   4582 O  O   . ARG C 1 177 ? 9.411  82.658  34.221 1.00 25.52  ? 180  ARG B O   1 
ATOM   4583 C  CB  . ARG C 1 177 ? 6.798  84.333  33.484 1.00 29.39  ? 180  ARG B CB  1 
ATOM   4584 C  CG  . ARG C 1 177 ? 5.877  83.113  33.249 1.00 37.16  ? 180  ARG B CG  1 
ATOM   4585 C  CD  . ARG C 1 177 ? 4.625  83.492  32.415 1.00 39.51  ? 180  ARG B CD  1 
ATOM   4586 N  NE  . ARG C 1 177 ? 3.499  83.841  33.289 1.00 46.72  ? 180  ARG B NE  1 
ATOM   4587 C  CZ  . ARG C 1 177 ? 2.746  82.926  33.906 1.00 58.53  ? 180  ARG B CZ  1 
ATOM   4588 N  NH1 . ARG C 1 177 ? 3.000  81.631  33.716 1.00 60.75  ? 180  ARG B NH1 1 
ATOM   4589 N  NH2 . ARG C 1 177 ? 1.794  83.283  34.771 1.00 56.69  ? 180  ARG B NH2 1 
ATOM   4590 N  N   . GLY C 1 178 ? 7.956  82.202  35.908 1.00 25.78  ? 181  GLY B N   1 
ATOM   4591 C  CA  . GLY C 1 178 ? 8.539  80.906  36.227 1.00 30.86  ? 181  GLY B CA  1 
ATOM   4592 C  C   . GLY C 1 178 ? 9.611  80.869  37.312 1.00 30.94  ? 181  GLY B C   1 
ATOM   4593 O  O   . GLY C 1 178 ? 9.990  79.814  37.822 1.00 26.94  ? 181  GLY B O   1 
HETATM 4594 N  N   . MSE C 1 179 ? 10.114 82.036  37.676 1.00 30.08  ? 182  MSE B N   1 
HETATM 4595 C  CA  . MSE C 1 179 ? 11.124 82.118  38.706 1.00 27.28  ? 182  MSE B CA  1 
HETATM 4596 C  C   . MSE C 1 179 ? 10.508 81.962  40.113 1.00 23.10  ? 182  MSE B C   1 
HETATM 4597 O  O   . MSE C 1 179 ? 9.537  82.638  40.462 1.00 31.44  ? 182  MSE B O   1 
HETATM 4598 C  CB  . MSE C 1 179 ? 11.919 83.427  38.505 1.00 19.24  ? 182  MSE B CB  1 
HETATM 4599 C  CG  . MSE C 1 179 ? 12.896 83.792  39.604 1.00 28.74  ? 182  MSE B CG  1 
HETATM 4600 SE SE  . MSE C 1 179 ? 13.662 85.512  39.218 1.00 43.87  ? 182  MSE B SE  1 
HETATM 4601 C  CE  . MSE C 1 179 ? 15.624 85.017  39.246 1.00 36.78  ? 182  MSE B CE  1 
ATOM   4602 N  N   . LEU C 1 180 ? 10.993 81.008  40.899 1.00 22.17  ? 183  LEU B N   1 
ATOM   4603 C  CA  . LEU C 1 180 ? 10.438 80.847  42.240 1.00 19.34  ? 183  LEU B CA  1 
ATOM   4604 C  C   . LEU C 1 180 ? 10.692 82.074  43.057 1.00 23.14  ? 183  LEU B C   1 
ATOM   4605 O  O   . LEU C 1 180 ? 11.631 82.837  42.754 1.00 23.18  ? 183  LEU B O   1 
ATOM   4606 C  CB  . LEU C 1 180 ? 11.047 79.663  42.927 1.00 22.81  ? 183  LEU B CB  1 
ATOM   4607 C  CG  . LEU C 1 180 ? 10.889 78.405  42.101 1.00 27.44  ? 183  LEU B CG  1 
ATOM   4608 C  CD1 . LEU C 1 180 ? 11.848 77.394  42.674 1.00 39.61  ? 183  LEU B CD1 1 
ATOM   4609 C  CD2 . LEU C 1 180 ? 9.456  77.919  42.143 1.00 27.01  ? 183  LEU B CD2 1 
ATOM   4610 N  N   . ARG C 1 181 ? 9.859  82.268  44.078 1.00 23.96  ? 184  ARG B N   1 
ATOM   4611 C  CA  . ARG C 1 181 ? 9.931  83.425  44.970 1.00 29.14  ? 184  ARG B CA  1 
ATOM   4612 C  C   . ARG C 1 181 ? 11.287 83.564  45.666 1.00 29.71  ? 184  ARG B C   1 
ATOM   4613 O  O   . ARG C 1 181 ? 11.832 84.662  45.741 1.00 33.04  ? 184  ARG B O   1 
ATOM   4614 C  CB  . ARG C 1 181 ? 8.790  83.354  45.971 1.00 27.31  ? 184  ARG B CB  1 
ATOM   4615 C  CG  . ARG C 1 181 ? 7.398  83.586  45.298 1.00 45.08  ? 184  ARG B CG  1 
ATOM   4616 C  CD  . ARG C 1 181 ? 6.210  83.033  46.125 1.00 36.62  ? 184  ARG B CD  1 
ATOM   4617 N  NE  . ARG C 1 181 ? 5.147  84.008  46.343 1.00 38.38  ? 184  ARG B NE  1 
ATOM   4618 C  CZ  . ARG C 1 181 ? 3.931  83.918  45.813 1.00 47.80  ? 184  ARG B CZ  1 
ATOM   4619 N  NH1 . ARG C 1 181 ? 3.621  82.899  45.028 1.00 43.17  ? 184  ARG B NH1 1 
ATOM   4620 N  NH2 . ARG C 1 181 ? 3.016  84.845  46.073 1.00 45.65  ? 184  ARG B NH2 1 
ATOM   4621 N  N   . GLU C 1 182 ? 11.836 82.431  46.107 1.00 28.75  ? 185  GLU B N   1 
ATOM   4622 C  CA  . GLU C 1 182 ? 13.148 82.319  46.782 1.00 25.25  ? 185  GLU B CA  1 
ATOM   4623 C  C   . GLU C 1 182 ? 14.296 82.670  45.822 1.00 23.38  ? 185  GLU B C   1 
ATOM   4624 O  O   . GLU C 1 182 ? 15.357 83.117  46.247 1.00 21.10  ? 185  GLU B O   1 
ATOM   4625 C  CB  . GLU C 1 182 ? 13.373 80.873  47.267 1.00 26.02  ? 185  GLU B CB  1 
ATOM   4626 C  CG  . GLU C 1 182 ? 12.444 80.379  48.383 1.00 44.20  ? 185  GLU B CG  1 
ATOM   4627 C  CD  . GLU C 1 182 ? 10.976 80.229  47.970 1.00 55.18  ? 185  GLU B CD  1 
ATOM   4628 O  OE1 . GLU C 1 182 ? 10.713 79.820  46.793 1.00 48.82  ? 185  GLU B OE1 1 
ATOM   4629 O  OE2 . GLU C 1 182 ? 10.099 80.509  48.848 1.00 51.29  ? 185  GLU B OE2 1 
ATOM   4630 N  N   . ASP C 1 183 ? 14.124 82.347  44.542 1.00 21.88  ? 186  ASP B N   1 
ATOM   4631 C  CA  . ASP C 1 183 ? 15.144 82.667  43.557 1.00 23.97  ? 186  ASP B CA  1 
ATOM   4632 C  C   . ASP C 1 183 ? 15.155 84.157  43.173 1.00 20.68  ? 186  ASP B C   1 
ATOM   4633 O  O   . ASP C 1 183 ? 16.219 84.692  42.749 1.00 20.41  ? 186  ASP B O   1 
ATOM   4634 C  CB  . ASP C 1 183 ? 15.007 81.782  42.305 1.00 22.10  ? 186  ASP B CB  1 
ATOM   4635 C  CG  . ASP C 1 183 ? 15.370 80.325  42.578 1.00 41.91  ? 186  ASP B CG  1 
ATOM   4636 O  OD1 . ASP C 1 183 ? 16.429 80.104  43.221 1.00 47.27  ? 186  ASP B OD1 1 
ATOM   4637 O  OD2 . ASP C 1 183 ? 14.612 79.405  42.162 1.00 48.51  ? 186  ASP B OD2 1 
ATOM   4638 N  N   . ALA C 1 184 ? 13.980 84.804  43.296 1.00 18.55  ? 187  ALA B N   1 
ATOM   4639 C  CA  . ALA C 1 184 ? 13.832 86.235  43.005 1.00 15.72  ? 187  ALA B CA  1 
ATOM   4640 C  C   . ALA C 1 184 ? 14.524 87.000  44.160 1.00 15.89  ? 187  ALA B C   1 
ATOM   4641 O  O   . ALA C 1 184 ? 15.248 87.979  43.944 1.00 19.53  ? 187  ALA B O   1 
ATOM   4642 C  CB  . ALA C 1 184 ? 12.305 86.630  42.847 1.00 21.61  ? 187  ALA B CB  1 
ATOM   4643 N  N   . VAL C 1 185 ? 14.334 86.506  45.371 1.00 13.02  ? 188  VAL B N   1 
ATOM   4644 C  CA  . VAL C 1 185 ? 14.950 87.078  46.563 1.00 16.71  ? 188  VAL B CA  1 
ATOM   4645 C  C   . VAL C 1 185 ? 16.482 86.972  46.422 1.00 17.72  ? 188  VAL B C   1 
ATOM   4646 O  O   . VAL C 1 185 ? 17.202 87.934  46.604 1.00 15.07  ? 188  VAL B O   1 
ATOM   4647 C  CB  . VAL C 1 185 ? 14.508 86.271  47.820 1.00 20.57  ? 188  VAL B CB  1 
ATOM   4648 C  CG1 . VAL C 1 185 ? 15.416 86.622  49.043 1.00 17.82  ? 188  VAL B CG1 1 
ATOM   4649 C  CG2 . VAL C 1 185 ? 13.030 86.553  48.124 1.00 16.45  ? 188  VAL B CG2 1 
ATOM   4650 N  N   . LEU C 1 186 ? 16.976 85.798  46.059 1.00 17.30  ? 189  LEU B N   1 
ATOM   4651 C  CA  . LEU C 1 186 ? 18.412 85.608  45.913 1.00 18.70  ? 189  LEU B CA  1 
ATOM   4652 C  C   . LEU C 1 186 ? 18.985 86.438  44.734 1.00 23.29  ? 189  LEU B C   1 
ATOM   4653 O  O   . LEU C 1 186 ? 20.054 87.041  44.847 1.00 17.90  ? 189  LEU B O   1 
ATOM   4654 C  CB  . LEU C 1 186 ? 18.743 84.125  45.748 1.00 29.60  ? 189  LEU B CB  1 
ATOM   4655 C  CG  . LEU C 1 186 ? 20.210 83.819  45.398 1.00 33.27  ? 189  LEU B CG  1 
ATOM   4656 C  CD1 . LEU C 1 186 ? 21.159 84.155  46.579 1.00 31.26  ? 189  LEU B CD1 1 
ATOM   4657 C  CD2 . LEU C 1 186 ? 20.311 82.369  44.963 1.00 29.26  ? 189  LEU B CD2 1 
ATOM   4658 N  N   . GLU C 1 187 ? 18.279 86.476  43.606 1.00 26.06  ? 190  GLU B N   1 
ATOM   4659 C  CA  . GLU C 1 187 ? 18.746 87.273  42.464 1.00 23.25  ? 190  GLU B CA  1 
ATOM   4660 C  C   . GLU C 1 187 ? 18.835 88.762  42.838 1.00 21.53  ? 190  GLU B C   1 
ATOM   4661 O  O   . GLU C 1 187 ? 19.756 89.464  42.415 1.00 17.81  ? 190  GLU B O   1 
ATOM   4662 C  CB  . GLU C 1 187 ? 17.833 87.094  41.251 1.00 23.30  ? 190  GLU B CB  1 
ATOM   4663 C  CG  . GLU C 1 187 ? 18.416 87.688  39.969 1.00 29.57  ? 190  GLU B CG  1 
ATOM   4664 C  CD  . GLU C 1 187 ? 19.824 87.184  39.674 1.00 38.92  ? 190  GLU B CD  1 
ATOM   4665 O  OE1 . GLU C 1 187 ? 20.751 88.008  39.455 1.00 43.23  ? 190  GLU B OE1 1 
ATOM   4666 O  OE2 . GLU C 1 187 ? 20.011 85.955  39.707 1.00 32.90  ? 190  GLU B OE2 1 
ATOM   4667 N  N   . TYR C 1 188 ? 17.862 89.224  43.624 1.00 17.37  ? 191  TYR B N   1 
ATOM   4668 C  CA  . TYR C 1 188 ? 17.821 90.600  44.125 1.00 16.66  ? 191  TYR B CA  1 
ATOM   4669 C  C   . TYR C 1 188 ? 19.095 90.888  44.936 1.00 19.96  ? 191  TYR B C   1 
ATOM   4670 O  O   . TYR C 1 188 ? 19.782 91.885  44.685 1.00 13.80  ? 191  TYR B O   1 
ATOM   4671 C  CB  . TYR C 1 188 ? 16.565 90.765  45.021 1.00 19.90  ? 191  TYR B CB  1 
ATOM   4672 C  CG  . TYR C 1 188 ? 16.348 92.165  45.560 1.00 18.18  ? 191  TYR B CG  1 
ATOM   4673 C  CD1 . TYR C 1 188 ? 15.302 92.981  45.061 1.00 13.71  ? 191  TYR B CD1 1 
ATOM   4674 C  CD2 . TYR C 1 188 ? 17.221 92.704  46.542 1.00 15.01  ? 191  TYR B CD2 1 
ATOM   4675 C  CE1 . TYR C 1 188 ? 15.136 94.304  45.522 1.00 11.35  ? 191  TYR B CE1 1 
ATOM   4676 C  CE2 . TYR C 1 188 ? 17.055 94.027  47.007 1.00 14.56  ? 191  TYR B CE2 1 
ATOM   4677 C  CZ  . TYR C 1 188 ? 16.007 94.813  46.483 1.00 10.18  ? 191  TYR B CZ  1 
ATOM   4678 O  OH  . TYR C 1 188 ? 15.855 96.089  46.937 1.00 13.19  ? 191  TYR B OH  1 
ATOM   4679 N  N   . LEU C 1 189 ? 19.389 90.014  45.916 1.00 20.69  ? 192  LEU B N   1 
ATOM   4680 C  CA  . LEU C 1 189 ? 20.561 90.132  46.801 1.00 18.72  ? 192  LEU B CA  1 
ATOM   4681 C  C   . LEU C 1 189 ? 21.902 90.037  46.016 1.00 15.36  ? 192  LEU B C   1 
ATOM   4682 O  O   . LEU C 1 189 ? 22.859 90.744  46.344 1.00 12.63  ? 192  LEU B O   1 
ATOM   4683 C  CB  . LEU C 1 189 ? 20.498 89.087  47.941 1.00 12.94  ? 192  LEU B CB  1 
ATOM   4684 C  CG  . LEU C 1 189 ? 19.368 89.213  48.963 1.00 13.44  ? 192  LEU B CG  1 
ATOM   4685 C  CD1 . LEU C 1 189 ? 19.347 88.052  50.002 1.00 15.44  ? 192  LEU B CD1 1 
ATOM   4686 C  CD2 . LEU C 1 189 ? 19.590 90.487  49.689 1.00 14.60  ? 192  LEU B CD2 1 
ATOM   4687 N  N   . LYS C 1 190 ? 21.954 89.205  44.964 1.00 12.87  ? 193  LYS B N   1 
ATOM   4688 C  CA  . LYS C 1 190 ? 23.173 89.062  44.158 1.00 19.30  ? 193  LYS B CA  1 
ATOM   4689 C  C   . LYS C 1 190 ? 23.484 90.360  43.432 1.00 17.98  ? 193  LYS B C   1 
ATOM   4690 O  O   . LYS C 1 190 ? 24.629 90.752  43.335 1.00 17.29  ? 193  LYS B O   1 
ATOM   4691 C  CB  . LYS C 1 190 ? 23.058 87.891  43.172 1.00 18.60  ? 193  LYS B CB  1 
ATOM   4692 C  CG  . LYS C 1 190 ? 22.999 86.527  43.892 1.00 26.04  ? 193  LYS B CG  1 
ATOM   4693 C  CD  . LYS C 1 190 ? 23.310 85.310  42.991 1.00 26.43  ? 193  LYS B CD  1 
ATOM   4694 C  CE  . LYS C 1 190 ? 22.321 85.133  41.881 1.00 37.64  ? 193  LYS B CE  1 
ATOM   4695 N  NZ  . LYS C 1 190 ? 22.883 84.364  40.715 1.00 37.53  ? 193  LYS B NZ  1 
ATOM   4696 N  N   . ILE C 1 191 ? 22.450 91.071  43.000 1.00 11.69  ? 194  ILE B N   1 
ATOM   4697 C  CA  . ILE C 1 191 ? 22.659 92.325  42.307 1.00 12.62  ? 194  ILE B CA  1 
ATOM   4698 C  C   . ILE C 1 191 ? 22.987 93.420  43.329 1.00 10.22  ? 194  ILE B C   1 
ATOM   4699 O  O   . ILE C 1 191 ? 23.939 94.191  43.156 1.00 9.98   ? 194  ILE B O   1 
ATOM   4700 C  CB  . ILE C 1 191 ? 21.386 92.654  41.457 1.00 15.13  ? 194  ILE B CB  1 
ATOM   4701 C  CG1 . ILE C 1 191 ? 21.229 91.614  40.327 1.00 9.13   ? 194  ILE B CG1 1 
ATOM   4702 C  CG2 . ILE C 1 191 ? 21.432 94.096  40.886 1.00 17.36  ? 194  ILE B CG2 1 
ATOM   4703 C  CD1 . ILE C 1 191 ? 19.949 91.716  39.582 1.00 17.65  ? 194  ILE B CD1 1 
ATOM   4704 N  N   . ALA C 1 192 ? 22.196 93.463  44.412 1.00 12.78  ? 195  ALA B N   1 
ATOM   4705 C  CA  . ALA C 1 192 ? 22.384 94.451  45.450 1.00 13.14  ? 195  ALA B CA  1 
ATOM   4706 C  C   . ALA C 1 192 ? 23.778 94.389  46.117 1.00 16.26  ? 195  ALA B C   1 
ATOM   4707 O  O   . ALA C 1 192 ? 24.342 95.431  46.432 1.00 15.92  ? 195  ALA B O   1 
ATOM   4708 C  CB  . ALA C 1 192 ? 21.335 94.325  46.463 1.00 13.83  ? 195  ALA B CB  1 
ATOM   4709 N  N   . GLN C 1 193 ? 24.348 93.198  46.330 1.00 16.01  ? 196  GLN B N   1 
ATOM   4710 C  CA  . GLN C 1 193 ? 25.633 93.155  47.011 1.00 16.49  ? 196  GLN B CA  1 
ATOM   4711 C  C   . GLN C 1 193 ? 26.797 93.797  46.275 1.00 15.16  ? 196  GLN B C   1 
ATOM   4712 O  O   . GLN C 1 193 ? 27.837 94.049  46.891 1.00 19.40  ? 196  GLN B O   1 
ATOM   4713 C  CB  . GLN C 1 193 ? 26.000 91.748  47.461 1.00 16.34  ? 196  GLN B CB  1 
ATOM   4714 C  CG  . GLN C 1 193 ? 26.306 90.828  46.354 1.00 18.68  ? 196  GLN B CG  1 
ATOM   4715 C  CD  . GLN C 1 193 ? 26.741 89.489  46.843 1.00 17.24  ? 196  GLN B CD  1 
ATOM   4716 O  OE1 . GLN C 1 193 ? 26.666 89.182  48.036 1.00 14.23  ? 196  GLN B OE1 1 
ATOM   4717 N  NE2 . GLN C 1 193 ? 27.189 88.664  45.918 1.00 19.65  ? 196  GLN B NE2 1 
ATOM   4718 N  N   . ASP C 1 194 ? 26.612 94.100  44.985 1.00 14.97  ? 197  ASP B N   1 
ATOM   4719 C  CA  . ASP C 1 194 ? 27.647 94.754  44.148 1.00 17.32  ? 197  ASP B CA  1 
ATOM   4720 C  C   . ASP C 1 194 ? 27.649 96.275  44.225 1.00 15.99  ? 197  ASP B C   1 
ATOM   4721 O  O   . ASP C 1 194 ? 28.551 96.935  43.715 1.00 14.97  ? 197  ASP B O   1 
ATOM   4722 C  CB  . ASP C 1 194 ? 27.507 94.384  42.670 1.00 17.38  ? 197  ASP B CB  1 
ATOM   4723 C  CG  . ASP C 1 194 ? 27.747 92.900  42.402 1.00 17.99  ? 197  ASP B CG  1 
ATOM   4724 O  OD1 . ASP C 1 194 ? 27.080 92.392  41.478 1.00 22.43  ? 197  ASP B OD1 1 
ATOM   4725 O  OD2 . ASP C 1 194 ? 28.559 92.249  43.112 1.00 20.04  ? 197  ASP B OD2 1 
ATOM   4726 N  N   . LEU C 1 195 ? 26.588 96.828  44.788 1.00 12.09  ? 198  LEU B N   1 
ATOM   4727 C  CA  . LEU C 1 195 ? 26.484 98.256  44.970 1.00 15.48  ? 198  LEU B CA  1 
ATOM   4728 C  C   . LEU C 1 195 ? 27.592 98.694  45.911 1.00 16.05  ? 198  LEU B C   1 
ATOM   4729 O  O   . LEU C 1 195 ? 27.901 98.042  46.917 1.00 14.04  ? 198  LEU B O   1 
ATOM   4730 C  CB  . LEU C 1 195 ? 25.128 98.666  45.551 1.00 14.04  ? 198  LEU B CB  1 
ATOM   4731 C  CG  . LEU C 1 195 ? 23.844 98.396  44.749 1.00 10.38  ? 198  LEU B CG  1 
ATOM   4732 C  CD1 . LEU C 1 195 ? 22.627 98.704  45.623 1.00 13.59  ? 198  LEU B CD1 1 
ATOM   4733 C  CD2 . LEU C 1 195 ? 23.832 99.221  43.474 1.00 15.95  ? 198  LEU B CD2 1 
ATOM   4734 N  N   . GLU C 1 196 ? 28.187 99.821  45.558 1.00 15.02  ? 199  GLU B N   1 
ATOM   4735 C  CA  . GLU C 1 196 ? 29.283 100.410 46.316 1.00 12.78  ? 199  GLU B CA  1 
ATOM   4736 C  C   . GLU C 1 196 ? 29.032 100.654 47.785 1.00 17.78  ? 199  GLU B C   1 
ATOM   4737 O  O   . GLU C 1 196 ? 29.920 100.428 48.595 1.00 20.13  ? 199  GLU B O   1 
ATOM   4738 C  CB  . GLU C 1 196 ? 29.696 101.718 45.651 1.00 15.39  ? 199  GLU B CB  1 
ATOM   4739 C  CG  . GLU C 1 196 ? 30.235 101.549 44.266 1.00 17.28  ? 199  GLU B CG  1 
ATOM   4740 C  CD  . GLU C 1 196 ? 29.170 101.590 43.154 1.00 23.66  ? 199  GLU B CD  1 
ATOM   4741 O  OE1 . GLU C 1 196 ? 29.602 101.590 41.973 1.00 26.40  ? 199  GLU B OE1 1 
ATOM   4742 O  OE2 . GLU C 1 196 ? 27.939 101.599 43.442 1.00 25.51  ? 199  GLU B OE2 1 
HETATM 4743 N  N   . MSE C 1 197 ? 27.834 101.121 48.133 1.00 14.91  ? 200  MSE B N   1 
HETATM 4744 C  CA  . MSE C 1 197 ? 27.494 101.420 49.515 1.00 8.74   ? 200  MSE B CA  1 
HETATM 4745 C  C   . MSE C 1 197 ? 26.885 100.234 50.251 1.00 15.90  ? 200  MSE B C   1 
HETATM 4746 O  O   . MSE C 1 197 ? 26.725 100.270 51.462 1.00 13.19  ? 200  MSE B O   1 
HETATM 4747 C  CB  . MSE C 1 197 ? 26.554 102.603 49.540 1.00 11.00  ? 200  MSE B CB  1 
HETATM 4748 C  CG  . MSE C 1 197 ? 27.116 103.811 48.795 1.00 17.92  ? 200  MSE B CG  1 
HETATM 4749 SE SE  . MSE C 1 197 ? 26.042 105.409 49.035 1.00 24.50  ? 200  MSE B SE  1 
HETATM 4750 C  CE  . MSE C 1 197 ? 26.107 105.563 50.964 1.00 4.85   ? 200  MSE B CE  1 
ATOM   4751 N  N   . TYR C 1 198 ? 26.627 99.149  49.529 1.00 13.16  ? 201  TYR B N   1 
ATOM   4752 C  CA  . TYR C 1 198 ? 26.063 97.959  50.176 1.00 16.42  ? 201  TYR B CA  1 
ATOM   4753 C  C   . TYR C 1 198 ? 26.949 97.420  51.323 1.00 16.09  ? 201  TYR B C   1 
ATOM   4754 O  O   . TYR C 1 198 ? 28.161 97.321  51.177 1.00 16.01  ? 201  TYR B O   1 
ATOM   4755 C  CB  . TYR C 1 198 ? 25.851 96.855  49.126 1.00 14.57  ? 201  TYR B CB  1 
ATOM   4756 C  CG  . TYR C 1 198 ? 25.509 95.502  49.706 1.00 17.21  ? 201  TYR B CG  1 
ATOM   4757 C  CD1 . TYR C 1 198 ? 24.187 95.047  49.726 1.00 13.78  ? 201  TYR B CD1 1 
ATOM   4758 C  CD2 . TYR C 1 198 ? 26.511 94.670  50.222 1.00 15.35  ? 201  TYR B CD2 1 
ATOM   4759 C  CE1 . TYR C 1 198 ? 23.863 93.811  50.240 1.00 14.64  ? 201  TYR B CE1 1 
ATOM   4760 C  CE2 . TYR C 1 198 ? 26.212 93.425  50.735 1.00 21.32  ? 201  TYR B CE2 1 
ATOM   4761 C  CZ  . TYR C 1 198 ? 24.874 92.989  50.742 1.00 22.47  ? 201  TYR B CZ  1 
ATOM   4762 O  OH  . TYR C 1 198 ? 24.570 91.717  51.188 1.00 17.95  ? 201  TYR B OH  1 
ATOM   4763 N  N   . GLY C 1 199 ? 26.335 97.106  52.455 1.00 12.63  ? 202  GLY B N   1 
ATOM   4764 C  CA  . GLY C 1 199 ? 27.059 96.520  53.568 1.00 13.93  ? 202  GLY B CA  1 
ATOM   4765 C  C   . GLY C 1 199 ? 28.116 97.378  54.253 1.00 17.47  ? 202  GLY B C   1 
ATOM   4766 O  O   . GLY C 1 199 ? 28.829 96.890  55.131 1.00 19.14  ? 202  GLY B O   1 
ATOM   4767 N  N   . VAL C 1 200 ? 28.203 98.657  53.896 1.00 22.06  ? 203  VAL B N   1 
ATOM   4768 C  CA  . VAL C 1 200 ? 29.175 99.535  54.529 1.00 15.99  ? 203  VAL B CA  1 
ATOM   4769 C  C   . VAL C 1 200 ? 28.620 100.354 55.690 1.00 16.61  ? 203  VAL B C   1 
ATOM   4770 O  O   . VAL C 1 200 ? 27.581 100.976 55.541 1.00 16.30  ? 203  VAL B O   1 
ATOM   4771 C  CB  . VAL C 1 200 ? 29.841 100.533 53.500 1.00 14.83  ? 203  VAL B CB  1 
ATOM   4772 C  CG1 . VAL C 1 200 ? 31.007 101.305 54.200 1.00 12.95  ? 203  VAL B CG1 1 
ATOM   4773 C  CG2 . VAL C 1 200 ? 30.378 99.782  52.284 1.00 9.90   ? 203  VAL B CG2 1 
ATOM   4774 N  N   . ASN C 1 201 ? 29.324 100.323 56.834 1.00 12.67  ? 204  ASN B N   1 
ATOM   4775 C  CA  . ASN C 1 201 ? 28.998 101.127 58.038 1.00 15.06  ? 204  ASN B CA  1 
ATOM   4776 C  C   . ASN C 1 201 ? 29.901 102.361 57.866 1.00 16.94  ? 204  ASN B C   1 
ATOM   4777 O  O   . ASN C 1 201 ? 31.151 102.240 57.893 1.00 14.72  ? 204  ASN B O   1 
ATOM   4778 C  CB  . ASN C 1 201 ? 29.452 100.388 59.322 1.00 16.97  ? 204  ASN B CB  1 
ATOM   4779 C  CG  . ASN C 1 201 ? 28.757 99.061  59.508 1.00 20.01  ? 204  ASN B CG  1 
ATOM   4780 O  OD1 . ASN C 1 201 ? 27.606 99.021  59.971 1.00 16.67  ? 204  ASN B OD1 1 
ATOM   4781 N  ND2 . ASN C 1 201 ? 29.440 97.959  59.157 1.00 14.53  ? 204  ASN B ND2 1 
ATOM   4782 N  N   . TYR C 1 202 ? 29.275 103.532 57.775 1.00 12.99  ? 205  TYR B N   1 
ATOM   4783 C  CA  . TYR C 1 202 ? 29.983 104.786 57.543 1.00 15.22  ? 205  TYR B CA  1 
ATOM   4784 C  C   . TYR C 1 202 ? 30.022 105.591 58.801 1.00 14.51  ? 205  TYR B C   1 
ATOM   4785 O  O   . TYR C 1 202 ? 29.017 105.724 59.453 1.00 18.67  ? 205  TYR B O   1 
ATOM   4786 C  CB  . TYR C 1 202 ? 29.295 105.650 56.498 1.00 15.61  ? 205  TYR B CB  1 
ATOM   4787 C  CG  . TYR C 1 202 ? 29.344 105.117 55.102 1.00 12.72  ? 205  TYR B CG  1 
ATOM   4788 C  CD1 . TYR C 1 202 ? 28.353 104.229 54.637 1.00 17.89  ? 205  TYR B CD1 1 
ATOM   4789 C  CD2 . TYR C 1 202 ? 30.343 105.504 54.234 1.00 12.00  ? 205  TYR B CD2 1 
ATOM   4790 C  CE1 . TYR C 1 202 ? 28.356 103.728 53.325 1.00 12.61  ? 205  TYR B CE1 1 
ATOM   4791 C  CE2 . TYR C 1 202 ? 30.357 105.019 52.905 1.00 14.89  ? 205  TYR B CE2 1 
ATOM   4792 C  CZ  . TYR C 1 202 ? 29.340 104.117 52.471 1.00 13.16  ? 205  TYR B CZ  1 
ATOM   4793 O  OH  . TYR C 1 202 ? 29.345 103.638 51.192 1.00 15.22  ? 205  TYR B OH  1 
ATOM   4794 N  N   . PHE C 1 203 ? 31.196 106.148 59.100 1.00 18.08  ? 206  PHE B N   1 
ATOM   4795 C  CA  . PHE C 1 203 ? 31.416 106.975 60.275 1.00 15.59  ? 206  PHE B CA  1 
ATOM   4796 C  C   . PHE C 1 203 ? 32.139 108.263 59.926 1.00 20.10  ? 206  PHE B C   1 
ATOM   4797 O  O   . PHE C 1 203 ? 33.069 108.286 59.114 1.00 18.15  ? 206  PHE B O   1 
ATOM   4798 C  CB  . PHE C 1 203 ? 32.250 106.223 61.292 1.00 13.39  ? 206  PHE B CB  1 
ATOM   4799 C  CG  . PHE C 1 203 ? 31.622 104.966 61.760 1.00 15.48  ? 206  PHE B CG  1 
ATOM   4800 C  CD1 . PHE C 1 203 ? 31.898 103.768 61.124 1.00 14.23  ? 206  PHE B CD1 1 
ATOM   4801 C  CD2 . PHE C 1 203 ? 30.756 104.970 62.847 1.00 23.04  ? 206  PHE B CD2 1 
ATOM   4802 C  CE1 . PHE C 1 203 ? 31.315 102.574 61.567 1.00 17.66  ? 206  PHE B CE1 1 
ATOM   4803 C  CE2 . PHE C 1 203 ? 30.165 103.771 63.306 1.00 19.09  ? 206  PHE B CE2 1 
ATOM   4804 C  CZ  . PHE C 1 203 ? 30.448 102.586 62.665 1.00 18.08  ? 206  PHE B CZ  1 
ATOM   4805 N  N   . SER C 1 204 ? 31.622 109.363 60.454 1.00 19.45  ? 207  SER B N   1 
ATOM   4806 C  CA  . SER C 1 204 ? 32.255 110.630 60.239 1.00 24.09  ? 207  SER B CA  1 
ATOM   4807 C  C   . SER C 1 204 ? 33.530 110.707 61.130 1.00 28.26  ? 207  SER B C   1 
ATOM   4808 O  O   . SER C 1 204 ? 33.486 110.481 62.357 1.00 24.97  ? 207  SER B O   1 
ATOM   4809 C  CB  . SER C 1 204 ? 31.294 111.741 60.565 1.00 21.31  ? 207  SER B CB  1 
ATOM   4810 O  OG  . SER C 1 204 ? 31.964 112.926 60.287 1.00 24.73  ? 207  SER B OG  1 
ATOM   4811 N  N   . ILE C 1 205 ? 34.661 110.935 60.462 1.00 24.19  ? 208  ILE B N   1 
ATOM   4812 C  CA  . ILE C 1 205 ? 35.966 111.018 61.092 1.00 24.49  ? 208  ILE B CA  1 
ATOM   4813 C  C   . ILE C 1 205 ? 36.880 112.183 60.566 1.00 21.39  ? 208  ILE B C   1 
ATOM   4814 O  O   . ILE C 1 205 ? 36.632 112.782 59.508 1.00 18.16  ? 208  ILE B O   1 
ATOM   4815 C  CB  . ILE C 1 205 ? 36.746 109.649 60.985 1.00 24.61  ? 208  ILE B CB  1 
ATOM   4816 C  CG1 . ILE C 1 205 ? 37.164 109.368 59.541 1.00 24.00  ? 208  ILE B CG1 1 
ATOM   4817 C  CG2 . ILE C 1 205 ? 35.918 108.501 61.561 1.00 22.01  ? 208  ILE B CG2 1 
ATOM   4818 C  CD1 . ILE C 1 205 ? 38.392 108.443 59.383 1.00 18.37  ? 208  ILE B CD1 1 
ATOM   4819 N  N   . LYS C 1 206 ? 37.894 112.552 61.353 1.00 19.90  ? 209  LYS B N   1 
ATOM   4820 C  CA  . LYS C 1 206 ? 38.828 113.603 60.940 1.00 19.74  ? 209  LYS B CA  1 
ATOM   4821 C  C   . LYS C 1 206 ? 40.244 113.066 61.015 1.00 26.78  ? 209  LYS B C   1 
ATOM   4822 O  O   . LYS C 1 206 ? 40.530 112.154 61.812 1.00 25.47  ? 209  LYS B O   1 
ATOM   4823 C  CB  . LYS C 1 206 ? 38.750 114.809 61.862 1.00 16.39  ? 209  LYS B CB  1 
ATOM   4824 C  CG  . LYS C 1 206 ? 37.454 115.577 61.756 1.00 17.87  ? 209  LYS B CG  1 
ATOM   4825 C  CD  . LYS C 1 206 ? 37.387 116.638 62.829 1.00 29.88  ? 209  LYS B CD  1 
ATOM   4826 C  CE  . LYS C 1 206 ? 36.475 117.828 62.468 1.00 41.18  ? 209  LYS B CE  1 
ATOM   4827 N  NZ  . LYS C 1 206 ? 37.144 118.932 61.690 1.00 51.66  ? 209  LYS B NZ  1 
ATOM   4828 N  N   . ASN C 1 207 ? 41.107 113.563 60.124 1.00 27.83  ? 210  ASN B N   1 
ATOM   4829 C  CA  . ASN C 1 207 ? 42.534 113.218 60.169 1.00 31.60  ? 210  ASN B CA  1 
ATOM   4830 C  C   . ASN C 1 207 ? 43.263 114.249 61.106 1.00 28.53  ? 210  ASN B C   1 
ATOM   4831 O  O   . ASN C 1 207 ? 42.609 115.092 61.729 1.00 23.49  ? 210  ASN B O   1 
ATOM   4832 C  CB  . ASN C 1 207 ? 43.155 113.160 58.761 1.00 21.35  ? 210  ASN B CB  1 
ATOM   4833 C  CG  . ASN C 1 207 ? 43.007 114.460 57.987 1.00 19.14  ? 210  ASN B CG  1 
ATOM   4834 O  OD1 . ASN C 1 207 ? 42.705 115.503 58.556 1.00 25.67  ? 210  ASN B OD1 1 
ATOM   4835 N  ND2 . ASN C 1 207 ? 43.218 114.399 56.670 1.00 17.71  ? 210  ASN B ND2 1 
ATOM   4836 N  N   . LYS C 1 208 ? 44.571 114.118 61.299 1.00 33.77  ? 211  LYS B N   1 
ATOM   4837 C  CA  . LYS C 1 208 ? 45.321 115.069 62.158 1.00 32.72  ? 211  LYS B CA  1 
ATOM   4838 C  C   . LYS C 1 208 ? 45.011 116.549 61.868 1.00 28.84  ? 211  LYS B C   1 
ATOM   4839 O  O   . LYS C 1 208 ? 44.738 117.305 62.783 1.00 33.39  ? 211  LYS B O   1 
ATOM   4840 C  CB  . LYS C 1 208 ? 46.832 114.849 61.994 1.00 32.82  ? 211  LYS B CB  1 
ATOM   4841 C  CG  . LYS C 1 208 ? 47.691 115.134 63.199 1.00 32.25  ? 211  LYS B CG  1 
ATOM   4842 C  CD  . LYS C 1 208 ? 47.419 114.109 64.277 1.00 45.43  ? 211  LYS B CD  1 
ATOM   4843 C  CE  . LYS C 1 208 ? 47.842 112.686 63.875 1.00 50.29  ? 211  LYS B CE  1 
ATOM   4844 N  NZ  . LYS C 1 208 ? 47.332 111.630 64.832 1.00 37.23  ? 211  LYS B NZ  1 
ATOM   4845 N  N   . LYS C 1 209 ? 44.990 116.943 60.596 1.00 31.54  ? 212  LYS B N   1 
ATOM   4846 C  CA  . LYS C 1 209 ? 44.723 118.333 60.232 1.00 32.44  ? 212  LYS B CA  1 
ATOM   4847 C  C   . LYS C 1 209 ? 43.261 118.789 60.282 1.00 31.55  ? 212  LYS B C   1 
ATOM   4848 O  O   . LYS C 1 209 ? 42.942 119.921 59.881 1.00 34.81  ? 212  LYS B O   1 
ATOM   4849 C  CB  . LYS C 1 209 ? 45.346 118.677 58.878 1.00 32.82  ? 212  LYS B CB  1 
ATOM   4850 C  CG  . LYS C 1 209 ? 44.822 117.852 57.720 1.00 38.85  ? 212  LYS B CG  1 
ATOM   4851 C  CD  . LYS C 1 209 ? 45.098 118.552 56.427 1.00 35.66  ? 212  LYS B CD  1 
ATOM   4852 C  CE  . LYS C 1 209 ? 45.555 117.588 55.367 1.00 43.19  ? 212  LYS B CE  1 
ATOM   4853 N  NZ  . LYS C 1 209 ? 46.039 118.312 54.154 1.00 46.81  ? 212  LYS B NZ  1 
ATOM   4854 N  N   . GLY C 1 210 ? 42.381 117.927 60.788 1.00 29.60  ? 213  GLY B N   1 
ATOM   4855 C  CA  . GLY C 1 210 ? 40.979 118.285 60.899 1.00 26.77  ? 213  GLY B CA  1 
ATOM   4856 C  C   . GLY C 1 210 ? 40.120 118.104 59.661 1.00 26.95  ? 213  GLY B C   1 
ATOM   4857 O  O   . GLY C 1 210 ? 38.997 118.582 59.654 1.00 26.45  ? 213  GLY B O   1 
ATOM   4858 N  N   . SER C 1 211 ? 40.622 117.464 58.606 1.00 26.51  ? 214  SER B N   1 
ATOM   4859 C  CA  . SER C 1 211 ? 39.783 117.250 57.424 1.00 24.27  ? 214  SER B CA  1 
ATOM   4860 C  C   . SER C 1 211 ? 38.645 116.300 57.782 1.00 24.50  ? 214  SER B C   1 
ATOM   4861 O  O   . SER C 1 211 ? 38.831 115.316 58.514 1.00 25.58  ? 214  SER B O   1 
ATOM   4862 C  CB  . SER C 1 211 ? 40.586 116.671 56.246 1.00 26.99  ? 214  SER B CB  1 
ATOM   4863 O  OG  . SER C 1 211 ? 41.424 117.637 55.626 1.00 32.23  ? 214  SER B OG  1 
ATOM   4864 N  N   . GLU C 1 212 ? 37.472 116.616 57.255 1.00 22.98  ? 215  GLU B N   1 
ATOM   4865 C  CA  . GLU C 1 212 ? 36.258 115.838 57.452 1.00 26.04  ? 215  GLU B CA  1 
ATOM   4866 C  C   . GLU C 1 212 ? 36.217 114.718 56.391 1.00 18.21  ? 215  GLU B C   1 
ATOM   4867 O  O   . GLU C 1 212 ? 36.284 114.969 55.185 1.00 20.65  ? 215  GLU B O   1 
ATOM   4868 C  CB  . GLU C 1 212 ? 35.051 116.776 57.370 1.00 28.24  ? 215  GLU B CB  1 
ATOM   4869 C  CG  . GLU C 1 212 ? 34.410 117.025 58.721 1.00 44.33  ? 215  GLU B CG  1 
ATOM   4870 C  CD  . GLU C 1 212 ? 33.676 115.776 59.186 1.00 61.69  ? 215  GLU B CD  1 
ATOM   4871 O  OE1 . GLU C 1 212 ? 32.720 115.378 58.468 1.00 70.16  ? 215  GLU B OE1 1 
ATOM   4872 O  OE2 . GLU C 1 212 ? 34.081 115.168 60.220 1.00 62.42  ? 215  GLU B OE2 1 
ATOM   4873 N  N   . LEU C 1 213 ? 36.150 113.475 56.844 1.00 24.43  ? 216  LEU B N   1 
ATOM   4874 C  CA  . LEU C 1 213 ? 36.174 112.322 55.929 1.00 25.32  ? 216  LEU B CA  1 
ATOM   4875 C  C   . LEU C 1 213 ? 35.216 111.236 56.427 1.00 21.34  ? 216  LEU B C   1 
ATOM   4876 O  O   . LEU C 1 213 ? 34.554 111.436 57.449 1.00 19.40  ? 216  LEU B O   1 
ATOM   4877 C  CB  . LEU C 1 213 ? 37.635 111.779 55.864 1.00 19.12  ? 216  LEU B CB  1 
ATOM   4878 C  CG  . LEU C 1 213 ? 38.778 112.764 55.480 1.00 19.01  ? 216  LEU B CG  1 
ATOM   4879 C  CD1 . LEU C 1 213 ? 40.144 112.127 55.740 1.00 14.98  ? 216  LEU B CD1 1 
ATOM   4880 C  CD2 . LEU C 1 213 ? 38.676 113.224 54.026 1.00 21.33  ? 216  LEU B CD2 1 
ATOM   4881 N  N   . TRP C 1 214 ? 35.114 110.120 55.691 1.00 17.59  ? 217  TRP B N   1 
ATOM   4882 C  CA  . TRP C 1 214 ? 34.257 109.000 56.123 1.00 17.25  ? 217  TRP B CA  1 
ATOM   4883 C  C   . TRP C 1 214 ? 35.062 107.738 56.297 1.00 16.25  ? 217  TRP B C   1 
ATOM   4884 O  O   . TRP C 1 214 ? 35.900 107.408 55.454 1.00 20.13  ? 217  TRP B O   1 
ATOM   4885 C  CB  . TRP C 1 214 ? 33.134 108.653 55.120 1.00 15.94  ? 217  TRP B CB  1 
ATOM   4886 C  CG  . TRP C 1 214 ? 32.108 109.707 54.953 1.00 12.81  ? 217  TRP B CG  1 
ATOM   4887 C  CD1 . TRP C 1 214 ? 32.084 110.652 53.973 1.00 18.20  ? 217  TRP B CD1 1 
ATOM   4888 C  CD2 . TRP C 1 214 ? 31.017 110.005 55.830 1.00 13.52  ? 217  TRP B CD2 1 
ATOM   4889 N  NE1 . TRP C 1 214 ? 31.072 111.531 54.201 1.00 17.12  ? 217  TRP B NE1 1 
ATOM   4890 C  CE2 . TRP C 1 214 ? 30.398 111.165 55.338 1.00 19.00  ? 217  TRP B CE2 1 
ATOM   4891 C  CE3 . TRP C 1 214 ? 30.505 109.403 56.988 1.00 17.64  ? 217  TRP B CE3 1 
ATOM   4892 C  CZ2 . TRP C 1 214 ? 29.286 111.752 55.961 1.00 25.45  ? 217  TRP B CZ2 1 
ATOM   4893 C  CZ3 . TRP C 1 214 ? 29.399 109.979 57.607 1.00 27.87  ? 217  TRP B CZ3 1 
ATOM   4894 C  CH2 . TRP C 1 214 ? 28.800 111.147 57.090 1.00 27.38  ? 217  TRP B CH2 1 
ATOM   4895 N  N   . LEU C 1 215 ? 34.866 107.058 57.411 1.00 14.15  ? 218  LEU B N   1 
ATOM   4896 C  CA  . LEU C 1 215 ? 35.484 105.770 57.534 1.00 14.43  ? 218  LEU B CA  1 
ATOM   4897 C  C   . LEU C 1 215 ? 34.337 104.803 57.195 1.00 18.55  ? 218  LEU B C   1 
ATOM   4898 O  O   . LEU C 1 215 ? 33.197 104.980 57.650 1.00 17.05  ? 218  LEU B O   1 
ATOM   4899 C  CB  . LEU C 1 215 ? 35.992 105.476 58.969 1.00 10.23  ? 218  LEU B CB  1 
ATOM   4900 C  CG  . LEU C 1 215 ? 36.319 103.988 59.250 1.00 13.17  ? 218  LEU B CG  1 
ATOM   4901 C  CD1 . LEU C 1 215 ? 37.661 103.563 58.613 1.00 15.21  ? 218  LEU B CD1 1 
ATOM   4902 C  CD2 . LEU C 1 215 ? 36.338 103.719 60.782 1.00 11.47  ? 218  LEU B CD2 1 
ATOM   4903 N  N   . GLY C 1 216 ? 34.644 103.803 56.377 1.00 18.34  ? 219  GLY B N   1 
ATOM   4904 C  CA  . GLY C 1 216 ? 33.681 102.753 56.078 1.00 15.75  ? 219  GLY B CA  1 
ATOM   4905 C  C   . GLY C 1 216 ? 34.213 101.411 56.637 1.00 17.72  ? 219  GLY B C   1 
ATOM   4906 O  O   . GLY C 1 216 ? 35.387 101.059 56.418 1.00 14.65  ? 219  GLY B O   1 
ATOM   4907 N  N   . VAL C 1 217 ? 33.410 100.755 57.483 1.00 16.42  ? 220  VAL B N   1 
ATOM   4908 C  CA  . VAL C 1 217 ? 33.716 99.433  58.037 1.00 18.47  ? 220  VAL B CA  1 
ATOM   4909 C  C   . VAL C 1 217 ? 32.724 98.411  57.419 1.00 15.82  ? 220  VAL B C   1 
ATOM   4910 O  O   . VAL C 1 217 ? 31.490 98.554  57.511 1.00 15.79  ? 220  VAL B O   1 
ATOM   4911 C  CB  . VAL C 1 217 ? 33.559 99.327  59.607 1.00 15.59  ? 220  VAL B CB  1 
ATOM   4912 C  CG1 . VAL C 1 217 ? 33.930 97.882  60.069 1.00 10.71  ? 220  VAL B CG1 1 
ATOM   4913 C  CG2 . VAL C 1 217 ? 34.362 100.412 60.313 1.00 15.21  ? 220  VAL B CG2 1 
ATOM   4914 N  N   . ASP C 1 218 ? 33.257 97.426  56.726 1.00 16.08  ? 221  ASP B N   1 
ATOM   4915 C  CA  . ASP C 1 218 ? 32.417 96.402  56.175 1.00 18.57  ? 221  ASP B CA  1 
ATOM   4916 C  C   . ASP C 1 218 ? 33.016 95.015  56.319 1.00 18.54  ? 221  ASP B C   1 
ATOM   4917 O  O   . ASP C 1 218 ? 34.053 94.856  57.005 1.00 20.08  ? 221  ASP B O   1 
ATOM   4918 C  CB  . ASP C 1 218 ? 32.001 96.728  54.733 1.00 24.19  ? 221  ASP B CB  1 
ATOM   4919 C  CG  . ASP C 1 218 ? 33.150 96.757  53.745 1.00 29.30  ? 221  ASP B CG  1 
ATOM   4920 O  OD1 . ASP C 1 218 ? 34.247 96.243  54.032 1.00 30.45  ? 221  ASP B OD1 1 
ATOM   4921 O  OD2 . ASP C 1 218 ? 32.929 97.275  52.623 1.00 27.32  ? 221  ASP B OD2 1 
ATOM   4922 N  N   . ALA C 1 219 ? 32.420 94.032  55.636 1.00 16.75  ? 222  ALA B N   1 
ATOM   4923 C  CA  . ALA C 1 219 ? 32.893 92.642  55.739 1.00 21.26  ? 222  ALA B CA  1 
ATOM   4924 C  C   . ALA C 1 219 ? 34.315 92.430  55.248 1.00 22.04  ? 222  ALA B C   1 
ATOM   4925 O  O   . ALA C 1 219 ? 34.993 91.515  55.709 1.00 23.41  ? 222  ALA B O   1 
ATOM   4926 C  CB  . ALA C 1 219 ? 31.937 91.687  54.994 1.00 18.88  ? 222  ALA B CB  1 
ATOM   4927 N  N   . LEU C 1 220 ? 34.781 93.292  54.351 1.00 23.93  ? 223  LEU B N   1 
ATOM   4928 C  CA  . LEU C 1 220 ? 36.106 93.120  53.750 1.00 25.58  ? 223  LEU B CA  1 
ATOM   4929 C  C   . LEU C 1 220 ? 37.253 93.977  54.206 1.00 23.53  ? 223  LEU B C   1 
ATOM   4930 O  O   . LEU C 1 220 ? 38.357 93.823  53.701 1.00 28.48  ? 223  LEU B O   1 
ATOM   4931 C  CB  . LEU C 1 220 ? 35.983 93.245  52.220 1.00 26.56  ? 223  LEU B CB  1 
ATOM   4932 C  CG  . LEU C 1 220 ? 34.771 92.559  51.563 1.00 32.60  ? 223  LEU B CG  1 
ATOM   4933 C  CD1 . LEU C 1 220 ? 34.625 93.018  50.133 1.00 34.14  ? 223  LEU B CD1 1 
ATOM   4934 C  CD2 . LEU C 1 220 ? 34.870 91.057  51.613 1.00 21.34  ? 223  LEU B CD2 1 
ATOM   4935 N  N   . GLY C 1 221 ? 37.021 94.875  55.148 1.00 15.90  ? 224  GLY B N   1 
ATOM   4936 C  CA  . GLY C 1 221 ? 38.096 95.739  55.611 1.00 19.28  ? 224  GLY B CA  1 
ATOM   4937 C  C   . GLY C 1 221 ? 37.666 97.131  55.993 1.00 23.23  ? 224  GLY B C   1 
ATOM   4938 O  O   . GLY C 1 221 ? 36.489 97.348  56.302 1.00 17.32  ? 224  GLY B O   1 
ATOM   4939 N  N   . LEU C 1 222 ? 38.613 98.071  55.932 1.00 21.57  ? 225  LEU B N   1 
ATOM   4940 C  CA  . LEU C 1 222 ? 38.392 99.471  56.319 1.00 18.63  ? 225  LEU B CA  1 
ATOM   4941 C  C   . LEU C 1 222 ? 38.655 100.336 55.096 1.00 19.11  ? 225  LEU B C   1 
ATOM   4942 O  O   . LEU C 1 222 ? 39.626 100.126 54.382 1.00 16.84  ? 225  LEU B O   1 
ATOM   4943 C  CB  . LEU C 1 222 ? 39.397 99.869  57.416 1.00 21.46  ? 225  LEU B CB  1 
ATOM   4944 C  CG  . LEU C 1 222 ? 39.409 99.132  58.777 1.00 29.21  ? 225  LEU B CG  1 
ATOM   4945 C  CD1 . LEU C 1 222 ? 40.364 99.842  59.743 1.00 22.00  ? 225  LEU B CD1 1 
ATOM   4946 C  CD2 . LEU C 1 222 ? 38.025 99.118  59.419 1.00 21.25  ? 225  LEU B CD2 1 
ATOM   4947 N  N   . ASN C 1 223 ? 37.817 101.334 54.874 1.00 16.73  ? 226  ASN B N   1 
ATOM   4948 C  CA  . ASN C 1 223 ? 37.971 102.192 53.713 1.00 17.17  ? 226  ASN B CA  1 
ATOM   4949 C  C   . ASN C 1 223 ? 37.824 103.617 54.132 1.00 17.23  ? 226  ASN B C   1 
ATOM   4950 O  O   . ASN C 1 223 ? 37.016 103.918 55.000 1.00 17.21  ? 226  ASN B O   1 
ATOM   4951 C  CB  . ASN C 1 223 ? 36.902 101.995 52.614 1.00 22.67  ? 226  ASN B CB  1 
ATOM   4952 C  CG  . ASN C 1 223 ? 36.592 100.538 52.275 1.00 20.53  ? 226  ASN B CG  1 
ATOM   4953 O  OD1 . ASN C 1 223 ? 37.471 99.725  52.079 1.00 20.49  ? 226  ASN B OD1 1 
ATOM   4954 N  ND2 . ASN C 1 223 ? 35.301 100.246 52.108 1.00 35.99  ? 226  ASN B ND2 1 
ATOM   4955 N  N   . ILE C 1 224 ? 38.547 104.499 53.446 1.00 12.17  ? 227  ILE B N   1 
ATOM   4956 C  CA  . ILE C 1 224 ? 38.471 105.911 53.731 1.00 12.93  ? 227  ILE B CA  1 
ATOM   4957 C  C   . ILE C 1 224 ? 37.830 106.600 52.501 1.00 13.68  ? 227  ILE B C   1 
ATOM   4958 O  O   . ILE C 1 224 ? 38.260 106.401 51.342 1.00 11.17  ? 227  ILE B O   1 
ATOM   4959 C  CB  . ILE C 1 224 ? 39.895 106.511 53.963 1.00 14.99  ? 227  ILE B CB  1 
ATOM   4960 C  CG1 . ILE C 1 224 ? 40.629 105.774 55.105 1.00 15.85  ? 227  ILE B CG1 1 
ATOM   4961 C  CG2 . ILE C 1 224 ? 39.786 108.004 54.224 1.00 14.69  ? 227  ILE B CG2 1 
ATOM   4962 C  CD1 . ILE C 1 224 ? 39.916 105.818 56.433 1.00 21.57  ? 227  ILE B CD1 1 
ATOM   4963 N  N   . TYR C 1 225 ? 36.811 107.427 52.751 1.00 16.36  ? 228  TYR B N   1 
ATOM   4964 C  CA  . TYR C 1 225 ? 36.135 108.157 51.665 1.00 17.77  ? 228  TYR B CA  1 
ATOM   4965 C  C   . TYR C 1 225 ? 36.284 109.685 51.859 1.00 19.55  ? 228  TYR B C   1 
ATOM   4966 O  O   . TYR C 1 225 ? 36.565 110.216 52.957 1.00 18.31  ? 228  TYR B O   1 
ATOM   4967 C  CB  . TYR C 1 225 ? 34.615 107.867 51.639 1.00 15.25  ? 228  TYR B CB  1 
ATOM   4968 C  CG  . TYR C 1 225 ? 34.208 106.420 51.592 1.00 17.20  ? 228  TYR B CG  1 
ATOM   4969 C  CD1 . TYR C 1 225 ? 34.361 105.590 52.705 1.00 17.68  ? 228  TYR B CD1 1 
ATOM   4970 C  CD2 . TYR C 1 225 ? 33.692 105.868 50.432 1.00 13.41  ? 228  TYR B CD2 1 
ATOM   4971 C  CE1 . TYR C 1 225 ? 34.019 104.240 52.652 1.00 14.70  ? 228  TYR B CE1 1 
ATOM   4972 C  CE2 . TYR C 1 225 ? 33.338 104.519 50.378 1.00 11.24  ? 228  TYR B CE2 1 
ATOM   4973 C  CZ  . TYR C 1 225 ? 33.514 103.724 51.483 1.00 11.30  ? 228  TYR B CZ  1 
ATOM   4974 O  OH  . TYR C 1 225 ? 33.260 102.390 51.391 1.00 15.86  ? 228  TYR B OH  1 
ATOM   4975 N  N   . GLU C 1 226 ? 36.240 110.341 50.717 1.00 17.06  ? 229  GLU B N   1 
ATOM   4976 C  CA  . GLU C 1 226 ? 36.231 111.771 50.604 1.00 21.74  ? 229  GLU B CA  1 
ATOM   4977 C  C   . GLU C 1 226 ? 34.833 112.122 51.192 1.00 20.98  ? 229  GLU B C   1 
ATOM   4978 O  O   . GLU C 1 226 ? 33.932 111.275 51.169 1.00 19.51  ? 229  GLU B O   1 
ATOM   4979 C  CB  . GLU C 1 226 ? 36.310 112.096 49.116 1.00 34.99  ? 229  GLU B CB  1 
ATOM   4980 C  CG  . GLU C 1 226 ? 37.312 113.123 48.718 1.00 55.55  ? 229  GLU B CG  1 
ATOM   4981 C  CD  . GLU C 1 226 ? 36.689 114.138 47.759 1.00 73.52  ? 229  GLU B CD  1 
ATOM   4982 O  OE1 . GLU C 1 226 ? 37.214 114.230 46.619 1.00 81.69  ? 229  GLU B OE1 1 
ATOM   4983 O  OE2 . GLU C 1 226 ? 35.671 114.815 48.135 1.00 66.92  ? 229  GLU B OE2 1 
ATOM   4984 N  N   . GLN C 1 227 ? 34.685 113.309 51.799 1.00 22.32  ? 230  GLN B N   1 
ATOM   4985 C  CA  . GLN C 1 227 ? 33.418 113.723 52.420 1.00 19.12  ? 230  GLN B CA  1 
ATOM   4986 C  C   . GLN C 1 227 ? 32.184 113.668 51.516 1.00 18.04  ? 230  GLN B C   1 
ATOM   4987 O  O   . GLN C 1 227 ? 31.099 113.343 51.986 1.00 19.48  ? 230  GLN B O   1 
ATOM   4988 C  CB  . GLN C 1 227 ? 33.494 115.167 52.952 1.00 19.34  ? 230  GLN B CB  1 
ATOM   4989 C  CG  . GLN C 1 227 ? 32.301 115.464 53.799 1.00 25.53  ? 230  GLN B CG  1 
ATOM   4990 C  CD  . GLN C 1 227 ? 32.258 116.856 54.336 1.00 45.40  ? 230  GLN B CD  1 
ATOM   4991 O  OE1 . GLN C 1 227 ? 31.708 117.084 55.420 1.00 55.48  ? 230  GLN B OE1 1 
ATOM   4992 N  NE2 . GLN C 1 227 ? 32.811 117.811 53.587 1.00 45.50  ? 230  GLN B NE2 1 
ATOM   4993 N  N   . ASN C 1 228 ? 32.368 114.065 50.249 1.00 18.62  ? 231  ASN B N   1 
ATOM   4994 C  CA  . ASN C 1 228 ? 31.306 114.125 49.253 1.00 17.40  ? 231  ASN B CA  1 
ATOM   4995 C  C   . ASN C 1 228 ? 31.066 112.891 48.421 1.00 18.26  ? 231  ASN B C   1 
ATOM   4996 O  O   . ASN C 1 228 ? 30.065 112.811 47.718 1.00 24.77  ? 231  ASN B O   1 
ATOM   4997 C  CB  . ASN C 1 228 ? 31.562 115.310 48.325 1.00 26.15  ? 231  ASN B CB  1 
ATOM   4998 C  CG  . ASN C 1 228 ? 31.303 116.635 48.984 1.00 32.08  ? 231  ASN B CG  1 
ATOM   4999 O  OD1 . ASN C 1 228 ? 30.435 116.755 49.851 1.00 35.73  ? 231  ASN B OD1 1 
ATOM   5000 N  ND2 . ASN C 1 228 ? 32.054 117.653 48.574 1.00 31.70  ? 231  ASN B ND2 1 
ATOM   5001 N  N   . ASP C 1 229 ? 31.990 111.940 48.466 1.00 18.37  ? 232  ASP B N   1 
ATOM   5002 C  CA  . ASP C 1 229 ? 31.832 110.738 47.650 1.00 18.03  ? 232  ASP B CA  1 
ATOM   5003 C  C   . ASP C 1 229 ? 31.841 109.441 48.522 1.00 22.23  ? 232  ASP B C   1 
ATOM   5004 O  O   . ASP C 1 229 ? 32.897 108.944 48.891 1.00 15.85  ? 232  ASP B O   1 
ATOM   5005 C  CB  . ASP C 1 229 ? 32.935 110.771 46.560 1.00 18.30  ? 232  ASP B CB  1 
ATOM   5006 C  CG  . ASP C 1 229 ? 32.918 109.561 45.595 1.00 20.09  ? 232  ASP B CG  1 
ATOM   5007 O  OD1 . ASP C 1 229 ? 32.162 108.614 45.784 1.00 14.79  ? 232  ASP B OD1 1 
ATOM   5008 O  OD2 . ASP C 1 229 ? 33.690 109.581 44.608 1.00 24.04  ? 232  ASP B OD2 1 
ATOM   5009 N  N   . ARG C 1 230 ? 30.656 108.906 48.857 1.00 16.55  ? 233  ARG B N   1 
ATOM   5010 C  CA  . ARG C 1 230 ? 30.607 107.651 49.630 1.00 18.34  ? 233  ARG B CA  1 
ATOM   5011 C  C   . ARG C 1 230 ? 30.503 106.390 48.733 1.00 11.91  ? 233  ARG B C   1 
ATOM   5012 O  O   . ARG C 1 230 ? 30.382 105.288 49.246 1.00 13.72  ? 233  ARG B O   1 
ATOM   5013 C  CB  . ARG C 1 230 ? 29.502 107.695 50.711 1.00 15.18  ? 233  ARG B CB  1 
ATOM   5014 C  CG  . ARG C 1 230 ? 29.773 108.704 51.847 1.00 18.15  ? 233  ARG B CG  1 
ATOM   5015 C  CD  . ARG C 1 230 ? 28.442 109.263 52.480 1.00 26.67  ? 233  ARG B CD  1 
ATOM   5016 N  NE  . ARG C 1 230 ? 27.799 108.300 53.365 1.00 41.31  ? 233  ARG B NE  1 
ATOM   5017 C  CZ  . ARG C 1 230 ? 26.483 108.152 53.532 1.00 48.73  ? 233  ARG B CZ  1 
ATOM   5018 N  NH1 . ARG C 1 230 ? 25.620 108.922 52.872 1.00 48.00  ? 233  ARG B NH1 1 
ATOM   5019 N  NH2 . ARG C 1 230 ? 26.024 107.178 54.327 1.00 47.08  ? 233  ARG B NH2 1 
ATOM   5020 N  N   . LEU C 1 231 ? 30.570 106.543 47.408 1.00 10.03  ? 234  LEU B N   1 
ATOM   5021 C  CA  . LEU C 1 231 ? 30.532 105.404 46.512 1.00 11.78  ? 234  LEU B CA  1 
ATOM   5022 C  C   . LEU C 1 231 ? 31.940 104.831 46.277 1.00 17.89  ? 234  LEU B C   1 
ATOM   5023 O  O   . LEU C 1 231 ? 32.165 103.643 46.384 1.00 20.81  ? 234  LEU B O   1 
ATOM   5024 C  CB  . LEU C 1 231 ? 29.918 105.776 45.150 1.00 16.29  ? 234  LEU B CB  1 
ATOM   5025 C  CG  . LEU C 1 231 ? 28.372 105.826 45.070 1.00 17.77  ? 234  LEU B CG  1 
ATOM   5026 C  CD1 . LEU C 1 231 ? 27.823 107.004 45.814 1.00 17.44  ? 234  LEU B CD1 1 
ATOM   5027 C  CD2 . LEU C 1 231 ? 27.957 105.900 43.594 1.00 17.34  ? 234  LEU B CD2 1 
ATOM   5028 N  N   . THR C 1 232 ? 32.903 105.710 46.085 1.00 11.13  ? 235  THR B N   1 
ATOM   5029 C  CA  . THR C 1 232 ? 34.262 105.297 45.722 1.00 17.78  ? 235  THR B CA  1 
ATOM   5030 C  C   . THR C 1 232 ? 35.259 105.734 46.748 1.00 16.38  ? 235  THR B C   1 
ATOM   5031 O  O   . THR C 1 232 ? 35.606 106.911 46.887 1.00 19.92  ? 235  THR B O   1 
ATOM   5032 C  CB  . THR C 1 232 ? 34.637 105.863 44.352 1.00 20.89  ? 235  THR B CB  1 
ATOM   5033 O  OG1 . THR C 1 232 ? 33.728 105.318 43.399 1.00 33.34  ? 235  THR B OG1 1 
ATOM   5034 C  CG2 . THR C 1 232 ? 36.062 105.480 43.942 1.00 20.62  ? 235  THR B CG2 1 
ATOM   5035 N  N   . PRO C 1 233 ? 35.705 104.766 47.521 1.00 13.66  ? 236  PRO B N   1 
ATOM   5036 C  CA  . PRO C 1 233 ? 36.669 104.988 48.569 1.00 16.57  ? 236  PRO B CA  1 
ATOM   5037 C  C   . PRO C 1 233 ? 38.011 105.350 47.910 1.00 16.98  ? 236  PRO B C   1 
ATOM   5038 O  O   . PRO C 1 233 ? 38.285 104.975 46.774 1.00 13.77  ? 236  PRO B O   1 
ATOM   5039 C  CB  . PRO C 1 233 ? 36.641 103.642 49.319 1.00 16.19  ? 236  PRO B CB  1 
ATOM   5040 C  CG  . PRO C 1 233 ? 36.258 102.676 48.244 1.00 12.95  ? 236  PRO B CG  1 
ATOM   5041 C  CD  . PRO C 1 233 ? 35.208 103.380 47.512 1.00 10.03  ? 236  PRO B CD  1 
ATOM   5042 N  N   . LYS C 1 234 ? 38.804 106.167 48.600 1.00 20.73  ? 237  LYS B N   1 
ATOM   5043 C  CA  . LYS C 1 234 ? 40.096 106.584 48.103 1.00 14.90  ? 237  LYS B CA  1 
ATOM   5044 C  C   . LYS C 1 234 ? 41.262 105.720 48.645 1.00 16.97  ? 237  LYS B C   1 
ATOM   5045 O  O   . LYS C 1 234 ? 42.252 105.484 47.934 1.00 13.40  ? 237  LYS B O   1 
ATOM   5046 C  CB  . LYS C 1 234 ? 40.284 108.063 48.474 1.00 20.26  ? 237  LYS B CB  1 
ATOM   5047 C  CG  . LYS C 1 234 ? 39.198 109.025 47.909 1.00 22.98  ? 237  LYS B CG  1 
ATOM   5048 C  CD  . LYS C 1 234 ? 39.137 108.943 46.375 1.00 23.96  ? 237  LYS B CD  1 
ATOM   5049 C  CE  . LYS C 1 234 ? 38.680 110.254 45.678 1.00 28.19  ? 237  LYS B CE  1 
ATOM   5050 N  NZ  . LYS C 1 234 ? 37.264 110.159 45.211 1.00 37.16  ? 237  LYS B NZ  1 
ATOM   5051 N  N   . ILE C 1 235 ? 41.122 105.218 49.867 1.00 15.60  ? 238  ILE B N   1 
ATOM   5052 C  CA  . ILE C 1 235 ? 42.177 104.420 50.541 1.00 18.99  ? 238  ILE B CA  1 
ATOM   5053 C  C   . ILE C 1 235 ? 41.549 103.245 51.213 1.00 16.22  ? 238  ILE B C   1 
ATOM   5054 O  O   . ILE C 1 235 ? 40.418 103.342 51.655 1.00 16.03  ? 238  ILE B O   1 
ATOM   5055 C  CB  . ILE C 1 235 ? 42.963 105.218 51.648 1.00 17.88  ? 238  ILE B CB  1 
ATOM   5056 C  CG1 . ILE C 1 235 ? 43.630 106.460 51.025 1.00 25.23  ? 238  ILE B CG1 1 
ATOM   5057 C  CG2 . ILE C 1 235 ? 44.119 104.362 52.193 1.00 17.07  ? 238  ILE B CG2 1 
ATOM   5058 C  CD1 . ILE C 1 235 ? 44.289 107.332 51.997 1.00 23.04  ? 238  ILE B CD1 1 
ATOM   5059 N  N   . GLY C 1 236 ? 42.267 102.128 51.253 1.00 15.14  ? 239  GLY B N   1 
ATOM   5060 C  CA  . GLY C 1 236 ? 41.729 100.956 51.899 1.00 15.97  ? 239  GLY B CA  1 
ATOM   5061 C  C   . GLY C 1 236 ? 42.757 100.102 52.568 1.00 14.77  ? 239  GLY B C   1 
ATOM   5062 O  O   . GLY C 1 236 ? 43.922 100.130 52.176 1.00 10.82  ? 239  GLY B O   1 
ATOM   5063 N  N   . PHE C 1 237 ? 42.329 99.436  53.636 1.00 19.19  ? 240  PHE B N   1 
ATOM   5064 C  CA  . PHE C 1 237 ? 43.180 98.544  54.434 1.00 17.39  ? 240  PHE B CA  1 
ATOM   5065 C  C   . PHE C 1 237 ? 42.493 97.200  54.518 1.00 21.89  ? 240  PHE B C   1 
ATOM   5066 O  O   . PHE C 1 237 ? 41.313 97.127  54.831 1.00 19.34  ? 240  PHE B O   1 
ATOM   5067 C  CB  . PHE C 1 237 ? 43.423 99.097  55.861 1.00 17.34  ? 240  PHE B CB  1 
ATOM   5068 C  CG  . PHE C 1 237 ? 44.117 100.467 55.898 1.00 22.98  ? 240  PHE B CG  1 
ATOM   5069 C  CD1 . PHE C 1 237 ? 43.362 101.654 55.924 1.00 23.41  ? 240  PHE B CD1 1 
ATOM   5070 C  CD2 . PHE C 1 237 ? 45.498 100.568 55.828 1.00 21.66  ? 240  PHE B CD2 1 
ATOM   5071 C  CE1 . PHE C 1 237 ? 43.979 102.911 55.863 1.00 20.17  ? 240  PHE B CE1 1 
ATOM   5072 C  CE2 . PHE C 1 237 ? 46.120 101.813 55.767 1.00 24.76  ? 240  PHE B CE2 1 
ATOM   5073 C  CZ  . PHE C 1 237 ? 45.345 102.996 55.783 1.00 21.64  ? 240  PHE B CZ  1 
ATOM   5074 N  N   . PRO C 1 238 ? 43.141 96.148  54.015 1.00 21.52  ? 241  PRO B N   1 
ATOM   5075 C  CA  . PRO C 1 238 ? 42.476 94.846  54.140 1.00 20.99  ? 241  PRO B CA  1 
ATOM   5076 C  C   . PRO C 1 238 ? 42.658 94.398  55.608 1.00 19.75  ? 241  PRO B C   1 
ATOM   5077 O  O   . PRO C 1 238 ? 43.514 94.939  56.317 1.00 22.54  ? 241  PRO B O   1 
ATOM   5078 C  CB  . PRO C 1 238 ? 43.254 93.987  53.136 1.00 24.54  ? 241  PRO B CB  1 
ATOM   5079 C  CG  . PRO C 1 238 ? 44.634 94.617  53.140 1.00 19.23  ? 241  PRO B CG  1 
ATOM   5080 C  CD  . PRO C 1 238 ? 44.340 96.080  53.165 1.00 20.53  ? 241  PRO B CD  1 
ATOM   5081 N  N   . TRP C 1 239 ? 41.845 93.456  56.086 1.00 25.61  ? 242  TRP B N   1 
ATOM   5082 C  CA  . TRP C 1 239 ? 41.928 92.965  57.493 1.00 25.75  ? 242  TRP B CA  1 
ATOM   5083 C  C   . TRP C 1 239 ? 43.304 92.414  57.877 1.00 33.21  ? 242  TRP B C   1 
ATOM   5084 O  O   . TRP C 1 239 ? 43.861 92.774  58.923 1.00 32.08  ? 242  TRP B O   1 
ATOM   5085 C  CB  . TRP C 1 239 ? 40.864 91.876  57.744 1.00 27.55  ? 242  TRP B CB  1 
ATOM   5086 C  CG  . TRP C 1 239 ? 39.452 92.399  57.771 1.00 25.88  ? 242  TRP B CG  1 
ATOM   5087 C  CD1 . TRP C 1 239 ? 38.402 91.955  57.026 1.00 18.33  ? 242  TRP B CD1 1 
ATOM   5088 C  CD2 . TRP C 1 239 ? 38.938 93.478  58.579 1.00 19.26  ? 242  TRP B CD2 1 
ATOM   5089 N  NE1 . TRP C 1 239 ? 37.277 92.676  57.316 1.00 24.68  ? 242  TRP B NE1 1 
ATOM   5090 C  CE2 . TRP C 1 239 ? 37.573 93.623  58.256 1.00 20.21  ? 242  TRP B CE2 1 
ATOM   5091 C  CE3 . TRP C 1 239 ? 39.507 94.335  59.535 1.00 18.56  ? 242  TRP B CE3 1 
ATOM   5092 C  CZ2 . TRP C 1 239 ? 36.757 94.599  58.848 1.00 14.87  ? 242  TRP B CZ2 1 
ATOM   5093 C  CZ3 . TRP C 1 239 ? 38.699 95.320  60.138 1.00 17.93  ? 242  TRP B CZ3 1 
ATOM   5094 C  CH2 . TRP C 1 239 ? 37.333 95.441  59.783 1.00 18.41  ? 242  TRP B CH2 1 
ATOM   5095 N  N   . SER C 1 240 ? 43.893 91.624  56.980 1.00 35.59  ? 243  SER B N   1 
ATOM   5096 C  CA  . SER C 1 240 ? 45.186 91.021  57.248 1.00 38.74  ? 243  SER B CA  1 
ATOM   5097 C  C   . SER C 1 240 ? 46.333 91.998  57.429 1.00 41.61  ? 243  SER B C   1 
ATOM   5098 O  O   . SER C 1 240 ? 47.460 91.558  57.630 1.00 44.31  ? 243  SER B O   1 
ATOM   5099 C  CB  . SER C 1 240 ? 45.505 90.007  56.167 1.00 36.58  ? 243  SER B CB  1 
ATOM   5100 O  OG  . SER C 1 240 ? 45.581 90.614  54.903 1.00 37.40  ? 243  SER B OG  1 
ATOM   5101 N  N   . GLU C 1 241 ? 46.064 93.307  57.343 1.00 38.88  ? 244  GLU B N   1 
ATOM   5102 C  CA  . GLU C 1 241 ? 47.116 94.330  57.546 1.00 39.52  ? 244  GLU B CA  1 
ATOM   5103 C  C   . GLU C 1 241 ? 46.987 94.990  58.889 1.00 39.41  ? 244  GLU B C   1 
ATOM   5104 O  O   . GLU C 1 241 ? 47.822 95.849  59.236 1.00 34.18  ? 244  GLU B O   1 
ATOM   5105 C  CB  . GLU C 1 241 ? 47.054 95.461  56.499 1.00 38.96  ? 244  GLU B CB  1 
ATOM   5106 C  CG  . GLU C 1 241 ? 47.647 95.109  55.162 1.00 36.60  ? 244  GLU B CG  1 
ATOM   5107 C  CD  . GLU C 1 241 ? 47.719 96.274  54.187 1.00 33.97  ? 244  GLU B CD  1 
ATOM   5108 O  OE1 . GLU C 1 241 ? 47.370 97.435  54.532 1.00 31.60  ? 244  GLU B OE1 1 
ATOM   5109 O  OE2 . GLU C 1 241 ? 48.161 95.995  53.061 1.00 35.61  ? 244  GLU B OE2 1 
ATOM   5110 N  N   . ILE C 1 242 ? 45.906 94.646  59.597 1.00 33.99  ? 245  ILE B N   1 
ATOM   5111 C  CA  . ILE C 1 242 ? 45.632 95.208  60.908 1.00 32.77  ? 245  ILE B CA  1 
ATOM   5112 C  C   . ILE C 1 242 ? 45.932 94.155  61.960 1.00 30.16  ? 245  ILE B C   1 
ATOM   5113 O  O   . ILE C 1 242 ? 45.457 93.015  61.875 1.00 29.17  ? 245  ILE B O   1 
ATOM   5114 C  CB  . ILE C 1 242 ? 44.134 95.556  61.081 1.00 27.87  ? 245  ILE B CB  1 
ATOM   5115 C  CG1 . ILE C 1 242 ? 43.568 96.327  59.864 1.00 34.48  ? 245  ILE B CG1 1 
ATOM   5116 C  CG2 . ILE C 1 242 ? 43.953 96.348  62.359 1.00 29.62  ? 245  ILE B CG2 1 
ATOM   5117 C  CD1 . ILE C 1 242 ? 44.245 97.598  59.601 1.00 33.47  ? 245  ILE B CD1 1 
ATOM   5118 N  N   . ARG C 1 243 ? 46.710 94.557  62.956 1.00 37.32  ? 246  ARG B N   1 
ATOM   5119 C  CA  . ARG C 1 243 ? 47.031 93.677  64.079 1.00 43.62  ? 246  ARG B CA  1 
ATOM   5120 C  C   . ARG C 1 243 ? 46.291 94.077  65.367 1.00 32.74  ? 246  ARG B C   1 
ATOM   5121 O  O   . ARG C 1 243 ? 45.890 93.219  66.114 1.00 33.42  ? 246  ARG B O   1 
ATOM   5122 C  CB  . ARG C 1 243 ? 48.553 93.568  64.333 1.00 44.03  ? 246  ARG B CB  1 
ATOM   5123 C  CG  . ARG C 1 243 ? 49.214 94.794  64.925 1.00 51.51  ? 246  ARG B CG  1 
ATOM   5124 C  CD  . ARG C 1 243 ? 50.499 94.423  65.673 1.00 62.08  ? 246  ARG B CD  1 
ATOM   5125 N  NE  . ARG C 1 243 ? 50.233 94.031  67.066 1.00 73.98  ? 246  ARG B NE  1 
ATOM   5126 C  CZ  . ARG C 1 243 ? 49.707 92.866  67.474 1.00 77.16  ? 246  ARG B CZ  1 
ATOM   5127 N  NH1 . ARG C 1 243 ? 49.356 91.909  66.614 1.00 79.12  ? 246  ARG B NH1 1 
ATOM   5128 N  NH2 . ARG C 1 243 ? 49.562 92.639  68.771 1.00 72.30  ? 246  ARG B NH2 1 
ATOM   5129 N  N   . ASN C 1 244 ? 46.010 95.361  65.550 1.00 28.40  ? 247  ASN B N   1 
ATOM   5130 C  CA  . ASN C 1 244 ? 45.354 95.825  66.750 1.00 28.72  ? 247  ASN B CA  1 
ATOM   5131 C  C   . ASN C 1 244 ? 44.633 97.117  66.432 1.00 30.14  ? 247  ASN B C   1 
ATOM   5132 O  O   . ASN C 1 244 ? 45.075 97.897  65.600 1.00 30.95  ? 247  ASN B O   1 
ATOM   5133 C  CB  . ASN C 1 244 ? 46.406 96.078  67.851 1.00 38.38  ? 247  ASN B CB  1 
ATOM   5134 C  CG  . ASN C 1 244 ? 45.793 96.523  69.159 1.00 36.38  ? 247  ASN B CG  1 
ATOM   5135 O  OD1 . ASN C 1 244 ? 45.669 97.723  69.432 1.00 43.67  ? 247  ASN B OD1 1 
ATOM   5136 N  ND2 . ASN C 1 244 ? 45.373 95.562  69.963 1.00 42.80  ? 247  ASN B ND2 1 
ATOM   5137 N  N   . ILE C 1 245 ? 43.538 97.336  67.154 1.00 32.06  ? 248  ILE B N   1 
ATOM   5138 C  CA  . ILE C 1 245 ? 42.701 98.525  67.052 1.00 30.01  ? 248  ILE B CA  1 
ATOM   5139 C  C   . ILE C 1 245 ? 42.374 98.878  68.465 1.00 31.26  ? 248  ILE B C   1 
ATOM   5140 O  O   . ILE C 1 245 ? 42.157 97.984  69.285 1.00 37.44  ? 248  ILE B O   1 
ATOM   5141 C  CB  . ILE C 1 245 ? 41.365 98.240  66.328 1.00 33.01  ? 248  ILE B CB  1 
ATOM   5142 C  CG1 . ILE C 1 245 ? 40.725 96.953  66.869 1.00 35.74  ? 248  ILE B CG1 1 
ATOM   5143 C  CG2 . ILE C 1 245 ? 41.594 98.183  64.822 1.00 34.59  ? 248  ILE B CG2 1 
ATOM   5144 C  CD1 . ILE C 1 245 ? 39.402 96.572  66.226 1.00 33.34  ? 248  ILE B CD1 1 
ATOM   5145 N  N   . SER C 1 246 ? 42.283 100.172 68.741 1.00 30.68  ? 249  SER B N   1 
ATOM   5146 C  CA  . SER C 1 246 ? 41.980 100.654 70.084 1.00 28.04  ? 249  SER B CA  1 
ATOM   5147 C  C   . SER C 1 246 ? 41.657 102.132 70.051 1.00 25.78  ? 249  SER B C   1 
ATOM   5148 O  O   . SER C 1 246 ? 41.909 102.788 69.040 1.00 29.80  ? 249  SER B O   1 
ATOM   5149 C  CB  . SER C 1 246 ? 43.198 100.433 70.989 1.00 34.54  ? 249  SER B CB  1 
ATOM   5150 O  OG  . SER C 1 246 ? 44.295 101.230 70.569 1.00 32.92  ? 249  SER B OG  1 
ATOM   5151 N  N   . PHE C 1 247 ? 41.071 102.648 71.129 1.00 26.92  ? 250  PHE B N   1 
ATOM   5152 C  CA  . PHE C 1 247 ? 40.724 104.066 71.207 1.00 33.01  ? 250  PHE B CA  1 
ATOM   5153 C  C   . PHE C 1 247 ? 40.884 104.684 72.575 1.00 38.64  ? 250  PHE B C   1 
ATOM   5154 O  O   . PHE C 1 247 ? 40.714 104.029 73.619 1.00 42.73  ? 250  PHE B O   1 
ATOM   5155 C  CB  . PHE C 1 247 ? 39.315 104.356 70.719 1.00 30.50  ? 250  PHE B CB  1 
ATOM   5156 C  CG  . PHE C 1 247 ? 38.276 103.619 71.452 1.00 31.56  ? 250  PHE B CG  1 
ATOM   5157 C  CD1 . PHE C 1 247 ? 37.627 104.211 72.536 1.00 38.61  ? 250  PHE B CD1 1 
ATOM   5158 C  CD2 . PHE C 1 247 ? 37.992 102.292 71.124 1.00 31.93  ? 250  PHE B CD2 1 
ATOM   5159 C  CE1 . PHE C 1 247 ? 36.714 103.487 73.301 1.00 37.59  ? 250  PHE B CE1 1 
ATOM   5160 C  CE2 . PHE C 1 247 ? 37.094 101.562 71.865 1.00 31.52  ? 250  PHE B CE2 1 
ATOM   5161 C  CZ  . PHE C 1 247 ? 36.451 102.158 72.963 1.00 39.42  ? 250  PHE B CZ  1 
ATOM   5162 N  N   . ASN C 1 248 ? 41.293 105.944 72.560 1.00 43.72  ? 251  ASN B N   1 
ATOM   5163 C  CA  . ASN C 1 248 ? 41.415 106.686 73.791 1.00 46.95  ? 251  ASN B CA  1 
ATOM   5164 C  C   . ASN C 1 248 ? 40.539 107.930 73.625 1.00 46.79  ? 251  ASN B C   1 
ATOM   5165 O  O   . ASN C 1 248 ? 40.935 108.938 73.011 1.00 43.20  ? 251  ASN B O   1 
ATOM   5166 C  CB  . ASN C 1 248 ? 42.865 107.026 74.077 1.00 50.63  ? 251  ASN B CB  1 
ATOM   5167 C  CG  . ASN C 1 248 ? 43.090 107.279 75.528 1.00 47.96  ? 251  ASN B CG  1 
ATOM   5168 O  OD1 . ASN C 1 248 ? 42.130 107.512 76.265 1.00 43.36  ? 251  ASN B OD1 1 
ATOM   5169 N  ND2 . ASN C 1 248 ? 44.343 107.185 75.971 1.00 52.04  ? 251  ASN B ND2 1 
ATOM   5170 N  N   . ASP C 1 249 ? 39.323 107.828 74.149 1.00 44.83  ? 252  ASP B N   1 
ATOM   5171 C  CA  . ASP C 1 249 ? 38.345 108.901 74.016 1.00 53.03  ? 252  ASP B CA  1 
ATOM   5172 C  C   . ASP C 1 249 ? 37.926 109.048 72.534 1.00 53.70  ? 252  ASP B C   1 
ATOM   5173 O  O   . ASP C 1 249 ? 37.314 108.121 71.980 1.00 53.56  ? 252  ASP B O   1 
ATOM   5174 C  CB  . ASP C 1 249 ? 38.899 110.214 74.573 1.00 52.74  ? 252  ASP B CB  1 
ATOM   5175 C  CG  . ASP C 1 249 ? 37.816 111.238 74.808 1.00 57.24  ? 252  ASP B CG  1 
ATOM   5176 O  OD1 . ASP C 1 249 ? 36.751 110.874 75.367 1.00 64.22  ? 252  ASP B OD1 1 
ATOM   5177 O  OD2 . ASP C 1 249 ? 38.028 112.405 74.424 1.00 64.80  ? 252  ASP B OD2 1 
ATOM   5178 N  N   . LYS C 1 250 ? 38.265 110.189 71.913 1.00 52.94  ? 253  LYS B N   1 
ATOM   5179 C  CA  . LYS C 1 250 ? 37.937 110.487 70.504 1.00 45.52  ? 253  LYS B CA  1 
ATOM   5180 C  C   . LYS C 1 250 ? 38.968 109.895 69.568 1.00 41.39  ? 253  LYS B C   1 
ATOM   5181 O  O   . LYS C 1 250 ? 38.677 109.617 68.424 1.00 41.37  ? 253  LYS B O   1 
ATOM   5182 C  CB  . LYS C 1 250 ? 37.871 111.992 70.259 1.00 43.16  ? 253  LYS B CB  1 
ATOM   5183 C  CG  . LYS C 1 250 ? 36.826 112.698 71.103 1.00 46.39  ? 253  LYS B CG  1 
ATOM   5184 C  CD  . LYS C 1 250 ? 35.483 112.005 71.027 1.00 43.10  ? 253  LYS B CD  1 
ATOM   5185 C  CE  . LYS C 1 250 ? 34.555 112.506 72.120 1.00 54.94  ? 253  LYS B CE  1 
ATOM   5186 N  NZ  . LYS C 1 250 ? 34.588 111.636 73.337 1.00 59.68  ? 253  LYS B NZ  1 
ATOM   5187 N  N   . LYS C 1 251 ? 40.183 109.721 70.061 1.00 43.66  ? 254  LYS B N   1 
ATOM   5188 C  CA  . LYS C 1 251 ? 41.254 109.166 69.260 1.00 45.19  ? 254  LYS B CA  1 
ATOM   5189 C  C   . LYS C 1 251 ? 41.120 107.652 69.077 1.00 42.70  ? 254  LYS B C   1 
ATOM   5190 O  O   . LYS C 1 251 ? 40.884 106.916 70.034 1.00 39.23  ? 254  LYS B O   1 
ATOM   5191 C  CB  . LYS C 1 251 ? 42.622 109.484 69.882 1.00 46.39  ? 254  LYS B CB  1 
ATOM   5192 C  CG  . LYS C 1 251 ? 43.734 108.680 69.255 1.00 43.23  ? 254  LYS B CG  1 
ATOM   5193 C  CD  . LYS C 1 251 ? 45.061 108.971 69.867 1.00 53.65  ? 254  LYS B CD  1 
ATOM   5194 C  CE  . LYS C 1 251 ? 45.573 110.321 69.407 1.00 54.08  ? 254  LYS B CE  1 
ATOM   5195 N  NZ  . LYS C 1 251 ? 47.053 110.394 69.663 1.00 62.93  ? 254  LYS B NZ  1 
ATOM   5196 N  N   . PHE C 1 252 ? 41.316 107.211 67.833 1.00 35.39  ? 255  PHE B N   1 
ATOM   5197 C  CA  . PHE C 1 252 ? 41.256 105.819 67.483 1.00 28.11  ? 255  PHE B CA  1 
ATOM   5198 C  C   . PHE C 1 252 ? 42.582 105.518 66.832 1.00 26.73  ? 255  PHE B C   1 
ATOM   5199 O  O   . PHE C 1 252 ? 43.059 106.296 66.020 1.00 34.81  ? 255  PHE B O   1 
ATOM   5200 C  CB  . PHE C 1 252 ? 40.089 105.575 66.518 1.00 26.86  ? 255  PHE B CB  1 
ATOM   5201 C  CG  . PHE C 1 252 ? 39.634 104.143 66.466 1.00 24.87  ? 255  PHE B CG  1 
ATOM   5202 C  CD1 . PHE C 1 252 ? 38.527 103.732 67.197 1.00 18.56  ? 255  PHE B CD1 1 
ATOM   5203 C  CD2 . PHE C 1 252 ? 40.320 103.205 65.691 1.00 29.40  ? 255  PHE B CD2 1 
ATOM   5204 C  CE1 . PHE C 1 252 ? 38.108 102.382 67.153 1.00 24.17  ? 255  PHE B CE1 1 
ATOM   5205 C  CE2 . PHE C 1 252 ? 39.914 101.849 65.633 1.00 31.93  ? 255  PHE B CE2 1 
ATOM   5206 C  CZ  . PHE C 1 252 ? 38.818 101.438 66.358 1.00 26.19  ? 255  PHE B CZ  1 
ATOM   5207 N  N   . VAL C 1 253 ? 43.194 104.404 67.204 1.00 28.77  ? 256  VAL B N   1 
ATOM   5208 C  CA  . VAL C 1 253 ? 44.500 104.014 66.662 1.00 30.45  ? 256  VAL B CA  1 
ATOM   5209 C  C   . VAL C 1 253 ? 44.461 102.600 66.043 1.00 25.79  ? 256  VAL B C   1 
ATOM   5210 O  O   . VAL C 1 253 ? 44.018 101.622 66.652 1.00 33.80  ? 256  VAL B O   1 
ATOM   5211 C  CB  . VAL C 1 253 ? 45.590 104.004 67.773 1.00 28.72  ? 256  VAL B CB  1 
ATOM   5212 C  CG1 . VAL C 1 253 ? 46.919 103.551 67.215 1.00 23.18  ? 256  VAL B CG1 1 
ATOM   5213 C  CG2 . VAL C 1 253 ? 45.694 105.362 68.427 1.00 33.41  ? 256  VAL B CG2 1 
ATOM   5214 N  N   . ILE C 1 254 ? 44.993 102.480 64.846 1.00 28.15  ? 257  ILE B N   1 
ATOM   5215 C  CA  . ILE C 1 254 ? 45.013 101.205 64.190 1.00 30.65  ? 257  ILE B CA  1 
ATOM   5216 C  C   . ILE C 1 254 ? 46.452 100.821 63.927 1.00 35.57  ? 257  ILE B C   1 
ATOM   5217 O  O   . ILE C 1 254 ? 47.146 101.472 63.158 1.00 41.94  ? 257  ILE B O   1 
ATOM   5218 C  CB  . ILE C 1 254 ? 44.200 101.268 62.893 1.00 33.85  ? 257  ILE B CB  1 
ATOM   5219 C  CG1 . ILE C 1 254 ? 42.718 101.463 63.276 1.00 37.12  ? 257  ILE B CG1 1 
ATOM   5220 C  CG2 . ILE C 1 254 ? 44.493 100.042 62.021 1.00 22.72  ? 257  ILE B CG2 1 
ATOM   5221 C  CD1 . ILE C 1 254 ? 41.838 102.088 62.232 1.00 40.82  ? 257  ILE B CD1 1 
ATOM   5222 N  N   . LYS C 1 255 ? 46.909 99.786  64.621 1.00 37.64  ? 258  LYS B N   1 
ATOM   5223 C  CA  . LYS C 1 255 ? 48.280 99.336  64.498 1.00 37.75  ? 258  LYS B CA  1 
ATOM   5224 C  C   . LYS C 1 255 ? 48.469 98.294  63.386 1.00 40.71  ? 258  LYS B C   1 
ATOM   5225 O  O   . LYS C 1 255 ? 47.851 97.219  63.407 1.00 40.43  ? 258  LYS B O   1 
ATOM   5226 C  CB  . LYS C 1 255 ? 48.772 98.778  65.837 1.00 39.85  ? 258  LYS B CB  1 
ATOM   5227 C  CG  . LYS C 1 255 ? 48.782 99.780  66.997 1.00 44.86  ? 258  LYS B CG  1 
ATOM   5228 C  CD  . LYS C 1 255 ? 49.293 99.121  68.277 1.00 49.42  ? 258  LYS B CD  1 
ATOM   5229 C  CE  . LYS C 1 255 ? 49.738 100.154 69.336 1.00 62.24  ? 258  LYS B CE  1 
ATOM   5230 N  NZ  . LYS C 1 255 ? 48.615 100.850 70.053 1.00 70.06  ? 258  LYS B NZ  1 
ATOM   5231 N  N   . PRO C 1 256 ? 49.356 98.587  62.406 1.00 48.42  ? 259  PRO B N   1 
ATOM   5232 C  CA  . PRO C 1 256 ? 49.640 97.680  61.283 1.00 49.70  ? 259  PRO B CA  1 
ATOM   5233 C  C   . PRO C 1 256 ? 50.534 96.491  61.630 1.00 51.88  ? 259  PRO B C   1 
ATOM   5234 O  O   . PRO C 1 256 ? 51.318 96.567  62.584 1.00 58.71  ? 259  PRO B O   1 
ATOM   5235 C  CB  . PRO C 1 256 ? 50.309 98.606  60.260 1.00 48.87  ? 259  PRO B CB  1 
ATOM   5236 C  CG  . PRO C 1 256 ? 51.049 99.556  61.103 1.00 47.44  ? 259  PRO B CG  1 
ATOM   5237 C  CD  . PRO C 1 256 ? 50.073 99.867  62.229 1.00 48.59  ? 259  PRO B CD  1 
ATOM   5238 N  N   . ILE C 1 257 ? 50.416 95.405  60.860 1.00 52.63  ? 260  ILE B N   1 
ATOM   5239 C  CA  . ILE C 1 257 ? 51.206 94.185  61.081 1.00 52.78  ? 260  ILE B CA  1 
ATOM   5240 C  C   . ILE C 1 257 ? 52.637 94.207  60.500 1.00 59.64  ? 260  ILE B C   1 
ATOM   5241 O  O   . ILE C 1 257 ? 52.885 93.773  59.374 1.00 59.32  ? 260  ILE B O   1 
ATOM   5242 C  CB  . ILE C 1 257 ? 50.497 92.939  60.545 1.00 47.84  ? 260  ILE B CB  1 
ATOM   5243 C  CG1 . ILE C 1 257 ? 49.113 92.774  61.165 1.00 46.28  ? 260  ILE B CG1 1 
ATOM   5244 C  CG2 . ILE C 1 257 ? 51.328 91.702  60.874 1.00 59.54  ? 260  ILE B CG2 1 
ATOM   5245 C  CD1 . ILE C 1 257 ? 48.400 91.486  60.742 1.00 39.45  ? 260  ILE B CD1 1 
ATOM   5246 N  N   . ASP C 1 258 ? 53.568 94.702  61.314 1.00 69.11  ? 261  ASP B N   1 
ATOM   5247 C  CA  . ASP C 1 258 ? 55.004 94.821  61.012 1.00 74.36  ? 261  ASP B CA  1 
ATOM   5248 C  C   . ASP C 1 258 ? 55.650 95.666  62.145 1.00 74.76  ? 261  ASP B C   1 
ATOM   5249 O  O   . ASP C 1 258 ? 55.734 95.229  63.309 1.00 73.23  ? 261  ASP B O   1 
ATOM   5250 C  CB  . ASP C 1 258 ? 55.234 95.442  59.597 1.00 80.18  ? 261  ASP B CB  1 
ATOM   5251 C  CG  . ASP C 1 258 ? 54.605 96.842  59.426 1.00 80.95  ? 261  ASP B CG  1 
ATOM   5252 O  OD1 . ASP C 1 258 ? 53.378 96.999  59.581 1.00 77.44  ? 261  ASP B OD1 1 
ATOM   5253 O  OD2 . ASP C 1 258 ? 55.358 97.791  59.122 1.00 85.06  ? 261  ASP B OD2 1 
ATOM   5254 N  N   . LYS C 1 259 ? 56.116 96.859  61.800 1.00 73.68  ? 262  LYS B N   1 
ATOM   5255 C  CA  . LYS C 1 259 ? 56.681 97.787  62.760 1.00 73.40  ? 262  LYS B CA  1 
ATOM   5256 C  C   . LYS C 1 259 ? 57.067 99.061  61.998 1.00 70.77  ? 262  LYS B C   1 
ATOM   5257 O  O   . LYS C 1 259 ? 56.898 100.185 62.493 1.00 61.85  ? 262  LYS B O   1 
ATOM   5258 C  CB  . LYS C 1 259 ? 57.908 97.182  63.487 1.00 83.86  ? 262  LYS B CB  1 
ATOM   5259 C  CG  . LYS C 1 259 ? 59.047 96.642  62.579 1.00 89.16  ? 262  LYS B CG  1 
ATOM   5260 C  CD  . LYS C 1 259 ? 60.379 97.387  62.783 1.00 86.14  ? 262  LYS B CD  1 
ATOM   5261 C  CE  . LYS C 1 259 ? 61.429 96.923  61.767 1.00 86.96  ? 262  LYS B CE  1 
ATOM   5262 N  NZ  . LYS C 1 259 ? 62.655 97.784  61.800 1.00 86.48  ? 262  LYS B NZ  1 
ATOM   5263 N  N   . LYS C 1 260 ? 57.464 98.885  60.742 1.00 68.18  ? 263  LYS B N   1 
ATOM   5264 C  CA  . LYS C 1 260 ? 57.918 100.016 59.968 1.00 68.03  ? 263  LYS B CA  1 
ATOM   5265 C  C   . LYS C 1 260 ? 56.833 100.993 59.510 1.00 65.07  ? 263  LYS B C   1 
ATOM   5266 O  O   . LYS C 1 260 ? 57.133 102.147 59.180 1.00 57.48  ? 263  LYS B O   1 
ATOM   5267 C  CB  . LYS C 1 260 ? 58.825 99.564  58.802 1.00 74.94  ? 263  LYS B CB  1 
ATOM   5268 C  CG  . LYS C 1 260 ? 60.213 100.298 58.710 1.00 77.42  ? 263  LYS B CG  1 
ATOM   5269 C  CD  . LYS C 1 260 ? 61.065 100.315 60.030 1.00 75.69  ? 263  LYS B CD  1 
ATOM   5270 C  CE  . LYS C 1 260 ? 60.637 101.423 61.011 1.00 73.39  ? 263  LYS B CE  1 
ATOM   5271 N  NZ  . LYS C 1 260 ? 61.330 101.358 62.322 1.00 79.35  ? 263  LYS B NZ  1 
ATOM   5272 N  N   . ALA C 1 261 ? 55.571 100.568 59.518 1.00 62.36  ? 264  ALA B N   1 
ATOM   5273 C  CA  . ALA C 1 261 ? 54.508 101.485 59.118 1.00 54.04  ? 264  ALA B CA  1 
ATOM   5274 C  C   . ALA C 1 261 ? 53.914 102.089 60.368 1.00 53.41  ? 264  ALA B C   1 
ATOM   5275 O  O   . ALA C 1 261 ? 53.599 101.363 61.324 1.00 55.85  ? 264  ALA B O   1 
ATOM   5276 C  CB  . ALA C 1 261 ? 53.452 100.756 58.340 1.00 60.69  ? 264  ALA B CB  1 
ATOM   5277 N  N   . PRO C 1 262 ? 53.701 103.420 60.361 1.00 48.43  ? 265  PRO B N   1 
ATOM   5278 C  CA  . PRO C 1 262 ? 53.147 104.176 61.485 1.00 51.92  ? 265  PRO B CA  1 
ATOM   5279 C  C   . PRO C 1 262 ? 51.685 103.755 61.798 1.00 50.70  ? 265  PRO B C   1 
ATOM   5280 O  O   . PRO C 1 262 ? 51.077 102.940 61.099 1.00 43.73  ? 265  PRO B O   1 
ATOM   5281 C  CB  . PRO C 1 262 ? 53.250 105.634 60.988 1.00 47.09  ? 265  PRO B CB  1 
ATOM   5282 C  CG  . PRO C 1 262 ? 52.976 105.508 59.539 1.00 48.71  ? 265  PRO B CG  1 
ATOM   5283 C  CD  . PRO C 1 262 ? 53.745 104.256 59.140 1.00 50.03  ? 265  PRO B CD  1 
ATOM   5284 N  N   . ASP C 1 263 ? 51.173 104.238 62.917 1.00 50.33  ? 266  ASP B N   1 
ATOM   5285 C  CA  . ASP C 1 263 ? 49.816 103.933 63.286 1.00 46.50  ? 266  ASP B CA  1 
ATOM   5286 C  C   . ASP C 1 263 ? 48.848 104.716 62.420 1.00 44.57  ? 266  ASP B C   1 
ATOM   5287 O  O   . ASP C 1 263 ? 49.100 105.878 62.040 1.00 41.15  ? 266  ASP B O   1 
ATOM   5288 C  CB  . ASP C 1 263 ? 49.561 104.302 64.735 1.00 46.14  ? 266  ASP B CB  1 
ATOM   5289 C  CG  . ASP C 1 263 ? 50.185 103.332 65.699 1.00 50.90  ? 266  ASP B CG  1 
ATOM   5290 O  OD1 . ASP C 1 263 ? 50.614 102.223 65.278 1.00 48.73  ? 266  ASP B OD1 1 
ATOM   5291 O  OD2 . ASP C 1 263 ? 50.228 103.699 66.892 1.00 50.57  ? 266  ASP B OD2 1 
ATOM   5292 N  N   . PHE C 1 264 ? 47.743 104.073 62.081 1.00 35.78  ? 267  PHE B N   1 
ATOM   5293 C  CA  . PHE C 1 264 ? 46.746 104.761 61.301 1.00 32.56  ? 267  PHE B CA  1 
ATOM   5294 C  C   . PHE C 1 264 ? 45.851 105.355 62.377 1.00 29.58  ? 267  PHE B C   1 
ATOM   5295 O  O   . PHE C 1 264 ? 45.224 104.623 63.139 1.00 33.49  ? 267  PHE B O   1 
ATOM   5296 C  CB  . PHE C 1 264 ? 46.026 103.751 60.419 1.00 29.14  ? 267  PHE B CB  1 
ATOM   5297 C  CG  . PHE C 1 264 ? 44.789 104.287 59.779 1.00 31.25  ? 267  PHE B CG  1 
ATOM   5298 C  CD1 . PHE C 1 264 ? 43.653 103.476 59.665 1.00 28.33  ? 267  PHE B CD1 1 
ATOM   5299 C  CD2 . PHE C 1 264 ? 44.724 105.622 59.382 1.00 28.79  ? 267  PHE B CD2 1 
ATOM   5300 C  CE1 . PHE C 1 264 ? 42.476 103.982 59.185 1.00 28.24  ? 267  PHE B CE1 1 
ATOM   5301 C  CE2 . PHE C 1 264 ? 43.544 106.150 58.897 1.00 35.73  ? 267  PHE B CE2 1 
ATOM   5302 C  CZ  . PHE C 1 264 ? 42.410 105.330 58.799 1.00 38.68  ? 267  PHE B CZ  1 
ATOM   5303 N  N   . VAL C 1 265 ? 45.835 106.679 62.486 1.00 33.13  ? 268  VAL B N   1 
ATOM   5304 C  CA  . VAL C 1 265 ? 45.030 107.314 63.543 1.00 32.40  ? 268  VAL B CA  1 
ATOM   5305 C  C   . VAL C 1 265 ? 44.031 108.321 63.018 1.00 30.10  ? 268  VAL B C   1 
ATOM   5306 O  O   . VAL C 1 265 ? 44.299 109.049 62.057 1.00 33.02  ? 268  VAL B O   1 
ATOM   5307 C  CB  . VAL C 1 265 ? 45.921 107.913 64.708 1.00 34.70  ? 268  VAL B CB  1 
ATOM   5308 C  CG1 . VAL C 1 265 ? 45.060 108.403 65.846 1.00 23.81  ? 268  VAL B CG1 1 
ATOM   5309 C  CG2 . VAL C 1 265 ? 46.885 106.817 65.247 1.00 35.35  ? 268  VAL B CG2 1 
ATOM   5310 N  N   . PHE C 1 266 ? 42.852 108.316 63.626 1.00 27.23  ? 269  PHE B N   1 
ATOM   5311 C  CA  . PHE C 1 266 ? 41.793 109.212 63.223 1.00 24.54  ? 269  PHE B CA  1 
ATOM   5312 C  C   . PHE C 1 266 ? 41.010 109.541 64.454 1.00 24.50  ? 269  PHE B C   1 
ATOM   5313 O  O   . PHE C 1 266 ? 41.164 108.883 65.488 1.00 28.28  ? 269  PHE B O   1 
ATOM   5314 C  CB  . PHE C 1 266 ? 40.926 108.576 62.104 1.00 27.54  ? 269  PHE B CB  1 
ATOM   5315 C  CG  . PHE C 1 266 ? 40.108 107.361 62.529 1.00 20.37  ? 269  PHE B CG  1 
ATOM   5316 C  CD1 . PHE C 1 266 ? 38.929 107.515 63.294 1.00 26.93  ? 269  PHE B CD1 1 
ATOM   5317 C  CD2 . PHE C 1 266 ? 40.514 106.077 62.170 1.00 15.31  ? 269  PHE B CD2 1 
ATOM   5318 C  CE1 . PHE C 1 266 ? 38.180 106.388 63.697 1.00 20.13  ? 269  PHE B CE1 1 
ATOM   5319 C  CE2 . PHE C 1 266 ? 39.792 104.949 62.553 1.00 20.85  ? 269  PHE B CE2 1 
ATOM   5320 C  CZ  . PHE C 1 266 ? 38.618 105.092 63.323 1.00 20.04  ? 269  PHE B CZ  1 
ATOM   5321 N  N   . TYR C 1 267 ? 40.206 110.591 64.343 1.00 25.91  ? 270  TYR B N   1 
ATOM   5322 C  CA  . TYR C 1 267 ? 39.414 111.132 65.440 1.00 30.34  ? 270  TYR B CA  1 
ATOM   5323 C  C   . TYR C 1 267 ? 37.921 111.120 65.164 1.00 29.98  ? 270  TYR B C   1 
ATOM   5324 O  O   . TYR C 1 267 ? 37.506 111.663 64.158 1.00 27.08  ? 270  TYR B O   1 
ATOM   5325 C  CB  . TYR C 1 267 ? 39.851 112.585 65.674 1.00 27.80  ? 270  TYR B CB  1 
ATOM   5326 C  CG  . TYR C 1 267 ? 41.329 112.701 65.956 1.00 42.83  ? 270  TYR B CG  1 
ATOM   5327 C  CD1 . TYR C 1 267 ? 42.233 112.995 64.928 1.00 41.55  ? 270  TYR B CD1 1 
ATOM   5328 C  CD2 . TYR C 1 267 ? 41.837 112.426 67.232 1.00 40.96  ? 270  TYR B CD2 1 
ATOM   5329 C  CE1 . TYR C 1 267 ? 43.604 113.002 65.153 1.00 36.79  ? 270  TYR B CE1 1 
ATOM   5330 C  CE2 . TYR C 1 267 ? 43.202 112.430 67.472 1.00 43.07  ? 270  TYR B CE2 1 
ATOM   5331 C  CZ  . TYR C 1 267 ? 44.089 112.714 66.428 1.00 43.17  ? 270  TYR B CZ  1 
ATOM   5332 O  OH  . TYR C 1 267 ? 45.457 112.658 66.651 1.00 45.48  ? 270  TYR B OH  1 
ATOM   5333 N  N   . ALA C 1 268 ? 37.145 110.498 66.063 1.00 34.81  ? 271  ALA B N   1 
ATOM   5334 C  CA  . ALA C 1 268 ? 35.685 110.421 65.996 1.00 34.16  ? 271  ALA B CA  1 
ATOM   5335 C  C   . ALA C 1 268 ? 35.111 111.568 66.816 1.00 37.36  ? 271  ALA B C   1 
ATOM   5336 O  O   . ALA C 1 268 ? 35.670 111.940 67.833 1.00 38.07  ? 271  ALA B O   1 
ATOM   5337 C  CB  . ALA C 1 268 ? 35.210 109.119 66.584 1.00 36.06  ? 271  ALA B CB  1 
ATOM   5338 N  N   . PRO C 1 269 ? 33.948 112.099 66.418 1.00 37.96  ? 272  PRO B N   1 
ATOM   5339 C  CA  . PRO C 1 269 ? 33.320 113.207 67.142 1.00 39.48  ? 272  PRO B CA  1 
ATOM   5340 C  C   . PRO C 1 269 ? 32.779 112.855 68.538 1.00 41.71  ? 272  PRO B C   1 
ATOM   5341 O  O   . PRO C 1 269 ? 32.584 113.750 69.363 1.00 38.62  ? 272  PRO B O   1 
ATOM   5342 C  CB  . PRO C 1 269 ? 32.196 113.621 66.194 1.00 43.85  ? 272  PRO B CB  1 
ATOM   5343 C  CG  . PRO C 1 269 ? 31.830 112.344 65.523 1.00 37.19  ? 272  PRO B CG  1 
ATOM   5344 C  CD  . PRO C 1 269 ? 33.151 111.715 65.237 1.00 32.56  ? 272  PRO B CD  1 
ATOM   5345 N  N   . ARG C 1 270 ? 32.569 111.555 68.789 1.00 39.63  ? 273  ARG B N   1 
ATOM   5346 C  CA  . ARG C 1 270 ? 32.029 111.019 70.053 1.00 35.34  ? 273  ARG B CA  1 
ATOM   5347 C  C   . ARG C 1 270 ? 32.708 109.685 70.443 1.00 32.57  ? 273  ARG B C   1 
ATOM   5348 O  O   . ARG C 1 270 ? 33.198 108.947 69.595 1.00 28.80  ? 273  ARG B O   1 
ATOM   5349 C  CB  . ARG C 1 270 ? 30.498 110.777 69.921 1.00 39.27  ? 273  ARG B CB  1 
ATOM   5350 C  CG  . ARG C 1 270 ? 29.554 111.997 70.143 1.00 49.85  ? 273  ARG B CG  1 
ATOM   5351 C  CD  . ARG C 1 270 ? 29.315 112.311 71.625 1.00 58.06  ? 273  ARG B CD  1 
ATOM   5352 N  NE  . ARG C 1 270 ? 28.942 111.096 72.367 1.00 68.88  ? 273  ARG B NE  1 
ATOM   5353 C  CZ  . ARG C 1 270 ? 29.716 110.467 73.265 1.00 66.39  ? 273  ARG B CZ  1 
ATOM   5354 N  NH1 . ARG C 1 270 ? 30.930 110.926 73.580 1.00 65.94  ? 273  ARG B NH1 1 
ATOM   5355 N  NH2 . ARG C 1 270 ? 29.304 109.326 73.801 1.00 55.10  ? 273  ARG B NH2 1 
ATOM   5356 N  N   . LEU C 1 271 ? 32.756 109.379 71.737 1.00 31.81  ? 274  LEU B N   1 
ATOM   5357 C  CA  . LEU C 1 271 ? 33.372 108.133 72.178 1.00 32.52  ? 274  LEU B CA  1 
ATOM   5358 C  C   . LEU C 1 271 ? 32.432 106.966 71.819 1.00 29.35  ? 274  LEU B C   1 
ATOM   5359 O  O   . LEU C 1 271 ? 32.863 105.817 71.637 1.00 28.77  ? 274  LEU B O   1 
ATOM   5360 C  CB  . LEU C 1 271 ? 33.606 108.168 73.692 1.00 39.85  ? 274  LEU B CB  1 
ATOM   5361 C  CG  . LEU C 1 271 ? 33.855 106.792 74.310 1.00 38.49  ? 274  LEU B CG  1 
ATOM   5362 C  CD1 . LEU C 1 271 ? 35.312 106.367 74.159 1.00 36.12  ? 274  LEU B CD1 1 
ATOM   5363 C  CD2 . LEU C 1 271 ? 33.419 106.846 75.738 1.00 42.01  ? 274  LEU B CD2 1 
ATOM   5364 N  N   . ARG C 1 272 ? 31.135 107.275 71.783 1.00 33.10  ? 275  ARG B N   1 
ATOM   5365 C  CA  . ARG C 1 272 ? 30.087 106.310 71.444 1.00 34.22  ? 275  ARG B CA  1 
ATOM   5366 C  C   . ARG C 1 272 ? 30.367 105.675 70.061 1.00 32.13  ? 275  ARG B C   1 
ATOM   5367 O  O   . ARG C 1 272 ? 30.207 104.451 69.873 1.00 33.10  ? 275  ARG B O   1 
ATOM   5368 C  CB  . ARG C 1 272 ? 28.728 107.030 71.450 1.00 31.49  ? 275  ARG B CB  1 
ATOM   5369 C  CG  . ARG C 1 272 ? 27.521 106.169 71.159 1.00 36.96  ? 275  ARG B CG  1 
ATOM   5370 C  CD  . ARG C 1 272 ? 26.283 107.036 70.963 1.00 49.81  ? 275  ARG B CD  1 
ATOM   5371 N  NE  . ARG C 1 272 ? 26.131 108.064 72.008 1.00 64.49  ? 275  ARG B NE  1 
ATOM   5372 C  CZ  . ARG C 1 272 ? 25.641 107.869 73.244 1.00 71.15  ? 275  ARG B CZ  1 
ATOM   5373 N  NH1 . ARG C 1 272 ? 25.233 106.666 73.651 1.00 72.02  ? 275  ARG B NH1 1 
ATOM   5374 N  NH2 . ARG C 1 272 ? 25.528 108.898 74.081 1.00 66.94  ? 275  ARG B NH2 1 
ATOM   5375 N  N   . ILE C 1 273 ? 30.766 106.542 69.118 1.00 33.99  ? 276  ILE B N   1 
ATOM   5376 C  CA  . ILE C 1 273 ? 31.103 106.211 67.719 1.00 31.17  ? 276  ILE B CA  1 
ATOM   5377 C  C   . ILE C 1 273 ? 32.291 105.225 67.688 1.00 29.31  ? 276  ILE B C   1 
ATOM   5378 O  O   . ILE C 1 273 ? 32.198 104.163 67.071 1.00 26.26  ? 276  ILE B O   1 
ATOM   5379 C  CB  . ILE C 1 273 ? 31.412 107.531 66.907 1.00 32.00  ? 276  ILE B CB  1 
ATOM   5380 C  CG1 . ILE C 1 273 ? 30.158 108.395 66.791 1.00 32.92  ? 276  ILE B CG1 1 
ATOM   5381 C  CG2 . ILE C 1 273 ? 31.951 107.240 65.533 1.00 33.99  ? 276  ILE B CG2 1 
ATOM   5382 C  CD1 . ILE C 1 273 ? 28.964 107.651 66.239 1.00 44.12  ? 276  ILE B CD1 1 
ATOM   5383 N  N   . ASN C 1 274 ? 33.368 105.558 68.416 1.00 30.49  ? 277  ASN B N   1 
ATOM   5384 C  CA  . ASN C 1 274 ? 34.558 104.708 68.518 1.00 24.66  ? 277  ASN B CA  1 
ATOM   5385 C  C   . ASN C 1 274 ? 34.228 103.337 69.128 1.00 18.59  ? 277  ASN B C   1 
ATOM   5386 O  O   . ASN C 1 274 ? 34.817 102.321 68.746 1.00 23.64  ? 277  ASN B O   1 
ATOM   5387 C  CB  . ASN C 1 274 ? 35.618 105.418 69.340 1.00 28.25  ? 277  ASN B CB  1 
ATOM   5388 C  CG  . ASN C 1 274 ? 36.386 106.371 68.523 1.00 33.08  ? 277  ASN B CG  1 
ATOM   5389 O  OD1 . ASN C 1 274 ? 36.516 106.171 67.326 1.00 24.27  ? 277  ASN B OD1 1 
ATOM   5390 N  ND2 . ASN C 1 274 ? 36.899 107.418 69.140 1.00 30.98  ? 277  ASN B ND2 1 
ATOM   5391 N  N   . LYS C 1 275 ? 33.322 103.303 70.095 1.00 19.64  ? 278  LYS B N   1 
ATOM   5392 C  CA  . LYS C 1 275 ? 32.953 102.021 70.652 1.00 25.99  ? 278  LYS B CA  1 
ATOM   5393 C  C   . LYS C 1 275 ? 32.257 101.151 69.601 1.00 25.66  ? 278  LYS B C   1 
ATOM   5394 O  O   . LYS C 1 275 ? 32.491 99.924  69.559 1.00 26.53  ? 278  LYS B O   1 
ATOM   5395 C  CB  . LYS C 1 275 ? 32.078 102.190 71.888 1.00 34.25  ? 278  LYS B CB  1 
ATOM   5396 C  CG  . LYS C 1 275 ? 32.850 102.543 73.156 1.00 38.46  ? 278  LYS B CG  1 
ATOM   5397 C  CD  . LYS C 1 275 ? 31.931 102.444 74.332 1.00 48.69  ? 278  LYS B CD  1 
ATOM   5398 C  CE  . LYS C 1 275 ? 32.442 103.215 75.529 1.00 58.06  ? 278  LYS B CE  1 
ATOM   5399 N  NZ  . LYS C 1 275 ? 31.323 103.327 76.510 1.00 60.88  ? 278  LYS B NZ  1 
ATOM   5400 N  N   . ARG C 1 276 ? 31.462 101.800 68.726 1.00 29.83  ? 279  ARG B N   1 
ATOM   5401 C  CA  . ARG C 1 276 ? 30.721 101.127 67.645 1.00 28.82  ? 279  ARG B CA  1 
ATOM   5402 C  C   . ARG C 1 276 ? 31.701 100.664 66.576 1.00 20.45  ? 279  ARG B C   1 
ATOM   5403 O  O   . ARG C 1 276 ? 31.609 99.554  66.093 1.00 21.19  ? 279  ARG B O   1 
ATOM   5404 C  CB  . ARG C 1 276 ? 29.655 102.036 67.028 1.00 37.59  ? 279  ARG B CB  1 
ATOM   5405 C  CG  . ARG C 1 276 ? 28.553 102.462 68.003 1.00 55.10  ? 279  ARG B CG  1 
ATOM   5406 C  CD  . ARG C 1 276 ? 27.378 103.121 67.268 1.00 64.27  ? 279  ARG B CD  1 
ATOM   5407 N  NE  . ARG C 1 276 ? 26.640 102.185 66.403 1.00 70.67  ? 279  ARG B NE  1 
ATOM   5408 C  CZ  . ARG C 1 276 ? 25.592 101.453 66.794 1.00 69.32  ? 279  ARG B CZ  1 
ATOM   5409 N  NH1 . ARG C 1 276 ? 25.144 101.508 68.042 1.00 75.72  ? 279  ARG B NH1 1 
ATOM   5410 N  NH2 . ARG C 1 276 ? 24.917 100.744 65.915 1.00 69.08  ? 279  ARG B NH2 1 
ATOM   5411 N  N   . ILE C 1 277 ? 32.662 101.514 66.249 1.00 18.47  ? 280  ILE B N   1 
ATOM   5412 C  CA  . ILE C 1 277 ? 33.688 101.169 65.284 1.00 21.24  ? 280  ILE B CA  1 
ATOM   5413 C  C   . ILE C 1 277 ? 34.462 99.930  65.760 1.00 24.97  ? 280  ILE B C   1 
ATOM   5414 O  O   . ILE C 1 277 ? 34.700 98.992  64.976 1.00 21.15  ? 280  ILE B O   1 
ATOM   5415 C  CB  . ILE C 1 277 ? 34.694 102.378 65.028 1.00 19.24  ? 280  ILE B CB  1 
ATOM   5416 C  CG1 . ILE C 1 277 ? 33.968 103.485 64.267 1.00 20.84  ? 280  ILE B CG1 1 
ATOM   5417 C  CG2 . ILE C 1 277 ? 35.878 101.949 64.165 1.00 13.31  ? 280  ILE B CG2 1 
ATOM   5418 C  CD1 . ILE C 1 277 ? 34.655 104.823 64.243 1.00 19.57  ? 280  ILE B CD1 1 
ATOM   5419 N  N   . LEU C 1 278 ? 34.834 99.905  67.042 1.00 25.48  ? 281  LEU B N   1 
ATOM   5420 C  CA  . LEU C 1 278 ? 35.595 98.776  67.583 1.00 27.05  ? 281  LEU B CA  1 
ATOM   5421 C  C   . LEU C 1 278 ? 34.787 97.481  67.501 1.00 20.39  ? 281  LEU B C   1 
ATOM   5422 O  O   . LEU C 1 278 ? 35.249 96.461  66.974 1.00 21.80  ? 281  LEU B O   1 
ATOM   5423 C  CB  . LEU C 1 278 ? 36.064 99.051  69.029 1.00 31.39  ? 281  LEU B CB  1 
ATOM   5424 C  CG  . LEU C 1 278 ? 37.256 98.174  69.434 1.00 24.30  ? 281  LEU B CG  1 
ATOM   5425 C  CD1 . LEU C 1 278 ? 38.417 99.037  69.901 1.00 27.23  ? 281  LEU B CD1 1 
ATOM   5426 C  CD2 . LEU C 1 278 ? 36.815 97.164  70.490 1.00 30.94  ? 281  LEU B CD2 1 
ATOM   5427 N  N   . ALA C 1 279 ? 33.551 97.552  67.963 1.00 22.85  ? 282  ALA B N   1 
ATOM   5428 C  CA  . ALA C 1 279 ? 32.657 96.402  67.937 1.00 22.47  ? 282  ALA B CA  1 
ATOM   5429 C  C   . ALA C 1 279 ? 32.540 95.871  66.488 1.00 25.35  ? 282  ALA B C   1 
ATOM   5430 O  O   . ALA C 1 279 ? 32.739 94.675  66.217 1.00 23.23  ? 282  ALA B O   1 
ATOM   5431 C  CB  . ALA C 1 279 ? 31.300 96.816  68.492 1.00 19.86  ? 282  ALA B CB  1 
ATOM   5432 N  N   . LEU C 1 280 ? 32.325 96.786  65.541 1.00 26.01  ? 283  LEU B N   1 
ATOM   5433 C  CA  . LEU C 1 280 ? 32.183 96.417  64.133 1.00 23.20  ? 283  LEU B CA  1 
ATOM   5434 C  C   . LEU C 1 280 ? 33.431 95.836  63.508 1.00 15.86  ? 283  LEU B C   1 
ATOM   5435 O  O   . LEU C 1 280 ? 33.337 94.884  62.733 1.00 21.38  ? 283  LEU B O   1 
ATOM   5436 C  CB  . LEU C 1 280 ? 31.669 97.609  63.291 1.00 15.18  ? 283  LEU B CB  1 
ATOM   5437 C  CG  . LEU C 1 280 ? 30.206 97.921  63.605 1.00 18.06  ? 283  LEU B CG  1 
ATOM   5438 C  CD1 . LEU C 1 280 ? 29.859 99.085  62.756 1.00 17.45  ? 283  LEU B CD1 1 
ATOM   5439 C  CD2 . LEU C 1 280 ? 29.271 96.740  63.288 1.00 18.90  ? 283  LEU B CD2 1 
ATOM   5440 N  N   . CYS C 1 281 ? 34.596 96.430  63.792 1.00 18.15  ? 284  CYS B N   1 
ATOM   5441 C  CA  . CYS C 1 281 ? 35.865 95.894  63.252 1.00 22.43  ? 284  CYS B CA  1 
ATOM   5442 C  C   . CYS C 1 281 ? 36.122 94.462  63.737 1.00 22.17  ? 284  CYS B C   1 
ATOM   5443 O  O   . CYS C 1 281 ? 36.438 93.571  62.942 1.00 23.62  ? 284  CYS B O   1 
ATOM   5444 C  CB  . CYS C 1 281 ? 37.060 96.759  63.652 1.00 20.45  ? 284  CYS B CB  1 
ATOM   5445 S  SG  . CYS C 1 281 ? 37.070 98.353  62.849 1.00 24.07  ? 284  CYS B SG  1 
HETATM 5446 N  N   . MSE C 1 282 ? 35.956 94.259  65.048 1.00 25.34  ? 285  MSE B N   1 
HETATM 5447 C  CA  . MSE C 1 282 ? 36.141 92.959  65.678 1.00 24.96  ? 285  MSE B CA  1 
HETATM 5448 C  C   . MSE C 1 282 ? 35.247 91.895  65.062 1.00 25.27  ? 285  MSE B C   1 
HETATM 5449 O  O   . MSE C 1 282 ? 35.714 90.813  64.679 1.00 26.72  ? 285  MSE B O   1 
HETATM 5450 C  CB  . MSE C 1 282 ? 35.862 93.053  67.179 1.00 31.79  ? 285  MSE B CB  1 
HETATM 5451 C  CG  . MSE C 1 282 ? 36.954 93.746  67.998 1.00 41.03  ? 285  MSE B CG  1 
HETATM 5452 SE SE  . MSE C 1 282 ? 36.446 93.903  69.854 1.00 57.85  ? 285  MSE B SE  1 
HETATM 5453 C  CE  . MSE C 1 282 ? 36.134 92.104  70.110 1.00 45.10  ? 285  MSE B CE  1 
ATOM   5454 N  N   . GLY C 1 283 ? 33.956 92.202  64.947 1.00 18.55  ? 286  GLY B N   1 
ATOM   5455 C  CA  . GLY C 1 283 ? 33.028 91.253  64.355 1.00 18.12  ? 286  GLY B CA  1 
ATOM   5456 C  C   . GLY C 1 283 ? 33.288 90.877  62.908 1.00 14.60  ? 286  GLY B C   1 
ATOM   5457 O  O   . GLY C 1 283 ? 33.231 89.709  62.520 1.00 21.97  ? 286  GLY B O   1 
ATOM   5458 N  N   . ASN C 1 284 ? 33.506 91.888  62.082 1.00 19.33  ? 287  ASN B N   1 
ATOM   5459 C  CA  . ASN C 1 284 ? 33.806 91.664  60.679 1.00 19.53  ? 287  ASN B CA  1 
ATOM   5460 C  C   . ASN C 1 284 ? 35.132 90.966  60.537 1.00 16.22  ? 287  ASN B C   1 
ATOM   5461 O  O   . ASN C 1 284 ? 35.263 90.088  59.708 1.00 20.90  ? 287  ASN B O   1 
ATOM   5462 C  CB  . ASN C 1 284 ? 33.815 92.982  59.899 1.00 17.75  ? 287  ASN B CB  1 
ATOM   5463 C  CG  . ASN C 1 284 ? 32.426 93.422  59.550 1.00 13.37  ? 287  ASN B CG  1 
ATOM   5464 O  OD1 . ASN C 1 284 ? 31.776 92.786  58.730 1.00 15.40  ? 287  ASN B OD1 1 
ATOM   5465 N  ND2 . ASN C 1 284 ? 31.946 94.479  60.189 1.00 14.75  ? 287  ASN B ND2 1 
ATOM   5466 N  N   . HIS C 1 285 ? 36.134 91.375  61.305 1.00 20.06  ? 288  HIS B N   1 
ATOM   5467 C  CA  . HIS C 1 285 ? 37.433 90.689  61.212 1.00 21.81  ? 288  HIS B CA  1 
ATOM   5468 C  C   . HIS C 1 285 ? 37.328 89.162  61.509 1.00 18.96  ? 288  HIS B C   1 
ATOM   5469 O  O   . HIS C 1 285 ? 37.773 88.328  60.723 1.00 19.96  ? 288  HIS B O   1 
ATOM   5470 C  CB  . HIS C 1 285 ? 38.459 91.354  62.121 1.00 25.49  ? 288  HIS B CB  1 
ATOM   5471 C  CG  . HIS C 1 285 ? 39.771 90.642  62.139 1.00 37.94  ? 288  HIS B CG  1 
ATOM   5472 N  ND1 . HIS C 1 285 ? 39.913 89.370  62.655 1.00 36.02  ? 288  HIS B ND1 1 
ATOM   5473 C  CD2 . HIS C 1 285 ? 40.963 90.957  61.580 1.00 44.34  ? 288  HIS B CD2 1 
ATOM   5474 C  CE1 . HIS C 1 285 ? 41.127 88.924  62.392 1.00 39.10  ? 288  HIS B CE1 1 
ATOM   5475 N  NE2 . HIS C 1 285 ? 41.785 89.866  61.741 1.00 46.06  ? 288  HIS B NE2 1 
ATOM   5476 N  N   . GLU C 1 286 ? 36.666 88.832  62.612 1.00 27.11  ? 289  GLU B N   1 
ATOM   5477 C  CA  . GLU C 1 286 ? 36.448 87.459  63.046 1.00 31.35  ? 289  GLU B CA  1 
ATOM   5478 C  C   . GLU C 1 286 ? 35.690 86.611  62.005 1.00 29.65  ? 289  GLU B C   1 
ATOM   5479 O  O   . GLU C 1 286 ? 36.075 85.472  61.696 1.00 25.69  ? 289  GLU B O   1 
ATOM   5480 C  CB  . GLU C 1 286 ? 35.665 87.487  64.357 1.00 40.65  ? 289  GLU B CB  1 
ATOM   5481 C  CG  . GLU C 1 286 ? 35.637 86.181  65.147 1.00 46.43  ? 289  GLU B CG  1 
ATOM   5482 C  CD  . GLU C 1 286 ? 34.570 86.194  66.239 1.00 47.86  ? 289  GLU B CD  1 
ATOM   5483 O  OE1 . GLU C 1 286 ? 33.877 85.170  66.383 1.00 57.69  ? 289  GLU B OE1 1 
ATOM   5484 O  OE2 . GLU C 1 286 ? 34.402 87.225  66.932 1.00 49.91  ? 289  GLU B OE2 1 
ATOM   5485 N  N   . LEU C 1 287 ? 34.604 87.146  61.460 1.00 22.64  ? 290  LEU B N   1 
ATOM   5486 C  CA  . LEU C 1 287 ? 33.881 86.372  60.479 1.00 17.88  ? 290  LEU B CA  1 
ATOM   5487 C  C   . LEU C 1 287 ? 34.701 86.230  59.183 1.00 22.57  ? 290  LEU B C   1 
ATOM   5488 O  O   . LEU C 1 287 ? 34.605 85.230  58.452 1.00 19.66  ? 290  LEU B O   1 
ATOM   5489 C  CB  . LEU C 1 287 ? 32.544 87.044  60.158 1.00 21.65  ? 290  LEU B CB  1 
ATOM   5490 C  CG  . LEU C 1 287 ? 31.540 87.008  61.278 1.00 20.54  ? 290  LEU B CG  1 
ATOM   5491 C  CD1 . LEU C 1 287 ? 30.323 87.889  60.939 1.00 30.19  ? 290  LEU B CD1 1 
ATOM   5492 C  CD2 . LEU C 1 287 ? 31.125 85.563  61.484 1.00 28.47  ? 290  LEU B CD2 1 
ATOM   5493 N  N   . TYR C 1 288 ? 35.489 87.255  58.870 1.00 20.89  ? 291  TYR B N   1 
ATOM   5494 C  CA  . TYR C 1 288 ? 36.298 87.252  57.650 1.00 21.46  ? 291  TYR B CA  1 
ATOM   5495 C  C   . TYR C 1 288 ? 37.301 86.082  57.698 1.00 22.30  ? 291  TYR B C   1 
ATOM   5496 O  O   . TYR C 1 288 ? 37.420 85.283  56.738 1.00 15.56  ? 291  TYR B O   1 
ATOM   5497 C  CB  . TYR C 1 288 ? 37.041 88.607  57.470 1.00 16.11  ? 291  TYR B CB  1 
ATOM   5498 C  CG  . TYR C 1 288 ? 37.813 88.731  56.162 1.00 16.40  ? 291  TYR B CG  1 
ATOM   5499 C  CD1 . TYR C 1 288 ? 37.197 89.218  55.019 1.00 18.65  ? 291  TYR B CD1 1 
ATOM   5500 C  CD2 . TYR C 1 288 ? 39.142 88.312  56.064 1.00 20.14  ? 291  TYR B CD2 1 
ATOM   5501 C  CE1 . TYR C 1 288 ? 37.868 89.287  53.832 1.00 18.49  ? 291  TYR B CE1 1 
ATOM   5502 C  CE2 . TYR C 1 288 ? 39.825 88.359  54.882 1.00 22.64  ? 291  TYR B CE2 1 
ATOM   5503 C  CZ  . TYR C 1 288 ? 39.187 88.853  53.763 1.00 29.61  ? 291  TYR B CZ  1 
ATOM   5504 O  OH  . TYR C 1 288 ? 39.848 88.904  52.557 1.00 26.31  ? 291  TYR B OH  1 
HETATM 5505 N  N   . MSE C 1 289 ? 37.974 86.003  58.846 1.00 23.84  ? 292  MSE B N   1 
HETATM 5506 C  CA  . MSE C 1 289 ? 38.960 84.974  59.114 1.00 29.75  ? 292  MSE B CA  1 
HETATM 5507 C  C   . MSE C 1 289 ? 38.309 83.598  59.126 1.00 26.59  ? 292  MSE B C   1 
HETATM 5508 O  O   . MSE C 1 289 ? 38.704 82.727  58.336 1.00 29.79  ? 292  MSE B O   1 
HETATM 5509 C  CB  . MSE C 1 289 ? 39.724 85.292  60.411 1.00 25.93  ? 292  MSE B CB  1 
HETATM 5510 C  CG  . MSE C 1 289 ? 40.616 86.558  60.317 1.00 29.52  ? 292  MSE B CG  1 
HETATM 5511 SE SE  . MSE C 1 289 ? 41.819 86.559  58.801 1.00 44.98  ? 292  MSE B SE  1 
HETATM 5512 C  CE  . MSE C 1 289 ? 42.053 88.428  58.552 1.00 41.22  ? 292  MSE B CE  1 
ATOM   5513 N  N   . ARG C 1 290 ? 37.219 83.488  59.892 1.00 26.14  ? 293  ARG B N   1 
ATOM   5514 C  CA  . ARG C 1 290 ? 36.429 82.256  60.050 1.00 29.97  ? 293  ARG B CA  1 
ATOM   5515 C  C   . ARG C 1 290 ? 36.015 81.643  58.680 1.00 30.10  ? 293  ARG B C   1 
ATOM   5516 O  O   . ARG C 1 290 ? 36.044 80.420  58.519 1.00 29.53  ? 293  ARG B O   1 
ATOM   5517 C  CB  . ARG C 1 290 ? 35.216 82.547  60.964 1.00 38.27  ? 293  ARG B CB  1 
ATOM   5518 C  CG  . ARG C 1 290 ? 34.482 81.339  61.571 1.00 52.46  ? 293  ARG B CG  1 
ATOM   5519 C  CD  . ARG C 1 290 ? 33.204 81.752  62.401 1.00 59.18  ? 293  ARG B CD  1 
ATOM   5520 N  NE  . ARG C 1 290 ? 31.943 81.772  61.616 1.00 68.12  ? 293  ARG B NE  1 
ATOM   5521 C  CZ  . ARG C 1 290 ? 31.030 80.787  61.590 1.00 65.99  ? 293  ARG B CZ  1 
ATOM   5522 N  NH1 . ARG C 1 290 ? 31.217 79.688  62.309 1.00 68.54  ? 293  ARG B NH1 1 
ATOM   5523 N  NH2 . ARG C 1 290 ? 29.939 80.872  60.828 1.00 42.82  ? 293  ARG B NH2 1 
ATOM   5524 N  N   . ARG C 1 291 ? 35.707 82.473  57.675 1.00 26.82  ? 294  ARG B N   1 
ATOM   5525 C  CA  . ARG C 1 291 ? 35.299 81.966  56.349 1.00 21.46  ? 294  ARG B CA  1 
ATOM   5526 C  C   . ARG C 1 291 ? 36.458 81.292  55.624 1.00 28.15  ? 294  ARG B C   1 
ATOM   5527 O  O   . ARG C 1 291 ? 36.253 80.361  54.825 1.00 25.18  ? 294  ARG B O   1 
ATOM   5528 C  CB  . ARG C 1 291 ? 34.844 83.108  55.425 1.00 19.55  ? 294  ARG B CB  1 
ATOM   5529 C  CG  . ARG C 1 291 ? 33.484 83.693  55.736 1.00 22.27  ? 294  ARG B CG  1 
ATOM   5530 C  CD  . ARG C 1 291 ? 33.039 84.844  54.797 1.00 20.76  ? 294  ARG B CD  1 
ATOM   5531 N  NE  . ARG C 1 291 ? 31.884 85.488  55.407 1.00 16.95  ? 294  ARG B NE  1 
ATOM   5532 C  CZ  . ARG C 1 291 ? 31.904 86.648  56.043 1.00 23.00  ? 294  ARG B CZ  1 
ATOM   5533 N  NH1 . ARG C 1 291 ? 33.042 87.336  56.113 1.00 20.72  ? 294  ARG B NH1 1 
ATOM   5534 N  NH2 . ARG C 1 291 ? 30.819 87.050  56.723 1.00 17.54  ? 294  ARG B NH2 1 
ATOM   5535 N  N   . ARG C 1 292 ? 37.665 81.816  55.870 1.00 27.78  ? 295  ARG B N   1 
ATOM   5536 C  CA  . ARG C 1 292 ? 38.875 81.356  55.201 1.00 33.95  ? 295  ARG B CA  1 
ATOM   5537 C  C   . ARG C 1 292 ? 39.609 80.163  55.798 1.00 36.31  ? 295  ARG B C   1 
ATOM   5538 O  O   . ARG C 1 292 ? 40.025 79.224  55.066 1.00 34.38  ? 295  ARG B O   1 
ATOM   5539 C  CB  . ARG C 1 292 ? 39.818 82.549  54.992 1.00 28.35  ? 295  ARG B CB  1 
ATOM   5540 C  CG  . ARG C 1 292 ? 39.350 83.411  53.813 1.00 28.79  ? 295  ARG B CG  1 
ATOM   5541 C  CD  . ARG C 1 292 ? 39.800 84.857  53.849 1.00 25.72  ? 295  ARG B CD  1 
ATOM   5542 N  NE  . ARG C 1 292 ? 39.252 85.528  52.665 1.00 24.54  ? 295  ARG B NE  1 
ATOM   5543 C  CZ  . ARG C 1 292 ? 38.016 86.034  52.601 1.00 27.11  ? 295  ARG B CZ  1 
ATOM   5544 N  NH1 . ARG C 1 292 ? 37.208 85.959  53.653 1.00 19.96  ? 295  ARG B NH1 1 
ATOM   5545 N  NH2 . ARG C 1 292 ? 37.577 86.623  51.488 1.00 27.21  ? 295  ARG B NH2 1 
ATOM   5546 N  N   . LYS C 1 293 ? 39.689 80.205  57.128 1.00 35.60  ? 296  LYS B N   1 
ATOM   5547 C  CA  . LYS C 1 293 ? 40.357 79.222  57.961 1.00 34.91  ? 296  LYS B CA  1 
ATOM   5548 C  C   . LYS C 1 293 ? 39.436 78.982  59.156 1.00 36.09  ? 296  LYS B C   1 
ATOM   5549 O  O   . LYS C 1 293 ? 39.528 79.647  60.216 1.00 28.99  ? 296  LYS B O   1 
ATOM   5550 C  CB  . LYS C 1 293 ? 41.728 79.767  58.416 1.00 44.17  ? 296  LYS B CB  1 
ATOM   5551 C  CG  . LYS C 1 293 ? 42.880 79.626  57.369 1.00 46.03  ? 296  LYS B CG  1 
ATOM   5552 C  CD  . LYS C 1 293 ? 43.730 80.883  57.270 1.00 45.38  ? 296  LYS B CD  1 
ATOM   5553 C  CE  . LYS C 1 293 ? 44.983 80.634  56.457 1.00 51.32  ? 296  LYS B CE  1 
ATOM   5554 N  NZ  . LYS C 1 293 ? 44.691 79.932  55.171 1.00 52.78  ? 296  LYS B NZ  1 
ATOM   5555 N  N   . PRO C 1 294 ? 38.475 78.066  58.980 1.00 38.87  ? 297  PRO B N   1 
ATOM   5556 C  CA  . PRO C 1 294 ? 37.529 77.745  60.054 1.00 44.49  ? 297  PRO B CA  1 
ATOM   5557 C  C   . PRO C 1 294 ? 38.207 76.999  61.243 1.00 49.39  ? 297  PRO B C   1 
ATOM   5558 O  O   . PRO C 1 294 ? 39.368 76.541  61.078 1.00 44.74  ? 297  PRO B O   1 
ATOM   5559 C  CB  . PRO C 1 294 ? 36.433 76.943  59.316 1.00 40.03  ? 297  PRO B CB  1 
ATOM   5560 C  CG  . PRO C 1 294 ? 37.131 76.314  58.172 1.00 30.83  ? 297  PRO B CG  1 
ATOM   5561 C  CD  . PRO C 1 294 ? 38.127 77.369  57.728 1.00 38.03  ? 297  PRO B CD  1 
ATOM   5562 O  OXT . PRO C 1 294 ? 37.601 76.932  62.344 1.00 52.57  ? 297  PRO B OXT 1 
ATOM   5563 N  N   . ALA D 2 1   ? 36.422 46.355  34.176 1.00 59.73  ? 488  ALA D N   1 
ATOM   5564 C  CA  . ALA D 2 1   ? 36.895 47.739  33.859 1.00 57.30  ? 488  ALA D CA  1 
ATOM   5565 C  C   . ALA D 2 1   ? 37.909 48.244  34.916 1.00 57.67  ? 488  ALA D C   1 
ATOM   5566 O  O   . ALA D 2 1   ? 38.196 47.547  35.907 1.00 55.49  ? 488  ALA D O   1 
ATOM   5567 C  CB  . ALA D 2 1   ? 35.673 48.713  33.755 1.00 52.35  ? 488  ALA D CB  1 
ATOM   5568 N  N   . GLU D 2 2   ? 38.455 49.445  34.675 1.00 55.85  ? 489  GLU D N   1 
ATOM   5569 C  CA  . GLU D 2 2   ? 39.447 50.091  35.546 1.00 53.53  ? 489  GLU D CA  1 
ATOM   5570 C  C   . GLU D 2 2   ? 39.193 51.576  35.779 1.00 51.22  ? 489  GLU D C   1 
ATOM   5571 O  O   . GLU D 2 2   ? 38.743 52.290  34.882 1.00 53.17  ? 489  GLU D O   1 
ATOM   5572 C  CB  . GLU D 2 2   ? 40.836 50.053  34.927 1.00 54.33  ? 489  GLU D CB  1 
ATOM   5573 C  CG  . GLU D 2 2   ? 41.563 48.770  35.087 1.00 65.57  ? 489  GLU D CG  1 
ATOM   5574 C  CD  . GLU D 2 2   ? 42.671 48.663  34.071 1.00 70.47  ? 489  GLU D CD  1 
ATOM   5575 O  OE1 . GLU D 2 2   ? 43.848 48.857  34.477 1.00 74.59  ? 489  GLU D OE1 1 
ATOM   5576 O  OE2 . GLU D 2 2   ? 42.352 48.407  32.872 1.00 59.36  ? 489  GLU D OE2 1 
ATOM   5577 N  N   . ALA D 2 3   ? 39.584 52.049  36.959 1.00 48.74  ? 490  ALA D N   1 
ATOM   5578 C  CA  . ALA D 2 3   ? 39.480 53.457  37.314 1.00 45.27  ? 490  ALA D CA  1 
ATOM   5579 C  C   . ALA D 2 3   ? 40.503 53.838  38.402 1.00 45.62  ? 490  ALA D C   1 
ATOM   5580 O  O   . ALA D 2 3   ? 40.903 53.027  39.224 1.00 46.89  ? 490  ALA D O   1 
ATOM   5581 C  CB  . ALA D 2 3   ? 38.060 53.842  37.744 1.00 40.89  ? 490  ALA D CB  1 
ATOM   5582 N  N   . SER D 2 4   ? 40.988 55.063  38.353 1.00 46.22  ? 491  SER D N   1 
ATOM   5583 C  CA  . SER D 2 4   ? 41.920 55.526  39.356 1.00 47.10  ? 491  SER D CA  1 
ATOM   5584 C  C   . SER D 2 4   ? 41.466 56.908  39.811 1.00 49.52  ? 491  SER D C   1 
ATOM   5585 O  O   . SER D 2 4   ? 40.635 57.554  39.160 1.00 50.17  ? 491  SER D O   1 
ATOM   5586 C  CB  . SER D 2 4   ? 43.322 55.626  38.789 1.00 49.23  ? 491  SER D CB  1 
ATOM   5587 O  OG  . SER D 2 4   ? 43.663 54.403  38.163 1.00 70.79  ? 491  SER D OG  1 
ATOM   5588 N  N   . ALA D 2 5   ? 42.013 57.375  40.923 1.00 49.18  ? 492  ALA D N   1 
ATOM   5589 C  CA  . ALA D 2 5   ? 41.627 58.668  41.424 1.00 44.22  ? 492  ALA D CA  1 
ATOM   5590 C  C   . ALA D 2 5   ? 42.575 59.142  42.503 1.00 48.59  ? 492  ALA D C   1 
ATOM   5591 O  O   . ALA D 2 5   ? 42.709 58.496  43.547 1.00 47.41  ? 492  ALA D O   1 
ATOM   5592 C  CB  . ALA D 2 5   ? 40.178 58.619  41.968 1.00 39.40  ? 492  ALA D CB  1 
ATOM   5593 N  N   . ASP D 2 6   ? 43.250 60.263  42.247 1.00 52.81  ? 493  ASP D N   1 
ATOM   5594 C  CA  . ASP D 2 6   ? 44.165 60.855  43.237 1.00 55.79  ? 493  ASP D CA  1 
ATOM   5595 C  C   . ASP D 2 6   ? 43.315 61.492  44.339 1.00 54.34  ? 493  ASP D C   1 
ATOM   5596 O  O   . ASP D 2 6   ? 42.237 62.034  44.086 1.00 53.78  ? 493  ASP D O   1 
ATOM   5597 C  CB  . ASP D 2 6   ? 45.011 61.996  42.646 1.00 59.93  ? 493  ASP D CB  1 
ATOM   5598 C  CG  . ASP D 2 6   ? 46.095 61.509  41.731 1.00 67.03  ? 493  ASP D CG  1 
ATOM   5599 O  OD1 . ASP D 2 6   ? 46.648 60.419  41.997 1.00 67.39  ? 493  ASP D OD1 1 
ATOM   5600 O  OD2 . ASP D 2 6   ? 46.398 62.222  40.749 1.00 70.94  ? 493  ASP D OD2 1 
ATOM   5601 N  N   . LEU D 2 7   ? 43.865 61.540  45.539 1.00 55.39  ? 494  LEU D N   1 
ATOM   5602 C  CA  . LEU D 2 7   ? 43.152 62.108  46.657 1.00 54.17  ? 494  LEU D CA  1 
ATOM   5603 C  C   . LEU D 2 7   ? 43.969 63.229  47.344 1.00 59.78  ? 494  LEU D C   1 
ATOM   5604 O  O   . LEU D 2 7   ? 45.022 62.994  47.967 1.00 59.46  ? 494  LEU D O   1 
ATOM   5605 C  CB  . LEU D 2 7   ? 42.722 61.022  47.676 1.00 43.24  ? 494  LEU D CB  1 
ATOM   5606 C  CG  . LEU D 2 7   ? 41.889 59.776  47.327 1.00 30.93  ? 494  LEU D CG  1 
ATOM   5607 C  CD1 . LEU D 2 7   ? 41.535 59.167  48.648 1.00 32.44  ? 494  LEU D CD1 1 
ATOM   5608 C  CD2 . LEU D 2 7   ? 40.601 60.059  46.539 1.00 30.83  ? 494  LEU D CD2 1 
ATOM   5609 N  N   . ARG D 2 8   ? 43.465 64.455  47.215 1.00 62.83  ? 495  ARG D N   1 
ATOM   5610 C  CA  . ARG D 2 8   ? 44.105 65.608  47.816 1.00 66.63  ? 495  ARG D CA  1 
ATOM   5611 C  C   . ARG D 2 8   ? 43.114 66.779  48.054 1.00 71.76  ? 495  ARG D C   1 
ATOM   5612 O  O   . ARG D 2 8   ? 42.194 67.015  47.252 1.00 66.64  ? 495  ARG D O   1 
ATOM   5613 C  CB  . ARG D 2 8   ? 45.277 66.053  46.924 1.00 64.98  ? 495  ARG D CB  1 
ATOM   5614 N  N   . ALA D 2 9   ? 43.310 67.486  49.175 1.00 77.84  ? 496  ALA D N   1 
ATOM   5615 C  CA  . ALA D 2 9   ? 42.498 68.648  49.583 1.00 79.16  ? 496  ALA D CA  1 
ATOM   5616 C  C   . ALA D 2 9   ? 42.835 69.854  48.708 1.00 80.50  ? 496  ALA D C   1 
ATOM   5617 O  O   . ALA D 2 9   ? 43.972 70.332  48.757 1.00 84.32  ? 496  ALA D O   1 
ATOM   5618 C  CB  . ALA D 2 9   ? 42.830 69.008  51.022 1.00 77.00  ? 496  ALA D CB  1 
ATOM   5619 N  N   . ASP D 2 10  ? 41.874 70.378  47.945 1.00 79.87  ? 497  ASP D N   1 
ATOM   5620 C  CA  . ASP D 2 10  ? 42.160 71.546  47.091 1.00 77.89  ? 497  ASP D CA  1 
ATOM   5621 C  C   . ASP D 2 10  ? 41.610 72.906  47.586 1.00 75.26  ? 497  ASP D C   1 
ATOM   5622 O  O   . ASP D 2 10  ? 40.791 73.545  46.913 1.00 78.31  ? 497  ASP D O   1 
ATOM   5623 C  CB  . ASP D 2 10  ? 41.781 71.279  45.606 1.00 72.59  ? 497  ASP D CB  1 
ATOM   5624 N  N   . ALA D 2 11  ? 42.104 73.344  48.749 1.00 74.30  ? 498  ALA D N   1 
ATOM   5625 C  CA  . ALA D 2 11  ? 41.724 74.613  49.390 1.00 74.21  ? 498  ALA D CA  1 
ATOM   5626 C  C   . ALA D 2 11  ? 41.432 75.747  48.387 1.00 73.76  ? 498  ALA D C   1 
ATOM   5627 O  O   . ALA D 2 11  ? 42.351 76.320  47.791 1.00 75.35  ? 498  ALA D O   1 
ATOM   5628 C  CB  . ALA D 2 11  ? 42.817 75.038  50.392 1.00 74.16  ? 498  ALA D CB  1 
ATOM   5629 N  N   . MET D 2 12  ? 40.148 76.066  48.220 1.00 68.96  ? 499  MET D N   1 
ATOM   5630 C  CA  . MET D 2 12  ? 39.712 77.090  47.271 1.00 64.48  ? 499  MET D CA  1 
ATOM   5631 C  C   . MET D 2 12  ? 39.677 78.559  47.759 1.00 60.90  ? 499  MET D C   1 
ATOM   5632 O  O   . MET D 2 12  ? 39.908 79.473  46.971 1.00 52.39  ? 499  MET D O   1 
ATOM   5633 C  CB  . MET D 2 12  ? 38.361 76.699  46.695 1.00 65.29  ? 499  MET D CB  1 
ATOM   5634 N  N   . ALA D 2 13  ? 39.347 78.785  49.033 1.00 58.46  ? 500  ALA D N   1 
ATOM   5635 C  CA  . ALA D 2 13  ? 39.305 80.138  49.625 1.00 57.93  ? 500  ALA D CA  1 
ATOM   5636 C  C   . ALA D 2 13  ? 40.711 80.800  49.684 1.00 59.11  ? 500  ALA D C   1 
ATOM   5637 O  O   . ALA D 2 13  ? 41.731 80.113  49.549 1.00 64.47  ? 500  ALA D O   1 
ATOM   5638 C  CB  . ALA D 2 13  ? 38.715 80.054  51.035 1.00 52.49  ? 500  ALA D CB  1 
ATOM   5639 N  N   . LYS D 2 14  ? 40.772 82.115  49.908 1.00 54.38  ? 501  LYS D N   1 
ATOM   5640 C  CA  . LYS D 2 14  ? 42.062 82.828  49.980 1.00 49.93  ? 501  LYS D CA  1 
ATOM   5641 C  C   . LYS D 2 14  ? 41.961 84.241  50.569 1.00 44.13  ? 501  LYS D C   1 
ATOM   5642 O  O   . LYS D 2 14  ? 40.984 84.973  50.295 1.00 42.29  ? 501  LYS D O   1 
ATOM   5643 C  CB  . LYS D 2 14  ? 42.673 82.939  48.567 1.00 55.42  ? 501  LYS D CB  1 
ATOM   5644 C  CG  . LYS D 2 14  ? 44.059 83.567  48.539 1.00 65.69  ? 501  LYS D CG  1 
ATOM   5645 C  CD  . LYS D 2 14  ? 44.523 83.948  47.147 1.00 67.78  ? 501  LYS D CD  1 
ATOM   5646 C  CE  . LYS D 2 14  ? 45.833 84.715  47.266 1.00 66.86  ? 501  LYS D CE  1 
ATOM   5647 N  NZ  . LYS D 2 14  ? 46.290 85.201  45.950 1.00 70.39  ? 501  LYS D NZ  1 
ATOM   5648 N  N   . ASP D 2 15  ? 42.986 84.642  51.330 1.00 31.38  ? 502  ASP D N   1 
ATOM   5649 C  CA  . ASP D 2 15  ? 43.016 85.994  51.907 1.00 35.98  ? 502  ASP D CA  1 
ATOM   5650 C  C   . ASP D 2 15  ? 42.911 87.046  50.781 1.00 32.88  ? 502  ASP D C   1 
ATOM   5651 O  O   . ASP D 2 15  ? 43.438 86.870  49.678 1.00 29.58  ? 502  ASP D O   1 
ATOM   5652 C  CB  . ASP D 2 15  ? 44.305 86.239  52.701 1.00 38.42  ? 502  ASP D CB  1 
ATOM   5653 C  CG  . ASP D 2 15  ? 44.375 87.664  53.305 1.00 43.39  ? 502  ASP D CG  1 
ATOM   5654 O  OD1 . ASP D 2 15  ? 45.364 88.402  53.037 1.00 36.99  ? 502  ASP D OD1 1 
ATOM   5655 O  OD2 . ASP D 2 15  ? 43.448 88.029  54.069 1.00 40.44  ? 502  ASP D OD2 1 
ATOM   5656 N  N   . ARG D 2 16  ? 42.202 88.130  51.043 1.00 25.23  ? 503  ARG D N   1 
ATOM   5657 C  CA  . ARG D 2 16  ? 42.082 89.190  50.044 1.00 22.18  ? 503  ARG D CA  1 
ATOM   5658 C  C   . ARG D 2 16  ? 41.485 88.790  48.710 1.00 22.45  ? 503  ARG D C   1 
ATOM   5659 O  O   . ARG D 2 16  ? 41.526 89.573  47.772 1.00 30.31  ? 503  ARG D O   1 
ATOM   5660 C  CB  . ARG D 2 16  ? 43.430 89.940  49.894 1.00 25.24  ? 503  ARG D CB  1 
ATOM   5661 C  CG  . ARG D 2 16  ? 43.806 90.647  51.197 1.00 25.43  ? 503  ARG D CG  1 
ATOM   5662 C  CD  . ARG D 2 16  ? 45.138 91.296  51.132 1.00 28.39  ? 503  ARG D CD  1 
ATOM   5663 N  NE  . ARG D 2 16  ? 45.145 92.365  50.140 1.00 34.54  ? 503  ARG D NE  1 
ATOM   5664 C  CZ  . ARG D 2 16  ? 46.083 93.298  50.077 1.00 32.17  ? 503  ARG D CZ  1 
ATOM   5665 N  NH1 . ARG D 2 16  ? 47.073 93.281  50.949 1.00 31.27  ? 503  ARG D NH1 1 
ATOM   5666 N  NH2 . ARG D 2 16  ? 46.033 94.243  49.156 1.00 22.10  ? 503  ARG D NH2 1 
ATOM   5667 N  N   . SER D 2 17  ? 40.860 87.604  48.634 1.00 28.23  ? 504  SER D N   1 
ATOM   5668 C  CA  . SER D 2 17  ? 40.218 87.132  47.394 1.00 25.33  ? 504  SER D CA  1 
ATOM   5669 C  C   . SER D 2 17  ? 39.164 88.126  46.795 1.00 21.29  ? 504  SER D C   1 
ATOM   5670 O  O   . SER D 2 17  ? 38.912 88.167  45.557 1.00 22.74  ? 504  SER D O   1 
ATOM   5671 C  CB  . SER D 2 17  ? 39.524 85.775  47.626 1.00 26.16  ? 504  SER D CB  1 
ATOM   5672 O  OG  . SER D 2 17  ? 38.468 85.897  48.578 1.00 24.46  ? 504  SER D OG  1 
ATOM   5673 N  N   . GLU D 2 18  ? 38.559 88.925  47.676 1.00 23.14  ? 505  GLU D N   1 
ATOM   5674 C  CA  . GLU D 2 18  ? 37.550 89.911  47.269 1.00 25.89  ? 505  GLU D CA  1 
ATOM   5675 C  C   . GLU D 2 18  ? 38.080 90.863  46.209 1.00 29.78  ? 505  GLU D C   1 
ATOM   5676 O  O   . GLU D 2 18  ? 37.308 91.458  45.456 1.00 29.11  ? 505  GLU D O   1 
ATOM   5677 C  CB  . GLU D 2 18  ? 37.044 90.735  48.459 1.00 29.55  ? 505  GLU D CB  1 
ATOM   5678 C  CG  . GLU D 2 18  ? 38.104 91.596  49.190 1.00 33.72  ? 505  GLU D CG  1 
ATOM   5679 C  CD  . GLU D 2 18  ? 38.915 90.817  50.244 1.00 28.64  ? 505  GLU D CD  1 
ATOM   5680 O  OE1 . GLU D 2 18  ? 38.729 89.582  50.376 1.00 24.25  ? 505  GLU D OE1 1 
ATOM   5681 O  OE2 . GLU D 2 18  ? 39.728 91.458  50.952 1.00 23.62  ? 505  GLU D OE2 1 
ATOM   5682 N  N   . GLU D 2 19  ? 39.401 91.006  46.143 1.00 26.12  ? 506  GLU D N   1 
ATOM   5683 C  CA  . GLU D 2 19  ? 39.978 91.896  45.157 1.00 27.65  ? 506  GLU D CA  1 
ATOM   5684 C  C   . GLU D 2 19  ? 39.870 91.381  43.722 1.00 27.60  ? 506  GLU D C   1 
ATOM   5685 O  O   . GLU D 2 19  ? 40.009 92.168  42.779 1.00 35.31  ? 506  GLU D O   1 
ATOM   5686 C  CB  . GLU D 2 19  ? 41.430 92.240  45.525 1.00 19.13  ? 506  GLU D CB  1 
ATOM   5687 C  CG  . GLU D 2 19  ? 41.556 93.010  46.843 1.00 22.73  ? 506  GLU D CG  1 
ATOM   5688 C  CD  . GLU D 2 19  ? 42.989 93.358  47.206 1.00 15.94  ? 506  GLU D CD  1 
ATOM   5689 O  OE1 . GLU D 2 19  ? 43.866 93.325  46.343 1.00 23.49  ? 506  GLU D OE1 1 
ATOM   5690 O  OE2 . GLU D 2 19  ? 43.243 93.623  48.375 1.00 20.00  ? 506  GLU D OE2 1 
ATOM   5691 N  N   . GLU D 2 20  ? 39.592 90.083  43.562 1.00 30.41  ? 507  GLU D N   1 
ATOM   5692 C  CA  . GLU D 2 20  ? 39.499 89.455  42.234 1.00 32.52  ? 507  GLU D CA  1 
ATOM   5693 C  C   . GLU D 2 20  ? 38.055 89.149  41.831 1.00 29.50  ? 507  GLU D C   1 
ATOM   5694 O  O   . GLU D 2 20  ? 37.798 88.609  40.737 1.00 30.03  ? 507  GLU D O   1 
ATOM   5695 C  CB  . GLU D 2 20  ? 40.319 88.145  42.181 1.00 40.58  ? 507  GLU D CB  1 
ATOM   5696 C  CG  . GLU D 2 20  ? 41.805 88.242  42.624 1.00 48.28  ? 507  GLU D CG  1 
ATOM   5697 C  CD  . GLU D 2 20  ? 42.533 89.527  42.166 1.00 57.74  ? 507  GLU D CD  1 
ATOM   5698 O  OE1 . GLU D 2 20  ? 43.251 90.117  43.008 1.00 60.27  ? 507  GLU D OE1 1 
ATOM   5699 O  OE2 . GLU D 2 20  ? 42.412 89.945  40.985 1.00 61.13  ? 507  GLU D OE2 1 
ATOM   5700 N  N   . ARG D 2 21  ? 37.115 89.478  42.710 1.00 26.65  ? 508  ARG D N   1 
ATOM   5701 C  CA  . ARG D 2 21  ? 35.702 89.220  42.436 1.00 22.71  ? 508  ARG D CA  1 
ATOM   5702 C  C   . ARG D 2 21  ? 35.207 90.094  41.295 1.00 25.21  ? 508  ARG D C   1 
ATOM   5703 O  O   . ARG D 2 21  ? 35.794 91.129  40.963 1.00 22.03  ? 508  ARG D O   1 
ATOM   5704 C  CB  . ARG D 2 21  ? 34.822 89.543  43.633 1.00 23.79  ? 508  ARG D CB  1 
ATOM   5705 C  CG  . ARG D 2 21  ? 34.838 88.544  44.715 1.00 26.69  ? 508  ARG D CG  1 
ATOM   5706 C  CD  . ARG D 2 21  ? 34.059 89.042  45.907 1.00 28.28  ? 508  ARG D CD  1 
ATOM   5707 N  NE  . ARG D 2 21  ? 32.615 89.100  45.680 1.00 32.98  ? 508  ARG D NE  1 
ATOM   5708 C  CZ  . ARG D 2 21  ? 31.749 89.398  46.645 1.00 32.95  ? 508  ARG D CZ  1 
ATOM   5709 N  NH1 . ARG D 2 21  ? 32.201 89.650  47.872 1.00 31.13  ? 508  ARG D NH1 1 
ATOM   5710 N  NH2 . ARG D 2 21  ? 30.451 89.489  46.383 1.00 35.57  ? 508  ARG D NH2 1 
ATOM   5711 N  N   . THR D 2 22  ? 34.161 89.607  40.644 1.00 28.98  ? 509  THR D N   1 
ATOM   5712 C  CA  . THR D 2 22  ? 33.503 90.339  39.580 1.00 29.61  ? 509  THR D CA  1 
ATOM   5713 C  C   . THR D 2 22  ? 32.052 90.524  40.056 1.00 23.26  ? 509  THR D C   1 
ATOM   5714 O  O   . THR D 2 22  ? 31.612 89.933  41.048 1.00 22.95  ? 509  THR D O   1 
ATOM   5715 C  CB  . THR D 2 22  ? 33.482 89.567  38.233 1.00 32.27  ? 509  THR D CB  1 
ATOM   5716 O  OG1 . THR D 2 22  ? 32.786 88.325  38.399 1.00 37.40  ? 509  THR D OG1 1 
ATOM   5717 C  CG2 . THR D 2 22  ? 34.907 89.336  37.716 1.00 32.50  ? 509  THR D CG2 1 
ATOM   5718 N  N   . THR D 2 23  ? 31.317 91.341  39.330 1.00 23.15  ? 510  THR D N   1 
ATOM   5719 C  CA  . THR D 2 23  ? 29.949 91.610  39.666 1.00 20.80  ? 510  THR D CA  1 
ATOM   5720 C  C   . THR D 2 23  ? 29.031 90.567  39.049 1.00 18.80  ? 510  THR D C   1 
ATOM   5721 O  O   . THR D 2 23  ? 29.404 89.829  38.123 1.00 21.49  ? 510  THR D O   1 
ATOM   5722 C  CB  . THR D 2 23  ? 29.543 92.992  39.116 1.00 22.93  ? 510  THR D CB  1 
ATOM   5723 O  OG1 . THR D 2 23  ? 29.775 92.998  37.710 1.00 22.93  ? 510  THR D OG1 1 
ATOM   5724 C  CG2 . THR D 2 23  ? 30.369 94.116  39.767 1.00 19.19  ? 510  THR D CG2 1 
ATOM   5725 N  N   . GLU D 2 24  ? 27.823 90.499  39.578 1.00 18.91  ? 511  GLU D N   1 
ATOM   5726 C  CA  . GLU D 2 24  ? 26.802 89.606  39.050 1.00 24.46  ? 511  GLU D CA  1 
ATOM   5727 C  C   . GLU D 2 24  ? 26.498 89.956  37.574 1.00 26.85  ? 511  GLU D C   1 
ATOM   5728 O  O   . GLU D 2 24  ? 26.370 89.057  36.741 1.00 27.01  ? 511  GLU D O   1 
ATOM   5729 C  CB  . GLU D 2 24  ? 25.518 89.771  39.866 1.00 15.02  ? 511  GLU D CB  1 
ATOM   5730 C  CG  . GLU D 2 24  ? 24.414 88.844  39.405 1.00 21.35  ? 511  GLU D CG  1 
ATOM   5731 C  CD  . GLU D 2 24  ? 24.797 87.354  39.575 1.00 28.23  ? 511  GLU D CD  1 
ATOM   5732 O  OE1 . GLU D 2 24  ? 25.833 87.028  40.235 1.00 29.36  ? 511  GLU D OE1 1 
ATOM   5733 O  OE2 . GLU D 2 24  ? 24.039 86.509  39.061 1.00 37.48  ? 511  GLU D OE2 1 
ATOM   5734 N  N   . ALA D 2 25  ? 26.391 91.253  37.256 1.00 25.09  ? 512  ALA D N   1 
ATOM   5735 C  CA  . ALA D 2 25  ? 26.083 91.692  35.891 1.00 28.21  ? 512  ALA D CA  1 
ATOM   5736 C  C   . ALA D 2 25  ? 27.144 91.232  34.907 1.00 31.64  ? 512  ALA D C   1 
ATOM   5737 O  O   . ALA D 2 25  ? 26.835 90.912  33.758 1.00 40.69  ? 512  ALA D O   1 
ATOM   5738 C  CB  . ALA D 2 25  ? 25.919 93.193  35.836 1.00 29.29  ? 512  ALA D CB  1 
ATOM   5739 N  N   . GLU D 2 26  ? 28.384 91.152  35.382 1.00 32.98  ? 513  GLU D N   1 
ATOM   5740 C  CA  . GLU D 2 26  ? 29.508 90.698  34.568 1.00 36.46  ? 513  GLU D CA  1 
ATOM   5741 C  C   . GLU D 2 26  ? 29.480 89.158  34.438 1.00 31.14  ? 513  GLU D C   1 
ATOM   5742 O  O   . GLU D 2 26  ? 29.829 88.624  33.400 1.00 31.83  ? 513  GLU D O   1 
ATOM   5743 C  CB  . GLU D 2 26  ? 30.817 91.189  35.185 1.00 46.83  ? 513  GLU D CB  1 
ATOM   5744 C  CG  . GLU D 2 26  ? 32.080 90.920  34.369 1.00 65.35  ? 513  GLU D CG  1 
ATOM   5745 C  CD  . GLU D 2 26  ? 33.337 91.514  35.011 1.00 77.41  ? 513  GLU D CD  1 
ATOM   5746 O  OE1 . GLU D 2 26  ? 33.208 92.251  36.025 1.00 84.14  ? 513  GLU D OE1 1 
ATOM   5747 O  OE2 . GLU D 2 26  ? 34.456 91.242  34.503 1.00 80.19  ? 513  GLU D OE2 1 
ATOM   5748 N  N   . LYS D 2 27  ? 28.988 88.441  35.448 1.00 28.76  ? 514  LYS D N   1 
ATOM   5749 C  CA  . LYS D 2 27  ? 28.957 86.987  35.341 1.00 31.53  ? 514  LYS D CA  1 
ATOM   5750 C  C   . LYS D 2 27  ? 27.589 86.432  34.947 1.00 31.63  ? 514  LYS D C   1 
ATOM   5751 O  O   . LYS D 2 27  ? 27.451 85.226  34.674 1.00 27.92  ? 514  LYS D O   1 
ATOM   5752 C  CB  . LYS D 2 27  ? 29.456 86.304  36.637 1.00 29.41  ? 514  LYS D CB  1 
ATOM   5753 C  CG  . LYS D 2 27  ? 28.719 86.656  37.893 1.00 39.54  ? 514  LYS D CG  1 
ATOM   5754 C  CD  . LYS D 2 27  ? 29.174 85.764  39.040 1.00 38.41  ? 514  LYS D CD  1 
ATOM   5755 C  CE  . LYS D 2 27  ? 30.485 86.218  39.637 1.00 34.14  ? 514  LYS D CE  1 
ATOM   5756 N  NZ  . LYS D 2 27  ? 30.218 87.420  40.425 1.00 35.21  ? 514  LYS D NZ  1 
ATOM   5757 N  N   . ASN D 2 28  ? 26.585 87.306  34.872 1.00 28.81  ? 515  ASN D N   1 
ATOM   5758 C  CA  . ASN D 2 28  ? 25.226 86.862  34.544 1.00 29.88  ? 515  ASN D CA  1 
ATOM   5759 C  C   . ASN D 2 28  ? 24.713 87.599  33.313 1.00 30.25  ? 515  ASN D C   1 
ATOM   5760 O  O   . ASN D 2 28  ? 24.218 88.738  33.410 1.00 26.58  ? 515  ASN D O   1 
ATOM   5761 C  CB  . ASN D 2 28  ? 24.289 87.053  35.770 1.00 29.81  ? 515  ASN D CB  1 
ATOM   5762 C  CG  . ASN D 2 28  ? 22.872 86.384  35.602 1.00 32.28  ? 515  ASN D CG  1 
ATOM   5763 O  OD1 . ASN D 2 28  ? 22.333 86.211  34.491 1.00 26.60  ? 515  ASN D OD1 1 
ATOM   5764 N  ND2 . ASN D 2 28  ? 22.269 86.047  36.734 1.00 23.65  ? 515  ASN D ND2 1 
ATOM   5765 N  N   . GLU D 2 29  ? 24.796 86.911  32.170 1.00 28.76  ? 516  GLU D N   1 
ATOM   5766 C  CA  . GLU D 2 29  ? 24.396 87.478  30.887 1.00 21.82  ? 516  GLU D CA  1 
ATOM   5767 C  C   . GLU D 2 29  ? 22.967 87.964  30.841 1.00 21.23  ? 516  GLU D C   1 
ATOM   5768 O  O   . GLU D 2 29  ? 22.717 88.948  30.171 1.00 24.39  ? 516  GLU D O   1 
ATOM   5769 C  CB  . GLU D 2 29  ? 24.670 86.503  29.721 1.00 28.38  ? 516  GLU D CB  1 
ATOM   5770 N  N   . ARG D 2 30  ? 22.030 87.272  31.505 1.00 23.52  ? 517  ARG D N   1 
ATOM   5771 C  CA  . ARG D 2 30  ? 20.610 87.679  31.514 1.00 20.70  ? 517  ARG D CA  1 
ATOM   5772 C  C   . ARG D 2 30  ? 20.446 88.998  32.276 1.00 21.20  ? 517  ARG D C   1 
ATOM   5773 O  O   . ARG D 2 30  ? 19.675 89.874  31.855 1.00 21.33  ? 517  ARG D O   1 
ATOM   5774 C  CB  . ARG D 2 30  ? 19.703 86.595  32.147 1.00 19.26  ? 517  ARG D CB  1 
ATOM   5775 N  N   . VAL D 2 31  ? 21.137 89.133  33.409 1.00 19.79  ? 518  VAL D N   1 
ATOM   5776 C  CA  . VAL D 2 31  ? 21.075 90.380  34.186 1.00 20.71  ? 518  VAL D CA  1 
ATOM   5777 C  C   . VAL D 2 31  ? 21.684 91.539  33.386 1.00 22.42  ? 518  VAL D C   1 
ATOM   5778 O  O   . VAL D 2 31  ? 21.140 92.637  33.350 1.00 16.59  ? 518  VAL D O   1 
ATOM   5779 C  CB  . VAL D 2 31  ? 21.766 90.206  35.530 1.00 21.73  ? 518  VAL D CB  1 
ATOM   5780 C  CG1 . VAL D 2 31  ? 21.849 91.504  36.245 1.00 19.36  ? 518  VAL D CG1 1 
ATOM   5781 C  CG2 . VAL D 2 31  ? 20.970 89.252  36.371 1.00 18.23  ? 518  VAL D CG2 1 
ATOM   5782 N  N   . GLN D 2 32  ? 22.762 91.241  32.665 1.00 27.60  ? 519  GLN D N   1 
ATOM   5783 C  CA  . GLN D 2 32  ? 23.444 92.210  31.810 1.00 30.33  ? 519  GLN D CA  1 
ATOM   5784 C  C   . GLN D 2 32  ? 22.528 92.636  30.655 1.00 26.52  ? 519  GLN D C   1 
ATOM   5785 O  O   . GLN D 2 32  ? 22.404 93.828  30.372 1.00 23.69  ? 519  GLN D O   1 
ATOM   5786 C  CB  . GLN D 2 32  ? 24.753 91.604  31.315 1.00 39.51  ? 519  GLN D CB  1 
ATOM   5787 C  CG  . GLN D 2 32  ? 25.526 92.432  30.327 1.00 52.64  ? 519  GLN D CG  1 
ATOM   5788 C  CD  . GLN D 2 32  ? 26.962 91.951  30.170 1.00 67.12  ? 519  GLN D CD  1 
ATOM   5789 O  OE1 . GLN D 2 32  ? 27.716 92.494  29.351 1.00 79.72  ? 519  GLN D OE1 1 
ATOM   5790 N  NE2 . GLN D 2 32  ? 27.360 90.943  30.967 1.00 65.67  ? 519  GLN D NE2 1 
ATOM   5791 N  N   . LYS D 2 33  ? 21.860 91.684  30.011 1.00 22.34  ? 520  LYS D N   1 
ATOM   5792 C  CA  . LYS D 2 33  ? 20.927 92.017  28.934 1.00 24.93  ? 520  LYS D CA  1 
ATOM   5793 C  C   . LYS D 2 33  ? 19.774 92.874  29.489 1.00 22.30  ? 520  LYS D C   1 
ATOM   5794 O  O   . LYS D 2 33  ? 19.415 93.885  28.889 1.00 24.50  ? 520  LYS D O   1 
ATOM   5795 C  CB  . LYS D 2 33  ? 20.413 90.719  28.253 1.00 32.25  ? 520  LYS D CB  1 
ATOM   5796 C  CG  . LYS D 2 33  ? 19.173 90.865  27.332 1.00 52.92  ? 520  LYS D CG  1 
ATOM   5797 C  CD  . LYS D 2 33  ? 17.828 90.672  28.089 1.00 56.85  ? 520  LYS D CD  1 
ATOM   5798 C  CE  . LYS D 2 33  ? 16.657 91.482  27.483 1.00 55.10  ? 520  LYS D CE  1 
ATOM   5799 N  NZ  . LYS D 2 33  ? 15.399 91.479  28.334 1.00 41.49  ? 520  LYS D NZ  1 
ATOM   5800 N  N   . HIS D 2 34  ? 19.254 92.504  30.663 1.00 20.90  ? 521  HIS D N   1 
ATOM   5801 C  CA  . HIS D 2 34  ? 18.142 93.212  31.303 1.00 16.68  ? 521  HIS D CA  1 
ATOM   5802 C  C   . HIS D 2 34  ? 18.486 94.674  31.594 1.00 20.11  ? 521  HIS D C   1 
ATOM   5803 O  O   . HIS D 2 34  ? 17.704 95.579  31.316 1.00 22.18  ? 521  HIS D O   1 
ATOM   5804 C  CB  . HIS D 2 34  ? 17.779 92.532  32.609 1.00 18.29  ? 521  HIS D CB  1 
ATOM   5805 C  CG  . HIS D 2 34  ? 17.042 91.244  32.444 1.00 23.59  ? 521  HIS D CG  1 
ATOM   5806 N  ND1 . HIS D 2 34  ? 16.568 90.803  31.229 1.00 25.05  ? 521  HIS D ND1 1 
ATOM   5807 C  CD2 . HIS D 2 34  ? 16.629 90.341  33.365 1.00 27.38  ? 521  HIS D CD2 1 
ATOM   5808 C  CE1 . HIS D 2 34  ? 15.885 89.688  31.406 1.00 28.47  ? 521  HIS D CE1 1 
ATOM   5809 N  NE2 . HIS D 2 34  ? 15.907 89.388  32.693 1.00 31.64  ? 521  HIS D NE2 1 
ATOM   5810 N  N   . LEU D 2 35  ? 19.639 94.886  32.218 1.00 17.18  ? 522  LEU D N   1 
ATOM   5811 C  CA  . LEU D 2 35  ? 20.099 96.220  32.524 1.00 19.23  ? 522  LEU D CA  1 
ATOM   5812 C  C   . LEU D 2 35  ? 20.335 97.076  31.271 1.00 20.35  ? 522  LEU D C   1 
ATOM   5813 O  O   . LEU D 2 35  ? 20.040 98.282  31.309 1.00 17.72  ? 522  LEU D O   1 
ATOM   5814 C  CB  . LEU D 2 35  ? 21.341 96.158  33.432 1.00 18.84  ? 522  LEU D CB  1 
ATOM   5815 C  CG  . LEU D 2 35  ? 21.133 95.644  34.876 1.00 18.77  ? 522  LEU D CG  1 
ATOM   5816 C  CD1 . LEU D 2 35  ? 22.482 95.347  35.519 1.00 20.68  ? 522  LEU D CD1 1 
ATOM   5817 C  CD2 . LEU D 2 35  ? 20.346 96.669  35.707 1.00 13.38  ? 522  LEU D CD2 1 
ATOM   5818 N  N   . LYS D 2 36  ? 20.781 96.453  30.162 1.00 21.53  ? 523  LYS D N   1 
ATOM   5819 C  CA  . LYS D 2 36  ? 20.998 97.162  28.878 1.00 27.13  ? 523  LYS D CA  1 
ATOM   5820 C  C   . LYS D 2 36  ? 19.679 97.669  28.344 1.00 23.19  ? 523  LYS D C   1 
ATOM   5821 O  O   . LYS D 2 36  ? 19.577 98.820  27.949 1.00 25.13  ? 523  LYS D O   1 
ATOM   5822 C  CB  . LYS D 2 36  ? 21.617 96.239  27.823 1.00 38.88  ? 523  LYS D CB  1 
ATOM   5823 C  CG  . LYS D 2 36  ? 22.911 96.771  27.231 1.00 51.42  ? 523  LYS D CG  1 
ATOM   5824 C  CD  . LYS D 2 36  ? 24.092 96.473  28.185 1.00 66.93  ? 523  LYS D CD  1 
ATOM   5825 C  CE  . LYS D 2 36  ? 25.407 97.194  27.810 1.00 68.85  ? 523  LYS D CE  1 
ATOM   5826 N  NZ  . LYS D 2 36  ? 25.729 98.387  28.680 1.00 65.23  ? 523  LYS D NZ  1 
ATOM   5827 N  N   . ALA D 2 37  ? 18.679 96.785  28.377 1.00 22.96  ? 524  ALA D N   1 
ATOM   5828 C  CA  . ALA D 2 37  ? 17.318 97.058  27.940 1.00 20.72  ? 524  ALA D CA  1 
ATOM   5829 C  C   . ALA D 2 37  ? 16.732 98.205  28.764 1.00 22.18  ? 524  ALA D C   1 
ATOM   5830 O  O   . ALA D 2 37  ? 16.209 99.163  28.206 1.00 26.76  ? 524  ALA D O   1 
ATOM   5831 C  CB  . ALA D 2 37  ? 16.467 95.798  28.092 1.00 17.65  ? 524  ALA D CB  1 
ATOM   5832 N  N   . LEU D 2 38  ? 16.863 98.118  30.091 1.00 26.09  ? 525  LEU D N   1 
ATOM   5833 C  CA  . LEU D 2 38  ? 16.327 99.129  31.011 1.00 18.15  ? 525  LEU D CA  1 
ATOM   5834 C  C   . LEU D 2 38  ? 16.975 100.484 30.764 1.00 20.35  ? 525  LEU D C   1 
ATOM   5835 O  O   . LEU D 2 38  ? 16.346 101.546 30.945 1.00 22.18  ? 525  LEU D O   1 
ATOM   5836 C  CB  . LEU D 2 38  ? 16.524 98.682  32.455 1.00 22.91  ? 525  LEU D CB  1 
ATOM   5837 C  CG  . LEU D 2 38  ? 15.406 97.773  32.957 1.00 14.22  ? 525  LEU D CG  1 
ATOM   5838 C  CD1 . LEU D 2 38  ? 15.656 97.221  34.318 1.00 15.68  ? 525  LEU D CD1 1 
ATOM   5839 C  CD2 . LEU D 2 38  ? 14.200 98.629  33.006 1.00 17.71  ? 525  LEU D CD2 1 
ATOM   5840 N  N   . THR D 2 39  ? 18.244 100.473 30.391 1.00 17.82  ? 526  THR D N   1 
ATOM   5841 C  CA  . THR D 2 39  ? 18.906 101.747 30.083 1.00 23.59  ? 526  THR D CA  1 
ATOM   5842 C  C   . THR D 2 39  ? 18.217 102.481 28.899 1.00 27.35  ? 526  THR D C   1 
ATOM   5843 O  O   . THR D 2 39  ? 17.949 103.690 29.006 1.00 26.05  ? 526  THR D O   1 
ATOM   5844 C  CB  . THR D 2 39  ? 20.435 101.568 29.870 1.00 23.84  ? 526  THR D CB  1 
ATOM   5845 O  OG1 . THR D 2 39  ? 20.994 100.977 31.051 1.00 23.82  ? 526  THR D OG1 1 
ATOM   5846 C  CG2 . THR D 2 39  ? 21.108 102.892 29.683 1.00 17.61  ? 526  THR D CG2 1 
ATOM   5847 N  N   . SER D 2 40  ? 17.848 101.721 27.849 1.00 26.16  ? 527  SER D N   1 
ATOM   5848 C  CA  . SER D 2 40  ? 17.127 102.218 26.645 1.00 26.10  ? 527  SER D CA  1 
ATOM   5849 C  C   . SER D 2 40  ? 15.743 102.720 26.993 1.00 26.48  ? 527  SER D C   1 
ATOM   5850 O  O   . SER D 2 40  ? 15.381 103.845 26.653 1.00 26.26  ? 527  SER D O   1 
ATOM   5851 C  CB  . SER D 2 40  ? 16.913 101.087 25.633 1.00 26.36  ? 527  SER D CB  1 
ATOM   5852 O  OG  . SER D 2 40  ? 18.129 100.624 25.160 1.00 25.58  ? 527  SER D OG  1 
ATOM   5853 N  N   . GLU D 2 41  ? 14.969 101.853 27.651 1.00 23.20  ? 528  GLU D N   1 
ATOM   5854 C  CA  . GLU D 2 41  ? 13.594 102.159 28.060 1.00 25.09  ? 528  GLU D CA  1 
ATOM   5855 C  C   . GLU D 2 41  ? 13.415 103.397 28.917 1.00 26.90  ? 528  GLU D C   1 
ATOM   5856 O  O   . GLU D 2 41  ? 12.365 104.067 28.859 1.00 26.05  ? 528  GLU D O   1 
ATOM   5857 C  CB  . GLU D 2 41  ? 13.010 100.967 28.791 1.00 33.03  ? 528  GLU D CB  1 
ATOM   5858 C  CG  . GLU D 2 41  ? 13.010 99.701  27.985 1.00 34.55  ? 528  GLU D CG  1 
ATOM   5859 C  CD  . GLU D 2 41  ? 12.551 98.508  28.801 1.00 41.14  ? 528  GLU D CD  1 
ATOM   5860 O  OE1 . GLU D 2 41  ? 12.216 98.647  30.013 1.00 36.31  ? 528  GLU D OE1 1 
ATOM   5861 O  OE2 . GLU D 2 41  ? 12.535 97.418  28.212 1.00 41.33  ? 528  GLU D OE2 1 
ATOM   5862 N  N   . LEU D 2 42  ? 14.409 103.664 29.759 1.00 18.07  ? 529  LEU D N   1 
ATOM   5863 C  CA  . LEU D 2 42  ? 14.370 104.843 30.621 1.00 21.28  ? 529  LEU D CA  1 
ATOM   5864 C  C   . LEU D 2 42  ? 15.051 106.110 30.033 1.00 20.65  ? 529  LEU D C   1 
ATOM   5865 O  O   . LEU D 2 42  ? 14.857 107.191 30.572 1.00 21.29  ? 529  LEU D O   1 
ATOM   5866 C  CB  . LEU D 2 42  ? 14.998 104.493 32.002 1.00 20.77  ? 529  LEU D CB  1 
ATOM   5867 C  CG  . LEU D 2 42  ? 14.368 103.373 32.863 1.00 16.78  ? 529  LEU D CG  1 
ATOM   5868 C  CD1 . LEU D 2 42  ? 15.186 103.161 34.172 1.00 17.58  ? 529  LEU D CD1 1 
ATOM   5869 C  CD2 . LEU D 2 42  ? 12.870 103.737 33.166 1.00 15.35  ? 529  LEU D CD2 1 
ATOM   5870 N  N   . ALA D 2 43  ? 15.791 105.981 28.922 1.00 20.77  ? 530  ALA D N   1 
ATOM   5871 C  CA  . ALA D 2 43  ? 16.536 107.103 28.329 1.00 20.83  ? 530  ALA D CA  1 
ATOM   5872 C  C   . ALA D 2 43  ? 15.669 108.298 28.010 1.00 17.72  ? 530  ALA D C   1 
ATOM   5873 O  O   . ALA D 2 43  ? 16.036 109.398 28.306 1.00 27.84  ? 530  ALA D O   1 
ATOM   5874 C  CB  . ALA D 2 43  ? 17.233 106.646 27.091 1.00 18.71  ? 530  ALA D CB  1 
ATOM   5875 N  N   . ASN D 2 44  ? 14.486 108.027 27.491 1.00 21.37  ? 531  ASN D N   1 
ATOM   5876 C  CA  . ASN D 2 44  ? 13.500 109.023 27.132 1.00 28.67  ? 531  ASN D CA  1 
ATOM   5877 C  C   . ASN D 2 44  ? 12.770 109.658 28.298 1.00 27.75  ? 531  ASN D C   1 
ATOM   5878 O  O   . ASN D 2 44  ? 12.372 110.805 28.233 1.00 24.85  ? 531  ASN D O   1 
ATOM   5879 C  CB  . ASN D 2 44  ? 12.439 108.418 26.227 1.00 41.52  ? 531  ASN D CB  1 
ATOM   5880 C  CG  . ASN D 2 44  ? 12.485 108.988 24.843 1.00 55.24  ? 531  ASN D CG  1 
ATOM   5881 O  OD1 . ASN D 2 44  ? 13.178 108.456 23.976 1.00 59.58  ? 531  ASN D OD1 1 
ATOM   5882 N  ND2 . ASN D 2 44  ? 11.780 110.105 24.627 1.00 58.67  ? 531  ASN D ND2 1 
ATOM   5883 N  N   . ALA D 2 45  ? 12.469 108.870 29.313 1.00 26.72  ? 532  ALA D N   1 
ATOM   5884 C  CA  . ALA D 2 45  ? 11.734 109.361 30.473 1.00 26.76  ? 532  ALA D CA  1 
ATOM   5885 C  C   . ALA D 2 45  ? 12.606 110.201 31.426 1.00 23.32  ? 532  ALA D C   1 
ATOM   5886 O  O   . ALA D 2 45  ? 12.112 110.929 32.286 1.00 21.41  ? 532  ALA D O   1 
ATOM   5887 C  CB  . ALA D 2 45  ? 11.170 108.180 31.233 1.00 25.41  ? 532  ALA D CB  1 
ATOM   5888 N  N   . ARG D 2 46  ? 13.910 110.031 31.332 1.00 24.22  ? 533  ARG D N   1 
ATOM   5889 C  CA  . ARG D 2 46  ? 14.789 110.742 32.230 1.00 28.98  ? 533  ARG D CA  1 
ATOM   5890 C  C   . ARG D 2 46  ? 14.917 112.227 32.039 1.00 28.33  ? 533  ARG D C   1 
ATOM   5891 O  O   . ARG D 2 46  ? 15.141 112.703 30.936 1.00 26.84  ? 533  ARG D O   1 
ATOM   5892 C  CB  . ARG D 2 46  ? 16.184 110.113 32.214 1.00 36.67  ? 533  ARG D CB  1 
ATOM   5893 C  CG  . ARG D 2 46  ? 17.240 110.848 33.060 1.00 44.45  ? 533  ARG D CG  1 
ATOM   5894 C  CD  . ARG D 2 46  ? 16.950 110.821 34.557 1.00 61.20  ? 533  ARG D CD  1 
ATOM   5895 N  NE  . ARG D 2 46  ? 18.097 111.270 35.347 1.00 66.21  ? 533  ARG D NE  1 
ATOM   5896 C  CZ  . ARG D 2 46  ? 18.662 110.565 36.325 1.00 67.35  ? 533  ARG D CZ  1 
ATOM   5897 N  NH1 . ARG D 2 46  ? 19.703 111.073 36.960 1.00 69.60  ? 533  ARG D NH1 1 
ATOM   5898 N  NH2 . ARG D 2 46  ? 18.184 109.376 36.692 1.00 62.07  ? 533  ARG D NH2 1 
ATOM   5899 N  N   . ASP D 2 47  ? 14.751 112.949 33.140 1.00 27.90  ? 534  ASP D N   1 
ATOM   5900 C  CA  . ASP D 2 47  ? 14.876 114.394 33.172 1.00 28.55  ? 534  ASP D CA  1 
ATOM   5901 C  C   . ASP D 2 47  ? 16.396 114.639 33.485 1.00 32.57  ? 534  ASP D C   1 
ATOM   5902 O  O   . ASP D 2 47  ? 16.850 114.532 34.633 1.00 28.56  ? 534  ASP D O   1 
ATOM   5903 C  CB  . ASP D 2 47  ? 14.013 114.945 34.302 1.00 25.61  ? 534  ASP D CB  1 
ATOM   5904 C  CG  . ASP D 2 47  ? 14.031 116.460 34.349 1.00 28.89  ? 534  ASP D CG  1 
ATOM   5905 O  OD1 . ASP D 2 47  ? 15.074 117.039 33.946 1.00 33.81  ? 534  ASP D OD1 1 
ATOM   5906 O  OD2 . ASP D 2 47  ? 13.021 117.078 34.772 1.00 27.70  ? 534  ASP D OD2 1 
ATOM   5907 N  N   . GLU D 2 48  ? 17.176 114.941 32.458 1.00 29.38  ? 535  GLU D N   1 
ATOM   5908 C  CA  . GLU D 2 48  ? 18.606 115.149 32.628 1.00 29.30  ? 535  GLU D CA  1 
ATOM   5909 C  C   . GLU D 2 48  ? 19.007 116.381 33.455 1.00 27.52  ? 535  GLU D C   1 
ATOM   5910 O  O   . GLU D 2 48  ? 20.190 116.618 33.659 1.00 31.29  ? 535  GLU D O   1 
ATOM   5911 C  CB  . GLU D 2 48  ? 19.308 115.226 31.277 1.00 38.07  ? 535  GLU D CB  1 
ATOM   5912 C  CG  . GLU D 2 48  ? 19.359 113.917 30.519 1.00 42.12  ? 535  GLU D CG  1 
ATOM   5913 C  CD  . GLU D 2 48  ? 20.255 112.873 31.180 1.00 46.28  ? 535  GLU D CD  1 
ATOM   5914 O  OE1 . GLU D 2 48  ? 21.346 113.218 31.712 1.00 46.50  ? 535  GLU D OE1 1 
ATOM   5915 O  OE2 . GLU D 2 48  ? 19.865 111.688 31.133 1.00 43.40  ? 535  GLU D OE2 1 
ATOM   5916 N  N   . SER D 2 49  ? 18.041 117.176 33.920 1.00 26.48  ? 536  SER D N   1 
ATOM   5917 C  CA  . SER D 2 49  ? 18.376 118.349 34.729 1.00 25.16  ? 536  SER D CA  1 
ATOM   5918 C  C   . SER D 2 49  ? 18.156 118.073 36.215 1.00 26.09  ? 536  SER D C   1 
ATOM   5919 O  O   . SER D 2 49  ? 18.158 118.996 37.023 1.00 20.75  ? 536  SER D O   1 
ATOM   5920 C  CB  . SER D 2 49  ? 17.526 119.560 34.339 1.00 29.87  ? 536  SER D CB  1 
ATOM   5921 O  OG  . SER D 2 49  ? 16.235 119.472 34.904 1.00 27.80  ? 536  SER D OG  1 
ATOM   5922 N  N   . LYS D 2 50  ? 17.851 116.815 36.534 1.00 27.40  ? 537  LYS D N   1 
ATOM   5923 C  CA  . LYS D 2 50  ? 17.643 116.361 37.901 1.00 25.56  ? 537  LYS D CA  1 
ATOM   5924 C  C   . LYS D 2 50  ? 18.654 115.250 38.129 1.00 29.34  ? 537  LYS D C   1 
ATOM   5925 O  O   . LYS D 2 50  ? 18.404 114.106 37.814 1.00 42.39  ? 537  LYS D O   1 
ATOM   5926 C  CB  . LYS D 2 50  ? 16.225 115.845 38.092 1.00 18.82  ? 537  LYS D CB  1 
ATOM   5927 C  CG  . LYS D 2 50  ? 15.191 116.945 37.846 1.00 17.62  ? 537  LYS D CG  1 
ATOM   5928 C  CD  . LYS D 2 50  ? 14.167 116.991 38.919 1.00 31.64  ? 537  LYS D CD  1 
ATOM   5929 C  CE  . LYS D 2 50  ? 13.095 118.045 38.619 1.00 41.35  ? 537  LYS D CE  1 
ATOM   5930 N  NZ  . LYS D 2 50  ? 12.003 117.496 37.755 1.00 51.33  ? 537  LYS D NZ  1 
ATOM   5931 N  N   . LYS D 2 51  ? 19.883 115.647 38.370 1.00 25.27  ? 538  LYS D N   1 
ATOM   5932 C  CA  . LYS D 2 51  ? 20.945 114.683 38.604 1.00 27.62  ? 538  LYS D CA  1 
ATOM   5933 C  C   . LYS D 2 51  ? 21.380 114.988 40.029 1.00 25.66  ? 538  LYS D C   1 
ATOM   5934 O  O   . LYS D 2 51  ? 21.572 116.155 40.366 1.00 23.30  ? 538  LYS D O   1 
ATOM   5935 C  CB  . LYS D 2 51  ? 22.208 114.973 37.723 1.00 28.15  ? 538  LYS D CB  1 
ATOM   5936 C  CG  . LYS D 2 51  ? 22.221 114.558 36.239 1.00 24.21  ? 538  LYS D CG  1 
ATOM   5937 C  CD  . LYS D 2 51  ? 23.563 114.968 35.624 1.00 19.22  ? 538  LYS D CD  1 
ATOM   5938 C  CE  . LYS D 2 51  ? 23.674 114.655 34.123 1.00 16.39  ? 538  LYS D CE  1 
ATOM   5939 N  NZ  . LYS D 2 51  ? 23.081 115.693 33.295 1.00 30.06  ? 538  LYS D NZ  1 
ATOM   5940 N  N   . THR D 2 52  ? 21.510 113.968 40.866 1.00 20.87  ? 539  THR D N   1 
ATOM   5941 C  CA  . THR D 2 52  ? 22.028 114.187 42.202 1.00 18.97  ? 539  THR D CA  1 
ATOM   5942 C  C   . THR D 2 52  ? 23.545 114.009 42.109 1.00 17.34  ? 539  THR D C   1 
ATOM   5943 O  O   . THR D 2 52  ? 24.046 113.553 41.055 1.00 11.92  ? 539  THR D O   1 
ATOM   5944 C  CB  . THR D 2 52  ? 21.439 113.203 43.206 1.00 17.00  ? 539  THR D CB  1 
ATOM   5945 O  OG1 . THR D 2 52  ? 21.920 111.880 42.934 1.00 13.80  ? 539  THR D OG1 1 
ATOM   5946 C  CG2 . THR D 2 52  ? 19.957 113.235 43.092 1.00 14.27  ? 539  THR D CG2 1 
ATOM   5947 N  N   . ALA D 2 53  ? 24.268 114.428 43.161 1.00 12.92  ? 540  ALA D N   1 
ATOM   5948 C  CA  . ALA D 2 53  ? 25.726 114.285 43.222 1.00 14.68  ? 540  ALA D CA  1 
ATOM   5949 C  C   . ALA D 2 53  ? 26.121 112.808 43.049 1.00 9.89   ? 540  ALA D C   1 
ATOM   5950 O  O   . ALA D 2 53  ? 27.052 112.509 42.261 1.00 14.14  ? 540  ALA D O   1 
ATOM   5951 C  CB  . ALA D 2 53  ? 26.282 114.833 44.555 1.00 14.57  ? 540  ALA D CB  1 
ATOM   5952 N  N   . ASN D 2 54  ? 25.415 111.892 43.745 1.00 14.59  ? 541  ASN D N   1 
ATOM   5953 C  CA  . ASN D 2 54  ? 25.700 110.455 43.591 1.00 11.41  ? 541  ASN D CA  1 
ATOM   5954 C  C   . ASN D 2 54  ? 25.456 110.009 42.180 1.00 15.18  ? 541  ASN D C   1 
ATOM   5955 O  O   . ASN D 2 54  ? 26.250 109.209 41.659 1.00 14.74  ? 541  ASN D O   1 
ATOM   5956 C  CB  . ASN D 2 54  ? 24.913 109.611 44.567 1.00 17.02  ? 541  ASN D CB  1 
ATOM   5957 C  CG  . ASN D 2 54  ? 25.506 109.623 45.954 1.00 15.23  ? 541  ASN D CG  1 
ATOM   5958 O  OD1 . ASN D 2 54  ? 26.598 110.143 46.171 1.00 16.72  ? 541  ASN D OD1 1 
ATOM   5959 N  ND2 . ASN D 2 54  ? 24.779 109.069 46.911 1.00 14.69  ? 541  ASN D ND2 1 
ATOM   5960 N  N   . ASP D 2 55  ? 24.378 110.491 41.529 1.00 13.53  ? 542  ASP D N   1 
ATOM   5961 C  CA  . ASP D 2 55  ? 24.171 110.139 40.096 1.00 12.47  ? 542  ASP D CA  1 
ATOM   5962 C  C   . ASP D 2 55  ? 25.413 110.528 39.247 1.00 17.92  ? 542  ASP D C   1 
ATOM   5963 O  O   . ASP D 2 55  ? 25.905 109.765 38.391 1.00 14.98  ? 542  ASP D O   1 
ATOM   5964 C  CB  . ASP D 2 55  ? 22.972 110.863 39.509 1.00 16.11  ? 542  ASP D CB  1 
ATOM   5965 C  CG  . ASP D 2 55  ? 21.673 110.350 40.054 1.00 12.01  ? 542  ASP D CG  1 
ATOM   5966 O  OD1 . ASP D 2 55  ? 21.548 109.144 40.316 1.00 12.24  ? 542  ASP D OD1 1 
ATOM   5967 O  OD2 . ASP D 2 55  ? 20.746 111.145 40.191 1.00 19.85  ? 542  ASP D OD2 1 
HETATM 5968 N  N   . MSE D 2 56  ? 25.947 111.716 39.475 1.00 14.13  ? 543  MSE D N   1 
HETATM 5969 C  CA  . MSE D 2 56  ? 27.112 112.123 38.694 1.00 15.12  ? 543  MSE D CA  1 
HETATM 5970 C  C   . MSE D 2 56  ? 28.407 111.359 39.029 1.00 18.83  ? 543  MSE D C   1 
HETATM 5971 O  O   . MSE D 2 56  ? 29.245 111.105 38.154 1.00 15.49  ? 543  MSE D O   1 
HETATM 5972 C  CB  . MSE D 2 56  ? 27.330 113.616 38.857 1.00 16.68  ? 543  MSE D CB  1 
HETATM 5973 C  CG  . MSE D 2 56  ? 26.149 114.399 38.277 1.00 19.58  ? 543  MSE D CG  1 
HETATM 5974 SE SE  . MSE D 2 56  ? 26.417 116.331 38.331 1.00 31.96  ? 543  MSE D SE  1 
HETATM 5975 C  CE  . MSE D 2 56  ? 25.986 116.638 40.084 1.00 18.99  ? 543  MSE D CE  1 
ATOM   5976 N  N   . ILE D 2 57  ? 28.577 111.021 40.304 1.00 17.05  ? 544  ILE D N   1 
ATOM   5977 C  CA  . ILE D 2 57  ? 29.742 110.232 40.719 1.00 17.04  ? 544  ILE D CA  1 
ATOM   5978 C  C   . ILE D 2 57  ? 29.609 108.856 40.058 1.00 15.52  ? 544  ILE D C   1 
ATOM   5979 O  O   . ILE D 2 57  ? 30.539 108.384 39.406 1.00 19.16  ? 544  ILE D O   1 
ATOM   5980 C  CB  . ILE D 2 57  ? 29.832 110.083 42.277 1.00 16.00  ? 544  ILE D CB  1 
ATOM   5981 C  CG1 . ILE D 2 57  ? 30.114 111.449 42.949 1.00 10.35  ? 544  ILE D CG1 1 
ATOM   5982 C  CG2 . ILE D 2 57  ? 30.902 109.048 42.672 1.00 14.82  ? 544  ILE D CG2 1 
ATOM   5983 C  CD1 . ILE D 2 57  ? 29.584 111.455 44.394 1.00 14.21  ? 544  ILE D CD1 1 
ATOM   5984 N  N   . HIS D 2 58  ? 28.423 108.265 40.154 1.00 11.95  ? 545  HIS D N   1 
ATOM   5985 C  CA  . HIS D 2 58  ? 28.185 106.957 39.568 1.00 11.95  ? 545  HIS D CA  1 
ATOM   5986 C  C   . HIS D 2 58  ? 28.410 106.908 38.060 1.00 11.37  ? 545  HIS D C   1 
ATOM   5987 O  O   . HIS D 2 58  ? 29.047 105.985 37.565 1.00 16.68  ? 545  HIS D O   1 
ATOM   5988 C  CB  . HIS D 2 58  ? 26.780 106.471 39.853 1.00 12.99  ? 545  HIS D CB  1 
ATOM   5989 C  CG  . HIS D 2 58  ? 26.447 105.261 39.058 1.00 17.66  ? 545  HIS D CG  1 
ATOM   5990 N  ND1 . HIS D 2 58  ? 26.853 103.997 39.436 1.00 18.94  ? 545  HIS D ND1 1 
ATOM   5991 C  CD2 . HIS D 2 58  ? 25.829 105.124 37.859 1.00 17.51  ? 545  HIS D CD2 1 
ATOM   5992 C  CE1 . HIS D 2 58  ? 26.498 103.130 38.499 1.00 19.16  ? 545  HIS D CE1 1 
ATOM   5993 N  NE2 . HIS D 2 58  ? 25.877 103.791 37.535 1.00 23.71  ? 545  HIS D NE2 1 
ATOM   5994 N  N   . ALA D 2 59  ? 27.898 107.896 37.319 1.00 14.65  ? 546  ALA D N   1 
ATOM   5995 C  CA  . ALA D 2 59  ? 28.044 107.906 35.844 1.00 13.12  ? 546  ALA D CA  1 
ATOM   5996 C  C   . ALA D 2 59  ? 29.535 108.026 35.457 1.00 16.60  ? 546  ALA D C   1 
ATOM   5997 O  O   . ALA D 2 59  ? 30.011 107.444 34.479 1.00 10.82  ? 546  ALA D O   1 
ATOM   5998 C  CB  . ALA D 2 59  ? 27.289 109.101 35.284 1.00 16.30  ? 546  ALA D CB  1 
ATOM   5999 N  N   . GLU D 2 60  ? 30.251 108.851 36.223 1.00 14.92  ? 547  GLU D N   1 
ATOM   6000 C  CA  . GLU D 2 60  ? 31.656 109.057 35.993 1.00 17.26  ? 547  GLU D CA  1 
ATOM   6001 C  C   . GLU D 2 60  ? 32.446 107.774 36.307 1.00 13.50  ? 547  GLU D C   1 
ATOM   6002 O  O   . GLU D 2 60  ? 33.354 107.408 35.564 1.00 14.31  ? 547  GLU D O   1 
ATOM   6003 C  CB  . GLU D 2 60  ? 32.122 110.267 36.808 1.00 20.17  ? 547  GLU D CB  1 
ATOM   6004 C  CG  . GLU D 2 60  ? 33.625 110.596 36.644 1.00 26.39  ? 547  GLU D CG  1 
ATOM   6005 C  CD  . GLU D 2 60  ? 34.028 111.212 35.288 1.00 25.64  ? 547  GLU D CD  1 
ATOM   6006 O  OE1 . GLU D 2 60  ? 33.204 111.439 34.403 1.00 20.67  ? 547  GLU D OE1 1 
ATOM   6007 O  OE2 . GLU D 2 60  ? 35.213 111.505 35.121 1.00 29.37  ? 547  GLU D OE2 1 
ATOM   6008 N  N   . ASN D 2 61  ? 32.021 107.057 37.350 1.00 15.79  ? 548  ASN D N   1 
ATOM   6009 C  CA  . ASN D 2 61  ? 32.625 105.766 37.733 1.00 16.43  ? 548  ASN D CA  1 
ATOM   6010 C  C   . ASN D 2 61  ? 32.410 104.767 36.583 1.00 14.44  ? 548  ASN D C   1 
ATOM   6011 O  O   . ASN D 2 61  ? 33.328 104.038 36.243 1.00 15.21  ? 548  ASN D O   1 
ATOM   6012 C  CB  . ASN D 2 61  ? 31.957 105.213 38.993 1.00 12.94  ? 548  ASN D CB  1 
ATOM   6013 C  CG  . ASN D 2 61  ? 32.499 105.820 40.269 1.00 11.20  ? 548  ASN D CG  1 
ATOM   6014 O  OD1 . ASN D 2 61  ? 33.557 106.422 40.285 1.00 14.62  ? 548  ASN D OD1 1 
ATOM   6015 N  ND2 . ASN D 2 61  ? 31.759 105.647 41.363 1.00 17.49  ? 548  ASN D ND2 1 
HETATM 6016 N  N   . MSE D 2 62  ? 31.226 104.773 35.950 1.00 12.60  ? 549  MSE D N   1 
HETATM 6017 C  CA  . MSE D 2 62  ? 30.944 103.851 34.823 1.00 11.85  ? 549  MSE D CA  1 
HETATM 6018 C  C   . MSE D 2 62  ? 31.706 104.296 33.638 1.00 13.25  ? 549  MSE D C   1 
HETATM 6019 O  O   . MSE D 2 62  ? 32.207 103.476 32.914 1.00 16.13  ? 549  MSE D O   1 
HETATM 6020 C  CB  . MSE D 2 62  ? 29.491 103.853 34.420 1.00 10.88  ? 549  MSE D CB  1 
HETATM 6021 C  CG  . MSE D 2 62  ? 28.596 103.433 35.578 1.00 28.06  ? 549  MSE D CG  1 
HETATM 6022 SE SE  . MSE D 2 62  ? 28.935 101.587 36.231 1.00 42.69  ? 549  MSE D SE  1 
HETATM 6023 C  CE  . MSE D 2 62  ? 27.397 100.797 35.237 1.00 47.92  ? 549  MSE D CE  1 
ATOM   6024 N  N   . ARG D 2 63  ? 31.803 105.599 33.405 1.00 17.24  ? 550  ARG D N   1 
ATOM   6025 C  CA  . ARG D 2 63  ? 32.559 106.057 32.249 1.00 12.89  ? 550  ARG D CA  1 
ATOM   6026 C  C   . ARG D 2 63  ? 34.034 105.613 32.331 1.00 20.32  ? 550  ARG D C   1 
ATOM   6027 O  O   . ARG D 2 63  ? 34.685 105.329 31.310 1.00 18.39  ? 550  ARG D O   1 
ATOM   6028 C  CB  . ARG D 2 63  ? 32.530 107.595 32.100 1.00 18.42  ? 550  ARG D CB  1 
ATOM   6029 C  CG  . ARG D 2 63  ? 33.142 108.161 30.745 1.00 18.12  ? 550  ARG D CG  1 
ATOM   6030 C  CD  . ARG D 2 63  ? 33.253 109.712 30.735 1.00 19.70  ? 550  ARG D CD  1 
ATOM   6031 N  NE  . ARG D 2 63  ? 34.174 110.243 31.761 1.00 18.28  ? 550  ARG D NE  1 
ATOM   6032 C  CZ  . ARG D 2 63  ? 35.477 110.485 31.575 1.00 23.38  ? 550  ARG D CZ  1 
ATOM   6033 N  NH1 . ARG D 2 63  ? 36.081 110.262 30.417 1.00 21.10  ? 550  ARG D NH1 1 
ATOM   6034 N  NH2 . ARG D 2 63  ? 36.196 110.988 32.549 1.00 19.61  ? 550  ARG D NH2 1 
ATOM   6035 N  N   . LEU D 2 64  ? 34.582 105.611 33.537 1.00 18.68  ? 551  LEU D N   1 
ATOM   6036 C  CA  . LEU D 2 64  ? 35.965 105.201 33.719 1.00 21.90  ? 551  LEU D CA  1 
ATOM   6037 C  C   . LEU D 2 64  ? 36.195 103.693 33.929 1.00 18.95  ? 551  LEU D C   1 
ATOM   6038 O  O   . LEU D 2 64  ? 37.311 103.276 34.212 1.00 29.21  ? 551  LEU D O   1 
ATOM   6039 C  CB  . LEU D 2 64  ? 36.604 106.047 34.840 1.00 22.76  ? 551  LEU D CB  1 
ATOM   6040 C  CG  . LEU D 2 64  ? 36.595 107.547 34.517 1.00 19.36  ? 551  LEU D CG  1 
ATOM   6041 C  CD1 . LEU D 2 64  ? 37.140 108.377 35.691 1.00 27.64  ? 551  LEU D CD1 1 
ATOM   6042 C  CD2 . LEU D 2 64  ? 37.365 107.799 33.261 1.00 18.89  ? 551  LEU D CD2 1 
ATOM   6043 N  N   . GLY D 2 65  ? 35.122 102.902 33.896 1.00 17.79  ? 552  GLY D N   1 
ATOM   6044 C  CA  . GLY D 2 65  ? 35.226 101.453 34.022 1.00 16.78  ? 552  GLY D CA  1 
ATOM   6045 C  C   . GLY D 2 65  ? 35.507 100.890 35.403 1.00 22.28  ? 552  GLY D C   1 
ATOM   6046 O  O   . GLY D 2 65  ? 36.127 99.833  35.541 1.00 27.35  ? 552  GLY D O   1 
ATOM   6047 N  N   . ARG D 2 66  ? 34.968 101.560 36.423 1.00 26.20  ? 553  ARG D N   1 
ATOM   6048 C  CA  . ARG D 2 66  ? 35.111 101.169 37.814 1.00 16.60  ? 553  ARG D CA  1 
ATOM   6049 C  C   . ARG D 2 66  ? 34.011 100.309 38.343 1.00 20.05  ? 553  ARG D C   1 
ATOM   6050 O  O   . ARG D 2 66  ? 32.856 100.454 37.948 1.00 23.14  ? 553  ARG D O   1 
ATOM   6051 C  CB  . ARG D 2 66  ? 35.098 102.394 38.732 1.00 20.57  ? 553  ARG D CB  1 
ATOM   6052 C  CG  . ARG D 2 66  ? 36.137 103.445 38.458 1.00 16.86  ? 553  ARG D CG  1 
ATOM   6053 C  CD  . ARG D 2 66  ? 36.238 104.449 39.634 1.00 20.55  ? 553  ARG D CD  1 
ATOM   6054 N  NE  . ARG D 2 66  ? 37.293 105.419 39.339 1.00 29.82  ? 553  ARG D NE  1 
ATOM   6055 C  CZ  . ARG D 2 66  ? 37.136 106.735 39.259 1.00 33.47  ? 553  ARG D CZ  1 
ATOM   6056 N  NH1 . ARG D 2 66  ? 35.959 107.296 39.474 1.00 25.91  ? 553  ARG D NH1 1 
ATOM   6057 N  NH2 . ARG D 2 66  ? 38.156 107.484 38.869 1.00 43.19  ? 553  ARG D NH2 1 
ATOM   6058 N  N   . ASP D 2 67  ? 34.386 99.423  39.257 1.00 19.19  ? 554  ASP D N   1 
ATOM   6059 C  CA  . ASP D 2 67  ? 33.435 98.587  39.965 1.00 20.96  ? 554  ASP D CA  1 
ATOM   6060 C  C   . ASP D 2 67  ? 33.968 98.459  41.407 1.00 18.01  ? 554  ASP D C   1 
ATOM   6061 O  O   . ASP D 2 67  ? 35.107 98.836  41.695 1.00 16.58  ? 554  ASP D O   1 
ATOM   6062 C  CB  . ASP D 2 67  ? 33.152 97.235  39.268 1.00 19.97  ? 554  ASP D CB  1 
ATOM   6063 C  CG  . ASP D 2 67  ? 34.364 96.370  39.137 1.00 25.83  ? 554  ASP D CG  1 
ATOM   6064 O  OD1 . ASP D 2 67  ? 34.737 95.743  40.132 1.00 28.15  ? 554  ASP D OD1 1 
ATOM   6065 O  OD2 . ASP D 2 67  ? 34.935 96.294  38.039 1.00 25.89  ? 554  ASP D OD2 1 
ATOM   6066 N  N   . LYS D 2 68  ? 33.103 98.008  42.308 1.00 17.80  ? 555  LYS D N   1 
ATOM   6067 C  CA  . LYS D 2 68  ? 33.425 97.865  43.698 1.00 19.89  ? 555  LYS D CA  1 
ATOM   6068 C  C   . LYS D 2 68  ? 34.746 97.102  43.960 1.00 20.49  ? 555  LYS D C   1 
ATOM   6069 O  O   . LYS D 2 68  ? 35.566 97.540  44.757 1.00 15.82  ? 555  LYS D O   1 
ATOM   6070 C  CB  . LYS D 2 68  ? 32.242 97.151  44.378 1.00 15.16  ? 555  LYS D CB  1 
ATOM   6071 C  CG  . LYS D 2 68  ? 32.258 97.150  45.917 1.00 16.19  ? 555  LYS D CG  1 
ATOM   6072 C  CD  . LYS D 2 68  ? 31.092 96.325  46.495 1.00 28.44  ? 555  LYS D CD  1 
ATOM   6073 C  CE  . LYS D 2 68  ? 30.700 96.775  47.932 1.00 27.61  ? 555  LYS D CE  1 
ATOM   6074 N  NZ  . LYS D 2 68  ? 29.548 95.972  48.371 1.00 32.87  ? 555  LYS D NZ  1 
ATOM   6075 N  N   . TYR D 2 69  ? 34.912 95.952  43.319 1.00 23.24  ? 556  TYR D N   1 
ATOM   6076 C  CA  . TYR D 2 69  ? 36.071 95.087  43.566 1.00 19.16  ? 556  TYR D CA  1 
ATOM   6077 C  C   . TYR D 2 69  ? 37.351 95.611  42.953 1.00 19.40  ? 556  TYR D C   1 
ATOM   6078 O  O   . TYR D 2 69  ? 38.365 95.619  43.612 1.00 15.52  ? 556  TYR D O   1 
ATOM   6079 C  CB  . TYR D 2 69  ? 35.724 93.644  43.154 1.00 17.88  ? 556  TYR D CB  1 
ATOM   6080 C  CG  . TYR D 2 69  ? 34.316 93.219  43.663 1.00 18.95  ? 556  TYR D CG  1 
ATOM   6081 C  CD1 . TYR D 2 69  ? 33.237 93.118  42.780 1.00 18.38  ? 556  TYR D CD1 1 
ATOM   6082 C  CD2 . TYR D 2 69  ? 34.056 93.022  45.045 1.00 19.82  ? 556  TYR D CD2 1 
ATOM   6083 C  CE1 . TYR D 2 69  ? 31.943 92.836  43.241 1.00 17.63  ? 556  TYR D CE1 1 
ATOM   6084 C  CE2 . TYR D 2 69  ? 32.770 92.756  45.514 1.00 18.48  ? 556  TYR D CE2 1 
ATOM   6085 C  CZ  . TYR D 2 69  ? 31.709 92.667  44.614 1.00 20.89  ? 556  TYR D CZ  1 
ATOM   6086 O  OH  . TYR D 2 69  ? 30.398 92.449  45.061 1.00 21.43  ? 556  TYR D OH  1 
ATOM   6087 N  N   . LYS D 2 70  ? 37.272 96.149  41.747 1.00 18.18  ? 557  LYS D N   1 
ATOM   6088 C  CA  . LYS D 2 70  ? 38.428 96.724  41.065 1.00 20.16  ? 557  LYS D CA  1 
ATOM   6089 C  C   . LYS D 2 70  ? 38.914 97.933  41.882 1.00 14.61  ? 557  LYS D C   1 
ATOM   6090 O  O   . LYS D 2 70  ? 40.092 98.105  42.053 1.00 18.94  ? 557  LYS D O   1 
ATOM   6091 C  CB  . LYS D 2 70  ? 38.018 97.143  39.654 1.00 25.78  ? 557  LYS D CB  1 
ATOM   6092 C  CG  . LYS D 2 70  ? 39.116 97.704  38.768 1.00 37.94  ? 557  LYS D CG  1 
ATOM   6093 C  CD  . LYS D 2 70  ? 40.056 96.626  38.260 1.00 52.29  ? 557  LYS D CD  1 
ATOM   6094 C  CE  . LYS D 2 70  ? 41.032 97.187  37.217 1.00 56.85  ? 557  LYS D CE  1 
ATOM   6095 N  NZ  . LYS D 2 70  ? 40.351 97.802  36.034 1.00 58.19  ? 557  LYS D NZ  1 
ATOM   6096 N  N   . THR D 2 71  ? 38.011 98.749  42.420 1.00 18.59  ? 558  THR D N   1 
ATOM   6097 C  CA  . THR D 2 71  ? 38.404 99.905  43.256 1.00 18.15  ? 558  THR D CA  1 
ATOM   6098 C  C   . THR D 2 71  ? 39.068 99.495  44.574 1.00 14.28  ? 558  THR D C   1 
ATOM   6099 O  O   . THR D 2 71  ? 40.045 100.094 44.989 1.00 17.51  ? 558  THR D O   1 
ATOM   6100 C  CB  . THR D 2 71  ? 37.213 100.803 43.566 1.00 14.98  ? 558  THR D CB  1 
ATOM   6101 O  OG1 . THR D 2 71  ? 36.841 101.544 42.389 1.00 17.17  ? 558  THR D OG1 1 
ATOM   6102 C  CG2 . THR D 2 71  ? 37.549 101.769 44.703 1.00 15.46  ? 558  THR D CG2 1 
ATOM   6103 N  N   . LEU D 2 72  ? 38.518 98.474  45.221 1.00 14.27  ? 559  LEU D N   1 
ATOM   6104 C  CA  . LEU D 2 72  ? 39.064 97.913  46.472 1.00 19.19  ? 559  LEU D CA  1 
ATOM   6105 C  C   . LEU D 2 72  ? 40.528 97.473  46.230 1.00 21.08  ? 559  LEU D C   1 
ATOM   6106 O  O   . LEU D 2 72  ? 41.440 97.788  47.016 1.00 18.70  ? 559  LEU D O   1 
ATOM   6107 C  CB  . LEU D 2 72  ? 38.224 96.698  46.847 1.00 26.21  ? 559  LEU D CB  1 
ATOM   6108 C  CG  . LEU D 2 72  ? 38.050 96.430  48.305 1.00 27.24  ? 559  LEU D CG  1 
ATOM   6109 C  CD1 . LEU D 2 72  ? 37.734 97.740  48.999 1.00 34.67  ? 559  LEU D CD1 1 
ATOM   6110 C  CD2 . LEU D 2 72  ? 36.936 95.407  48.439 1.00 33.63  ? 559  LEU D CD2 1 
ATOM   6111 N  N   . ARG D 2 73  ? 40.736 96.803  45.094 1.00 17.18  ? 560  ARG D N   1 
ATOM   6112 C  CA  . ARG D 2 73  ? 42.046 96.322  44.663 1.00 20.36  ? 560  ARG D CA  1 
ATOM   6113 C  C   . ARG D 2 73  ? 42.984 97.503  44.492 1.00 17.59  ? 560  ARG D C   1 
ATOM   6114 O  O   . ARG D 2 73  ? 44.082 97.528  45.012 1.00 20.04  ? 560  ARG D O   1 
ATOM   6115 C  CB  . ARG D 2 73  ? 41.913 95.600  43.308 1.00 20.65  ? 560  ARG D CB  1 
ATOM   6116 C  CG  . ARG D 2 73  ? 43.165 94.873  42.915 1.00 29.64  ? 560  ARG D CG  1 
ATOM   6117 C  CD  . ARG D 2 73  ? 43.079 94.195  41.582 1.00 41.23  ? 560  ARG D CD  1 
ATOM   6118 N  NE  . ARG D 2 73  ? 44.272 93.368  41.411 1.00 50.20  ? 560  ARG D NE  1 
ATOM   6119 C  CZ  . ARG D 2 73  ? 45.499 93.852  41.214 1.00 57.27  ? 560  ARG D CZ  1 
ATOM   6120 N  NH1 . ARG D 2 73  ? 45.694 95.172  41.154 1.00 61.63  ? 560  ARG D NH1 1 
ATOM   6121 N  NH2 . ARG D 2 73  ? 46.532 93.012  41.087 1.00 52.66  ? 560  ARG D NH2 1 
ATOM   6122 N  N   . GLN D 2 74  ? 42.527 98.494  43.757 1.00 21.12  ? 561  GLN D N   1 
ATOM   6123 C  CA  . GLN D 2 74  ? 43.300 99.708  43.496 1.00 25.12  ? 561  GLN D CA  1 
ATOM   6124 C  C   . GLN D 2 74  ? 43.644 100.579 44.721 1.00 24.10  ? 561  GLN D C   1 
ATOM   6125 O  O   . GLN D 2 74  ? 44.748 101.083 44.819 1.00 20.29  ? 561  GLN D O   1 
ATOM   6126 C  CB  . GLN D 2 74  ? 42.517 100.548 42.480 1.00 26.58  ? 561  GLN D CB  1 
ATOM   6127 C  CG  . GLN D 2 74  ? 42.776 102.028 42.521 1.00 48.53  ? 561  GLN D CG  1 
ATOM   6128 C  CD  . GLN D 2 74  ? 43.569 102.481 41.343 1.00 56.52  ? 561  GLN D CD  1 
ATOM   6129 O  OE1 . GLN D 2 74  ? 44.777 102.209 41.236 1.00 66.41  ? 561  GLN D OE1 1 
ATOM   6130 N  NE2 . GLN D 2 74  ? 42.898 103.167 40.424 1.00 57.40  ? 561  GLN D NE2 1 
ATOM   6131 N  N   . ILE D 2 75  ? 42.688 100.786 45.626 1.00 26.07  ? 562  ILE D N   1 
ATOM   6132 C  CA  . ILE D 2 75  ? 42.940 101.614 46.801 1.00 21.58  ? 562  ILE D CA  1 
ATOM   6133 C  C   . ILE D 2 75  ? 43.760 100.980 47.897 1.00 16.62  ? 562  ILE D C   1 
ATOM   6134 O  O   . ILE D 2 75  ? 44.043 101.646 48.896 1.00 18.38  ? 562  ILE D O   1 
ATOM   6135 C  CB  . ILE D 2 75  ? 41.641 102.128 47.455 1.00 13.84  ? 562  ILE D CB  1 
ATOM   6136 C  CG1 . ILE D 2 75  ? 40.767 100.957 47.891 1.00 21.51  ? 562  ILE D CG1 1 
ATOM   6137 C  CG2 . ILE D 2 75  ? 40.857 102.967 46.457 1.00 21.03  ? 562  ILE D CG2 1 
ATOM   6138 C  CD1 . ILE D 2 75  ? 39.461 101.402 48.548 1.00 20.38  ? 562  ILE D CD1 1 
ATOM   6139 N  N   . ARG D 2 76  ? 44.031 99.684  47.777 1.00 17.41  ? 563  ARG D N   1 
ATOM   6140 C  CA  . ARG D 2 76  ? 44.852 98.980  48.764 1.00 17.17  ? 563  ARG D CA  1 
ATOM   6141 C  C   . ARG D 2 76  ? 46.293 98.868  48.240 1.00 20.21  ? 563  ARG D C   1 
ATOM   6142 O  O   . ARG D 2 76  ? 47.145 98.227  48.867 1.00 24.50  ? 563  ARG D O   1 
ATOM   6143 C  CB  . ARG D 2 76  ? 44.304 97.590  49.008 1.00 14.39  ? 563  ARG D CB  1 
ATOM   6144 C  CG  . ARG D 2 76  ? 42.898 97.606  49.567 1.00 15.44  ? 563  ARG D CG  1 
ATOM   6145 C  CD  . ARG D 2 76  ? 42.440 96.201  49.727 1.00 16.00  ? 563  ARG D CD  1 
ATOM   6146 N  NE  . ARG D 2 76  ? 41.407 96.100  50.739 1.00 19.10  ? 563  ARG D NE  1 
ATOM   6147 C  CZ  . ARG D 2 76  ? 40.701 94.998  50.954 1.00 17.04  ? 563  ARG D CZ  1 
ATOM   6148 N  NH1 . ARG D 2 76  ? 40.937 93.912  50.244 1.00 14.28  ? 563  ARG D NH1 1 
ATOM   6149 N  NH2 . ARG D 2 76  ? 39.660 95.041  51.763 1.00 16.13  ? 563  ARG D NH2 1 
ATOM   6150 N  N   . GLN D 2 77  ? 46.557 99.422  47.061 1.00 15.76  ? 564  GLN D N   1 
ATOM   6151 C  CA  . GLN D 2 77  ? 47.922 99.400  46.550 1.00 21.79  ? 564  GLN D CA  1 
ATOM   6152 C  C   . GLN D 2 77  ? 48.826 100.339 47.317 1.00 19.10  ? 564  GLN D C   1 
ATOM   6153 O  O   . GLN D 2 77  ? 48.371 101.291 47.931 1.00 18.70  ? 564  GLN D O   1 
ATOM   6154 C  CB  . GLN D 2 77  ? 47.971 99.714  45.037 1.00 17.49  ? 564  GLN D CB  1 
ATOM   6155 C  CG  . GLN D 2 77  ? 47.601 98.506  44.228 1.00 20.86  ? 564  GLN D CG  1 
ATOM   6156 C  CD  . GLN D 2 77  ? 47.467 98.789  42.795 1.00 28.42  ? 564  GLN D CD  1 
ATOM   6157 O  OE1 . GLN D 2 77  ? 47.216 99.927  42.405 1.00 38.73  ? 564  GLN D OE1 1 
ATOM   6158 N  NE2 . GLN D 2 77  ? 47.578 97.741  41.970 1.00 30.92  ? 564  GLN D NE2 1 
ATOM   6159 N  N   . GLY D 2 78  ? 50.126 100.069 47.272 1.00 26.30  ? 565  GLY D N   1 
ATOM   6160 C  CA  . GLY D 2 78  ? 51.037 100.892 48.031 1.00 23.03  ? 565  GLY D CA  1 
ATOM   6161 C  C   . GLY D 2 78  ? 51.202 100.243 49.367 1.00 18.49  ? 565  GLY D C   1 
ATOM   6162 O  O   . GLY D 2 78  ? 50.524 99.265  49.690 1.00 26.06  ? 565  GLY D O   1 
ATOM   6163 N  N   . ASN D 2 79  ? 52.131 100.743 50.149 1.00 22.97  ? 566  ASN D N   1 
ATOM   6164 C  CA  . ASN D 2 79  ? 52.373 100.143 51.449 1.00 24.06  ? 566  ASN D CA  1 
ATOM   6165 C  C   . ASN D 2 79  ? 51.570 100.955 52.453 1.00 21.65  ? 566  ASN D C   1 
ATOM   6166 O  O   . ASN D 2 79  ? 51.009 102.002 52.109 1.00 25.00  ? 566  ASN D O   1 
ATOM   6167 C  CB  . ASN D 2 79  ? 53.900 100.115 51.753 1.00 17.43  ? 566  ASN D CB  1 
ATOM   6168 C  CG  . ASN D 2 79  ? 54.540 101.487 51.679 1.00 19.98  ? 566  ASN D CG  1 
ATOM   6169 O  OD1 . ASN D 2 79  ? 54.109 102.420 52.351 1.00 22.82  ? 566  ASN D OD1 1 
ATOM   6170 N  ND2 . ASN D 2 79  ? 55.573 101.621 50.852 1.00 27.79  ? 566  ASN D ND2 1 
ATOM   6171 N  N   . THR D 2 80  ? 51.510 100.445 53.685 1.00 23.78  ? 567  THR D N   1 
ATOM   6172 C  CA  . THR D 2 80  ? 50.769 101.049 54.770 1.00 29.29  ? 567  THR D CA  1 
ATOM   6173 C  C   . THR D 2 80  ? 51.124 102.504 55.053 1.00 30.01  ? 567  THR D C   1 
ATOM   6174 O  O   . THR D 2 80  ? 50.232 103.326 55.278 1.00 30.60  ? 567  THR D O   1 
ATOM   6175 C  CB  . THR D 2 80  ? 50.872 100.159 56.036 1.00 33.41  ? 567  THR D CB  1 
ATOM   6176 O  OG1 . THR D 2 80  ? 50.437 98.828  55.713 1.00 27.75  ? 567  THR D OG1 1 
ATOM   6177 C  CG2 . THR D 2 80  ? 49.983 100.693 57.156 1.00 38.30  ? 567  THR D CG2 1 
ATOM   6178 N  N   . LYS D 2 81  ? 52.410 102.840 54.961 1.00 28.74  ? 568  LYS D N   1 
ATOM   6179 C  CA  . LYS D 2 81  ? 52.851 104.199 55.235 1.00 26.02  ? 568  LYS D CA  1 
ATOM   6180 C  C   . LYS D 2 81  ? 52.382 105.137 54.149 1.00 23.13  ? 568  LYS D C   1 
ATOM   6181 O  O   . LYS D 2 81  ? 51.988 106.237 54.440 1.00 27.51  ? 568  LYS D O   1 
ATOM   6182 C  CB  . LYS D 2 81  ? 54.375 104.277 55.347 1.00 31.33  ? 568  LYS D CB  1 
ATOM   6183 C  CG  . LYS D 2 81  ? 54.837 105.585 55.949 1.00 39.19  ? 568  LYS D CG  1 
ATOM   6184 C  CD  . LYS D 2 81  ? 56.342 105.771 55.842 1.00 49.27  ? 568  LYS D CD  1 
ATOM   6185 C  CE  . LYS D 2 81  ? 56.684 106.984 54.964 1.00 57.01  ? 568  LYS D CE  1 
ATOM   6186 N  NZ  . LYS D 2 81  ? 56.356 108.311 55.611 1.00 57.17  ? 568  LYS D NZ  1 
ATOM   6187 N  N   . GLN D 2 82  ? 52.445 104.713 52.893 1.00 23.09  ? 569  GLN D N   1 
ATOM   6188 C  CA  . GLN D 2 82  ? 52.029 105.569 51.787 1.00 20.48  ? 569  GLN D CA  1 
ATOM   6189 C  C   . GLN D 2 82  ? 50.545 105.919 51.897 1.00 26.10  ? 569  GLN D C   1 
ATOM   6190 O  O   . GLN D 2 82  ? 50.138 107.085 51.618 1.00 22.08  ? 569  GLN D O   1 
ATOM   6191 C  CB  . GLN D 2 82  ? 52.300 104.898 50.425 1.00 24.82  ? 569  GLN D CB  1 
ATOM   6192 C  CG  . GLN D 2 82  ? 53.783 104.714 50.008 1.00 30.57  ? 569  GLN D CG  1 
ATOM   6193 C  CD  . GLN D 2 82  ? 53.967 103.733 48.831 1.00 31.54  ? 569  GLN D CD  1 
ATOM   6194 O  OE1 . GLN D 2 82  ? 53.206 102.772 48.664 1.00 25.33  ? 569  GLN D OE1 1 
ATOM   6195 N  NE2 . GLN D 2 82  ? 54.988 103.971 48.024 1.00 33.12  ? 569  GLN D NE2 1 
ATOM   6196 N  N   . ARG D 2 83  ? 49.744 104.899 52.244 1.00 22.29  ? 570  ARG D N   1 
ATOM   6197 C  CA  . ARG D 2 83  ? 48.301 105.094 52.383 1.00 22.77  ? 570  ARG D CA  1 
ATOM   6198 C  C   . ARG D 2 83  ? 47.964 105.911 53.600 1.00 25.35  ? 570  ARG D C   1 
ATOM   6199 O  O   . ARG D 2 83  ? 46.978 106.635 53.592 1.00 20.15  ? 570  ARG D O   1 
ATOM   6200 C  CB  . ARG D 2 83  ? 47.540 103.766 52.374 1.00 23.08  ? 570  ARG D CB  1 
ATOM   6201 C  CG  . ARG D 2 83  ? 47.382 103.195 50.962 1.00 24.66  ? 570  ARG D CG  1 
ATOM   6202 C  CD  . ARG D 2 83  ? 46.739 101.816 50.949 1.00 22.44  ? 570  ARG D CD  1 
ATOM   6203 N  NE  . ARG D 2 83  ? 47.747 100.761 51.050 1.00 26.00  ? 570  ARG D NE  1 
ATOM   6204 C  CZ  . ARG D 2 83  ? 47.740 99.809  51.970 1.00 24.64  ? 570  ARG D CZ  1 
ATOM   6205 N  NH1 . ARG D 2 83  ? 46.780 99.772  52.890 1.00 28.90  ? 570  ARG D NH1 1 
ATOM   6206 N  NH2 . ARG D 2 83  ? 48.654 98.855  51.924 1.00 18.07  ? 570  ARG D NH2 1 
ATOM   6207 N  N   . ILE D 2 84  ? 48.755 105.801 54.665 1.00 27.46  ? 571  ILE D N   1 
ATOM   6208 C  CA  . ILE D 2 84  ? 48.478 106.604 55.852 1.00 28.75  ? 571  ILE D CA  1 
ATOM   6209 C  C   . ILE D 2 84  ? 48.851 108.071 55.511 1.00 30.41  ? 571  ILE D C   1 
ATOM   6210 O  O   . ILE D 2 84  ? 48.163 109.024 55.886 1.00 31.33  ? 571  ILE D O   1 
ATOM   6211 C  CB  . ILE D 2 84  ? 49.275 106.091 57.086 1.00 26.36  ? 571  ILE D CB  1 
ATOM   6212 C  CG1 . ILE D 2 84  ? 48.745 104.745 57.525 1.00 29.81  ? 571  ILE D CG1 1 
ATOM   6213 C  CG2 . ILE D 2 84  ? 49.078 107.006 58.275 1.00 28.29  ? 571  ILE D CG2 1 
ATOM   6214 C  CD1 . ILE D 2 84  ? 49.526 104.114 58.620 1.00 24.76  ? 571  ILE D CD1 1 
ATOM   6215 N  N   . ASP D 2 85  ? 49.871 108.257 54.694 1.00 31.27  ? 572  ASP D N   1 
ATOM   6216 C  CA  . ASP D 2 85  ? 50.256 109.611 54.348 1.00 30.06  ? 572  ASP D CA  1 
ATOM   6217 C  C   . ASP D 2 85  ? 49.199 110.236 53.464 1.00 30.85  ? 572  ASP D C   1 
ATOM   6218 O  O   . ASP D 2 85  ? 48.911 111.425 53.577 1.00 30.85  ? 572  ASP D O   1 
ATOM   6219 C  CB  . ASP D 2 85  ? 51.612 109.637 53.647 1.00 39.06  ? 572  ASP D CB  1 
ATOM   6220 C  CG  . ASP D 2 85  ? 52.765 109.302 54.579 1.00 45.12  ? 572  ASP D CG  1 
ATOM   6221 O  OD1 . ASP D 2 85  ? 53.848 108.972 54.055 1.00 43.13  ? 572  ASP D OD1 1 
ATOM   6222 O  OD2 . ASP D 2 85  ? 52.589 109.338 55.819 1.00 51.99  ? 572  ASP D OD2 1 
ATOM   6223 N  N   . GLU D 2 86  ? 48.668 109.467 52.523 1.00 29.87  ? 573  GLU D N   1 
ATOM   6224 C  CA  . GLU D 2 86  ? 47.632 110.021 51.668 1.00 30.30  ? 573  GLU D CA  1 
ATOM   6225 C  C   . GLU D 2 86  ? 46.437 110.434 52.529 1.00 25.40  ? 573  GLU D C   1 
ATOM   6226 O  O   . GLU D 2 86  ? 45.815 111.467 52.272 1.00 24.35  ? 573  GLU D O   1 
ATOM   6227 C  CB  . GLU D 2 86  ? 47.159 109.016 50.629 1.00 29.96  ? 573  GLU D CB  1 
ATOM   6228 C  CG  . GLU D 2 86  ? 46.283 109.739 49.618 1.00 40.19  ? 573  GLU D CG  1 
ATOM   6229 C  CD  . GLU D 2 86  ? 45.744 108.858 48.527 1.00 48.31  ? 573  GLU D CD  1 
ATOM   6230 O  OE1 . GLU D 2 86  ? 46.347 107.785 48.265 1.00 46.08  ? 573  GLU D OE1 1 
ATOM   6231 O  OE2 . GLU D 2 86  ? 44.713 109.255 47.929 1.00 51.89  ? 573  GLU D OE2 1 
ATOM   6232 N  N   . PHE D 2 87  ? 46.122 109.612 53.537 1.00 23.50  ? 574  PHE D N   1 
ATOM   6233 C  CA  . PHE D 2 87  ? 45.028 109.889 54.443 1.00 22.94  ? 574  PHE D CA  1 
ATOM   6234 C  C   . PHE D 2 87  ? 45.230 111.217 55.159 1.00 31.30  ? 574  PHE D C   1 
ATOM   6235 O  O   . PHE D 2 87  ? 44.290 112.020 55.254 1.00 26.04  ? 574  PHE D O   1 
ATOM   6236 C  CB  . PHE D 2 87  ? 44.911 108.793 55.476 1.00 23.23  ? 574  PHE D CB  1 
ATOM   6237 C  CG  . PHE D 2 87  ? 44.030 109.159 56.639 1.00 29.38  ? 574  PHE D CG  1 
ATOM   6238 C  CD1 . PHE D 2 87  ? 42.636 109.335 56.455 1.00 27.10  ? 574  PHE D CD1 1 
ATOM   6239 C  CD2 . PHE D 2 87  ? 44.569 109.263 57.935 1.00 27.12  ? 574  PHE D CD2 1 
ATOM   6240 C  CE1 . PHE D 2 87  ? 41.779 109.595 57.550 1.00 23.23  ? 574  PHE D CE1 1 
ATOM   6241 C  CE2 . PHE D 2 87  ? 43.742 109.524 59.051 1.00 25.94  ? 574  PHE D CE2 1 
ATOM   6242 C  CZ  . PHE D 2 87  ? 42.332 109.689 58.868 1.00 22.01  ? 574  PHE D CZ  1 
ATOM   6243 N  N   . GLU D 2 88  ? 46.448 111.450 55.669 1.00 32.90  ? 575  GLU D N   1 
ATOM   6244 C  CA  . GLU D 2 88  ? 46.746 112.707 56.362 1.00 31.11  ? 575  GLU D CA  1 
ATOM   6245 C  C   . GLU D 2 88  ? 46.696 113.875 55.397 1.00 31.77  ? 575  GLU D C   1 
ATOM   6246 O  O   . GLU D 2 88  ? 46.315 114.971 55.780 1.00 32.67  ? 575  GLU D O   1 
ATOM   6247 C  CB  . GLU D 2 88  ? 48.104 112.667 57.096 1.00 30.13  ? 575  GLU D CB  1 
ATOM   6248 C  CG  . GLU D 2 88  ? 48.283 111.599 58.225 1.00 24.06  ? 575  GLU D CG  1 
ATOM   6249 C  CD  . GLU D 2 88  ? 47.259 111.660 59.414 1.00 27.87  ? 575  GLU D CD  1 
ATOM   6250 O  OE1 . GLU D 2 88  ? 47.355 110.805 60.344 1.00 29.33  ? 575  GLU D OE1 1 
ATOM   6251 O  OE2 . GLU D 2 88  ? 46.346 112.520 59.405 1.00 28.88  ? 575  GLU D OE2 1 
ATOM   6252 N  N   . SER D 2 89  ? 47.022 113.639 54.131 1.00 32.02  ? 576  SER D N   1 
ATOM   6253 C  CA  . SER D 2 89  ? 46.992 114.724 53.151 1.00 36.39  ? 576  SER D CA  1 
ATOM   6254 C  C   . SER D 2 89  ? 45.596 115.018 52.620 1.00 30.77  ? 576  SER D C   1 
ATOM   6255 O  O   . SER D 2 89  ? 45.420 115.992 51.909 1.00 31.64  ? 576  SER D O   1 
ATOM   6256 C  CB  . SER D 2 89  ? 47.972 114.473 51.990 1.00 37.35  ? 576  SER D CB  1 
ATOM   6257 O  OG  . SER D 2 89  ? 47.376 113.696 50.964 1.00 50.58  ? 576  SER D OG  1 
HETATM 6258 N  N   . MSE D 2 90  ? 44.601 114.202 52.976 1.00 31.56  ? 577  MSE D N   1 
HETATM 6259 C  CA  . MSE D 2 90  ? 43.230 114.435 52.512 1.00 32.69  ? 577  MSE D CA  1 
HETATM 6260 C  C   . MSE D 2 90  ? 42.516 115.597 53.209 1.00 33.90  ? 577  MSE D C   1 
HETATM 6261 O  O   . MSE D 2 90  ? 41.403 115.959 52.750 1.00 37.45  ? 577  MSE D O   1 
HETATM 6262 O  OXT . MSE D 2 90  ? 43.044 116.109 54.220 1.00 37.77  ? 577  MSE D OXT 1 
HETATM 6263 C  CB  . MSE D 2 90  ? 42.402 113.144 52.661 1.00 32.40  ? 577  MSE D CB  1 
HETATM 6264 C  CG  . MSE D 2 90  ? 42.542 112.212 51.463 1.00 35.25  ? 577  MSE D CG  1 
HETATM 6265 SE SE  . MSE D 2 90  ? 41.771 110.518 51.736 1.00 36.48  ? 577  MSE D SE  1 
HETATM 6266 C  CE  . MSE D 2 90  ? 39.951 110.889 50.957 1.00 35.67  ? 577  MSE D CE  1 
HETATM 6267 S  S   . SO4 E 3 .   ? 42.295 153.297 56.040 0.50 26.42  ? 2001 SO4 A S   1 
HETATM 6268 O  O1  . SO4 E 3 .   ? 41.605 153.154 54.833 0.50 32.39  ? 2001 SO4 A O1  1 
HETATM 6269 O  O2  . SO4 E 3 .   ? 43.068 154.460 55.962 0.50 32.01  ? 2001 SO4 A O2  1 
HETATM 6270 O  O3  . SO4 E 3 .   ? 41.319 153.439 57.048 0.50 34.93  ? 2001 SO4 A O3  1 
HETATM 6271 O  O4  . SO4 E 3 .   ? 43.005 152.117 56.268 0.50 31.17  ? 2001 SO4 A O4  1 
HETATM 6272 S  S   . SO4 F 3 .   ? 14.775 76.909  56.040 0.50 38.75  ? 3001 SO4 B S   1 
HETATM 6273 O  O1  . SO4 F 3 .   ? 15.707 76.942  54.966 0.50 41.94  ? 3001 SO4 B O1  1 
HETATM 6274 O  O2  . SO4 F 3 .   ? 13.748 76.087  55.546 0.50 40.24  ? 3001 SO4 B O2  1 
HETATM 6275 O  O3  . SO4 F 3 .   ? 15.231 76.213  57.223 0.50 37.54  ? 3001 SO4 B O3  1 
HETATM 6276 O  O4  . SO4 F 3 .   ? 14.538 78.294  56.334 0.50 35.70  ? 3001 SO4 B O4  1 
HETATM 6277 O  O   . HOH G 4 .   ? 43.363 130.864 68.734 1.00 62.43  ? 600  HOH A O   1 
HETATM 6278 O  O   . HOH G 4 .   ? 42.167 138.893 60.787 1.00 20.42  ? 601  HOH A O   1 
HETATM 6279 O  O   . HOH G 4 .   ? 43.366 135.352 62.624 1.00 24.49  ? 602  HOH A O   1 
HETATM 6280 O  O   . HOH G 4 .   ? 31.334 132.897 61.305 1.00 15.31  ? 603  HOH A O   1 
HETATM 6281 O  O   . HOH G 4 .   ? 28.422 134.659 59.875 1.00 21.99  ? 604  HOH A O   1 
HETATM 6282 O  O   . HOH G 4 .   ? 31.463 130.971 63.712 1.00 28.44  ? 605  HOH A O   1 
HETATM 6283 O  O   . HOH G 4 .   ? 26.616 139.976 58.238 1.00 23.89  ? 606  HOH A O   1 
HETATM 6284 O  O   . HOH G 4 .   ? 30.698 139.760 50.870 1.00 18.17  ? 607  HOH A O   1 
HETATM 6285 O  O   . HOH G 4 .   ? 40.240 138.283 59.003 1.00 17.04  ? 608  HOH A O   1 
HETATM 6286 O  O   . HOH G 4 .   ? 38.790 126.339 46.438 1.00 13.98  ? 609  HOH A O   1 
HETATM 6287 O  O   . HOH G 4 .   ? 43.567 130.328 44.185 1.00 13.00  ? 611  HOH A O   1 
HETATM 6288 O  O   . HOH G 4 .   ? 56.373 145.703 41.484 1.00 35.36  ? 612  HOH A O   1 
HETATM 6289 O  O   . HOH G 4 .   ? 31.574 127.781 42.336 1.00 32.95  ? 614  HOH A O   1 
HETATM 6290 O  O   . HOH G 4 .   ? 31.771 127.636 46.337 1.00 13.49  ? 615  HOH A O   1 
HETATM 6291 O  O   . HOH G 4 .   ? 26.719 133.541 51.504 1.00 38.56  ? 616  HOH A O   1 
HETATM 6292 O  O   . HOH G 4 .   ? 27.441 120.398 62.929 1.00 42.80  ? 617  HOH A O   1 
HETATM 6293 O  O   . HOH G 4 .   ? 20.774 132.876 52.814 1.00 24.57  ? 619  HOH A O   1 
HETATM 6294 O  O   . HOH G 4 .   ? 25.361 128.475 49.102 1.00 16.92  ? 620  HOH A O   1 
HETATM 6295 O  O   . HOH G 4 .   ? 22.046 120.597 48.506 1.00 17.26  ? 621  HOH A O   1 
HETATM 6296 O  O   . HOH G 4 .   ? 20.830 114.811 51.510 1.00 19.41  ? 622  HOH A O   1 
HETATM 6297 O  O   . HOH G 4 .   ? 14.976 139.282 54.927 1.00 33.47  ? 626  HOH A O   1 
HETATM 6298 O  O   . HOH G 4 .   ? 47.632 134.216 68.932 1.00 28.16  ? 629  HOH A O   1 
HETATM 6299 O  O   . HOH G 4 .   ? 46.407 143.038 61.274 1.00 27.76  ? 630  HOH A O   1 
HETATM 6300 O  O   . HOH G 4 .   ? 49.675 136.316 61.492 1.00 41.10  ? 631  HOH A O   1 
HETATM 6301 O  O   . HOH G 4 .   ? 48.583 144.405 58.850 1.00 44.38  ? 632  HOH A O   1 
HETATM 6302 O  O   . HOH G 4 .   ? 34.657 137.669 69.854 1.00 29.98  ? 633  HOH A O   1 
HETATM 6303 O  O   . HOH G 4 .   ? 45.547 129.872 75.186 1.00 33.55  ? 634  HOH A O   1 
HETATM 6304 O  O   . HOH G 4 .   ? 43.107 133.135 61.845 1.00 32.69  ? 635  HOH A O   1 
HETATM 6305 O  O   . HOH G 4 .   ? 35.961 131.622 61.663 1.00 26.57  ? 636  HOH A O   1 
HETATM 6306 O  O   . HOH G 4 .   ? 34.131 133.213 60.656 1.00 23.69  ? 637  HOH A O   1 
HETATM 6307 O  O   . HOH G 4 .   ? 36.513 128.609 60.212 1.00 100.00 ? 638  HOH A O   1 
HETATM 6308 O  O   . HOH G 4 .   ? 31.198 126.420 58.295 1.00 21.14  ? 639  HOH A O   1 
HETATM 6309 O  O   . HOH G 4 .   ? 33.125 125.818 54.412 1.00 29.93  ? 640  HOH A O   1 
HETATM 6310 O  O   . HOH G 4 .   ? 34.220 132.581 53.212 1.00 35.79  ? 641  HOH A O   1 
HETATM 6311 O  O   . HOH G 4 .   ? 33.689 130.161 54.802 1.00 28.90  ? 642  HOH A O   1 
HETATM 6312 O  O   . HOH G 4 .   ? 34.993 126.622 56.986 1.00 49.26  ? 643  HOH A O   1 
HETATM 6313 O  O   . HOH G 4 .   ? 31.672 128.591 53.647 1.00 17.65  ? 644  HOH A O   1 
HETATM 6314 O  O   . HOH G 4 .   ? 27.954 137.525 48.394 1.00 26.99  ? 645  HOH A O   1 
HETATM 6315 O  O   . HOH G 4 .   ? 26.411 136.715 50.563 1.00 71.78  ? 646  HOH A O   1 
HETATM 6316 O  O   . HOH G 4 .   ? 28.511 137.084 52.810 1.00 29.16  ? 647  HOH A O   1 
HETATM 6317 O  O   . HOH G 4 .   ? 27.876 135.494 55.167 1.00 21.75  ? 648  HOH A O   1 
HETATM 6318 O  O   . HOH G 4 .   ? 27.954 136.688 57.811 1.00 19.82  ? 649  HOH A O   1 
HETATM 6319 O  O   . HOH G 4 .   ? 23.853 140.076 57.724 1.00 21.90  ? 650  HOH A O   1 
HETATM 6320 O  O   . HOH G 4 .   ? 23.840 145.250 50.962 1.00 46.68  ? 651  HOH A O   1 
HETATM 6321 O  O   . HOH G 4 .   ? 30.291 151.022 54.095 1.00 31.83  ? 652  HOH A O   1 
HETATM 6322 O  O   . HOH G 4 .   ? 43.818 132.455 45.775 1.00 18.27  ? 653  HOH A O   1 
HETATM 6323 O  O   . HOH G 4 .   ? 46.612 132.744 45.798 1.00 27.87  ? 654  HOH A O   1 
HETATM 6324 O  O   . HOH G 4 .   ? 49.191 136.494 51.454 1.00 40.26  ? 655  HOH A O   1 
HETATM 6325 O  O   . HOH G 4 .   ? 42.231 121.197 47.438 1.00 27.59  ? 656  HOH A O   1 
HETATM 6326 O  O   . HOH G 4 .   ? 35.674 121.650 47.537 1.00 25.32  ? 657  HOH A O   1 
HETATM 6327 O  O   . HOH G 4 .   ? 34.053 121.547 50.925 1.00 51.65  ? 658  HOH A O   1 
HETATM 6328 O  O   . HOH G 4 .   ? 34.123 122.872 54.111 1.00 31.03  ? 659  HOH A O   1 
HETATM 6329 O  O   . HOH G 4 .   ? 38.664 121.993 40.519 1.00 24.64  ? 660  HOH A O   1 
HETATM 6330 O  O   . HOH G 4 .   ? 33.916 132.021 39.700 1.00 31.11  ? 661  HOH A O   1 
HETATM 6331 O  O   . HOH G 4 .   ? 31.295 129.799 40.479 1.00 26.96  ? 662  HOH A O   1 
HETATM 6332 O  O   . HOH G 4 .   ? 32.397 133.095 37.696 1.00 42.20  ? 663  HOH A O   1 
HETATM 6333 O  O   . HOH G 4 .   ? 33.089 133.971 41.407 1.00 36.68  ? 664  HOH A O   1 
HETATM 6334 O  O   . HOH G 4 .   ? 31.649 136.624 39.726 1.00 29.85  ? 665  HOH A O   1 
HETATM 6335 O  O   . HOH G 4 .   ? 51.652 143.305 36.809 1.00 20.91  ? 666  HOH A O   1 
HETATM 6336 O  O   . HOH G 4 .   ? 57.473 142.796 44.123 1.00 33.34  ? 667  HOH A O   1 
HETATM 6337 O  O   . HOH G 4 .   ? 60.914 132.336 45.242 1.00 24.64  ? 668  HOH A O   1 
HETATM 6338 O  O   . HOH G 4 .   ? 57.461 133.014 46.283 1.00 29.95  ? 669  HOH A O   1 
HETATM 6339 O  O   . HOH G 4 .   ? 50.983 131.605 50.288 1.00 38.06  ? 670  HOH A O   1 
HETATM 6340 O  O   . HOH G 4 .   ? 44.385 122.732 49.089 1.00 24.35  ? 671  HOH A O   1 
HETATM 6341 O  O   . HOH G 4 .   ? 49.073 120.708 38.478 1.00 35.56  ? 672  HOH A O   1 
HETATM 6342 O  O   . HOH G 4 .   ? 41.560 116.394 44.481 1.00 35.12  ? 673  HOH A O   1 
HETATM 6343 O  O   . HOH G 4 .   ? 57.965 131.554 39.562 1.00 33.09  ? 674  HOH A O   1 
HETATM 6344 O  O   . HOH G 4 .   ? 49.767 149.741 44.268 1.00 47.72  ? 675  HOH A O   1 
HETATM 6345 O  O   . HOH G 4 .   ? 30.565 140.245 43.347 1.00 26.96  ? 676  HOH A O   1 
HETATM 6346 O  O   . HOH G 4 .   ? 25.356 128.224 41.123 1.00 28.21  ? 678  HOH A O   1 
HETATM 6347 O  O   . HOH G 4 .   ? 24.008 128.288 45.230 1.00 23.30  ? 679  HOH A O   1 
HETATM 6348 O  O   . HOH G 4 .   ? 23.813 130.765 48.878 1.00 24.08  ? 681  HOH A O   1 
HETATM 6349 O  O   . HOH G 4 .   ? 22.786 132.877 50.630 1.00 37.23  ? 682  HOH A O   1 
HETATM 6350 O  O   . HOH G 4 .   ? 29.741 122.804 61.761 1.00 38.58  ? 683  HOH A O   1 
HETATM 6351 O  O   . HOH G 4 .   ? 20.570 110.699 56.262 1.00 35.53  ? 685  HOH A O   1 
HETATM 6352 O  O   . HOH G 4 .   ? 16.266 108.889 56.557 1.00 53.67  ? 686  HOH A O   1 
HETATM 6353 O  O   . HOH G 4 .   ? 31.545 120.326 50.207 1.00 29.26  ? 687  HOH A O   1 
HETATM 6354 O  O   . HOH G 4 .   ? 23.432 121.387 42.592 1.00 19.14  ? 688  HOH A O   1 
HETATM 6355 O  O   . HOH G 4 .   ? 12.788 139.057 61.154 1.00 31.55  ? 691  HOH A O   1 
HETATM 6356 O  O   . HOH G 4 .   ? 22.018 116.271 64.381 1.00 34.61  ? 692  HOH A O   1 
HETATM 6357 O  O   . HOH G 4 .   ? 24.552 131.229 71.921 1.00 36.84  ? 693  HOH A O   1 
HETATM 6358 O  O   . HOH G 4 .   ? 25.162 137.108 68.282 1.00 31.44  ? 694  HOH A O   1 
HETATM 6359 O  O   . HOH G 4 .   ? 24.868 146.569 59.174 1.00 29.35  ? 695  HOH A O   1 
HETATM 6360 O  O   . HOH G 4 .   ? 27.310 144.739 58.784 1.00 41.18  ? 696  HOH A O   1 
HETATM 6361 O  O   . HOH G 4 .   ? 16.334 152.772 53.630 1.00 34.74  ? 697  HOH A O   1 
HETATM 6362 O  O   . HOH G 4 .   ? 19.748 149.938 63.245 1.00 45.83  ? 698  HOH A O   1 
HETATM 6363 O  O   . HOH G 4 .   ? 28.011 126.204 40.816 1.00 21.09  ? 708  HOH A O   1 
HETATM 6364 O  O   . HOH G 4 .   ? 18.333 124.404 44.499 1.00 26.90  ? 721  HOH A O   1 
HETATM 6365 O  O   . HOH G 4 .   ? 53.220 141.276 63.866 1.00 32.31  ? 722  HOH A O   1 
HETATM 6366 O  O   . HOH G 4 .   ? 46.947 147.567 61.424 1.00 38.41  ? 723  HOH A O   1 
HETATM 6367 O  O   . HOH G 4 .   ? 49.427 149.147 63.517 1.00 54.09  ? 724  HOH A O   1 
HETATM 6368 O  O   . HOH G 4 .   ? 44.180 151.641 60.094 1.00 58.27  ? 725  HOH A O   1 
HETATM 6369 O  O   . HOH G 4 .   ? 44.498 150.617 57.506 1.00 38.06  ? 726  HOH A O   1 
HETATM 6370 O  O   . HOH G 4 .   ? 40.486 153.369 65.500 1.00 36.43  ? 727  HOH A O   1 
HETATM 6371 O  O   . HOH G 4 .   ? 31.978 137.355 68.614 1.00 38.06  ? 728  HOH A O   1 
HETATM 6372 O  O   . HOH G 4 .   ? 32.479 126.066 71.237 1.00 44.58  ? 729  HOH A O   1 
HETATM 6373 O  O   . HOH G 4 .   ? 30.999 130.215 70.242 1.00 24.88  ? 730  HOH A O   1 
HETATM 6374 O  O   . HOH G 4 .   ? 31.220 144.457 44.710 1.00 38.91  ? 731  HOH A O   1 
HETATM 6375 O  O   . HOH G 4 .   ? 31.438 150.843 57.140 1.00 32.81  ? 732  HOH A O   1 
HETATM 6376 O  O   . HOH G 4 .   ? 45.396 134.308 52.915 1.00 31.09  ? 733  HOH A O   1 
HETATM 6377 O  O   . HOH G 4 .   ? 47.393 134.860 55.244 1.00 39.67  ? 734  HOH A O   1 
HETATM 6378 O  O   . HOH G 4 .   ? 48.229 133.485 48.003 1.00 32.71  ? 735  HOH A O   1 
HETATM 6379 O  O   . HOH G 4 .   ? 39.986 131.157 56.506 1.00 31.15  ? 736  HOH A O   1 
HETATM 6380 O  O   . HOH G 4 .   ? 45.312 128.136 53.001 1.00 37.53  ? 737  HOH A O   1 
HETATM 6381 O  O   . HOH G 4 .   ? 38.158 121.575 53.291 1.00 33.40  ? 738  HOH A O   1 
HETATM 6382 O  O   . HOH G 4 .   ? 41.489 126.954 56.694 1.00 49.54  ? 739  HOH A O   1 
HETATM 6383 O  O   . HOH G 4 .   ? 48.284 137.974 48.215 1.00 28.52  ? 740  HOH A O   1 
HETATM 6384 O  O   . HOH G 4 .   ? 48.904 140.536 49.512 1.00 29.25  ? 741  HOH A O   1 
HETATM 6385 O  O   . HOH G 4 .   ? 59.789 136.161 45.551 1.00 30.15  ? 742  HOH A O   1 
HETATM 6386 O  O   . HOH G 4 .   ? 60.251 138.150 43.777 1.00 40.00  ? 743  HOH A O   1 
HETATM 6387 O  O   . HOH G 4 .   ? 64.504 134.780 35.334 1.00 43.93  ? 744  HOH A O   1 
HETATM 6388 O  O   . HOH G 4 .   ? 53.929 128.358 44.057 1.00 36.76  ? 745  HOH A O   1 
HETATM 6389 O  O   . HOH G 4 .   ? 49.961 126.737 44.788 1.00 27.06  ? 746  HOH A O   1 
HETATM 6390 O  O   . HOH G 4 .   ? 50.326 125.155 46.784 1.00 65.05  ? 747  HOH A O   1 
HETATM 6391 O  O   . HOH G 4 .   ? 43.805 143.429 34.968 1.00 38.64  ? 749  HOH A O   1 
HETATM 6392 O  O   . HOH G 4 .   ? 43.520 146.255 34.688 1.00 45.05  ? 750  HOH A O   1 
HETATM 6393 O  O   . HOH G 4 .   ? 42.764 143.479 31.849 1.00 40.34  ? 751  HOH A O   1 
HETATM 6394 O  O   . HOH G 4 .   ? 44.030 150.020 40.239 1.00 33.59  ? 752  HOH A O   1 
HETATM 6395 O  O   . HOH G 4 .   ? 27.053 132.571 42.028 1.00 29.06  ? 753  HOH A O   1 
HETATM 6396 O  O   . HOH G 4 .   ? 28.335 130.795 40.229 1.00 39.09  ? 754  HOH A O   1 
HETATM 6397 O  O   . HOH G 4 .   ? 20.835 112.673 53.869 1.00 28.34  ? 755  HOH A O   1 
HETATM 6398 O  O   . HOH G 4 .   ? 24.451 109.956 56.425 1.00 42.58  ? 756  HOH A O   1 
HETATM 6399 O  O   . HOH G 4 .   ? 17.748 131.756 52.441 1.00 24.89  ? 757  HOH A O   1 
HETATM 6400 O  O   . HOH G 4 .   ? 18.541 122.182 43.033 1.00 36.34  ? 759  HOH A O   1 
HETATM 6401 O  O   . HOH G 4 .   ? 15.855 121.762 40.926 1.00 57.06  ? 760  HOH A O   1 
HETATM 6402 O  O   . HOH G 4 .   ? 9.196  138.232 53.396 1.00 39.51  ? 761  HOH A O   1 
HETATM 6403 O  O   . HOH G 4 .   ? 20.735 115.461 68.130 1.00 53.74  ? 762  HOH A O   1 
HETATM 6404 O  O   . HOH G 4 .   ? 39.476 121.780 31.965 1.00 39.70  ? 771  HOH A O   1 
HETATM 6405 O  O   . HOH G 4 .   ? 16.881 137.674 53.928 1.00 37.68  ? 778  HOH A O   1 
HETATM 6406 O  O   . HOH G 4 .   ? 57.517 117.877 34.620 1.00 65.37  ? 784  HOH A O   1 
HETATM 6407 O  O   . HOH G 4 .   ? 48.951 116.795 38.376 1.00 71.46  ? 789  HOH A O   1 
HETATM 6408 O  O   . HOH G 4 .   ? 57.140 147.407 45.881 1.00 64.65  ? 792  HOH A O   1 
HETATM 6409 O  O   . HOH G 4 .   ? 53.411 141.871 50.088 1.00 41.76  ? 793  HOH A O   1 
HETATM 6410 O  O   . HOH G 4 .   ? 36.500 133.214 54.271 1.00 48.24  ? 795  HOH A O   1 
HETATM 6411 O  O   . HOH G 4 .   ? 28.462 146.997 56.629 1.00 30.92  ? 796  HOH A O   1 
HETATM 6412 O  O   . HOH G 4 .   ? 36.659 131.808 57.609 1.00 38.11  ? 797  HOH A O   1 
HETATM 6413 O  O   . HOH G 4 .   ? 43.985 125.987 62.818 1.00 43.92  ? 798  HOH A O   1 
HETATM 6414 O  O   . HOH G 4 .   ? 16.212 113.406 64.359 1.00 51.29  ? 799  HOH A O   1 
HETATM 6415 O  O   . HOH G 4 .   ? 31.152 140.392 66.202 1.00 49.54  ? 800  HOH A O   1 
HETATM 6416 O  O   . HOH G 4 .   ? 51.325 138.764 75.731 1.00 74.48  ? 801  HOH A O   1 
HETATM 6417 O  O   . HOH G 4 .   ? 11.301 129.174 68.708 1.00 44.33  ? 804  HOH A O   1 
HETATM 6418 O  O   . HOH G 4 .   ? 40.251 122.436 34.373 1.00 37.19  ? 805  HOH A O   1 
HETATM 6419 O  O   . HOH G 4 .   ? 23.574 112.631 46.185 1.00 15.95  ? 1702 HOH A O   1 
HETATM 6420 O  O   . HOH G 4 .   ? 22.968 115.978 45.385 1.00 22.66  ? 1703 HOH A O   1 
HETATM 6421 O  O   . HOH G 4 .   ? 28.338 112.620 51.812 1.00 33.74  ? 1758 HOH A O   1 
HETATM 6422 O  O   . HOH H 4 .   ? 38.919 124.763 30.970 1.00 35.00  ? 610  HOH C O   1 
HETATM 6423 O  O   . HOH H 4 .   ? 47.778 129.780 31.219 1.00 38.85  ? 613  HOH C O   1 
HETATM 6424 O  O   . HOH H 4 .   ? 12.126 118.014 61.855 1.00 31.45  ? 618  HOH C O   1 
HETATM 6425 O  O   . HOH H 4 .   ? 29.257 119.449 48.368 1.00 27.50  ? 623  HOH C O   1 
HETATM 6426 O  O   . HOH H 4 .   ? 23.497 127.430 42.844 1.00 19.20  ? 624  HOH C O   1 
HETATM 6427 O  O   . HOH H 4 .   ? 15.075 119.822 44.841 1.00 72.02  ? 625  HOH C O   1 
HETATM 6428 O  O   . HOH H 4 .   ? 11.714 133.972 46.183 1.00 34.80  ? 627  HOH C O   1 
HETATM 6429 O  O   . HOH H 4 .   ? 35.846 119.390 45.611 1.00 23.68  ? 628  HOH C O   1 
HETATM 6430 O  O   . HOH H 4 .   ? 27.195 140.193 43.503 1.00 30.00  ? 677  HOH C O   1 
HETATM 6431 O  O   . HOH H 4 .   ? 22.363 130.057 46.606 1.00 21.72  ? 680  HOH C O   1 
HETATM 6432 O  O   . HOH H 4 .   ? 11.544 114.670 58.692 1.00 28.10  ? 684  HOH C O   1 
HETATM 6433 O  O   . HOH H 4 .   ? 20.909 120.611 42.369 1.00 19.78  ? 689  HOH C O   1 
HETATM 6434 O  O   . HOH H 4 .   ? 10.577 133.652 51.017 1.00 37.26  ? 699  HOH C O   1 
HETATM 6435 O  O   . HOH H 4 .   ? 33.228 134.213 31.253 1.00 28.34  ? 700  HOH C O   1 
HETATM 6436 O  O   . HOH H 4 .   ? 24.194 120.158 40.040 1.00 23.00  ? 704  HOH C O   1 
HETATM 6437 O  O   . HOH H 4 .   ? 33.310 128.113 36.284 1.00 38.39  ? 705  HOH C O   1 
HETATM 6438 O  O   . HOH H 4 .   ? 28.960 117.611 35.937 1.00 18.44  ? 706  HOH C O   1 
HETATM 6439 O  O   . HOH H 4 .   ? 27.421 118.567 33.822 1.00 22.69  ? 707  HOH C O   1 
HETATM 6440 O  O   . HOH H 4 .   ? 26.579 127.655 38.717 1.00 39.70  ? 710  HOH C O   1 
HETATM 6441 O  O   . HOH H 4 .   ? 19.217 119.358 31.149 1.00 28.06  ? 711  HOH C O   1 
HETATM 6442 O  O   . HOH H 4 .   ? 18.965 124.935 33.125 1.00 59.81  ? 712  HOH C O   1 
HETATM 6443 O  O   . HOH H 4 .   ? 17.382 124.602 37.491 1.00 34.56  ? 713  HOH C O   1 
HETATM 6444 O  O   . HOH H 4 .   ? 20.413 129.510 40.040 1.00 27.38  ? 714  HOH C O   1 
HETATM 6445 O  O   . HOH H 4 .   ? 15.402 131.590 40.652 1.00 37.75  ? 715  HOH C O   1 
HETATM 6446 O  O   . HOH H 4 .   ? 18.820 126.327 42.144 1.00 30.83  ? 716  HOH C O   1 
HETATM 6447 O  O   . HOH H 4 .   ? 5.598  117.800 57.347 1.00 38.12  ? 717  HOH C O   1 
HETATM 6448 O  O   . HOH H 4 .   ? 9.274  124.303 48.786 1.00 41.70  ? 718  HOH C O   1 
HETATM 6449 O  O   . HOH H 4 .   ? 12.052 116.957 49.005 1.00 63.15  ? 719  HOH C O   1 
HETATM 6450 O  O   . HOH H 4 .   ? 8.884  113.862 59.140 1.00 57.31  ? 720  HOH C O   1 
HETATM 6451 O  O   . HOH H 4 .   ? 45.737 116.685 30.118 1.00 84.72  ? 748  HOH C O   1 
HETATM 6452 O  O   . HOH H 4 .   ? 5.652  125.729 46.695 1.00 33.07  ? 763  HOH C O   1 
HETATM 6453 O  O   . HOH H 4 .   ? 0.544  125.464 52.467 1.00 36.30  ? 764  HOH C O   1 
HETATM 6454 O  O   . HOH H 4 .   ? 1.185  122.138 51.268 1.00 63.28  ? 765  HOH C O   1 
HETATM 6455 O  O   . HOH H 4 .   ? 3.033  129.037 55.090 1.00 37.29  ? 766  HOH C O   1 
HETATM 6456 O  O   . HOH H 4 .   ? 21.752 136.426 39.409 1.00 36.72  ? 767  HOH C O   1 
HETATM 6457 O  O   . HOH H 4 .   ? 25.144 130.121 35.356 1.00 40.57  ? 768  HOH C O   1 
HETATM 6458 O  O   . HOH H 4 .   ? 31.889 117.510 35.053 1.00 40.74  ? 769  HOH C O   1 
HETATM 6459 O  O   . HOH H 4 .   ? 39.568 113.218 42.461 1.00 34.51  ? 770  HOH C O   1 
HETATM 6460 O  O   . HOH H 4 .   ? 44.442 124.400 26.491 1.00 54.69  ? 772  HOH C O   1 
HETATM 6461 O  O   . HOH H 4 .   ? 47.234 126.465 26.616 1.00 36.30  ? 773  HOH C O   1 
HETATM 6462 O  O   . HOH H 4 .   ? 38.513 136.019 26.308 1.00 30.20  ? 774  HOH C O   1 
HETATM 6463 O  O   . HOH H 4 .   ? 35.962 137.300 25.092 1.00 100.00 ? 775  HOH C O   1 
HETATM 6464 O  O   . HOH H 4 .   ? 19.438 146.132 50.000 1.00 51.94  ? 776  HOH C O   1 
HETATM 6465 O  O   . HOH H 4 .   ? 21.003 147.038 51.859 1.00 33.79  ? 777  HOH C O   1 
HETATM 6466 O  O   . HOH H 4 .   ? 28.169 124.988 30.986 1.00 37.99  ? 779  HOH C O   1 
HETATM 6467 O  O   . HOH H 4 .   ? 28.741 119.858 31.866 1.00 55.45  ? 780  HOH C O   1 
HETATM 6468 O  O   . HOH H 4 .   ? 29.220 123.033 32.669 1.00 30.98  ? 781  HOH C O   1 
HETATM 6469 O  O   . HOH H 4 .   ? 26.370 129.120 33.280 1.00 37.90  ? 782  HOH C O   1 
HETATM 6470 O  O   . HOH H 4 .   ? 31.997 122.537 33.130 1.00 45.86  ? 783  HOH C O   1 
HETATM 6471 O  O   . HOH H 4 .   ? 33.597 121.563 37.313 1.00 38.75  ? 785  HOH C O   1 
HETATM 6472 O  O   . HOH H 4 .   ? 28.588 135.095 36.087 1.00 36.24  ? 786  HOH C O   1 
HETATM 6473 O  O   . HOH H 4 .   ? 36.710 121.462 37.638 1.00 24.59  ? 787  HOH C O   1 
HETATM 6474 O  O   . HOH H 4 .   ? 43.551 109.380 36.829 1.00 40.04  ? 788  HOH C O   1 
HETATM 6475 O  O   . HOH H 4 .   ? 23.591 143.752 40.239 1.00 64.46  ? 790  HOH C O   1 
HETATM 6476 O  O   . HOH H 4 .   ? 8.118  135.012 49.997 1.00 100.00 ? 794  HOH C O   1 
HETATM 6477 O  O   . HOH H 4 .   ? 38.836 131.589 24.375 1.00 49.79  ? 802  HOH C O   1 
HETATM 6478 O  O   . HOH H 4 .   ? 8.368  127.643 42.961 1.00 46.40  ? 803  HOH C O   1 
HETATM 6479 O  O   . HOH H 4 .   ? 36.560 111.883 42.339 1.00 39.56  ? 1690 HOH C O   1 
HETATM 6480 O  O   . HOH H 4 .   ? 38.767 110.336 39.859 1.00 45.23  ? 1791 HOH C O   1 
HETATM 6481 O  O   . HOH I 4 .   ? 33.766 117.213 46.412 1.00 19.24  ? 702  HOH B O   1 
HETATM 6482 O  O   . HOH I 4 .   ? 34.760 113.775 45.373 1.00 21.55  ? 703  HOH B O   1 
HETATM 6483 O  O   . HOH I 4 .   ? 29.281 117.532 51.887 1.00 33.82  ? 758  HOH B O   1 
HETATM 6484 O  O   . HOH I 4 .   ? 14.259 99.018  68.725 1.00 47.05  ? 1600 HOH B O   1 
HETATM 6485 O  O   . HOH I 4 .   ? 14.949 91.363  60.742 1.00 20.49  ? 1601 HOH B O   1 
HETATM 6486 O  O   . HOH I 4 .   ? 13.930 94.750  62.375 1.00 20.40  ? 1602 HOH B O   1 
HETATM 6487 O  O   . HOH I 4 .   ? 26.019 96.993  61.173 1.00 14.85  ? 1603 HOH B O   1 
HETATM 6488 O  O   . HOH I 4 .   ? 29.015 95.290  59.636 1.00 12.98  ? 1604 HOH B O   1 
HETATM 6489 O  O   . HOH I 4 .   ? 25.678 99.073  63.311 1.00 27.19  ? 1605 HOH B O   1 
HETATM 6490 O  O   . HOH I 4 .   ? 30.663 89.672  57.927 1.00 17.72  ? 1606 HOH B O   1 
HETATM 6491 O  O   . HOH I 4 .   ? 26.516 90.166  50.804 1.00 17.37  ? 1607 HOH B O   1 
HETATM 6492 O  O   . HOH I 4 .   ? 17.011 91.584  58.850 1.00 19.60  ? 1608 HOH B O   1 
HETATM 6493 O  O   . HOH I 4 .   ? 18.618 103.484 46.297 1.00 12.37  ? 1609 HOH B O   1 
HETATM 6494 O  O   . HOH I 4 .   ? 14.137 99.749  43.748 1.00 15.24  ? 1611 HOH B O   1 
HETATM 6495 O  O   . HOH I 4 .   ? 1.178  84.130  41.080 1.00 38.03  ? 1612 HOH B O   1 
HETATM 6496 O  O   . HOH I 4 .   ? 25.942 102.151 41.809 1.00 25.02  ? 1614 HOH B O   1 
HETATM 6497 O  O   . HOH I 4 .   ? 26.045 102.124 45.940 1.00 13.78  ? 1615 HOH B O   1 
HETATM 6498 O  O   . HOH I 4 .   ? 30.676 95.965  51.364 1.00 43.67  ? 1616 HOH B O   1 
HETATM 6499 O  O   . HOH I 4 .   ? 30.025 108.849 62.775 1.00 59.00  ? 1617 HOH B O   1 
HETATM 6500 O  O   . HOH I 4 .   ? 45.333 111.430 62.028 1.00 27.15  ? 1618 HOH B O   1 
HETATM 6501 O  O   . HOH I 4 .   ? 36.582 96.937  52.494 1.00 17.73  ? 1619 HOH B O   1 
HETATM 6502 O  O   . HOH I 4 .   ? 32.299 101.601 48.959 1.00 21.41  ? 1620 HOH B O   1 
HETATM 6503 O  O   . HOH I 4 .   ? 35.518 109.088 48.319 1.00 16.63  ? 1621 HOH B O   1 
HETATM 6504 O  O   . HOH I 4 .   ? 37.096 115.186 51.679 1.00 31.66  ? 1622 HOH B O   1 
HETATM 6505 O  O   . HOH I 4 .   ? 34.155 102.526 42.806 1.00 17.90  ? 1624 HOH B O   1 
HETATM 6506 O  O   . HOH I 4 .   ? 9.926  96.068  68.712 1.00 26.03  ? 1629 HOH B O   1 
HETATM 6507 O  O   . HOH I 4 .   ? 10.757 87.085  60.995 1.00 32.39  ? 1630 HOH B O   1 
HETATM 6508 O  O   . HOH I 4 .   ? 7.271  93.910  61.570 1.00 59.19  ? 1631 HOH B O   1 
HETATM 6509 O  O   . HOH I 4 .   ? 9.272  85.762  58.183 1.00 86.75  ? 1632 HOH B O   1 
HETATM 6510 O  O   . HOH I 4 .   ? 22.447 92.406  69.810 1.00 29.12  ? 1633 HOH B O   1 
HETATM 6511 O  O   . HOH I 4 .   ? 12.079 100.236 74.758 1.00 41.30  ? 1634 HOH B O   1 
HETATM 6512 O  O   . HOH I 4 .   ? 14.204 96.923  61.534 1.00 27.61  ? 1635 HOH B O   1 
HETATM 6513 O  O   . HOH I 4 .   ? 21.007 98.126  61.435 1.00 28.78  ? 1636 HOH B O   1 
HETATM 6514 O  O   . HOH I 4 .   ? 23.367 96.707  60.305 1.00 18.97  ? 1637 HOH B O   1 
HETATM 6515 O  O   . HOH I 4 .   ? 20.803 102.447 59.546 1.00 94.04  ? 1638 HOH B O   1 
HETATM 6516 O  O   . HOH I 4 .   ? 26.409 103.386 58.014 1.00 23.15  ? 1639 HOH B O   1 
HETATM 6517 O  O   . HOH I 4 .   ? 24.811 104.414 54.129 1.00 35.06  ? 1640 HOH B O   1 
HETATM 6518 O  O   . HOH I 4 .   ? 23.661 97.445  52.898 1.00 26.28  ? 1641 HOH B O   1 
HETATM 6519 O  O   . HOH I 4 .   ? 23.960 99.555  54.364 1.00 23.87  ? 1642 HOH B O   1 
HETATM 6520 O  O   . HOH I 4 .   ? 22.699 103.137 56.764 1.00 56.46  ? 1643 HOH B O   1 
HETATM 6521 O  O   . HOH I 4 .   ? 25.865 101.457 53.525 1.00 17.67  ? 1644 HOH B O   1 
HETATM 6522 O  O   . HOH I 4 .   ? 29.654 92.153  48.091 1.00 28.68  ? 1645 HOH B O   1 
HETATM 6523 O  O   . HOH I 4 .   ? 31.270 92.545  50.662 1.00 47.39  ? 1646 HOH B O   1 
HETATM 6524 O  O   . HOH I 4 .   ? 29.382 92.452  52.636 1.00 36.26  ? 1647 HOH B O   1 
HETATM 6525 O  O   . HOH I 4 .   ? 29.709 94.343  54.958 1.00 18.81  ? 1648 HOH B O   1 
HETATM 6526 O  O   . HOH I 4 .   ? 29.383 93.340  57.616 1.00 13.64  ? 1649 HOH B O   1 
HETATM 6527 O  O   . HOH I 4 .   ? 33.566 89.941  57.564 1.00 16.88  ? 1650 HOH B O   1 
HETATM 6528 O  O   . HOH I 4 .   ? 33.625 84.826  50.613 1.00 48.76  ? 1651 HOH B O   1 
HETATM 6529 O  O   . HOH I 4 .   ? 27.283 78.875  54.292 1.00 42.01  ? 1652 HOH B O   1 
HETATM 6530 O  O   . HOH I 4 .   ? 13.880 97.436  45.550 1.00 13.44  ? 1653 HOH B O   1 
HETATM 6531 O  O   . HOH I 4 .   ? 11.100 97.320  45.370 1.00 21.89  ? 1654 HOH B O   1 
HETATM 6532 O  O   . HOH I 4 .   ? 8.161  93.815  51.045 1.00 31.22  ? 1655 HOH B O   1 
HETATM 6533 O  O   . HOH I 4 .   ? 15.600 108.497 47.449 1.00 26.05  ? 1656 HOH B O   1 
HETATM 6534 O  O   . HOH I 4 .   ? 22.146 108.100 47.572 1.00 29.29  ? 1657 HOH B O   1 
HETATM 6535 O  O   . HOH I 4 .   ? 23.370 108.773 50.318 1.00 53.40  ? 1658 HOH B O   1 
HETATM 6536 O  O   . HOH I 4 .   ? 22.633 107.119 53.952 1.00 44.16  ? 1659 HOH B O   1 
HETATM 6537 O  O   . HOH I 4 .   ? 19.197 107.880 40.352 1.00 20.92  ? 1660 HOH B O   1 
HETATM 6538 O  O   . HOH I 4 .   ? 23.923 97.691  39.436 1.00 33.33  ? 1661 HOH B O   1 
HETATM 6539 O  O   . HOH I 4 .   ? 26.128 100.186 40.260 1.00 22.77  ? 1662 HOH B O   1 
HETATM 6540 O  O   . HOH I 4 .   ? 25.635 96.521  37.380 1.00 33.73  ? 1663 HOH B O   1 
HETATM 6541 O  O   . HOH I 4 .   ? 24.616 95.847  41.173 1.00 34.89  ? 1664 HOH B O   1 
HETATM 6542 O  O   . HOH I 4 .   ? 25.826 93.367  39.410 1.00 24.73  ? 1665 HOH B O   1 
HETATM 6543 O  O   . HOH I 4 .   ? 5.926  86.788  36.345 1.00 21.72  ? 1666 HOH B O   1 
HETATM 6544 O  O   . HOH I 4 .   ? 0.081  87.154  43.698 1.00 29.67  ? 1667 HOH B O   1 
HETATM 6545 O  O   . HOH I 4 .   ? -3.013 97.981  44.910 1.00 23.93  ? 1668 HOH B O   1 
HETATM 6546 O  O   . HOH I 4 .   ? 0.037  97.042  46.091 1.00 20.29  ? 1669 HOH B O   1 
HETATM 6547 O  O   . HOH I 4 .   ? 6.184  97.923  49.853 1.00 29.09  ? 1670 HOH B O   1 
HETATM 6548 O  O   . HOH I 4 .   ? 13.440 107.211 48.807 1.00 26.19  ? 1671 HOH B O   1 
HETATM 6549 O  O   . HOH I 4 .   ? 8.505  109.396 38.381 1.00 24.87  ? 1672 HOH B O   1 
HETATM 6550 O  O   . HOH I 4 .   ? 16.223 113.347 43.375 1.00 33.24  ? 1673 HOH B O   1 
HETATM 6551 O  O   . HOH I 4 .   ? -0.358 98.753  38.871 1.00 27.32  ? 1674 HOH B O   1 
HETATM 6552 O  O   . HOH I 4 .   ? 7.735  80.348  44.110 1.00 39.02  ? 1675 HOH B O   1 
HETATM 6553 O  O   . HOH I 4 .   ? 27.210 89.685  43.302 1.00 17.90  ? 1676 HOH B O   1 
HETATM 6554 O  O   . HOH I 4 .   ? 32.274 101.941 40.892 1.00 21.76  ? 1678 HOH B O   1 
HETATM 6555 O  O   . HOH I 4 .   ? 33.546 101.386 45.109 1.00 16.28  ? 1679 HOH B O   1 
HETATM 6556 O  O   . HOH I 4 .   ? 33.329 98.995  48.625 1.00 21.89  ? 1681 HOH B O   1 
HETATM 6557 O  O   . HOH I 4 .   ? 35.001 97.122  50.417 1.00 30.51  ? 1682 HOH B O   1 
HETATM 6558 O  O   . HOH I 4 .   ? 27.991 107.008 61.673 1.00 61.31  ? 1683 HOH B O   1 
HETATM 6559 O  O   . HOH I 4 .   ? 37.039 119.057 56.227 1.00 33.94  ? 1685 HOH B O   1 
HETATM 6560 O  O   . HOH I 4 .   ? 40.956 120.514 56.370 1.00 38.91  ? 1686 HOH B O   1 
HETATM 6561 O  O   . HOH I 4 .   ? 25.814 109.348 49.844 1.00 26.37  ? 1687 HOH B O   1 
HETATM 6562 O  O   . HOH I 4 .   ? 34.258 108.363 42.442 1.00 18.10  ? 1688 HOH B O   1 
HETATM 6563 O  O   . HOH I 4 .   ? 37.046 109.224 42.321 1.00 33.59  ? 1689 HOH B O   1 
HETATM 6564 O  O   . HOH I 4 .   ? 44.633 90.250  60.555 1.00 39.36  ? 1691 HOH B O   1 
HETATM 6565 O  O   . HOH I 4 .   ? 35.655 113.645 64.062 1.00 42.11  ? 1692 HOH B O   1 
HETATM 6566 O  O   . HOH I 4 .   ? 33.214 98.529  71.550 1.00 42.53  ? 1693 HOH B O   1 
HETATM 6567 O  O   . HOH I 4 .   ? 32.274 92.966  68.279 1.00 47.61  ? 1694 HOH B O   1 
HETATM 6568 O  O   . HOH I 4 .   ? 32.463 83.262  59.041 1.00 27.84  ? 1695 HOH B O   1 
HETATM 6569 O  O   . HOH I 4 .   ? 29.941 84.716  58.161 1.00 23.71  ? 1696 HOH B O   1 
HETATM 6570 O  O   . HOH I 4 .   ? 40.894 77.206  53.541 1.00 27.64  ? 1697 HOH B O   1 
HETATM 6571 O  O   . HOH I 4 .   ? 36.917 79.931  63.145 1.00 38.26  ? 1698 HOH B O   1 
HETATM 6572 O  O   . HOH I 4 .   ? 46.871 96.449  50.855 1.00 34.83  ? 1699 HOH B O   1 
HETATM 6573 O  O   . HOH I 4 .   ? 39.672 105.318 44.395 1.00 18.09  ? 1721 HOH B O   1 
HETATM 6574 O  O   . HOH I 4 .   ? 3.867  88.879  63.418 1.00 30.14  ? 1722 HOH B O   1 
HETATM 6575 O  O   . HOH I 4 .   ? 10.154 82.494  61.205 1.00 62.65  ? 1723 HOH B O   1 
HETATM 6576 O  O   . HOH I 4 .   ? 7.910  81.109  63.385 1.00 40.60  ? 1724 HOH B O   1 
HETATM 6577 O  O   . HOH I 4 .   ? 13.528 78.212  59.768 1.00 33.30  ? 1725 HOH B O   1 
HETATM 6578 O  O   . HOH I 4 .   ? 12.744 79.612  57.398 1.00 62.07  ? 1726 HOH B O   1 
HETATM 6579 O  O   . HOH I 4 .   ? 16.352 76.409  65.443 1.00 46.29  ? 1727 HOH B O   1 
HETATM 6580 O  O   . HOH I 4 .   ? 25.288 92.932  68.572 1.00 37.02  ? 1728 HOH B O   1 
HETATM 6581 O  O   . HOH I 4 .   ? 24.588 104.102 71.303 1.00 33.85  ? 1729 HOH B O   1 
HETATM 6582 O  O   . HOH I 4 .   ? 26.282 99.862  69.960 1.00 29.05  ? 1730 HOH B O   1 
HETATM 6583 O  O   . HOH I 4 .   ? 26.429 85.218  44.472 1.00 27.18  ? 1731 HOH B O   1 
HETATM 6584 O  O   . HOH I 4 .   ? 25.421 79.047  56.949 1.00 26.26  ? 1732 HOH B O   1 
HETATM 6585 O  O   . HOH I 4 .   ? 12.025 95.983  52.504 1.00 24.19  ? 1733 HOH B O   1 
HETATM 6586 O  O   . HOH I 4 .   ? 9.928  95.382  54.614 1.00 34.90  ? 1734 HOH B O   1 
HETATM 6587 O  O   . HOH I 4 .   ? 9.382  96.675  47.720 1.00 28.38  ? 1735 HOH B O   1 
HETATM 6588 O  O   . HOH I 4 .   ? 17.541 98.859  56.207 1.00 32.63  ? 1736 HOH B O   1 
HETATM 6589 O  O   . HOH I 4 .   ? 12.122 101.634 52.605 1.00 36.10  ? 1737 HOH B O   1 
HETATM 6590 O  O   . HOH I 4 .   ? 18.637 108.286 53.197 1.00 33.74  ? 1738 HOH B O   1 
HETATM 6591 O  O   . HOH I 4 .   ? 16.040 103.038 55.863 1.00 49.13  ? 1739 HOH B O   1 
HETATM 6592 O  O   . HOH I 4 .   ? 8.883  91.722  47.818 1.00 22.23  ? 1740 HOH B O   1 
HETATM 6593 O  O   . HOH I 4 .   ? 8.504  89.612  49.532 1.00 35.39  ? 1741 HOH B O   1 
HETATM 6594 O  O   . HOH I 4 .   ? -2.062 93.823  44.961 1.00 35.47  ? 1742 HOH B O   1 
HETATM 6595 O  O   . HOH I 4 .   ? -2.652 91.411  43.429 1.00 37.05  ? 1743 HOH B O   1 
HETATM 6596 O  O   . HOH I 4 .   ? -6.791 95.208  34.775 1.00 35.47  ? 1744 HOH B O   1 
HETATM 6597 O  O   . HOH I 4 .   ? 3.780  102.069 43.830 1.00 37.27  ? 1745 HOH B O   1 
HETATM 6598 O  O   . HOH I 4 .   ? 7.618  103.221 44.437 1.00 29.27  ? 1746 HOH B O   1 
HETATM 6599 O  O   . HOH I 4 .   ? 6.882  105.084 46.065 1.00 52.00  ? 1747 HOH B O   1 
HETATM 6600 O  O   . HOH I 4 .   ? 14.095 86.924  34.453 1.00 36.37  ? 1749 HOH B O   1 
HETATM 6601 O  O   . HOH I 4 .   ? 13.591 83.949  34.473 1.00 42.32  ? 1750 HOH B O   1 
HETATM 6602 O  O   . HOH I 4 .   ? 14.039 86.704  31.674 1.00 32.39  ? 1751 HOH B O   1 
HETATM 6603 O  O   . HOH I 4 .   ? 13.402 80.009  39.987 1.00 30.60  ? 1752 HOH B O   1 
HETATM 6604 O  O   . HOH I 4 .   ? 30.286 97.466  41.737 1.00 26.28  ? 1753 HOH B O   1 
HETATM 6605 O  O   . HOH I 4 .   ? 28.646 99.498  40.008 1.00 31.19  ? 1754 HOH B O   1 
HETATM 6606 O  O   . HOH I 4 .   ? 36.850 117.098 53.783 1.00 37.35  ? 1755 HOH B O   1 
HETATM 6607 O  O   . HOH I 4 .   ? 33.718 119.761 56.575 1.00 55.83  ? 1756 HOH B O   1 
HETATM 6608 O  O   . HOH I 4 .   ? 39.551 98.082  52.126 1.00 24.91  ? 1757 HOH B O   1 
HETATM 6609 O  O   . HOH I 4 .   ? 38.975 107.618 43.236 1.00 48.03  ? 1759 HOH B O   1 
HETATM 6610 O  O   . HOH I 4 .   ? 47.731 91.676  53.295 1.00 32.33  ? 1761 HOH B O   1 
HETATM 6611 O  O   . HOH I 4 .   ? 37.327 114.462 67.437 1.00 40.22  ? 1762 HOH B O   1 
HETATM 6612 O  O   . HOH I 4 .   ? 18.627 108.490 32.140 1.00 37.57  ? 1771 HOH B O   1 
HETATM 6613 O  O   . HOH I 4 .   ? 0.243  112.169 34.090 1.00 63.54  ? 1784 HOH B O   1 
HETATM 6614 O  O   . HOH I 4 .   ? 8.484  113.011 38.048 1.00 56.32  ? 1789 HOH B O   1 
HETATM 6615 O  O   . HOH I 4 .   ? -0.657 82.693  45.727 1.00 56.44  ? 1792 HOH B O   1 
HETATM 6616 O  O   . HOH I 4 .   ? 4.304  88.017  49.809 1.00 40.35  ? 1793 HOH B O   1 
HETATM 6617 O  O   . HOH I 4 .   ? 21.066 97.040  53.953 1.00 31.09  ? 1795 HOH B O   1 
HETATM 6618 O  O   . HOH I 4 .   ? 29.092 82.756  56.530 1.00 30.66  ? 1796 HOH B O   1 
HETATM 6619 O  O   . HOH I 4 .   ? 20.879 97.872  57.359 1.00 33.87  ? 1797 HOH B O   1 
HETATM 6620 O  O   . HOH I 4 .   ? 12.428 104.162 62.682 1.00 51.36  ? 1798 HOH B O   1 
HETATM 6621 O  O   . HOH I 4 .   ? 41.664 116.490 63.784 1.00 46.59  ? 1799 HOH B O   1 
HETATM 6622 O  O   . HOH I 4 .   ? 26.171 89.366  66.298 1.00 50.44  ? 1800 HOH B O   1 
HETATM 6623 O  O   . HOH I 4 .   ? 5.544  91.865  75.620 1.00 45.02  ? 1801 HOH B O   1 
HETATM 6624 O  O   . HOH I 4 .   ? 45.802 100.267 68.373 1.00 30.17  ? 1804 HOH B O   1 
HETATM 6625 O  O   . HOH I 4 .   ? 17.557 106.358 33.821 1.00 24.29  ? 1805 HOH B O   1 
HETATM 6626 O  O   . HOH J 4 .   ? 20.443 117.664 42.378 1.00 23.50  ? 690  HOH D O   1 
HETATM 6627 O  O   . HOH J 4 .   ? 36.555 111.669 37.325 1.00 29.84  ? 701  HOH D O   1 
HETATM 6628 O  O   . HOH J 4 .   ? 22.037 119.162 39.232 1.00 30.72  ? 709  HOH D O   1 
HETATM 6629 O  O   . HOH J 4 .   ? 19.281 119.332 39.498 1.00 38.15  ? 791  HOH D O   1 
HETATM 6630 O  O   . HOH J 4 .   ? 18.357 105.350 30.824 1.00 26.41  ? 1610 HOH D O   1 
HETATM 6631 O  O   . HOH J 4 .   ? 10.455 100.102 31.078 1.00 28.83  ? 1613 HOH D O   1 
HETATM 6632 O  O   . HOH J 4 .   ? 28.200 110.331 48.323 1.00 23.40  ? 1623 HOH D O   1 
HETATM 6633 O  O   . HOH J 4 .   ? 42.326 109.865 44.750 1.00 100.00 ? 1625 HOH D O   1 
HETATM 6634 O  O   . HOH J 4 .   ? 42.406 90.642  54.703 1.00 29.95  ? 1626 HOH D O   1 
HETATM 6635 O  O   . HOH J 4 .   ? 45.544 95.476  46.075 1.00 25.96  ? 1627 HOH D O   1 
HETATM 6636 O  O   . HOH J 4 .   ? 21.697 110.278 45.426 1.00 21.64  ? 1628 HOH D O   1 
HETATM 6637 O  O   . HOH J 4 .   ? 30.668 89.564  43.649 1.00 34.43  ? 1677 HOH D O   1 
HETATM 6638 O  O   . HOH J 4 .   ? 35.102 99.734  46.434 1.00 19.21  ? 1680 HOH D O   1 
HETATM 6639 O  O   . HOH J 4 .   ? 46.341 114.906 58.692 1.00 25.08  ? 1684 HOH D O   1 
HETATM 6640 O  O   . HOH J 4 .   ? 24.599 95.662  31.207 1.00 36.28  ? 1700 HOH D O   1 
HETATM 6641 O  O   . HOH J 4 .   ? 20.740 118.048 37.026 1.00 28.27  ? 1701 HOH D O   1 
HETATM 6642 O  O   . HOH J 4 .   ? 32.993 109.670 39.851 1.00 19.10  ? 1704 HOH D O   1 
HETATM 6643 O  O   . HOH J 4 .   ? 24.346 101.657 36.059 1.00 46.80  ? 1705 HOH D O   1 
HETATM 6644 O  O   . HOH J 4 .   ? 29.119 112.355 35.831 1.00 14.40  ? 1706 HOH D O   1 
HETATM 6645 O  O   . HOH J 4 .   ? 30.806 111.411 33.836 1.00 30.44  ? 1707 HOH D O   1 
HETATM 6646 O  O   . HOH J 4 .   ? 29.298 103.816 40.483 1.00 27.88  ? 1708 HOH D O   1 
HETATM 6647 O  O   . HOH J 4 .   ? 35.855 110.575 39.406 1.00 32.74  ? 1709 HOH D O   1 
HETATM 6648 O  O   . HOH J 4 .   ? 30.980 102.027 38.380 1.00 44.39  ? 1710 HOH D O   1 
HETATM 6649 O  O   . HOH J 4 .   ? 38.985 110.957 31.184 1.00 30.62  ? 1711 HOH D O   1 
HETATM 6650 O  O   . HOH J 4 .   ? 39.644 104.631 32.921 1.00 49.93  ? 1712 HOH D O   1 
HETATM 6651 O  O   . HOH J 4 .   ? 40.028 104.951 37.752 1.00 39.15  ? 1713 HOH D O   1 
HETATM 6652 O  O   . HOH J 4 .   ? 37.268 100.370 39.915 1.00 25.46  ? 1714 HOH D O   1 
HETATM 6653 O  O   . HOH J 4 .   ? 42.041 97.972  40.268 1.00 34.78  ? 1715 HOH D O   1 
HETATM 6654 O  O   . HOH J 4 .   ? 38.746 103.443 41.875 1.00 31.40  ? 1716 HOH D O   1 
HETATM 6655 O  O   . HOH J 4 .   ? 52.022 111.833 57.450 1.00 42.35  ? 1717 HOH D O   1 
HETATM 6656 O  O   . HOH J 4 .   ? 48.729 105.381 48.643 1.00 48.16  ? 1718 HOH D O   1 
HETATM 6657 O  O   . HOH J 4 .   ? 45.262 113.305 48.945 1.00 43.64  ? 1719 HOH D O   1 
HETATM 6658 O  O   . HOH J 4 .   ? 48.975 115.767 59.299 1.00 33.76  ? 1720 HOH D O   1 
HETATM 6659 O  O   . HOH J 4 .   ? 11.903 113.327 29.998 1.00 54.76  ? 1748 HOH D O   1 
HETATM 6660 O  O   . HOH J 4 .   ? 42.400 107.183 41.119 1.00 46.14  ? 1760 HOH D O   1 
HETATM 6661 O  O   . HOH J 4 .   ? 51.503 103.729 46.318 1.00 35.08  ? 1763 HOH D O   1 
HETATM 6662 O  O   . HOH J 4 .   ? 57.016 104.157 52.336 1.00 45.10  ? 1764 HOH D O   1 
HETATM 6663 O  O   . HOH J 4 .   ? 56.561 106.880 51.432 1.00 47.46  ? 1765 HOH D O   1 
HETATM 6664 O  O   . HOH J 4 .   ? 54.736 100.618 54.969 1.00 33.82  ? 1766 HOH D O   1 
HETATM 6665 O  O   . HOH J 4 .   ? 35.339 93.152  39.257 1.00 36.93  ? 1767 HOH D O   1 
HETATM 6666 O  O   . HOH J 4 .   ? 31.955 99.618  35.662 1.00 30.97  ? 1768 HOH D O   1 
HETATM 6667 O  O   . HOH J 4 .   ? 26.107 112.623 34.839 1.00 29.03  ? 1769 HOH D O   1 
HETATM 6668 O  O   . HOH J 4 .   ? 17.998 116.716 42.756 1.00 78.40  ? 1770 HOH D O   1 
HETATM 6669 O  O   . HOH J 4 .   ? 13.371 105.645 26.398 1.00 37.57  ? 1772 HOH D O   1 
HETATM 6670 O  O   . HOH J 4 .   ? 10.931 103.464 26.436 1.00 36.90  ? 1773 HOH D O   1 
HETATM 6671 O  O   . HOH J 4 .   ? 19.494 94.141  26.321 1.00 29.65  ? 1774 HOH D O   1 
HETATM 6672 O  O   . HOH J 4 .   ? 21.556 92.409  24.802 1.00 59.24  ? 1775 HOH D O   1 
HETATM 6673 O  O   . HOH J 4 .   ? 38.225 83.386  49.535 1.00 35.24  ? 1776 HOH D O   1 
HETATM 6674 O  O   . HOH J 4 .   ? 36.568 82.667  51.687 1.00 34.01  ? 1777 HOH D O   1 
HETATM 6675 O  O   . HOH J 4 .   ? 40.569 91.845  53.647 1.00 17.67  ? 1778 HOH D O   1 
HETATM 6676 O  O   . HOH J 4 .   ? 29.308 105.027 30.863 1.00 32.62  ? 1779 HOH D O   1 
HETATM 6677 O  O   . HOH J 4 .   ? 29.186 109.882 31.716 1.00 38.88  ? 1780 HOH D O   1 
HETATM 6678 O  O   . HOH J 4 .   ? 28.698 107.089 32.391 1.00 30.68  ? 1781 HOH D O   1 
HETATM 6679 O  O   . HOH J 4 .   ? 31.530 100.746 33.415 1.00 40.44  ? 1782 HOH D O   1 
HETATM 6680 O  O   . HOH J 4 .   ? 25.798 106.627 33.206 1.00 39.85  ? 1783 HOH D O   1 
HETATM 6681 O  O   . HOH J 4 .   ? 24.188 108.303 36.574 1.00 45.97  ? 1785 HOH D O   1 
HETATM 6682 O  O   . HOH J 4 .   ? 28.810 95.244  36.221 1.00 47.19  ? 1786 HOH D O   1 
HETATM 6683 O  O   . HOH J 4 .   ? 21.408 108.185 37.379 1.00 21.37  ? 1787 HOH D O   1 
HETATM 6684 O  O   . HOH J 4 .   ? 14.403 120.659 36.890 1.00 71.22  ? 1788 HOH D O   1 
HETATM 6685 O  O   . HOH J 4 .   ? 33.912 85.859  39.977 1.00 77.55  ? 1790 HOH D O   1 
HETATM 6686 O  O   . HOH J 4 .   ? 49.367 94.314  50.414 1.00 75.66  ? 1794 HOH D O   1 
HETATM 6687 O  O   . HOH J 4 .   ? 19.616 98.781  24.493 1.00 36.25  ? 1802 HOH D O   1 
HETATM 6688 O  O   . HOH J 4 .   ? 49.354 102.150 42.542 1.00 42.10  ? 1803 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   4   4   THR THR A . n 
A 1 2   ILE 2   5   5   ILE ILE A . n 
A 1 3   SER 3   6   6   SER SER A . n 
A 1 4   VAL 4   7   7   VAL VAL A . n 
A 1 5   ARG 5   8   8   ARG ARG A . n 
A 1 6   VAL 6   9   9   VAL VAL A . n 
A 1 7   THR 7   10  10  THR THR A . n 
A 1 8   THR 8   11  11  THR THR A . n 
A 1 9   MSE 9   12  12  MSE MSE A . n 
A 1 10  ASP 10  13  13  ASP ASP A . n 
A 1 11  ALA 11  14  14  ALA ALA A . n 
A 1 12  GLU 12  15  15  GLU GLU A . n 
A 1 13  LEU 13  16  16  LEU LEU A . n 
A 1 14  GLU 14  17  17  GLU GLU A . n 
A 1 15  PHE 15  18  18  PHE PHE A . n 
A 1 16  ALA 16  19  19  ALA ALA A . n 
A 1 17  ILE 17  20  20  ILE ILE A . n 
A 1 18  GLN 18  21  21  GLN GLN A . n 
A 1 19  PRO 19  22  22  PRO PRO A . n 
A 1 20  ASN 20  23  23  ASN ASN A . n 
A 1 21  THR 21  24  24  THR THR A . n 
A 1 22  THR 22  25  25  THR THR A . n 
A 1 23  GLY 23  26  26  GLY GLY A . n 
A 1 24  LYS 24  27  27  LYS LYS A . n 
A 1 25  GLN 25  28  28  GLN GLN A . n 
A 1 26  LEU 26  29  29  LEU LEU A . n 
A 1 27  PHE 27  30  30  PHE PHE A . n 
A 1 28  ASP 28  31  31  ASP ASP A . n 
A 1 29  GLN 29  32  32  GLN GLN A . n 
A 1 30  VAL 30  33  33  VAL VAL A . n 
A 1 31  VAL 31  34  34  VAL VAL A . n 
A 1 32  LYS 32  35  35  LYS LYS A . n 
A 1 33  THR 33  36  36  THR THR A . n 
A 1 34  ILE 34  37  37  ILE ILE A . n 
A 1 35  GLY 35  38  38  GLY GLY A . n 
A 1 36  LEU 36  39  39  LEU LEU A . n 
A 1 37  ARG 37  40  40  ARG ARG A . n 
A 1 38  GLU 38  41  41  GLU GLU A . n 
A 1 39  VAL 39  42  42  VAL VAL A . n 
A 1 40  TRP 40  43  43  TRP TRP A . n 
A 1 41  PHE 41  44  44  PHE PHE A . n 
A 1 42  PHE 42  45  45  PHE PHE A . n 
A 1 43  GLY 43  46  46  GLY GLY A . n 
A 1 44  LEU 44  47  47  LEU LEU A . n 
A 1 45  GLN 45  48  48  GLN GLN A . n 
A 1 46  TYR 46  49  49  TYR TYR A . n 
A 1 47  GLN 47  50  50  GLN GLN A . n 
A 1 48  ASP 48  51  51  ASP ASP A . n 
A 1 49  THR 49  52  52  THR THR A . n 
A 1 50  LYS 50  53  53  LYS LYS A . n 
A 1 51  GLY 51  54  54  GLY GLY A . n 
A 1 52  PHE 52  55  55  PHE PHE A . n 
A 1 53  SER 53  56  56  SER SER A . n 
A 1 54  THR 54  57  57  THR THR A . n 
A 1 55  TRP 55  58  58  TRP TRP A . n 
A 1 56  LEU 56  59  59  LEU LEU A . n 
A 1 57  LYS 57  60  60  LYS LYS A . n 
A 1 58  LEU 58  61  61  LEU LEU A . n 
A 1 59  ASN 59  62  62  ASN ASN A . n 
A 1 60  LYS 60  63  63  LYS LYS A . n 
A 1 61  LYS 61  64  64  LYS ALA A . n 
A 1 62  VAL 62  65  65  VAL VAL A . n 
A 1 63  THR 63  66  66  THR THR A . n 
A 1 64  ALA 64  67  67  ALA ALA A . n 
A 1 65  GLN 65  68  68  GLN GLN A . n 
A 1 66  ASP 66  69  69  ASP ALA A . n 
A 1 67  VAL 67  70  70  VAL VAL A . n 
A 1 68  ARG 68  71  71  ARG ARG A . n 
A 1 69  LYS 69  72  72  LYS ALA A . n 
A 1 70  GLU 70  73  73  GLU GLU A . n 
A 1 71  SER 71  74  74  SER SER A . n 
A 1 72  PRO 72  75  75  PRO PRO A . n 
A 1 73  LEU 73  76  76  LEU LEU A . n 
A 1 74  LEU 74  77  77  LEU LEU A . n 
A 1 75  PHE 75  78  78  PHE PHE A . n 
A 1 76  LYS 76  79  79  LYS LYS A . n 
A 1 77  PHE 77  80  80  PHE PHE A . n 
A 1 78  ARG 78  81  81  ARG ARG A . n 
A 1 79  ALA 79  82  82  ALA ALA A . n 
A 1 80  LYS 80  83  83  LYS LYS A . n 
A 1 81  PHE 81  84  84  PHE PHE A . n 
A 1 82  TYR 82  85  85  TYR TYR A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  GLU 84  87  87  GLU GLU A . n 
A 1 85  ASP 85  88  88  ASP ASP A . n 
A 1 86  VAL 86  89  89  VAL VAL A . n 
A 1 87  SER 87  90  90  SER SER A . n 
A 1 88  GLU 88  91  91  GLU GLU A . n 
A 1 89  GLU 89  92  92  GLU GLU A . n 
A 1 90  LEU 90  93  93  LEU LEU A . n 
A 1 91  ILE 91  94  94  ILE ILE A . n 
A 1 92  GLN 92  95  95  GLN GLN A . n 
A 1 93  ASP 93  96  96  ASP ASP A . n 
A 1 94  ILE 94  97  97  ILE ILE A . n 
A 1 95  THR 95  98  98  THR THR A . n 
A 1 96  GLN 96  99  99  GLN GLN A . n 
A 1 97  ARG 97  100 100 ARG ARG A . n 
A 1 98  LEU 98  101 101 LEU LEU A . n 
A 1 99  PHE 99  102 102 PHE PHE A . n 
A 1 100 PHE 100 103 103 PHE PHE A . n 
A 1 101 LEU 101 104 104 LEU LEU A . n 
A 1 102 GLN 102 105 105 GLN GLN A . n 
A 1 103 VAL 103 106 106 VAL VAL A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 GLU 105 108 108 GLU GLU A . n 
A 1 106 GLY 106 109 109 GLY GLY A . n 
A 1 107 ILE 107 110 110 ILE ILE A . n 
A 1 108 LEU 108 111 111 LEU LEU A . n 
A 1 109 ASN 109 112 112 ASN ASN A . n 
A 1 110 ASP 110 113 113 ASP ASP A . n 
A 1 111 ASP 111 114 114 ASP ASP A . n 
A 1 112 ILE 112 115 115 ILE ILE A . n 
A 1 113 TYR 113 116 116 TYR TYR A . n 
A 1 114 CYS 114 117 117 CYS CYS A . n 
A 1 115 PRO 115 118 118 PRO PRO A . n 
A 1 116 PRO 116 119 119 PRO PRO A . n 
A 1 117 GLU 117 120 120 GLU GLU A . n 
A 1 118 THR 118 121 121 THR THR A . n 
A 1 119 ALA 119 122 122 ALA ALA A . n 
A 1 120 VAL 120 123 123 VAL VAL A . n 
A 1 121 LEU 121 124 124 LEU LEU A . n 
A 1 122 LEU 122 125 125 LEU LEU A . n 
A 1 123 ALA 123 126 126 ALA ALA A . n 
A 1 124 SER 124 127 127 SER SER A . n 
A 1 125 TYR 125 128 128 TYR TYR A . n 
A 1 126 ALA 126 129 129 ALA ALA A . n 
A 1 127 VAL 127 130 130 VAL VAL A . n 
A 1 128 GLN 128 131 131 GLN GLN A . n 
A 1 129 SER 129 132 132 SER SER A . n 
A 1 130 LYS 130 133 133 LYS LYS A . n 
A 1 131 TYR 131 134 134 TYR TYR A . n 
A 1 132 GLY 132 135 135 GLY GLY A . n 
A 1 133 ASP 133 136 136 ASP ASP A . n 
A 1 134 PHE 134 137 137 PHE PHE A . n 
A 1 135 ASN 135 138 138 ASN ASN A . n 
A 1 136 LYS 136 139 139 LYS ALA A . n 
A 1 137 GLU 137 140 140 GLU GLU A . n 
A 1 138 VAL 138 141 141 VAL VAL A . n 
A 1 139 HIS 139 142 142 HIS HIS A . n 
A 1 140 LYS 140 143 143 LYS LYS A . n 
A 1 141 SER 141 144 144 SER SER A . n 
A 1 142 GLY 142 145 145 GLY GLY A . n 
A 1 143 TYR 143 146 146 TYR TYR A . n 
A 1 144 LEU 144 147 147 LEU LEU A . n 
A 1 145 ALA 145 148 148 ALA ALA A . n 
A 1 146 GLY 146 149 149 GLY GLY A . n 
A 1 147 ASP 147 150 150 ASP ASP A . n 
A 1 148 LYS 148 151 151 LYS LYS A . n 
A 1 149 LEU 149 152 152 LEU LEU A . n 
A 1 150 LEU 150 153 153 LEU LEU A . n 
A 1 151 PRO 151 154 154 PRO PRO A . n 
A 1 152 GLN 152 155 155 GLN GLN A . n 
A 1 153 ARG 153 156 156 ARG ARG A . n 
A 1 154 VAL 154 157 157 VAL VAL A . n 
A 1 155 LEU 155 158 158 LEU LEU A . n 
A 1 156 GLU 156 159 159 GLU GLU A . n 
A 1 157 GLN 157 160 160 GLN GLN A . n 
A 1 158 HIS 158 161 161 HIS HIS A . n 
A 1 159 LYS 159 162 162 LYS LYS A . n 
A 1 160 LEU 160 163 163 LEU LEU A . n 
A 1 161 ASN 161 164 164 ASN ASN A . n 
A 1 162 LYS 162 165 165 LYS LYS A . n 
A 1 163 ASP 163 166 166 ASP ASP A . n 
A 1 164 GLN 164 167 167 GLN GLN A . n 
A 1 165 TRP 165 168 168 TRP TRP A . n 
A 1 166 GLU 166 169 169 GLU GLU A . n 
A 1 167 GLU 167 170 170 GLU GLU A . n 
A 1 168 ARG 168 171 171 ARG ARG A . n 
A 1 169 ILE 169 172 172 ILE ILE A . n 
A 1 170 GLN 170 173 173 GLN GLN A . n 
A 1 171 VAL 171 174 174 VAL VAL A . n 
A 1 172 TRP 172 175 175 TRP TRP A . n 
A 1 173 HIS 173 176 176 HIS HIS A . n 
A 1 174 GLU 174 177 177 GLU GLU A . n 
A 1 175 GLU 175 178 178 GLU GLU A . n 
A 1 176 HIS 176 179 179 HIS HIS A . n 
A 1 177 ARG 177 180 180 ARG ARG A . n 
A 1 178 GLY 178 181 181 GLY GLY A . n 
A 1 179 MSE 179 182 182 MSE MSE A . n 
A 1 180 LEU 180 183 183 LEU LEU A . n 
A 1 181 ARG 181 184 184 ARG ARG A . n 
A 1 182 GLU 182 185 185 GLU GLU A . n 
A 1 183 ASP 183 186 186 ASP ASP A . n 
A 1 184 ALA 184 187 187 ALA ALA A . n 
A 1 185 VAL 185 188 188 VAL VAL A . n 
A 1 186 LEU 186 189 189 LEU LEU A . n 
A 1 187 GLU 187 190 190 GLU GLU A . n 
A 1 188 TYR 188 191 191 TYR TYR A . n 
A 1 189 LEU 189 192 192 LEU LEU A . n 
A 1 190 LYS 190 193 193 LYS LYS A . n 
A 1 191 ILE 191 194 194 ILE ILE A . n 
A 1 192 ALA 192 195 195 ALA ALA A . n 
A 1 193 GLN 193 196 196 GLN GLN A . n 
A 1 194 ASP 194 197 197 ASP ASP A . n 
A 1 195 LEU 195 198 198 LEU LEU A . n 
A 1 196 GLU 196 199 199 GLU GLU A . n 
A 1 197 MSE 197 200 200 MSE MSE A . n 
A 1 198 TYR 198 201 201 TYR TYR A . n 
A 1 199 GLY 199 202 202 GLY GLY A . n 
A 1 200 VAL 200 203 203 VAL VAL A . n 
A 1 201 ASN 201 204 204 ASN ASN A . n 
A 1 202 TYR 202 205 205 TYR TYR A . n 
A 1 203 PHE 203 206 206 PHE PHE A . n 
A 1 204 SER 204 207 207 SER SER A . n 
A 1 205 ILE 205 208 208 ILE ILE A . n 
A 1 206 LYS 206 209 209 LYS LYS A . n 
A 1 207 ASN 207 210 210 ASN ASN A . n 
A 1 208 LYS 208 211 211 LYS LYS A . n 
A 1 209 LYS 209 212 212 LYS LYS A . n 
A 1 210 GLY 210 213 213 GLY GLY A . n 
A 1 211 SER 211 214 214 SER SER A . n 
A 1 212 GLU 212 215 215 GLU GLU A . n 
A 1 213 LEU 213 216 216 LEU LEU A . n 
A 1 214 TRP 214 217 217 TRP TRP A . n 
A 1 215 LEU 215 218 218 LEU LEU A . n 
A 1 216 GLY 216 219 219 GLY GLY A . n 
A 1 217 VAL 217 220 220 VAL VAL A . n 
A 1 218 ASP 218 221 221 ASP ASP A . n 
A 1 219 ALA 219 222 222 ALA ALA A . n 
A 1 220 LEU 220 223 223 LEU LEU A . n 
A 1 221 GLY 221 224 224 GLY GLY A . n 
A 1 222 LEU 222 225 225 LEU LEU A . n 
A 1 223 ASN 223 226 226 ASN ASN A . n 
A 1 224 ILE 224 227 227 ILE ILE A . n 
A 1 225 TYR 225 228 228 TYR TYR A . n 
A 1 226 GLU 226 229 229 GLU GLU A . n 
A 1 227 GLN 227 230 230 GLN GLN A . n 
A 1 228 ASN 228 231 231 ASN ASN A . n 
A 1 229 ASP 229 232 232 ASP ASP A . n 
A 1 230 ARG 230 233 233 ARG ARG A . n 
A 1 231 LEU 231 234 234 LEU LEU A . n 
A 1 232 THR 232 235 235 THR THR A . n 
A 1 233 PRO 233 236 236 PRO PRO A . n 
A 1 234 LYS 234 237 237 LYS LYS A . n 
A 1 235 ILE 235 238 238 ILE ILE A . n 
A 1 236 GLY 236 239 239 GLY GLY A . n 
A 1 237 PHE 237 240 240 PHE PHE A . n 
A 1 238 PRO 238 241 241 PRO PRO A . n 
A 1 239 TRP 239 242 242 TRP TRP A . n 
A 1 240 SER 240 243 243 SER SER A . n 
A 1 241 GLU 241 244 244 GLU GLU A . n 
A 1 242 ILE 242 245 245 ILE ILE A . n 
A 1 243 ARG 243 246 246 ARG ARG A . n 
A 1 244 ASN 244 247 247 ASN ASN A . n 
A 1 245 ILE 245 248 248 ILE ILE A . n 
A 1 246 SER 246 249 249 SER SER A . n 
A 1 247 PHE 247 250 250 PHE PHE A . n 
A 1 248 ASN 248 251 251 ASN ASN A . n 
A 1 249 ASP 249 252 252 ASP ASP A . n 
A 1 250 LYS 250 253 253 LYS LYS A . n 
A 1 251 LYS 251 254 254 LYS LYS A . n 
A 1 252 PHE 252 255 255 PHE PHE A . n 
A 1 253 VAL 253 256 256 VAL VAL A . n 
A 1 254 ILE 254 257 257 ILE ILE A . n 
A 1 255 LYS 255 258 258 LYS LYS A . n 
A 1 256 PRO 256 259 259 PRO PRO A . n 
A 1 257 ILE 257 260 260 ILE ILE A . n 
A 1 258 ASP 258 261 261 ASP ASP A . n 
A 1 259 LYS 259 262 262 LYS LYS A . n 
A 1 260 LYS 260 263 263 LYS LYS A . n 
A 1 261 ALA 261 264 264 ALA ALA A . n 
A 1 262 PRO 262 265 265 PRO PRO A . n 
A 1 263 ASP 263 266 266 ASP ASP A . n 
A 1 264 PHE 264 267 267 PHE PHE A . n 
A 1 265 VAL 265 268 268 VAL VAL A . n 
A 1 266 PHE 266 269 269 PHE PHE A . n 
A 1 267 TYR 267 270 270 TYR TYR A . n 
A 1 268 ALA 268 271 271 ALA ALA A . n 
A 1 269 PRO 269 272 272 PRO PRO A . n 
A 1 270 ARG 270 273 273 ARG ARG A . n 
A 1 271 LEU 271 274 274 LEU LEU A . n 
A 1 272 ARG 272 275 275 ARG ARG A . n 
A 1 273 ILE 273 276 276 ILE ILE A . n 
A 1 274 ASN 274 277 277 ASN ASN A . n 
A 1 275 LYS 275 278 278 LYS LYS A . n 
A 1 276 ARG 276 279 279 ARG ARG A . n 
A 1 277 ILE 277 280 280 ILE ILE A . n 
A 1 278 LEU 278 281 281 LEU LEU A . n 
A 1 279 ALA 279 282 282 ALA ALA A . n 
A 1 280 LEU 280 283 283 LEU LEU A . n 
A 1 281 CYS 281 284 284 CYS CYS A . n 
A 1 282 MSE 282 285 285 MSE MSE A . n 
A 1 283 GLY 283 286 286 GLY GLY A . n 
A 1 284 ASN 284 287 287 ASN ASN A . n 
A 1 285 HIS 285 288 288 HIS HIS A . n 
A 1 286 GLU 286 289 289 GLU GLU A . n 
A 1 287 LEU 287 290 290 LEU LEU A . n 
A 1 288 TYR 288 291 291 TYR TYR A . n 
A 1 289 MSE 289 292 292 MSE MSE A . n 
A 1 290 ARG 290 293 293 ARG ARG A . n 
A 1 291 ARG 291 294 294 ARG ARG A . n 
A 1 292 ARG 292 295 295 ARG ARG A . n 
A 1 293 LYS 293 296 296 LYS LYS A . n 
A 1 294 PRO 294 297 297 PRO PRO A . n 
B 2 1   ALA 1   488 488 ALA ALA C . n 
B 2 2   GLU 2   489 489 GLU GLU C . n 
B 2 3   ALA 3   490 490 ALA ALA C . n 
B 2 4   SER 4   491 491 SER SER C . n 
B 2 5   ALA 5   492 492 ALA ALA C . n 
B 2 6   ASP 6   493 493 ASP ASP C . n 
B 2 7   LEU 7   494 494 LEU LEU C . n 
B 2 8   ARG 8   495 495 ARG ALA C . n 
B 2 9   ALA 9   496 496 ALA ALA C . n 
B 2 10  ASP 10  497 497 ASP ALA C . n 
B 2 11  ALA 11  498 498 ALA ALA C . n 
B 2 12  MET 12  499 499 MET ALA C . n 
B 2 13  ALA 13  500 500 ALA ALA C . n 
B 2 14  LYS 14  501 501 LYS LYS C . n 
B 2 15  ASP 15  502 502 ASP ASP C . n 
B 2 16  ARG 16  503 503 ARG ARG C . n 
B 2 17  SER 17  504 504 SER SER C . n 
B 2 18  GLU 18  505 505 GLU GLU C . n 
B 2 19  GLU 19  506 506 GLU GLU C . n 
B 2 20  GLU 20  507 507 GLU GLU C . n 
B 2 21  ARG 21  508 508 ARG ARG C . n 
B 2 22  THR 22  509 509 THR THR C . n 
B 2 23  THR 23  510 510 THR THR C . n 
B 2 24  GLU 24  511 511 GLU GLU C . n 
B 2 25  ALA 25  512 512 ALA ALA C . n 
B 2 26  GLU 26  513 513 GLU GLU C . n 
B 2 27  LYS 27  514 514 LYS LYS C . n 
B 2 28  ASN 28  515 515 ASN ASN C . n 
B 2 29  GLU 29  516 516 GLU ALA C . n 
B 2 30  ARG 30  517 517 ARG ALA C . n 
B 2 31  VAL 31  518 518 VAL VAL C . n 
B 2 32  GLN 32  519 519 GLN GLN C . n 
B 2 33  LYS 33  520 520 LYS LYS C . n 
B 2 34  HIS 34  521 521 HIS HIS C . n 
B 2 35  LEU 35  522 522 LEU LEU C . n 
B 2 36  LYS 36  523 523 LYS LYS C . n 
B 2 37  ALA 37  524 524 ALA ALA C . n 
B 2 38  LEU 38  525 525 LEU LEU C . n 
B 2 39  THR 39  526 526 THR THR C . n 
B 2 40  SER 40  527 527 SER SER C . n 
B 2 41  GLU 41  528 528 GLU GLU C . n 
B 2 42  LEU 42  529 529 LEU LEU C . n 
B 2 43  ALA 43  530 530 ALA ALA C . n 
B 2 44  ASN 44  531 531 ASN ASN C . n 
B 2 45  ALA 45  532 532 ALA ALA C . n 
B 2 46  ARG 46  533 533 ARG ARG C . n 
B 2 47  ASP 47  534 534 ASP ASP C . n 
B 2 48  GLU 48  535 535 GLU GLU C . n 
B 2 49  SER 49  536 536 SER SER C . n 
B 2 50  LYS 50  537 537 LYS LYS C . n 
B 2 51  LYS 51  538 538 LYS LYS C . n 
B 2 52  THR 52  539 539 THR THR C . n 
B 2 53  ALA 53  540 540 ALA ALA C . n 
B 2 54  ASN 54  541 541 ASN ASN C . n 
B 2 55  ASP 55  542 542 ASP ASP C . n 
B 2 56  MSE 56  543 543 MSE MSE C . n 
B 2 57  ILE 57  544 544 ILE ILE C . n 
B 2 58  HIS 58  545 545 HIS HIS C . n 
B 2 59  ALA 59  546 546 ALA ALA C . n 
B 2 60  GLU 60  547 547 GLU GLU C . n 
B 2 61  ASN 61  548 548 ASN ASN C . n 
B 2 62  MSE 62  549 549 MSE MSE C . n 
B 2 63  ARG 63  550 550 ARG ARG C . n 
B 2 64  LEU 64  551 551 LEU LEU C . n 
B 2 65  GLY 65  552 552 GLY GLY C . n 
B 2 66  ARG 66  553 553 ARG ARG C . n 
B 2 67  ASP 67  554 554 ASP ASP C . n 
B 2 68  LYS 68  555 555 LYS LYS C . n 
B 2 69  TYR 69  556 556 TYR TYR C . n 
B 2 70  LYS 70  557 557 LYS LYS C . n 
B 2 71  THR 71  558 558 THR THR C . n 
B 2 72  LEU 72  559 559 LEU LEU C . n 
B 2 73  ARG 73  560 560 ARG ARG C . n 
B 2 74  GLN 74  561 561 GLN GLN C . n 
B 2 75  ILE 75  562 562 ILE ILE C . n 
B 2 76  ARG 76  563 563 ARG ARG C . n 
B 2 77  GLN 77  564 564 GLN GLN C . n 
B 2 78  GLY 78  565 565 GLY GLY C . n 
B 2 79  ASN 79  566 566 ASN ASN C . n 
B 2 80  THR 80  567 567 THR THR C . n 
B 2 81  LYS 81  568 568 LYS LYS C . n 
B 2 82  GLN 82  569 569 GLN GLN C . n 
B 2 83  ARG 83  570 570 ARG ARG C . n 
B 2 84  ILE 84  571 571 ILE ILE C . n 
B 2 85  ASP 85  572 572 ASP ASP C . n 
B 2 86  GLU 86  573 573 GLU GLU C . n 
B 2 87  PHE 87  574 574 PHE PHE C . n 
B 2 88  GLU 88  575 575 GLU GLU C . n 
B 2 89  SER 89  576 576 SER SER C . n 
B 2 90  MSE 90  577 577 MSE MSE C . n 
C 1 1   THR 1   4   4   THR THR B . n 
C 1 2   ILE 2   5   5   ILE ILE B . n 
C 1 3   SER 3   6   6   SER SER B . n 
C 1 4   VAL 4   7   7   VAL VAL B . n 
C 1 5   ARG 5   8   8   ARG ARG B . n 
C 1 6   VAL 6   9   9   VAL VAL B . n 
C 1 7   THR 7   10  10  THR THR B . n 
C 1 8   THR 8   11  11  THR THR B . n 
C 1 9   MSE 9   12  12  MSE MSE B . n 
C 1 10  ASP 10  13  13  ASP ASP B . n 
C 1 11  ALA 11  14  14  ALA ALA B . n 
C 1 12  GLU 12  15  15  GLU GLU B . n 
C 1 13  LEU 13  16  16  LEU LEU B . n 
C 1 14  GLU 14  17  17  GLU GLU B . n 
C 1 15  PHE 15  18  18  PHE PHE B . n 
C 1 16  ALA 16  19  19  ALA ALA B . n 
C 1 17  ILE 17  20  20  ILE ILE B . n 
C 1 18  GLN 18  21  21  GLN GLN B . n 
C 1 19  PRO 19  22  22  PRO PRO B . n 
C 1 20  ASN 20  23  23  ASN ASN B . n 
C 1 21  THR 21  24  24  THR THR B . n 
C 1 22  THR 22  25  25  THR THR B . n 
C 1 23  GLY 23  26  26  GLY GLY B . n 
C 1 24  LYS 24  27  27  LYS LYS B . n 
C 1 25  GLN 25  28  28  GLN GLN B . n 
C 1 26  LEU 26  29  29  LEU LEU B . n 
C 1 27  PHE 27  30  30  PHE PHE B . n 
C 1 28  ASP 28  31  31  ASP ASP B . n 
C 1 29  GLN 29  32  32  GLN GLN B . n 
C 1 30  VAL 30  33  33  VAL VAL B . n 
C 1 31  VAL 31  34  34  VAL VAL B . n 
C 1 32  LYS 32  35  35  LYS LYS B . n 
C 1 33  THR 33  36  36  THR THR B . n 
C 1 34  ILE 34  37  37  ILE ILE B . n 
C 1 35  GLY 35  38  38  GLY GLY B . n 
C 1 36  LEU 36  39  39  LEU LEU B . n 
C 1 37  ARG 37  40  40  ARG ARG B . n 
C 1 38  GLU 38  41  41  GLU GLU B . n 
C 1 39  VAL 39  42  42  VAL VAL B . n 
C 1 40  TRP 40  43  43  TRP TRP B . n 
C 1 41  PHE 41  44  44  PHE PHE B . n 
C 1 42  PHE 42  45  45  PHE PHE B . n 
C 1 43  GLY 43  46  46  GLY GLY B . n 
C 1 44  LEU 44  47  47  LEU LEU B . n 
C 1 45  GLN 45  48  48  GLN GLN B . n 
C 1 46  TYR 46  49  49  TYR TYR B . n 
C 1 47  GLN 47  50  50  GLN GLN B . n 
C 1 48  ASP 48  51  51  ASP ASP B . n 
C 1 49  THR 49  52  52  THR THR B . n 
C 1 50  LYS 50  53  53  LYS LYS B . n 
C 1 51  GLY 51  54  54  GLY GLY B . n 
C 1 52  PHE 52  55  55  PHE PHE B . n 
C 1 53  SER 53  56  56  SER SER B . n 
C 1 54  THR 54  57  57  THR THR B . n 
C 1 55  TRP 55  58  58  TRP TRP B . n 
C 1 56  LEU 56  59  59  LEU LEU B . n 
C 1 57  LYS 57  60  60  LYS LYS B . n 
C 1 58  LEU 58  61  61  LEU LEU B . n 
C 1 59  ASN 59  62  62  ASN ASN B . n 
C 1 60  LYS 60  63  63  LYS LYS B . n 
C 1 61  LYS 61  64  64  LYS ALA B . n 
C 1 62  VAL 62  65  65  VAL VAL B . n 
C 1 63  THR 63  66  66  THR THR B . n 
C 1 64  ALA 64  67  67  ALA ALA B . n 
C 1 65  GLN 65  68  68  GLN GLN B . n 
C 1 66  ASP 66  69  69  ASP ALA B . n 
C 1 67  VAL 67  70  70  VAL VAL B . n 
C 1 68  ARG 68  71  71  ARG ARG B . n 
C 1 69  LYS 69  72  72  LYS ALA B . n 
C 1 70  GLU 70  73  73  GLU GLU B . n 
C 1 71  SER 71  74  74  SER SER B . n 
C 1 72  PRO 72  75  75  PRO PRO B . n 
C 1 73  LEU 73  76  76  LEU LEU B . n 
C 1 74  LEU 74  77  77  LEU LEU B . n 
C 1 75  PHE 75  78  78  PHE PHE B . n 
C 1 76  LYS 76  79  79  LYS LYS B . n 
C 1 77  PHE 77  80  80  PHE PHE B . n 
C 1 78  ARG 78  81  81  ARG ARG B . n 
C 1 79  ALA 79  82  82  ALA ALA B . n 
C 1 80  LYS 80  83  83  LYS LYS B . n 
C 1 81  PHE 81  84  84  PHE PHE B . n 
C 1 82  TYR 82  85  85  TYR TYR B . n 
C 1 83  PRO 83  86  86  PRO PRO B . n 
C 1 84  GLU 84  87  87  GLU GLU B . n 
C 1 85  ASP 85  88  88  ASP ASP B . n 
C 1 86  VAL 86  89  89  VAL VAL B . n 
C 1 87  SER 87  90  90  SER SER B . n 
C 1 88  GLU 88  91  91  GLU GLU B . n 
C 1 89  GLU 89  92  92  GLU GLU B . n 
C 1 90  LEU 90  93  93  LEU LEU B . n 
C 1 91  ILE 91  94  94  ILE ILE B . n 
C 1 92  GLN 92  95  95  GLN GLN B . n 
C 1 93  ASP 93  96  96  ASP ASP B . n 
C 1 94  ILE 94  97  97  ILE ILE B . n 
C 1 95  THR 95  98  98  THR THR B . n 
C 1 96  GLN 96  99  99  GLN GLN B . n 
C 1 97  ARG 97  100 100 ARG ARG B . n 
C 1 98  LEU 98  101 101 LEU LEU B . n 
C 1 99  PHE 99  102 102 PHE PHE B . n 
C 1 100 PHE 100 103 103 PHE PHE B . n 
C 1 101 LEU 101 104 104 LEU LEU B . n 
C 1 102 GLN 102 105 105 GLN GLN B . n 
C 1 103 VAL 103 106 106 VAL VAL B . n 
C 1 104 LYS 104 107 107 LYS LYS B . n 
C 1 105 GLU 105 108 108 GLU GLU B . n 
C 1 106 GLY 106 109 109 GLY GLY B . n 
C 1 107 ILE 107 110 110 ILE ILE B . n 
C 1 108 LEU 108 111 111 LEU LEU B . n 
C 1 109 ASN 109 112 112 ASN ASN B . n 
C 1 110 ASP 110 113 113 ASP ASP B . n 
C 1 111 ASP 111 114 114 ASP ASP B . n 
C 1 112 ILE 112 115 115 ILE ILE B . n 
C 1 113 TYR 113 116 116 TYR TYR B . n 
C 1 114 CYS 114 117 117 CYS CYS B . n 
C 1 115 PRO 115 118 118 PRO PRO B . n 
C 1 116 PRO 116 119 119 PRO PRO B . n 
C 1 117 GLU 117 120 120 GLU GLU B . n 
C 1 118 THR 118 121 121 THR THR B . n 
C 1 119 ALA 119 122 122 ALA ALA B . n 
C 1 120 VAL 120 123 123 VAL VAL B . n 
C 1 121 LEU 121 124 124 LEU LEU B . n 
C 1 122 LEU 122 125 125 LEU LEU B . n 
C 1 123 ALA 123 126 126 ALA ALA B . n 
C 1 124 SER 124 127 127 SER SER B . n 
C 1 125 TYR 125 128 128 TYR TYR B . n 
C 1 126 ALA 126 129 129 ALA ALA B . n 
C 1 127 VAL 127 130 130 VAL VAL B . n 
C 1 128 GLN 128 131 131 GLN GLN B . n 
C 1 129 SER 129 132 132 SER SER B . n 
C 1 130 LYS 130 133 133 LYS LYS B . n 
C 1 131 TYR 131 134 134 TYR TYR B . n 
C 1 132 GLY 132 135 135 GLY GLY B . n 
C 1 133 ASP 133 136 136 ASP ASP B . n 
C 1 134 PHE 134 137 137 PHE PHE B . n 
C 1 135 ASN 135 138 138 ASN ASN B . n 
C 1 136 LYS 136 139 139 LYS ALA B . n 
C 1 137 GLU 137 140 140 GLU GLU B . n 
C 1 138 VAL 138 141 141 VAL VAL B . n 
C 1 139 HIS 139 142 142 HIS HIS B . n 
C 1 140 LYS 140 143 143 LYS LYS B . n 
C 1 141 SER 141 144 144 SER SER B . n 
C 1 142 GLY 142 145 145 GLY GLY B . n 
C 1 143 TYR 143 146 146 TYR TYR B . n 
C 1 144 LEU 144 147 147 LEU LEU B . n 
C 1 145 ALA 145 148 148 ALA ALA B . n 
C 1 146 GLY 146 149 149 GLY GLY B . n 
C 1 147 ASP 147 150 150 ASP ASP B . n 
C 1 148 LYS 148 151 151 LYS LYS B . n 
C 1 149 LEU 149 152 152 LEU LEU B . n 
C 1 150 LEU 150 153 153 LEU LEU B . n 
C 1 151 PRO 151 154 154 PRO PRO B . n 
C 1 152 GLN 152 155 155 GLN GLN B . n 
C 1 153 ARG 153 156 156 ARG ARG B . n 
C 1 154 VAL 154 157 157 VAL VAL B . n 
C 1 155 LEU 155 158 158 LEU LEU B . n 
C 1 156 GLU 156 159 159 GLU GLU B . n 
C 1 157 GLN 157 160 160 GLN GLN B . n 
C 1 158 HIS 158 161 161 HIS HIS B . n 
C 1 159 LYS 159 162 162 LYS LYS B . n 
C 1 160 LEU 160 163 163 LEU LEU B . n 
C 1 161 ASN 161 164 164 ASN ASN B . n 
C 1 162 LYS 162 165 165 LYS LYS B . n 
C 1 163 ASP 163 166 166 ASP ASP B . n 
C 1 164 GLN 164 167 167 GLN GLN B . n 
C 1 165 TRP 165 168 168 TRP TRP B . n 
C 1 166 GLU 166 169 169 GLU GLU B . n 
C 1 167 GLU 167 170 170 GLU GLU B . n 
C 1 168 ARG 168 171 171 ARG ARG B . n 
C 1 169 ILE 169 172 172 ILE ILE B . n 
C 1 170 GLN 170 173 173 GLN GLN B . n 
C 1 171 VAL 171 174 174 VAL VAL B . n 
C 1 172 TRP 172 175 175 TRP TRP B . n 
C 1 173 HIS 173 176 176 HIS HIS B . n 
C 1 174 GLU 174 177 177 GLU GLU B . n 
C 1 175 GLU 175 178 178 GLU GLU B . n 
C 1 176 HIS 176 179 179 HIS HIS B . n 
C 1 177 ARG 177 180 180 ARG ARG B . n 
C 1 178 GLY 178 181 181 GLY GLY B . n 
C 1 179 MSE 179 182 182 MSE MSE B . n 
C 1 180 LEU 180 183 183 LEU LEU B . n 
C 1 181 ARG 181 184 184 ARG ARG B . n 
C 1 182 GLU 182 185 185 GLU GLU B . n 
C 1 183 ASP 183 186 186 ASP ASP B . n 
C 1 184 ALA 184 187 187 ALA ALA B . n 
C 1 185 VAL 185 188 188 VAL VAL B . n 
C 1 186 LEU 186 189 189 LEU LEU B . n 
C 1 187 GLU 187 190 190 GLU GLU B . n 
C 1 188 TYR 188 191 191 TYR TYR B . n 
C 1 189 LEU 189 192 192 LEU LEU B . n 
C 1 190 LYS 190 193 193 LYS LYS B . n 
C 1 191 ILE 191 194 194 ILE ILE B . n 
C 1 192 ALA 192 195 195 ALA ALA B . n 
C 1 193 GLN 193 196 196 GLN GLN B . n 
C 1 194 ASP 194 197 197 ASP ASP B . n 
C 1 195 LEU 195 198 198 LEU LEU B . n 
C 1 196 GLU 196 199 199 GLU GLU B . n 
C 1 197 MSE 197 200 200 MSE MSE B . n 
C 1 198 TYR 198 201 201 TYR TYR B . n 
C 1 199 GLY 199 202 202 GLY GLY B . n 
C 1 200 VAL 200 203 203 VAL VAL B . n 
C 1 201 ASN 201 204 204 ASN ASN B . n 
C 1 202 TYR 202 205 205 TYR TYR B . n 
C 1 203 PHE 203 206 206 PHE PHE B . n 
C 1 204 SER 204 207 207 SER SER B . n 
C 1 205 ILE 205 208 208 ILE ILE B . n 
C 1 206 LYS 206 209 209 LYS LYS B . n 
C 1 207 ASN 207 210 210 ASN ASN B . n 
C 1 208 LYS 208 211 211 LYS LYS B . n 
C 1 209 LYS 209 212 212 LYS LYS B . n 
C 1 210 GLY 210 213 213 GLY GLY B . n 
C 1 211 SER 211 214 214 SER SER B . n 
C 1 212 GLU 212 215 215 GLU GLU B . n 
C 1 213 LEU 213 216 216 LEU LEU B . n 
C 1 214 TRP 214 217 217 TRP TRP B . n 
C 1 215 LEU 215 218 218 LEU LEU B . n 
C 1 216 GLY 216 219 219 GLY GLY B . n 
C 1 217 VAL 217 220 220 VAL VAL B . n 
C 1 218 ASP 218 221 221 ASP ASP B . n 
C 1 219 ALA 219 222 222 ALA ALA B . n 
C 1 220 LEU 220 223 223 LEU LEU B . n 
C 1 221 GLY 221 224 224 GLY GLY B . n 
C 1 222 LEU 222 225 225 LEU LEU B . n 
C 1 223 ASN 223 226 226 ASN ASN B . n 
C 1 224 ILE 224 227 227 ILE ILE B . n 
C 1 225 TYR 225 228 228 TYR TYR B . n 
C 1 226 GLU 226 229 229 GLU GLU B . n 
C 1 227 GLN 227 230 230 GLN GLN B . n 
C 1 228 ASN 228 231 231 ASN ASN B . n 
C 1 229 ASP 229 232 232 ASP ASP B . n 
C 1 230 ARG 230 233 233 ARG ARG B . n 
C 1 231 LEU 231 234 234 LEU LEU B . n 
C 1 232 THR 232 235 235 THR THR B . n 
C 1 233 PRO 233 236 236 PRO PRO B . n 
C 1 234 LYS 234 237 237 LYS LYS B . n 
C 1 235 ILE 235 238 238 ILE ILE B . n 
C 1 236 GLY 236 239 239 GLY GLY B . n 
C 1 237 PHE 237 240 240 PHE PHE B . n 
C 1 238 PRO 238 241 241 PRO PRO B . n 
C 1 239 TRP 239 242 242 TRP TRP B . n 
C 1 240 SER 240 243 243 SER SER B . n 
C 1 241 GLU 241 244 244 GLU GLU B . n 
C 1 242 ILE 242 245 245 ILE ILE B . n 
C 1 243 ARG 243 246 246 ARG ARG B . n 
C 1 244 ASN 244 247 247 ASN ASN B . n 
C 1 245 ILE 245 248 248 ILE ILE B . n 
C 1 246 SER 246 249 249 SER SER B . n 
C 1 247 PHE 247 250 250 PHE PHE B . n 
C 1 248 ASN 248 251 251 ASN ASN B . n 
C 1 249 ASP 249 252 252 ASP ASP B . n 
C 1 250 LYS 250 253 253 LYS LYS B . n 
C 1 251 LYS 251 254 254 LYS LYS B . n 
C 1 252 PHE 252 255 255 PHE PHE B . n 
C 1 253 VAL 253 256 256 VAL VAL B . n 
C 1 254 ILE 254 257 257 ILE ILE B . n 
C 1 255 LYS 255 258 258 LYS LYS B . n 
C 1 256 PRO 256 259 259 PRO PRO B . n 
C 1 257 ILE 257 260 260 ILE ILE B . n 
C 1 258 ASP 258 261 261 ASP ASP B . n 
C 1 259 LYS 259 262 262 LYS LYS B . n 
C 1 260 LYS 260 263 263 LYS LYS B . n 
C 1 261 ALA 261 264 264 ALA ALA B . n 
C 1 262 PRO 262 265 265 PRO PRO B . n 
C 1 263 ASP 263 266 266 ASP ASP B . n 
C 1 264 PHE 264 267 267 PHE PHE B . n 
C 1 265 VAL 265 268 268 VAL VAL B . n 
C 1 266 PHE 266 269 269 PHE PHE B . n 
C 1 267 TYR 267 270 270 TYR TYR B . n 
C 1 268 ALA 268 271 271 ALA ALA B . n 
C 1 269 PRO 269 272 272 PRO PRO B . n 
C 1 270 ARG 270 273 273 ARG ARG B . n 
C 1 271 LEU 271 274 274 LEU LEU B . n 
C 1 272 ARG 272 275 275 ARG ARG B . n 
C 1 273 ILE 273 276 276 ILE ILE B . n 
C 1 274 ASN 274 277 277 ASN ASN B . n 
C 1 275 LYS 275 278 278 LYS LYS B . n 
C 1 276 ARG 276 279 279 ARG ARG B . n 
C 1 277 ILE 277 280 280 ILE ILE B . n 
C 1 278 LEU 278 281 281 LEU LEU B . n 
C 1 279 ALA 279 282 282 ALA ALA B . n 
C 1 280 LEU 280 283 283 LEU LEU B . n 
C 1 281 CYS 281 284 284 CYS CYS B . n 
C 1 282 MSE 282 285 285 MSE MSE B . n 
C 1 283 GLY 283 286 286 GLY GLY B . n 
C 1 284 ASN 284 287 287 ASN ASN B . n 
C 1 285 HIS 285 288 288 HIS HIS B . n 
C 1 286 GLU 286 289 289 GLU GLU B . n 
C 1 287 LEU 287 290 290 LEU LEU B . n 
C 1 288 TYR 288 291 291 TYR TYR B . n 
C 1 289 MSE 289 292 292 MSE MSE B . n 
C 1 290 ARG 290 293 293 ARG ARG B . n 
C 1 291 ARG 291 294 294 ARG ARG B . n 
C 1 292 ARG 292 295 295 ARG ARG B . n 
C 1 293 LYS 293 296 296 LYS LYS B . n 
C 1 294 PRO 294 297 297 PRO PRO B . n 
D 2 1   ALA 1   488 488 ALA ALA D . n 
D 2 2   GLU 2   489 489 GLU GLU D . n 
D 2 3   ALA 3   490 490 ALA ALA D . n 
D 2 4   SER 4   491 491 SER SER D . n 
D 2 5   ALA 5   492 492 ALA ALA D . n 
D 2 6   ASP 6   493 493 ASP ASP D . n 
D 2 7   LEU 7   494 494 LEU LEU D . n 
D 2 8   ARG 8   495 495 ARG ALA D . n 
D 2 9   ALA 9   496 496 ALA ALA D . n 
D 2 10  ASP 10  497 497 ASP ALA D . n 
D 2 11  ALA 11  498 498 ALA ALA D . n 
D 2 12  MET 12  499 499 MET ALA D . n 
D 2 13  ALA 13  500 500 ALA ALA D . n 
D 2 14  LYS 14  501 501 LYS LYS D . n 
D 2 15  ASP 15  502 502 ASP ASP D . n 
D 2 16  ARG 16  503 503 ARG ARG D . n 
D 2 17  SER 17  504 504 SER SER D . n 
D 2 18  GLU 18  505 505 GLU GLU D . n 
D 2 19  GLU 19  506 506 GLU GLU D . n 
D 2 20  GLU 20  507 507 GLU GLU D . n 
D 2 21  ARG 21  508 508 ARG ARG D . n 
D 2 22  THR 22  509 509 THR THR D . n 
D 2 23  THR 23  510 510 THR THR D . n 
D 2 24  GLU 24  511 511 GLU GLU D . n 
D 2 25  ALA 25  512 512 ALA ALA D . n 
D 2 26  GLU 26  513 513 GLU GLU D . n 
D 2 27  LYS 27  514 514 LYS LYS D . n 
D 2 28  ASN 28  515 515 ASN ASN D . n 
D 2 29  GLU 29  516 516 GLU ALA D . n 
D 2 30  ARG 30  517 517 ARG ALA D . n 
D 2 31  VAL 31  518 518 VAL VAL D . n 
D 2 32  GLN 32  519 519 GLN GLN D . n 
D 2 33  LYS 33  520 520 LYS LYS D . n 
D 2 34  HIS 34  521 521 HIS HIS D . n 
D 2 35  LEU 35  522 522 LEU LEU D . n 
D 2 36  LYS 36  523 523 LYS LYS D . n 
D 2 37  ALA 37  524 524 ALA ALA D . n 
D 2 38  LEU 38  525 525 LEU LEU D . n 
D 2 39  THR 39  526 526 THR THR D . n 
D 2 40  SER 40  527 527 SER SER D . n 
D 2 41  GLU 41  528 528 GLU GLU D . n 
D 2 42  LEU 42  529 529 LEU LEU D . n 
D 2 43  ALA 43  530 530 ALA ALA D . n 
D 2 44  ASN 44  531 531 ASN ASN D . n 
D 2 45  ALA 45  532 532 ALA ALA D . n 
D 2 46  ARG 46  533 533 ARG ARG D . n 
D 2 47  ASP 47  534 534 ASP ASP D . n 
D 2 48  GLU 48  535 535 GLU GLU D . n 
D 2 49  SER 49  536 536 SER SER D . n 
D 2 50  LYS 50  537 537 LYS LYS D . n 
D 2 51  LYS 51  538 538 LYS LYS D . n 
D 2 52  THR 52  539 539 THR THR D . n 
D 2 53  ALA 53  540 540 ALA ALA D . n 
D 2 54  ASN 54  541 541 ASN ASN D . n 
D 2 55  ASP 55  542 542 ASP ASP D . n 
D 2 56  MSE 56  543 543 MSE MSE D . n 
D 2 57  ILE 57  544 544 ILE ILE D . n 
D 2 58  HIS 58  545 545 HIS HIS D . n 
D 2 59  ALA 59  546 546 ALA ALA D . n 
D 2 60  GLU 60  547 547 GLU GLU D . n 
D 2 61  ASN 61  548 548 ASN ASN D . n 
D 2 62  MSE 62  549 549 MSE MSE D . n 
D 2 63  ARG 63  550 550 ARG ARG D . n 
D 2 64  LEU 64  551 551 LEU LEU D . n 
D 2 65  GLY 65  552 552 GLY GLY D . n 
D 2 66  ARG 66  553 553 ARG ARG D . n 
D 2 67  ASP 67  554 554 ASP ASP D . n 
D 2 68  LYS 68  555 555 LYS LYS D . n 
D 2 69  TYR 69  556 556 TYR TYR D . n 
D 2 70  LYS 70  557 557 LYS LYS D . n 
D 2 71  THR 71  558 558 THR THR D . n 
D 2 72  LEU 72  559 559 LEU LEU D . n 
D 2 73  ARG 73  560 560 ARG ARG D . n 
D 2 74  GLN 74  561 561 GLN GLN D . n 
D 2 75  ILE 75  562 562 ILE ILE D . n 
D 2 76  ARG 76  563 563 ARG ARG D . n 
D 2 77  GLN 77  564 564 GLN GLN D . n 
D 2 78  GLY 78  565 565 GLY GLY D . n 
D 2 79  ASN 79  566 566 ASN ASN D . n 
D 2 80  THR 80  567 567 THR THR D . n 
D 2 81  LYS 81  568 568 LYS LYS D . n 
D 2 82  GLN 82  569 569 GLN GLN D . n 
D 2 83  ARG 83  570 570 ARG ARG D . n 
D 2 84  ILE 84  571 571 ILE ILE D . n 
D 2 85  ASP 85  572 572 ASP ASP D . n 
D 2 86  GLU 86  573 573 GLU GLU D . n 
D 2 87  PHE 87  574 574 PHE PHE D . n 
D 2 88  GLU 88  575 575 GLU GLU D . n 
D 2 89  SER 89  576 576 SER SER D . n 
D 2 90  MSE 90  577 577 MSE MSE D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 9   A MSE 12  ? MET SELENOMETHIONINE 
2  A MSE 179 A MSE 182 ? MET SELENOMETHIONINE 
3  A MSE 197 A MSE 200 ? MET SELENOMETHIONINE 
4  A MSE 282 A MSE 285 ? MET SELENOMETHIONINE 
5  A MSE 289 A MSE 292 ? MET SELENOMETHIONINE 
6  B MSE 56  C MSE 543 ? MET SELENOMETHIONINE 
7  B MSE 62  C MSE 549 ? MET SELENOMETHIONINE 
8  B MSE 90  C MSE 577 ? MET SELENOMETHIONINE 
9  C MSE 9   B MSE 12  ? MET SELENOMETHIONINE 
10 C MSE 179 B MSE 182 ? MET SELENOMETHIONINE 
11 C MSE 197 B MSE 200 ? MET SELENOMETHIONINE 
12 C MSE 282 B MSE 285 ? MET SELENOMETHIONINE 
13 C MSE 289 B MSE 292 ? MET SELENOMETHIONINE 
14 D MSE 56  D MSE 543 ? MET SELENOMETHIONINE 
15 D MSE 62  D MSE 549 ? MET SELENOMETHIONINE 
16 D MSE 90  D MSE 577 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?        tetrameric 4 
2 software_defined_assembly PISA,PQS tetrameric 4 
3 software_defined_assembly PQS      tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E,F,G,H,I,J 
2 1,2 C,D,F,I,J           
3 1,3 A,B,E,G,H           
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 13880 ? 
2 MORE         -96   ? 
2 'SSA (A^2)'  35120 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 153.3000000000 0.0000000000 0.0000000000 -1.0000000000 112.1000000000 
3 'crystal symmetry operation' 4_576 x,-y+2,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 306.6000000000 0.0000000000 0.0000000000 -1.0000000000 112.1000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    SO4 
_pdbx_struct_special_symmetry.auth_seq_id     2001 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   SO4 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-05-10 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MADSYS phasing          .         ? 1 
X-PLOR refinement       3.851     ? 2 
MOSFLM 'data reduction' .         ? 3 
CCP4   'data scaling'   '(SCALA)' ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            SE 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            MSE 
_pdbx_validate_rmsd_bond.auth_seq_id_1             200 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CE 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            MSE 
_pdbx_validate_rmsd_bond.auth_seq_id_2             200 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.386 
_pdbx_validate_rmsd_bond.bond_target_value         1.950 
_pdbx_validate_rmsd_bond.bond_deviation            -0.564 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.059 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 197 ? ? CG A ASP 197 ? ? OD2 A ASP 197 ? ? 123.80 118.30 5.50 0.90 N 
2 1 C  A LYS 258 ? ? N  A PRO 259 ? ? CA  A PRO 259 ? ? 128.44 119.30 9.14 1.50 Y 
3 1 C  A LYS 296 ? ? N  A PRO 297 ? ? CA  A PRO 297 ? ? 128.82 119.30 9.52 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 13  ? ? -147.59 28.05   
2  1 ARG A 71  ? ? -60.78  97.14   
3  1 LYS A 72  ? ? -49.70  109.33  
4  1 LYS A 212 ? ? -69.04  1.11    
5  1 ASP A 252 ? ? 58.92   -116.48 
6  1 ASP A 261 ? ? 169.93  -114.85 
7  1 LYS A 262 ? ? -179.71 -24.41  
8  1 ALA C 500 ? ? -67.97  -173.05 
9  1 LYS C 501 ? ? 171.71  135.50  
10 1 ASP B 13  ? ? -140.34 21.62   
11 1 ASP B 69  ? ? -75.25  45.67   
12 1 ARG B 71  ? ? -54.56  91.79   
13 1 LYS B 72  ? ? -45.46  109.83  
14 1 LEU B 93  ? ? -112.71 74.40   
15 1 SER B 243 ? ? -63.25  0.67    
16 1 ASP B 252 ? ? 66.96   -114.24 
17 1 ASP B 261 ? ? 170.56  -113.10 
18 1 LYS B 262 ? ? -178.34 -32.44  
19 1 ALA D 492 ? ? -167.18 117.99  
20 1 ASP D 497 ? ? -104.64 63.19   
21 1 ALA D 498 ? ? -34.75  105.83  
22 1 ARG D 503 ? ? 58.69   13.84   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 64  ? CG  ? A LYS 61  CG  
2  1 Y 1 A LYS 64  ? CD  ? A LYS 61  CD  
3  1 Y 1 A LYS 64  ? CE  ? A LYS 61  CE  
4  1 Y 1 A LYS 64  ? NZ  ? A LYS 61  NZ  
5  1 Y 1 A ASP 69  ? CG  ? A ASP 66  CG  
6  1 Y 1 A ASP 69  ? OD1 ? A ASP 66  OD1 
7  1 Y 1 A ASP 69  ? OD2 ? A ASP 66  OD2 
8  1 Y 1 A LYS 72  ? CG  ? A LYS 69  CG  
9  1 Y 1 A LYS 72  ? CD  ? A LYS 69  CD  
10 1 Y 1 A LYS 72  ? CE  ? A LYS 69  CE  
11 1 Y 1 A LYS 72  ? NZ  ? A LYS 69  NZ  
12 1 Y 1 A LYS 139 ? CG  ? A LYS 136 CG  
13 1 Y 1 A LYS 139 ? CD  ? A LYS 136 CD  
14 1 Y 1 A LYS 139 ? CE  ? A LYS 136 CE  
15 1 Y 1 A LYS 139 ? NZ  ? A LYS 136 NZ  
16 1 Y 1 C ARG 495 ? CG  ? B ARG 8   CG  
17 1 Y 1 C ARG 495 ? CD  ? B ARG 8   CD  
18 1 Y 1 C ARG 495 ? NE  ? B ARG 8   NE  
19 1 Y 1 C ARG 495 ? CZ  ? B ARG 8   CZ  
20 1 Y 1 C ARG 495 ? NH1 ? B ARG 8   NH1 
21 1 Y 1 C ARG 495 ? NH2 ? B ARG 8   NH2 
22 1 Y 1 C ASP 497 ? CG  ? B ASP 10  CG  
23 1 Y 1 C ASP 497 ? OD1 ? B ASP 10  OD1 
24 1 Y 1 C ASP 497 ? OD2 ? B ASP 10  OD2 
25 1 Y 1 C MET 499 ? CG  ? B MET 12  CG  
26 1 Y 1 C MET 499 ? SD  ? B MET 12  SD  
27 1 Y 1 C MET 499 ? CE  ? B MET 12  CE  
28 1 Y 1 C GLU 516 ? CG  ? B GLU 29  CG  
29 1 Y 1 C GLU 516 ? CD  ? B GLU 29  CD  
30 1 Y 1 C GLU 516 ? OE1 ? B GLU 29  OE1 
31 1 Y 1 C GLU 516 ? OE2 ? B GLU 29  OE2 
32 1 Y 1 C ARG 517 ? CG  ? B ARG 30  CG  
33 1 Y 1 C ARG 517 ? CD  ? B ARG 30  CD  
34 1 Y 1 C ARG 517 ? NE  ? B ARG 30  NE  
35 1 Y 1 C ARG 517 ? CZ  ? B ARG 30  CZ  
36 1 Y 1 C ARG 517 ? NH1 ? B ARG 30  NH1 
37 1 Y 1 C ARG 517 ? NH2 ? B ARG 30  NH2 
38 1 Y 1 B LYS 64  ? CG  ? C LYS 61  CG  
39 1 Y 1 B LYS 64  ? CD  ? C LYS 61  CD  
40 1 Y 1 B LYS 64  ? CE  ? C LYS 61  CE  
41 1 Y 1 B LYS 64  ? NZ  ? C LYS 61  NZ  
42 1 Y 1 B ASP 69  ? CG  ? C ASP 66  CG  
43 1 Y 1 B ASP 69  ? OD1 ? C ASP 66  OD1 
44 1 Y 1 B ASP 69  ? OD2 ? C ASP 66  OD2 
45 1 Y 1 B LYS 72  ? CG  ? C LYS 69  CG  
46 1 Y 1 B LYS 72  ? CD  ? C LYS 69  CD  
47 1 Y 1 B LYS 72  ? CE  ? C LYS 69  CE  
48 1 Y 1 B LYS 72  ? NZ  ? C LYS 69  NZ  
49 1 Y 1 B LYS 139 ? CG  ? C LYS 136 CG  
50 1 Y 1 B LYS 139 ? CD  ? C LYS 136 CD  
51 1 Y 1 B LYS 139 ? CE  ? C LYS 136 CE  
52 1 Y 1 B LYS 139 ? NZ  ? C LYS 136 NZ  
53 1 Y 1 D ARG 495 ? CG  ? D ARG 8   CG  
54 1 Y 1 D ARG 495 ? CD  ? D ARG 8   CD  
55 1 Y 1 D ARG 495 ? NE  ? D ARG 8   NE  
56 1 Y 1 D ARG 495 ? CZ  ? D ARG 8   CZ  
57 1 Y 1 D ARG 495 ? NH1 ? D ARG 8   NH1 
58 1 Y 1 D ARG 495 ? NH2 ? D ARG 8   NH2 
59 1 Y 1 D ASP 497 ? CG  ? D ASP 10  CG  
60 1 Y 1 D ASP 497 ? OD1 ? D ASP 10  OD1 
61 1 Y 1 D ASP 497 ? OD2 ? D ASP 10  OD2 
62 1 Y 1 D MET 499 ? CG  ? D MET 12  CG  
63 1 Y 1 D MET 499 ? SD  ? D MET 12  SD  
64 1 Y 1 D MET 499 ? CE  ? D MET 12  CE  
65 1 Y 1 D GLU 516 ? CG  ? D GLU 29  CG  
66 1 Y 1 D GLU 516 ? CD  ? D GLU 29  CD  
67 1 Y 1 D GLU 516 ? OE1 ? D GLU 29  OE1 
68 1 Y 1 D GLU 516 ? OE2 ? D GLU 29  OE2 
69 1 Y 1 D ARG 517 ? CG  ? D ARG 30  CG  
70 1 Y 1 D ARG 517 ? CD  ? D ARG 30  CD  
71 1 Y 1 D ARG 517 ? NE  ? D ARG 30  NE  
72 1 Y 1 D ARG 517 ? CZ  ? D ARG 30  CZ  
73 1 Y 1 D ARG 517 ? NH1 ? D ARG 30  NH1 
74 1 Y 1 D ARG 517 ? NH2 ? D ARG 30  NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 SO4 1   2001 2001 SO4 SO4 A . 
F 3 SO4 1   3001 3001 SO4 SO4 B . 
G 4 HOH 1   600  600  HOH HOH A . 
G 4 HOH 2   601  601  HOH HOH A . 
G 4 HOH 3   602  602  HOH HOH A . 
G 4 HOH 4   603  603  HOH HOH A . 
G 4 HOH 5   604  604  HOH HOH A . 
G 4 HOH 6   605  605  HOH HOH A . 
G 4 HOH 7   606  606  HOH HOH A . 
G 4 HOH 8   607  607  HOH HOH A . 
G 4 HOH 9   608  608  HOH HOH A . 
G 4 HOH 10  609  609  HOH HOH A . 
G 4 HOH 11  611  611  HOH HOH A . 
G 4 HOH 12  612  612  HOH HOH A . 
G 4 HOH 13  614  614  HOH HOH A . 
G 4 HOH 14  615  615  HOH HOH A . 
G 4 HOH 15  616  616  HOH HOH A . 
G 4 HOH 16  617  617  HOH HOH A . 
G 4 HOH 17  619  619  HOH HOH A . 
G 4 HOH 18  620  620  HOH HOH A . 
G 4 HOH 19  621  621  HOH HOH A . 
G 4 HOH 20  622  622  HOH HOH A . 
G 4 HOH 21  626  626  HOH HOH A . 
G 4 HOH 22  629  629  HOH HOH A . 
G 4 HOH 23  630  630  HOH HOH A . 
G 4 HOH 24  631  631  HOH HOH A . 
G 4 HOH 25  632  632  HOH HOH A . 
G 4 HOH 26  633  633  HOH HOH A . 
G 4 HOH 27  634  634  HOH HOH A . 
G 4 HOH 28  635  635  HOH HOH A . 
G 4 HOH 29  636  636  HOH HOH A . 
G 4 HOH 30  637  637  HOH HOH A . 
G 4 HOH 31  638  638  HOH HOH A . 
G 4 HOH 32  639  639  HOH HOH A . 
G 4 HOH 33  640  640  HOH HOH A . 
G 4 HOH 34  641  641  HOH HOH A . 
G 4 HOH 35  642  642  HOH HOH A . 
G 4 HOH 36  643  643  HOH HOH A . 
G 4 HOH 37  644  644  HOH HOH A . 
G 4 HOH 38  645  645  HOH HOH A . 
G 4 HOH 39  646  646  HOH HOH A . 
G 4 HOH 40  647  647  HOH HOH A . 
G 4 HOH 41  648  648  HOH HOH A . 
G 4 HOH 42  649  649  HOH HOH A . 
G 4 HOH 43  650  650  HOH HOH A . 
G 4 HOH 44  651  651  HOH HOH A . 
G 4 HOH 45  652  652  HOH HOH A . 
G 4 HOH 46  653  653  HOH HOH A . 
G 4 HOH 47  654  654  HOH HOH A . 
G 4 HOH 48  655  655  HOH HOH A . 
G 4 HOH 49  656  656  HOH HOH A . 
G 4 HOH 50  657  657  HOH HOH A . 
G 4 HOH 51  658  658  HOH HOH A . 
G 4 HOH 52  659  659  HOH HOH A . 
G 4 HOH 53  660  660  HOH HOH A . 
G 4 HOH 54  661  661  HOH HOH A . 
G 4 HOH 55  662  662  HOH HOH A . 
G 4 HOH 56  663  663  HOH HOH A . 
G 4 HOH 57  664  664  HOH HOH A . 
G 4 HOH 58  665  665  HOH HOH A . 
G 4 HOH 59  666  666  HOH HOH A . 
G 4 HOH 60  667  667  HOH HOH A . 
G 4 HOH 61  668  668  HOH HOH A . 
G 4 HOH 62  669  669  HOH HOH A . 
G 4 HOH 63  670  670  HOH HOH A . 
G 4 HOH 64  671  671  HOH HOH A . 
G 4 HOH 65  672  672  HOH HOH A . 
G 4 HOH 66  673  673  HOH HOH A . 
G 4 HOH 67  674  674  HOH HOH A . 
G 4 HOH 68  675  675  HOH HOH A . 
G 4 HOH 69  676  676  HOH HOH A . 
G 4 HOH 70  678  678  HOH HOH A . 
G 4 HOH 71  679  679  HOH HOH A . 
G 4 HOH 72  681  681  HOH HOH A . 
G 4 HOH 73  682  682  HOH HOH A . 
G 4 HOH 74  683  683  HOH HOH A . 
G 4 HOH 75  685  685  HOH HOH A . 
G 4 HOH 76  686  686  HOH HOH A . 
G 4 HOH 77  687  687  HOH HOH A . 
G 4 HOH 78  688  688  HOH HOH A . 
G 4 HOH 79  691  691  HOH HOH A . 
G 4 HOH 80  692  692  HOH HOH A . 
G 4 HOH 81  693  693  HOH HOH A . 
G 4 HOH 82  694  694  HOH HOH A . 
G 4 HOH 83  695  695  HOH HOH A . 
G 4 HOH 84  696  696  HOH HOH A . 
G 4 HOH 85  697  697  HOH HOH A . 
G 4 HOH 86  698  698  HOH HOH A . 
G 4 HOH 87  708  708  HOH HOH A . 
G 4 HOH 88  721  721  HOH HOH A . 
G 4 HOH 89  722  722  HOH HOH A . 
G 4 HOH 90  723  723  HOH HOH A . 
G 4 HOH 91  724  724  HOH HOH A . 
G 4 HOH 92  725  725  HOH HOH A . 
G 4 HOH 93  726  726  HOH HOH A . 
G 4 HOH 94  727  727  HOH HOH A . 
G 4 HOH 95  728  728  HOH HOH A . 
G 4 HOH 96  729  729  HOH HOH A . 
G 4 HOH 97  730  730  HOH HOH A . 
G 4 HOH 98  731  731  HOH HOH A . 
G 4 HOH 99  732  732  HOH HOH A . 
G 4 HOH 100 733  733  HOH HOH A . 
G 4 HOH 101 734  734  HOH HOH A . 
G 4 HOH 102 735  735  HOH HOH A . 
G 4 HOH 103 736  736  HOH HOH A . 
G 4 HOH 104 737  737  HOH HOH A . 
G 4 HOH 105 738  738  HOH HOH A . 
G 4 HOH 106 739  739  HOH HOH A . 
G 4 HOH 107 740  740  HOH HOH A . 
G 4 HOH 108 741  741  HOH HOH A . 
G 4 HOH 109 742  742  HOH HOH A . 
G 4 HOH 110 743  743  HOH HOH A . 
G 4 HOH 111 744  744  HOH HOH A . 
G 4 HOH 112 745  745  HOH HOH A . 
G 4 HOH 113 746  746  HOH HOH A . 
G 4 HOH 114 747  747  HOH HOH A . 
G 4 HOH 115 749  749  HOH HOH A . 
G 4 HOH 116 750  750  HOH HOH A . 
G 4 HOH 117 751  751  HOH HOH A . 
G 4 HOH 118 752  752  HOH HOH A . 
G 4 HOH 119 753  753  HOH HOH A . 
G 4 HOH 120 754  754  HOH HOH A . 
G 4 HOH 121 755  755  HOH HOH A . 
G 4 HOH 122 756  756  HOH HOH A . 
G 4 HOH 123 757  757  HOH HOH A . 
G 4 HOH 124 759  759  HOH HOH A . 
G 4 HOH 125 760  760  HOH HOH A . 
G 4 HOH 126 761  761  HOH HOH A . 
G 4 HOH 127 762  762  HOH HOH A . 
G 4 HOH 128 771  771  HOH HOH A . 
G 4 HOH 129 778  778  HOH HOH A . 
G 4 HOH 130 784  784  HOH HOH A . 
G 4 HOH 131 789  789  HOH HOH A . 
G 4 HOH 132 792  792  HOH HOH A . 
G 4 HOH 133 793  793  HOH HOH A . 
G 4 HOH 134 795  795  HOH HOH A . 
G 4 HOH 135 796  796  HOH HOH A . 
G 4 HOH 136 797  797  HOH HOH A . 
G 4 HOH 137 798  798  HOH HOH A . 
G 4 HOH 138 799  799  HOH HOH A . 
G 4 HOH 139 800  800  HOH HOH A . 
G 4 HOH 140 801  801  HOH HOH A . 
G 4 HOH 141 804  804  HOH HOH A . 
G 4 HOH 142 805  805  HOH HOH A . 
G 4 HOH 143 1702 1702 HOH HOH A . 
G 4 HOH 144 1703 1703 HOH HOH A . 
G 4 HOH 145 1758 1758 HOH HOH A . 
H 4 HOH 1   610  610  HOH HOH C . 
H 4 HOH 2   613  613  HOH HOH C . 
H 4 HOH 3   618  618  HOH HOH C . 
H 4 HOH 4   623  623  HOH HOH C . 
H 4 HOH 5   624  624  HOH HOH C . 
H 4 HOH 6   625  625  HOH HOH C . 
H 4 HOH 7   627  627  HOH HOH C . 
H 4 HOH 8   628  628  HOH HOH C . 
H 4 HOH 9   677  677  HOH HOH C . 
H 4 HOH 10  680  680  HOH HOH C . 
H 4 HOH 11  684  684  HOH HOH C . 
H 4 HOH 12  689  689  HOH HOH C . 
H 4 HOH 13  699  699  HOH HOH C . 
H 4 HOH 14  700  700  HOH HOH C . 
H 4 HOH 15  704  704  HOH HOH C . 
H 4 HOH 16  705  705  HOH HOH C . 
H 4 HOH 17  706  706  HOH HOH C . 
H 4 HOH 18  707  707  HOH HOH C . 
H 4 HOH 19  710  710  HOH HOH C . 
H 4 HOH 20  711  711  HOH HOH C . 
H 4 HOH 21  712  712  HOH HOH C . 
H 4 HOH 22  713  713  HOH HOH C . 
H 4 HOH 23  714  714  HOH HOH C . 
H 4 HOH 24  715  715  HOH HOH C . 
H 4 HOH 25  716  716  HOH HOH C . 
H 4 HOH 26  717  717  HOH HOH C . 
H 4 HOH 27  718  718  HOH HOH C . 
H 4 HOH 28  719  719  HOH HOH C . 
H 4 HOH 29  720  720  HOH HOH C . 
H 4 HOH 30  748  748  HOH HOH C . 
H 4 HOH 31  763  763  HOH HOH C . 
H 4 HOH 32  764  764  HOH HOH C . 
H 4 HOH 33  765  765  HOH HOH C . 
H 4 HOH 34  766  766  HOH HOH C . 
H 4 HOH 35  767  767  HOH HOH C . 
H 4 HOH 36  768  768  HOH HOH C . 
H 4 HOH 37  769  769  HOH HOH C . 
H 4 HOH 38  770  770  HOH HOH C . 
H 4 HOH 39  772  772  HOH HOH C . 
H 4 HOH 40  773  773  HOH HOH C . 
H 4 HOH 41  774  774  HOH HOH C . 
H 4 HOH 42  775  775  HOH HOH C . 
H 4 HOH 43  776  776  HOH HOH C . 
H 4 HOH 44  777  777  HOH HOH C . 
H 4 HOH 45  779  779  HOH HOH C . 
H 4 HOH 46  780  780  HOH HOH C . 
H 4 HOH 47  781  781  HOH HOH C . 
H 4 HOH 48  782  782  HOH HOH C . 
H 4 HOH 49  783  783  HOH HOH C . 
H 4 HOH 50  785  785  HOH HOH C . 
H 4 HOH 51  786  786  HOH HOH C . 
H 4 HOH 52  787  787  HOH HOH C . 
H 4 HOH 53  788  788  HOH HOH C . 
H 4 HOH 54  790  790  HOH HOH C . 
H 4 HOH 55  794  794  HOH HOH C . 
H 4 HOH 56  802  802  HOH HOH C . 
H 4 HOH 57  803  803  HOH HOH C . 
H 4 HOH 58  1690 1690 HOH HOH C . 
H 4 HOH 59  1791 1791 HOH HOH C . 
I 4 HOH 1   702  702  HOH HOH B . 
I 4 HOH 2   703  703  HOH HOH B . 
I 4 HOH 3   758  758  HOH HOH B . 
I 4 HOH 4   1600 1600 HOH HOH B . 
I 4 HOH 5   1601 1601 HOH HOH B . 
I 4 HOH 6   1602 1602 HOH HOH B . 
I 4 HOH 7   1603 1603 HOH HOH B . 
I 4 HOH 8   1604 1604 HOH HOH B . 
I 4 HOH 9   1605 1605 HOH HOH B . 
I 4 HOH 10  1606 1606 HOH HOH B . 
I 4 HOH 11  1607 1607 HOH HOH B . 
I 4 HOH 12  1608 1608 HOH HOH B . 
I 4 HOH 13  1609 1609 HOH HOH B . 
I 4 HOH 14  1611 1611 HOH HOH B . 
I 4 HOH 15  1612 1612 HOH HOH B . 
I 4 HOH 16  1614 1614 HOH HOH B . 
I 4 HOH 17  1615 1615 HOH HOH B . 
I 4 HOH 18  1616 1616 HOH HOH B . 
I 4 HOH 19  1617 1617 HOH HOH B . 
I 4 HOH 20  1618 1618 HOH HOH B . 
I 4 HOH 21  1619 1619 HOH HOH B . 
I 4 HOH 22  1620 1620 HOH HOH B . 
I 4 HOH 23  1621 1621 HOH HOH B . 
I 4 HOH 24  1622 1622 HOH HOH B . 
I 4 HOH 25  1624 1624 HOH HOH B . 
I 4 HOH 26  1629 1629 HOH HOH B . 
I 4 HOH 27  1630 1630 HOH HOH B . 
I 4 HOH 28  1631 1631 HOH HOH B . 
I 4 HOH 29  1632 1632 HOH HOH B . 
I 4 HOH 30  1633 1633 HOH HOH B . 
I 4 HOH 31  1634 1634 HOH HOH B . 
I 4 HOH 32  1635 1635 HOH HOH B . 
I 4 HOH 33  1636 1636 HOH HOH B . 
I 4 HOH 34  1637 1637 HOH HOH B . 
I 4 HOH 35  1638 1638 HOH HOH B . 
I 4 HOH 36  1639 1639 HOH HOH B . 
I 4 HOH 37  1640 1640 HOH HOH B . 
I 4 HOH 38  1641 1641 HOH HOH B . 
I 4 HOH 39  1642 1642 HOH HOH B . 
I 4 HOH 40  1643 1643 HOH HOH B . 
I 4 HOH 41  1644 1644 HOH HOH B . 
I 4 HOH 42  1645 1645 HOH HOH B . 
I 4 HOH 43  1646 1646 HOH HOH B . 
I 4 HOH 44  1647 1647 HOH HOH B . 
I 4 HOH 45  1648 1648 HOH HOH B . 
I 4 HOH 46  1649 1649 HOH HOH B . 
I 4 HOH 47  1650 1650 HOH HOH B . 
I 4 HOH 48  1651 1651 HOH HOH B . 
I 4 HOH 49  1652 1652 HOH HOH B . 
I 4 HOH 50  1653 1653 HOH HOH B . 
I 4 HOH 51  1654 1654 HOH HOH B . 
I 4 HOH 52  1655 1655 HOH HOH B . 
I 4 HOH 53  1656 1656 HOH HOH B . 
I 4 HOH 54  1657 1657 HOH HOH B . 
I 4 HOH 55  1658 1658 HOH HOH B . 
I 4 HOH 56  1659 1659 HOH HOH B . 
I 4 HOH 57  1660 1660 HOH HOH B . 
I 4 HOH 58  1661 1661 HOH HOH B . 
I 4 HOH 59  1662 1662 HOH HOH B . 
I 4 HOH 60  1663 1663 HOH HOH B . 
I 4 HOH 61  1664 1664 HOH HOH B . 
I 4 HOH 62  1665 1665 HOH HOH B . 
I 4 HOH 63  1666 1666 HOH HOH B . 
I 4 HOH 64  1667 1667 HOH HOH B . 
I 4 HOH 65  1668 1668 HOH HOH B . 
I 4 HOH 66  1669 1669 HOH HOH B . 
I 4 HOH 67  1670 1670 HOH HOH B . 
I 4 HOH 68  1671 1671 HOH HOH B . 
I 4 HOH 69  1672 1672 HOH HOH B . 
I 4 HOH 70  1673 1673 HOH HOH B . 
I 4 HOH 71  1674 1674 HOH HOH B . 
I 4 HOH 72  1675 1675 HOH HOH B . 
I 4 HOH 73  1676 1676 HOH HOH B . 
I 4 HOH 74  1678 1678 HOH HOH B . 
I 4 HOH 75  1679 1679 HOH HOH B . 
I 4 HOH 76  1681 1681 HOH HOH B . 
I 4 HOH 77  1682 1682 HOH HOH B . 
I 4 HOH 78  1683 1683 HOH HOH B . 
I 4 HOH 79  1685 1685 HOH HOH B . 
I 4 HOH 80  1686 1686 HOH HOH B . 
I 4 HOH 81  1687 1687 HOH HOH B . 
I 4 HOH 82  1688 1688 HOH HOH B . 
I 4 HOH 83  1689 1689 HOH HOH B . 
I 4 HOH 84  1691 1691 HOH HOH B . 
I 4 HOH 85  1692 1692 HOH HOH B . 
I 4 HOH 86  1693 1693 HOH HOH B . 
I 4 HOH 87  1694 1694 HOH HOH B . 
I 4 HOH 88  1695 1695 HOH HOH B . 
I 4 HOH 89  1696 1696 HOH HOH B . 
I 4 HOH 90  1697 1697 HOH HOH B . 
I 4 HOH 91  1698 1698 HOH HOH B . 
I 4 HOH 92  1699 1699 HOH HOH B . 
I 4 HOH 93  1721 1721 HOH HOH B . 
I 4 HOH 94  1722 1722 HOH HOH B . 
I 4 HOH 95  1723 1723 HOH HOH B . 
I 4 HOH 96  1724 1724 HOH HOH B . 
I 4 HOH 97  1725 1725 HOH HOH B . 
I 4 HOH 98  1726 1726 HOH HOH B . 
I 4 HOH 99  1727 1727 HOH HOH B . 
I 4 HOH 100 1728 1728 HOH HOH B . 
I 4 HOH 101 1729 1729 HOH HOH B . 
I 4 HOH 102 1730 1730 HOH HOH B . 
I 4 HOH 103 1731 1731 HOH HOH B . 
I 4 HOH 104 1732 1732 HOH HOH B . 
I 4 HOH 105 1733 1733 HOH HOH B . 
I 4 HOH 106 1734 1734 HOH HOH B . 
I 4 HOH 107 1735 1735 HOH HOH B . 
I 4 HOH 108 1736 1736 HOH HOH B . 
I 4 HOH 109 1737 1737 HOH HOH B . 
I 4 HOH 110 1738 1738 HOH HOH B . 
I 4 HOH 111 1739 1739 HOH HOH B . 
I 4 HOH 112 1740 1740 HOH HOH B . 
I 4 HOH 113 1741 1741 HOH HOH B . 
I 4 HOH 114 1742 1742 HOH HOH B . 
I 4 HOH 115 1743 1743 HOH HOH B . 
I 4 HOH 116 1744 1744 HOH HOH B . 
I 4 HOH 117 1745 1745 HOH HOH B . 
I 4 HOH 118 1746 1746 HOH HOH B . 
I 4 HOH 119 1747 1747 HOH HOH B . 
I 4 HOH 120 1749 1749 HOH HOH B . 
I 4 HOH 121 1750 1750 HOH HOH B . 
I 4 HOH 122 1751 1751 HOH HOH B . 
I 4 HOH 123 1752 1752 HOH HOH B . 
I 4 HOH 124 1753 1753 HOH HOH B . 
I 4 HOH 125 1754 1754 HOH HOH B . 
I 4 HOH 126 1755 1755 HOH HOH B . 
I 4 HOH 127 1756 1756 HOH HOH B . 
I 4 HOH 128 1757 1757 HOH HOH B . 
I 4 HOH 129 1759 1759 HOH HOH B . 
I 4 HOH 130 1761 1761 HOH HOH B . 
I 4 HOH 131 1762 1762 HOH HOH B . 
I 4 HOH 132 1771 1771 HOH HOH B . 
I 4 HOH 133 1784 1784 HOH HOH B . 
I 4 HOH 134 1789 1789 HOH HOH B . 
I 4 HOH 135 1792 1792 HOH HOH B . 
I 4 HOH 136 1793 1793 HOH HOH B . 
I 4 HOH 137 1795 1795 HOH HOH B . 
I 4 HOH 138 1796 1796 HOH HOH B . 
I 4 HOH 139 1797 1797 HOH HOH B . 
I 4 HOH 140 1798 1798 HOH HOH B . 
I 4 HOH 141 1799 1799 HOH HOH B . 
I 4 HOH 142 1800 1800 HOH HOH B . 
I 4 HOH 143 1801 1801 HOH HOH B . 
I 4 HOH 144 1804 1804 HOH HOH B . 
I 4 HOH 145 1805 1805 HOH HOH B . 
J 4 HOH 1   690  690  HOH HOH D . 
J 4 HOH 2   701  701  HOH HOH D . 
J 4 HOH 3   709  709  HOH HOH D . 
J 4 HOH 4   791  791  HOH HOH D . 
J 4 HOH 5   1610 1610 HOH HOH D . 
J 4 HOH 6   1613 1613 HOH HOH D . 
J 4 HOH 7   1623 1623 HOH HOH D . 
J 4 HOH 8   1625 1625 HOH HOH D . 
J 4 HOH 9   1626 1626 HOH HOH D . 
J 4 HOH 10  1627 1627 HOH HOH D . 
J 4 HOH 11  1628 1628 HOH HOH D . 
J 4 HOH 12  1677 1677 HOH HOH D . 
J 4 HOH 13  1680 1680 HOH HOH D . 
J 4 HOH 14  1684 1684 HOH HOH D . 
J 4 HOH 15  1700 1700 HOH HOH D . 
J 4 HOH 16  1701 1701 HOH HOH D . 
J 4 HOH 17  1704 1704 HOH HOH D . 
J 4 HOH 18  1705 1705 HOH HOH D . 
J 4 HOH 19  1706 1706 HOH HOH D . 
J 4 HOH 20  1707 1707 HOH HOH D . 
J 4 HOH 21  1708 1708 HOH HOH D . 
J 4 HOH 22  1709 1709 HOH HOH D . 
J 4 HOH 23  1710 1710 HOH HOH D . 
J 4 HOH 24  1711 1711 HOH HOH D . 
J 4 HOH 25  1712 1712 HOH HOH D . 
J 4 HOH 26  1713 1713 HOH HOH D . 
J 4 HOH 27  1714 1714 HOH HOH D . 
J 4 HOH 28  1715 1715 HOH HOH D . 
J 4 HOH 29  1716 1716 HOH HOH D . 
J 4 HOH 30  1717 1717 HOH HOH D . 
J 4 HOH 31  1718 1718 HOH HOH D . 
J 4 HOH 32  1719 1719 HOH HOH D . 
J 4 HOH 33  1720 1720 HOH HOH D . 
J 4 HOH 34  1748 1748 HOH HOH D . 
J 4 HOH 35  1760 1760 HOH HOH D . 
J 4 HOH 36  1763 1763 HOH HOH D . 
J 4 HOH 37  1764 1764 HOH HOH D . 
J 4 HOH 38  1765 1765 HOH HOH D . 
J 4 HOH 39  1766 1766 HOH HOH D . 
J 4 HOH 40  1767 1767 HOH HOH D . 
J 4 HOH 41  1768 1768 HOH HOH D . 
J 4 HOH 42  1769 1769 HOH HOH D . 
J 4 HOH 43  1770 1770 HOH HOH D . 
J 4 HOH 44  1772 1772 HOH HOH D . 
J 4 HOH 45  1773 1773 HOH HOH D . 
J 4 HOH 46  1774 1774 HOH HOH D . 
J 4 HOH 47  1775 1775 HOH HOH D . 
J 4 HOH 48  1776 1776 HOH HOH D . 
J 4 HOH 49  1777 1777 HOH HOH D . 
J 4 HOH 50  1778 1778 HOH HOH D . 
J 4 HOH 51  1779 1779 HOH HOH D . 
J 4 HOH 52  1780 1780 HOH HOH D . 
J 4 HOH 53  1781 1781 HOH HOH D . 
J 4 HOH 54  1782 1782 HOH HOH D . 
J 4 HOH 55  1783 1783 HOH HOH D . 
J 4 HOH 56  1785 1785 HOH HOH D . 
J 4 HOH 57  1786 1786 HOH HOH D . 
J 4 HOH 58  1787 1787 HOH HOH D . 
J 4 HOH 59  1788 1788 HOH HOH D . 
J 4 HOH 60  1790 1790 HOH HOH D . 
J 4 HOH 61  1794 1794 HOH HOH D . 
J 4 HOH 62  1802 1802 HOH HOH D . 
J 4 HOH 63  1803 1803 HOH HOH D . 
#